3R7SA

Crystal structure of apo caspase2
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
159
structure length
159
Chain Sequence
b'MQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-2 subunit p18
publication title Structural and enzymatic insights into caspase-2 protein substrate recognition and catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 50
structure length 159
sequence length 159
chains with identical sequence C
ec nomenclature ec 3.4.22.55: Caspase-2.
pdb deposition date 2011-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r7sA00
3R5KA 2H51A 4EHNA 4HVAA 1RWPA 5IC4A 2C2KA 3R6GA 1SC4A 3PCXA 2XZTA 4ZVQA 2CJYA 2FP3A 4PRYA 4EHFA 5IBPA 4AWBA 4QUAA 4QU8A 4DCJA 2NN3C 4QUIA 4NBKA 3H1PA 4EJFA 1CVRA 1RHRA 2HBRA 3R5JA 5I9TA 1I51A 4QUGA 3S70A 1I4OA 1RHJA 4JR2A 3S8EA 3KJQA 3R7BA 1NW9B 1BMQA 2H4YA 3R7SA 3H11B 4HQRA 3IBCA 1M72A 1RHKA 1QX3A 3RJMA 3UO8B 2H48A 3NS7A 4I1RA 4QU9A 4PS1A 4NOLA 5IBCA 2J33A 3QNWA 4N7MA 1RHUA 5H0IA 3V6MA 2J31A 3V3KA 3E4CA 1RWVA 2H54A 3KJFA 3V4LA 1RWWA 1NMEA 4ZVUA 4NOMA 2QLFA 5K20A 4ZVSA 4AW9A 4M9RA 3GJRA 4JJ7A 2QL5A 3PD0A 1I3OA 2CNLA 4FEAA 3P45A 5JFTA 3KJNA 3DEHA 2K7ZA 2H4WA 2P2CA 3SIPA 4N7JA 4PS0A 2CNKA 5LU8A 2DKOA 3GJQA 2WDPA 4D3ZA 2FUNB 5IAKA 2QL9A 3NR2A 4EHKA 2XZDA 3D6HA 1RHMA 1RWXA 4NBNA 2C2MA 2QLBA 1IBCA 1F1JA 3D6FA 4JJEA 4QUEA 3BIJA 5LUAA 4FGUA 4QUDA 4JQYA 5IAGA 4DCOA 2CDRA 3DEKA 4JJ8A 3R6LA 4IEFB 4N5DA 4NBLA 5LUBA 3R7NA 3SIRA 3V6LA 5IABA 1RE1A 3GJSA 2XYHA 1RWKA 4QU0A 3EDQA 3ITNA 4N6GA 2HBYA 4JR0A 1SC1A 4N6OA 4QU5A 4QULA 4EHHA 1JXQA 1I4EB 1SHLA 2CNNA 3D6MA 4QUHA 1GQFA 1KMCA 1QDUA 3P4UA 4ZVRA 3DEIA 4JQZA 1NMSA 5I9BA 3UOAB 4EHAA 4QTYA 5IANA 2Y1LA 4IYRA 3V4OA 4JR1A 4QUJA 3V55A 4AWAA 2HBQA 1PAUA 3OD5A 2H65A 4D3YA 1ICEA 2J30A 1GFWA 4HQ0A 3NKFA 5IAJA 4EHDA 3DEJA 5IC6A 1SC3A 4FXOA 1SHJA 5IAEA 1RHQA 1CP3A 4ZVTA 4PRZA 3PD1A 2HBZA 3IBFA 4ZVOA 3GJTA 4QTXA 4DCPA 4EHLA 2H5JA 2C2ZA 1PYOA 5IBRA 3H0EA 4NOKA 2J32A 5LU9A 2CNOA 4I1PA 1K86A 3K7EA 2XYGA 1RWMA 4JB8A 1K88A 4N6NA 1RWNA 4QUBA 2AR9A 1RWOA 1QTNA 2CJXA 2C2OA 4ZVPA 4D3XA 5IASA 4LSZA 1NMQA 2XYPA 2Y0BA 4FDLA 1F9EA 2FQQA 3H11A 2C1EA 3EDRA 3H13A 2H5IA 2QLJA 2QL7A 5IARA 4NOJA
chains in the Genus database with same CATH superfamily
2DFKB 4I55B 4IGAA 4EHNA 4DV6B 2NZ2A 2VHXA 2DR2A 3OIFA 3T3HA 4PX5A 3SXUA 6PFKA 4F4CA 3BMCA 2H85A 5DYIA 4EB8A 3WOVA 1JT9A 4MQ6A 5IJWA 5EHQA 5K3EA 3C3BA 5HBGA 4HLNA 4OX9Y 1IBSA 2VVTA 3JQ6A 3IEMA 1FFGA 4K86A 1FQJA 2O2SA 3BM5A 2A35A 3CKKA 4YB8A 1RQNA 1Y3FE 4X3OA 1OI4A 2GF9A 1QG4A 3E82A 1R00A 1RAFA 2JJYA 4GO1A 1VLHA 3F9RA 5EJ9A 1L5RA 5H8WA 1X7ZB 2CJFA 4KN9S 4TMXA 3GT3A 2IWRA 2R2GA 5CA1A 4F9GA 1LPMA 5B1EA 1V2GA 2DFLA 3PKJA 3SNHA 3GF4A 3CVXA 3ZXSA 3HFJA 5DYTA 4D79A 4KV9A 4JP3A 5J43A 3RQSA 3IAFA 1RM0A 5TF0A 3CQ9A 1J97A 3I01M 4ZTZB 5A4MS 2ZW9A 3VJLA 2Q5OA 2EQ5A 2XUOA 2K6GA 5SICE 4BQFA 4DJDC 5K20A 2GA8A 2O48X 2QMOA 2JD1A 3LBIA 2ZJ3A 3EEYA 3ZNQA 3HACA 3I9JA 1CF2O 2P6MA 1MH1A 1QMPA 1RM5A 1Y42X 2J3MA 2JK1A 3CE9A 3C87A 3LKVA 4R2HA 5DWDA 4JSTA 3T5CA 2EJTA 2YY7A 5D5HA 3RUDA 1MEJA 3PC8C 4ZVLA 4TYWA 5KQSA 4JB2A 5ED0A 2X4LA 4IMJB 2CXQA 1DOHA 1FSGA 3CPJB 3ZWBA 4HLUC 1FXSA 1QIGA 2HA7A 1T6ZA 3GJQA 3BX1A 1D6MA 3LFHA 4W63A 3FI0A 4CM8B 1BDJA 2VAPA 3B1KA 2IUEA 2ORIA 3LQYA 4GI5A 3A4IA 4KI0A 3VBEA 4BCBA 3LCUA 1U8FO 1UEXC 5CFQA 1ULHA 4AJHA 3IVGA 3W34A 1NURA 2IH2A 3ZE7A 3RS5A 3SGLA 4YPVA 2JGLA 1YH3A 2VUIB 1HKUA 2WF7A 3GLQA 3RFCA 1HFWA 5ER9A 4FWTA 2BCEA 4P83A 5EQDA 2ORED 1WD7A 2PZEA 3IALA 5JATA 1PG0A 3ZWVA 1PWHA 2C9BA 2NADA 2UUPA 1YC2A 2B21A 1GQOA 3GFGA 4TS3A 4ZN6A 2C7BA 1YA8A 1C5KA 1VIYA 3MJEA 4MR9B 1OH6A 3X1JA 1G4UR 2FGKA 2GXSA 2L69A 3D0QA 3L7JA 4N0DA 1T9ZA 1PO7A 3EFOB 4KIFA 4B32A 2RHMA 4AZSA 1PFWA 4OQXA 5TIIA 1CIPA 2IZ6A 4GLLA 2PKWA 2I7VA 3AF1A 4NENB 4L75A 2VYVD 2VTVA 1A27A 3A9WA 2J59A 2NXWA 4MX8A 1QB8A 4C08A 5DGTA 3G9ZA 2RGXA 4HQ0A 3E0XA 1XL0A 3B3QA 4BMCA 5AKLA 5AI8A 1D03A 2FSPA 1QS0A 4MW2A 3IT3A 1Y5MA 3KT6A 2IEBA 3QU5A 4R0NA 1GFZA 4XDGA 3ETDA 1ZBDA 1DU4A 4J0JA 3WHLA 4U5XA 4ZGWA 4MW9A 2VIIA 3ZI7A 1A9XB 4P3PA 3HJRA 2N42A 1KVUA 3UV6A 1ZHOA 4YK7A 1K5PA 4CW7A 3CRQA 5AQEA 4FT4A 1U31A 4MA0A 1S2MA 2WU0A 3SN6A 4DQVA 3AFIA 2W11A 2X0KA 3MPUA 1CUXA 1E69A 3FJOA 5DXAA 3GD5A 5EMLA 2G5TA 1D9ZA 1GNSA 4UUQA 3R9WA 2W4IA 1CY8A 5IM4F 3FDXA 4OGKA 3ER9A 1TFUA 2Y1OA 2X4GA 3BD6A 3ZHUA 2I6GA 2QM8A 1XCJA 2B36A 2HTFA 1YZHA 5JRZA 2DWUA 3DQQA 1RZRD 4I5FA 4RKFA 5AJXA 3BBLA 3OEED 3TWOA 3Q8KA 4HWOA 4IINA 3I05A 4FBLA 4YT4A 4DMCA 4YJ3A 3KQMA 3S2SA 2PKCA 4FOTA 2EGUA 4I1OA 4OMUA 4Z9YA 3RAJA 1O95C 1JA1A 2VHWA 1FK8A 1YB6A 1RHJA 2BZ1A 1L7MA 1ZQ9A 5F21A 4AUKA 1PR3A 3ZCPA 3A4LA 3OQNA 3PTLA 2C29D 1MQAA 2OORC 1PZMA 5IXYA 3K6SB 3AM5A 1CFZA 1V25A 2KPOA 1UKZA 2AJDA 3EIOA 4QFDA 4YAUA 2C3UA 2Y67A 4WSOA 3CURA 4Q3AA 3SU8A 1RKBA 1O57A 1U7TA 4UOQA 4MQUA 2ODTX 4LWPA 1BC5A 3U3RA 2FETA 1NXQA 2CMFA 2IXEA 1HK7A 1BHQ1 1MNAA 3GEPA 3ZDQA 3G0DA 3MCAA 1P4JA 5ERXA 4DWWA 5EJ5A 1KYTA 1XNQB 1VRCA 3IIJA 4RF2A 1FDSA 2I6XA 5ALIA 3ZV3A 3R0XA 4DLTA 1U2DA 1YK1A 1GTZA 1C9KA 3VZCA 5BSEA 1ZN8A 3QYFA 2R8EA 2EZ8A 2H7YA 2QZSA 1DG1G 1JJFA 4F4UA 