3R7SA

Crystal structure of apo caspase2
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
159
structure length
159
Chain Sequence
b'MQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-2 subunit p18
publication title Structural and enzymatic insights into caspase-2 protein substrate recognition and catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 50
structure length 159
sequence length 159
chains with identical sequence C
ec nomenclature ec 3.4.22.55: Caspase-2.
pdb deposition date 2011-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r7sA00
1GQFA 3S8EA 4JR0A 1K86A 3D6HA 2QL5A 4JQZA 4ZVOA 4QUAA 3R7NA 4HVAA 4EHDA 1CP3A 4ZVSA 3EDQA 3NS7A 4NOLA 4QUEA 3OD5A 3IBCA 2J31A 4IYRA 1RWPA 3R5KA 2CNOA 4ZVPA 1IBCA 3S70A 3EDRA 1SC4A 2XYPA 1BMQA 1JXQA 1M72A 3IBFA 3PD0A 3KJFA 4JJEA 2FQQA 1I4EB 4N7MA 4FXOA 5I9BA 5IAEA 1ICEA 4EHFA 4QU9A 1RHUA 5IAJA 1F9EA 3RJMA 2NN3C 4QUGA 2HBRA 1NMSA 1RWOA 3NR2A 3H13A 1RHJA 3P4UA 4JR2A 1KMCA 3GJSA 2H4YA 4ZVRA 3UOAB 1I3OA 3V55A 3R7SA 3UO8B 5IC4A 5IARA 3D6MA 4PRZA 4QU5A 4D3XA 1RWWA 4JR1A 4N6OA 2Y1LA 3R6GA 3DEJA 2CDRA 2XYGA 5IAKA 2Y0BA 3D6FA 4DCOA 2DKOA 3SIRA 4QUJA 1SC1A 4ZVQA 2H54A 1RHRA 1RWVA 2J32A 4JB8A 3DEKA 4NBLA 5JFTA 2XYHA 3V4OA 4N5DA 4D3ZA 2QLFA 3H11B 3PD1A 4DCJA 3SIPA 3GJRA 4QU8A 3KJQA 5IBRA 2HBZA 2K7ZA 1SHLA 5LU9A 1I4OA 2CJYA 1I51A 4NBNA 2QLJA 1PYOA 4NBKA 4JJ8A 5IABA 1QTNA 5LUAA 1RWMA 4QTYA 4QUDA 4EJFA 3GJTA 2H51A 3P45A 4PS0A 3R6LA 4EHNA 4NOKA 1NMQA 1RHQA 5IBPA 4AW9A 3V6LA 4PRYA 2CNNA 4QU0A 1CVRA 4PS1A 3NKFA 4EHKA 5LU8A 2J30A 2C2ZA 3BIJA 1QX3A 4FDLA 4HQRA 4QTXA 4FEAA 3K7EA 2QL9A 1RWKA 1GFWA 4FGUA 4N7JA 2C2KA 2H48A 4I1RA 1SHJA 2H4WA 4N6GA 5LUBA 4D3YA 5K20A 3DEHA 3R5JA 5IAGA 5IASA 3QNWA 4EHAA 4IEFB 2P2CA 3H0EA 2CJXA 2C1EA 3E4CA 4DCPA 2CNLA 2H5IA 2XZDA 3GJQA 3ITNA 2AR9A 2FP3A 2XZTA 1PAUA 1K88A 3DEIA 1NW9B 4EHLA 4QULA 5H0IA 4NOJA 5IANA 2CNKA 1RE1A 2QL7A 4M9RA 5IC6A 2HBQA 3KJNA 2J33A 4NOMA 4ZVTA 4AWAA 1RHKA 4EHHA 4QUHA 2H65A 4JQYA 2HBYA 4HQ0A 4ZVUA 3V3KA 1RWXA 4I1PA 1NMEA 1RHMA 3H1PA 4JJ7A 2H5JA 3H11A 4QUBA 1RWNA 2QLBA 4QUIA 1QDUA 5IBCA 2WDPA 1F1JA 3V6MA 2C2OA 3R7BA 3V4LA 5I9TA 3PCXA 4N6NA 4AWBA 2C2MA 1SC3A 2FUNB 4LSZA
chains in the Genus database with same CATH superfamily
3LZDA 1GGVA 2UZ0A 3SPXA 4BAZA 3BAZA 3ICVA 3MJVA 4NCIA 4RGVA 3KSRA 1AQNA 5JS1A 1JLLA 2O6LA 1XEFA 1A5SB 1XZGA 4IS2A 4Z3KA 4QRDA 3N0VA 1DFHA 1T4BA 3VZRA 5CAEA 1P18A 1L9XA 4GI2A 2YCBA 4KQHA 5LA6F 1DLJA 4UQPA 4NCAA 4GVXA 4KQGA 4RA6B 3AOGA 4MYCA 3D5QA 3THYB 1VYVA 1OD6A 2XYPA 1E9VA 2HO4A 2EKDA 2ODQA 1O97C 1S7CA 4KQ9A 4MWSA 1JFTA 3EPPA 3GZJA 3R3ZA 3GLIB 1C3OB 2HHLA 2R1VA 4BWGA 2IZ6A 4E14A 3BT7A 3ZUGA 1ZH8A 4YGXB 1NJ6A 5G2OA 1USUA 1P0PA 3UA3A 4FMDF 1DQYA 4B5KA 3H16A 2KYRA 1JR4A 8LDHA 5K3SA 3OE4A 3N74A 2GAIA 5IF3A 1ECBA 1MN6A 1DXHA 4OH7A 4F1WA 4AZ0A 2ZOSA 1C0LA 1ZM2A 3SMQA 2GI4A 3QLJA 3ZU6A 2A88A 3C45A 4R5MA 3L01A 4Z5XA 2VSQA 1QBGA 3I9V6 1IATA 2D5LA 1YKGA 2AKAB 5FWYB 4JLWA 4OI1A 1QGUB 2RHTA 4MAMA 2YZMA 4PCLA 2HBZA 4Q4JA 2EKPA 1TAHA 2B34A 3I4LA 1SCBA 5AJXA 2B35A 4BBAA 2BZ1A 1RRVA 3CUVA 4G1FA 5K6AA 1EQ2A 2C61A 4XUCA 3SKYA 1ZI6A 1HUQA 3G0HA 4F38A 2CDAA 1NLZA 1NNI1 2D4AA 3QMMA 4B1FA 5AUOB 5IXJA 2GQ0A 3KWFA 5K0JA 3MCAA 4DLZA 4GLBA 1UM9A 4CUZA 2F1OA 3OUZA 2C83A 2OPBA 4HVCA 3VAZA 3KQWA 4LGYA 5FO1A 2NQTA 1CFZA 4DKJA 4AYXA 1B0UA 1AZSC 3C6QA 5KKNB 3DHWC 2WAAA 4XARA 4YY3B 1M2OB 2IYZA 4ZYXA 3B1VA 4TYMA 4W8GA 3ZWDA 3UV6A 5ARBA 1GTL1 3CVWA 4D6YA 2FX3A 4P9NA 2AHRA 2J3EA 1U7UA 3QHQA 5AJWA 2HPZA 3FCEA 4ITVA 3VA7A 2Y8EA 2JI7A 2B1JA 3FVTA 3JVEA 1KTVA 5EZYB 3W6UA 3WSVA 3CBGA 4DRYA 2I62A 2RGNA 4YAOA 1N6RA 1L5QA 1KBOA 4GOKA 1OE0A 2OZLB 2ARKA 1H1LA 3GEEA 1DC3A 1JZSA 2O6HA 2O48X 3VZCA 1QNLA 2YDYA 1R10A 3IQIX 4ZVTA 4YBZA 4AKHA 1KJQA 4YAWA 5IDQA 4EJ0A 3CPSA 3MJSA 4NPAA 5CXSA 2Z5GA 4C2TA 3RU2A 1TMOA 2LCIA 3VYSB 1K6EA 3D7KA 5FT9A 5B1DA 1TW2A 2BFNA 1N32B 2XPCA 5TQ2B 4LOAA 1L3BA 3D3NA 4B2LA 1G7TA 3QK7A 3VAYA 3VV3A 3GJXC 3IESA 1EGAA 1E5DA 2HREA 3OOWA 1LDEA 3P2OA 5DBFA 4JGGA 4PHGA 2PJDA 5C1DA 4O4IA 5E9AA 3KQOA 4MTCA 1G8MA 2LRHA 3O93A 3QPCA 4B9AA 1CE8B 1F3LA 2J5KA 2APJA 4YFVA 2AG6A 3W6NA 3A1FA 2HDHA 2QBYB 1WBJB 2GCGA 3DL7A 5FA5A 5IJAA 3DSRA 1MB0A 1SXJC 1VLJA 2CXSA 2QAGB 3FMOB 4PAQA 3FFWA 3ABZA 2QT9A 1F38A 3R5KA 5HG0A 1FC0A 4I5IA 1GNRA 2A1IA 4KXMA 4TV8A 4CT0A 4U2BA 2YYSA 3C3WA 3A70A 3OKAA 1ZD8A 4KSCA 5FYQA 5I4BA 4KITB 2KHZA 4EUKA 3WO1A 3GGGA 2B5WA 5EWLB 1BHSA 1BW9B 1P5ZB 2DBYA 1CDEA 2Q1SA 1MB3A 4P35A 3RC9A 2EHDA 3ZBQA 1NW3A 3LPCA 1QONA 2L0XA 4JJZA 1T9AA 3DUFB 3S29A 1MC5A 1RTKA 1N3YA 3HJGA 3T5BA 3ACBA 3B85A 4P4SB 3V4VB 4JITA 2W22A 3AU9A 3AWIA 4TQUS 4YJHB 4D2IA 4WK4B 5GMOA 1Z2OX 2OO5A 4D45A 4KVFA 1N3LA 5AW1A 3U4HA 1ZN8A 4HDOB 2ASVA 1XXHE 4IICA 3K2QA 2E82A 4CNBA 3AFOA 4GX0A 2OORA 3PQ5A 2M6SA 5J5VA 1RKXA 4INAA 2XKBA 5K09A 2FW8A 1QIEA 1QH8B 3OBIA 4RVSA 3E5RA 1MBZA 2ZBQA 5T6BA 2QRGA 4INZA 3TW4A 3B78A 1NNLA 1GM5A 3Q41A 1DDOA 3RVOA 3MWJA 3RVDA 2Q5CA 4OHUA 3F7OA 3OC6A 5TE9A 2P0AA 3HTXA 2LCFA 2A2ZA 4HH3C 4OVKA 1L4GA 2HRZA 2Y0EA 4UUPA 2J4FA 4DIBA 5J1TB 1OZAA 1V4BA 2OYSA 3H8SA 3HCFA 3RAGA 5LUAA 