3R7SA

Crystal structure of apo caspase2
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
159
structure length
159
Chain Sequence
MQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and enzymatic insights into caspase-2 protein substrate recognition and catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Caspase-2 subunit p18
total genus 50
structure length 159
sequence length 159
chains with identical sequence C
ec nomenclature ec 3.4.22.55: Caspase-2.
pdb deposition date 2011-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r7sA00
3V6MA 4LSZA 4M9RA 4ZVTA 4EHFA 2K7ZA 2H4YA 4AWBA 3D6HA 2H51A 3V3KA 4DCOA 5K20A 5IAKA 3R5KA 3UOAB 2XZDA 5I9BA 1CVRA 5LUAA 3K7EA 2CDRA 1RHKA 1PAUA 2QLJA 4IEFB 5IARA 3SIPA 1SC1A 3S70A 4QTXA 1M72A 3D6MA 5LU8A 3BIJA 4QU9A 4PRYA 5IC4A 4NBNA 1RWKA 4QUDA 1NMSA 4PS0A 1QTNA 4D3ZA 1RWOA 4ZVUA 2XZTA 4DCJA 1PYOA 1ICEA 2H5IA 3NS7A 3PD1A 4D3YA 4QUBA 4EHKA 4EJFA 4QUEA 2CNLA 4JQZA 4EHNA 5JFTA 1SC3A 3H1PA 4N5DA 2CNOA 3EDQA 3KJNA 3RJMA 1GQFA 3GJSA 4NBLA 5IAEA 3V4OA 3P4UA 5IABA 3V4LA 2H5JA 4I1RA 5IAJA 3DEKA 2HBZA 1F9EA 2FQQA 2H48A 3DEJA 4JR1A 1F1JA 5IBPA 3SIRA 4D3XA 3H11A 1RWWA 2CJXA 4FDLA 1NMQA 4PS1A 2HBQA 2CNNA 2AR9A 2Y1LA 4NOMA 2C1EA 1I4EB 1QX3A 3R7SA 2HBYA 1RWMA 5I9TA 1RWVA 3OD5A 4QU8A 4HQ0A 4IYRA 4JJ7A 2C2OA 1RE1A 4N6NA 2QL9A 4QTYA 5LUBA 5IAGA 1RHQA 5IASA 3V55A 1I4OA 3GJRA 2XYHA 2QL5A 4NOJA 4FXOA 4DCPA 5IBCA 4JQYA 3S8EA 4PRZA 1RWXA 2NN3C 2C2KA 5IBRA 2DKOA 2J32A 3KJQA 4EHLA 5LU9A 3QNWA 4I1PA 4N7MA 1RHRA 1SHJA 4NOKA 3V6LA 3GJTA 2FUNB 1QDUA 2H4WA 5H0IA 1I51A 4QULA 2QLBA 2CJYA 3H0EA 2FP3A 3R7NA 3EDRA 4EHHA 1K88A 2CNKA 2QL7A 3DEHA 4NBKA 1RWNA 2H54A 1SC4A 4EHAA 4AWAA 3R5JA 2J31A 1I3OA 2QLFA 3KJFA 2Y0BA 4JB8A 4QUHA 4HQRA 4ZVSA 3DEIA 2P2CA 5IC6A 1KMCA 2C2ZA 2J33A 2XYGA 3IBFA 1BMQA 4QUIA 2HBRA 3R6LA 4HVAA 4QU0A 4QU5A 3NKFA 2J30A 3ITNA 4ZVPA 4N6GA 3R7BA 1RHMA 3PD0A 2WDPA 3H13A 4N6OA 1RHJA 1JXQA 4ZVRA 4FGUA 3PCXA 4NOLA 1GFWA 3UO8B 2H65A 1CP3A 1RHUA 3IBCA 4QUJA 1NMEA 3R6GA 4JR2A 4QUGA 4JR0A 1K86A 4FEAA 4N7JA 5IANA 4EHDA 1SHLA 1IBCA 3GJQA 3P45A 4JJ8A 2XYPA 4ZVOA 4ZVQA 4AW9A 1RWPA 1NW9B 2C2MA 3H11B 4QUAA 3D6FA 3E4CA 4JJEA 3NR2A
chains in the Genus database with same CATH superfamily
5C1OA 2H1WA 3VBEA 1ZCFA 1ZU4A 1W5BA 2HJVA 2MDTA 5G40A 1M1YE 4TSKA 4F8YA 5HQ3A 3WAGA 3O2NA 2WKWA 5HK9A 3O8LA 2W43A 4JIGA 1V16B 3P2MA 2XNKA 4O63O 3KWFA 4R1LA 3OPYI 4RY0A 5EHXA 2FN9A 4FILA 4IIJB 3NKVA 2B0JA 2Q46A 2ZUUA 4YEDA 1Z7GA 5EFOA 2C61A 2DTXA 1DAFA 3WIUA 3FFAA 2RONA 2E5LB 1BVHA 1THMA 1G63A 4PM4A 3RLIA 4B7XA 5JH7B 1EAMA 4ALLA 2QNBA 3D43A 3D7KA 1IM2A 3DT8A 3HI4A 5CK5A 3EDCA 1EP2B 3KLNA 3D3JA 3IALA 1DRVA 1GR0A 2YJTD 5BQFA 4RVNA 1C7EA 3RFFA 1LLFA 3U9TA 1NC3A 1NW4A 2FZWA 1GCIA 3V2IA 3TKYA 3NHZA 5JAPA 1F0NA 2Q3MA 1E6CA 3FBGA 4Q7EA 3L82B 4ZVNA 4UE2A 1U2PA 3F3KA 4ROSA 4K9NA 1G3QA 2I8AA 4BFZA 5F1KA 3X1WA 1DV2A 2E9SA 5HJ7A 5AVVA 3HV0A 2FEKA 4QNRA 4N41A 5KYUB 2XMRA 1VA4A 3EF0A 3OZBA 3Q7SA 3Q6MA 4BZWA 1WEHA 1K6EA 3FKSA 4MV1A 1ISGA 3BG5A 3GFTA 3GUVA 3R3JA 4AG5A 2EBUA 4EUSA 1DJLA 4C6TB 2RI1A 3MA0A 2BF7A 1NJ1A 4OATA 4AD8A 3GU3A 4AS2A 3FA2A 4XSGA 5ITVA 3OZGA 2JLWA 3FMFA 4RUKA 3MB8A 4IUYA 3N3BC 4KV9A 3UJBA 1V7ZA 2ABWA 2HV9A 5LM3A 1QH1B 3MM4A 2I6TA 1XLWA 3EGWA 4EUKA 2XVZA 1M8GA 1XPOA 3FR7A 4FFSA 3SD7A 4EA9A 1SBCA 3RRNA 2ODNA 4CDRA 3HBLA 1Q95A 3ZIDA 5IKEA 2AFHB 2O6LA 3CT6A 1VHQA 1CJUC 1JIKA 4G09A 1JRLA 4FC6A 1DC4A 1BGVA 1XRRA 3KTAA 4LC0A 4YREA 1MGOA 2X4IA 3E8XA 3WO0A 5AKJA 1IB6A 1ZUD1 4C0QC 1X2BA 2WPNA 2VT3A 3IDQA 2YZ2A 1MO5A 3JAKB 5K3AA 4DMGA 1OAAA 3TGPA 3D7SA 1DQPA 3A2MA 1G20A 2VDLB 3I58A 3H6KA 5JG7A 2B7LA 3W7BA 4ZT4A 3ZHZA 4Z54A 5LOVA 3CLTC 2A7QA 3H3JA 4DSAA 3B5JA 5DGTA 2NVUA 3VTFA 1QUFA 1SOAA 4UBLA 3W0LB 3ZYCA 2ZUEA 1MH1A 1KMCA 1MX1A 2AX4A 1KSJA 4HGYA 1RYMA 2ADOA 5H5JA 2FPMA 2HM7A 1QJ4A 2QUHA 4JJ4A 4BVGA 1UBTS 1IHDA 2DPGA 4IG4A 1XU4A 4CE6A 3VU9A 2NOAA 4UOZA 4IBOA 4OBXA 3A7EA 4DDUA 1XX6A 1W47A 2OBLA 1QZUA 1NVFA 2W6ID 3DEAA 4NJEB 3SM3A 4BFYA 5CDGA 2C57A 3ABIA 2BZ1A 4ENWA 1K86A 2QV0A 1HKUA 2IEAA 4ZVOA 1QO0D 2HAEA 3K1TA 4Y2RA 4AKEA 2BJHA 2AV6A 2WA1A 5KB3A 1N5JA 1SXQA 4IQFA 4Q4JB 4BV8A 5FPHA 4G1EB 1BX0A 4G1MB 2XXAA 1S5PA 3H05A 3LCRA 2WFLB 1K3TA 1XA0A 3JQRA 3CISA 3LPCA 4G41A 4KDEA 2HT1A 2BGGA 1CP2A 4NMMA 5LNK6 4Q00A 1NSYA 1FTQA 3BXHA 1DX6A 1EFCA 4PCAA 2QX8A 4BECA 4MWGA 5IAKA 1HZZC 3UOAB 3P2OA 4OREX 3V3TA 4LZLA 3WGOA 5AICA 3WIOA 5A03A 1SXJD 3MFQA 4NMHA 5E1DA 4E2FA 2B2CA 3GRCA 5ER6A 1RMQA 4LXGA 4B2LA 2PH5A 1HT1E 1ZA1A 1VZ2A 2WF8A 3O0TA 1Q50A 2B9VA 2HHAA 4NYMQ 2AOUA 2V59A 3ZZMA 1B6GA 4JLAA 4N7RA 4BO8A 4CKBB 4IILA 3DD5A 5KWIA 3HJFA 3R9XB 1NVKA 2COKA 1VHDA 3NWJA 3U7GA 1R2QA 4JL5A 3LU1A 1YVUA 4P7KA 3AUKA 1I4DD 1JUDA 2VRCD 1UM9B 4G3XA 1GRCA 3NVMB 3G59A 1NU8A 4B34A 4JSYA 2C54A 4RHEA 3CSDA 4G5XA 2R6FA 2J5QA 2QR3A 3W05A 5AOVA 3W2GA 1W9HA 3HABA 2IOQA 4ENTA 3E8SA 2DC1A 3O8BA 5LL6P 2HBZA 4R05A 4WXMA 2LGJA 1AMUA 3M9LA 3SC2B 3K92A 4IJMA 3HG7A 5FDFA 2QI9F 4MS1A 5G1OA 3QXCA 3QPAA 4CL2A 1AGRA 1Z08A 3GN1A 4LJ7A 3OURA 4G1VA 4BFUA 4LV6A 1UWVA 1JYSA 4LGMA 2LCIA 5B6PA 3A04A 1I94B 4O29A 