3FBGA 4DAEA 1S4MA 1ZU4A 1Q0QA 3MJDA 4JT2A 3RSCA 1U81A 1T3GA 4X7MA 4YJ2F 4ODIA 4DNFA 2VQFB 2HJGA 1GTL1 2EHJA 4IOMA 2QL9A 3GHHA 1LW6E 4RULA 1L4MA 3I28A 3VV3A 3OJCA 4JCOA 3W2HA 1JHXA 2Y2VA 1QHFA 4GQBA 4UVDA 5F23A 3L7KA 3K0FA 1YZLA 1KS9A 3EEFA 4QZVA 3QG5A 4P36A 1G8AA 4IDBA 5EKUA 4A8PA 3E0QA 2HEGA 2FF7A 1SBNE 2GK6A 2NUAA 3G2NA 2CSUA 3AUJB 3D4OA 5E4JA 3GHYA 3ZOZA 3I5XA 5JCJD 1L9XA 4RO0A 5A6SA 4GMFA 2CD7A 5DNDA 4R71A 2JAPA 3MELA 2I4RA 1U7PA 2Z4TA 3FZYA 1XMIA 5KVCA 4JWTA 3T5PA 5IVDA 3EZ7A 3O8DA 5E7MA 3RO7A 3A1CA 3UA3A 3F8WA 1Z4JA 5K9ZA 4LHEA 2IUTA 2ZYWX 4EF6A 2J5QA 2HWWA 1SXJB 4K3VA 1GITA 3OIWA 2P75A 3Q15C 5GY7A 1YNSA 3GJZA 5JMOA 3QXCA 1T25A 4GLJA 5C46F 2DB3A 3IX7A 1NC3A 3COPA 3GLGA 2HUPA 2PCJA 3G8YA 1QV6A 2ZKIA 1M7BA 2PUFA 4CEIB 1CX9B 3BCRA 2VNHA 1MPTA 3AL3A 3LD9A 4GC9A 3ABIA 5BQOA 1YR7A 3WRWA 2BAGA 4FC6A 4AZ0A 1WS6A 3H17A 3VPFA 1CP3A 3OT1A 1LQUA 4PRZA 1KEEB 2HEIA 2G8NA 3KPUA 4KXMA 2AI2A 4K8RB 4WLFA 3G2HA 5BVGA 4ZOLF 5C51B 5IBRA 1OXSC 3QFSA 1V71A 2PT6A 3I1JA 3U6KA 1V8ZA 2OFWA 4E13A 4N6NA 4P4SB 1BJTA 2AL7A 2JFOA 2YXNA 4MAMA 5DHQA 4TLMB 4UTRA 4MUHA 1OX4B 2VSNA 5IT0A 3VPHA 5G0WA 4GBED 1QP0A 3NHUA 1TYEB 3W5BA 2V3VA 1WLSA 2MR5A 2WPDD 1RYNA 2X4IA 3JD2A 3ETCA 1JG4A 4PHHA 5SZJA 3SDZA 1SKMA 2PLWA 4RLHA 5CLQA 3CF2A 1P77A 3RR2A 3MQ2A 3CW2A 3R7WB 5JWRA 3B2NA 3GVHA 1CR1A 4ZO9A 4UMEA 2WY2D 2QQ5A 1Z5VA 3P4XA 4Q9AA 1SOMA 1WTCA 3OI7A 2O8FB 4EKGA 4MYDA 4CMCA 3WSWA 3IAXA 5BURA 2HNAA 3SPXA 3TBFA 2P67A 1I4OA 2DLCX 1Y3IA 1Y81A 2AN1A 2QRKA 5FBLB 5JDIA 3K92A 2G9RA 5DM1A 2DPXA 4GGMX 1LDEA 1GZSA 1DEXA 3T5DA 4LVNA 2EFHB 3DAFA 3W9SA 3G5MA 2GPYA 3OIGA 1CY6A 1E2EA 3JQDA 3I9KA 3LX8A 4I1YA 4MYHA 2XD4A 4PVCA 1EFPA 5EXEA 3W8DA 2JLZA 5IBCA 3H5LA 1QKJA 2GZAA 3H5VA 3VA7A 3SXUB 3BMCB 4EPYA 1DGQA 2UYYA 2MIIA 2O2YA 3ROFA 1NT4A 5F51A 4BE9A 1JJVA 1GG5A 1E3DA 2ZI5A 2I3ZA 1Y0BA 3FUUA 5FO0A 3NDBB 3QVMA 5GGYA 1BW9A 1P75A 4UATA 4HB3A 4YLEA 1KRHA 4PTYA 4AMZA 3V34A 4AJNA 3L1HA 5CA1B 2FSSA 4KP7A 5K01A 1JQ3A 2C8JA 1GN8A 3SIXA 1P1BA 1RI3A 1T9HA 1CQPA 3GFRA 3ZWNA 1PVVA 4QVKA 1CUZA 1IN4A 1H1LA 3G8CA 3MGKA 4JBNA 4KW7A 3RGGA 3RRYA 3LRXA 4G24A 2FPWA 4KN5A 4D9JA 4E5KA 4EUEA 5K8JB 1DQZA 1NU8A 2X0FA 1CJKC 2QRVA 4PM4A 1PNOA 1QIIA 5HDQA 5FULA 4LOJA 4CV3A 5A0VA 2JPDA 1UAGA 2JAUA 1KJZA 4MUAA 3U4QA 5IF3A 4H0NA 3TR6A 2XOKD 4GICA 5IMBA 2DQSA 3KP1A 3OLCX 3TNDA 4NHOA 3VVCA 4PGMA 4AMUA 3EXG2 3EF1A 3JD0A 1H0RA 1GPBA 3H3XA 4D0RA 3DXYA 4BRUA 3AWIA 5AK6A 1BJKA 3FXAA 4I5IA 3LV8A 4FLFA 4IQ8A 4WT7A 2X0DA 1MPXA 1ZAYA 4EEXA 4ERNA 5HUHA 2M6KA 1H4QA 1IEXA 3OPQA 4YCBA 2H65A 1FFAA 1DUVG 3TPFA 2J6CA 1H2BA 2R85A 3RSLA 4PF1A 2PSDA 4L8FA 1MF7A 2G76A 3WYFA 1O08A 2XE4A 5LPNA 3HN6A 5BY2A 2CV2A 1W59A 1BDIA 3KKPA 2DBRA 1II8A 3R4CA 3T3OA 2ZIVB 1O5OA 3V7NA 4EO9A 4RFSA 3ZU4A 5KPJA 4B80A 3V2IA 4C03A 1OKKD 3UKJA 2X0EA 3NWJA 4EHIA 5LNK1 2DWCA 5K0NA 5PNTA 1RWOA 2VYVA 1X86B 3HSYA 4JI6B 1F4LA 1Z26A 3P9RA 4ESEA 1LEHA 1EUQA 2LTAA 1OGIA 1FUKA 3R7FA 1YFKA 4B3XA 1XN1A 4PC2A 221PA 2HMTA 2R2AA 1YR6A 4YCSA 3KZKA 5E3JA 3F6SA 3K2QA 3BTVA 5EE9A 3KJXA 1BE6A 3JVEA 5K3SA 1A8HA 4CGYA 1PFYA 1YB1A 4OLFA 1QS0B 4W5HA 1F06A 3AVXA 2R6CA 1P2UA 3FZQA 4D9CA 1QHHA 5AM1A 3NDRA 2FPUA 5AM4A 4XQ0A 4M7PA 5IT9A 1SVIA 3IELA 2XIQA 3KO8A 1GNQA 4B0OA 3G49A 3QOFA 1P33A 4V0QA 5GPBA 1ZITA 2APJA 3QHQA 1W52X 1B76A 3D7KA 3P0RA 3TI7A 3V4SA 5ISMA 4HEA1 3A4TA 3RI3A 4RHFA 4Z7QB 1UQTA 1Y7PA 3WLSA 1TGYA 3TSCA 5AVQA 1Z6GA 6ADHA 3CZ9A 1AJEA 3PCTA 2HKIA 1SCUA 3L46A 2CLKB 3WGZA 2DRIA 2Q5CA 2DFVA 4RA9A 1E7YA 2RFLA 5IS2A 1NVEA 1BEZA 1PX0A 1QQAA 3UJNA 4Y2QA 1V9LA 5LIPA 1M1NA 4DL9A 1QR2A 4G3XA 4ARCA 1YOBA 3UY4A 4L4YA 4UW9A 4FGZA 5IXJA 3DEYX 4RTOA 4G8JA 4TN5A 4IF4A 4CMIB 3RIEA 4DA8A 2DMRA 2DVMA 2JFHA 2JI8A 2XPCA 5GM2A 2J46A 1OWLA 1G8FA 2RHJA 5AVVA 2LCIA 4WBNA 3FYUC 2XUFA 3GLHA 1J25A 2V97A 3GYGA 3MYRA 5CMLA 2IS1A 1RWQA 2YYYA 2PCLA 1LSJA 2FMUA 3CGWA 3I45A 3OEHD 1RIIA 3PVSA 4Y98A 6AT1A 2QLBA 5COQA 2ZSFA 3QBDA 5SY9A 4HYQA 1J8VA 1Q95A 4B84A 3EIQA 4CHGA 2BM0A 4OAOA 4PPFA 4OHOA 3MWLA 4DG9A 1PTJA 2PA3A 2A2ZA 5EUMA 2A33A 2YY5A 5EKTA 4EA8A 4JNKA 3CWCA 1LB1B 1XKLA 4ZQHA 5CFRA 2HPVA 5ELXA 1L5YA 1VXOA 4H4CA 3A4MA 4LDRA 4CEHB 3C7KA 1F3LA 4XWYA 2JLXA 3L8HA 4IGFA 2Q6LA 1XA4A 2E4VA 2R5NA 4D9GA 4HCJA 2ZRAA 3CEAA 1P3DA 2Q62A 1TMOA 3KLMX 1Z6YA 4IDHA 4K46A 1FOEB 1I2MA 2IHNA 4MQLA 4OXIA 2QPTA 1BMTA 5HYVA 5K6TA 1Y8ZA 2UYGA 1ZLYA 1TQ4A 3MJCA 3K0FB 4HY3A 4WX2B 4NMWA 1EH5A 3FOAA 4YASA 1AXGA 1T3LA 4B35A 2YWGA 2H7XA 2NUAB 2H59A 4CR8A 4P4NA 3WG9A 3K09A 2HU8A 1X1TA 3VOSA 4AUMA 1QM5A 5A6SB 2WVGA 4HS9A 3I2FA 3WR5A 5A5EA 2W8ZA 4XOUA 1T9BA 2PRYA 2ABWA 3NG1A 1ADBA 5JBQA 1E61A 3FOWA 3H4VA 3FNBA 2Z1DA 4NZZA 1RWMA 3FDZA 4YV2A 2FQYA 2IHZA 2MMGA 5AVWA 2WVHA 3E58A 5A7GA 1NR5A 3TLZA 5DBOA 1A96A 3LO5A 3MEQA 5INTA 2GBIA 2EBHX 4MVXA 1FP2A 2XT0A 1SBYA 2IYLD 2PGDA 2OOSA 3DJFA 4HQNA 4IUDS 4Y1GA 3GLGB 4DG8A 5AXDA 3U4DA 1Y7TA 4UHDA 5DM2A 2OBNA 3WIOA 4PG5A 5FWYB 4ZYTA 4RM2A 1FS5A 2G80A 1PNVA 4QOHA 1R0BA 5DBHX 2P4UA 4G1BA 2A67A 2BFEA 5CB8A 4DARA 5IBPA 1PQPA 5BVGB 1VL6A 3RROA 2Q29A 1E7RA 3IP6A 1ETHA 4OK5A 4DBLE 3CH5A 3LOUA 2RGUA 1JI0A 1YS7A 4RLQA 4AS3A 