4RVCA 1GPH1 1WD5A 4RY8A 5CRIA 1XZ8A 4MEJA 3EULA 4GP7A 3L7CA 4C5BA 4QA9A 1I30A 4DLBA 1BDHA 2VHYA 3S8MA 3LF2A 4EVIA 2VNIA 3EE6A 2NXJA 3LIPA 4WUVA 5IUKC 3WWCA 1F5NA 1KFBB 4FGJA 4C4TA 1HFKA 2B83A 2Z1NA 1HDCA 4G1MB 1YV9A 3F4BA 3USZA 5TS2A 2D3TA 3TW8A 5IDYA 4RO0A 4LJYA 2O57A 2PL3A 1L5HB 3OEWA 4R1UA 3LPLA 3FRJA 4XLZA 3T41A 3ZWYA 1AMUA 2H1LA 1LV8A 5BN3A 3LFUA 1MC1A 2DT5A 4I1RA 1YDWA 3KFVA 4MWDA 4PC1A 1R8SA 3MINB 3Q2KA 5B53A 5AW3A 3RVLA 3QF4A 3GUVA 4QDUA 3QBTA 2PG3A 2AZMA 4K1LA 4MKIA 1M34A 5K2OA 1J70A 3TS1A 1MO6A 1RM3A 2YVAA 3M6UA 5I6DA 4JJ6A 5LQUA 3IP1A 4YTEA 2FPKA 1P9NA 5A6SB 5B1YA 1HK7A 3VX4A 4UTVA 3OJWA 1T8UA 1U0HC 4GOJA 1XKQA 4RXUA 3W1VA 1JAHA 2Y3IA 5REQB 3PLRA 5AVYA 2BM0A 4JVSB 5ALPA 3LM8A 4P4TA 1D03A 5ICGA 1U2RA 4YDHB 1ZK1A 4K6MA 3LBNA 2QRLA 3HCNA 3HCRA 2J67A 4YAFA 4ASUA 2WDPA 4YMHA 4J7XA 5K0TA 3K2EA 2PL9A 3R7FA 3V4LA 2GVNA 5G40A 1TT7A 5B4VA 4X94A 3EYAA 5C3UA 1GSIA 1JQLB 1Y6JA 5EVJA 2WE7A 1C3LA 5DTEA 2WA2A 4BFTA 2IYPA 1JAXA 2GF0A 1NR5A 3DDHA 3IIIA 2QL5A 4M8KA 4ZQIA 3VSCA 3GLUA 2I3AA 4II7A 4NV0A 4YDRA 2ZWAA 4RH1A 3OIWA 4AMGA 2WSSD 3AVXA 3LP8A 2IXBA 5HM6A 1AOXA 4KVGA 4AIIA 2ERCA 4JB2A 3EIQA 2J0SA 3DE2X 1T4DA 2H1FA 2G88A 2G36A 3B13B 2XUKA 3EFHA 4GZ3A 4S1OA 4KO1S 1SCAA 4O2BB 2H1RA 4GLFA 3G85A 4AUNA 5K0FA 2ZB2A 1V1JA 5HQJA 2CF5A 3KTOA 1F7UA 1XQ9A 3I2YX 5K4HA 1OC4A 1JG2A 3LQQA 1YFKA 4G07A 2R1TB 3HU1A 2BM9A 2C3PA 1FRVA 2NAFA 3ANNA 2YVKA 2GJSA 1E63A 1ZEMA 4GOXA 4ZO8A 1V7PC 2OCLA 3CF4A 3R5HA 5G0SA 1A8HA 2A9KA 4OL9A 1G9XA 1T25A 1ZCBA 3WKEA 1LPBB 1QJCA 1U8AA 3N5CA 3FVWA 5AKJA 3K1ZA 2CL5A 4R1OA 5JAZA 4W6QA 5FBQB 3V8MA 2WUFA 4LFBB 4Z3DA 1WU7A 1I0LA 4P3YA 3AEQA 1JVNA 3EXEB 3ZEAA 5C7OO 2FVXA 1EXDA 1ESEA 2EJTA 1WCYA 1KI9A 1FUIA 3PXEA 4EENA 1ORVA 1C29B 1EBFA 1VCIA 2DHEA 5LQJA 5FFNA 1K7YA 3RASA 3L2OB 1NYRA 3KD3A 4ZMBA 3AH8A 5CM9C 1VE7A 3OPYA 1X42A 3W90A 4FFRA 3FPAA 1N2IA 1P2BA 4JL8A 3EEYA 4ODIA 5L7TA 3KJEA 4Q6BA 3VU3A 4BLOA 2C1ZA 2P5SA 4AZ3A 1DE0A 3Q8KA 4XFJA 2EJVA 4DHWA 3MBIA 4XOIA 4CF4A 4EJ2A 1KXZA 1WNFA 2RE8A 3FJOA 1N5JA 2X9NA 1Y4SA 4WQMA 1GGKA 4C6SA 2IS4A 3EZNA 4PG5A 3DZFA 4UPVA 4WN9B 5GINE 1SC6A 1EXMA 1GTG1 4ZTBA 1FFXA 3LHKA 1WXEA 3B48A 3WBFA 1J9ZA 2VSOA 2XT6A 3HI6A 1TM2A 2PX2A 3RTAA 3GL9A 3UKOA 3JRNA 3RABA 1BGWA 3ADCA 1I6KA 4N6GA 5EMNA 2HYDA 3RRXA 1D4AA 1HQYE 3GA5A 3TLGB 3V80A 1KTIA 3OU7A 1SCIA 1OHHD 5IKEA 4EW2A 1WHSA 3MWDB 2YWHA 4B7CA 4AY6A 5EZSA 4U3JB 4RPGA 1QRUA 1ZLXA 2BH2A 2HEIA 1KRXA 3JVVA 3EC1A 3M1IA 2FSIA 4KUEA 1I5OA 1KRHA 1U9IA 1ECPA 4MSUA 4EAAA 1APBA 4TKVB 4OI2A 4RCVA 3SZ3A 1G63A 2CHVA 5HOQA 4EPXA 3RRNA 2K2WA 5K4GA 5ALMA 3T3NA 1Q19A 3MHPA 2OECA 2HXGA 5K4AA 3C3AA 1OAOA 4F8YA 2DUMA 4MGKR 2QGFA 3K0AB 4UXJA 4RETA 4MLDA 1SIBE 5D3MA 4Y3UA 1AU9A 1UXIA 2WD9A 2QZPA 1NUAA 1SBQA 2QP3A 1Q16A 4I2VA 4TM7A 4NZMA 5EFZA 3IOMA 4RZSA 2OHOA 1I7QB 4E32A 3CLKA 3KLBA 1DLIA 3THWA 1Z6TA 3ZHVA 3DKRA 5TGTA 3VOSA 4X41A 5KC9A 4PO1A 3OMXA 1F2DA 4G1EB 4OMDA 5EHNA 3WKBA 1GYPA 1V8BA 5LQRA 4ZEWA 4JI0B 1QU3A 4L8YA 1U3DA 2MU1A 3GPIA 1ZQ9A 2GNOA 1GSAA 4I9FA 4YEDA 4LTDA 5DKFA 2YKGA 1CP3A 2FWAA 3PCRB 3UWMA 5LZ5A 1Y6ZA 3O8DA 1M6VB 1N2OA 1U7WA 2LZ0A 4KK4A 2NP7A 1XTUA 3AB8A 3G0CA 4ZYUA 1ZVVA 4R3NA 2NU8B 1XD9A 1PJ4A 4CUKA 5BPHA 2VWGA 4KIUA 2X6RA 4EEZA 3EDRA 2DMRA 1SC4A 4P08A 3IE2A 1QMGA 4NZYA 2ET6A 1NN0A 4NENB 1I4EB 4TL8A 2HUPA 1TJPB 1FU7A 2P79A 1Z29A 2HU7A 2ZI5A 3GXBA 3GRRA 4LOIA 1JKIA 4Y2TA 1IOLA 1J9GA 1NA5A 1VLLA 3OSUA 4OXQA 2ZWOA 4Y8VA 1DCFA 2QN7A 3AR6A 3E03A 2UYYA 4NCHA 4DN6A 1PKEA 3CSSA 2VP6A 1DIRA 4CQLA 2V9PA 3STUA 2C7OA 2AXQA 2G08A 2C0CA 1S4MA 3BCUA 5AM3A 1J8YF 1OTYA 2C4TA 3QYAA 3WGZA 1CUHA 3Q9LA 2J9FB 4DA4A 1QIHA 1SZDA 3AX6A 1Q17A 2XUOA 3MTIA 3IDAA 3PDHA 2IHTA 1FRFS 4YV2A 3Q9NA 3UGQA 2XTMA 1Y8CA 2PZMA 4H0FA 1QM5A 5K8CA 4AX4A 2F8SA 2RHHA 1FVHA 2NVUB 3KHTA 1V3VA 2H1VA 5A7GA 4YRCA 4TUYF 5U1PA 3RWOA 1XZDA 4A8PA 2VS1A 1AKMA 3FKQA 4DC0A 4J76A 4L51A 4DBZA 5BXQC 5JALA 1QHEA 4KGXA 1QHIA 2WG2A 2Q1TA 2X3UA 4EWLA 1YT5A 2JI4A 2ZYWX 3LUKA 5A0VA 3O0DA 3ZGXA 2I99A 2ENUA 1VM6A 5AP9A 4D74A 4KQ1A 3DGFC 3A31A 3HA2A 3WLIA 2QUHA 3DVRX 1NC3A 4KQXA 2G76A 1CEXA 1PGNA 4GIBA 2R1UA 2IUTA 3JZDA 1T2EA 1X7WB 2HTFA 1DINA 3NKFA 3B2NA 3ML1A 2GGSA 1N6KA 2UVPB 3F74A 2C2ZA 4HXFB 2INGX 4G23A 3F6EX 2MDTA 3E8SA 1H85A 4QE3A 4QSMA 4Q4CA 3ZDDA 2YYZA 1JMVA 2GZSA 2W2TA 3DOJA 5EOVA 4B4KA 4BDSA 2GYYA 1ZJ5A 4DR7B 5SY9A 3FZNA 1BRMA 2VK8A 5IHPA 1CRZA 3P9IA 1Q7RA 1CQPA 2X9VA 3UIEA 4EVRA 2I2FA 2REXB 2ZW9A 4L6AA 3HXMA 3A1EA 5LZ4A 1T8SA 1M1YE 1TPZA 4NG4A 5J1SB 1Z22A 2EQ5A 2O2HA 2LV8A 2Q29A 1ZGJA 1OH7A 2ODBA 1WBDA 1K92A 4S1PA 4QULA 2DYKA 2V7GA 3AU8A 2TRSB 4RMIA 4DWJA 2QL7A 1WZ2A 721PA 5SV2A 4DMRA 1YCGA 2FPPA 3ER8A 4K6KA 2XT0A 2C9DA 4ZIRA 1ES9A 1VL1A 4JJ4A 1I33A 1RXSA 2DR0A 3R7DA 1JHZA 1NQOA 4EB6A 1MB9A 3VZQA 1EHYA 1Y37A 4JI7B 1RADA 1B1AA 3WIVA 1UMDA 3FHCB 2Q46A 3VC2A 3EEBA 1G5TA 3FYUA 4KNVA 2HQRA 3QPAA 4AB1A 3AI3A 2XNJA 5JXHA 4MA4A 3C7KA 3VPHA 1J56A 1QS0A 2I22A 3C4JA 3ZNPA 3VPSA 3AY0A 1DO0A 3WAKA 3CONA 2VTEA 5EJ4A 2UZ1B 4F2HA 1R6UA 2W6MA 4M54A 3R4VA 3FUTA 1PU2A 2W2VA 2YBDA 1BQ3A 1HA3A 1ONNA 2JFXA 4MQBA 2BMEA 1JQ3A 3HKEA 4J0FA 2WWRA 