3R7SA

Crystal structure of apo caspase2
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
159
structure length
159
Chain Sequence
MQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Caspase-2 subunit p18
publication title Structural and enzymatic insights into caspase-2 protein substrate recognition and catalysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 159
sequence length 159
chains with identical sequence C
ec nomenclature ec 3.4.22.55: Caspase-2.
pdb deposition date 2011-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r7sA00
2P2CA 3R6GA 5H0IA 4NOKA 3KJNA 1RWXA 3R5JA 4FGUA 4DCPA 4QTYA 1K86A 5IABA 4NBNA 1PAUA 4QUAA 4EJFA 5I9TA 2FUNB 3IBFA 3R6LA 4JR1A 4ZVUA 3V4OA 5LUBA 4PRYA 3NKFA 5K20A 2H48A 5IARA 4EHKA 2HBZA 2QL5A 5IBRA 1I51A 2QL9A 3GJRA 4ZVTA 1SHLA 2XYPA 3SIPA 2XYHA 1PYOA 2H4WA 1CVRA 4N6NA 4QUDA 3S70A 5IASA 3R7SA 3R7NA 5LUAA 3V6MA 2QLFA 1ICEA 4N6OA 2J30A 1I3OA 2CNOA 4JJEA 4N5DA 4ZVPA 4JJ8A 4ZVQA 3PCXA 4QUGA 3OD5A 3UOAB 2FQQA 2HBYA 4PS0A 4QUIA 1GQFA 3ITNA 4NBKA 2C2ZA 4QU0A 2CJXA 4QUJA 3H1PA 4I1PA 3S8EA 3QNWA 1I4OA 2QLJA 1SHJA 3DEKA 1QX3A 1NW9B 4FEAA 4NOMA 5IBCA 3GJTA 2H4YA 4JB8A 4M9RA 2DKOA 1RWVA 1SC3A 3H13A 3H0EA 4JQYA 4NBLA 2CDRA 4FDLA 4FXOA 1RHKA 1RHQA 3UO8B 1RWKA 2J31A 4DCOA 2C1EA 4JR2A 2Y0BA 1KMCA 4N6GA 4LSZA 4D3XA 1CP3A 3K7EA 2CNNA 4HQRA 5IC6A 3E4CA 3PD1A 4EHLA 3NR2A 4EHDA 5IANA 1RWPA 3DEJA 3D6FA 1RHRA 2C2MA 4JR0A 4QULA 3IBCA 4QUHA 5IAJA 4HVAA 4QU9A 2Y1LA 2J33A 1NMQA 2FP3A 3GJSA 3V4LA 4EHFA 4HQ0A 2J32A 4N7JA 5LU9A 3D6MA 3H11A 3NS7A 4N7MA 4PS1A 1BMQA 1QTNA 2NN3C 2CJYA 4QTXA 4ZVOA 1JXQA 4D3YA 5I9BA 4IEFB 5IAEA 4AW9A 4I1RA 3V6LA 1I4EB 4QUEA 1RWWA 2H5IA 3H11B 3PD0A 3DEIA 2H65A 3GJQA 4NOLA 4JQZA 1NMSA 4PRZA 5LU8A 4JJ7A 4QU5A 4EHAA 1RHMA 1IBCA 4AWAA 3R5KA 3P45A 5IBPA 2HBQA 2QLBA 4ZVSA 3RJMA 2WDPA 3KJQA 4IYRA 3R7BA 1F9EA 1GFWA 2H5JA 3EDRA 2C2OA 4EHHA 1RHJA 1RHUA 3V55A 2H51A 4EHNA 4QU8A 5IAGA 1RWNA 3V3KA 2XYGA 2AR9A 4NOJA 2K7ZA 5IAKA 2XZDA 2CNKA 4DCJA 1RWMA 2XZTA 2QL7A 2H54A 4AWBA 3BIJA 2HBRA 1K88A 1RWOA 4QUBA 1F1JA 3DEHA 4ZVRA 1M72A 4D3ZA 5IC4A 3SIRA 1SC4A 1QDUA 1SC1A 3EDQA 2C2KA 2CNLA 5JFTA 3KJFA 3P4UA 1NMEA 3D6HA 1RE1A
chains in the Genus database with same CATH superfamily
3A7EA 2CJFA 4PZ0A 5L51A 1ZBDA 4QTYA 4Y2UA 2EDAA 4FYVA 2ZT6A 1KAOA 2B69A 5A7FA 5DWVA 5DASA 2MINA 1DAKA 3C3XA 3OLYA 1NBOA 4TMXA 4DN6A 3I6MA 2O8NA 1NI3A 3P0IA 4ZT2A 5ICSA 5JS7A 5JYBA 3NJRA 4R8RA 3VBEA 3IQZA 4PC6A 3VNVA 1NW6A 3BVPA 1PEYA 1ZG3A 1MB3A 3KQTA 3EZGA 1F60A 4OK3A 5HS4A 4RY2A 4HVCA 4TSRA 5A3JA 3KQVA 3L06A 4FCCA 1HZZC 3RYHB 1PZEA 5HUJA 5KTNA 5HSGA 4C0XA 1AUQA 2XHZA 1L9XA 1QGYA 1JUDA 1QZUA 2CL0X 4R8SA 4EQ6A 1YS7A 2XMRA 3MT0A 4BVJA 5L9AA 1ZWLA 1KR2A 3UMBA 1TM2A 3DNMA 4LJAA 1Z4PX 3TD6A 2RE8A 2OCDA 3BGIA 2FCRA 1R0SA 3MD0A 3UK6A 1Z3CA 2D6FA 1JA9A 3CRQA 1JAIA 2OV1A 3TWOA 3DKRA 1KZ7B 3V8BA 3WJ7A 4G8BA 2A5YB 1Y1SA 1WMEA 2UVQA 1TU3A 3ETEA 2XVYA 3LT4A 3QVUA 4F72A 1N2CE 3E0XA 5CDFA 4EFMA 2JAPA 5DSXA 3EH1A 2JAQA 3L3BA 2ZBFA 2A0YA 1RQNA 4YO7A 2IHNA 1GQRA 3DYBA 4PX5A 3C3JA 2R6ZA 2R7MA 1TU4A 2D0DA 4U9HS 5C35A 2ONCA 1V39A 1ZD5A 2GD1O 3IAEA 1Q50A 5IU6A 5FUYA 3WA7A 4EQZA 2YJTD 5AK0A 2ES4A 3DO8A 3WY9A 1Q1GA 2X7XA 1FRFS 2GNOA 1DCMA 1KVTA 1V16B 3C3PA 3ESAA 5H3CA 1V11B 5U1PA 2VNIA 4LBYA 1JB9A 1W59A 1FW6A 1IOVA 1DAFA 1KA9H 3HDTA 3GY0A 3LWDA 3I0ZA 2NO1A 4QM6A 1JHVA 4ZQGA 3IBCA 3H9EO 1XEWX 4HDNA 4OQLA 4FGZA 4G24A 5DW0A 1AZTA 1XYVA 4FMDF 1YZTA 4UVHA 4AO6A 1T9CA 2XMDA 4FBMA 3I34X 1D0SA 4PPNA 3ZWPA 1C1DA 4B0PA 2IPMA 2FI1A 3LKBA 2V1XA 2X3YA 3L8FA 4QDJA 2Y0CA 3MZ0A 3NHAA 2C2GA 2FQ1A 5H4GA 4LNAA 1C0IA 1QZTA 4JWKA 2R8YA 1KOJA 4KBFA 4BQFA 1SOVA 2H5IA 1SIUA 2R5NA 3IEKA 2HK7A 1Q7EA 3FKQA 5DWDA 4RHTA 1T6XA 2OV4A 4LVOA 5DDIP 4OH1A 3HFJA 3Q40A 1PW7A 2IIPA 1T2VA 3H9QA 1SD5A 2BR4A 2HA4A 2VDVE 2XMPA 3K9NA 3L02A 3X1JA 3KWMA 5L7TA 3TI9A 1RACA 2VH5R 1NUTA 1SVLA 1QNFA 4JLNA 3ZVRA 3HSSA 4D9CA 1FDOA 1E2IA 2ZZKA 4BAZA 1VQ1A 3LPLA 4DB2A 2I4LA 3KXLA 2UZAA 1GTVA 2H1RA 2Q2WA 3EQ8A 3GOQA 1R8SA 1GPYA 4TTPA 2P3SA 4W5WA 1SG9A 1U3CA 4L8LA 2BFEA 4FMPA 5H8WA 2F64A 5I47A 4I50A 1ORWA 2DR0A 3W3AD 5DTEA 5FI1B 2FPIA 4KVAA 2P9YA 4GBJA 5ALJA 1ZMRA 2CLDX 1UC9A 2X4DA 1EP9A 3V1YA 2CB0A 4CXMA 2PGAA 3V8VA 4BWFB 4EFDA 1T26A 