4AS2A 1U98A 4U9UA 4UUNA 2ZDGA 1CR2A 3COYA 2X13A 2P1DA 4DHWA 1W5EA 4RTPA 3LXRA 3NHMA 3CF4A 3PNQA 3IP5A 1I2CA 1TTQB 2Z0MA 3CRNA 3FMOB 1E7WA 4OB8A 4KPGA 1R3DA 4QEKA 2VNIA 2MOKA 5DM70 5E4TA 1O0BA 1A7KA 1T43A 2ACKA 4D80A 1M3SA 4EEKA 2ZIUB 3OEWA 4ON9A 2B7CA 1NKTA 2GYWA 4CTMA 5AQ1A 4Q7MB 2GX6A 3K8ZA 5AKKA 3LHSA 4YWHA 2REOA 1LCIA 4XARA 1T26A 3WGYA 2WM8A 3BULA 3IAHA 6REQA 4KQEA 4U7JA 2PU7A 4ZFNA 2E21A 1Z6QA 2XNKA 3DOFA 3CF4G 1I3OA 4RH0A 1SIBE 4JUAA 3MC1A 4GMKA 4ADSG 5ADUS 2K7ZA 3D1JA 4KRXA 5JSQA 4ARBA 3OCJA 1FNSA 5JD6A 2BV3A 2C88A 4WMLA 3M3PA 4ECEA 6GPBA 3WL8A 3KHTA 4NKRA 4WINA 1JW9B 1QJCA 2P79A 2XRYA 4M9ZA 4ZA2A 3TTXA 3K0SA 4LV6A 1EFPB 4RD3A 4R7ZA 4CT5A 2R8RA 1WW8A 2D7CA 2ONCA 1TIPA 3RVDA 3I04A 1SCNE 5E1DA 5AVJA 4QGAA 3EAQA 1J09A 2DJIA 5J4VA 3CKYA 3EXFB 3RSQA 5DBIA 5AOCA 1K3UB 4KL8S 3BTUA 2BEKA 2HRZA 2O20A 2PH7A 3C4VA 4Y6SA 4RHCA 2HDOA 3NFRA 3SK0A 3G6KA 3VPDA 2BDUA 1KBQA 1J90A 2W83A 4IDPA 4EJ0A 2X77A 4EYEA 5FUXA 1A88A 1KH2A 4FR2A 4M8KA 4WVFA 3FPSA 1AUVA 3VTZA 4TV8B 1SBCA 2WHPB 5AESA 3ECCA 4YROA 1DDGA 5CJPA 1T24A 2WNSA 4YALA 1UK6A 1DIHA 1H1LB 4KLCA 4GZLA 4C88A 4NH4A 3C6YA 3IEIA 2BI4A 1ZINA 1UOOA 2QRVB 3R2JA 5FTNA 1W4CA 3FE2A 3EMBA 4F5WA 2RDMA 3NHZA 4CMGA 3NHJA 4HGYA 1PKXA 2M6SA 2ZETA 4BV9A 5J2TF 3JQ9A 3I0MA 3DHYA 1RS0A 1NTOA 2GCIA 3I1YA 1SCAA 3S3TA 3NW9A 4M1TA 621PA 2XY4A 1QQ5A 2M32A 1K98A 2UUOA 1J22A 3OPVA 4F4HA 4CUKA 4ZI7A 3AY6A 5EGNA 4CBVA 1S9HA 3BMXA 1N9GA 5GOZA 5C7YA 5CFNA 4OLAA 4ZXPA 4DC1A 4EHJA 5A4JA 3ORHA 5C8VA 1FTNA 4FCVA 3JXEA 2OHFA 5FEMA 3PRJA 1CDOA 1M2EA 1U8TA 1Y5LA 4AKEA 3WAJA 2XCTB 1TZMA 3D2CA 5K7SA 1E9AA 3O03A 3RV4A 1B16A 5BORA 4F92B 3H16A 2FHPA 1PJ2A 4NBSA 3L84A 1B00A 2OBBA 3F3SA 2Y68A 1HF3A 1J2TA 2D7JA 2CCGA 2P90A 3M6LA 1KZGB 2YWEA 5CX4A 3GLRA 1X70A 3PK0A 4HDOB 1II8B 3M70A 4NEQA 4XXHA 5AKYA 4NBKA 5BO5A 3ZDZB 2J9FA 4RFSB 1AF7A 3NLLA 3DBHA 1UPUA 2XDWA 2ZSHA 3A26A 2XCOA 5IUNC 4ZALA 4DRXA 1CV2A 2BP7A 4J1SA 1DC4A 2BGNA 1KMIY 2R6AA 1H69A 5HPYB 5I7FA 2FPLA 3PQ7A 5IRCD 1ZK2A 3ZW9A 1XMVA 5I7SA 2BGLA 3ROTA 1AE1A 5F9HA 2P3QA 4YUZA 1WZUA 2PNFA 1I6LA 1ZZEA 1PBNA 2VPYA 4NQZA 4BMYA 5BWOA 5J5CA 1QHHB 1IUKA 4G0WA 1HLPA 1OGYA 1YRLA 2YWDA 4OHZA 2J9ZB 1UKEA 3KKZA 3UBMA 3W8NA 2IIBA 3DGFC 3KSBC 3PQ2A 1BXKA 3NHSA 3ROKA 1N3YA 2IZ5A 3JPWA 4G0YA 1KAQA 4HEHA 3EG5A 4Q4HA 4DLLA 4EABA 2IT1A 4Z4EA 3INNA 2ZJ4A 3DW1X 4O4HA 1JYEA 5EP2A 2PUAA 2C4TA 3CCBA 4K6GA 1KAEA 2HLDD 2I1LA 4TT3D 1Z13A 5P21A 5JXWA 3G7SA 4CV2A 2IXBA 1YDEA 1RXWA 5HMMA 1QVWA 2K4MA 4OQLA 1GTVA 2O0HA 3MHPA 3L05A 1RLIA 4DMKA 4A9AA 1SCUB 1XZ8A 3DLIA 1G21E 2XCQA 1U8UA 1DQPA 2WG2A 3EQ6A 3BIJA 2WJYA 4RA9B 5HZGA 1OH5A 2LPMA 1N2HA 1KDTA 3EYAA 4G5RA 5TT0A 1B6TA 4BE7B 1BEEA 5B3LA 2GPSA 1U0GA 3CW8X 4TXLA 1PZFA 1RCTE 3OHMA 1M1NB 4X00A 1H9BA 1Z63A 4XWAA 1YJAA 4GS5A 1ATIA 1HKHA 3WQBA 5EJMA 5LWQA 3GLTA 3L8CA 1JDUA 3ANTA 4AT1A 3KOMA 4P7KA 4I19A 4TL9A 4QT4A 3IVRA 2WJAA 1BH2A 1D0IA 1LLCA 1GZ3A 3S2GA 3THRA 4P0PB 5GM1A 5FD8A 4JFAA 3EQ9A 3HLTA 1XEFA 4WBNB 3SS9X 1M0WA 1E0DA 4G41A 4GSYA 5DISB 3SJCA 1GPH1 4BLQA 2AKAB 3QFHA 2AR0A 3FKSA 3NIGB 5JXJA 4RJLA 3PHBE 4JLUA 5DTJA 5C8YA 3GMIA 3L8FA 5MN5A 3QVXA 3E7WA 5HJ5A 1GCOA 4KLNA 721PA 3FSJX 4XIFA 4QOIA 4KIGA 3IDQA 4FYXA 3WFIA 5BMVB 2IYZA 3IJ5A 2PKQO 5E7IA 4EZEA 1ELOA 2EEPA 1D1QA 3H18A 4G86A 1FLAA 4JI1B 1J2EA 3TIGA 4POOA 1Y6GA 3CLKA 2QUKA 1FTGA 3ZLJA 3TXXA 1FYWA 3QRWA 2JAWA 3RF6A 3F8SA 1FTYA 2AG6A 2FWJA 3EQ7A 4FZVA 4KLRA 4AP9A 2QYTA 1S6YA 1W5TA 2RHDA 4O4IA 2M2IA 1V9SA 1Q7RA 2Q0QA 2QMZA 3W2GA 4JJKA 4UULA 3VAYA 3B1WA 3AB7A 1GL3A 1ZX1A 3PNKA 3PVZA 3RRNA 1QF9A 3UGQA 1L7NA 3B6JA 1EVKA 3LWDA 4HGOA 2OG2A 5TE9A 3LF1A 2CWWA 2F1RA 3H2SA 4U2KA 3SQLA 5JAZA 2ZZNA 4RIGA 1XCGB 3QEKA 4RYLA 4MICA 4RHUA 4AJ9A 4CFZA 1LPBB 4M22A 4DNXA 3UJBA 5DULA 4BZPA 3FDZB 1KORA 1QONA 1U0TA 2GEJA 1OW3B 2GPWA 2C2HA 1VSTA 5FPHA 3AKEA 3EWNA 5D6OA 2XUHA 1L7PA 3IDSA 1LBQA 2ZPTX 3AFHA 4MO2A 3M6VA 1L4LA 3QLVA 1MOPA 5EJAA 5L9AA 1RWVA 2Q5LA 2AZDA 2XB6A 4LWZA 1IM5A 2G36A 1AQJA 2RAFA 1UBMS 1DOAA 1M2VA 3SS7X 1QZUA 2FEMA 2BFEB 1CP2A 1W44A 3OT5A 4EECA 3RHSA 1CQJA 1MDFA 1OFGA 3BWMA 2YYAA 2KMLA 1FFWA 2NWQA 3LECA 1JG7A 2WWTA 1F51E 1GG8A 4QECA 3TD2A 2VRWA 5I9LA 2IZOA 3GROA 3K9WA 2OZLA 1TZJA 4KE9A 1PHPA 5LB4A 2DLNA 2XI4A 2R84A 4BAUA 2FPIA 3A6HA 4P58A 1R27A 2X9LA 2CUZA 4TV9F 3UUEA 5KX5B 4IEEA 4UNQA 4DKXA 4RKQA 5CH5A 5HKKD 1DBWA 1O03A 5CK4A 4EGFA 2V6BA 1GTRA 4WXYB 3HLKA 2DG2A 5TGZA 4DBLC 3ENWA 3L8EA 2PVSA 1KNXA 4PE5B 4LHVA 4ZVVA 3F74A 1SGWA 2QYHA 3GUCA 3W77A 4LZNA 4QUDA 1JG3A 2J4CA 2RGAA 3NKLA 5B30A 3DEKA 1LJ8A 4CQLA 4K5QA 6REQB 1OJ7A 2W37A 4OF4A 2R86A 1KZ7B 3NAZA 4ZYXA 3OCUA 3ENQA 1NVGA 1GLGA 3DBRB 1PG2A 3QFFA 1ULSA 2WJHA 4YJHA 3S44A 3L4BA 4YI5A 2I91A 3HB0A 3Q2IA 1DDIA 3WJ7A 2X0IA 1S2IA 4G26A 1UUFA 5A5VA 3F6EX 1I3MA 1YC5A 3WLAA 4LY0A 4CTNA 1H5QA 3SSAA 3P2MA 1OY1A 1LF5A 4NYJQ 2AD5A 4Q1VA 1JAHA 1B8VA 2BBWA 3PL5A 1XN4A 3BGDA 3UB4A 1G3MA 3C0KA 1SUBA 1W85A 4NE7A 5F9MA 4B45A 4BV8A 4DQDA 5CFZA 2V5AA 1LK5A 1EXVA 1OIVA 4LXGA 2BDTA 2XYRA 2BEVA 2OM2A 2ZR0A 2OHXA 1VG9B 2W6JA 1G4AE 2X3YA 4BVAA 4YRZA 2ZITA 5HQTA 3QA9A 4WLOA 3FA2A 1I7SB 1W1UA 5CM2Z 3RTGA 