3KSDO 3L9WA 2ZIEA 1ZL0A 1V9LA 1SEVA 1HGXA 5HM6A 2O6HA 2JAHA 3V8EA 1NY6A 2N47A 4H4DA 4XH9B 3AXSA 4O4JA 3BDAA 2JJ2D 3BYZA 4G0ZA 2NZWA 1JQBA 2V0NA 5E38A 5CIQA 5IBRA 2JD2A 1U3UA 2I0FA 5F33A 1K7SN 2Z58A 4IHJA 4ER6A 2O52A 4RJIA 2HA6A 3K5PA 2DM6A 2BY4A 4URWR 2NUTB 4DL9A 5U4XA 1KEEA 2N0SA 1D8TA 1B1CA 3HCOA 2OV6A 3PJEA 2Q2OA 2V58A 2F9LA 4HY3A 5I9MA 3V4SA 4IGEA 2MTBA 2VBIA 4MCIA 4C7KA 1Z4PX 1PNTA 2Q4BA 1L4GA 4H0CA 1VKZA 2VPPA 2HA0A 2J5XA 2YV1A 3WGVA 4S1TA 1QRUA 1TD9A 5KUTA 1QP4A 1RI1A 1WF6A 4NCIA 4JLMA 5IJ9A 1JDUA 1DADA 3V1UA 1CKEA 2AI1A 3KQUA 2DBVO 2CLLB 3KSZO 5ICGA 4M54A 1XQVA 2WTEA 1U0SY 4QQNA 1O96B 3OX4A 2I4MA 3CE9A 4HB0A 4OJKA 1RXWA 1V3UA 4A7PA 1JXQA 4GYWA 3IAUA 3WP0A 1KETA 1I3MA 5AFSA 4I5IA 4TXJA 1ZHHA 1UBCA 3PQ6A 3FMIA 4LAFA 4GMDA 2DTDA 1OXMA 4E6PA 4JJ8A 4AG6A 1XJ5A 3OMWA 3FZYA 3I4FA 3LY8A 5CB4B 2WSMA 5JWRA 1YVRA 5JPIA 3PG5A 3VTZA 3DOIA 1BFUA 1I6LA 4CM5A 4DMMA 5EJ6A 1N8TA 2FR8A 2FUG6 3MTDA 3OJWA 4ROTA 2GVNA 1EVIA 2Y0EA 1YIOA 1E0KA 1SK9A 4K8OA 4MAAA 4MP8A 4QDTA 5SZKB 3SYNA 4NCXA 4WQMA 1DTSA 4COOA 2W6ZA 1XL1A 4HJXA 1RLIA 2VNIA 3L7MA 4HUQB 2ZFUA 1MQ9A 3HUDA 1UQRA 2BKAA 3IGFA 4F21A 2DBZA 3LY5A 1FS5A 3CX3A 4INZA 3IE1A 1RC8A 2XVYA 1HDIA 1RYHA 1Z5OA 3PUYA 2J6CA 5LMUB 1NJ5A 3S70A 3CLUC 5FWYA 2WJJA 3KT0A 3RRMA 1YUMA 3TZBA 2YCBA 4NAHA 4FB4A 1AHIA 4G23A 2ZUTA 4BNDB 5TJ9A 1RQXA 5EIEA 1QTNA 5JSZB 2XQJA 4IJUA 3RFVA 1MUUA 3UMCA 1ID8A 1UKZA 3RTEA 4TTQA 3TJMA 2ECKA 3VNUA 1GSHA 5FUBA 3OY2A 4Y9SA 3WLSA 4RFLA 5KOIA 2JW5A 4O8CA 1TIKA 4U7PB 8ABPA 2CY0A 2OZLB 5B7NA 3HK2A 2FH5B 3O8NA 1ODTC 4O0MA 1TLFA 2B1QA 3KUKA 4FMCB 4OK5A 1U6JA 3PQ8A 4Y67A 1MQAA 3RBZA 2Q6LA 1JKFA 1QB7A 4QEDA 3EVEA 1WXGA 4B33A 5BV0A 2BFOA 1AKNA 1EX7A 9ATCA 2Y1LA 2YTZA 1H2RS 4NJOA 4XQ9A 1YA4A 3OEWA 4D8XA 2ZBFA 1QKIA 4FQ7A 4LTNA 3QYJA 3PPWA 1RZRA 2GPTA 2IH4A 2AN3A 1USWA 1KH2A 4JB2A 4X0EA 1QCZA 5JD6A 4IOLA 3SI7A 3UHAA 4CDMA 4QPJC 1WQ4A 3PLAE 1AQLA 1TVMA 3WSTA 5IEJA 1NT4A 4LRYA 3ZY2A 2SCUB 3K9WA 4EBFA 2R8OA 4UAJA 4O02B 4EY8A 1KOJA 1Z5VA 4RSHA 2ZB2A 1QHHB 3EXHA 3P9RA 1O77A 1T2FA 2WIDA 5DT9A 5IN4A 2HQOA 1B43A 4G0PA 3LQ2A 4ND8B 4RVOA 3UJNA 1E1NA 1L3IA 1NV9A 2X19A 3H9GA 1IIBA 3T9CA 4Q12A 4GLBA 1SRQA 3WO1A 3EGVA 1U3FA 2EJCA 3LP8A 5TMBA 3BIFA 4PN3A 4C2TA 2ZR7A 2DXIA 1SIUA 1XXLA 1S01A 3MMPA 3EUFA 1O89A 2FGJA 4E14A 5KSOA 4HNQA 2OXTA 5LP6C 3RSOA 5BMOA 3EFHA 1T5BA 3PX3A 3LQQA 2HTFA 4LCBA 5THXA 1IMJA 1CUYA 4L85A 4GP6A 3W7VA 2QJOA 5KWJA 1GGJA 1TE2A 4EQ6B 1NGSA 2RH8A 3TCNA 3V7FA 4RQBA 1CQJA 4E30A 5DOVA 4DLNA 1QZZA 1SCIA 4ZK2A 5C4MA 1YRLA 2FTKE 3M8KA 1EMDA 1ZK0A 3BGVA 3TNJA 2AMJA 1K27A 4FSHA 2YJGA 1CEEA 2ZT7A 3L8HA 1PQYA 1NF9A 1N5DA 2AZMA 2FR0A 5JBQA 1VJ0A 2J5KA 2IC5A 2OCDA 2WEKA 3VI3B 2FY8A 4GLFA 4RCVA 4ARSA 4AQDA 3CFYA 3GRUA 5IAAA 2J0SA 2QLTA 1WB9A 2C84A 1TZKA 2VAPA 1JXMA 1Q0HA 1FX0B 1Z7BA 2GNAA 1ZJ6A 2VHJA 3A0UA 2IBMA 3O1LA 3SN6A 2F62A 4BNDA 4YV2A 2P6OA 1C9DB 3R9XA 2JAQA 2BM1A 5JPCA 5E7IA 4CF3A 4U3JA 3L7LA 3C6BA 3G82C 1FDUA 4X3OA 4X91A 1F7VA 3BUSA 1SXHA 2L17A 4B81A 3D1LA 2R6JA 4LFCB 3EJ6A 1MOZA 3LPMA 3IR5A 2VRCA 2I3AA 2NP6A 3Q3GE 2EAUA 4U8GA 4MHTA 2ID8A 1KU6A 1KY3A 2I87A 4K5QA 4U02A 1V8ZA 5D3MA 3TSOA 5I4IA 4HVCA 2VDVE 4IF6A 4MR9A 4ZCMA 1XAHA 5ADUS 2IHYA 2J9ZB 5EQDA 1MB3A 3BC1A 3DFIA 4YRDA 5LZ9A 3K16A 3KZOA 3KZCA 3RUPA 5IVIA 3P9QA 3CWQA 2QQFA 2W2QA 2RH9B 2BUBA 3O4GA 4NYMR 4F2HA 3FSGA 2FMKA 2ZSHA 2ZWAA 1UBMS 5DYWA 4FFWA 1JU4A 4NULA 3L84A 5A9RA 3COYA 4V0OA 3VR4A 1N7HA 2HPHA 3IQZA 3IXMA 1CVLA 2WM9B 4PO8A 2X5XA 4TLLB 3W8FA 2PSSA 1AF7A 1R7RA 1Y6ZA 1W4BA 4X1YA 3UJHA 1ZVVA 4RDCA 3E7XA 3HCDA 4IJ6A 4PBSA 4TYNA 4L08A 5FR1A 2IYSA 3URKA 2XH8A 3G5LA 2CJXA 4BUCA 1E3DA 4XPZA 4TS4A 2MR6A 1Y1PA 4DIDA 2QMZA 4Y7CA 3AOEC 5EXTA 2VPXA 4U9UA 5FAKA 4WH0A 3AUYA 2ZIFA 4CBVA 2YY5A 5JD5A 4MYRA 1D6SA 1W0KD 3CBQA 3GQBB 2AFRA 4AN0A 3I23A 2VOJA 4DMCA 1TGYA 3EMDA 5KSZA 1RPNA 4WEOA 2GEFA 1SB9A 3ELBA 5JISA 2B8EA 3R7AA 1VHLA 5AKGA 4BLPA 1YOVA 1TM5E 4FN4A 4BBJA 2C1XA 2C78A 2WWXA 2ZE5A 2QY9A 3QOXA 1LPPA 3FXAA 3QVVA 5F7OA 2JLZA 4ARBA 4BO5A 3E48A 4KQ6A 4ZFNA 3MXOA 2ZRGA 2VQDA 1ZR4A 3OZUA 1KRXA 3I45A 1AMNA 1LWNA 4DREA 2D54A 3B13B 4J0DA 2ODEA 4K87A 3NDJA 4OAOA 1P1KA 1Z5WA 1C7ZA 4PGHA 2FR8C 1L8QA 4YJHB 5TS2A 3WIVA 2QTFA 2QRGA 2YY7A 3DEHA 2PL3A 3DT9A 4J3NA 2ORVA 4IMIB 3EYWA 1RJWA 1YJ5A 2J31A 2Q8NA 1IZ8A 3RU2A 5A4KA 1JBQA 2R1TB 3BAZA 3PF9A 4CU2A 1GV0A 3ONVA 3PEUA 3T7KA 1JJIA 1YL6A 1X1SA 4BGUA 4NZZA 1E8MA 3QW2A 2EVWX 1I14A 2ZT5A 3PHCA 3R4CA 1EXWA 1JJBA 5DB4A 1V71A 2BRUA 1ZNQO 4NXNB 2O8CB 4RLSA 2ETXA 2XNCA 3OETA 4LHXA 5REQB 1V25A 3X1KA 4CM7A 1COZA 4DV2B 2AJCA 3MBIA 1HM5A 3BEDA 3GG9A 1MNQA 1R18A 2ZJ6A 3CWZA 4XCXA 3R0IA 2QVYX 1NBIA 1JDZA 3AP2A 3HWRA 4GOLD 4ZAZA 3VYRB 3MHTA 4PCUA 2H63A 2Q1UA 3QEMA 5BQ3A 1W5AA 1I7SB 1D7OA 2EKDA 5KYTA 1TO1E 3OM1A 3ACBA 2IEDA 5JNLA 5EE9A 2Q07A 4QVGA 1O9BA 3T7CA 3MRXA 1E7WA 1QTIA 2D00A 2YYAA 3TKAA 4QM6A 1H5QA 1WLYA 2GS9A 4RLQA 3PK0A 2R96A 3FPSA 4DEVA 1THZA 3ZHCA 5K3SA 4PCLA 3NUGA 4DTIA 4YYEA 4Q1DA 3ZQUA 3HTXA 1H3FA 1PKEA 4LNUB 4PYNA 4F97A 4RTQA 2VIIA 1A96A 2YJ6A 1J09A 2XGMA 2YASA 1ULZA 1BJRE 4LJ4A 1BWSA 3B1YA 4GUAA 3BWCA 3KELA 3HKDB 3JQ6A 