2BRUA 4FZ3A 3Q3HA 5T3YA 4UHFA 3GGCA 5A05A 1EK0A 3GLHE 2ZIZA 4GX2A 3MOIA 4YV0A 1OILA 1B42A 1L4MA 2GESA 2X0IA 2GPBA 4W6QA 4DY6A 4JZYA 3MAGA 1C8VB 1UBEA 2FPMA 3MJVA 2Z4RA 5B3JC 5LKRA 4L9RA 1F2TB 1MH9A 4JJEA 1V6SA 1PR9A 4L72A 5E2AA 3UFBA 4FCTA 5MHTA 2E7ZA 2LR0A 3EGVA 5SYMA 2WKRA 4HEA6 4E88A 3QI2A 1Y8RA 3AXSA 1G8GA 3ANXA 2DAPA 2XIJA 3QFCA 4EMSA 3ND7A 2IYOA 5K5EA 3CG0A 2WW8A 1AA6A 2JLAA 1UK6A 1YKSA 4GVPA 1TJ3A 3ZCQA 2WIFA 5ADUS 5A9SA 5JJLA 3FYSA 3VR0A 1YASA 2NTYC 1U2SA 3PFKA 3BGDA 4BRSA 4O3MA 4DOMA 1F0YA 3H04A 4O59O 1CUGA 3N86A 5ITZB 2IXAA 2XA9A 1KY2A 1MU0A 2BONA 2EKZA 3QP9A 3TI7A 3U0BA 1H2XA 4KO2S 2E1PA 3KHSA 1WCIA 4RESA 4ZTBA 5B2ZA 5CYOA 1EVQA 1RI4A 3PJDA 3W1WA 2ZE5A 1S2DA 3H1AA 4IKOA 4RIFA 2J3JA 2DUNA 4KRGA 1OCEA 5J2TF 1XPRA 3FMVA 2PYZA 3IDQA 2DQ4A 2YV3A 2ZQYA 2AN3A 1ISSA 4IIDA 1NSYA 5IAAA 1JE0A 1GQQA 3H2IA 3EWAA 3I9LA 1Y9ZA 1NSFA 3RNOA 3OE7D 5JCJD 2N9UA 1QB8A 3D2BA 4FNMA 4QGGA 3L1VA 4CI9A 2VK4A 5EERA 1XVAA 1W0KA 4K5QA 4KIUA 3UM9A 4P35A 5F1OA 3HCPA 4PLCA 4D96A 2FPWA 3NEAA 3TOXA 3ENZA 1DBVO 4AU1A 2O5CA 3JR3A 4OXXA 5JEEA 2FRDC 3WJ2A 3JYLA 4OPMA 4G5FA 3WLJA 3LYLA 4BPBA 5JSQA 4Z3DA 4E2WA 2CFSA 1Y5NA 2QTBA 4RELA 3T8YA 3WMXA 4LJ9A 2CFRA 2GJAA 2BKEA 4IINA 3AU9A 4TGLA 4ESEA 4KQ6A 5DTRA 4C43A 1UEIA 1XQYA 4BV9A 2ZI3A 3NHPA 1DXYA 1SKAA 4H7IA 1DBPA 5LYJF 3DCYA 5CM9C 3VNBA 1DUVG 4E2FA 5B3LA 4OJQA 2FPUA 2ZULA 5EGSA 5K1ZA 3V1UA 2XAUA 4YCAA 1U4SA 3PEFA 4IV0A 3KRTA 4ZFNA 5LCXA 4ON9A 3EGOA 4MRNA 5EIFA 3SF0A 1UOOA 2YR0A 5KS2A 2J0UB 1FNBA 4Q7KA 4RK0A 5DULA 2WHRA 1BDMA 3COWA 2H51A 2IVFA 1RWNA 4CG1A 3LQ4A 3PE3A 5FNVA 2ZI4A 2C3PA 1MQ9A 2J7PD 3T1OA 3A11A 2OQRA 3I1FA 3NAGA 4Z0NA 4HXGA 5FEUA 5I9LA 4LXYA 3GRZA 3UG7A 4CM7A 4E51A 4IUBS 4M98A 4R1SA 1EZ4A 5AJUA 1ZA2A 4LJSA 1QDUA 4LGVA 1MAWA 3SC6A 3THYA 4WBNF 3OM0A 4HS9A 3T1TA 2JJQA 2GM3A 3C2QA 3LGSA 3MGKA 1BA3A 1K86A 1PJ8A 1USGA 4DMUB 4ASUA 4ZCSA 3Q72A 1EVKA 3GGDA 5TPZD 1W5BA 3HA7A 3AUXA 3EB9A 1RQRA 3GJXC 1MJGA 4X8LA 1RTTA 2ZR0A 1KAMA 2P6MA 3AR7A 3EFOA 4HLUA 3H8SA 1ZX1A 1P1BA 1NYQA 3NV7A 4YDRA 1EJBA 2NW6A 3MUEA 4PLZA 1BX0A 4KDFA 5GJVC 5LZ9A 1YR8A 2DE0X 3TBFA 5KNDD 1YZVA 4B8WA 1EEHA 1DP4A 5KCMA 2IX3A 1NUAA 1LF0A 1T9BA 3HVUA 1X1EA 2KPOA 3JYQA 3ABIA 3WZ2A 3L6CA 2DWCA 2JRCA 2PBLA 2PSSA 2Z8YA 3CF4G 4ZOAA 1BE6A 4OHZA 3UOGA 4DWWA 3DMTA 4QRDA 3DBVO 3GA5A 3R6WA 4GOND 4NDAA 1UKCA 2P7IA 1ZUWA 3BS4A 1L7OA 2BUCA 1PNTA 3ZK9A 2GLTA 5D1HA 3BOSA 4R2JA 1J09A 3IBGA 3E70C 1V3UA 3O2NA 4GU5A 4I1YA 3WYBA 3CKKA 3I05A 4L73A 4ARSA 4QXAA 5KNCA 1IZ8A 1NJFA 1SBNE 5GIPE 4B3SB 2DJ5A 5AI5A 5BSRA 3VHLB 3EZXA 4F4CA 2G71A 3I53A 5DMXA 1T35A 1SBIA 2VEDA 3QK7A 3DHNA 3S8YA 4IFTA 1X2EA 4Q7LA 5K2MA 4ETMA 5A04A 4BXOB 2JKVA 2IP1A 1G3MA 2QRVB 3WK8A 3NBFA 3Q5EA 4TRNA 2YJGA 5B7PA 4YQEA 5C3MA 4CKCA 3G9TA 3NEYA 1WBBA 1U0RA 2ZPUA 1ID1A 4WZBA 1D9XA 2P41A 4W7HA 4AYWA 4RLQA 2A9PA 3OQIA 1XZBA 3GLSA 3RSFA 4MI1A 1PZFA 2FMHA 1I1OA 1AKRA 1NKTA 1WY5A 2OFOA 2IOYA 2CXPA 4LOIA 3ND8A 1QKIA 2DOKA 5FI0B 3WWCA 3ZZ0A 3JQAA 4L02A 3OOSA 1ONSA 4KVGA 1UJCA 2JZOA 5DJ5A 3H5LA 4Q16A 4ZIRA 2X2FA 4JR0A 3KNZA 1QP0A 1B74A 3A2NA 1L4NA 4UNRA 2IYSA 2NG1A 5A1JA 1KEPA 1Q3TA 2G8NA 3NS7A 4KSCA 4QFBA 1OC4A 3BB1A 4I5GA 3B1ZA 3WIDA 4PYQA 3WB0A 1NF8A 3LT5A 4IEFB 1DMRA 1U8AA 4MICA 5IAEA 2Y77A 4OQQA 3REOA 3DONA 2H2AA 4I6JA 3G6WA 4OQDA 3HDGA 1IUPA 1VIYA 1RBZA 5JARA 3AB8A 5HHTA 3QBEA 1SBYA 3IIKA 1RYMA 2JFXA 4NP6A 1SCAA 1X7XA 2HX1A 4JLMA 2GNPA 4H0CA 4BMPB 4NMWA 3SSAA 4CQMA 3DT9A 1I24A 4RKQA 1JEDA 1KMMA 1KVQA 2XODA 3QVKA 2G1KA 3SKYA 5B58C 3TRIA 2J9YB 2XD9A 3MMPA 4E11A 4OUKX 1EFLA 4HZIA 5K3OA 5KYGA 1Z8FA 3FLEA 5CA0F 1HX7A 2CLKB 5JJ5A 3UMVA 4HFMA 1XA3A 2OZVA 2ADMA 4RV4A 3ZQ6A 4TRRA 4ZGGA 1I2MA 1ML3A 3CNBA 4MEAA 3V9AA 4BP8A 3DV0B 1LBIA 3KEOA 3Q1KA 3Q2OA 1CRWG 4IIVA 4JX9A 4Q9IA 4JUFA 3UWMA 3FOAA 3AHDA 4F4DA 5CFZA 3H87A 1QOPB 1HEUA 2Q5FA 4J0KA 1UIRA 2WHQA 3TR6A 2WM8A 3CJQA 3WSVA 1GNPA 1NOIA 4CM3A 1ZOSA 3IP3A 3MTQA 3LXMA 1G38A 2F8SA 3RVBA 4H16A 2GN1A 3B52X 4JLBA 4KQJA 4TN1A 1EIWA 2YX1A 5IKXA 1ZVQA 4LRQA 4WSOA 5EPEA 3TZ6A 5KC9A 4B5KA 3ER8A 1DIGA 4RY0A 4V0RA 4S1NA 1KYQA 2IBMA 5H83A 4LZNA 2ZUTA 4WCFA 3R7DA 4V24A 2CSUA 1D07A 3R3ZA 2EKQA 2ZPAA 3H97A 1LBHA 1WMDA 3R7SA 3RSLA 3OZFA 5I7FA 1FYDA 1TVMA 4K8RB 4M7RA 2IV2X 4BRWA 2BUAA 2Z3ZA 1HUQA 