2EJWA 3TQIA 5DK6A 3ZJUA 4HJRA 3RC8A 2JLVA 2QYOA 3ABRB 3PSAA 4PE5B 3CRW1 4ZT7A 4RS4A 4MVJE 5AH0A 3ROGA 4XYMA 9LDTA 1H4QA 2E55A 1U3VA 1E7WA 3KCNA 4TT8A 5DT2A 3ZNOA 2Z58A 5CFZA 1W4LA 3W7AA 3ZJ5A 1E2BA 1CZUA 1V1RA 4ALIA 1DRUA 4UTPA 1MOQA 4NIMA 1UXHA 4DC9A 1P1IA 1J2TA 3AVWA 1IUOA 3R7SA 1U0RA 4TKMA 5K3BA 1Z68A 2Q0QA 3CSDA 3OJXA 4URFA 4C5AA 1DWPA 3NH6A 1XVLA 1YRAA 3QVLA 4C3VA 4LDZA 2JBWA 1R0CA 5HHTA 1GDHA 5EE3A 5ALZA 3DF9A 4R8SA 2AMLA 5IEJA 5IS2A 4KYVA 5A9TA 3UJCA 4KVAA 4QD3A 4DQDA 5FXMA 5HK9A 2D0PB 1ITZA 2QZ4A 3UCFA 3G6WA 4O8ZA 4A0FA 4EZBA 4X1IB 1VE1A 3SHVA 2ZGVA 4UCQA 1UBCA 2W8ZA 3THRA 5KMGA 4CEJA 3U4MA 4TMXA 4KJXA 3PHIA 3TJRA 3U7QB 4UZFA 1US8B 1XO1A 2Z4SA 3ETDA 1PYOA 5E6RB 4KOEC 4EX7A 4D4LA 6GPBA 1M75A 2QG6A 2C07A 2NUTA 2IEAA 4Z4CA 2QVXX 2ZBUA 3GEMA 3I8XA 3NWBA 2PGIA 3DZGA 4NESA 1XMJA 4PS0A 2D8AA 4I3GA 5ENVA 1OIXA 1L5KA 3DBRA 4B6RA 4MK4A 5JQGB 5FCDA 3OAAA 1H2HA 2ZYDA 4O3MA 3B3GA 2R8PA 1GQQA 4PZCA 3AW9A 2Z9CA 4L2IA 3KAJA 4YRJA 4HG2A 2RGCA 4TKZA 2J30A 3PJEA 1ZI9A 4IWXA 4C78A 4D81A 4UOEA 3JRXA 4OJMX 4TGLA 1FW8A 1L0BA 3EZGA 4WZAA 4CPDA 2ZM6B 4AECA 5HF8A 3LLUA 2PL1A 2O8BA 3NWPA 2FR8C 3O75A 2WYOA 1HXHA 3SC6A 1N5DA 2PCJA 4MHSA 3SN6A 3QNWA 1SK9A 4OK6A 3CRQA 2WZDA 4QATA 3CUTA 3QFTA 1P9RA 3GRVA 3P9PA 4IDHA 1U11A 4RHEA 5EIAA 1H6BA 1M76A 4G41A 1GD1O 3T5MA 4RTPA 2ZIVB 1SUCA 1HFWA 4PZUA 2WIJA 3R9KA 3S1AA 3TKLA 1I3CA 5JPIA 1VC2A 2ALJA 3VZBA 1QYIA 3E7XA 1NPYA 1EDDA 4RHXA 3PWZA 1B6SA 3MOGA 2OV4A 1CLEA 4DLSA 2IPMA 5C7IO 1V3TA 3TZHA 3RS5A 2WHQA 1JR3A 4BMPB 2DRIA 1G6Q1 2QTZA 1OH5A 4I50B 3B6EA 2GZRA 2YRWA 2G09A 4KMRA 4EYQA 5LIRA 4RF4A 1LF0A 5HK8A 2FZ5A 2QQFA 3V42A 4CDMA 3A6LA 4JQCA 4D0SA 4E13A 5GJVC 3QVUA 4GR5A 4F3CA 1DOAA 3RVQA 4G2TA 5CVUA 3LLVA 1YDEA 1OCEA 3A0RB 3BICA 4QDOA 3G2IA 3BF8A 2I2WA 5L7WA 2L18A 4PQFA 4LX8A 1LRKA 2X7JA 2QSUA 3GGJA 4W5TA 2OGZA 2A1UB 1IWOA 3GMIA 3O8QA 4G5XA 4J0GA 4MW6A 1DPGA 5L95A 1N34B 2FPWA 2WTAA 3T94A 2JKYA 2WT9A 3I5YA 2M98A 4L8VA 3KOOA 2Q3MA 1NI4B 3O3CA 1SU6A 2KM1A 3STHA 1SOUA 2DFTA 3C3PA 4H6WA 4LHYA 1UEIA 4TPKA 4X1YB 3UHAA 5DGIA 4CLRA 2QAGC 1S0UA 3A7EA 3KXLA 4FEEA 2PJRA 4IJUA 3K0FA 1F6BA 1MB2A 2BOVA 1DC8A 3EZ7A 1M1ZA 3K5PA 4R8VA 2YZ7A 2DSTA 5EWMB 1JSRA 1PO7A 2HRQA 1UM8A 1XPRA 1H1DA 1MV5A 3FCCA 1YI8A 4J7UA 2OHGA 1ZD3A 4OLFA 1ESNA 2B1IA 1VPVA 2B9VA 2O1SA 3P32A 4N9QA 3DKKA 4U2CA 3V8QA 1SC1A 2RJNA 4BFVA 1GR1A 1HEUA 2OC9A 2MJLA 2J5QA 1EM8A 1N8KA 4QPZA 1SVOA 2FRDC 4PGMA 1ZNYA 1G2IA 5A4KA 1RYEA 2YZNA 4AXBA 2AR7A 4YRBA 2W2NA 2CSUA 2V1UA 1DB3A 4JENA 1PT7A 3FTDA 3NOOA 3QM1A 3T1OA 3IAUA 2EWMA 1SHLA 1HDGO 2RMKA 1K27A 3NBFA 2H9AA 3SVZA 1E1KA 1GKKA 3IELA 5CT9A 1G8JA 1L7BA 2FMKA 4KL8S 4BLVA 3BMNB 1RJGA 3A05A 1C7QA 2X15A 2ZE8A 3CRRA 4HNAB 5ENZA 1Z3IX 2CWWA 5E0OA 3ENNA 2B2CA 4EY4A 3BCHA 1QB7A 1X77A 3JALB 1VI5A 1WLYA 1R88A 1J23A 2B21A 2C58A 4EY5A 3UFBA 1M6YA 3MA0A 1ESDA 2NVOA 3K0BA 3L1KA 3O73A 1NW6A 3TMAA 4RJ2A 3WYAA 5BSTA 1RCFA 4XE5A 1KO4A 1XV5A 1P2FA 2MSKA 1Z5NA 3GJ4A 4W5WA 1IY1A 3KU1A 5KWJA 1YJQA 3GGOA 2YYAA 3QWHA 4TWZA 1UZMA 2OD7A 4YYZA 2XV1A 3NEAA 2GZMA 3RT1A 3UOGA 1A2KC 3KEQA 3WLHA 3RVSA 2EFCB 4IMJB 4MJ7A 4MX8A 4P7GA 4PIMA 5CIWA 3U4QB 1KYIA 2VA9A 4XOUA 1ADJA 2PNJA 1NNUA 3V8BA 4UU7A 1M33A 3O8RA 3Q3HA 2FSGA 1YJBA 4CM9A 4BIIA 2ZZMA 2UUPA 3NM5A 1VI2A 3SEFA 2OYCA 2FWIA 3RF7A 5H1YA 2FSPA 2O07A 3GN2A 4RZXA 4QUIA 3ZOZA 3C2QA 4JOSA 2KE5A 1O0SA 1KJ9A 3CH5A 3BXZA 4DF3A 3INYA 1BS1A 5KSOA 1EJ0A 3UB4A 1DEXA 1NV8A 1AKNA 2CSXA 3OFNA 1OLSB 2Y77A 2EGHA 4K0RA 1J0AA 4GBMA 4PINA 5F3DA 1GPAA 1AH2A 2Z2JA 1RKBA 3BGDA 3IOYA 3SSNA 4LXXA 3GLFE 1A9PA 2NU6A 3U0VA 4I8XA 5CEFA 4UBKA 4LNUA 3A7DA 4OAQA 4J0JA 1FTSA 1SVKA 2JRCA 4ZVSA 1O0BA 1MQAA 1R9GA 1JSLA 1Q0QA 4RF3A 2N1MA 3QH4A 1HR0B 3QX3A 4UEWA 4HXYA 4TQGA 5JS6A 4OHZA 2AT1A 1N2CB 1C2YA 3BILA 1SKMA 1IJBA 2YQZA 1QV6A 1XOIA 1AC5A 2PUVA 4MW4A 3CPJB 4P54A 3TPFA 4OK3A 1NXVA 4KQWA 3L8GA 1PVVA 1Z5OA 1GL7A 1KPHA 1N2ZA 3H2ZA 3K31A 3CRVA 4TQ9A 3B12A 3CHYA 1GNVA 3WQRA 1EMDA 5BV7A 1NVVR 4M9CA 3FG9A 3H5TA 3T1NA 5D51S 1O7JA 3NHZA 4FDVA 5AKYA 1HG1A 3TNYA 3KHKA 3DL4A 3UXHA 4AJLA 1AK1A 2FDXA 2WFAA 3DG9A 3DHEA 2BHLA 4KDCA 5C34B 2OFWA 4PLPA 2DKOA 2ANBA 2ZAOA 2QAIA 3RYFA 4CM5A 1NM5C 3QLUA 3REOA 4CKBA 1FFDA 3OJLA 2FHSA 2BEJA 1LX6A 3FDFA 4KXYA 4X7PA 4PBTA 4IFEA 4BKPA 1LC3A 5I7UA 1A9RA 1T0BA 3VZDA 1MABA 2NO9A 2YNMA 3E22B 3FRIA 4HYQA 4JP1A 5BORA 5JH7F 3I5XA 3NC4A 1IQRA 2AK2A 3B1ZA 4RULA 4JVNA 4DQKA 4EI7A 4JHXA 1OWLA 4BP8A 3ICQB 1YULA 2DOKA 4K88A 1Z15A 4G26A 4TXNA 4PCAA 3JQAD 2VAMA 2R11A 2II6A 4PBRA 3RUDA 2WTXA 1P39A 2CXXA 4LHWA 4MRMA 4GP9A 5A4IS 3O26A 4CQMD 2BKLA 1Z5ZA 2J46A 2ST1A 2WSLA 3RJ5A 4JU8A 1W85B 5ITWA 4YO7A 4DMCA 5GOZA 3SJAA 4RTNA 3SYLA 3U3KA 3GB9A 2B30A 3TRKA 4X8HA 2AI2A 3O3OB 1RWKA 3CJRA 2Q4DA 3KKKA 5TIIA 3NG1A 2BW0A 1KAGA 3MWEB 3RWMB 2WUDA 4G5SA 4Q7KA 3IAFA 1ILEA 5SICE 2IXAA 1XC7A 3OTQA 4DCPA 3NHAA 2NXNA 1VG8A 3IV9A 2H1CA 4FU0A 1U2GC 4NJEB 2GAJA 5ALQA 4YT4A 2WP0A 2PS1A 3SG0A 2JGDA 3WLMA 3JVDA 1ISRA 3I5MA 3KR2A 4DV7B 2Z8ZA 4KLAA 1GAJA 4BNGA 3BJIC 2Q3CA 4I1PA 3LKBA 2JFBA 3ELYA 1MKYA 3TEMA 3EAFA 4OU4A 4E22A 4R84A 2H3HA 3PENA 5JZSA 4PX2A 1BCRB 1K2WA 