3CJQA 1ODFA 3KBBA 3HCCA 1ZPDA 3UHFA 1GKYA 5B7PA 3FB1A 4N3NA 4U6QA 2AR0A 1UEXC 2YX1A 3CB2A 3KR1A 3ODGA 1R74A 2X40A 1CERA 2BSAA 1X2EA 4REQB 5DYTA 5JADA 3GMSA 2XWQA 4KDRA 4IG9A 3HO6A 1KYQA 2JRLA 3EVGA 3H86A 3KC2A 1YS2X 3OU7A 4LHSA 3GJZA 4XM1A 1YK0A 5DEIA 3HKBA 8MHTA 4AP9A 1MAHA 4R1PA 5LD2C 2B2NA 1EAYA 2GHQA 3GGJA 1VIDA 2W0MA 4NBLA 1QS0A 2W2NA 2YINC 4YQFA 4U2FA 1U0GA 5JZBA 4G0UA 2VJBA 3NWBA 1Z07A 4N9WA 4MKZA 1VRVA 3ICVA 3NGMA 3HA7A 4BMPB 5IPFA 4JOQA 5CX4A 2C3UA 4KO4S 3NJ4A 4BWFB 4RY9A 3WYDA 3L6EA 2VYNA 4HSGA 3O8CA 3L4EA 5IXJA 3LXUX 3TTYA 1I4EB 4V0RA 4DC0A 1E1YA 3JWPA 2ONJA 4BDSA 2B99A 4O4LA 1PZNA 4WJZA 3PQCA 4J7XA 5IAGA 4BEJA 1QORA 1H0SA 1ADBA 2QRKA 2ZDGA 3DL0A 4EF5A 3GLFB 1XRNA 3L6OO 1QK3A 3QE4A 2QUAA 3GA5A 3JCZA 3AIKA 2FPGA 2JFZA 2O3UA 1YOVB 2B8WA 2Y6UA 1EBFA 3K2QA 3KXPA 3MRTA 1ZOPA 3BDVA 3NI2A 1F60A 3JR3A 4GR4A 2O8NA 3WKDA 4JOBA 2H4JA 2W5UA 1WZCA 1Z9BA 1QGED 1QIGA 3DL7A 3TF5A 2Y2UA 4CG2A 4OP1A 2NUPA 1ZX1A 3IKLA 4D9KA 4GZMA 2XQKA 1ECGA 3K4QA 1Z68A 5TR9A 4D0GA 3ELYA 2WPDA 2XPCA 3W9BA 2OHIA 4BMVA 1JHRA 2A0FA 1UPCA 3W2IA 5KKCA 3L4JA 4DB4A 4PYIA 5F12A 1J6UA 3H5RA 3R3UA 3TUIC 4Q47A 1G38A 2J41A 4FGLA 4J0HA 2AH5A 4PPYA 3OFKA 3VZRA 3ZEAA 2FOXA 2ARKA 1BIFA 4CM4A 3HWWA 4ZDWA 5C3MA 1T1IA 1PHPA 3TRJA 1KTIA 4RH3A 3G23A 2IUFA 4NPCA 4Q0MA 4NYJQ 2GBIA 1DPFA 5GZ1A 2BFWA 3G0IA 1XZLA 3F4LA 3G13A 5JNSA 2FV8A 1PJ3A 3LBYA 3NBXX 4KHZA 4I0WB 4YWJA 4F86A 2GXAA 4IWXA 1RSZA 5CK4A 3WRXC 5CHEA 1AM4D 3T95A 3CCFA 1W6RA 1MNAA 4X1KA 4KQHA 4PQGA 2VOEA 3LVBA 3SYLA 4YV0A 5E4FA 5MFZA 2BFMA 5JS8A 2XZDA 1YK1A 1YZNA 1F06A 4RGYA 5L6LB 4QDXA 1S8AA 3IEMA 4LHWA 1UPXA 4OBBA 1FK8A 2EG5A 3QPCA 2PS0A 1CNMA 3DR3A 1AS3A 3V1MA 1QB8A 4BC1A 1R5JA 3C70A 4K6CA 4RD3A 1JAZA 1N0UA 1GCAA 1TK3A 3HNPA 3HWSA 4J03A 2J9YB 3N0WA 1LNSA 2QW8A 4R2LA 3V8RA 2P68A 2Q3CA 4NEQA 4YRJA 1IVNA 1J22A 4WLOA 3S1SA 3A4IA 1OILA 1CB7A 1XP8A 4DV3B 1A77A 3T34A 1RYEA 4FR5A 4FOSA 4U1RA 1XEAA 3OE7D 3BMNA 2R6AA 4NZMA 4IVRA 1GNTA 3QVXA 2ZJ4A 4LZAA 5CGQB 1VIAA 2XRFA 3M6FA 5J4VA 2UVPA 1BMFD 4FK8A 1P9OA 5BWNA 1BKDR 3G02A 2Y1FA 4PTLA 4UHJA 4EGQA 4EG3A 3GUYA 3P0FA 3JQAD 1UC4B 4MQEA 3EF1A 4QT0A 2HOQA 2XUKA 1FX1A 4D96A 2B6NA 4GWGA 4FFNA 3HUFA 4G0NA 3A3YA 3TFOA 4LF4B 4L02A 1FF9A 3D02A 3UGQA 2O8BB 4NOMA 1Z0JA 4PFKA 3JQ7A 1O5TA 3FZQA 1OXKB 3FIUA 3RU9A 1DIGA 1XTJA 3V4PB 3ZNOA 4GXRA 2EEPA 1OWLA 3A7DA 4HHEA 2C3PA 4OU4A 3THSA 3KQOA 1MPXA 3MIZA 4I6EA 3HSSA 2I65A 4KPUA 4AROA 2UUCB 1C3JA 1Z7EA 2P6PA 1L3BA 3F5DA 2JGAA 4ZZIA 1DV1A 4XFJA 3V8VA 3N07A 3RS4A 1KY2A 2VUHB 1G1AA 2A9QA 5FB3A 4CMKA 3AP1A 4PN7A 1JSLA 2P2ZA 3FETA 3K5WA 3H9UA 5AYVA 3TQQA 1NJGA 4A3SA 3ZHVA 5B55A 1FFWA 1AB5A 1KC1A 1ZC3A 3MBKA 3VKWA 5A06A 3WNBA 1FCJA 4LVNA 5AVRA 1QKKA 1TADA 2Y1OA 4UQPA 3H5LA 2F43A 5DN9A 4XIYA 2H08A 3L1KA 5G0UA 3UXYA 3ZV5A 1I3NA 5H9WA 3INYA 4ALJA 4BIIA 5HKOA 2O8BA 2BEWA 5HVNA 2NU6A 4XWAA 3BE6A 5IFLA 4RWZA 5INTA 1W96A 2V8OA 5MGBA 4R9UC 4LNAA 4OMFG 1RPZA 2X5NA 3ENNA 1SVOA 4MEAA 2PTHA 4F3TA 1ZK4A 4ZU6X 3FHJA 3BQ9A 3V46A 2XWJI 4RPIA 1T4DA 2XCOA 1SBIA 1CSEE 2WHQA 1Q12A 1YIAA 3F9CA 3LDFA 3ZV7A 2IXGA 1A3CA 5DLPA 2MWMA 1Z83A 4PNHA 1QNLA 3IS3A 2Q1SA 4PQEA 4MUYA 1SVUA 2ZYIA 2AFHE 4TVOA 5AM1A 4CVNA 2KM1A 1ZSVA 1QC5A 3FZEA 4KE7A 3WL7A 3Q0EA 1KF0A 2JJQA 4K6KA 2QP9X 4YECA 3Q6NA 3MAGA 2O8EA 4BGIA 3QLTA 2IYFA 4PSVA 5LZ5A 4DUGD 1HQYE 4A23A 1N5IA 5I4BA 4MWEA 3KR9A 3S40A 1WUHS 2Q5LA 1NKVA 5FADA 1EVKA 2HMSA 3BEOA 3FDIA 4X1IA 4P98A 5F73A 5H3LA 3SQMA 5EHQA 3MTQA 1ZSNA 1TZ2A 3RFCA 4YP6A 4CR8A 1NR1A 1IQ0A 2CLOB 1UT8A 2JFBA 1K92A 1P5RA 1A5SB 2FRXA 3BJRA 1AS0A 1UINA 2C8JA 2I71A 4US0R 3WSWA 1WPQA 1ZRNA 2ZJ5A 1TJ5A 4IV5A 3DWIA 4I9GA 3DC7A 4WCFA 2IZ1A 5CA0A 3VGJA 1I9GA 1XNRB 1GU7A 3OM0A 4LMAA 1TKCA 2NU8B 2A88A 4NMLA 4GXNA 2N1BA 4XM2A 1JLKA 3U37A 3X1ZA 4Z3OA 1BX3A 2VNSA 3BIJA 3GFBA 3ZU6A 2IS6A 2BISA 2BEWB 4EHIA 1Q6ZA 4RPKA 4A6EA 5GADl 4E22A 1KMNA 5PGMA 1TCBA 2Z1MA 4M8NE 2X1HA 4DA7A 1NASA 3DVLA 2VDJA 2BEUA 4KBFA 3G88A 5GMOA 1DBIA 1K4MA 3CNBA 1HOXA 3ZH9B 4Z49A 5CDTA 1L5ZA 4UM9D 1KE2A 4CDNA 4X20B 4AJKA 2FETA 4MKHA 1CWUA 1O96A 3HDHA 4OVKA 3WNVA 1XJWA 5AJWA 4F1KA 2PTGA 3ZHUA 2P3OA 2Q0QA 3EOAI 3PJFA 3L4SO 3GLRA 2J4CA 3KQVA 1P1HA 4EELA 1Z3IX 2ST1A 3SQXA 1E6EA 1ZYUA 5FTLA 5DNCA 2J6BA 4I8DA 3GG2A 2OR3A 2SHKA 1WBBA 3ESBA 1FW8A 3CR8A 4QO7A 3WLPA 4GI1A 4RETA 2EARA 3AR4A 3GUZA 2BR4A 3DOCA 3L6RA 5LC1A 1W34A 1DZIA 1Z17A 2AUTA 4ZI5A 4L9SA 4G5FA 4R8SA 5CR9A 1RQNA 2VDNB 2CWDA 1FUKA 2AZ4A 3FHLA 4XX1A 4ZQGA 2FMFA 1Z36A 1UP4A 1FTWA 2O4UX 2E4WA 5TGZA 2ETVA 1YS7A 1Z5UA 4KLRA 1SVWA 4ZREA 2JLUA 3MTGA 4A03A 1W8IA 2G9UA 2OHVA 4EF4A 2GJ8A 3OOYA 4O2LA 2B2XA 1Q6YA 1PL0A 4HOYA 5EWMB 3JAWA 1U8AA 1J42A 3QFRA 1VCIA 2V65A 3SGLA 4B8YA 1OBFO 1K8XB 2SICE 4JLUA 2V0GA 3L4KA 3DNFA 3ESAA 2QPLA 3QVLA 4G9GA 4BO9A 1ZNYA 4LXIA 4C2BA 4HMOA 4Q16A 2P0AA 2RJNA 2W6IA 2Y4NA 4PPGA 1UDBA 1U2RA 4AZTA 2BLNA 1T3TA 1QQAA 3I6YA 1NUQA 2J09A 3VOSA 3QF4A 4OUKX 3UJ9A 4C87A 4EABA 1NPTO 1SRRA 2V6JA 3ACDA 1M8FA 2AG1A 1J39A 2FRDA 1SIBE 1NURA 1Y4ZA 2VAVA 3GEIA 3KETA 4ND5A 4P9NA 2DETA 2JJ1A 3PA8A 4HGZA 4CWAA 3TI7A 3T5BA 4FDVA 3EG5A 4YJ3F 2XUOA 1UWLA 4LA4A 4XTCS 