2XE4A 3LU1A 3WO1A 4CLHA 1SELA 3OJXA 2XT6A 3T5BA 2ATCA 4NMMA 1PEKE 1P2TA 3GMIA 4N40A 2D5LA 2GEKA 4L9WA 2O2DA 4KITB 5KTRA 3HDVA 1Y1TA 3DZCA 1NJGA 3OD5A 3P2MA 4RFVA 1D3AA 1R6TA 1XZLA 2V55B 2QSUA 3E8SA 2OCXA 2ODEA 3WMFA 1AUXA 4DCGA 5GINE 3A3KA 3EIUA 1KE2A 1SKQA 2RCNA 5FT9A 4F96A 1C9EA 3PFIA 5JBNA 2X4GA 1W47A 1HE3A 2MSWA 4WN9B 2IH2A 2V6JA 2HMUA 3VZSA 4RORA 1ITZA 2O6LA 2HDWA 2HO4A 2ZIGA 1H1DA 5ALKA 1KDPA 1M66A 1R8QA 5EKTA 5JAIA 2BMEA 2EX4A 5K8JB 4UU0A 1REQA 2DFLA 1RHKA 4U7TB 2QN1A 1V8BA 3PPVA 4CLRB 1FSPA 1DZ3A 2VA9A 3EDYA 1S0UA 3TRFA 3UQZA 1ZMOA 3GUUA 3BRWA 5IM5A 2JLSA 3CW2A 3QU2A 5DTJA 5I3ZA 2FE4A 2FZWA 2PXHA 2VXYA 2XOXA 4NZYA 1IZ9A 3JPWA 4G67A 5GQSA 5KYVA 3VKVA 4B0OA 4B6JA 2BVNA 2C9CA 1ZI8A 1RHRA 1P1HA 4YAUA 1R50A 3NU1A 4L6AA 1MAAA 1CUJA 2YXEA 3W77A 5DNAA 1G55A 1MB4A 2B25A 1WMSA 3UAZA 4PN7A 2J85A 3QMWA 3G13A 3N74A 4AUNA 1JQKA 4OYLA 1W5TA 5HBRA 3VV3A 2YRWA 3SC3A 3K0CC 4MEJA 1JW9B 4LTDA 2PZEA 3BSWA 1ZZGA 3L8DA 1D2MA 4MINA 1B6GA 4Y18A 4E6EA 1D2EA 4AW9A 1MB2A 2ZLBA 3R44A 1G2PA 3TNFA 4BWVA 2PRYA 2DR2A 2JA1A 3JYHA 1M2HA 1MFZA 4DYHA 1ZNXA 3WXBA 4DR2B 3KQSA 4CIXA 5LU8A 4TS4A 1M0SA 1UDBA 1V5EA 2F43B 2XXJA 3HACA 3ZY5A 4L27A 3L49A 1EWRA 4FDAA 2Z6AA 1M5TA 3B3AA 3U1VA 4Y8VA 4YUZA 3OOYA 5A4DA 1OXSC 4UU8A 1OH8A 2P2GA 2W42A 1ZOIA 1XHFA 4GO1A 3T9DA 2J3EA 4MPDA 3BCRA 2QEQA 1M0TA 2VWHA 1J0BA 3MNFA 3LOQA 1QZ3A 2J9GA 3WGVA 1NYLA 1VIAA 3IAXA 4JYBA 4I3FA 4HSGA 3VHXB 5ARDA 2Y2VA 4RLHA 2YHAA 3USES 4IWNA 5IF9A 2YQ4A 4LC0A 3H3FA 4H4EA 4AWBA 2YCLA 3BTOA 3E1SA 4D41A 2Z08A 3KELA 4K87A 4REQB 3SYRA 2HUPA 3EQ6A 3RFUA 3L1KA 4BMDA 3G8AA 3DOOA 5D3QA 3DTVD 1KERA 4KB5A 4EL5A 2BEUB 2ZI9A 4U5QA 3UKOA 2WYWA 2QE7D 3GGSA 1O5OA 2Z1DA 3R0VA 4BFVA 3KCQA 1N5LA 4M38A 4FGUA 2HV9A 2QTTA 4YJDA 3R5HA 2L19A 2IXFA 1GZDA 4HLCA 5I9TA 5BUCA 4NCAA 1PJQA 4IWYA 4LMAA 1OH7A 2HNBA 5BQ3A 1JEOA 3IERA 4J0JA 4Q7JB 3FYCA 3HYNA 2HAEA 1W87A 4C21A 4X1YA 3UPTA 4ZU6X 2ZZNA 2X0KA 2OD7A 2Z98A 3MT7A 2ERXA 4JLUA 4ACBA 4D0RA 2VYND 1MA3A 4WX2B 1ZSNA 1E7WA 3AY3A 4HPWA 4ZXPA 4RW0A 4FOPA 3SJBA 3QEJA 4AF6A 2ISCA 3U56A 1AZSC 3C5WP 2BFOA 5HIMA 3SC2B 4BNYA 1RKXA 1B2LA 3I01M 3ZHTA 3DE4X 2O8FA 4F6LA 3G0OA 1LC0A 2YRFA 1K6IA 2IQ5A 3T3DA 1Z56C 4F4UA 2G3YA 2Z2ZA 2QA5A 3DW1X 3TTYA 4EQ6B 2PO7A 2HRRA 3Q11A 2XWSA 4U3JA 4Y6GB 4KE9A 3W5SA 4MMYB 1TOAA 1N1EA 2GLUA 2ZRKA 4Q5IA 3WE7A 3DVQX 1HQKA 3Q6IA 4EIWA 2WSYB 1L1RA 3IHTA 5IKMA 2A9KA 2W2OA 4KIGA 4KRXA 1E3QA 2AJTA 2C2BA 2PMCA 2Z2IA 3FWYA 1GAJA 2JCSA 2PGNA 2ZBPA 4KFUA 1WKVA 1ZJ6A 3GAZA 1A7AA 1SURA 2ZT5A 4XWWA 3T5DA 1P75A 1O77A 1VBFA 1E2MA 2DBRA 1KO5A 2Q6VA 1D7OA 4DUPA 4EH1A 2IYNA 2Z9CA 1N33B 5HX7A 3A8TA 5A4AA 1NNEA 1H69A 4MV9A 4IIJA 4Y2SA 2RHJA 3C98A 3BILA 2Z4TA 2I2XB 2V4MA 5EZYA 1QTRA 3ADPA 5CURA 3ZHZA 4E12A 1QRUA 1CUEA 1DIAA 1TCUA 1E9VA 3WZLA 4BN0A 5ERGB 7REQA 5LZ4A 1G6Q1 1JXQA 2VF2A 5LQAA 3LCJA 1ONPA 2IFTA 3OZEA 4HDNB 4NAVA 2MHCA 3IKVA 3PWSA 4WLVA 2QVXX 5MGNA 3DGEC 4OFXA 2UYYA 4J16A 4LYHA 1KBOA 1Z15A 2WZBA 3DEIA 1C1DB 1E0AA 4NENA 3ZDYB 5FTLA 1Z0AA 4BO1A 4NSNA 5EXDA 3U1BA 4CPDA 3AMVA 2IYEA 3I2GA 1CZLA 5TMDA 4YMTA 5LQSA 3G49A 2PE5A 5C5DA 4BE4A 4CWAA 1QBGA 1UWKA 2IQIA 2WE8A 4HHEA 4Q1BA 4QEZA 4WK6A 2HREA 5LIPA 1MFPA 5DRYA 2R6JA 4JLKA 3ZIDA 5IAGA 2Y66A 1D03A 1EFVB 4Y3UA 4LXGA 4L15A 4DLAA 2E6KA 5DCYA 4QHYA 4EI2A 4M6WA 3OIYA 4JT4A 1Z0JA 2NZXA 4PLPA 2CNDA 5ILQA 1I0LA 3KYCB 2RGBA 3P0HA 4FYPA 4PZDA 1N8SA 4UEKA 3BT7A 2FN4A 4WEOA 2HLDA 5FJIA 4EW1A 3ETDA 3H3JA 1PJCA 3DVLA 3U9TA 3NHUA 5LQNA 3E58A 5LBIA 1U1DA 2RHCA 3DE5X 4IHAA 3CS3A 2HRCA 3FHJA 3IDZA 1Q0LA 4XJXA 4AQYB 4ZYLA 5FKJA 1JSCA 3HB7A 4S35A 4Y2PA 2XOEA 2DHCA 1U8XX 1U8ZA 1JPUA 2BFEB 2VLBA 3QOXA 3G85A 4JR1A 3NKFA 4HH4A 3CG4A 2DWOA 4B7UA 2EHJA 1W36B 2OGUA 2OUKA 1GV1A 3G2QA 4UMVA 1F9AA 1WV0A 2FPIB 4YUVA 3DLIA 1TKCA 3IAM6 3ZNPA 1G9TA 1FBNA 2PX0A 3G79A 5CH5A 3LGXA 5LMCA 5TJ9A 1NAIA 4FD3A 1QVZA 3T3IA 3V5NA 2PS0A 3NM6B 3LX8A 3ANLA 4YCSA 5JC8A 2WAAA 3G9ZA 1GNTA 3L5OA 4Q1FA 3MWLA 1GGJA 2AMVA 4BFUA 4CQLB 2LCQA 2D7DA 4Z9XA 3A1CA 4HRXA 4EVSA 4RMHA 5JFGA 1M6YA 1RR6A 2L17A 1EESA 1TAHA 2WUWE 3VNQA 2R6GA 5JQGA 2ZXUA 2EIHA 4HFJA 4PNEA 4QPCA 1PR3A 4BPRA 3OZWA 4G41A 4BOYA 3A3YA 3WLEA 2AN5A 1SHUX 5E8JA 1Y8RB 3QW2A 4H08A 4HEHA 3E3NA 3G2LA 2IXEA 4OA5A 2V1UA 2E5LB 1H85A 3H19A 4YV1A 2Q6LA 