2QU7A 3LF2A 1VLVA 4ZJYA 3IP3A 4GBMA 4R7GA 4W5TA 3BA1A 4IZ6A 4ACBA 1W5SA 1TUEA 3CMMA 2PMDA 2XYPA 4FQ5A 5FBWB 4F3KA 3V9PA 3KTOA 2XVMA 5G1NA 2GA9A 1O6ZA 2AF4C 2PQMA 2I1VB 4A6XA 4DEVA 2H51A 1O0SA 1SU8A 3TE6A 2X1MA 3EY9A 2VRNA 3OTIA 3RTDA 1SD1A 3D1VA 4QDKA 2DHRA 3DQPA 2A5JA 3NWBA 3O90A 4HMPA 1ABFA 4RF5A 2C4VA 1Q0UA 2QRLA 2QN8A 3G8DA 2D00A 2FEOA 1XU7A 2R8OA 3HXTA 3VGJA 1NP3A 2RBKA 2OV8A 4TTPA 3RBXA 4Q1BA 3ZVMA 4M53A 1OVMA 2ZROA 3LW7A 2DTDA 2V7QD 5AXBA 4BGEA 1L7AA 2MT9A 3H5AA 2Y6VA 4ZI7B 1QPBA 1HG0A 2CXSA 4K26A 1RKUA 1SG0A 1SBZA 2AFVA 3DAHA 1PS9A 2VRCD 1XZLA 2WUEA 1FFCA 2ZUDA 3IC5A 3QUBA 4QDOA 1X39A 1UQUA 4ETMA 3Q3GE 4BPBA 3HPQA 1YDWA 5DYNA 2FK8A 4D9NA 1Z4PX 4PIVA 5C81A 3J81A 3G2OA 3WA6A 1Q7TA 3OCYA 4UUPA 3T95A 4B7UA 2J9FB 1LRLA 1M74A 1FVHA 3AY0A 4X62B 2XQFA 3DBHB 3I1IA 4EBFA 3C5HA 4YI3A 3NTLA 2J5KA 2WV7A 2VDLB 4DNQA 4DRXB 1E1KA 1T8UA 1JEYA 3HY4A 2QXTA 2YQ5A 1E2DA 1J5XA 2BP7B 4LXUA 1ESMA 2V5UA 1TA0A 2Y93A 4QQ8A 1KWKA 1U63A 2D54A 2PGOA 2XNJA 3GUUA 3TBKA 2X2OA 1C9DB 5J47A 2LDBA 3CNQS 3C3JA 4L9SA 4BQSA 4RCYA 3U80A 1KAGA 3G13A 3JTEA 4J2OA 1U5CA 2DBVO 3K71B 1RWBA 4FP9A 4C6SA 1JHUA 2IW1A 2WMOB 3CO0S 3ZLUA 2QIPA 1TTPB 2ZYIA 2WF8A 3A1DA 3ETGA 3F78A 4LY3A 4MWCA 1Z83A 1V11A 4IG9A 1N5LA 1R0YA 4ZARA 1ZSVA 3KPVA 1RWKA 5HIAA 4J43A 1LBIA 4C22A 5BSGA 4CETA 4LXXA 2Q3CA 3V1NA 4JR0A 1Y4DE 2FZCA 2J85A 4Q4HB 2YHIA 2HYIC 3PA6A 4O4HB 5ADVA 1XL1A 2AJBA 1S3GA 3D2LA 1LSOA 4FOLA 3HJAA 3N74A 3RS2A 3AETA 3K0AA 5B3JA 3WKDA 1A7UA 1P3JA 1TEXA 5AMXA 3OIUA 4I46A 5C4GB 1WLYA 3W1VA 3LHFA 4J1TA 1KZHA 4XQGA 4G0OA 4R31A 1E5TA 2VJDA 1S8AA 2Q1YA 4M0MA 4ZEOA 1C9NA 3H2IA 1OZFA 4G1VA 1BS9A 3OQMA 4DV4B 1J5EB 3P0HA 2O7SA 4N49A 1FBTA 2PYIA 3KU1A 5KSPA 4O0MA 4FMDF 4HPXB 4EOGA 2PX6A 3GVIA 2DY1A 5G02A 2OWEA 4W82A 4OKSA 3U31A 2N9UA 3LU1A 1QUFA 1FDRA 1GQSA 4JGGA 5CLIA 1C50A 5DXFA 3ZBTA 3OX3A 1UINA 4LVCA 4Q4CA 1GGFA 1K0FA 2EATA 2P5SA 4XIIA 4C20A 5EIAA 1JXOA 3CINA 3H42B 2WSBA 5CITA 3GGGA 4KQGA 3WZ2A 2AZ4A 5C8YB 3PDCA 3CVUA 3NIBA 3LTEA 5EQFA 1LNZA 1JFVA 1WXQA 3KAPA 1ZG3A 2D4AA 4NU6A 5KI6A 4FN5A 4ESHA 2JGEA 2Q99A 3CKMA 1JPNA 4Q4LA 5KS2A 2GR9A 4TL7A 3ZHYA 3HO1A 3OF3A 1C8KA 2HLHA 3GU3A 2XE7A 3IAUA 3W6PA 3D0KA 1IZ0A 3K9QO 3O2QB 3OCWA 4K9PA 4MB6A 1NJGA 2Q1TA 4G25A 5JVDB 2D1FA 3QE4A 4RPHA 5CCEA 2HBRA 2Y0CA 4F56A 1SXQA 1CDEA 3CVWA 2CUKA 4CEJA 4KHPB 2BVNA 3L7MA 1JLKA 3EZYA 4GRAA 3ETJA 4RQTA 4HRAA 1TQ6A 2A9VA 5K0TA 3WIVA 2I65A 1X1EA 2X2EA 3KLOA 3B6KA 1TPYA 2DE0X 3N59A 3KXLA 3RC8A 2H2WA 3VPXA 3SE7A 3EZ9A 2QK4A 4GPBA 2V4ZA 1R0RE 2QGZA 4I4IA 4WFIA 5THQA 5L3RA 3REQA 1U3WA 2R96A 4FS8A 2QLMA 1U1GA 1Y3HA 1XP5A 3UJPA 4L07A 1ST3A 4O3FA 2QJOA 3V3KA 2ZJ8A 4I50F 2HHHB 2XA2A 1E3JA 4X8MA 5F4BA 5ARBA 3A6GA 3PNVA 1CERA 2P3SA 2BTEA 3UHPA 3DL2A 1KIAA 1XDGA 1AZTA 1CUUA 4YCAA 4M21A 4OK6A 1L8XA 1JJAA 1UXOA 1ODFA 2E4YA 1HRDA 4LHYA 3LVQE 4WBXC 2I0FA 1RJEA 2C83A 1E62A 2Q1XA 3H1EA 3L4JA 4B79A 4KU4A 4C0WA 4ENWA 1HMPA 4CKBA 4YT2A 1CPYA 4HH3C 4JP1A 2E7ZA 1HZJA 3NVMB 3QENA 2WUFA 4UC0A 2W00A 1NUTA 3W5VA 3GNTA 2FUCA 2P9FA 2PX8A 3CX4A 1H6BA 3OFND 4NCIA 4IDOA 5A4DA 4AJOA 3F9IA 1IBCA 4QE3A 4POAA 4C87A 2IIQA 3ENZA 4NDZA 1M2VB 1Q3HA 2ZBEA 4FYJA 4JQYA 5LUBA 1QH8A 1R37A 5F33A 5AUNB 3IO3A 4G1FA 1CQJB 1G6OA 2QRGA 2IC5A 4Y2SA 5DGDA 5HVNA 4ER5A 1YRYE 3Q11A 5CR9A 4HEJA 3LPNA 4CMEC 4Y1RA 3CVYA 3PSHA 1QDLB 2OZLB 3BRQA 3RJTA 4N6OA 1JDPA 3BE6A 4BN5A 4JEHA 2B25A 4LSMA 2AN3A 3PPVA 4QDJA 4HGZA 3RYFB 3PR1A 1DZIA 2AK2A 3VVLA 5JT1A 1I30A 2PTHA 3L6BA 1ZJWA 3CJRA 2QM7A 1EX1A 4HAUA 3K05A 5BR4A 3ORRA 3ROEA 2V7GA 1IN7A 3PE6A 4FFPA 4Q3OA 4LDNA 3F46A 2CYBA 4JVSB 4RPKA 3AONB 1WMFA 2QUBA 1Q7EA 2H4HA 2XBLA 3P1JA 3ZDYB 4CQLB 4PX3A 1WCIA 5HEKA 2NU6A 3KHUA 2SBTA 4BL5A 4F1WA 3GVXA 3SYTA 1DZ3A 3QFTA 1M5RA 1PE0A 4ND2A 1GIAA 1PUJA 2EBFX 2FHSA 4RPGA 4XB6B 1P8JA 5EJ2A 1OXMA 3DL7A 3RU7A 4YJHB 4ER6A 1CZLA 3KCNA 4G8BA 3UVEA 1R4ZA 3TTYA 1BXRA 1G2PA 3I64A 5JEDA 1TZBA 3WNCA 2FOIA 2BWJA 3FD8A 3NT4A 4D4LA 1GKYA 3K4PA 3P9ZA 2QGNA 3FZEA 5F1PA 1KRWA 2PUHA 5CT9A 4C3ZA 3DA8A 3P27A 1VLZA 3PUYA 1SD5A 2VN8A 3BDIA 4PEVA 4BYMA 4JU8A 2E18A 1RYBA 4KVFA 1W85B 4KYIB 4GUDA 2H4JA 2PMEA 5LYJF 1GSHA 2QVGA 2F4VB 5C5DA 4G0VA 3M5WA 1Y9AA 2BEVB 4Y2YA 3V7YA 2A9QA 1QFJA 1XVAA 4JB0A 2FW0A 4BX8A 2R44A 1QYRA 4MJLA 5CDHA 1HNZB 4WZBA 2HDWA 3BF7A 2YMQA 1CBUA 4DV5B 3K1TA 4OBWA 1AQIA 2XYQA 3V42A 5JAPA 4KMMA 4MW7A 3JTMA 1ZNYA 2R68A 3DZGA 4XW2A 1DXHA 2IX9A 2P6OA 5A4AA 3NATA 2FZVA 3KOUA 4O2BB 5DTMA 1KKLA 1RWWA 3B70A 4FKMA 5AT1A 1EEXB 3WBJA 1ML3A 3WLTA 4ALMA 1ULZA 2F90A 4C5BA 4F11A 3H05A 3OU6A 2QUHA 1K5HA 1DEKA 2F67A 4RTNA 2QJRA 1YJXA 2FW7A 3FPBA 2XKAA 5IJ9B 3DH0A 1NOJA 5F1YA 1SCBA 2FCRA 1KHTA 4Z3DA 4AP5A 4HJXA 4LZZA 1Z33A 1XAJA 4I9UA 1YB4A 1HNXB 2MWMA 3OHSX 3WYCA 1X1RA 1DMRA 1ZA2A 3E1GA 2OV1A 4KUEA 4MUBA 4L5IA 3TLBA 2O4CA 2NO6A 3IUBA 1P5HA 1B0ZA 5B7QA 5DSZA 2MSNA 5ECGC 2XODA 2PY6A 5IC5A 5CUQA 1R18A 5MN4A 3B8EA 4A0GA 1KIFA 4O4JA 2DY0A 4LRQA 1KVTA 1IRIA 3AUSA 2LKDA 3BD7A 4FHZA 3UCFA 3OY7A 2UZ1B 2YHUA 2YCBA 2SNIE 3HNPA 2D7DA 4HQFA 1SK8A 1TO1E 1SCJA 1TVEA 4GR9A 4EAAA 2M1XA 5EPOA 1M75A 1CE8A 4RKRA 3A9UA 5L51A 2Y76A 4D4GA 2CVHA 