2NO1A 2X8JA 5IC6A 1BW9A 5EJAA 4E13A 2R86A 4RFVA 3IAS6 1IY0A 5D6OA 5JTTA 4E2ZA 2HNBA 1JGTA 2BVNA 4DA6A 4N6OA 3DMTC 2KLBA 3UKJA 1X9HA 4H0NA 4B7CA 2G77B 3H99A 4W6QA 5DV9A 3RS0A 3Q3JB 4G5RA 2WMYA 4UHCA 5CYOA 1URPA 2OCYC 5EPOA 2WM2A 5FT9A 4P3KA 4PAWA 4QFMA 1RRMA 2J0UA 3K30A 2XAAA 2XTMA 4FU0A 4ITRC 5LZ7A 4JYBA 2QTHA 4BQRA 4D3DA 1PG5A 1LC3A 2CYAA 1HQCA 3DHEA 5GQSA 1Z56C 3INGA 1EM8A 5ALJA 5T67A 2PQ0A 5TQVA 5J47A 3PYLA 4JLBA 3B1WA 1LB1B 1PV4A 1MP0A 1CDDA 2I54A 2NTYC 5ERXA 1D09A 3EZ2A 4KE9A 5A3JA 4OUDA 1POXA 2Z2YA 3DL4A 4EL5A 4QTUB 1DO8A 3R3HA 4KLNA 4MVJE 3STHA 4B9AA 8GPBA 1V7CA 3C1AA 1LDMA 4P82A 1Q1QA 1CJKC 1Z7YA 2ZSKA 2RKWA 1ENPA 1QFSA 4HWTA 3WAJA 3II6X 2VRNA 4Q7LA 5EY5B 3WISA 1PU2A 3SNKA 4H4CA 3DYIA 3KOOA 3MGGA 4DLRA 3CVVA 3EWIA 1YR6A 3N8KA 3EXG1 4XGNA 3AR7A 3GJYA 1I6WA 4M89A 5DRYA 3UMYA 2HSDA 2NPOA 4HB3A 1M34B 4YP9A 2JBAA 2IOFA 3UWPA 2CZCA 5FFMA 3LUBA 3ZDDA 2CXRA 2JIQA 3NBMA 5BP7A 5SZIA 5BPHA 4R1OA 4GI2A 1Z2PX 1E77A 4JUCA 3OWOA 1ESMA 2BI4A 2H1HA 3DOJA 3O1HB 3QEJA 1N6NA 2CZGA 5AJXA 1XDGA 2I1LA 3LTNC 2I4LA 1F3OA 1FQWA 4ISBA 1A9PA 2C5EA 1CZHA 2FP4A 3T5PA 2ORED 3E84A 1EFDN 4Z9YA 1W76A 3A4YA 4NBRA 4NBWA 2AYYA 2EATA 3A6KA 4LXUA 4CV3A 1V26A 3D8HA 4BLSA 1MB2A 2RGXA 3T7JA 2UUOA 3F4BA 3U1VA 3ZWCA 1SGWA 5EZ5A 3H19A 1U7PA 3TEJA 2NZJA 3PVSA 2HFJA 2HU5A 4JNKA 1DEHA 2AFHA 3LMKA 3PRJA 3OVMA 4EY4A 5TEVA 4PC1A 4R0NA 1EVEA 1EUDB 4L5CA 5KHAA 4CHGA 2HRCA 3DBRA 4NBVA 4G2TA 4DEXA 3MWGA 3CU5A 3U7JA 4F3KA 3HVUA 5FOQA 3J81k 4G0XA 1S7GA 2W00A 3AEYA 3EZXA 3UB3A 2AG0A 3JYLA 4PLWA 4FT4A 4LGYA 3WGKA 3LP5A 3V33A 3G8AA 3EDRA 4REQA 5DNWA 3KT6A 1UFVA 4FONA 1DQZA 2PWZA 4GP9A 4PGGA 4TMWA 1IJKA 2OFOA 3FLAA 1LVGA 4RENA 3AXTA 3PTLA 1PFKA 2RGRA 1MN6A 2WV7A 2C29D 1GUYA 4MGHA 4P0PB 1PRYA 4ZICA 1QAQA 1QRRA 3ETDA 1C1HA 2CFSA 4HWRA 2P67A 5FLKA 2IPNA 4PLGA 4HV4A 3GZJA 3FUWA 1TLLA 1V1RA 5CM9C 4AZ3A 5AM5A 4HDRB 5TF4A 3H75A 3I1FA 3IBCA 4JA2A 4PZ9A 3OTGA 1HURA 3ADBA 2XA2A 2DT8A 3U7QB 1SD2A 2FPXA 2LV8A 5G4KB 5ALEA 4Q82A 1CZNA 1FSZA 1PT8A 3OOJA 4FW8A 4XYMA 3V4VB 5IXYA 2QTGA 2CMHA 2IYOA 1Y98A 3DDWA 3DCNA 3CLSD 3OBIA 3IULA 3OZRA 4FDTA 4FJ1A 2Q27A 3MAJA 1J8FA 4B75A 4KGDA 3ILYA 2ZVQX 1HEUA 1RAHA 4ZT3A 3JU3A 2P77A 2JCXA 4DNXA 2CFOA 2FQWA 5BUCA 3TBFA 4Q9AA 4O3FA 2FEXA 3G0OA 2Q7DA 2QLJA 1G2OA 2Q29A 2XADA 4B8WA 2R97A 4RJJA 5HWSA 3I8XA 1P61B 2VHUA 4QUKA 1C14A 5EESA 1FEZA 4BP9A 3M9XA 5A4FS 4ESEA 5JASA 4PWZA 2HSGA 2GASA 2QZZA 4UBMA 4V2UA 5GV7A 2IK8A 3DDCA 2H0RA 4MS4B 3G0CA 2O0HA 3HB5X 1CLUA 1JWLA 3KU4A 1WVIA 2QAJA 2AG6A 3HZOA 4R4JA 5FI3A 2AFIE 3T52A 1RADA 3W8RA 4IFEA 6AT1A 2LE0A 1CRWG 3MWDB 2WIKA 3KXDA 3R77A 1G2PA 2A57A 2J9FA 3VNAA 4EWLA 4RE6A 2JLRA 4XPIA 1ZONA 2HIMA 2Z2JA 2QT0A 4O2BB 4QXMA 2XXBA 4PHFA 2B7CA 3AKZA 1QPZA 1T3SA 4B79A 4IRUB 4IHQA 3E5MA 5CM2Z 2GPBA 2F1HA 1NN3A 3K1AB 4QSMA 5JE8A 1PDWA 2TECE 3NDIA 4ON9A 3VPBA 4NIMA 4D3XA 4JAVC 1ZIYA 3QBTA 1C8KA 5AW0A 1NNUA 5JMWA 4LXXA 2ZE8A 4DFDA 1BU5A 1NOKA 3JPWA 3F6EX 4F8JA 3DKRA 2IHKA 3AI1A 3DOFA 3MTAA 3VX3A 1I30A 1NXSA 2XD4A 4D74A 1NYLA 1R3UA 3LQ1A 3MILA 3GLQA 3OT1A 3DLBA 1SVMA 1MVNA 1MPTA 3DA8A 3E23A 2ZE7A 1Z6ZA 4W5JA 2E1RA 1EESA 1JH8A 2G9ZA 2YHSA 3B3FA 1HFEL 1SXJB 2MSKA 3OI7A 3UOWA 5KQGA 2QM7A 4LYYA 3DMTA 4GO1A 4LMPA 2CV0A 3RJ9A 1DIHA 1P18A 3BBLA 3LVQE 4OSPA 5FHQA 4MHOA 5SZJA 3SNHA 3TEMA 5YASA 5F9HA 5B6IA 3R6TA 3NTVA 2OBFA 1JDPA 1H5UA 2O3TA 2PGJA 4ENSA 5L45A 2NQTA 2NUAB 4ZYYA 3ZGOA 2UZ0A 2JJ8A 1XAJA 2P9EA 2DQ4A 2CDAA 3CUTA 3OFNA 4IH9A 3AEUA 3LQYA 2E1PA 5HJEA 2CBZA 4ZGGA 3GI1A 1JEAA 2Y3IA 1WQ1R 4U7DA 1YB7A 2XQFA 1Y9AA 4C4OA 4F6LA 2CLDX 4FKBA 3OEHA 3BK2A 2Q5HA 2HYDA 2WZBA 3TSCA 5MN6A 1IM5A 3FPGA 4QSHA 4JV5B 3CG0A 3PHHA 1O94C 1U2DC 4A1OA 3DOOA 5B3AA 1LK7A 1JB9A 1V8DA 3H4TA 2C9OA 4FYVA 4U5QA 3SSOA 1R00A 4LOIA 3Q3VA 4JGGA 1NDHA 4ZYLA 5BR4A 4J4TA 5BN1A 3RJTA 3DFMA 4ZCSA 3IUMA 4FGUA 5LKAA 1GQ2A 1JEQB 2XGOA 3F1LA 3RVBA 4B7AA 4QUJA 2DFLA 1GCOA 1SBYA 3M5WA 3OPYA 4G86A 4JEMA 2CUKA 3HA5A 3PC8A 3OECA 2BEKA 3CLVA 4IPTA 5B2ZA 1M6VA 5J5CA 3T4UA 5BVHB 5KAMA 2JVIA 3ENVA 3LA8A 1MG0A 1IUNA 3C3JA 4HX5A 2ZPUA 1D3AA 4TL8A 3N8IA 4AUNA 1N2GA 1W88B 2KBFA 2YXEA 1Y1TA 1ZMBA 1IHOA 1J8QA 1KO1A 1YVDA 2PMFA 5AVSA 1LXCA 1UANA 1RI5A 4TM8A 1TCVA 2PJUA 1KJJA 2D5CA 3F78A 1HNZB 4JEIA 2Q7XA 3K8YA 5K3OA 4D57A 5CT4A 2DG2A 4M6WA 4YAJA 3ASYA 3TQRA 5K20A 4B3SB 1DFHA 3DTNA 3L7DA 2WD7A 3P94A 1LH0A 4FGZA 4WKOA 1KI6B 4GEGA 3KQQA 1LF5A 3ZIAA 2NM0A 3USCS 3HB7A 3I34X 1UBGA 4RZIA 5KOYA 1G55A 1N6IA 2AD5A 2GH1A 2XOKD 4V24A 4B7UA 4M2LA 1JFRA 1YJBA 2CK3D 3HI6A 1QV7A 2VSXA 3KJZA 4HLCA 2IPXA 1OV4A 4N3BA 3GRZA 4H59A 3L7NA 2B4KA 2OPBA 3B51X 2PUEA 4RKFA 2D0PB 1D1QA 3BFKA 5B2EA 2UYCA 3MOGA 1MAUA 4GRDA 5F9MA 1OC2A 2OP0A 4NK5A 4IY1A 4RVFA 4TL6A 2QAGA 3RVOA 4EZEA 3EEQA 4N48A 3RDPA 2P9HA 4H18A 4JLPA 4JJGA 4CL8A 2FN3A 4W1PA 4M1MA 4Y9RA 2C4NA 5EIAA 1IULA 4TZTA 5IULC 2VYCA 4MV6A 2HF9A 1QE5A 5BWCA 3I2YX 1JEYB 4GI3A 2ZDHA 4CM1A 5KTKA 2VT2A 4DADA 1G4AE 1TVKA 5BRAA 2WFAA 4JU8A 1VYTA 1XNQB 3T54A 2AI2A 2YCLA 3HLYA 5DM0A 4ZD6A 5CVUA 4HNUA 3QG1A 4NJMA 3IHWA 4C6SA 2I1VB 3QHQA 3AUSA 1BO6A 4F9GA 4V0ME 2E37A 4L9RA 3C4VA 1JA0A 1UBOS 1K7YA 