3C74A 4HQLA 4WE3A 4A36A 4LMPA 1HDXA 1R5NA 3AUAA 3ORHA 3TZ6A 4AUEA 1SEPA 2H31A 5GVRA 1QFJA 5HUHA 1QQBA 3UPDA 1S3GA 1A4IA 1PEDA 2ZWMA 1SHKA 2ZS9A 3WV4A 2F3PA 1VHDA 3V2GA 4JUBA 3HFGA 3VO2A 1ZGZA 2JFWA 3STVA 2VL7A 2GERA 4HNRA 4DEYA 5KTNA 2NIPA 4DR1B 2F1KA 2HGSA 3EDQA 3GRYA 3JPYA 4QQRA 3AONB 3GBVA 4MV3A 5AI4A 5DXAA 5FOVA 3T7RA 1FUKA 1NUQA 1TZBA 2JD2A 1CT9A 2R7MA 2VXOA 1XMQB 4AKTA 3SF8B 4UBNA 1PT8A 4Q4HA 4OUKX 1SA0A 3NBZC 5EEHA 4C5CA 4YJGB 2R8BA 3EXHA 5JT1A 5FHQA 4MPDA 5C5CA 4RPLA 1L2TA 3ASUA 4O6VA 1QBKC 4B8YA 1HQDA 1FEZA 3P0EA 1ATZA 2OCAA 1P4HA 4B80A 4ESHA 2J7PD 2HRDA 4L4ZA 2RK6A 4BO8A 1VGVA 2R48A 3WDMA 1D2HA 3WNQA 1DIOB 3ZQJA 4E33A 4QVIA 5ALYA 2RFLA 1FNSA 3D6AA 4KFTA 3M49A 1Z35A 1P4AA 3OY2A 2RHDA 3QVVA 4GPD1 5TPZA 4L5YA 4AKGA 3SLGA 5C8ZA 2OAQ1 2FKAA 2IYTA 4JYZA 1Z47A 5L4NA 1IQUA 4K9OA 1HFJA 2A94A 1DBSA 2AFIB 2FMUA 1TVEA 2J7KA 4JZKA 2YFYA 4C7KA 4YCCA 2H11A 1NULA 4CMBA 4GU5A 4N3NA 1RIIA 3UQZA 4MQLA 2XUPA 2ZI4A 4CI0B 3WLOA 1Q0HA 1ZL2A 1C1YA 3ESXA 4ESVA 4KXUA 1MGPA 2ICAA 2JGNA 3K09A 3R3SA 4HDMA 4KWTA 3NM4A 4LF9B 4M7RA 5EJFA 2IUUA 1QTNA 1W5FA 4A16A 2P9ZA 3EIUA 4J2TA 2C78A 1RRKA 2J3KA 1MG0A 5HFNA 3ZQ6A 2OKGA 1TUBB 1X74A 2YV2A 4OGWA 5EHIA 2O8FA 2PQ0A 4CHGA 3AZOA 2HDWA 3DT9A 2YQ4A 2VHEA 5K8LA 2DFLA 2ZIXB 5JE8A 4HAOA 2FQYA 1NJ5A 2VG8A 2Q3HA 2COKA 3C3KA 4YCBA 4C7XA 5CH8A 3CUSA 5FLYA 5K8IA 2VDPB 3HO1A 5ILOA 4CQMB 1A5ZA 1D6SA 1M8KA 1KKUA 4RTRA 3U5TA 1E89A 2HIHA 2JFGA 4NHEA 1U0NA 5AKIA 1XRRA 3BFJA 5DM1A 4D9HA 1LBTA 1Q2XA 3U4GA 3IAS6 1K6IA 1UFKA 2HZBA 4I1UA 1P5RA 2CFTA 5A2GA 1XVUA 2WWHA 1JPNA 1JE0A 3LC2O 3KOMA 4RPCA 4XJVA 1QVVA 5B3JA 2JDIA 1MIHA 1ODSA 1ZGBA 1SNYA 1AJEA 2ZSEA 2ZJYA 1JHAA 1W47A 2FFAA 2OVBA 5HKKA 1FIUA 5GPBA 4DUPA 1WB6A 4BMVA 3WWOA 1SXJE 4F7WA 1GU7A 1K8QA 3SX2A 4Q1EA 4BAGA 3ZBUA 2GCPA 3H2YA 1BVUA 1HDRA 4WZBE 2NSLA 1VMEA 4CM7A 1NZFA 1TYBE 1W93A 4YVFA 1A69A 3UUEA 2QL6A 3RCBA 4E5UA 3D81A 2H5LA 1LNQA 3CG0A 3GRCA 3KAQA 3PUWA 4OCZA 1YIAA 2ZXUA 4MW7A 5LA6A 1TADA 3GLHE 1ODIA 4MQFA 3KOUA 5THKA 1D5WA 1PVDA 1QGZA 3BJRA 4F8JA 3MLAA 5G1OA 3U7IA 4TTIA 1ISPA 2P3QA 4GVLA 5CEJA 1OI3A 2FZKA 3FNRA 2QIOA 4GM0A 4RHTA 4WBSA 5SZIA 1ZVKA 4AZWA 4CR7A 3DTTA 5KJFA 4BXOB 4LJ7A 5KVSA 1OWMA 4PLWA 3NU1A 2O2DA 2Z09A 3IQWA 4JCCA 5J4HA 4N76A 4R69A 3ZE9A 1T5LA 5FWYA 1ORRA 1WOMA 2FFJA 2VDKB 4J43A 4W1PA 1GGNA 1QGUA 4YQEA 5IYZF 3TDMA 1I32A 4HAXA 1KEUA 2C95A 2ZSUA 3P2JA 3A6GA 1J25A 3ESRA 3TD9A 2OVFA 3K0HA 1ZMBA 3O8OB 4IAOA 1GILA 1XROA 2OBYA 2PUJA 2XNCA 4MVJP 3U80A 4KR6A 1BSVA 2OILA 2QTBA 2WTNA 1E8NA 5K6TA 1G4UR 4BVAA 1CF9A 4COKA 3VC1A 1O89A 1RZVA 2Q8QA 3DEJA 4U2EA 4IILA 3I6MA 4M8NE 1Z7GA 2X0DA 4KIFA 3G2PA 4PSDA 3M1LA 3RUPA 4OQPA 4DSAA 3GLRA 4P1ZA 2BM1A 3B3JA 5JPDA 2JLQA 1I2DA 2GJ4A 4FUTA 3J80A 1SUAA 3M4XA 2B37A 4S12A 2P9BA 2W43A 4B33A 1O9GA 5AESA 1F2VA 2GK4A 3FMGA 1Z0ZA 2PMCA 3FYHA 1IMJA 1OLUA 2DBQA 3FZEA 1IQPA 4G8DA 1M10A 1RXIA 1P9WA 1DT5A 2EERA 2V7VA 3JQ9A 3OKFA 3ZWNA 1I2MA 1XDGA 2BZGA 2H51A 5LC1A 4NOKA 4UD6A 4UCXA 1C3XA 1UEJA 2XTZA 3G2MA 2H8GA 3NDPA 3T9EA 2AVNA 1E8DA 5TLSA 2WZCA 3UUFA 3NRCA 3OHSX 2ECFA 2AJDA 2QY6A 3DZDA 1XA4A 3GG2A 1J90A 1JKXA 1QFSA 2ECKA 2ZS7A 1OXUA 1S8NA 4V24A 5ANRB 4ZCSA 2WIDA 4CMGA 2QN6A 1XQ6A 4OBXA 4G8BA 1OVGA 3ACDA 5JASA 2RSLA 3U7JA 4G1VA 1CJTC 1YU6A 3T7JA 3X2EA 1R9NA 1RI2A 1E59A 4IQGA 4J7CA 5D84A 2C3OA 1V8DA 4MZXA 4EJ6A 5JI2E 3LX6A 3NVKI 5AM4A 2PMDA 1WMFA 4HGRA 1BC5A 1WWKA 1PAUA 2XVYA 5FOXA 2DWCA 3H4MA 4C7BA 1MIOB 2ZJ6A 3PUHA 4GE0A 3W5JA 4M1WA 2BFDA 2X7XA 4UBOA 3QE9Y 1Z6GA 4Y6PA 4W9MC 3S7TA 1I10A 2CHQA 1V11A 5JWHA 3MTQA 4GUAA 4P7BA 2WTUA 1JI0A 3PGVA 2ZTMA 1E98A 1GA4A 1M66A 2VT3A 2PWZA 3FB1A 3K73O 4JQOA 4Q1BA 5DT9A 2NV6A 4AG5A 3E48A 1HDIA 1AGXA 3DP9A 1EAYA 4JZYA 5EWLA 1RJDA 2WAYA 3JD2A 3JQ6A 4FYIA 3VMMA 2VPWA 3EZXA 4GZ6A 4QG3A 5JAHA 4I4TB 1U3UA 4XLLA 1ZK3A 1N2XA 3MOIA 5EPOA 1RAIA 3IVMA 3VR5D 2EG9A 2H7XA 2L17A 3D54D 4NYMQ 4R40A 3RFVA 1HF3A 2AG0A 2RHLA 5DLEA 1L6RA 1YJ8A 4NYJQ 4NSNA 1N77A 2DHCA 5AW0A 3MIZA 1FP1D 4LG1A 2OCDA 3EVAA 3ZDYB 2AUMA 1QH8A 5TQJA 3U9SA 5JNVA 3RIYA 3LHSA 4MJXA 4J1NA 4CKEB 4MR8B 4DNFA 3JWEA 1B8NA 3OZXA 1D1TA 1QIFA 1PNTA 3FSGD 3OM8A 1NC1A 1V8PA 1VLZA 4I66A 5KAMA 5C35A 3H13A 1G3IA 4HNHA 3OT4A 4HAIA 1RPNA 1ECFA 4ESEA 1MGOA 3CKKA 2DR2A 3X43A 1QR6A 2EBFX 2P4UA 2ZJ1A 3G3EA 2CBZA 3H3XA 1XAJA 5DI9A 4BVHA 1C8KA 1OKKD 1H0RA 2ID4A 2WT8A 3DBHB 4W99A 4BO3A 4CGYA 3MXTA 1I7LA 3EUEA 3PJGA 4URHA 2Q3DA 1E1RD 1M74A 1MJGM 1MRZA 1OOEA 2PMBA 4QQNA 1KHTA 4ZWNA 4ESOA 1P1HA 1IG3A 3BXEA 2G8NA 1EWTA 4KGZA 1B16A 1NQTA 3FDXA 4Q7LA 4R8KA 1UZNA 2AUNA 4IIYA 5AMXA 1NI3A 4IL5A 1LRLA 3UT5A 4WESB 3LGAA 4FNOA 4GPBA 3E8XA 1HNNA 5ETJA 1IHOA 3I42A 3MSXA 2RCNA 1SBZA 3BIFA 4N48A 5ITZA 4CU5A 3ANLA 2C5AA 2ZB8A 2QM0A 3PUIA 2GHQA 1D7OA 3HWWA 4IZIA 2F17A 1PDWA 1ISIA 4RJKA 5GAJA 4D79A 4QL3A 3DKVA 5F5XA 4D9KA 3CGWA 4LNAA 5EHZA 3P5SA 4DDKA 2FPOA 2LTAA 1Y4AE 2GK6A 5EXEA 1ZBDA 5A6SA 3TAHA 1ONOA 3JAKB 4FOTA 1FFHA 1IOZA 2PKQP 3MT8A 5REQA 1RR6A 2GCEA 3RVNA 1E1YA 3MRTA 4XYBA 2FEWB 3IVXA 1WR8A 2QT0A 4L3WA 3O8NA 4DRXB 4TTVA 5GWXA 3R7AA 2BSXA 2RAVA 2REQA 1Z12A 2Z5LA 3AF4A 1JG7A 3R5JA 4WEOA 1CB0A 