1RXSA 3N1UA 3IVXA 4YRGA 4HDRB 2O7NA 3OX4A 2CYBA 2QN2A 2PH7A 4J7AA 1N7GA 4PR0A 3U7IA 3DUFA 5EWMA 1ND5A 2XMGA 4YBZA 5L6LB 2QTAA 4MVJI 4FGJA 1P0QA 5AFSA 5AUNB 2R1TA 3DL0A 4OQNA 3T5CA 2C7VA 3PXUA 4LBZA 4XVRA 4C87A 1WCIB 3UANA 2ZSAA 2PL3A 3CNNA 5I8WA 4ZU3A 1KY4A 2M32A 2SCUA 3PUKA 4QNMA 3NAZA 2ZYWX 3UWPA 4DLPA 4G25A 4E1VA 2YIMA 4AP5A 1TTTA 4UREA 2Q1XA 3OOWA 4US1R 3MGBA 4RKFA 1BU8A 2AB0A 2OAGA 4W5JA 5ALIA 5BNFA 3ZHOA 5LN1A 4P33A 1TYEB 1L5KA 3E9CA 2PAAA 4HQ0A 1Q16A 3FFTA 3BXXA 5ELXA 5CM2Z 4AMUA 4D3YA 4ESHA 3G2JA 2I87A 3SK0A 4RTMA 4X7PA 1FNSA 3T3EA 3IOEA 1P7WA 4GQIA 2UZIR 4QQ8A 4BNZA 3GPIA 1LWNA 2H4HA 2YV5A 3NALA 4UCFA 1H05A 2PPLA 3L04A 4EMTA 4FE4A 4QUEA 3GGPA 4X1KA 5DEOA 3V2HA 2HR1A 4OLBA 1N5IA 1CDEA 2B8TA 1R12A 2GYVA 4F71A 1ZBQA 3Q8WA 1ZOLA 4X1IB 2BYTA 5DO9A 3AYZB 4TXJA 2NU6B 3GXOA 4C7MA 1N2XA 3K9LA 1Z2PX 2QAGA 1Z3IX 4MPPA 4I3HA 4BKOA 2FV8A 2OP1A 3I6ZA 4BS9A 4DLUA 2Q3BA 3ROKA 3HJGA 5IH7A 2B2XA 3KQQA 1AS2A 5CVTA 4DUGA 4N03A 4GI1A 1UK9A 4NONA 4E22A 2XZDA 3DLCA 3E22A 4F2PA 1P1CA 1DRVA 5ICGA 3E27A 5IVHA 3LHIA 5EHNA 1NJ5A 2PSFA 4U5XA 4Y1RA 5E1OA 5FJJA 2JD2A 4J90A 4W99A 4Y2TA 1H3FA 3DMFA 2GM4A 4Y2YA 2CMFA 4EP1A 5J63A 4LRXA 4A23A 2IHTA 5HP4A 2VDQB 2JZCA 2VJCA 4Z3KA 1JP7A 2FY8A 3BK2A 1L4YA 3HKDA 3PGA1 4KQFA 2O06A 4XB2A 4UM9B 3THYB 3BJZA 1E18A 1PDWA 3PNQA 4I1UA 4O2RA 3ROGA 4AMVA 3SZLA 2DVMA 3MJDA 3LWZA 4TMYA 4XXHA 1NW5A 3KU1A 5FOQA 5JW6A 1NN0A 2H17A 1J99A 1RCFA 1UJ2A 3L6OO 2QYTA 4WY5A 3TEJA 4UE3S 5A3RA 3ZJVA 4NYIQ 2YWHA 2BMVA 3DB1A 4YRAA 2CUTA 3L82B 3K5IA 3EFOB 1YDMA 1DTWA 4IIGA 5LLTA 3IIJA 1T4CA 3TPZA 4BB0A 2OTCA 1EE2A 1ISHA 1SD1A 2J45A 4RTPA 4M1WA 4UPVA 4C6SA 1HNZB 2VSYA 2C4MA 1FP7A 1ZGBA 4KQCA 4XI9A 4YCLA 3ZWVA 1WHSB 4AMYA 4C4XA 4TLMB 5I7UA 2AR0A 5BUZA 2ZRGA 3E5RA 1XP8A 3GFOA 3MPUA 3OKCA 3D4LA 1SHJA 2AEMA 3BIWA 4Q39A 4WTOA 4DWVA 1OI4A 4KBYA 4P38A 2VDUE 4EI9A 3CH6A 2WWRA 1F3LA 2FZKA 1XCOA 5CK5A 1SUBA 5DYGA 4MPRA 4JB8A 2FSHA 4QEKA 4RO0A 1D6NA 3EZNA 1Q6ZA 5C4GB 4C4RA 1P5RA 3DDZX 3OAAA 2X1HA 3OE4A 2KE5A 5ESDA 5JWRA 2F55A 4KH0A 4YRJA 3PPXA 1E60A 2XMBA 4QASA 5CVCA 2D1TA 2JGLA 4OUDA 1Z12A 4CKCB 1GCGA 1N3BA 1YACA 1L3BA 3F67A 4WZBB 5AM0A 1XDUA 4F5DA 2XECA 3LV8A 2UZ1A 2I1WA 3BJIC 3OQIB 4PGHA 3ZCUA 5CFMA 1GL7A 3LI2A 4KIFA 4MQUA 4C08A 1B8PA 3D59A 3IIIA 4N0MA 1JEEA 3JQAB 4R7TA 4W1QA 4DR5B 4A2WA 5L3QB 1LD3A 1EGVB 4ZT7A 3HCOA 4P7GA 2Y76A 5C34B 4BGVA 3C1OA 4ZIRB 4XW2A 3JZFA 1Q7BA 4DXHA 3GLQA 4TQAA 4NU8X 4R98A 3AI2A 1R6AA 5DYYA 5EIOA 1WBDA 2A2ZA 5A6SA 1LCIA 1LWOA 4Q7MB 1GG8A 1A7KA 1TT7A 2YV4A 2LE0A 1WTCA 3JATB 1IEVA 1K7EB 1VBNA 1HG1A 2Y9MB 4QOIA 3G88A 2HCRA 3OHSX 4FHDA 4PU0A 3SHVA 3HJRA 1M7BA 2H3HA 2HJ9A 2V7XA 4FYJA 4NXMB 1RHMA 4TUYF 3MYRA 4E3WA 1NXPA 3AY0A 3MCTA 3TPCA 3EDOA 1X7WB 1VBKA 1X7XB 5JCOA 1X1RA 3N59A 4HDOB 2ZJFA 3N6VA 4MHOA 3M6VA 3TSCA 3HI4A 1VMDA 1TZBA 1WPRA 1BRTA 1Y9DA 2QR5A 3DAHA 1OFTA 3DDCA 3CV3A 4J4TA 2ZKLA 2PMBA 2VIIA 1UPTA 2D2XA 2OC4A 2OQ2A 2YJ3A 1ACMA 1PQ4A 1PTKA 1YR3A 2O57A 1NBME 4WOCA 1ODCA 2FSGA 1JMVA 4UCWA 1G291 2G9VA 2H1VA 5D3MA 4CCSA 1W85B 2O7RA 4G5OA 2OECA 3PRYA 5H7XA 3CBGA 3A9TA 5JMPA 4X54A 3ZOZA 3AU8A 2HFKA 4RA6B 2GTHA 1QPGA 3R3UA 3CVUA 4UZFA 5HCNA 2O50A 3DAYA 4ZKEA 1E8NA 4OMCA 4EJFA 3ITKA 2OCYC 6Q21A 3GARA 2H4FA 2ZOSA 1RXEA 3HEAA 1TQ4A 3G1WA 3BK7A 2QL9A 3NIFB 3O4FA 3VYUB 1E9EA 1VG8A 3JASA 4EUNA 3BFPA 3A14A 3FWZA 1HFEL 1UC5B 3EQ9A 1XE3A 1W25A 3ZY3A 5CCEA 4D5EA 2CV1A 3AHJA 5AI4A 2Z5GA 3VO8A 1QVWA 4EI7A 1KR5A 4WCFB 5BQXA 1GZUA 3RC1A 1GIAA 3BEOA 4ZVQA 4MQBA 1D4AA 1ZKMA 2LXNA 4QAQA 2ZE6A 5J59A 4AY3A 4DZRA 4DSZA 4LCBA 4ROTA 1NI5A 2XCLA 1HDGO 4PFJA 3N0XA 4E30A 3IXMA 4BC0A 3RBAA 1C4OA 4RTSA 4PPQA 1AB5A 3O9VA 1WQ3A 4PZPA 4BEJA 4I1PA 5F7OA 1ODFA 1K5PA 3QE0A 1MMFB 4ZT3A 2GZ3A 3N76A 1CD5A 1CIJA 3OPQA 1K27A 4MI9A 4I50F 2C2XA 2P2NA 4HX5A 4ND5A 4UUQA 4G1MB 4IVNA 2BN4A 5F2OA 3VNRA 1KYIA 3ZY2A 1C7QA 3V8RA 4N0DA 4BO5A 3VR2A 3T0GA 3B9PA 3TLCA 3V8NA 2ZUFA 4B3RB 2HN9A 1LSJA 4KL8S 2WR8A 2B9VA 1NFQA 3RI3A 2IYQA 1O0CA 2FOLA 3AHIA 1SRQA 1X7GA 3PA6A 4YMWA 4DDVA 1QO9A 1QYRA 3A1NA 3C6YA 4UUNA 4D9KA 4IH1A 3OQPA 1NOKA 1ZD2P 2XDYA 3FVRA 3JSAA 1CP3A 3DKIA 2I6FA 3PWKA 4ZJPA 1REQB 4WKBA 1IK6A 3BTVA 1LKZA 2TMYA 4BZXA 3OZCA 5JNLA 1AKWA 4II7A 3BFVA 4MS1A 4TQUS 1HDZA 1ZL2A 1JIIA 3FOEC 4UE6A 