1KZYC 1AKWA 3NTXA 1OVGA 2JFXA 3H84A 2G5GX 4MKFA 1JXAA 1AF4A 1M1UA 2V4UA 4UQOA 2HEIA 1FSPA 4RK4A 5DXFA 4ZAVA 3CVYA 1PSDA 1Z2OX 2I7TA 4EHLA 1DG3A 2I29A 1F5NA 4TM7A 3ILHA 2FRDC 3INNA 4I4TF 1WDLA 1Z37A 2WABA 3AHFA 2QN2A 3GRYA 3IA7A 2XBUA 2C03A 4C78A 4DQXA 4Y0VA 4UM9B 4WZZA 1P91A 2OCPA 3FJYA 3NV9A 3UGKA 1G6Q1 5AESA 3GD7A 3S7ZA 1AKEA 4K03A 3A6HA 4KO8A 4R69A 3UFBA 4QOEA 1USUA 1F4LA 2GJ4A 1VL0A 4DR7B 5CVTA 5EERA 1N2JA 1XLUA 2RIPA 1LJLA 4OM7A 4CKCA 4HDKA 1MF7A 4EITA 1IK6A 3AZPA 1TO6A 1WXFA 1K7EB 1I5EA 3I8OA 4EJ6A 1VPWA 2G1PA 3BHIA 5FWYB 1JA1A 4OK6A 2WAOA 2IW1A 5EG5A 3ZXIA 1C9NA 1JAXA 3L8CA 1OGYA 4BNMA 2J6IA 1H9BA 2BHSA 4OXYA 4YPVA 2DPLA 3FSJX 1LBHA 4Y6SA 4BKRA 1HDXA 2XXJA 3ESDA 3OIWA 4FDMA 4GS5A 1YQWA 3TLAA 3EH1A 1SCKA 2FX3A 2J3QA 1YZGA 3OOWA 3IVCA 4HJRA 4M0FA 4P7GA 1NVDA 4Q4DA 5CB4A 1U5CA 3OA0A 3ZIUA 3RC8A 1IXRC 2QTRA 3EVFA 3JASB 4KRXA 4XQGA 4YMTA 1GTRA 1ZUNA 4LV5B 2DWUA 3PWSA 3Q15C 5DPMA 4B4OA 2O7RA 4DTCA 2Q3HA 2MCFA 1E2JA 3HSYA 5LUAA 4GF5A 4MOWA 2ZAOA 4DCSA 2BT4A 5ALYA 2OYCA 5A0TA 2AMLA 2GDZA 3FG9A 3FKSD 2H29A 3CVOA 4AP6A 1YJCA 4MS3A 2WD9A 4G8CA 4F92B 1FYWA 3TVTA 3ZNQA 1YD7A 4X65B 1M8JA 1C41A 2QX7A 4QUDA 1TCAA 2VH1A 4IGIA 4AB1A 3SQWA 4WKNA 2UYGA 4QELA 3LXMA 1FU8A 1XDDA 4Y9UA 1KQGA 3Q3CA 1MT0A 3WP1B 3DBOB 1B15A 1CUDA 2FJUA 4D4KA 4X1OA 4ZCIA 5DCWA 5CVCA 4EFNA 2VSYA 3WGGA 1GKKA 2NTNA 2IBSA 2OG2A 1LGYA 3QKSB 3WQSB 2RHGB 2JGNA 3FFWA 3R6DA 4N40A 3REGA 3PXCX 1C0EA 4F4FA 1U9IA 2LCFA 1R37A 3KUXA 4KTTE 1M10A 2BMDA 1MG5A 2XB6A 4C2UA 2VKQA 4ZMRA 1EUDA 3LVRE 4RH0A 1UAGA 2WYWA 3WGMA 1QAOA 3N28A 4L9AA 4Q9KA 4RW0A 3F6RA 1YRQA 2ZUCA 4XZ3A 5J63A 4NR0A 3U7EB 4BLWA 3PNLA 4O0LA 3FPCA 4RV5A 1EPUA 2HA7A 3BAFA 4ENVA 1M1YA 5H4GA 1KAOA 2V7TA 1A9RA 5A0VA 2NU7A 4LJLA 2QD3A 3DBIA 4JYAB 2O2SA 3IP8A 2D06A 1VI5A 1FDTA 1MFZA 2YR0A 2P9TA 1O94A 4P83A 4A0QA 2V7EA 3NAGA 3KSBC 3PQ2A 2FUKA 1W6UA 2QMHA 3GP3A 4RD4A 5EE5B 4BZPA 2PQ6A 2RG7A 2ZT6A 3KCNA 4TV9B 1C4OA 3HUUA 2EGHA 2XYHA 1QOZA 4IDHA 1ODIA 3SBXA 4RM3A 1BD4A 1FZTA 3GR6A 2Q9AA 3DGFC 2M2IA 4BO4A 1UMBA 3EW9A 4C30A 3WXBA 1II0A 1E4EA 3EAQA 1L9XA 5K0BA 3ZGXA 1LLCA 4ND2A 2XGGA 2K5UA 1CUZA 4KWHA 3RJ5A 5HRCA 4PZZA 3EIXA 2R5WA 1XRJA 1ZD8A 2GYYA 2DH6A 2OO5A 1U1EA 3IAM6 1XDBA 4DLTA 2C4KA 5DISB 4ZCTA 2PEYA 1TRHA 2QL7A 2P2DA 3BKXA 3FCSB 3O8OB 4AJOA 4F3NA 3FAZA 3L05A 1OX4A 4KXLA 3M1AA 1JHYA 7AT1A 3BXZA 2AF4C 5KVSA 3IOEA 2C5LA 5DKFA 3STTA 1NY5A 3QU9A 5EJ9A 3I30X 4ZI7F 5I48A 1J33A 4OBWA 4KGXA 5AJTA 3B8EA 4AZ0B 5HOQA 2QUBA 3PQ7A 2EZUA 3I42A 1KZ4A 3C3CA 4BXOB 1Z7WA 2I9PA 3B6IA 4BMNA 3G79A 2O1SA 3GYBA 4KUGA 4HBZA 2FPUA 5IKXA 4JZYA 3FYUC 3NETA 2VAMA 4WUVA 1MV5A 1OXSC 1GN9A 1KI7A 3DONA 3GYGA 1IRIA 3GPDG 3H2BA 3NYQA 4JT8A 3SEFA 3LA6A 1EUQA 2SKCA 2ODPA 4MMXB 1KO4A 3BXFA 4TRRA 5H83A 2RHWA 4OHWA 1H8HD 5FHRA 5FWXB 4I3GA 2BDUA 1KKLA 2HH9A 3BS4A 4B87A 3ZE6A 1U3GA 4AAYA 4JJFA 4R7GA 4BLVA 2G83A 4F7DA 2J0UB 5CLJA 4EAQA 4Y2VA 4KHPB 3QE0A 2VPYA 5JH7A 1YRBA 4GAEA 3I2FA 3J7TA 3IUNA 5AVYA 4JGIA 5LA6A 3IERA 1Z34A 3EXEA 1QHEA 1LKZA 2WYIA 1DHTA 1Q3HA 4XVQA 5IT9A 3OWXA 1WUKS 5FEMA 1GPYA 1XHLA 2XB4A 4D8WA 2X4LA 4RF3A 1VE9A 3IPRA 3PTZA 4F5DA 5HIAA 2JLCA 1E2IA 3KYCA 8OHMA 2O1EA 3DKKA 1P7WA 3ENWA 4I55A 2JK1A 4YP1A 4GWLA 3CPSA 2XDYA 4JKYA 4I5GA 4R8LA 4HQFA 1Q1ZA 1ONSA 1CF2O 5CAEB 5HUJA 4ZA2A 3UJPA 4Q1FA 1ULHA 2RE8A 2Q5JA 1IPEA 1V8OA 1MB0A 1SXGA 2VWGA 5GOTA 1C3XA 1HX7A 2XAUA 4KVAA 4TV8F 5F51A 5FPTA 3RRJA 4GMKA 1N7IA 3VX4A 3GNQA 3E53A 4FFPA 2B83A 3P4YA 3ANNA 4CNBA 1QQ7A 2EFJA 1C1YA 1CIPA 2XYRA 2GJSA 2PH7A 1J2EA 3DW1X 4CIAA 2R62A 5FH9A 4FGWA 2CV2A 3I76A 3KDSE 1KPIA 3FNGA 4ZGWA 1GRRA 2AWNA 1QH1A 1RWBA 3H17A 2MSEB 5BOSB 4AYXA 1Z33A 3GJ7A 3VZPA 2FSUA 5TE9A 5BYAA 3EE6A 1XWIA 3N0XA 2FDCA 3WL4A 1BHJA 3AEZA 5AXAA 3AW8A 4G07A 1KQNA 1MOSA 4RTOA 3FX2A 1R4NA 4W6ZA 2AXQA 1T1SA 3GBVA 1YA8A 3O4VA 3CZ5A 5AXBA 3NOOA 3QVGA 4M83A 5GWXA 1Z12A 4NU6A 2RGNC 2V9CA 2PH3A 4NL4H 1H0HA 3W5CA 3AF4A 1QE0A 1YJXA 3A6EA 1ORHA 1J2JA 1P4HA 1D1PA 3GRPA 1GEEA 3JTMA 4KV7A 4MARA 4M0UA 3GLIE 1RAFA 2D1SA 2Y99A 2ERYA 2QK4A 4BNIA 4ZIRA 5AI5A 4YMWA 3G2NA 1XROA 3P9YA 4QARA 5GJVC 2PUCA 4M87A 3SR3A 3CY6A 2EDAA 3QX7A 3UZUA 1M2KA 2QLMA 1OKKD 4TMXA 5SY9A 1VL1A 2PD4A 2QTTA 3KBOA 3E7FA 2HBRA 4FMDF 1Y8ZA 3F5FA 3PXDA 3OTWA 3SEQA 2VCYA 4NABA 2F8TA 3TIVA 4CMIA 1MHPA 1FLNA 2DFTA 1ZIOA 3C5VA 3WFIA 4B5LA 4UU0A 2QWXA 3AGQA 4M8IA 4OFBA 5A02A 1USIA 2DY0A 4JXKA 4KI7A 5H7XA 1DTWA 2AUMA 2PSHA 3U4MA 2K2WA 1KVTA 2W2KB 1QVVA 1H2BA 3PF8A 1V47A 3Q6IA 3WHIA 3ANXA 1KAGA 4XEUA 2VC2B 2VA9A 1E61A 4MRNA 3NEAA 5H4HA 1Z0ZA 2FLWA 1PSZA 3PNSA 5EUQB 3QTLA 3HM9A 4LF8B 1T5HX 4JI6B 2WIBA 3V80A 2YS6A 2HGSA 3ZWAA 3A3NA 3M89A 1UAYA 4F5EA 2QNRA 4YX9A 3QP9A 2FU5C 3C14C 1KI6A 1AUOA 1IK4A 1OVMA 3D64A 3LKBA 4ID3A 3EODA 4IS3A 4NH0A 4RMNA 2X2EA 5J9FA 5K05A 2IYAA 3BMNB 2JH9A 2YC4C 3IE0A 5FOUA 4E08A 3UJCA 1L5VA 4BYGA 4OSOA 1W8DA 4QPPA 3LE8A 2CFIA 4XDYA 4I9HA 4DY4A 3P9IA 3KNZA 4J75A 2WFZA 4LUCA 1P17A 3LWBA 3PC2A 1P1FA 1F14A 1JLRA 2KJQA 3HP7A 4HEHA 4NLLA 3TJRA 3ZWYA 2IYVA 4BVHA 4YDHB 1EKXA 2O05A 3DHWC 1H4VB 1Y8QB 2AQHA 2JHGA 3AUJB 2VA8A 4JIMA 3U48A 2ZSEA 4E11A 1KJZA 3LNCA 5JFTA 