1J07A 1R6VA 2OCYC 3ZY2A 5M04A 4EQZA 1T3TA 3CZ9A 2GEBA 3MYYA 4KKXB 3KSMA 1PHRA 3QU7A 3QVOA 2I4NA 5B1HA 1RAAA 2CXTA 4YBRA 1DCKA 1RRPA 5HRAA 4UBMA 1DAHA 3F49S 3N2GB 4PZDA 5EJGA 1TYCA 3O84A 4F45A 4ZT3A 2CLOB 3SKXA 4TLCA 1Z56C 4BC1A 5KYNA 1IY8A 2P5YA 4PCUA 4L4RA 1XZIA 2VJMB 3PR3A 4O2BA 3D43A 2HA4A 1E61A 1G19A 2OCGA 4HUJA 1BKSB 5I01A 2B7BA 1JHPA 1W88B 2D54A 2E4UA 3FPHA 1EX7A 1AQYA 1CC1S 1UWVA 3BULA 3FKSD 2EDCA 3NBAA 4RA9B 1EFVB 2OBMA 4E2ZA 2IW3A 4KWIA 1G6HA 2WWYA 2R1TA 3BZBA 1UOEA 4KQIA 1AV7A 1G21A 2OHFA 2WFLA 2ZRAA 3EGDB 3HCPA 4HD8A 4UAVA 4UOQA 3EOZA 4QJ5A 2FY8A 3NEJA 1ULHA 3E7WA 1GXSB 4JEIA 1PR0A 3GNQA 5A5DA 4J2OA 4JVLA 4BU1A 2G7ZA 1UDWA 4TKUA 5EJ2A 3OECA 1FRQA 4XDGA 3AUXA 4R2HA 3SIXA 5K0GA 1NOKA 5ALHA 4H0NA 1P1CA 2F59A 4YJFB 3AERB 5EJ6A 1E3QA 1C9NA 1K1EA 3L82B 1JTFA 1VLHA 1R66A 1I6WA 4PHFA 3OJOA 3R74A 3C98A 3SZMA 1XKLA 4WAUA 5MFZA 1EE2A 1EI9A 2GVZC 3JR3A 4HDAA 5KHOC 2JL1A 1L4MA 1UIMA 2CXPA 2DSNA 3PNYA 1TO6A 4IWYA 1F0PA 2VC2B 3HCCA 4ALLA 5HIAA 4IHAA 1NFRA 5C31A 4UNQA 1SWVA 5EP4A 3V7NA 4FZRA 3AXTA 2DR3A 4D0LB 1OZ0A 3NDIA 2VZEA 4IVNA 4ZU6X 4ME6A 1U9JA 2WWFA 5F2EA 5BWMA 1UOOA 3N59A 3ZZUA 2CVZA 4BLSA 2VLBA 3CLRD 2QDKA 2HA2A 4Y2VA 1XZQA 2G5TA 1R2QA 1Y5LA 4K6GA 4LHEA 3OFKA 5EIHA 3PC6A 2VH2A 1KZHA 1XT6A 1NUUA 4LJRA 4RVNA 2PANA 3NHSA 4XCQA 1GZUA 2BE7A 4O2LA 3OTGA 5ESWA 3TLGA 1E2MA 3ANTA 3IRVA 3K4QA 3E61A 5COAA 2J59A 4AY5A 1QCZA 1QJ4A 4XX0A 3MB8A 3UFXA 4PTLA 3QHAA 1A4RA 4HDRB 4IXDA 1XA3A 4RACA 4GBJA 4RGBA 5HRUA 2RKBA 4QTYA 4O4JB 3TTSA 5KJCA 2D0DA 5I7HA 1DO2A 5DNAA 1B76A 2HMAA 2ZRJA 1PGJA 3UJNA 2O50A 2RH4A 4FR2A 5ELLA 3DDWA 3OQHA 1JEYA 5C81A 3L18A 3T1VA 4NEGA 4CE6A 3ZQKA 4DA7A 1U9YA 1G8YA 1U0OC 1UPUA 4ICIA 4PWYA 1NG1A 5FTJA 2VDWA 1ADBA 4PGHA 1H9CA 5I9LA 1Y5MA 2MHCA 4LY6A 2AGVA 4NX2A 1Z4MA 5AKLA 3HCDA 3WYBA 2DF8A 3SJCA 4LOHA 4A0SA 3DV2A 3HXLA 3KKLA 3E9MA 3GLTA 3WQBA 2H2FA 2R6R1 4IM7A 3JPWA 2JHAA 3BFPA 3U4DA 1DC5A 1QZXA 4HRAA 5HE9A 4BFZA 5LYJB 3NOVA 4UVDA 3ZDRA 1NP7A 1YGPA 4QFCA 2NUAA 4TLMB 4EGQA 3DV0A 4OM7A 1YDHA 3I9FA 1SVWA 3WDSA 5JDIC 10MHA 1NW4A 4ND8A 2KB0A 3I2JA 2XCUA 4HBGA 1IG0A 4DLKA 3SBXA 1ZIXA 3CB4A 3T06B 4DBLC 1WUYA 1TL7C 2O05A 1KMNA 3OMWA 3FNBA 4KFUA 2WF8A 4ZAWA 1J4AA 4YP7A 3T5DA 1JQ5A 3GCZA 3NPAA 1DV1A 4XWKA 3CFYA 3F3SA 1UP7A 3LLCA 2WSSA 3UB2A 2GD0A 1EXNA 3DL0A 3RAJA 3E5HA 3ILHA 2QN2A 4ZT4A 5JYEA 3GAZA 2QLBA 4DSOA 5TVKA 1JIXA 1VRVA 3QUCA 1YSCA 4KIGA 3TVTA 2VEDA 4M6WB 1O03A 1J9EA 4FNMA 3A9VA 3FF1A 3LT2A 4N0EA 4PR3A 4Z54A 1C0KA 1O5OA 4HAZA 2XGSA 3HUTA 4MCIA 4R01A 4RKRA 3PNOA 1Y9JA 3NUGA 4DWVA 3QEMB 4N7BA 1DCTA 2UXBB 2PTGA 1J2YA 1J00A 1RC1A 5HX7A 5IMBA 1HLDA 2ZSFA 3EFOB 1CQJA 3NTXA 4LCJA 4DQ0A 4Z1MD 2J9FA 1N75A 4H7DA 4N8SA 3IJEB 1EDOA 3HZRA 1HYBA 2GN2A 4IHJF 1NRJB 1N2JA 1L5VA 5AVZA 2YIDA 5JYBA 5KNCD 1NW7A 5CNKA 1N2GA 2P4HX 4LYHA 1N6HA 1COZA 4MQ6A 2HQOA 4OFBA 4OQQA 3ROFA 2X6QA 1T3ZA 3GP8A 4BP1A 4LVNA 1F5SA 4DE5A 2YXEA 2Z9DA 3DZBA 3ETNA 1ZSNA 3KYCB 4DWOA 4X65B 4M9ZA 2WKPA 2V4UA 2GRUA 4PQRA 4UU1A 3VSEA 5J4YA 2GRAA 1AK9A 1PJQA 3ILSA 3R0JA 4LW8A 2OZKA 1RQXA 4W9RA 3TSOA 3UW1A 3P26A 5JVDB 1TTTA 4PN3A 4B6FA 2WU4A 2XOKD 1ZM3A 2DECA 4IWNA 3SEQA 2FN8A 3G1TA 3D6FA 3R0IA 1J1ZA 4CBVA 3D5TA 3U81A 3SGLA 3LPMA 2YWDA 2V6IA 3RUFA 1C50A 1JT9A 1R27A 2V7TA 3LX8A 1WXGA 1XDUA 3OFSA 3Q5DA 5DX8A 2JLXA 4CR8A 2XYHA 3IEPA 2BFOA 5DHAA 1FU8A 5AM0A 2Q4TA 1E99A 3D0RA 3T4XA 1WCWA 4QFBA 4L3VA 5FUWA 2GA9A 4KXFB 3A6PC 5LOVA 1H69A 3L7IA 4BMYA 1ML4A 1FU4A 1Z0JA 1OMOA 2QTFA 4FMBB 3T38A 4JASB 2WOJA 4XPIB 4CF5A 4TWJA 2Q21A 3QBEA 1PJTA 1UJ4A 4QYIA 3VH4A 2ZWVA 2BGMA 4JT2A 1Y7PA 4MQUA 2D74A 2J07A 1OHHA 4IQ4A 5CR9A 5K0EA 4C4XA 1PJSA 3ZZTA 3DE7X 1B0ZA 5DXFA 5HFAA 3HZOA 5KREA 3IQXA 4MKXA 3KYDA 1XLWA 3DMGA 5DNWA 2QKYA 3QIAA 5HR5A 4TL9A 3V1NA 821PA 3GFTA 1ABBA 1LB1B 3AM4A 3AQIA 4MV9A 3WC4A 4B09A 2OR3A 4LSGA 5C32A 5M2QA 3GARA 3IP6A 3V5NA 1NLFA 1CY7A 1L7QA 2MSNA 3L5OA 1R0RE 4ZOCA 4JD5A 4C05A 1E2FA 2FUG6 3LKDA 4FNGA 4FSXA 1A7UA 4R31A 2I1WA 1PGPA 1JBKA 3DM5A 1IXKA 4WXYB 1Y8QA 2H6EA 1F12A 4J1TA 1YB5A 3RRJA 2JLAA 3JARB 4HDSB 2R6FA 3UK6A 1H0HA 1M2VB 1NVDA 1YK0A 3ERCA 1GPJA 3VYWA 2QVBA 2Q4RA 4IZOA 3W8EA 5JSQA 2JIRA 621PA 4IF6A 4KBGA 3ES9A 1G98A 5BOVA 3JD0A 3R40A 1OILA 3OCXA 2JLSA 2YOHA 3LQ2A 1JBEA 4H1TA 1V6SA 1HG0A 3EWSA 2CFCA 4MI9A 4H77A 4RK4A 3HR8A 1FQWA 4JI3B 3KOWA 1VJ5A 3ET5A 2J0UA 5IFKA 1CW2B 3TSYA 3OZFA 2IZ7A 4MWZA 1KZ1A 3SY8A 3LVRE 2BEVA 2YIJA 3CW9A 2I2AA 4M55A 2Q5JA 4XASA 1XAIA 3KWMA 2VXBA 1UJCA 5K7SA 4QUAA 1GCOA 3O7WA 3LX5A 3OEHA 3N07A 3QVTA 2IEBA 1CUYA 2OUIA 4MRPA 2FAXA 4BV8A 2UYHA 1T1JA 3AIKA 1T2AA 2A3RA 3REQA 4H1VA 2G70A 5IU6A 4JC8A 1CCWA 5DGTA 1PQPA 4FCTA 2E3JA 4NWIA 3YASA 3LKVA 3WR5A 1GA1A 1LV7A 4XM1A 4MV0A 2WNHA 1Q1EA 1H2RS 2Z4RA 4Y1GA 4BMZA 3HPRA 3NHRA 1ZUNB 3QJYA 4MV6A 3ONWA 3R09A 3UH0A 2PZBA 1HSOA 1N5MA 1U3WA 2ZUDA 4IEEA 1DTWA 1MR3F 4OQEA 3UNXA 4BFLA 4Q3OA 1US8A 3D7NA 4PSUA 3TSAA 2OY0A 4EYKA 3ZY6A 3E82A 2DERA 3CRZA 1XKXA 1SB9A 3W5VA 2ZUUA 5L3VA 4GOLD 3KZCA 2ZJ4A 3FPBA 3ZU4A 4C7VA 3JAWA 3E84A 3L93A 1QRDA 1T6NA 1P2TA 1CUGA 3E0QA 3RRFA 3CH4B 1C9YA 1MW9X 3IQEA 5E3JA 5C18A 2B4AA 3NC1C 4JVOA 4YONB 