4D4JA 3CZPA 4XGRA 1BS9A 2R1VB 1WW2A 1DO8A 1ZMTA 3ELUA 3D31A 4XYMA 1LJUA 4LJ7A 5DHTA 3WLNA 4HRYA 1HRDA 2VZ9A 2BTQA 4OFWA 3WQQA 4LJLA 1KMNA 2NU7A 3FPKA 4KOEC 3S3TA 3VTZA 3IAM1 2JARA 3B48A 4JLAA 2GAAA 1Q20A 2SKDA 2ZR9A 3B3JA 2VNKA 1KMIY 4LVNA 2VXCA 3EMDA 4BUJA 3THWA 4ESVA 1LXCA 3AETA 2IY7A 1T0HB 3JZDA 4C7KA 4BLRA 1FUYB 2A6PA 1PQUA 2WNSA 4E5NA 3EBOA 4Y0NA 3KV3O 3QELB 4FIZA 4R51A 4TV9A 4A27A 4YAIA 4DDTA 4BNWA 3TE7A 4ZHQA 4JC8A 2VJMA 4J2OA 1G2QA 3WDKA 1D5CA 2ZVDA 5FQOA 1K7FB 3T9EA 1HDCA 2P9HA 2XA2A 3B1XA 3PUXA 3PS9A 4ZO7A 3S4YA 3IE0A 4LY3A 5TQ0B 4EI8A 5J23A 4TYMA 3MCAA 1YU9A 4JKYA 4P5PA 2LNDA 2Q4TA 2XVXA 3EULA 1KMQA 4OXQA 4V0NA 1M34A 7GPBA 3EEOA 4Z4IA 1A8QA 1J2EA 3NDJA 4FR5A 1A9XA 3GLGE 1VP9A 1Z34A 1TM7E 3CF0A 2YV2A 3H1GA 3GNSA 3W3AH 4BMSA 2IT1A 3I2KA 5FFFA 2FH5B 1LY1A 3T1HB 2VF7A 3PFCA 4QICA 5IABA 2I3GA 4QQRA 4INZA 1W1IA 3MWEA 1IH8A 1TLFA 4Y9DA 3UJCA 3PFNA 3ZWKA 4F6CA 3RRBA 3N6XA 3AB7A 4E21A 4IXTA 2G9UA 3D8UA 3EZ9A 4NMLA 1KI8A 3ECSA 2GS9A 2K4MA 4RVFA 3CEJA 2E2WA 4XDZA 1ID8A 3D02A 4QUDA 4QRIA 2DFPA 5CNMA 1KDTA 1K8XB 3BWMA 4IGAA 4KXFB 3KZMA 2QLFA 5DHFA 4EY3A 2ZIVB 4OKNA 1BXKA 5AOCA 3T41A 5CFLA 4RTJA 1QIKA 1TKBA 1DWPA 4NE9A 2RI1A 5JVDF 3PTAA 5K0NA 3D0QA 4NFYA 1AKQA 4FVTA 3M5CA 2IYYA 3GLIA 3BH0A 4X1YB 1U02A 2BHLA 4U9IS 2OA0A 3X3HA 3K6KA 3RVKA 5B64A 4G4GA 3SF8A 3PUJA 4CN8A 5I48A 5FNVF 4QPNA 1Y48E 4MUXA 2IV3A 4YAJA 4BWYA 3X1ZA 1A9RA 1QMGA 3WIEA 2ECFA 5EJ8A 1FLDA 3B5JA 3OMLA 2F48A 3GL9A 3AR9A 3SSMA 5C2JB 4PTYA 2C00A 1X86B 1RXCA 2QT1A 3GWGA 2O8FB 1Z9BA 1I1QB 1CJSA 4UBIA 3PUVA 3JWGA 1PJBA 4JXKA 3H0EA 3BRCA 1J0XO 4MRAA 2HSWA 2CHUA 3LLCA 3B1VA 5E4TA 4U3JB 4RYDA 4AD8A 2UU9B 1W36C 4ERNA 4KI0A 3RIHA 4P82A 4LF7B 1LLUA 1KAGA 5E1MA 5D3KA 4IFIA 3OZVA 5HF9A 1PFYA 4JUIA 1C3LA 1KDVA 3HXQA 1SKUA 3O6VA 4QXPA 5BQFA 1L4UA 5D1NA 3IJ5A 2BRUC 4AQ7A 4ZK2A 3PVSA 1WMBA 1ISJA 1KVUA 4HMPA 4BEVA 1OX4A 4MAAA 1KGDA 4IOMA 1COWA 2Y1WA 5E38A 1O97D 4GOJA 1SVKA 3PKZA 3QXJA 2IZ0A 4OO3A 1X1AA 4I4LA 4IIJB 3R5XA 3IFSA 4WMLA 3GD7A 4FZJA 1MH1A 4CZ2A 5EZYB 2GBLA 2IEYA 3FZGA 3L8ZA 1NMXA 2XNCA 4QVKA 3JTEA 5AK3A 4A2QA 4MLZA 1U8TA 1GGVA 1HTWA 3VV2A 1W9MA 2YYZA 1N36B 1PR6A 2RGXA 4RHYA 3L8MA 1H2YA 1Z5NA 2RAFA 1MLDA 2O5VA 1WXDA 2P3LA 2YMQA 3OM8A 2DCMA 2PXXA 1R9MA 3AP3A 3OJCA 2BGWA 3NJ4A 2A1IA 2JGIA 4WOJA 3EIWA 1AV7A 3CNQS 1P0FA 4L0CA 3RYTC 1QG2A 3LLSA 3JXEA 2IUYA 3H05A 1GHTA 3H84A 3IEIA 3NPAA 5EJ4A 3T5GA 5CK4A 3S5JA 1P72A 4MV8A 5K8UA 2ID8A 2RH5A 3LC2O 5ALEA 5EHIA 3AVOA 1D04A 4HS4A 4ZC8A 4D8XA 4QM7A 5JRJA 3EXG2 4YAFA 2XZOA 2IH4A 1YZHA 1QHXA 2L82A 3OPNA 4Y9TA 5SZKB 4QX6A 3A2LA 3BQ9A 3N0WA 3M2TA 3WNVA 4BN5A 3I4CA 4I14A 2AG0A 2NZWA 1K8RA 4QBHA 2PSJA 2KM1A 3STWA 4M6WB 4CTOA 4EGFA 1GU0A 2IUFA 4L4UA 4Q3DA 3OJEA 1KJYA 4DCPA 2QVBA 2BCGY 3DBOB 4HAXA 2WD8A 4NBVA 1UEJA 3V4OA 5IT9A 1TC2A 1H9AA 1WRBA 3EW9A 2TS1A 4OGGA 1I8TA 1K92A 5EG5A 1I3CA 5CLFA 3AR3A 1HQDA 4ZT6A 4WE3A 2J0SA 3PGMA 5IASA 4E32A 1CJBA 1TCBA 3I1YA 4HQFA 2ZVPX 4MROA 2W6ID 5KNDH 1XD8A 4K7JA 5IZ4A 3D43A 4GECA 1E8MA 4LECA 3LF2A 1NXTA 2QPTA 3NYWA 3WG9A 4BZZA 1YNOA 3I6YA 1H8HA 3GCZA 4C5AA 1FZTA 1BCRB 1VHTA 2WVGA 4YRCA 3U49A 5GJWC 2V03A 4QXMA 2EFEB 1GVNB 3LUHA 3OJOA 1UIMA 3QX7A 4FEYA 2CN1A 3T94A 3UOAB 4EVRA 4M9ZA 1CYDA 1F14A 1S96A 3NAQA 2P6OA 3TRDA 4F3KA 2FOXA 2BKLA 3C7TA 3K32A 4YR9A 2BDUA 4NQZA 5KINB 3QNWA 3D6NB 3ENNA 3U4GA 2CF6A 5ALUA 2EG5A 3FTPA 3VR6D 1E58A 1EGAA 2P3QA 3VPGA 3CZRA 1ZQ1A 4UM7A 4EITA 3PR2B 4QXOA 1ACLA 2GJSA 2OLEA 2G40A 3C8ZA 2DKFA 4G1EB 4JJIA 5JQGB 1P73A 3P9PA 2IWRA 2VP4A 2QROA 1DKRA 1WW3A 1ZNZA 1FFXA 2YXLA 2X76A 4HO1X 4JQYA 4DR3B 3MMZA 2L18A 3GMSA 1UPAA 5FD8A 5KSPA 1L4KA 2QTNA 5KQSA 2CK3D 3HCWA 3VKFA 4OHMA 2C7BA 3T7DA 1WZ2A 3VNUA 2ZJ1A 3D7LA 1JPVA 1K97A 2WNIA 3NHLA 4WH0A 5JNSA 4KMRA 3U3OA 2C99A 3QEMA 5FBHA 4MO2A 4L76A 5EWMB 4FCWA 3SKVA 3ZZ1A 1NW7A 2RJOA 2EYUA 1PX0A 2JH9A 3B1YA 4HLUC 3AJEA 3ZI4A 4CJXA 3GFGA 2O3SA 5CIWA 3RIGA 4LSWA 4Q1EA 3BWYA 5M2QA 1E9FA 1UBFA 2XUJA 3G23A 2SCUB 5GZ3A 2XDWA 3H9JA 4QTXA 4QYIA 4CL2A 3NUGA 1ISIA 1Z6AA 3TTUA 4B2LA 4OL0A 2ODNA 3RUIA 4BGIA 1PK7A 3DMTC 1LPPA 3VAYA 1MGPA 2XITA 4A1FA 1W94A 2ZI6A 3LHKA 1X15A 2F7SA 1Z4MA 3FPGA 2ADOA 1F48A 2NSHA 2Z2JA 1Z22A 1OAAA 1QVAA 3BGWA 5E8RA 5EP4A 5KVSA 1U80A 4QNNA 4YRPA 2EZ8A 2WBLC 3CRRA 