3GP8A 1W4LA 1DDGA 5CA1F 3UHPA 5H81A 3U3KA 3CR7A 1W0CA 2RBEA 2O7VA 3CN7A 1NG1A 4L1KA 1T5LA 2RHMA 1N77A 3NAMA 5ARDA 2WIJA 2F1JA 2ZSDA 2ZS7A 3BH6A 4TS3A 4LDZA 3F6YA 1U7DA 1OHHD 3O90A 2WYHA 1ACJA 4J0FA 4UVDA 5AHKA 1T9CA 4DR4B 4RTPA 1NLYA 1OBVA 3C3AA 3GVIA 3OBBA 4E5DA 2WJGA 1PDVA 3B1KA 3HMQA 4MRPA 1EJ2A 1O5OA 2IHUA 4HRXA 3SIWA 1JKIA 4P3OA 4HAZA 1BE0A 3L7YA 1WCXA 5CXSA 4YT2A 2ZROA 5H70A 2ZM6B 2OHXA 1DKNA 1T91A 4YQZA 3R5SA 3UB4A 1KFCB 4GICA 2SKEA 2Q2WA 1PZEA 4ZAYA 5AXCA 2CXTA 1TJ4A 4PZEA 4CEIA 4NDAA 2VHXA 2J32A 3TZCA 4JVOA 4B32A 1B7GO 1SXJA 1G9XA 7MDHA 3UMBA 5IJZA 4IRXA 3JYNA 3TLBA 1TZCA 3TSYA 4MDEA 1DRKA 1ISJA 3MZ0A 4HS9A 2IS1A 1MA0A 4UE6A 1Y6QA 2IPAB 1DJMA 1RJGA 3QKUA 1U7TA 2VHWA 2ZRDA 4ZRNA 1WXDA 4F1WA 3DZGA 1BC5A 3G2PA 1VE7A 4P34A 1F6BA 1U0NA 1C0PA 1EINA 1KOLA 1IHXA 4FEGA 4WJKB 2QTWB 1C81A 4JOSA 4UU8A 1I7NA 2RGEA 1KYYA 4JROA 2XB9A 1Z26A 4LTDA 3ZKAA 1KMHB 1MIHA 1I80A 1KFKB 3UMFA 2QD2A 3QELA 4HRAA 3QFHA 4EGFA 5LQKA 4MLZA 5G2OA 1ZW6A 2IIPA 3ZCVA 4WKBA 1FYEA 1BNCA 3FR8A 3WDMA 3GWZA 4H6VA 3DO6A 1JW9B 3L8GA 4UCXA 3VDXA 1U81A 3ND9A 2O3RA 3CRRA 1I9CA 3DHYA 3PP8A 4TLMB 3KB6A 2I2BA 3SHTA 4TUYA 5G1NA 3ZHBA 3FTEA 3H0KA 3Q0TA 1B8VA 4ZN6A 1LUAA 1X39A 4IOKA 2EFDB 1R64A 1J0XO 4B80A 1FJXA 4AI6A 3T94A 4E2WA 1XA4A 4P81A 3MWEB 4B6GA 1X80B 4QASA 1H8EA 1D04A 1T8TA 3FUVA 3GZTB 3H2SA 5BYKA 2OAQ1 3C3WA 4YK7A 1T1RA 2IP2A 5D5HA 1IB0A 4L0DA 3OZWA 2H2FA 3L79A 2R44A 3OLYA 4PSKA 1EFLA 4I4LA 4A8JC 1AD2A 1Q1AA 2ZG6A 4C1BA 1XNGA 1ZAKA 1UQUA 1X7DA 2IIVA 4OTZA 1L5KA 2BJVA 4UUQA 3FHOA 3W5IA 1UWKA 3SFVA 3UT5A 2ZPAA 1MJNA 2HO5A 2XYQA 4RIEA 1EG2A 1TM3E 2WG1A 4X92A 1NW7A 1UIRA 1KJYA 1L4NA 4ZANA 3WLOA 2H5LA 4IZ6A 1SMKA 5E1MA 5HKKD 2XTAA 2QX9A 3FSGD 3L1JA 4HDRA 4OQPA 4ZCQA 5JU6A 1IBRA 2EBHX 3D6TB 3VYUB 2IVZA 2ZXUA 2WTXA 2Q5FA 3DDSA 3TPCA 1JVNA 4FYIA 4EQZA 4WOKA 1SD5A 3D3WB 2BUAA 2F17A 2NO5A 1A2QA 2PMCA 3CR3C 4U7WA 1NMXA 5SYAA 4NU0A 2A4KA 3QXXA 3ZYZA 1XP5A 4XFKA 4IX1A 2M1XA 1ZLYA 5JSQA 3X1XA 1AZTA 5KNBD 5LA6F 2BSXA 2NT3A 5CT5A 4OIMA 4E21A 3OJXA 6ADHA 3IJEB 2A8YA 2ENWA 1O97D 1HE4A 4M7PA 1BCSB 2JFFA 5TPWA 2X1MA 3AFGA 3A1FA 4V1CI 1I24A 1RS0A 2R3SA 3GRAA 4F06A 3ZHOA 4AN1A 3IVAA 1HMYA 3Q7QA 4CN8A 3EPLA 3U13A 4KREA 3A4MA 4ENUA 3L7JA 2MHCA 1SD1A 5ETJA 1R27A 4JT4A 5EZQA 3ZW7A 1TCUA 3W9YA 5JJCA 5FI1B 2UZIR 4MX8A 1QS0B 3IUJA 5KPDA 3P9XA 1Y4UA 1TGVA 1LI5A 2A59A 2UXBB 4KQIA 5BNZA 1PD0A 3ITEA 4I1IA 4NHOA 4QDUA 5EWLB 3ZS8A 3SFZA 9GPBA 2XYVA 3H2IA 1RXCA 2XWSA 3I1JA 2W2MA 3M6LA 4UMEA 1D0SA 1Q20A 3ETHA 4NNPA 2PKCA 4Z0PA 3RAEC 2OL4A 3DGEC 1JDBC 4HATA 3DO8A 4GQBA 3WY9A 3AKYA 5EHNA 1T34A 1N6KA 4MB6A 4OG2A 2ZWVA 3L3BA 1HFJA 1PEYA 4HADA 4QXAA 5KWSA 4FWTA 4BKMA 3NCTA 2XUDA 4D6PA 4U39A 5FPSA 2V5UA 5CG2A 5EPUA 1WCIA 3NEJA 4H16A 1R0CA 3RAGA 4ZRMA 2VCHA 4DGQA 4DIOA 2BKEA 1NX9A 5KTTA 1DO0A 1BQ3A 1SCBA 2IUUA 4O6VA 5JAMA 1C4KA 1JILA 2AUNA 2XMQA 3O2QB 3R8XA 4E32A 4ZO9A 1RR6A 3LDUA 4BFCA 2QLLA 2UYOA 3WLTA 1L8AA 2F59A 2PO7A 4BBAA 1XOIA 3G2IA 3L1HA 2P11A 2OSVA 2A9PA 3D6FA 3UUGA 3QEMB 1E6MA 4H7IA 1MVOA 3ZXYA 1Q21A 2VK8A 3K70B 3PPYA 3NMUF 2OBNA 4W9NC 1JU9A 3SM9A 1BE6A 2WV9A 4M4SA 5JVDA 4ABTA 2NXNA 3K1ZA 3QVMA 1VSUA 2PKYX 3T3NA 2VNHA 1P2GA 2BP7B 3G6KA 3PKZA 3PR3A 5E3HA 5KU1A 4M46A 1R6BX 5GP1A 3CH4B 4URVR 1L0BA 4DV0B 3F5SA 3LFHA 1EFKA 1NVMB 3LRPA 1WMBA 2OTCA 3P52A 4LDRA 3K9LA 2G28A 4QG3A 3BGSA 3BSWA 4CT4B 1J06A 3TOSA 5F2OA 2ZAIA 2I6XA 3GY0A 4G1CA 1DAHA 1HZZA 3THXB 1V5GA 2QJRA 1M74A 5GVRA 1VBMA 2P35A 3FYTA 3ZD8A 4LZJA 1XI2A 2HO4A 5TVGA 1UP7A 4DCUA 4BNUA 1O95D 3JQCA 2IZ0A 3W4KA 2EF0A 4GXQA 4O2AA 3DVAA 1D4FA 4RVCA 3VO8A 2PGLA 4HNRA 4ETMA 2ATCA 3KAJA 2VTEA 3Q3HA 2HWYA 4IXMA 5HIIA 4L8FA 2G1UA 3K15A 4MVWA 4RA6B 4TS9A 3SF0A 3DLHA 1KNQA 4RCYA 2Q9CA 4EPTA 2GOYA 3IKTA 2R2AA 4QPZA 2IKSA 2Q1YA 3CNQS 4S35A 5TPZD 2HRQA 3TGLA 3ILXA 4XKJA 3OO1A 5DWDA 1SA0B 1ZBQA 5E6UA 2ZJ8A 5F5LA 4RKWA 3TS1A 5BV2P 2I2WA 4CT5A 1TK2A 1ZK2A 1Q7EA 3B1ZA 3BGIA 2PT5A 1L5WA 3MYRA 3NNSA 4QU8A 5I9TA 3LJKA 3FTFA 5CVVA 3ZBUA 10MHA 5TT0A 1G1MA 2P6NA 1G9TA 5AQEA 3SJAA 3TTVA 2Z8YA 3FOFC 2YIMA 3WLJA 3P96A 1ZM7A 4TWAA 2QENA 4YI5A 1W5EA 1JU3A 4LDAA 1WTCA 2XEXA 3EEIA 2CWWA 3S1AA 1OBOA 2NN3C 1XMQB 4GNKA 4KR6A 1GPBA 1ZM9A 3EIEA 3KJQA 4X1YB 4B2PA 1TC1A 2KW5A 1XJ0A 3PEFA 3HCPA 2YWHA 4HAVA 4W8HA 3WJ7A 3F5QA 3OT4A 5DGHA 4C3VA 4C7VA 4KZPA 4QFDA 3L5OA 2XUJA 4UMVA 2JVKA 5IM4F 3GLGE 1E6KA 4V1CB 3NDRA 3RVMA 4HYTA 3WMFA 4EFMA 4RQAA 3LQ4A 1B14A 2H54A 3DR5A 2PQ2A 3DE0X 5G0TA 2PT9A 3KJFA 2X76A 4LIPD 3ZHRA 1M2FA 4WKPA 2JH3A 4L8LA 3RYIB 1E94E 2OHHA 4JXXA 1N33B 4U5XA 4Z51A 1DO2A 1PQUA 4HNSA 2I5PO 4OGWA 3WTCA 3FFTA 3GFFA 3ZWBA 4DJ5X 3O74A 1LEHA 2PD6A 1QDLB 3H3XA 3CX8A 4UJ3A 3OZEA 5E6RA 1YO6A 4OHKA 3UC9A 3CPHA 5B58C 2ZS8A 1RKQA 3GCZA 4IHAA 4JBHA 1HYEA 3QMVA 5C8YF 3WI7A 5HDBB 1TX4B 3TD6A 1ACMA 3SXUB 4F45A 2UUBB 1EFAA 1FLAA 4GX2A 3N2GB 4MKIA 5ECGC 3SX0A 3VAYA 1DAPA 2HCJB 3HA3A 3I6QA 3N0RA 2Z56A 3A36A 3CCCA 1TQ2A 3IQGX 4Q4HA 5EE1A 3WB1A 3CLRD 3TX6A 1TMOA 1YS1X 4DJAA 1SCUB 4K1XA 4OQZA 2NXEA 5JCOA 3CBGA 3CEJA 4XCVA 5FJIA 3V8BA 2J3EA 3OJOA 1HDCA 3HDGA 2EQ5A 3VVCA 3H2YA 5IVKA 2VQEB 3C4QA 1SKUA 1JFFB 