2ZI9A 5BYBA 4HD8A 3B12A 3U60B 4O08A 1PR6A 3GFOA 1VJCA 3C85A 3EQ8A 4MEBA 5JCOA 4JELA 4ZCSA 2J7KA 2WG0A 3IIMA 4WZAE 5FWAA 1EA5A 2J4FA 2WU1A 3KSDO 1TM2A 1KR5A 1ZW6A 4AKHA 4UUAA 2FOXA 5HTKA 4FGWA 4TSRA 4HYEA 3MWFA 2WD7A 3N0WA 5LZ8A 5HP4A 2JJ1D 3B3GA 4UEJA 1AXRA 2EQBA 3KNZA 3QE2A 4D82A 1V11B 2IUFA 3T4EA 3VH1A 2EFJA 1W49A 3NTQA 5BNWA 1X80A 3B3AA 1RZ3A 3B8HA 3DOJA 3K5HA 1HEUA 1CD5A 1RJGA 3IQXA 3H0EA 4V2IA 5H3LA 3UXEA 2VSFA 5DSXA 4LXQA 4OIFA 5FLEX 2YHIB 4BTEA 1A7JA 1WVMA 1YS6A 1FNNA 4B4WA 3PIDA 5CPBA 3ED1A 1C7IA 4U7WA 2D13A 4K9RA 5F7XA 1VKZA 4M0PA 3ZR4B 1IXKA 1KZYC 3CEJA 3GGSA 4DIBA 3THWA 1RCUA 2GD0A 2WA2A 2ZATA 3AETB 3ASYA 3H13A 3K0AB 3MWGA 4BDTA 4F2GA 3EGXA 1R0SA 2EKLA 2JJ8A 4L9WA 4KXUA 3FDFA 4WXMA 2WE8A 4Q9JA 1I1QB 1OA0A 4BU1A 1H94A 1RKVA 3K6KA 3CCFA 4B09A 2PFGA 3AI2A 821PA 4PWZA 4EVSA 5LJLA 4YFYA 2Q1UA 3UF0A 3TFQA 2O8EA 3HVRA 2AI1A 3KXPA 1N2CA 2XAAA 4K87A 4BO1A 2BCJQ 2VS1A 2GYUA 4HC4A 4HQ6A 1MX5A 4X65B 1G1AA 4CCWA 3VH3A 4TROA 3M89A 1H5NA 2X5NA 4H16A 1R0WA 2A58A 4G97A 3AR4A 3WP0A 3IURA 5EXTA 2IWHA 2WILA 13PKA 2A3RA 1NY6A 2WI8A 3GP3A 1JDJA 2H48A 3OX2A 3IHWA 4R6XA 4D3DA 5IDXA 3HXPA 5KYYA 1UK8A 1ES9A 4PLGA 3W5SA 4S0ZA 4S04A 2PKEA 4O4LF 1ONOA 3ZWWA 3CMCO 2A1UA 4UXJA 4TXMA 1V2HE 1G7SA 1YJ8A 2P78A 3BDVA 2FOLA 3KTDA 3MWDA 1R8QA 1BKYA 2CYCA 4FWBA 2XMQA 3DE2X 4Q3LA 4CEJB 2WTUA 3ZIDA 2HA6A 1BOOA 4FHFA 5JTUA 3UPUA 3LT4A 2RHOA 1EUCA 3Q6MA 4IXNA 4S1VA 2WJVA 1QR6A 4HYTA 5CB4F 2O6HA 3AYXB 5KNCD 2PM8A 4JLDA 5CA0A 3TSZA 1QP7A 1VGVA 1QQTA 5JS1A 3PNOA 3REQB 3QUCA 1A9PA 1EJ2A 2SHKA 1M6WA 3FRIA 1A4XA 5FOXA 2OOKA 1JQLB 2L0XA 2Z83A 2BGUA 4FUTA 4MWSA 4EELA 1B1CA 3U7QA 1SPBS 1J1UA 4UHEA 2XECA 1B2RA 3OQ6A 1RPAA 3DG9A 1OZHA 2YRFA 4CODB 1S02A 2ZPUA 3G9QA 1IBKB 4B8ZA 1U5BA 1T6YA 3LI2A 3BFPA 2YJ5A 3NUZA 4FNGA 1ZSNA 4WI1A 5IKOA 1Q20A 3B5EA 1Z8NA 4CKBB 1V8BA 3NT2A 1UT8A 3AR8A 3QF7A 3GUHA 3AUTA 3GDGA 4Y18A 3VR5D 1HDXA 1K8XB 5KC9A 2OL4A 3Q0EA 2LD4A 2OO3A 1JFLA 3HDJA 3SBOA 3OESA 3QKRA 1FBNA 1AX9A 2QYOA 5HF6A 3VAAA 3OC6A 1WWKA 4CL2A 1JNXX 5SYAA 4FZRA 5L6MB 2HZBA 2HLNA 1BA3A 1G64A 1L4FA 2OAP1 2QM0A 2PX2A 1CUVA 1QH8B 3R24A 3RIXA 1DBSA 2JIRA 4EUFA 5LZ4A 4Q12A 3MTGA 1TZ2A 1XCBA 5BUCA 5BN3A 1XYGA 2CHFA 4IJWA 3EXAA 3FHTA 4NOKA 2BTQB 4I1PA 1EP1B 2ZLBA 4PYNA 3WXBA 2BKLA 4KIWA 1EIZA 1FVXA 4BGDA 3BD9A 5DCYA 1L7VC 1X9IA 2RB4A 5H80A 2C2OA 3A1NA 1HFKA 4OHYA 3F6YA 4X90A 3ZS9A 2OB2A 4GOJA 1M54A 2GBFA 4OHMA 3UJ7A 1CC1S 1J23A 4GI7A 5KCZA 2W2VA 3OU2A 2QJFA 4PYKA 4HOYA 2G9VA 2VSOA 2P8SA 2QRNA 3R5HA 3CF0A 3HUUA 2IW3A 1VFNA 4IH1A 4KFUA 4LGCA 3FFBA 1X8XA 2C5FA 1KFEB 3UG6A 2JGRA 2F9MA 4J9UE 1BWRA 4P3KA 5AJUA 1HRKA 2EW2A 3T7AA 1WCIB 1WUTA 4BO0A 2YUIA 3LBYA 4IFBA 4L4UA 3U17A 2IS2A 2NSHA 3LY5A 1JVBA 2Y9MB 3H1PA 4PAWA 2ETVA 1GAJA 2F17A 2FW1A 5T41A 4QOFA 3EASA 1ZRNA 3NWOA 4ARSA 5EHNA 1XDZA 4FDAA 4AS1A 2JFNA 2ZJAA 3A10A 4RESA 3NJ8A 4HKTA 3LBNA 2OWDA 1X9HA 3L40A 4YCJA 4XPIA 1XMOB 3AF3A 1Q5PA 4JN6B 5L3SA 3BXZA 2GKGA 3ELYA 5HFNA 2R48A 3EK2A 2J3HA 4LMBA 4RZHA 3KXKA 3QU4A 3BL8A 3E7PA 4KGDA 3K31A 4UNIA 2PRZA 2UV8A 2PL1A 1QGYA 1LPOA 3NHFA 1N6OA 4EJSA 2MU1A 1UKAA 4PPNA 2ID8A 2NNLD 4QHYA 1TMKA 2FFQA 2Q50A 2HHLA 4BWFB 4C7MA 1GTSA 1D4ZA 2D6FA 1G63A 4DV0B 3AFOA 1JSCA 4NK4A 4Y2UA 3SVZA 2IYQA 4QJIA 2A9RA 2GEVA 2A0YA 4FC7A 1OAOA 1T9GR 4AN0A 3F2IA 3BXHA 4KQFA 3GLIE 2P65A 1Q0SA 1Z45A 4D99A 3KJEA 2HDHA 4AIIA 5EQTA 2PAAA 3VYSB 3Q9NA 4Q7KA 2CMDA 2W6NA 1V3VA 1IHDA 3WNVA 4GOXA 5G0UA 3L4KA 3LA6A 1JECA 1GQQA 4AKTA 5SZIA 4PRLA 3CLTD 3OE7D 1FVFA 1K7EB 1PTKA 3HC7A 4RV5A 4A0SA 2RB5A 5ALKA 2A5GA 3RB8A 4H2DA 2XKKA 2FZGA 2YZNA 3FCCA 1PEAA 5GINE 1CLUA 6CHYA 1O94C 4DSUA 3BAZA 3UATA 2MMCA 4DRZA 2XEDA 1I01A 1Y3DE 2Q5IA 2JEOA 2BZGA 2AMFA 2CNNA 2PH1A 2QDXA 5EUBA 3KKQA 4ZV9A 3ND9A 1V1RA 4IDAA 3P4UA 1DEOA 2QZ9A 3H2ZA 4Q48A 1YDGA 3MD0A 3OP1A 1P9WA 1RW4A 1FFBA 1PFGA 2JFQA 3ES9A 3PPXA 1Y8RA 5EY5B 4OL9A 2YXPX 1DQYA 1Q0ZA 4RJIA 4O4JB 5CG1A 3PNYA 3CRW1 3C8MA 1Q84A 1QX4A 4GI1A 3TL3A 2O2GA 4ZVTA 3ZQUA 1GTG1 4KACA 1DHRA 2VDVE 4QBIA 3TTTA 2HYDA 5FA5A 2BBOA 4FE3A 4JIMA 1HC7A 2R25B 4G56A 2IPOA 4HDNA 4MV9A 3JZAA 5FJJA 4UTZA 4HLDA 1DCMA 5HE9A 5JRJA 1KI1A 1P7VA 1VSUA 3EFEA 3VFDA 4Y9UA 4F6LA 5A0TA 4P3YA 3MOGA 3UWPA 2HV8A 2OFOA 5KWEA 1YACA 4MW1A 1P7ZA 4JI4B 5I7UA 1FUYB 2ZYGA 2LGJA 2COKA 3GIDA 3FCSB 4L3WA 4J49A 1ISFA 3HVUA 3HB9A 4IDFA 5FH9A 1Q44A 1WG8A 2G0AA 2NV6A 3HU5A 5B58C 3F67A 3PUZA 3ZY5A 3H8VA 3UXYA 1N57A 2HL6A 1L7BA 4HWRA 4P08A 2FMKA 2OAQ1 3X2EA 5JNSA 4Q1EA 3RVQA 4GKAA 3CUSA 1AOXA 3WFZA 1OWOA 4HMQA 4E5UA 1P0MA 2R65A 2YWFA 1TK9A 3OSZA 4GP6A 4WGGA 5EZYF 3T5MA 5BV0A 5HZHA 3KELA 2NVBA 1H8HD 4J7XA 4M9XA 5AW3A 3AEKA 5JH7B 2P41A 5E4FA 4ZMSA 4TLCA 1MOZA 3TQFA 4JZKA 2Q4EA 3VXKA 3HN2A 1NW9B 4ZYLA 3GFFA 1KSJA 3DMYA 1WO8A 3GJ7A 3N2IA 5FFNA 5CW2A 5ALLA 3MCUA 4AZ3A 3THWB 5H83A 3CY6A 4GX1A 4K1LA 5JNLA 1T4BA 3LT0A 4Q1DA 1KNQA 2VBCA 1RYHA 1TW3A 3N1UA 2BEWA 3QIVA 2FRVA 4MYSA 3BK1A 4NAHA 1OXTA 1Y4AE 3O9ZA 2QIOA 4YP9A 4PTZA 1Z38A 2WV9A 1IATA 3EIHA 4KMOA 4MGYR 5FWXA 2IIPA 3WLLA 1X77A 3GVPA 1MUUA 3HYRA 2I9PA 3HCNA 3FF4A 4RNCA 2O1WA 5JW6A 3WA7A 2O8EB 5TS3A 2ZYRA 1LLFA 1OPXA 2XF8A 2TMYA 