1HBJA 1Z6QA 4IQGA 2CXSA 4L7VA 2VRNA 1OE0A 5AOBA 1B8UA 3A2KA 3P45A 5AKZA 1P9NA 1JHXA 1RBYA 1CFZA 1JKIA 1Z37A 1ZUNB 3GFFA 4NULA 4X1KB 3RS7A 3FFAA 1SC9A 5K3FB 5CDTA 2WFLA 4M9SA 3OZIA 4AZ0A 5ITWA 2JI9A 1PNRA 2ACKA 2AFHA 3PU6A 4D4LA 1OXBB 2QAGB 3RTDA 3UJ6A 2G1PA 4KXWA 1SVOA 2IIBA 1ZS9A 3ZG6A 1VJRA 1X19A 2G08A 4G5QA 1PSDA 2E18A 1GITA 1QQ7A 3KSDO 4TWRA 2ZTVA 5FF9A 4YJ2A 3E5MA 4XB6B 3E22B 2CKDA 1SN7A 1HT0A 3R6GA 3IT0A 3E2PA 2NYUA 1CQJB 3I23A 5E7QA 4UBJA 2ATVA 1KQNA 2REXB 2QVYX 2FUNB 1QFMA 4C7JA 1LPSA 4ZZ0A 4OM7A 1R8JA 4I4TB 2HBZA 4JLJA 3HFGA 2ZIEA 3IBTA 1Q2XA 2BFDA 3S1AB 2WUEA 2VDJA 2H18A 3KG2A 3HKDB 2I6XA 4AB1A 4NE7A 2NO7A 4R4JA 1FS4A 2D2VA 2GD2A 4XD7A 5CFRA 3LOUA 3RU7A 2M2IA 1HE1C 2X1MA 5AK5A 3WWEA 1QCDA 4NV3A 1IHOA 2ZUEA 1ZZEA 2C58A 3PCXA 3UCXA 5B4UA 5LYYA 1JMKC 4CHGA 2GXSA 1XZAA 3ITEA 1QG4A 2Q9CA 4BNKA 1EFPB 3B6ZA 1XK7A 3QTLA 4US0R 5JRDS 2P30A 3HBNA 4GDMA 2JLRA 1DTWB 5JMTA 4YALA 4K8OA 1T4CB 4WY2A 1Z25A 2DULA 2X19A 3DBRB 4OB6A 4V0QA 5LXTA 5BWMA 5DM70 3LD9A 1Y1RA 4PFKA 5DX8A 3S29A 2AG1A 1S01A 3BBLA 3PE4A 3HSKA 3DAGA 4WK2B 1U3GA 5DV9A 5AI6A 3P5SA 3ZHBA 2J9FA 1ZEMA 4DLZA 1CBUA 4BFYA 1O4VA 2H63A 1HQYE 1EZ1A 1X1DA 1NYRA 3WOHA 3VGPA 3ORQA 3F2VA 3PLRA 2V9CA 2I0FA 2G5GX 2ATEA 2HWYA 5EFZA 2HCJB 1RYYA 4C0AC 1O94D 4IR7A 1X1CA 3A3OA 5LDGA 4DQKA 3FMFA 2C1EA 3HVHA 3I3OA 2IYWA 2NVOA 2DQZA 3IUJA 1IC6A 2C07A 3UVEA 4IQ0A 4CFSA 4TKUA 4RTLA 1WPQA 2NQTA 3JD1A 3RFFA 3K16A 2IDMA 4LF9B 1KZ6A 4ZREA 4DSOA 2JJ2D 1IXZA 3LKVA 1XQWA 4WCFC 3DM5A 4MCAA 1J6UA 1ABBA 1ABFA 4XUGB 5GTDA 3IEXA 1T2DA 1CEYA 1DTSA 2LZ0A 1TEHA 1LDEA 3LDUA 4B17A 1YXMA 4OUDB 1Q0QA 2VN8A 3PA8A 4U6SA 1XLVA 1T2UA 2PUVA 1OFUX 1E3TA 2XQJA 5DVZA 3DOUA 4AN4A 5JY6A 4M46A 1A8PA 1KZ9A 2QM3A 4PYOA 4F8YA 2OENG 4XWTA 4KPFC 4HADA 2BM8A 3A1FA 3TQOA 3ZBUA 1R5BA 4RD3A 4A7PA 3BH6A 3C3EA 4RDCA 2OC9A 3TUIC 3Q9SA 2WU3A 4YAOA 2P5TB 2QB5A 5EESA 1DSSG 3CWQA 1MP0A 3AERB 3KWJA 4C03A 4J6EA 2I55A 2WIBA 2ECOA 3ET5A 4HKTA 2W71A 5DN6D 2ZRBA 4HGOA 3FFXA 5BYKA 3GPDG 3HUUA 2YYAA 4QFDA 2A57A 4GHWA 4F1WA 1BGVA 3KVOA 4V2UA 3FCUB 3KAQA 2P4HX 2AQKA 2DFNA 3BREA 2HXSA 4ECAA 1P2SA 3RHSA 3RYIA 2CNKA 1Z8HA 3VXKA 2J6BA 4FEEA 2Y92A 4IIJF 5K3BA 3LBYA 2H54A 3DW3X 4XYEA 5K8TA 3PF9A 1PU2A 2CHFA 5EZYF 5H59A 5DGIA 3TNJA 2WTXA 2BHRA 2QZSA 2I22A 3QE4A 2OZPA 1XB2A 1UJ5A 3C8MA 4H7JA 4KQHA 4B75A 1N6NA 2RHDA 2AMFA 5CFNA 1XMSA 2HF7A 4INAA 3NHJA 3I9JA 3KJNA 3ISTA 2E0IA 3QXSA 1CLUA 4NBNA 1PAUA 1LEHA 3A4MA 5D3MB 1DEKA 2BE7A 2UUPA 2H2DA 1AUPA 2WKWA 4E2YA 4G1CA 3PPYA 2JFVA 4ZAWA 4FGLA 3AFIA 5HUQA 4PIPA 2IEIA 3S70A 1UM8A 1TAGA 3PPWA 1XQVA 4DV3B 2VRBA 1LS6A 2H59A 4RPGA 3T4XA 2CT8A 1A9ZA 3IQEA 3FRIA 1ATZA 5BSTA 4C89A 2L0XA 5FWYA 1POXA 3ZGZA 4J94A 1Z5VA 3HP1A 4MWTA 4ZVLA 4OGKA 3SOPA 1KQ3A 1RRPA 3GCDA 3KZXA 3Q3EA 4AJ4A 2LP4Y 4QFMA 2FSUA 2R1ZA 2AC2A 4H6PA 3S0JA 4WWHA 5BVGB 2AXQA 2XKBA 3DE6X 1PF7E 3FGZA 4TX1A 1HLFA 3ZE1B 4F7DA 5IUJC 3QLEA 3T5PA 1N2BA 3I2JA 3UB4A 1RQXA 4DC1A 1W4AA 3SM9A 4M1QA 1BEZA 1PV2A 4Q24A 1RPAA 3TM5A 2F3UA 3FHCB 3UNXA 3KOUA 3ABRB 5K05A 4NU5A 4UVIA 1EBBA 1FX0B 4BX9A 1KJIA 2EKBA 3EPPA 1ISPA 2QTGA 2Z8XA 3JARA 4DKXA 5K8LA 1CY6A 1I94B 1Y1QA 2FP4B 2PLWA 3B1WA 3PQ8A 4EB0A 4R1TA 3OPYI 3EQ2A 4HZUA 1DRWA 5AD1A 1EE1A 1EVJA 1QQBA 1EA7A 3R5SA 2HY7A 4FMCB 4Y67A 3ZDXB 3SXUA 1FS6A 2EU8A 4A5OA 2MSEB 2XWQA 3EVCA 4UXIA 4XOUA 3KSBC 1N57A 1A8UA 4NEHB 1HE8B 1IN5A 1L5SA 2Q3LA 1P9OA 1CF2O 3MELA 4FZVA 6PFKA 3SIWA 3Q3JB 5C8YB 5AJZA 1Y7PA 3HM9A 1SU8A 1AGYA 3MTIA 4N0PA 5JQGF 3RJ5A 1FLAA 4AXBA 4MS1B 2QJTA 4J9UE 1Q84A 2F4VB 3WLKX 2NT4A 1I4EB 3C3YA 3NONA 4NZZA 3QXCA 3UGTA 2PZKA 3GDHA 5JE8A 4WJLA 3SJ7A 2E5FA 3IPRA 2BTQB 4FHEA 4LDQA 1F2UB 1PTJA 3VZQA 4NVRA 3KLMX 3TLKA 1NPYA 2D3TA 1SXGA 1MJNA 4X85A 4KR9A 1JWBB 1AUOA 4G1BA 2TMDA 3IUSA 2GBFA 5ECDA 1OBFO 4YGYA 5D00A 2GJ8A 4DV7B 3THWB 5JAMA 3NOOA 3MBKA 4GRIA 4BLQA 2DY1A 5GMOA 4Y1GA 1HO3A 2YJNA 3GUZA 4YTEA 4G0OA 2G9ZA 3EXAA 4FYKA 3K0HA 1EX7A 4TV9B 2NIPA 4RANA 2QG4A 5FH9A 1QQAA 1U5BB 1N9ZA 2DECA 1KKUA 3H1EA 4PAMA 2E6UX 2NWQA 4YJ2F 4P36A 2NPFA 1GT91 5CEEA 2NTVA 4MW2A 3IUMA 1YHYA 3EGXB 2ONKA 2PH5A 4BB6A 1A77A 4W5OA 1NY6A 3BG5A 4XEUA 1DLJA 3KT6A 1FP4A 1TT5A 2ASEA 3AIIA 5A5VA 2O5EA 2LCFA 3C14C 3FGNA 4IXNA 1AH2A 3T99A 1A9XB 4M1OA 3JVUA 1W0KD 2PUWA 3K0BA 3EHDA 