1JVBA 1UK7A 1UZAA 3NFRA 4LOKA 2I7XA 4OXKA 4R8RA 4UZFA 2GX6A 4KQKA 5LBUA 3D4IA 4PPFA 3QWHA 2H4HA 1QG0A 3RSSA 3PJGA 2B78A 1H2AS 4KYUA 3O26A 4H1VA 4K9MA 3ZWPA 5IUJC 1OZFA 3EIHA 1YNSA 2CJWA 2I8CA 2BHNA 3RC3A 3X2EA 1AE1A 3R5TA 1H2XA 4HMQA 4X8HA 1ICIA 4RPJA 1X1RA 2HLDD 1KPGA 1H4QA 4MNTA 1E98A 4KXYA 4I50B 1WW2A 2ODQA 3K0EA 2V96A 1SKQA 2PO5A 2VP6A 3GROA 4L16A 5CD9A 3TW6A 4BXOA 5F2EA 1T8YA 2RKBA 3T06B 4EB3A 3PIIA 3OQJA 1ZCAA 4KMSA 3UBTA 1HR0B 1VB5A 4OPMA 1V35A 3MQFA 1O08A 3AV3A 4V0SA 1NKSA 3DKPA 1JJAA 4CHTA 1UK8A 5FYDA 2ILTA 2VO1A 4M0KA 1CY8A 1LS6A 1QQ5A 3W6PA 1U4SA 3JZMA 4OGLA 2HCTA 3LPNA 3GEMA 4Q3LA 2W22A 5TLSA 1QF7A 1M2WA 4IW3B 5DCUA 5EMJA 5P21A 3UAOA 1WCWA 4ZEVA 2OK7A 1DBRA 1JT9A 2RHRA 3AINA 1Z5NA 2HIHA 4HS4A 4L3OA 4WFJA 5EZSA 2YWCA 4V2IA 2O5EA 4QRDA 1WXEA 1CJTC 4PAOA 1E62A 4NRDA 1WOYA 1M67A 4EYKA 1WB4A 3AUXA 1Q2UA 3DFUA 1I1NA 4FNMA 1YZLA 4N5MA 3PJRA 3U3XA 1PS0A 1V39A 1NR5A 1V96A 3GJRA 3WQBA 2BGTA 2DHEA 2C3OA 5FP0A 5HIKA 5BR8B 1QIJA 2E4AA 2O8DB 3BCRA 3UG7A 4NV3A 1O97C 2EP7A 1FVXA 3ECSA 4ZODA 3IYLW 4Y6QA 2ZSIA 4F4JA 3V4FA 4ZYUA 4UPVA 3I6IA 4E5PA 2H4WA 2CB0A 3GK3A 3LZ6A 4WDQA 4M21A 4X97A 1UBHS 2IU3A 4HAWA 1IONA 1O58A 2GCEA 5I8WA 3EGDB 4Y1RB 3UY4A 3VO2A 3CRVA 4HQKA 2ZANA 3RKSA 1XTUA 2IVFA 1M7HA 2WF5A 4DPLA 4HQRA 4CKWA 4IJKA 1VB3A 3MRSA 4WKCA 2XUQA 4ARZB 4WAUA 4AIIA 2WIFA 5BYJA 3DTVD 4WINA 1JR2A 3QNMA 1YC5A 4O1MA 1XEWY 1FVHA 2H11A 4IKPA 1J0BA 4GVLA 4PO1A 3PQFA 4G0YA 4ZQBA 1L7OA 3EYAA 3ZWKA 3TXYA 1XHEA 2HK9A 2UVPB 4UNIA 5ARCA 5C35A 2OHJA 3KRTA 4TRNA 5AVWA 2X5JO 1TZBA 3O73A 4M1YA 2UZ4A 4G65A 5KJ6A 4C3UA 3DXYA 3G8BA 3TLXA 3LC2O 4N7JA 4GXTA 3FCCA 4C0SA 4D9HA 4DV1B 3NOXA 4X61A 5HK8A 3D8UA 1L5RA 1IIRA 3G2LA 4K28A 5HIJA 3ZTWA 3SSNA 4C4AA 4B4VA 3HBFA 1AKYA 1V43A 4U9IS 3L02A 3LHSA 4FCCA 1YUNA 4AECA 1DSSG 2ECQA 5J2UF 2VTBB 5C1PA 4FNGA 4M7RA 4DKXA 4OU5A 4M0MA 2WU3A 4Q3BA 1S2IA 1XVAA 2V1XA 2X1LA 3PL5A 3QTBA 4NU8X 3X43A 3LWNA 2X3FA 5ICEA 3EJWA 1ZM2A 3V7UA 3I9LA 3BX1A 3HJBA 1N2HA 2AOUB 1A9SA 4NCAA 4I9FA 4A0FA 3LCJA 1VE3A 1FUYB 4XIGS 4P54A 2A5LA 5EHGA 1AZSC 3PRYA 6REQB 3I6MA 3DULA 1SR8A 1JBKA 4TT8A 1SUCA 4IIJF 1N78A 3AM4A 3CNEA 3TQOA 3WGZA 4YCCA 2GQ0A 3MF4A 4ZT2A 1SU6A 2C00A 5L7YA 2I2CA 1IZYA 2Z9DA 4GMXA 2FN4A 2YJ3A 2YQ5A 3V8NA 2HMWA 3ADOA 1VJ5A 3T3DA 3C2QA 5EIFA 5JZSA 2ISCA 1HH4A 4IZHA 2Z5GA 4QHSA 1W85B 2R8BA 1B0PA 2WD8A 1W49A 4DT1B 2EW8A 2KX7A 1U04A 3A4NA 4F96A 2JCYA 3B48A 2C4HA 4PINA 5BORA 1H6BA 1GOTA 2H5JA 4CKCB 1Y9ZA 4DUPA 2W6MA 1HNXB 1GTG1 1GTVA 2E3JA 4DRZA 2XT0A 4DN6A 1U1CA 2C7GA 1ZP6A 4RGVA 3OCCA 2XMSA 2G72A 2CXXA 1JDVA 4UTPA 4FFOA 3RQSA 2OXRA 2D8AA 2FW6A 2O2XA 3WK9A 2PX0A 4MRSA 1LPSA 2R6R1 3BE5A 1DARA 4A9AA 4MXDA 3FVWA 3D31A 1MOQA 1I32A 4LI0A 4RA9A 3EVNA 3GOQA 4CFZA 5JSUA 3OJCA 2CEAA 4QEZA 1ONPA 2REOA 2HV8A 1WXHA 2PAAA 3ZE1B 2HA5A 4P58A 2GCOB 1NQUA 2RIRA 1XVUA 2UZAA 4JMPA 2CHFA 4K3VA 1GITA 4HNVA 1T6BY 1XGKA 1Z6GA 4AJJA 3PV0A 1XQ1A 4J0IA 3CF0A 2XECA 5AVZA 4CKEB 1IL0A 2CVPA 3A6JA 4EYGA 1ESDA 5F4ZA 1B41A 4JSTA 4UTOA 4O2BF 1U0TA 4KXVA 1O5IA 5AI6A 4NZYA 1MRZA 4ZZ2A 3G5AA 4HUTA 2F3RA 1UM8A 3GLVA 1FYVA 4E6EA 3F71A 3AR5A 1FP4A 3EUEA 2AMFA 3JTEA 4F3YA 1T3ZA 2PL1A 3FJOA 2JZNA 4PLPA 3GVHA 4OD0A 5B3JA 1GA4A 3BFJA 3E1SA 2F55A 2A0KA 5M04A 1NC1A 1GPDG 4JX9A 1JN0A 3T99A 4JI1B 5D01A 4A16A 3OZCA 4B0PA 4BNXA 5B4TA 1PEKE 4OQQA 2QQEA 1DAOA 1WHSB 3LW8A 4MAMA 4PVDA 3RKUA 1GPNA 1XMXA 3HKBB 3IA2A 2YL2A 1E6WA 1JVSA 2OCXA 2PBLA 3H1BA 3RUEA 2BR5A 3W04A 4ZI2A 1QZXA 1NAHA 2B5OA 3CUUA 2FG7C 3UMSA 3TTWA 3DQPA 4AZSA 3GGGA 2CB9A 1H23A 4MEJA 4P4TA 4TKMA 5KREA 2Q3DA 3RAFC 2O5CA 2BRUC 1DRJA 3DXZA 3FPLA 3LUDA 3HGQA 5CW2A 1YQ9A 1LI4A 1SHKA 2AEMA 2OUKA 3IMFA 4EFKA 2IDMA 4WVLA 2E4YA 3HU5A 4CV0A 2ODWA 1Z2EA 3K9QO 1QFMA 4EZBA 1GY8A 1UJ4A 1VG9B 3FI0A 4GE0A 1A7KA 1J2YA 1T2NA 3H2GA 4AIRA 1NF2A 1G3MA 3GEPA 3OX1A 3Q88A 3S2IA 4GP7A 4WOPA 3OM9A 4OIFA 4AJ9A 3DLAA 2GHRA 2ZRBA 4MVJI 1KWGA 5DLYA 4WN9A 1RAAA 1L2TA 4NMWA 3QHPA 2YXNA 1N0WA 2FSVA 3GVXA 1SUFA 4KMMA 1GZ4A 5IARA 4L07A 3VPCA 3ML1A 4L3VA 4B3HA 1N0HA 4CQMA 3OIGA 2QJFA 1YI1A 3I9OA 3P0RA 3CO0S 1UFKA 1XUOA 4GDMA 5K5EA 16PKA 2M9MA 3WC4A 1OUMA 2PLRA 3RVJA 4B6JA 3EZLA 1KI3A 4NBNA 1E9CA 2HT6A 1E1CA 3AJAA 3M6XA 3DE3X 4HI0E 3WWDA 3ZI0A 4UPEA 3K6RA 3Q1KA 5JRJA 1GPWB 1JFVA 3GDFA 4A6PA 5B3KA 1N9KA 4EHKA 1CFJA 1E2FA 2QPOA 5IKMA 1ORDA 4PZDA 4BATA 5LQCA 3GLKA 4OM8A 2WJ6A 3K9FC 2YKGA 4ECEA 3OG9A 4A0RA 1MOPA 1NBHA 3B3AA 4ESOA 3NYRA 4Q4CA 2YHIA 4M9XA 3ZE7A 2V7BA 3GFOA 4HVLA 1MB4A 1L8OA 3KTAB 2E89A 3DB2A 4YJGB 2JS7A 5GVSA 3NRCA 4F56A 3H2ZA 1XZHA 4P2BA 3QKRB 1ULUA 1U11A 2FQQA 2YWXA 1PJ8A 3MJFA 3W5HA 2RHCA 1OX5A 1MXFA 4OQLA 5KNBH 2W4MA 4BLOA 5I9NA 1JIIA 4WESB 5AKLA 2Z04A 1J9EA 1FQJA 5DOZA 5ALVA 1L4UA 3H9JA 1CQPA 1B0ZA 3D0RA 1C30B 9LDBA 5I7FA 2YVQA 1Z06A 3VHXA 1E5DA 3A9CA 3C87A 2CMDA 4QNNA 3NYWA 3TKLA 3PS9A 1Q22A 6GPBA 2J3LA 4FOLA 1H93A 1VQ1A 2NQ2C 3R7LA 1Z8HA 4WBSA 1L1QA 1VJRA 3L0IB 1WEKA 1G8HA 3PCTA 3JYOA 5IBCA 3N2KB 3PHGA 4UM7A 4XSHA 1L4HA 3KSMA 1WNFA 1JR3D 3ANMA 4C0AC 3PNKA 1YOBA 1OCEA 2QVGA 3KHSA 3SF8B 3DJFA 5G0SA 1TIBA 5JHGB 4O08A 1I33A 5IK2A 4LY0A 3FD8A 4DRYA 3GQBA 