1WW3A 2VHWA 3DEKA 4K81B 2YMLA 4OJYA 4WCFC 3LT4A 2QTGA 4Q3AA 1WUKS 5FL7A 1WS6A 5IPFA 5LD2B 1UJ2A 4OHMA 2JFUA 3KS9A 2J6CA 1P29A 3OZVA 1B7GO 1CWUA 3T5GA 5IXSA 1YD7A 1FPMA 3BGWA 1YOVA 2P2DA 3COZA 3D64A 2C77A 1U3FA 4RPKA 1YR8A 4OAOA 1ILWA 2FUG1 3H18A 3LDHA 3N2ZB 3NGLA 3QLVC 3T35A 4BX9A 2J9RA 4YLGA 3BWYA 4MKGA 3WLPA 3PFGA 2HWWA 2LPMA 4CLEA 3D2BA 3MT9A 3ZJVA 1M0SA 2OD9A 1N2HA 4OXYA 3G68A 3O3MB 1ARZA 3FCXA 2XDQA 1NIJA 3I61A 1N36B 3VNRA 4KTTE 4QC2A 1GPUA 2HA5A 3SQLA 2I8CA 3W78A 4B17A 4C1NA 1V7ZA 3DWGA 4WIAA 3WMWA 1SCKA 3LQYA 2CJWB 3CLSC 3DC2A 4QBKA 3LCUA 2PKWA 5KUTA 3I9LA 1GGEA 3AFNA 3BG5A 3GHYA 1FQJA 5F4BA 3X2SA 3KKQA 2X4LA 3CCCA 4Q1VA 4GL2A 2C8JA 1C7ZA 2X14A 4HB4A 2WSBA 4NBRA 1IOWA 1N25A 3F8WA 4IEIA 4KPFC 1SUEA 1NLYA 1R64A 4QTZA 5DHUA 4XWYA 4PYKA 4QQKA 4M1MA 5ALDA 3RFTA 3ROPA 3WIBA 3RNLA 3ER9A 3X1DA 3C14C 2EFJA 4MW2A 5FOQA 2I4RA 5B6PA 4Q4LA 1ADGA 5JXJA 7MHTA 5IJXA 1XCLA 1FXUA 2A1UA 5FI5A 2OYRA 3GGSA 3EG5A 1TYDE 2HAEA 2XB2A 1WCIB 4BLUA 4LI3X 2Z2ZA 3CH6A 4KN5A 3ZCQA 1T8WA 4YAEA 5ESRA 1P1RA 4X1YA 2QJRA 4F6CA 4N49A 4UHBA 1U31A 5ALSA 1T1SA 2BIFA 2Z43A 4ZVOA 3QOXA 3PFKA 3CURA 1SBCA 3CR7A 5EWMA 4D43A 4YLEA 2CLHB 1S1MA 1TCUA 3FGPA 3WB1A 5FBWB 3TXXA 1KY2A 4MROA 5FAXA 4GI5A 1GCAA 5JRZA 1YOBA 2XGJA 3S81A 3AR8A 3D31A 3O82A 3GGCA 3TCXB 1ZOOA 1E5VA 3RVRA 4ZRMA 3KJFA 2OHVA 4EG8A 1E7QA 4NV1A 2PFSA 5BN4A 2B78A 4RDCA 4F12A 1EUDB 3VKHA 1SKYE 3NM6B 1GG9A 1JQBA 2VRCD 5EQTA 3JQ8B 3K3PA 5AJVB 3V1KA 2YVLA 1GHTA 3QVGA 1KHHA 2BI4A 2E5WA 3LZCA 4HLCA 4Q03A 3S2IA 4YHHB 1H2FA 4WOKA 4E08A 1ZD1A 1P7VA 1OIWA 1QVWA 5K3OA 1GAQA 3FA2A 3MJCA 1KIFA 4HNAA 5AI0A 5JCOC 3TVYA 1S8AA 5EFOA 1U2QA 2DJIA 5JNTA 3ONVA 2GSDA 4FS3A 2SKDA 1G5PA 1ZK2A 3EG9B 4RQUA 3OJEA 3SIRA 4FZJA 3S2SA 3SZLA 3N2KB 5CCXA 1SZCA 2YWCA 3FHOA 3DD1A 3I76A 4JT8A 2ZE5A 2QLFA 4TV9B 5GM1A 5LYJF 3AHIA 4OHKA 4JN6B 2BFEA 2GEUA 5JNLA 1RBMA 2BGKA 2AOWA 3R6TA 4O4HB 1SU4A 1XZMA 4KODA 1A97A 4A2PA 3PT9A 1IN6A 3FIUA 2ZIUB 3VR5H 5MN6A 3ZNQA 4L5JA 4QYXA 2ZBGA 4I5FA 1RCTE 5BNIA 1I2BA 1QH1B 1V35A 1TF7A 3DR5A 4IHQA 3PZBA 4BEWA 4EMBA 4PC7A 2VPIA 5KJEA 2ZSAA 5HFJA 5B6JA 1YZYA 2QPAA 3DGEC 4K2HA 4WNAA 4R2KA 4F97A 1GZVA 1Z8HA 3OCWA 4TS1A 3TZLA 3EW7A 1P74A 1QHSA 4B34A 1PT5A 3RIXA 1RLMA 3OPQA 1XPOA 1H66A 1QX3A 3BH7A 3BH6A 4OXIA 1RTTA 3AYZB 3E4DA 3IVAA 1FZQA 3WADA 2G71A 2OUKA 3QEJA 4NAHA 4XW2A 2XJ9A 1H0KA 4MIKA 4PYOA 2CXOA 1ZHHA 4H7IA 3GZNB 1LDYA 1UBOS 3B60A 4HWKA 5ERYA 3FFBA 2C9BA 4E70A 1VKHA 4HX2A 2BHRA 4FX5A 3WL8A 3LP6A 2ZDQA 3NYWA 4ZTUB 3EY9A 2H9IA 3LYLA 1E0AA 1G1AA 1K7CA 1SVUA 5C9ZA 5JTUA 3ITNA 3RYIB 4CG1A 4PG7A 5KYTA 5D86A 2KSQA 3INTA 4R1QA 1ISFA 4BB0A 4B76A 3B1XA 3CIFA 4UJ5A 1USWA 5CFLA 4A27A 4DJ5X 2HCFA 3GEHA 2M6KA 4FQ7A 5IDVA 1WOYA 2EKLA 3MPUA 4LZLA 5AFSA 2XRZA 4CV3A 5EP3A 4ENVA 2V7QD 3PL5A 1NJ2A 3C7TA 2Y9MB 3QUBA 4PO3X 4D8TA 9ABPA 4YALA 1UDAA 3A14A 4PN7A 1THZA 4EY6A 4MVJM 3DAYA 2R84A 5D01A 1VSVA 2CW5A 2P9GA 1CZKA 1DRKA 3VPAA 1DI0A 3ZY3A 5HJ2A 5FB3A 3RIMA 2JGJA 1UP6A 1EWKA 3SSAA 4EKIA 1QOZA 3N6XA 2C5FA 2HU5A 4P4UA 1HDYA 2O4UX 4NNJA 3WGQA 2A59A 4XCVA 4HC4A 5E2IA 3BRQA 2GPNA 4ZV4A 3EXHC 3AUYA 3L8MA 2C4MA 4G65A 2Y92A 3DL2A 2XQFA 5LXTA 1XZPA 1CKEA 4DQUA 4RDIA 3RU9A 1Z3CA 3GJ6A 1AZWA 4B4WA 4DCNA 3N2IA 2WT4A 4HVLA 5LQMA 3W8RA 4ARUA 2R8XA 2VP4A 1FMTA 4G9GA 4LOKA 5G0TA 3WDLA 3HV2A 1BMQA 3ITEA 1FJGB 2UZ3A 3FZGA 2W6PA 3H5WA 4KIJA 3E22A 3BIXA 3T9BA 3ZE6A 4YROA 1DQPA 1P44A 1IM5A 1PR5A 2XB8A 4UE3S 3UXMA 3ICPA 1A96A 3LPNA 1WMEA 4K87A 1XQVA 5CFQA 1JHRA 1VIAA 2L69A 2WPDD 3AJ8A 2XF2A 5F64A 3VISA 3GJ7A 2GN9A 3I8OA 2BWJA 3WAGA 4MUMA 3OOHA 3I92A 4F7DA 5G1PA 2WQ6A 4LNHA 4RD1A 3W5HA 4EABA 1XTBA 3D4BA 3DR3A 4O0MA 4PVDA 3UWKA 4DCOA 1Y1TA 1TPYA 4NMHA 6REQA 2VYCA 3K09C 3VU9A 1EUYA 1JSCA 3FDZA 2GYWA 2XWJI 3PDJA 4N0QA 5G4KA 4Y9DA 4D9JA 2A0FA 1B14A 1MHPA 1XE3A 1V0JA 4MW0A 2R6JA 4BNHA 2LGJA 3H2GA 5IBRA 3TIFA 4US1R 1CJUC 2ZCUA 3TDNA 4FYWA 4UXIA 3FF4A 3GCDA 3DOIA 1EH5A 4RYDA 4YV7A 1ZR4A 1ZW6A 2YWGA 3W34A 2FSVC 5KI6A 3F9CA 1R0KA 3PDIB 4X92A 1T9DA 4DMGA 3BH0A 3TYXA 1E3TA 1PZMA 3LWNA 4IQFA 5DSZA 1II8A 2D5CA 4FYPA 2ZYAA 4MR9A 4U5QA 2PX0A 4JKYA 3VH1A 2JIQA 2VDOB 3F1KA 1MENA 4JYCA 1LNZA 4YJ3F 4G0UA 1QMPA 5F78A 3JD4A 2DXIA 1CVRA 1SCUB 3WI7A 4FDLA 4RK7A 2WEKA 1A98A 4F46A 5AVSA 4MVJG 1TF5A 2BEUB 3CQ9A 2DCMA 4U6QA 1BCRA 3I2HA 4H3KB 5I5EA 1XRSB 1I7NA 1NOIA 4FD3A 4WCDA 3O47A 3SKVA 4C0BA 3G5MA 3EXAA 3N8KA 4Z9BA 3P19A 3RIHA 5HQ3B 2HYIC 2HA6A 1XVIA 5EHQA 2VTKA 2VDUE 5K3FA 2ID9A 3VX3A 2VT2A 3QKIA 1EK2A 4JQSA 1BXRB 4WSOA 4LHXA 4YECA 3C7DB 4DMFA 3O4GA 4OAPA 3LXRA 3ZS8A 2GCOB 4NOJA 4DMUB 1CUWA 3IS3A 1UADA 4N7RA 3V4ZA 3ZGOA 5GGYA 4BNDB 1MJFA 2OAEA 4P31A 1PR3A 5BQ3A 3PYLA 1Y5RA 2PXHA 3SF8A 1SXQA 4R9RA 5AW6A 2YCLA 1BWQA 4FDAA 1WVGA 2QN9A 4CU2A 5B30A 3M6IA 5I7WA 3WK4A 4Q02A 1C4XA 1E2QA 1G8HA 2WJVA 4QNMA 3VZSA 3SEZA 1OROA 1MEJA 4AG3A 2GLUA 2YV3A 1N9KA 4ZPJA 1UBKS 5DSXA 4F2GA 3M8KA 1WXDA 4NJMB 3VM6A 5A02A 2ZYHA 5AVTA 2FXIA 1QIMA 3KPVA 2W8BA 4HMPA 4RLSA 4B3RB 4XRRA 1QO0A 5KO2A 3FJYA 3RKSA 4MB0A 4PYMA 1D2MA 3WWDA 2BE9A 3WQHA 4YMGA 2XCSB 2QW1A 2FQWA 5CGQB 3HMQA 1ZMTA 2MT9A 3IEMA 4X6LA 3A06A 4LBVA 3ZN2A 