3V4ZA 3VR4A 3U44B 3L1HA 4D46A 1EVEA 2ZAOA 1D9ZA 2WJVA 3DD1A 3LS2A 2EEZA 2HMWA 5KTOA 3ND5A 3V4VB 1E2UA 5IDXA 2AFIE 2CY0A 4ZRMA 2VPIA 3MWEB 4J16C 2WM3A 1JAZA 2UYQA 4JBIA 1NJ2A 4Z4EA 4C4YA 1QONA 4QYMA 4KMSA 1CS4C 1WETA 3LP6A 4LWZA 3AX6A 4PWZA 2ROQA 5DCUA 4U0KA 2UVPA 2PGDA 4KC0A 3RS3A 3PV0A 3SLRA 5BVHA 5IWCA 2XLCA 3ZDZB 4GI5A 4KFTA 3IESA 3M34A 1WB5A 4IJUA 4NH0A 5CX1A 3FNBA 1O57A 2PHZA 2UZ0A 3OHPA 4J03A 4UULA 4W4TA 3I2IA 2WJJA 4GG1A 1PS0A 3H7AA 4DFDA 1UDAA 3GLIB 1R5JA 3V8QA 1H22A 3ST7A 1GPBA 1FMTA 3HV2A 3Q7SA 3SF8B 1NJ1A 4PFSA 2AW3A 2I65A 2RGYA 2W6JA 5HDQA 2GO1A 4Q1AA 5EIHA 5JR3A 2W5UA 3HU2A 5FLKA 5DNYB 2ZYDA 3MCWA 4EKYA 1SPBS 2P9QA 3ELYA 1XXHE 5HR5A 3PC6A 2VNHA 1OSNA 5ABPA 4L8VA 1NSTA 3QPDA 5KDLA 3DKKA 3VAZA 1QS0B 1NVFA 3A4YA 5KX5A 1TYDE 1VLVA 4FQ8A 4F3TA 4NK4A 4PAGA 2G80A 2X41A 4YRLA 4ASUD 5E6UA 5IANA 1UKAA 3A70A 3AEXA 4FOSA 4J8PA 4DLVA 5ECGC 4BFSA 3M8KA 5KSOA 1A5SB 2DFVA 4OJYA 5EKUA 1XELA 5JJCA 2ZK7A 3WKAA 4Z49A 4R8VA 1ZM7A 4GLJA 1RXWA 1KRWA 4G36A 2VNSA 4ZYWA 5DNUA 3WWPA 4B44A 1Z75A 5I5EA 2CGEA 4F4IA 3I4LA 5FFNA 1P61B 3IAAA 2YN0A 1YA4A 4JB0A 7AT1A 4GUDA 1A5BB 3CJRA 3VM6A 3HLKA 2G07A 4PSDA 3BAFA 4R81A 4HMOA 3VDRA 1OX4B 1DC5A 1Y8ZA 2HPHA 1LDGA 1NVXQ 3A25A 3SS8A 2JD0A 2BF7A 5BV2P 8AT1A 2FUKA 4XOIA 1E99A 1FTGA 1LV7A 1LBQA 3Q0TA 1MIHA 3FSRA 1B8OA 2PCLA 3OQVA 4H7KA 4L5BA 2O23A 5ALFA 4AULA 4BATA 5KNCD 1OVGA 3QVJA 3OG9A 1D8TA 1DELA 4BKMA 4QGAA 2VQ6A 1OLSA 3A28A 3PGKA 3OJWA 4LYDA 1AKTA 2VL7A 2LVBA 4KWHA 4L28A 5AT1A 3KPYA 3T3PB 5C52B 1YJBA 4N01A 3RLFA 1WW8A 2O07A 1K66A 2ZWOA 4HGQA 2PWZA 1N6KA 4U9UA 3T5TA 4Z4FA 1PIWA 2CBXA 5I7WA 4FP9A 4ZVKA 3K1JA 3BZUA 3L6DA 3RUDA 3NZEA 4JB2A 3ZVLA 4PXAA 2GEFA 4URYR 2J5QA 5F7JA 4L1KA 4S12A 1Y81A 3TOZA 5SY6A 1CJKC 3SHWA 5FA5A 1CPYA 3P9YA 1WUYA 4O4LA 3B7WA 4Y2QA 3VDNB 1K7SN 1IRIA 1CUXA 1E9CA 1T2EA 2EW2A 2J7KA 3QWAA 4GGPA 1QFYA 3LUKA 2HRDA 1RPJA 2HTEA 3H5NA 2BCEA 2Z2XA 3O9ZA 4ISCA 3ZI0A 1GA6A 1T1GA 1G5PA 4MWEA 3U09A 4NZ9A 2J3IA 4RC9A 5ECWA 1H6BA 3IIEA 4NCJA 3G7NA 2WE7A 3CZ9A 3W4JA 1JIXA 1PJ3A 3HJNA 4O4HA 5A1TA 4K6HA 4OXIA 3PFHA 2JAOA 5LP1A 4PPGA 1IVNA 4REMA 2IIVA 4WESA 1QDLB 4YLGA 5BSHA 4YHHB 1WF3A 2WWFA 4AJJA 3ORRA 3AR8A 3ZWBA 5HRAA 4QD3A 1V7ZA 3A1UA 4HN2A 5FPHA 3H5IA 3PPIA 1R6UA 1EAYA 2VAPA 3NWJA 4CQMD 1LQUA 2QNIA 2QAGC 4WL0A 3F6CA 2V98A 2VYQA 1T25A 4RTKA 4FE7A 4ZCIA 1L7EA 4R41A 1RYHA 3TOCA 1Q1BA 1ZK1A 2G76A 3VBCA 1SBCA 2P11A 3HB0A 1I1NA 4BQEA 4X97A 3HR7A 2AJDA 1IG0A 2P78A 4RETA 1XA0A 3VDXA 5B55A 1NKSA 1WL8A 4BNNA 4JJFA 5KAMA 3L0CA 5FDFA 4F4JA 2YXNA 3CBQA 4GQBA 1DXOA 2NXWA 3K96A 2D59A 1OKKA 1NE2A 2SECE 3RT1A 3O8CA 3D4IA 1N9GB 2BM0A 4ID3A 2EGHA 2PN1A 3D7RA 3CNEA 4N6GA 1DINA 4D3XA 1RTKA 3MB5A 2P6NA 5EP1A 1G5QA 4KO4S 2ILVA 1RWPA 3JVEA 5GONA 3VC3A 3N28A 4BX8A 2HQBA 2QAIA 1HC7A 2RBEA 4IDAA 1U31A 3ESQA 2NXEA 3SYNA 5JSYA 5GVSA 4JK3A 4KQXA 4W5NA 2QK4A 2WHEA 5CT9A 1KH2A 3SIXA 3QEMB 2FPXA 4HWPA 4DWJA 4RE5A 5IT4A 1UC4B 3D54D 2JIZD 4F45A 1UK7A 1JBQA 1T13A 1E3EA 4RZXA 5JZSA 1ESEA 2B82A 2OXRA 3ZGOA 1DCTA 1H9CA 1QCZA 4JBLA 2MYNA 4BMOB 3IVCA 5LB4A 2PL1A 3UJDA 1QGAA 3WGKA 4BU0A 3U7FB 4YASA 4QYIB 3MUNA 2HA0A 2FETA 4NCXA 5KYYB 3MJTA 4NCHA 2QG9A 1NBAA 3NV9A 4GOXA 4EARA 1BDJA 5LQCA 2QE6A 1N0IA 3QYJA 3W9UA 3F6EX 3D6TB 4FMCF 1L8OA 1IYZA 1XYGA 4FKBA 1XD2A 3RODA 3WRWA 4D97A 3W2TA 1GV0A 3EXEA 2E82A 3IEMA 4CKBA 1RJ9B 1L7PA 3PFFA 3PQDA 2IYZA 4YRZA 1SU4A 3CH4B 3C7KA 1ZRNA 1BCSA 3VU1A 1XX6A 2W6NA 3QNUA 4RY8A 3FIJA 3UGKA 3VYWA 4ONEA 5HK9A 1GQYA 2GFHA 1JSLA 2K2WA 4GWGA 5EHZA 5J47A 3G3EA 1I33A 2G0AA 4OYHA 3QI7A 5A3VA 1XPJA 1H2HA 4NARA 2WFLB 5FL7A 2O4UX 4AZ0B 3A6EA 3D3JA 3FWHA 4UDOA 2AFHB 2OOSA 2OZKA 3O4GA 7ADHA 4PCVA 1Z7GA 3Q9LA 4GBGA 4B6RA 1OYYA 1L5RA 2YJ4A 2MIIA 3AC0A 4JI1B 3CN7A 3WV5A 3OIDA 2DQYA 3E81A 3HTXA 1EB8A 4JLVA 4OKSA 3NX4A 2O6HA 5DW3A 3TTWA 1F2DA 2UYCA 3VR5A 4BVFA 4CU5A 4R2WA 5KWIA 1GN9A 2QHXA 5IAOA 2DX7A 1EJ6A 3BQMB 1UP7A 1PGNA 3NRJA 5EMMA 3HGMA 9MHTA 3IDFA 4TV9F 4N6OA 2J30A 1SJ9A 2RHLA 5C0OE 4BO6A 2OXFA 1I7PA 4ZHQF 5IXSA 5I4KA 2ECQA 2PSDA 1FYFA 2BFDB 3DCJA 3HPQA 2O59A 5JLJA 2REOA 2A9QA 1RXVA 3K9CA 4ZWNA 2CZGA 2AQHA 1V3QE 4LVUA 1GQFA 1OFGA 4DIDA 4QARA 1KEWA 1UXGA 3TSOA 3VZRA 4DVGA 8ADHA 1LQTA 5JCOC 1VXOA 1P17A 1VC2A 1XYYA 2Q3FA 2NV2B 3LRTA 3N87A 4JP8A 4RTNA 