4FR0A 3HADA 3GPLA 5ADHA 1R0YA 5I7HA 1WZ2A 5EAIA 5L3QA 3HQ4O 1SUDA 5AM0A 4PYKA 3X0DA 4DCTA 5CCEA 2FVYA 1FZQA 1II8A 4LGCA 3DUWA 3JQFC 2QORA 2YMMA 3F96A 4MWSA 4PYLA 1PR1A 3EZ6A 3I09A 3SF8A 4D0RA 1CBUA 1NQXA 4MPTA 2QSYA 3T61A 2B69A 4TQGA 4Y0NA 3OQOA 2HWUA 3GDOA 4QUIA 5F4BA 2ASEA 1HY3A 2Y1DA 2O57A 1XZMA 4UUPA 5JC1A 3L0ZA 1PGQA 4KXMA 3GEHA 2XI4A 2GERA 2QAGB 1WSWA 1MEOA 1GG9A 4J0GA 1S7CA 2J3MA 3DE7X 1OROA 2ZIXB 2X8LA 3KLPX 3N2YA 2LCQA 3VC2A 4B48A 5HTOA 3USZA 2NXWA 1NBWB 2CK3A 1DS6A 1E79A 2E4UA 4X6LA 4GYJA 2D1RA 4FZJA 1VECA 3WHKA 5IJWA 1Y3HA 5KZMB 4PXAA 4ZPXA 3A2KA 5FBRB 5FORA 3KIPA 4D43A 2DWOA 1CW2B 5JMPA 1CNFA 2DVMA 1JECA 2O06A 3H65A 4XB6B 1B74A 1JLLA 1X70A 2O14A 3SEAA 3VUFA 5HYVA 3KZVA 3D6VA 3I53A 1E96A 2Z2ZA 4MV5A 3RODA 4B76A 4JLWA 5LWQA 3VU8A 3LECA 3VSEA 2BFEA 3KEFA 4HLUA 4A73A 4NARA 1K98A 1KZ9A 4CTOA 4RF2A 5CCBA 1T5IA 3CWCA 4RL4A 4DV6B 3ZU4A 1QYWA 3FAKA 5D3ZA 2ZTLA 1Y42X 1EHIA 3EFOB 5BO5A 4RSMA 2BFBA 1TEVA 3OTIA 4PZYA 4DIBA 1NI4A 2G7MC 1K75A 2PM8A 2HU8A 4WZAE 4RWEA 5E0OA 4C29A 3X1YA 3G0DA 2NV2B 2OHFA 4BE9A 5LP6A 3M9WA 5A3SA 4C0HA 5B30A 1KBZA 4OOFA 2BKUA 4KPEC 2GK6A 3KYDB 1XAGA 3EEFA 2VEOA 2V4MA 2O59A 3I3SR 2FPOA 2HA3A 5EQJB 5CT6A 3JR7A 4U7JA 3I01M 2YIJA 1QFYA 5J43A 5A71A 3RW9A 4OQMA 1TD1A 2R1UA 5DRTA 2BE9A 5I5GA 5LIPA 3QEBZ 4W4TA 3BZBA 5CRIA 3NTQA 4X94A 3F73A 4K9OA 3NC1C 3WRYC 1FNCA 5JBNA 4D5EA 2DY1A 1H69A 1Z5ZA 3M5DA 2YQ4A 1JLSA 2DF8A 2V3WA 3PE6A 4XARA 4EAAA 2DPYA 3AETB 3LBHA 3OKAA 4RZ2A 4BWVA 5A2GA 2JDID 3CVWA 1UC9A 2C4WA 8ADHA 1EWKA 4MYTA 1X0VA 3VJKA 1L7RA 1U31A 4LYAA 4QBTA 4LN1A 1OI7A 1E18A 3OHSX 4M98A 1ZGHA 3O4FA 5D1NA 2PRYA 1QU2A 3O4IA 3OCYA 4ZMBA 4FYWA 1XCOA 3RVLA 1Q57A 2M6SA 1NJSA 3R7NA 2F8LA 3MHPA 3HH8A 4Z0HO 3AM5A 2IWHA 2DFDA 3EG9B 1J1IA 2HREA 3I9NA 3M4JA 3M82A 4RHXA 3UCFA 2RGGA 4AWAA 3CZRA 1TF5A 2J7PD 4N9QA 4ZVSA 3B1XA 3IP6A 3PL1A 1KI9A 1PGNA 4N3CA 5E1BA 1GPJA 1FQOA 3D3WA 1YDFA 3JSXA 4IV8A 4IICA 4NECA 3RBVA 3OKPA 1J9ZA 5JQGF 1QH0A 3Q72A 2CF6A 3Q4GA 4OY3A 4XX0A 3TZEA 2J07A 3VU0A 4RA9B 3HSKA 4EJSC 1IRXA 4PHTA 4XWKA 2HF8A 1Z0UA 2WTNA 4DLBA 4DZTA 1RKVA 4A15A 5LKRA 4REOA 4DV7B 3RIXA 4DRXB 1UADA 4JA0A 3SIXA 1IH8A 4LY6A 2NPFA 3QE2A 3WL6A 2D1YA 4X63A 1FDOA 1REQA 1UDCA 4RIFA 4C5AA 1DC7A 3MOIA 5DLEA 4EEXA 2DEUA 3CF6R 2H9IA 5EPEA 1QE3A 2B8NA 1LZKA 4OJNA 3BTSA 3PEWA 2GKSA 3SVTA 3TIIA 3DOEA 4WNAA 1ID1A 5HW0A 3LT2A 4X93A 5E9AA 4BNVA 2A1IA 1N6HA 2PX2A 3BRQA 4R83A 1IMOA 2W2LA 3HVJA 4D8YA 2A84A 1F0PA 1EQAA 721PA 4HEA6 4MIEA 2DYKA 2IYTA 1CG6A 2EZ9A 1DNPA 1ZJ5A 2PXHA 3FWYA 3A11A 3I3OA 3ESYA 5FTMA 4A0HA 1NQVA 3E9RA 1ULSA 4E2XA 5CBPB 5TQ2A 1K7XB 5F1PA 4TVKA 2XRZA 4QFCA 2QRLA 4DLKA 2O7NA 3MJDA 5FO0A 3G5UA 2QI9C 1SXPA 4D3YA 3QEOA 3PITA 1O54A 2XMDA 2AEFA 2RHOA 2H7XA 1G41A 5JXHA 3LLVA 3LDAA 2QTCA 3MWLA 1FYDA 2XRMA 3GGCA 5ECDA 1GGFA 1FBNA 4ZOBA 5HMLA 4I5FA 4KNYA 4HZGA 4X3PA 4RPLA 5I9SA 3P4UA 2QUZA 1C1DB 4PGAA 4Q5IA 4R2MA 3DEKA 1WQ3A 1EK1A 4DSNA 3TZ6A 4I1SA 2FFJA 1C3EA 3OJLA 2QKYA 2Y1KA 2O2DA 3ZE2B 1J8YF 1NP7A 3F67A 3HDYA 3R3XA 2HEGA 4U4AA 3ZGNA 5AW2A 5K0TA 1XZAA 1NVAA 4G89A 1AKUA 2QSUA 3HXKA 3OJEA 4GGMX 3MIIA 4HFJA 1NXQA 2FUEA 1RWVA 4WOCA 4E07A 1JHQA 2OESA 3GH1A 3GJ5A 5ADVA 3BTVA 2XVAA 2FWMX 2IV2X 4D4LA 1RHQA 2NO9A 3A6ZA 5DLDA 3TK1A 2X9GA 1WVMA 5CP8A 3NWEA 5B3LA 4Y2UA 1EJ6A 3R8CA 1EFUA 4FJ2A 2YXPX 2HDHA 2ZQZA 4OV6B 5CFRA 5D7BA 2X9QA 4OH1A 1NVXQ 1N3YA 3DW3X 4BB9A 2D7CA 4B3IA 2QTMA 3L93A 3UPUA 1UF9A 5HFJA 1SUWA 2C2GA 3CRW1 1JDSA 2WM8A 3W5JA 3RFTA 1WKVA 3U4HA 1T4CA 5JJIA 3OSZA 2W4QA 3BXOA 5AUPB 3GP5A 3A9WA 1ZFNA 1XLTC 5KVVA 2VTVA 3FDXA 4JB8A 2V9ZA 1KI8A 3I1IA 2Y1EA 1GFZA 5FIUA 3ECCA 1S8FA 4HPXB 4N8SA 1I2AA 2OCBA 3E7WA 1C8BA 3GLTA 4HLUC 1G98A 1J70A 1QGZA 3DH0A 4HP8A 1OFIA 3I4LA 2CL0X 1KKMA 1S2GA 3T1HB 1KEUA 3KJEA 4V0QA 2XBMA 3B9RA 3RLFA 4B44A 3QBVA 2MYTA 4N4AA 1SK8A 2PGNA 5DBHX 3ROQA 1HQDA 3N0TA 2FWIA 1O0SA 3O1IC 1ISMA 1DU4A 2G9RA 3DBLB 1JHZA 4X95A 4EX6A 2G36A 2B8JA 3EMKA 5C9ZA 4FEAA 3FLBA 3MS2A 1EGMB 3FBWA 3KWLA 3A31A 3Q40A 5F3DA 4GKAA 3T4XA 1DG9A 3I32A 1TVEA 5EINA 4HC4A 5FBQB 4RFSA 1OB5A 1ECFA 2WTAA 1AXEA 2BZGA 3F6BX 4E5VA 2ZBPA 3NIWA 3AB3A 4HMPA 1NFRA 3UXMA 2PXAA 4V0LA 5KJEA 2IIQA 3WJ2A 2ZP1A 3FVQA 4HDSB 3ZD6A 3NGXA 3BXGA 2L2QA 1DT5A 1QRDA 3B2QA 3M1IA 4LPSA 4M9SA 1T4BA 5DHTA 3BE8A 1FJ2A 1YDHA 3ONWA 3QLUA 4KO1S 4XJXA 3R4VA 1PR9A 4PICA 3SJUA 2O2HA 2APJA 1F4PA 1QHSA 1HC7A 2XA9A 1PFQA 5IC4A 5DN6D 1OGJA 1U7OA 2HMYB 2QJTA 3QUCA 3C6XA 5DIFA 4RXTA 1D8AA 3PICA 5M3BA 1IATA 1X3LA 5K8CA 1HDRA 5K3CA 3DAFA 3KQKA 1IZZA 1R9JA 2GPAA 1HRKA 3JD4A 3KAKA 5JQGA 4UHFA 1M0EA 4JQZA 4LJAA 4YWHA 5ICFA 4B9EA 4EMBA 1NVEA 1IUOA 2LDXA 5JYDA 3SX2A 4P80A 2QDKA 4RCZA 3W6UA 3JATB 1VHJA 3O95A 3KZNA 4DHWA 1ZKMA 2WWHA 3UGTA 3MPOA 3QLEA 1ZISA 3ORRA 1A4RA 1OA1A 1VCOA 3Q2KA 2V97A 4OJMX 4B4KA 1T1JA 1Q7BA 4OKNA 1U2QA 5DYIA 4DM4A 2G88A 2R1VA 5JVDF 5GIOE 1IN4A 2JATA 3MINA 3OPXA 4JP8A 1YS4A 4RL6A 4KNVA 4O25A 1TAQA 4R31A 4HB4A 2P0EA 4ILKA 4UHKA 4QGFA 4CIBA 3VU1A 4PG6A 3KV3O 2WNHA 3AY7A 2HDOA 3QW4B 5BRNA 4LX8A 2HPVA 1RACA 4R2XA 3WHPA 1QRTA 1RIFA 4UNQA 3EASA 1U0LA 3K8QA 3K9HA 4HCJA 4DYVA 2HA4A 3TOXA 2IQ5A 3GGDA