2W48A 3KSAC 3ZVMA 2I33A 2O2JA 3ZCPA 4N3CA 1IB0A 3A0UA 3OQVA 4PGFA 3DTYA 4O0LA 4ROTA 4AYWA 5DCLA 4S0ZA 3LP5A 3L9XA 2EKZA 1RLOA 3N0XA 1R00A 2WD7B 2ZI6A 1YL5A 3OJ0A 4MS3B 1N3BA 4OMFG 4RD2A 1LVHA 4ZT5A 3I45A 5A3JA 1ZCZA 2HQSA 1P1BA 1OGYA 3CMCO 1S2GA 1TFUA 3EGIA 3FCYA 1ETHA 3IAEA 1CDDA 2FW9A 1GTVA 3UO8B 1SUSA 1JJ7A 3QLEA 1V48A 1PGQA 4X7RA 3DOCA 5JQWA 4MINA 1R1DA 1TJNA 4IVPA 3CIOA 2D1SA 4CIAA 2Q9UA 3JQAA 2COEA 1SN7A 5JJKA 1CY1A 4YASA 4OJNA 3I6QA 1RM0A 3PEUA 5BYJA 2YV5A 1MQ9A 1XJ0A 3VVBA 3TJZA 2RJ3A 3E81A 5IMSA 2NLOA 4CQMA 1DUSA 2Y68A 3MG9A 1ZNQO 4M8IA 5CA1B 1ZMOA 5K8VA 1R74A 3R3HA 5A0TA 1WZUA 1YE8A 1CR0A 2IPNA 1J0XO 4JP2A 3UEOA 2QQ5A 1O08A 5B1SA 4LJAA 5HMMA 1ZNXA 2G1KA 4FFBA 1QK5A 4YO8A 4Q21A 4RJJA 2W90A 2YIMA 3WLJA 2Y1CA 3JAMA 1I7DA 5CA0F 1AX9A 1Y1KE 4NTZA 1N0WA 1OVMA 3CLRC 3COVA 2P0YA 3PEEA 1IY9A 2Z1MA 1JEQB 4IIHA 3DVSX 3TNDA 1PJ3A 5KNCH 4TMFA 4F93B 2HKIA 1LX7A 2N9UA 4C89A 4HNTA 3FOZA 4RH3A 1KOJA 4ZV7A 4MAFA 4I0WB 1XI2A 4DJDC 5HIKA 3IV6A 5E7MA 3JQFC 1AZLA 3A36A 3HJBA 4QOFA 3SC4A 1RAFA 5K0NA 1BDJA 2R4TA 4DUZB 2JNWA 2CN1A 2OO3A 3HB4X 1JDJA 4C0JA 1LI4A 3KKMA 1UJ6A 1PFVA 1X6VA 3IKJA 4NQRA 4PIPA 4A1FA 3TR0A 2EJUA 3NV7A 1T34A 1WMDA 3N9IA 3C24A 3T54A 3F5DA 2VJCA 4XDZA 4MKRA 4X0EA 4EG7A 1TGYA 3K1TA 1Y5IA 4EHLA 1I94B 4PFQA 3DDSA 3O7MA 3DXFA 3QITA 1L7OA 2ZE7A 4S1TA 3C5EA 2AK3A 5K8TA 1CYDA 2OO7A 4CV2A 3TKAA 1KJWA 5I3ZA 4LV5B 2QTNA 2NXCA 3QVJA 4E6PA 2HY7A 1WVMA 4PLHA 4I55A 3IAM1 3WLFA 3P4XA 3GVHA 4QDXA 2GS9A 1TM5E 4FLFA 2QY9A 1Q22A 3PKJA 3V9AA 4AMZA 1YZKA 4C4AA 1VECA 1XTQA 4MB2A 1E6UA 5EWJB 4K7JA 2PT5A 3TOSA 1G0OA 2UZAA 4URVR 4WBXC 1ELOA 4MUAA 4EDHA 5AVXA 1EIWA 1CJVC 3NUZA 3SZOA 4S1NA 5IJWA 4IYJA 4EG6A 1TQDA 2J7PA 3MQFA 4BOYA 2M2IA 2C9CA 2FUKA 2V7UA 3F4LA 3IUQA 4EDFA 5FOUA 4HH1A 5TMBA 4S05A 1KFCB 4P3KA 1D2CA 2VHXA 4NPCA 4ZAZA 3VH3A 2XITA 1QGYA 5ERGB 4BQEA 4YUWA 3UV7A 1SBHA 4M46A 5ALFA 1QIGA 4Z8YA 4J94A 5FBKA 1FW6A 4W82A 2XBLA 1MVOA 1PZEA 4NU0A 2HSZA 1JFFB 1TT5B 2OFPA 3KXPA 1VJ1A 3LBIA 3T34A 2A4KA 3ZDEA 2VP2A 3HZZA 2KBEA 3NBXX 4J6FA 3B8HA 1AN9A 4P2BA 2CHUA 2ONZA 3AETA 4CMKA 5BQ5A 4ZO7A 4ENPA 3T1YB 4PYQA 4UW9A 4EUSA 2SCUA 1PFUA 4WEQA 5FORA 2F64A 3M89A 3MTEA 1C7FA 1L4LA 4ZP1A 1Y48E 1YRYE 2F3RA 5J2TB 1Q3TA 2JGAA 5GADl 3MUEA 4KXNA 3LOQA 5DSTA 5C5DA 4IDFA 5TT0A 4A82A 3ZWQA 2QTVA 3A11A 2D1FA 1LTKA 4O08A 3HCEA 1FSFA 4ZI7B 4U7JA 3LX4A 2ABWA 1T3GA 3BHNA 4B4DA 1KAEA 3C5VA 2IPAB 3ZCRA 3OU2A 1XNGA 3RBXA 3MT0A 4OOEA 4EJFA 1Q44A 3H9GA 4F91B 5LD2C 1IEWA 3M1AA 1VL2A 4LF6B 1GJRA 3I64A 4J16C 1TO2E 3P8ZA 4ZAVA 3RF6A 3PPYA 2WWGA 2ODTX 3S5UA 2JLYA 1K9SA 1T6YA 3L7JA 3ZX4A 4PRYA 5A03A 5KTOA 4YRDA 1ZUHA 2X41A 4JA2A 3RRBA 3VR2D 3CWCA 1F3OA 4GMHA 4RL6A 4DLVA 3U37A 1HNZB 4PQYA 1EXWA 4MUIA 5B64A 4BASA 2WTMA 4J1SA 4RIFA 5DX1A 3GGPA 1XZNA 2Q6TA 3UC9A 4DRZA 2B0CA 5C7LO 4ERXA 4B0PA 4GDMA 3AEZA 2QK4A 3L0CA 2B94A 4EHAA 2NTEA 1G291 1XB2A 4UVGA 3RSFA 2CJXA 2OXRA 2O0KA 1NQVA 1FZTA 1LPPA 3KM0A 4O33A 3B6IA 3M6AA 3Q8LA 2IP4A 2WKWA 1JMYA 3OQJA 4I46A 2Q5OA 3OH8A 4EF6A 2JCSA 3TJMA 1K0FA 4TYWA 1B0AA 3ET4A 5C4GB 1D1QA 3CINA 3KJNA 4K03A 4Q12A 2CNWD 1T24A 3BMCA 4RHFA 4UMFA 5CVDA 4ZT2A 1KNQA 1SG0A 3N1UA 4JB3A 4YRMA 4C4ZA 2OXTA 3LKZA 1PNOA 3DKPA 3U44A 1HORA 4EZEA 1R7RA 1FQKA 1ENZA 2C2HA 4MR8A 5P21A 4YT2A 3LDGA 1KJIA 3IBSA 2D5AA 4N6NA 1JKJA 1H2XA 4OQZA 4TXHA 3QEOA 3KLPX 1T8YA 2QZZA 5DNVA 2ZSHA 2Z2XA 5NULA 2H00A 3EDMA 4MMYB 4AKSA 1V25A 4CIDA 2DJ5A 4BNLA 1N2CE 3VC7A 4EGAA 3PUYA 4F6RA 5FI3A 1L4KA 2C3MA 4BNIA 2LE0A 3DBHA 4KE6A 4RIGA 1R8YA 1Z6QA 2PZFA 3GVPA 4HRVA 4O2AB 2VJYA 2PUGA 4L9SA 2ZIZA 1VHQA 3AJEA 4ZU3A 1Y6FA 4DS3A 4X3OA 4WZ6A 1LDBA 1L8AA 2G1AA 4FZ5A 1UKVY 4RTJA 3G2QA 3ZBTA 1ICIA 3A10A 1W4ZA 3PD0A 4HAVA 4NDAA 3TTTA 2I4MA 1T3SA 3VPCA 4M22A 4E0BA 2QTCA 4RDXA 1T9HA 5KVVA 3ZW9A 1R4NB 3QLTA 1QDEA 1Z0KA 1YIDA 1BEEA 3DB2A 3AVYA 2W2OA 4GOMD 4R8RA 2FDCA 4QPJC 1GEGA 2H2HA 3I5AA 1XYVA 2YFHA 1TLLA 3R5TA 4RWZA 3SJBA 1U80A 3DZCA 4NFYA 1UK7A 4LF8B 3PQ7A 1KYTA 1V5FA 3W0LB 1CJMA 1C1XB 3U13A 4WK2B 3HYLA 2VPQA 2JCXA 5GV7A 1A8IA 4JI4B 3LH5A 3JAKA 1JDNA 3FWPA 3ZWVA 2WYUA 1OI4A 2W4IA 3OEEA 5AM5A 2YN4A 2X7HA 1D0SA 3K30A 3W2HA 3FTFA 3GEBA 3ZD9A 1R5JA 3AOEA 1ZH2A 4UUMA 2XGMA 1F9AA 3EODA 4QBFA 3FNQA 3JD1A 3V32A 1K8RA 3TIXB 3TEFA 1W1UA 2QTLA 5KZMB 5L3SB 4EG0A 4WOPA 2SNIE 4FYVA 4HFJA 3JQCA 3Q0EA 5TT1A 4B2PA 4JFAA 4WVFA 1Y42X 3HC7A 2BEKA 4M7PA 1G7CA 3CRNA 1T43A 4E5VA 1R6AA 4EG1A 4HH4A 2B8NA 2C59A 3N2GA 3OWXA 3UWOA 2AB0A 3UV3A 3KLNA 3W3ZB 4L50A 3NEPX 4Z9AA 1KE1A 3G2NA 3U40A 2XVAA 2C5LA 3HHPA 2DM6A 4DBLE 1SBIA 1WPQA 4G0PA 2YIVX 3EXG1 3OE7D 4UHDA 2Z08A 1YQGA 5KOIA 4JYAB 1IWPB 5CVVA 3IDFA 1M5TA 3CCFA 3KEGA 3OWHA 4RA9A 4P0PB 2PUTA 3THSA 2IYRA 3I28A 1P0MA 4OSOA 3VKFA 4DEXA 1MRSA 4QQ8A 5EZYF 5IEBA 1VSQA 2HHJA 1RQLA 1KYQA 3U7GA 4DLLA 2O1EA 2VP0A 3DC7A 3OE1A 4K5QA 1EFRD 1HZJA 3AF3A 3DONA 4Q16A 3TPCA 3WBKA 3SS9X 5C2JB 3GPLA 3FWNA 4GS5A 5JBIA 2QQEA 4DDUA 4CWAA 4N5NA 5AUPB 4DV2B 4YJ2B 3WSWA 4IIXA 1A7JA 1QYCA 1ADFA 2CFRA 2V8OA 3HXTA 4NYIQ 2XXBA 4KXQA 3VR5A 4EA7A 5BSKA 5IT4A 3BK1A 3F3KA 3NDRA 2I91A 1RAEA 4NEQA 3WL3A 3KWJA 2R7AA 1ZC3A 4RF2A 3ZEIA 