5LFAA 4ZJZA 3O0DA 3ZBUA 3GMTA 4B3DA 4PFSA 3KT3A 4ZAZA 2UYOA 4X1IA 3VR0A 3GXBA 2DHCA 1IXSB 3AL2A 3H3FA 3QE3A 2W2KA 3LL4A 5DBEX 5GV8A 5K2MA 1EB8A 3QLUC 4PXYA 4QYXA 4LX8A 2V9PA 3SJZA 3HB4X 3SLRA 2OZEA 5KVQA 4XSVA 2HZ7A 5FF9A 1SZCA 2G04A 1JL3A 1XNRB 5KYYB 1ZW1A 4BB6A 2G88A 3LCVB 5HIKA 4TWZA 1UFRA 1P0CA 2XUIA 4W7SA 1FF9A 3P19A 4H6PA 3RD5A 1TTTA 4F8EA 5DNAA 1K68A 2JJMA 4KGZA 4HXYA 3CKLA 3FB1A 1KR2A 4W5WA 1CNFA 3MWDB 4NCJA 4X84A 1OREA 1P4SA 2IF0A 3DTYA 1NXWA 1SOWA 5TPZD 3TRHA 2OUKA 4YJ3F 3WB1A 5H59A 1ZCZA 1OWNA 3TCXB 2FSGA 4GI3A 1V6SA 1ZM4A 2X14A 3EWSA 3GCWA 4TXJA 4JC5A 4B8YA 1SRQA 3CEMA 1EUCB 1D4FA 3AIMA 3U7GA 3DWIA 1OZ0A 1YZYA 3F5QA 4LMRA 1IQ0A 3PBKA 5ALWA 1IOVA 2BZ0A 3H84A 5CA0B 2ZQ5A 3TQHA 5JMWA 1MAUA 4P82A 4RCVA 1QG6A 1B6GA 3EMDA 2WM2A 2ZE7A 4XI9A 1RBMA 2YJ6A 3I8XA 4D98A 4ZEMA 1JHDA 1RPNA 3BJIC 2H92A 2G5GX 2KW5A 4NS4A 1GWNA 3PUIA 1YVDA 3C6ZA 3U7QB 3NTVA 1U2GC 2A14A 1QVVA 2X5OA 1SKYB 4RH1A 1EPUA 4MI6A 1NASA 2JARA 2ZBFA 4OLHA 1CNMA 1RC0A 1U5BB 1ISJA 3LX5A 1FYDA 3FTEA 3FFXA 1P2TA 3TM5A 4KXWA 4S1PA 2Q8PA 5K3FA 3R6WA 1VHDA 2PV7A 3CX6A 1YZ3A 5ENDA 3EVEA 5FT9A 4HTFB 1Y1TA 1J2RA 2ZXUA 3CNNA 2I7DA 2XNHA 4KNYA 3H9BA 3W2FA 4WNCA 4G9GA 4P8RA 1E5XA 4XX1A 4EFLA 2R7NA 1DKOA 2R9VA 1CUDA 1KY2A 1M1UA 1TUBA 3EIFA 1L4EA 1F2DA 2K2WA 3IAS6 4TRMA 5FL7A 4QXQA 4BFYA 3AGQA 2YV5A 1EAYA 1ZIYA 1JFSA 1L3CA 1ZNXA 3ZBPA 1AUPA 3NJRA 3ZS8A 4R9UC 4M55A 5LDGA 4OJNA 3U9TA 2VDWB 5B4TA 2O23A 3TSAA 5I9TA 2JIPA 5IFLA 4ZCTA 3AHDA 3DPIA 3F4BA 3Q8MA 1SD2A 4WY8A 4ZD6A 4TWJA 2YMPA 1AC5A 3GLHE 1E0AA 6ABPA 1KEPA 2ZIXB 1U7DA 2PZGA 3HP7A 2I66A 1BXZA 3A6KA 1UBRS 3D6JA 1ZLXA 5C1DA 5AK0A 4RTKA 3LHDA 1IUPA 1KEWA 1ZD1A 3ILXA 3DM5A 2LKCA 1EFUA 2PXXA 2JAXA 1THMA 4J91A 5KNDA 3ENKA 1SKUA 1YKSA 2OYCA 3RVKA 4WOJA 3E8XA 2QD2A 4HS4A 4GC5A 2N1MA 3N0XA 5LC1A 3QH4A 3OURA 3O4HA 3CZPA 1XK7A 4NYMR 3LLUA 4Z53A 4GH5A 4QG3A 1RIFA 1ULUA 5JFTA 2CVFA 5DI9A 4MQBA 1QG2A 1SVKA 2C9CA 3NC4A 5TF4A 4MGKR 4AY3A 3ROMA 1UJ4A 5JIBA 5C32A 4LZLA 4ZDWA 3WKBA 3BE4A 2PUGA 4D26A 3ZW8A 1USGA 3KD2A 5F77A 4XPIB 1FB5A 1MJ5A 1RADA 2GH1A 4JT4A 4LOKA 5HFJA 1DKUA 3GA5A 1Z0ZA 2P9JA 3LSTA 5L3SB 3THXB 4KWIA 3CLSC 5JS8A 4HMOA 4INJA 4D8VA 2HQBA 1ENZA 2IPMA 2JBAB 1LDMA 3AHEA 3LDAA 2G0NA 3AZQA 3M6AA 1A9ZA 2HWUA 3HZOA 1SKQA 2LCFA 1P3Y1 1UPAA 1LGYA 1TL7C 2JGNA 3HA3A 3MCTA 3Q7SA 2L19A 2VC2B 3VQTA 4BMZA 4DEXA 4BGVA 1KVQA 4L28A 4QASA 1CY4A 1RE1A 3PF9A 3O8QA 1F5SA 1OUMA 3QWFA 3DVAA 3TIXB 2JVIA 5IM5A 4LFCB 2HMUA 3D7SA 3UHFA 4JI5B 4HAIA 2IXDA 1TJ3A 4IVRA 4JX8A 4RPCA 4MULA 1WNFA 1DT5A 4JMPA 2OQVA 1SUIA 3ZEIA 2W6MA 5FI1B 2CBGA 3Q3IA 1CXZA 4NI5A 2E4WA 3PV0A 3ZU2A 1WDWB 4RIIA 1I36A 4KR0A 2C42A 3KVYA 3G82C 4OJQA 4MUGA 4D56A 4GHWA 1XZPA 4B2PA 4D8WA 1VMKA 1RHQA 4M0KA 1DS6A 2PL9A 2VP4A 3L0IB 1C7JA 1AB6A 2ASVA 2OZPA 1WMBA 2F48A 2X6RA 3JQAA 1JU4A 2G1UA 4RFVA 4WDQA 4MOWA 1GN9A 1ISGA 5BYJA 1XPOA 1NIPA 4K8OA 4UUOA 2EV9A 2VWQA 3SP1A 4C6HA 3G0GA 1HEIA 4DLUA 4YT5A 4EL0A 1EK1A 1ZRMA 3FY4A 1D2MA 1GQ2A 3IPRA 4F06A 3EPJA 1V1RB 4RSHA 3R9KA 1EM8A 2KLHA 4KO1S 1TRHA 2J8ZA 2JA1A 5DLPA 1EGQA 3EDRA 3VR4D 4DLVA 2HT1A 1CF4A 1RI5A 2OZVA 2XQIA 4EA9A 1Y8RB 4LDAA 4YJGA 1TZCA 1HDGO 3FOCA 4EZIA 3BVPA 3C24A 1ECLA 3GAMA 4JJFA 2XQJA 1U7WA 2Q3MA 3CHYA 4KWHA 1MW9X 1JZSA 3IMGA 3JWHA 2EBWA 2JLRA 3U37A 3VNBA 2RD2A 5B2ZA 2FK7A 1AUXA 5IYZA 1G5QA 2A94A 4R81A 4E88A 1BH6A 5BSVA 5T4HA 4UEKA 1FRNA 3OKCA 2OG1A 4HDNB 1L5KA 3X2SA 4KAFA 3E18A 3DLAA 3NP9A 1I3LA 1T2VA 2WHYA 3HR7A 5KO2A 1MC5A 5H70A 1YQ9A 2PWPA 4WOCA 2ONKA 3WS7A 4GX5A 3ESQA 4YHHB 3VUFA 5T8KA 1YA6A 4K1XA 4YP0A 5HW0A 5M2QA 1E3MA 3BDAA 4F2DA 2PIAA 2QVCA 4BWYA 4N5HX 3CH6A 3EJ6A 4IWXA 1F8YA 4L9RA 4C7VA 1AMNA 2VYFA 2WJJA 1N8KA 1KMNA 1WOYA 2QX4A 5LQKA 1JSRA 1E1NA 1FRQA 1K63A 4MVYA 2GHIA 4L27A 5TQVA 2D5CA 4YRGA 2GPAA 1ONBA 1D04A 3M2PA 5GADl 3CRMA 1ZEJA 3RBVA 2WWGA 5JCZA 3DV0B 2VJOA 1FQOA 3OQBA 5F52A 4MP6A 3RKRA 3VZQA 3AEKB 5DHUA 2Z3VA 1G2QA 2C5GA 1BCRA 1RJFA 2GJ9A 2GRAA 1N5RA 2P35A 2XQGA 3GFQA 3N05A 3KZCA 3N8IA 1W0CA 5KTTA 1VPWA 1GGVA 3WDMA 3ABSB 4RPLA 4M1KA 5ELMA 1P62B 4TWBA 3K1YA 3AR2A 1EX9A 4XASA 2F6RA 3H1TA 4KN6A 2BC9A 3A0RB 4R9RA 3BMQB 1PSWA 2BEWB 3U19A 1GRQA 1M2JA 3FVTA 3IJRA 5CHEA 1P4HA 4NMHA 1JS1X 2FZKA 4KQWA 1EFRA 1K2WA 3PPWA 5FWXB 2BM1A 2IKQA 5GZ1A 2D8MA 2VR1A 2VXCA 4KRFA 5HRCA 1T5DX 1EE9A 2C9MA 3CNBA 1ZMTA 3VSBA 1OBFO 3L77A 3R3JA 4BUJA 4B7XA 2NO1A 1WQ1R 4TLAA 2AOVA 2AW5A 2P8JA 4X1IB 4AUEA 3VO2A 4AKSA 1R4MB 1A9TA 2A7XA 2W2KB 3IHTA 4A5SA 5ILOA 4B3TB 2QW1A 1P1KA 4RJ2A 4YAGA 4ZHSA 3JW8A 4KTTE 1YI8A 1Z4LA 1LUAA 2HN9A 2W6ZA 2XVAA 4WKCA 4EJ6A 1GNRA 4EJMA 5T7BA 1WVGA 4N3GA 4H60A 4EIWA 1RI2A 1SB9A 2Z57A 3VU1A 5JFOA 4ZZIA 3ZIAA 1INLA 2GSWA 3T5AA 1XMPA 2DFDA 2ON6A 3HKDA 3K20A 4YP6A 1TA9A 4LOHA 1A9QA 4IXMA 4LY9A 2WWWA 1X1CA 4L1KA 2X15A 2IY9A 1CRLA 2NZJA 2ASEA 1DKRA 1M7HA 1P17A 1X6VA 1KC1A 1YONA 2VT2A 1RWNA 3H4IA 3NZEA 4CM6A 1LC3A 1LFAA 4LIPD 2EBUA 1IY1A 1Z62A 2NXEA 2QR5A 1D5CA 4UJ3A 3ZHQA 4PG4A 3U3ZA 4FR5A 3QTLA 2K2QB 5CVVA 2G67A 3QPBA 3ANMA 1GAWA 1O89A 3H9QA 3PNMA 3EX7C 3ICEA 5BWCA 1EWKA 3FHOA 4M1YA 4UCWA 4PZLA 4B3GA 1GPJA 4UHJA 2FWRA 4Z9BA 3UJ8A 1E9VA 2C94A 4R7TA 2ZUSA 1CZKA 4XWGA 4KLAA 1EXMA 3RARA 3ZWAA 1WY5A 1VBKA 1PR5A 1I80A 1J1ZA 3CONA 3OZDA 1L7XA 1J0BA 2W6ID 2O2DA 4X7BA 4G67A 4G0UA 1WD5A 2QMQA 4HJRA 3STHA 4AJKA 1L5OA 4K9KA 5JSHA 4DT1A 3C1AA 2XMSA 1IB0A 5JAMA 1MP0A 3SYLA 3W2TA 4G65A 2QRHA 2OV3A 3K73O 3NGXA 1NY5A 3AI7A 3JQEA 1A2BA 4H6WA 5JSZB 1UEIA 3U1VA 5KNLA 3PEUA 1Q6YA 3MWKA 4XD7A 2ACWA 2JD2A 2YVAA 4M1ZA 3R8XA 5KSOA 3NX4A 4HFNA 1QE5A 3RK1A 3SBEA 2WOJA 3EIXA 2C99A 1MXFA 1TUBB 3FGOA 4ZEXA 2C78A 2YWXA 3VU3A 2PJUA 4OB6A 4ZU6X 4OD0A 3I92A 3OY2A 3BIFA 2KS6A 1KYXA 4ZOEA 1MA0A 2PR2A 2QOEA 4JJ7A 3DZHA 3BHMA 1A8IA 3W2EA 2H11A 1AF4A 1AIPA 3ZZUA 3TR0A 1JR3E 1DE0A 2YIMA 3H5RA 3C7DB 2V55B 3C3WA 1VHQA 1U9CA 4E0BA 4QAJA 2OGZA 2R8XA 5CFPA 4X92A 3D2BA 4D3ZA 4RXMA 4DR3B 1N1DA 3HMQA 4IQFA 3TTUA 4TUYA 1OFUX 3G8AA 3RFXA 1RHMA 2CL6X 2ZYUX 4GL2A 3HBJA 3F5FA 1I4WA 2OKGA 3DBIA 3UJDA 1LBEA 1L7OA 3VVBA 1AZLA 4R1PA 1P0QA 2E89A 3KM0A 1BD4A 3RJ9A 4CDMA 2JGDA 2VHZA 4JSYA 1DX6A 4QU0A 1GYPA 1Z2CA 2X7HA 3AVVA 1JF8A 1UJNA 3N2LA 4R2JA 5AJHA 1V26A 1Q7CA 4QULA 2HRRA 4MS1B 1M33A 2I4MA 2VF4X 4I81A 3MILA 4YMSA 2E6UX 4MDYA 4FJ2A 4WE3A 1DPGA 5KOHA 3U7IA 4MJ3A 4UHKA 1CJVC 5IBQA 4B5KA 1EKXA 3CZ5A 5KHAA 1JEQA 3X1MA 3GEGA 3MK31 2C9ZA 3BCSA 1LBHA 5IUKC 1TYBE 1XLWA 1JLSA 1QAQA 2IJGX 5L45A 2GFHA 3CBGA 1ZXBA 2Z6UA 4TZ0A 4Z8XA 1RQLA 2WHQA 1O95A 1VE1A 2QQ0A 2KWIA 1EIWA 1BMDA 2OORA 3WMWA 1F6BA 2GAJA 2WNHA 3DVAB 3N7AA 4N3NA 4R40A 5J1TB 5B1SA 5BSUA 3UMCA 3LWZA 3JCZA 4IKOA 3W9UA 2GTHA 1V9CA 2ZUCA 3B51X 3CM0A 1M0TA 1QIMA 4MCJA 4KPFC 3H8SA 2G40A 4DQKA 1T4CA 1MABA 2QP9X 4DIUA 2G83A 1VG8A 3W5DA 1CLEA 3H11A 3U5ZB 4E21A 4MVJD 1ZL0A 3ZHVA 4Z1MA 4C7OA 1C3EA 1KMMA 1QVRA 1XQ9A 2JRCA 3H9EO 1QU2A 1P2SA 3WLQA 2RHHA 3MLBA 4DE5A 4D0SA 1D4AA 5FBQB 5ITWA 1Z0KA 3E5HA 2ZI7A 1SVWA 4BWGA 2Z8YA 4UFNA 2A9FA 3EAFA 1Z5OA 2QD4A 3JQAB 1BYIA 1EGMB 3ZV4A 4GWLA 4Y2VA 3TVDA 2PLAA 4I3GA 4X45A 1E6LA 5HWSA 3ESBA 3IP9A 2Z2YA 4ABTA 2B3DA 2N46A 4ZIRA 2W58A 3DTTA 3GEIA 2PKYX 3UT5A 3MB5A 1CR4A 5HBRA 3HXOA 1JHQA 2GYYA 3A4NA 3MB8A 3KQVA 4HDAA 4MAAA 4BFVA 4A15A 1Z06A 1AGNA 3HDVA 4YJGB 4ZDIA 5K51A 5IM4A 1CJSA 2OCGA 1J8DA 3PDWA 4G1MB 3NEPX 2WOOA 1JB1A 2BW0A 3AH8A 4RA6A 3GGJA 1NSFA 1HUQA 3NNDA 3PITA 1QK3A 5EE1A 3ECSA 3ITDA 4J3JA 3OJFA 4L78A 4C43A 2HMSA 2OXCA 2RGRA 1GILA 3HBMA 3QLTA 1GUAA 4G0NA 4GYYA 2JIZD 4KX5A 5FUYA 2V4MA 2MDTA 4JBLA 4XGNA 5KJFA 1G19A 3GT4A 1TYDE 5FOQA 2BUBA 1PL6A 1PJBA 2YZ2A 1CJMA 3F6PA 3TMAA 3H83A 1V7CA 1DTEA 2R87A 5DP1A 1LPPA 3L1UA 5HIJA 4QBTA 4YRRA 4O59O 2A9JA 5TPWA 3QQPA 1NI5A 3P2OA 4DBZA 4DW8A 4EHKA 5E6UB 2JCBA 4CR6A 2IEGA 2B5WA 3UKOA 1P72A 3TB6A 5JJLA 1LPSA 5JNVA 2R47A 3MHTA 4MA4A 2L2QA 5B4VA 3PIRA 3ND5A 1XLVA 2Z6QA 5D87A 3FVWA 4JJ8A 5EFOA 2EARA 2O0JA 1CS0B 5EIHA 2UZ0A 1JIVA 4NYIQ 4Q16A 2CWDA 4G36A 1NMXA 4YCDA 3D5EA 1JLLB 3OLWA 4MA5A 5BV1A 2AHRA 2PIDA 4L8GA 1BCRB 1DUIA 3HZRA 3S1SA 3C6BA 4MRVA 5ALJA 1ZCFA 4ZP1A 3RC2A 3BWBA 4WIAA 3WB2A 1MW8X 2P4QA 3VZBA 1QV9A 5FTMA 2HQOA 4BB9A 1HM5A 4YJ2A 1LDNA 2FZLA 4WUVA 2Y0EA 1JKJA 1NMSA 4EHAA 3OLQA 2RAVA 3H8WA 1OROA 1U3CA 3QSGA 1E9FA 3FR8A 2VA9A 3WGQA 2IKSA 3H19A 4MDHA 4P4GA 1KP9A 3DEJA 1QAMA 1XTPA 2G08A 1U1CA 1W34A 4X1YB 3DZFA 1KDOA 4L5AA 5LNK6 4IS2A 5KWVA 1JE1A 1SIOA 1Y89A 2JRLA 3ORSA 4XB1A 4Y2XA 2A1IA 4MRAA 4OM7A 5G0SA 3ZE2B 1SZJG 3B6ZA 3JYPA 1Z3IX 4YPFA 2B8WA 2OC4A 5C5EA 3I6QA 1CZUA 3JQ9C 5F5XA 1II9A 1PDVA 1HNWB 1EVJA 2TMKA 1AKWA 2FE1A 3FPKA 3QE0A 4NY1A 2ZAIA 4PR3A 3V7FA 3WLNA 4AK9A 3IT2A 4PC6A 2OESA 2V96A 5HRUA 1IAVA 1ODLA 3FDJA 4KQ9A 4MGZR 1NAIA 4P53A 2DLDA 1D6JA 2XVZA 3I1FA 2HX1A 3RRJA 3H2KA 2UYQA 1MTZA 4LZPA 3S28A 3KOXA 5ERYA 4JD5A 4ALJA 1Y1QA 3HKEA 1RDFA 2C4MA 4WL0A 4C78A 1ND6A 2VDUE 3PWKA 4ZVQA 2YWCA 4W1PA 3DHWC 4PWYA 1KIMA 3ZY2A 2V7TA 2ZE5A 5TQJA 4ZOLA 5TMPA 2E49A 3C5CA 3UMJA 5BSFA 1C30A 5CFLA 4ZU1X 1K2VN 2WBLC 3G89A 4QQNA 4YBRA 2ATVA 4DJFC 3WZLA 3RNLA 1VJTA 4C9BA 5DGHA 3WQQA 3PJRA 2HD4A 2Q9AA 1MNQA 1GZ5A 4UKDA 2WUDA 2CJPA 2L42A 2GPTA 1ENPA 3K2IA 5AW7A 4AG6A 1L8OA 4F96A 4X0EA 3PS9A 2JEZA 4M37A 1K08A 1GRVA 2W6IA 4FMCF 4K6FA 5ES3A 5JUWA 1IC6A 5D3MA 1ECJA 4TWAA 2PL5A 2DZDA 3D7MA 2HPAA 3K32A 1YFZA 4QBFA 1P4RA 3RAPR 5BV8A 4K88A 4DCSA 1TVKA 3U16A 4Q1FA 4DT1B 2PPLA 5C7LO 4UU0A 1EXDA 1V47A 2BR3A 5HS4A 4A82A 3LAWA 5FUBA 2IYWA 4DMMA 2PXAA 2WP0A 3RAGA 3W4JA 2DH6A 3VJRA 2CLMB 5YASA 3BG5A 3T94A 2BGWA 3LBAA 4O4IF 3ZY6A 4YRIA 1YI1A 2C4WA 1E9RA 1Q16A 4G0QA 4HDMA 7MDHA 2AFHE 1EP3B 1YL5A 2J7PA 2WKPA 2ZBDA 5HDBB 3TD6A 1NN5A 4MR8B 4P98A 4GG1A 2KLBA 1XA0A 2IRWA 5F35A 4QOEA 3ER8A 3NM4A 4F6RA 2NZ8A 3OF5A 2IV2X 3O4FA 2XDQA 1EVLA 1HE2A 1KOFA 5K5EA 1LJUA 1IVYA 3KX2A 3HJCA 4XJVA 2AWNA 4D7AA 1K7FB 3MBOA 1JR2A 3ITNA 2XHZA 1QH9A 2VG8A 3NV7A 4MAFA 1YKFA 2VXYA 2NV2B 3K4HA 3OA2A 2A5YB 4ENSA 3QVVA 1XZMA 3C7AA 3WWPA 4EHHA 2AN5A 3L5KA 4V0ME 3WGKA 3CIOA 4XVRA 2JLSA 2P9CA 5FOSA 4YVFA 1NRXA 1ZIPA 1IIRA 4Q9NA 4PQRA 5CVJA 3WMGA 3ER6A 5ALOA 4HNSA 1MB4A 1KDZA 2BGJA 3V1UA 4IYRA 1E0KA 3EPPA 4EB6A 3WX0A 3ZZMA 4KPEC 1VE5A 1FNDA 1MXHA 1U3TA 2AIRA 3GRZA 5KSWB 5EZ6B 5CIWA 2HQRA 1AZWA 5HKOA 4DR2B 3KLPX 5U4QA 3OZBA 4BX2A 4NU0A 2JGDB 3HCFA 4FCTA 2D8AA 2GWRA 2Z8ZA 1BN7A 