1MF7A 4D44A 5BSRA 3LL4A 5TJHA 4ETMA 4YFYA 2QI9C 3FRHA 1EVZA 4XM2A 5KWIA 2OSBA 2QNIA 3NXSA 3VMFA 1YHNA 4K9RA 3CKMA 1HTBA 4YPFA 1UWKA 1LQ2A 3B82A 4CMCA 5C51B 2IS1A 3OI7A 3E2PA 5JD5A 1M8JA 3W5BA 2HLNA 4XDYA 3ZWWA 1E7RA 1KJJA 4JB0A 2AOUA 3CJTA 2ATCA 2GM4A 1X7YA 1I6MA 1Z18A 3FSGA 3CV3A 4MWGA 1WTAA 4GGMX 5ALRA 4DLPA 5A9SB 1UC4B 4FFVA 4BB9A 4GAEA 4N54A 1P1FA 3IT1A 2ZBFA 3CBQA 4P83A 1TK9A 3IHWA 1DX9A 3S70A 3SXUA 1OKKA 4RADA 4MPRA 3N86A 5AO9A 3K20A 4XVRA 1VCHA 2Y1GA 3Q3GE 4JFRA 5AIAA 3QBDA 5CP8A 3PVZA 1Y9EA 5IN5A 3A4VA 4BEBA 1E1RA 1U63A 2A6PA 2XUHA 2HMYB 1H42A 3TTWA 3TQHA 3GLIA 1G2OA 1VTKA 1OTXA 2OB1A 4JLDA 1I2ZA 2AYYA 1T4CB 2OCXA 1A9XB 2TMKA 4EGSA 1HQKA 1U3TA 2O3JA 2HPAA 1I24A 3OFJA 4R71A 4W8HA 3SHFA 3UAWA 1JAIA 3EC2A 4HDRA 5DE3A 1AGNA 2AFIE 4O4JA 1NSTA 1Z73A 1GAXA 2W6QA 4L0QA 2VATA 5AHKA 4TTJA 3SE7A 4DSZA 5BW4A 1BU5A 4GF5A 1GRNA 2FPLA 2UUOA 3LRXA 3LT1A 3OIGA 4IIFA 4WXHA 5AYVA 1SOMA 3R7WB 5BNWA 1UBUS 4PXAA 3MOSA 1UPXA 1USIA 1HOTA 1RHRA 3WWYA 4MIEA 3F47A 5G4LA 3QW2A 1RRFA 5TEWA 4FGKA 1PR2A 2I7TA 1R6TA 4GHWA 2VF7A 4GT1A 2FUCA 2IUFA 1AE1A 2FPXA 4DCMA 4OHBA 4ILKA 4RZ2A 3FDJA 3EPHA 2BI7A 2RHWA 3SJ7A 3TZEA 1VB3A 5DF1A 5EC8A 3BE6A 1NF8A 4F72A 5I7SA 1ML3A 4CKCB 1MDFA 3OY7A 5BMVB 1WD7A 3JRWA 4PPNA 1UKAA 5FTKA 5EKTA 3KETA 3MMZA 1K6MA 3W5AA 2GZ1A 4HKTA 4A2QA 1KVQA 1UDXA 2R7KA 4GOOD 3ZU5A 4LYAA 1Y3BE 3DFUA 1JEJA 2C4VA 1CIPA 1VMKA 1A2QA 1Z4JA 4LQCA 2A33A 3A2NA 4OGFA 3LDAA 4YRAA 1Q0TA 2ZPUA 1PZFA 5EERA 1AGPA 3G9TA 2JK1A 4GC5A 8MHTA 4FXPA 2HJSA 2IU3A 2YY7A 3T52A 2ZI7A 1SJ9A 1BDIA 3EQ9A 3G1WA 3NONA 4OFXA 1XTIA 3KXIA 4MUFA 4YRLA 2H1OA 1QV9A 5DYTA 1E2KA 3IPYA 2X8LA 3FKSA 3NIWA 2QXTA 5BR8B 4G3XA 4R3UC 4NU8X 2XZDA 1O94A 2JEOA 1DFGA 3T0GA 1NP6A 4MWCA 4QO7A 2VHVA 4QYMA 2C88A 1XX6A 1OTHA 1Z4IA 3NTVA 3H5LA 4PZ0A 4BVEA 3DT8A 3L8CA 4IOJA 5F12A 3G0OA 1GOTA 4BYMA 2ZQ5A 4BS9A 2JK0A 2C31A 3AHDA 4QGGA 3ZLJA 4RTKA 4H7JA 4QOGA 1Q57A 3CVYA 4G4GA 1B6GA 1XZFA 4V0ME 2Z6UA 3FNEA 1N7GA 3RW9A 2ZJAA 4MVJD 2WJ3A 1ZD9A 5DRTA 1ENPA 4OX9Y 3NDBB 4EARA 1XR3A 4RV9A 4G01B 3DV9A 3OT1B 3ZTYA 2HA0A 3WL5A 2I7CA 1XJWA 2W2QA 3HUFA 4IY1A 3HY3A 3K1AA 4B2IA 4JR0A 2O5EA 2F7SA 3F6BX 4M37A 4R2JA 5DIFA 4E5PA 4F3RA 2HWUA 1EFLA 4NY1A 4ZDIA 3H99A 3KZKA 1MTZA 5CX1A 4A15A 1Z9BA 2KQUA 1BCSA 1H93A 1QLWA 2OEPA 3O2SB 4BVKA 4ZJPA 4N1AA 4ZC1A 1YRHA 5KYWB 2VUHB 1T9CA 2FA9A 4O2BF 1WQ4A 2QD1A 1S9HA 3FOBA 5D6NA 3WS7A 2V03A 3ZDZB 1GZDA 3LBYA 1T29A 4GI1A 2GM9A 4K3UA 4MPPA 4OREX 1IN4A 2PO7A 1JPUA 3SD7A 1YZVA 3AF5A 4HN4B 4DA6A 2I3DA 2UYCA 5J59A 3P71T 1NVEA 2MSLA 5IZCC 4DNPA 4N5HX 2VZ0A 1DKQA 2EJCA 1PZXA 4OYHA 4IX1A 4CF3A 2B5VA 3ZR4B 4GYYA 1UKZA 1HGXA 3IA7A 1ZJ6A 1XFAA 4UC0A 1F17A 4UMEA 5D3KA 5FOSA 4PICA 2OK7A 5EE1A 1EFTA 5KHLB 3SBDA 2C29D 4CCAA 3KJXA 4EQ6B 3ZQ4A 1YNSA 5CTAA 1QIIA 3AO0B 1NTOA 3L7DA 3WLLA 1LKZA 4ZGGA 2IYNA 1IMOA 2AN9A 4V38A 4KAFA 5DN6D 1V5GA 3IQZA 2BV3A 4QBGB 4RPJA 3ROTA 1VPWA 1AQ6A 4FEYA 1QH0A 2AN5A 2J6BA 3EB9A 3M4ZA 3NB0A 2EX1A 4ARCA 3JQRA 1FSSA 3OCYA 4PNEA 4CLDA 1KC1A 5CIQA 4B87A 1R9JA 4XUDA 4HPWA 5F76A 3N0TA 1ULTA 3ODPA 1IZ9A 3I72A 5AI6A 4BNKA 4PAMA 3I5UA 3RUAA 1OX5A 3BX1A 2XYQA 4BTEA 1I7SB 3E6AA 4BE9A 1O5IA 3IUPA 2GSWA 3RLIA 4CIYA 2XZPA 4PF1A 4TTPA 4D8YA 2F90A 4RC9A 1JBQA 4I19A 2FPUA 1HE3A 3BMQB 4FHDA 3MLEA 3WB2A 1ZJJA 4Y1FA 4DJTA 2BJWA 4RZUA 1B3RA 3RS0A 2WJAA 3SDZA 1QRTA 4KO8A 3WFZA 3ORRA 3WGYA 1G3UA 1VSTA 4D1YA 3RU3A 2I6UA 4IEFB 1CUVA 4ZXFA 3GT0A 3G49A 4CN8A 1E2HA 2CMDA 1EX6A 2GN0A 1P0QA 1PSZA 3A3OA 4JWTA 3S7ZA 3DT6A 3W9UA 1RXVA 3PUKA 4X3PA 4QFMA 3V48A 5C4MA 4Y0VA 2DQYA 5TNXA 5HZGA 4OX9B 3SLRA 2IU6A 1O87A 1M8FA 2W2KA 3GW8A 3M3DA 4BNFA 3UAXA 4BQSA 2HBYA 2WU1A 4BQIA 3IKTA 3IKLA 4O1IA 2CY0A 3I6BA 1WXXA 4Z1MA 3RTGA 2J3HA 5HS6A 4Q00A 3SAJA 4A2CA 3KB1A 4G5FA 1LSUA 4EGJA 3KVRA 1XJCA 1NVKA 4TT3D 1UKCA 1T5TA 3SWWA 1WSBA 3EOBI 5KNCA 1MJNA 3EVEA 4XVQA 4FFNA 1PNQA 4DKXA 2EEPA 3AR3A 3ZH2A 2W98A 4FHCA 3ZLTA 1W2GA 2QNBA 3TB6A 4FZVA 4F5WA 2VRWA 1CHDA 1RBZA 5IAAA 1KYZA 3VNBA 1KY3A 2VJPA 3B1FA 2DTEA 1KH3A 2AXPA 5HA5A 2WU3A 3U3JA 4CG2A 4RKYA 3GQVA 4MYHA 5E3IA 1RWPA 1XEWX 5BUZA 3VV2A 4C1BA 2MSCB 3AJRA 3LY8A 1LGYA 2XOKA 1KEWA 3B6JA 2PBZA 4R1NA 4N3BA 5AJUA 5E1BA 3KL2A 2XGGA 1YS2X 2Y1OA 4JYMA 5I9BA 1N57A 2DUNA 1WXWA 1X1RA 2GLTA 4Z86A 5DHRA 1T2CA 5FLEX 5TC4A 3ELBA 3S28A 1PZNA 1SVMA 1O54A 2YJ3A 4MOWA 4BUCA 1EK6A 2VEOA 4LZZA 1SOAA 4Y67A 4GC9A 2XNDD 3SBOA 3K6KA 5EIBD 3VFDA 5AK3A 3UOAB 4B43A 2QE6A 5LZ7A 1KEEA 4MJ3A 2ORVA 1Y1PA 4QOSA 4EF4A 5E4JA 4C6TA 1Z4NA 3AI1A 3ETLA 3HSYA 4XTCS 1BVHA 1JPJA 1AM4D 5CFRA 1JHMA 1D07A 1TCBA 4XEUA 1Y4ZA 2PAAA 2Q3JA 4A8JA 5JRDS 3WRWA 5HUQA 4F4HA 4DIUA 3BF7A 2RGEA 7YASA 4ZTZB 2ZUSA 2IHYA 1AGRA 2CZQA 2WPNA 5BVHA 4BUZA 2I55A 2ZBVA 1X2BA 1FDIA 1XMIA 3RARA 1KYXA 3T7IA 3R75A 1E4EB 1XP8A 2OE2A 2ERYA 3LLMA 5F23A 3BFVA 4W7IA 5EVCA 2JIMA 4BNXA 2YHIB 4B40A 3FTNA 3DMPA 3ICEA 2E4ZA 4J0DA 2JVKA 4RPIA 2P62A 2NVWA 3VGJA 2IHVA 3K0SA 3B38A 1FYDA 4WY2A 2CYCA 1MXHA 1W48A 2QNRA 3JWJA 2J9ZB 2DWPA 1SHTX 3JU3A 4B9EA 3OMLA 1IXZA 3G8AA 4AQDA 2HJRA 1R4ZA 1GPDG 2RIPA 1YB6A 3PWKA 5HXAA 1DWQA 4ZOLB 4G67A 4HB3A 1AHHA 3WJAA 3SOPA 1WCIA 2WG0A