5IJXA 1YS4A 3I01A 5BYKA 3IBYA 3TLEA 1VP9A 3E3MA 3I5UA 1RFGE 1RPZA 1Z0SA 2VK4A 4K9DA 4J0IA 1BO6A 3DL4A 5AO9A 1Y80A 5F5LA 5ITZB 2Z4RA 3DWGA 1QFYA 4RDXA 1NL3A 1E5QA 3BN3A 5KOHB 1FQKA 5KC8A 2VKQA 3LYLA 1PX2A 1JEQB 4DOMA 1KP3A 2P2NA 3AUXA 5FAXA 5AVTA 1EWTA 4WXRA 3QVLA 1LV8A 5LQDA 1FNMA 5I9NA 5KNCH 1R8XA 3H99A 3IVMA 1E2KA 1ZXXA 3B1XA 3OUTA 2YW9A 3HU2A 2ZTSA 4ISCA 1GM5A 1CIJA 3DVSX 4KQIA 4US0R 3AIOA 2AK3A 5KWJA 1OPRA 1VL2A 1F0NA 2GFQA 2P4SA 4B4KA 3GRKA 3T3DA 4JJIA 4ZT7A 3V8VA 4F84A 4FB5A 1VTKA 1TQHA 3ZDEA 5C34B 1RBZA 2XCRB 1QTRA 3HWSA 2B2CA 3WISA 5EMHA 4M83A 1MABB 4MUIA 2RI0A 3QNMA 4RK4A 5B57C 1YAJA 1J0AA 1D0SA 1FSFA 1HSZA 1NVXQ 1IOZA 2QROA 3H11B 5G3YA 5K3BA 2F62A 3IILA 4YMWA 4S35A 4K3UA 1QO0D 2J6IA 2WIFA 1W87A 2AFIE 1T1IA 2BGIA 3VR5H 4CIBA 1HDCA 4WKPA 4G4SP 3COSA 4G0PA 5GJVC 1CQWA 4AXXA 2QP4A 4BMNA 4FBGA 5BWMA 1JAXA 1R0XA 2P9GA 3KBOA 4CQJA 5LZ9A 3E5MA 1ZRHA 4KQJA 4CRWB 1R0KA 4UAJA 3HDGA 3QLVC 3L0DA 4TKVA 2AUTA 3E9CA 4RSMA 4KH0A 3UUGA 2X8JA 4G09A 4D9KA 3ITEA 3C43A 4M6WA 2NO5A 1IM2A 4FT2A 4IKEA 4OGGA 2EJWA 3UT5B 4DMRA 4JI7B 1XKTA 2QVXX 2XMZA 4BDSA 1UWCA 1UH5A 3GLUA 3GCGA 3VR2D 2GZ2A 1XG5A 4D25A 1PT6A 2IGBA 1OR8A 2XYVA 2IS6A 3H7AA 3M33A 3O4IA 5M34A 3ADOA 1AS3A 1XOIA 2JIZA 4MKXA 3TLXA 3MINA 1SVSA 2R5WA 2WYOA 3M5PA 1UBUS 3X1DA 5KKAA 1PJ4A 2PFSA 3AB3A 4FSHA 3TQRA 2JCSA 1ECGA 2L18A 2F1IA 4NHEA 1URPA 4ARIA 3FB4A 2YMMA 4TT8A 4BNWA 1JI3A 3UZUA 2VXBA 2R7MA 2ZDQA 5IWCA 2FN3A 3QVWA 3MTIA 5EXDA 1LNQA 4CFSA 1TDJA 2HO5A 3ND7A 3WGHA 1SHLA 3EXG1 3Q7QA 3HB5X 4TVKA 1IWOA 2CDBA 1VL8A 5TPWB 1YZGA 1IEVA 3VNVA 4TLDA 5BNZA 1EDDA 2PGIA 4OAQA 1BDBA 3G5LA 5DRTA 5GONA 1T2DA 4J0KA 5H3HA 5JY1A 1XZEA 3QUSA 2ZRLA 2FFHA 1O9GA 3KDPA 5M5BA 5HUJA 1EFCA 5LB2A 4DS3A 1WHSA 5IAEA 5KVVA 1OVGA 1PWYE 3LY8A 1B14A 4FTWA 3U48A 3VZPA 3WYEA 4Z4HA 1PFKA 1VECA 3B9BA 4S0XA 3PX7A 4DDMA 4QFBA 4F93B 4QUBA 1BFUA 3QMVA 2ZB4A 1FXUA 2QN6A 1FTSA 3GCXA 1LZKA 2ZCVA 3SE0A 4YJ2B 1F9AA 1I6WA 2CFRA 2NM0A 2Q9CA 1NI4A 1JKJB 3R3SA 5CFMA 1JH8A 1MO4A 2QP3A 4DWOA 2OHIA 4AN1A 2WWYA 3R3YA 2R1TB 4KDCA 4QPNA 4PO1A 2CMKA 4DCNA 1T8PA 3F1KA 3SM9A 2YOGA 2VKTA 4K0KB 1TCUA 5HIIA 2W70A 1YR9A 1WXXA 1DKPA 1WABA 3B7PA 4RMJA 4XWOA 1UP7A 5IN4A 1JUDA 1TC2A 3OTHA 4HLCA 2JZOA 4LF7B 4TTRA 2IOHA 1OFTA 3AL0C 3TS1A 3H97A 3G7NA 1EK5A 2H2AA 1AT1A 3GZ4A 4LYGA 5EMNA 1VDMA 1KETA 3B2EA 3GMDA 4KCGA 3WYNA 2QM3A 1TECE 4BVLA 4DIEA 1WB6A 3WHIA 1DJPA 4G9EA 1LX6A 5LMZA 2PRSA 1XBTA 3P97A 3HO8A 5H9WA 1Z4IA 1ZONA 2WMYA 2XJ9A 3E9NA 1R15A 3GFSA 3IBTA 4YYEA 3ED5A 4YUWA 5BP7A 1AN0A 1NF3A 2ZVQX 1UPXA 1T3HA 4L6CA 1VGRA 4BV2A 1L6IA 1WA5A 1NJSA 4MWEA 4PZ9A 1XPUA 5FTLA 3SKYA 1L7RA 1XTJA 1KYZA 4TQAA 3QK7A 4YRCA 1DBQA 3KQTA 1M2OB 3ND6A 4ZOLB 4UBOA 4Q01A 2WHRA 3W3AD 3RS7A 1E2HA 4CLXA 1I33A 2CLDX 2DPGA 3JQFA 2C8VA 4FGJA 3F1LA 3OO1A 2EC5A 8ADHA 2OCPA 4WNIA 2V5VA 1ULAA 2QTMA 1W2GA 1DAGA 2H0RA 2ZVDA 2AYXA 1E7SA 3L8DA 3OJEA 4KRYA 4V03A 1WEKA 2I7CA 1ZP6A 3M6UA 3GCZA 1MLDA 3T7JA 2FMFA 1LY1A 1FYXA 3JQGA 1RNLA 4E2YA 1UIRA 4NNJA 5D3MB 1IDOA 3LMKA 4JI3B 1OIWA 1I2DA 4JLBA 5THXA 2WHXA 4EI7A 5HUQA 1DCTA 1L7QA 3T0GA 3CPEA 2V7WA 2P2GA 1YQDA 3A9TA 2IP1A 4X54A 4QDZA 1GAEO 3ZGNA 5IG2A 5GVSA 5IAOA 2LDXA 1OT3A 4RDCA 2ADMA 4IQ4A 4RTQA 4E5MA 1MG5A 1D1SA 2DF8A 2QENA 4TGLA 2SCUA 3G2JA 4M98A 5AFSA 1SIWA 5BUZA 4EFNA 5KYTA 4C07A 4YMGA 3K35A 3LFUA 3LRTA 1FFSA 2XZLA 3G5UA 4KO3S 5L3VA 2DULA 5IH3A 1VB5A 2QZPA 4QO8A 5KTOA 3WKCA 4MKFA 1ZS9A 4F6RB 3OBBA 5L3QA 1IN6A 2IEAA 4BFXA 3AM1A 2R6ZA 2XDQB 1Q91A 4XM2A 1FYVA 3W7BA 1N2CE 4C01A 5B3JC 5LYYA 1AQ6A 1WKBA 4J1TC 2YFKA 2A0KA 5T6BA 3RVMA 3K9LA 2YS6A 1GPDG 1OC4A 3AUAA 1PN3A 3LBFA 1Q11A 3OM9A 4GOKA 4I0WB 4MUYA 4YJKA 3V1TC 1NZJA 1KK2A 2NXCA 4ZVPA 5ICEA 5IASA 5EL0A 4ZRMA 3L06A 3HA2A 2GN9A 2HF2A 2CMHA 2CLIB 2X8AA 2RAPA 5JI2E 4N40A 2C1EA 4KVGA 1Y4UA 3EBLA 2QN2A 3CGGA 4GRDA 3WVNA 4EB6B 4ENPA 3VKUA 2V54A 4DGQA 1BJRE 3Q8WA 3UUFA 1MJGM 2DQ4A 4AP6A 1RACA 3DUFA 4Z0HO 4YMHA 1PT7A 1C3XA 2RI1A 5TARA 4ZT4A 1DWOA 4X93A 3LKZA 1I4DD 1RMQA 2Q07A 5IK2A 1G6HA 4Y9TA 4L5JA 4F5DA 4YECA 1UMDA 4NFSA 2DECA 4E30A 2GAFA 4YRJA 3GEMA 5J2TA 3CNOA 4C14A 5G4LA 2FUG1 5AIAA 5JD3A 4QYSA 1C7QA 2PUWA 3JV7A 4KKXB 3UT0A 5CCXA 2QSZA 3NASA 3JQBA 3KPWA 3U44A 2IITA 2G9NA 5KYXB 3AO0B 1KJIA 2NACA 4NARA 3IXLA 1AN9A 2J0QA 4LUCA 2I4NA 3SX2A 4IRUB 2ODNA 2PWAA 2VJBA 1P5JA 2VYNA 3QGMA 1RHKA 3HDHA 4M46A 4JQSA 5ITSA 1T2CA 4IIBA 3S2YA 1PT9A 4TKLA 3O31A 3CUTA 3WTBA 2ZBPA 1EK0A 1T35A 2E5WA 2SKCA 1RT9A 1XP8A 3KVRA 1NMEA 4M1EA 4KDEA 5CRIA 5ALZA 5EJEA 4PINA 1KSGA 3QKUA 4IV5A 4MQFB 2WTXA 2WUWE 4YRAA 1TM3E 5AR1A 2G1AA 5DZSA 4QGSA 3KQLA 3GJRA 5AP9A 3MTJA 2RHRA 2YNMD 1XRSB 3ESDA 1EXNA 1DC3A 3FYUB 4M8LA 1BDMA 3HEBA 3TLGA 3U1TA 2IX3A 2RKOA 4B7CA 1R4NA 3KRTA 1WEHA 2Z9DA 2G1JA 4KIJA 4QIHA 4ZOBA 5FORA 3RYIA 3SC6A 2QLTA 1GDTA 3HK2A 4R16A 2VJKA 3AMVA 2AOWA 4GZMA 2BMEA 2RGEA 1CTQA 2PH3A 3HBAA 1IWBB 3L2OB 3N3AC 3AUYA 3W05A 2FE4A 2KM1A 1GZVA 1RP1A 1VE7A 3MJFA 2ZSEA 4N5LA 1NXSA 3PYXA 2CXTA 3A05A 4H3VA 4YJFB 4HNAA 4GRIA 3LCMA 2QE6A 2GDZA 2SICE 4BFTA 3S7TA 1BHO1 1RRGA 3GG2A 4OREX 3R7NA 3V6LA 4IQGA 3LH5A 2Y92A 1F12A 2PWZA 3AKYA 3L07A 3CZMA