1EUQA 1KZ4A 5EVCA 4J4HA 2BSAA 3WB2A 3QFFA 2Q1YA 1OWOA 3FYUA 2GFIA 1JXMA 4G97A 4XX0A 2LWIA 4LYEA 4RAQA 2ZB7A 1I5OA 1ENZA 2AC7A 2OV6A 4JSYA 5TMEA 5F3WB 5AI9A 3I04A 1WSDA 3FIUA 2P77A 2WT8A 5EWJA 3G1UA 5HQTA 3R8CA 4MJ7A 1N2ZA 1CCWA 2OXEA 3E84A 4IYJA 3LCMA 1SWWA 3M4JA 4MVJP 1PJZA 1RYFA 2QTHA 1YVEI 1YUMA 2RCYA 4WXMA 3S2SA 4MVJD 1C2YA 2DXIA 3AF4A 4G85A 4DUYB 1NN3A 2ZE8A 1L2TA 4ZCTA 4JEIA 1AOXA 2J9FB 4N82A 1WB4A 3PNYA 4TKLA 3WZMA 3K7EA 4EVQA 5MF6A 4RULA 2HWXA 3QWBA 1YMVA 3RANA 5LQKA 2BGRA 2PRZA 4PRKA 5HIAA 2PX5A 4UD2A 3H2KA 3R40A 4LN1A 3WFJA 1SKMA 1JIKA 5JNRA 2Z1MA 2J07A 1WXXA 2A0XA 1P18A 3O3OB 4O4JA 1TXGA 1SK9A 3TQHA 4JL6A 4TKUB 3HNOA 4ZU1X 4O5OA 4WI1A 3SLKA 5JAPA 3GR6A 1R1DA 3ZU5A 4A0SA 3TB4A 1TNDA 4URFA 2BCJQ 2X3UA 4DJFC 3EASA 16PKA 3QITA 3SZMA 4JIGA 3CCCA 2IUSA 1P0CA 4MGIR 4XIGS 5GOZA 2FPGA 5P8WA 1YR2A 3BXHA 2Q21A 4O2LA 3RU9A 4WV3A 1UQUA 2B9EA 2OYCA 1I4WA 2A3NA 2VBFA 4TMWA 2DEUA 3U13A 3GRFA 3W5JA 4I4IA 2IK8A 1L5NA 2C94A 1Z6ZA 2HJRA 1XTUA 1P2BA 2DPLA 2PVSA 3O7MA 4ZCQA 2QX9A 1MO2A 1IXRC 2ZRCA 3HCCA 4OB7A 4ZDIA 2J3MA 4PR3A 5IN4A 3FZNA 2QX4A 3B6JA 1Z0DA 3AEQA 3IMGA 2VP9A 2G36A 3KM0A 3SNHA 1SQ0A 1VMEA 3BFJA 1YRBA 3EXIA 5F52A 1N0VC 4KCGA 5G40A 3L01A 1BSVA 3W1VA 4EPWA 1AQ6A 4MR7A 2VHTA 4CKYA 3UCEA 3ZS8A 2LPMA 3AJRA 2OG2A 4GM1A 5JATA 1M0WA 2GMWA 3WLFA 4OHFA 2QZPA 4W9NA 1UBGA 1HGXA 2ZJ4A 4L85A 4L3WA 4TTJA 1QHGA 4PM4A 4C0SA 3G5TA 3MHTA 4MKGA 5EJEA 3RYIB 3IA2A 2I1VB 1JAXA 4MA4A 5ICCA 4K9RA 2HCTA 3I9FA 3AQIA 3AG5A 3OF3A 1KQGA 3K70D 4NYMR 1AKNA 1IUNA 1F20A 1RPTA 1XVLA 3ANTA 4KAFA 4TVKA 1GKUB 1XQ1A 3ZDFA 2V3CC 1XCJA 3OEED 4DLSA 1FNMA 1GYRA 2HL6A 1B6SA 1OIWA 3DMDA 3FF1A 1OFUA 4FUQA 1XTBA 4G0QA 3AF2A 4BMCA 5DIFA 2DM6A 2ALJA 3S1SA 1B3RA 2X2OA 4YI5A 1L5HB 4RCYA 1AA9A 1EFTA 3PQ7A 1ADFA 1KI6A 1BG6A 3U19A 1JGTA 4PZLA 4OX9B 2Q7DA 4Y2XA 4EG0A 1X3LA 2BEVA 2VF8A 4ZARA 2V5AA 4X6YA 3UFXA 2YY5A 4R71A 3B38A 1JILA 3V7NA 3NATA 3D3NA 1OGIA 1I3MA 4LJ5A 1SOAA 1D09A 2MT9A 4WFIA 3L6UA 4UUPA 5J40A 3HI6A 4Z1MA 5KWEA 2NZJA 4G9GA 1B15A 3KOYA 2ZSDA 3RHZA 1RCUA 5HF5A 5WRFA 3BCUA 1R10A 4MWSA 4BO2A 4ODIA 4B3BA 1IB6A 3INTA 1L6IA 1R8XA 2OSVA 1NYTA 3I6BA 1BVHA 3BDAA 1YK1A 1E9BA 2P90A 4LXUA 3U3JA 2ZYGA 3IKMB 4X44A 4RIGA 5E0OA 1HDXA 5T3UA 1KK2A 4YCMA 2Q45A 4GWKA 4FYYA 1SCJA 3K94A 3G9QA 1ISRA 4BNGA 1JMYA 1KU6A 1BHSA 2DRIA 2UV8A 3RIMA 1M2FA 1EPUA 2REQB 4G0ZA 2A92A 5AXDA 3M0EA 1U5AA 3EK2A 1AQYA 1FJXA 1AD2A 1X14A 1XTJA 1F51E 1PWZA 2AF4C 3NGLA 1JBEA 3KB6A 3PZBA 4IJVA 2C3YA 5AKLA 4HZUB 5AW2A 4CEIA 3HKBA 4HNSA 4UCQA 4TM8A 3JW8A 2WHPA 4OQXA 2YKGA 1P1RA 4N7JA 5LU9A 4RVOA 3SKXA 2G8LA 3LKDA 5IVKA 2V58A 1JJ7A 2VUIB 2ZJ2A 3O1IC 4GMGA 1QTNA 1G4HA 4ZYVA 1JTVA 3SXUB 1XN4A 4IWXA 2BHSA 1JEYA 2F2TA 3EBPA 2HM7A 4LQDA 5HA5A 2N75A 3W7VA 2YVAA 2XMSA 3NGXA 3L43A 2WD9A 3URMA 3B6EA 3RS2A 2I67A 2WUVA 2C0CA 1CIVA 2H0RA 1KK1A 4FFSA 4QJ5A 1ULZA 2AOXA 2X86A 3W79A 4A8JA 2BFBA 4YJ3B 4LFBB 1VI5A 2F1JA 2HPVA 4IX9A 4LV5B 4RHCA 5HXAA 3IOMA 2ID4A 3DMRA 2R7NA 4EJSC 1W44A 3AVQA 3DHEA 2G6TA 3INYA 4NKRA 4DANA 9LDTA 5DT2A 4DARA 2YQ5A 1KH1A 5EE1A 2ZSEA 4TLDA 2ANBA 3WBKA 3KEMA 3NHKA 1NGSA 4L3VA 4H7FA 4UARA 4KO1S 3V3KA 3MWFA 4EJ0A 1Z68A 2GASA 5IJ9A 1ZQ9A 1E8DA 4BECA 1ZY2A 2QZ9A 2HA3A 3ZU3A 2GERA 3MTEA 4ZDJA 4FM9A 2ZRAA 5ICEA 1K89A 2J8ZA 4KGVA 2RJ3A 2PLRA 2EFDB 4HD8A 2WPDA 3D6HA 1PGQA 4Y0VA 4B3JA 1AGPA 4LXXA 1NA5A 3PYLA 4GSLA 5B2EA 1FFYA 1P4HA 2WZQA 3IP7A 2B20A 2P9GA 1OJLA 5DM1A 3GT3A 1J70A 5BQ5A 2OWEA 4U2BA 2Q4DA 2VYCA 1FXWA 3KVNA 5DF1A 1LS1A 1Z16A 4DDWA 2I6GA 3QBTA 1ZXLA 5H9WA 1JZQA 3WBFA 4HZGA 5SYAA 1DT3A 5LUAA 4NBUA 4Q82A 2GWHA 2QPAA 5FUVA 2GBLC 1Z8NA 1ZVMA 3EGCA 1DUIA 4F6RA 4A6PA 5BWOA 3C74A 1JTEA 2P79A 2VSFA 4P4SB 5D87A 4K6FA 5HFAA 3HKEA 2AYZA 2XSZA 4FLFA 4X64B 3PG5A 3W9BA 4DDKA 4IJKA 2QD4A 3SLGA 3S2FA 4ALLA 4MLPA 4TTIA 4XZ3A 5F3DA 1ESMA 5JWOA 1SD2A 4XKJA 2HBYA 4FE3A 3K5HA 1WVGA 3UJAA 1PQWA 2X9NA 1BHO1 1QFZA 4B34A 4DF3A 2WQ6A 4AC9A 1O0BA 1O6GA 4PONA 4X5OA 1WULS 4QDUA 1WABA 5AHRA 3VR6H 5BVHB 4X3CA 4K6OA 4L3OA 5CW1A 2Y6UA 3WK4A 3HBAA 2WV7A 1HWYA 3NNNA 1CUWA 3AJ9A 3E8MA 1UPXA 1WXFA 3CZQA 4TWJA 5BN1A 1LDNA 2E4VA 5DNEA 5GVRA 1T1JA 2WVHA 3N70A 2DTEA 3SS7X 1NNI1 3FGOA 3Q0IA 3W5BA 1QK4A 4H77A 5KVVA 1QANA 1XJCA 3MMSA 4JYPA 4DCUA 5JAOA 1C9YA 1ZK2A 1T5SA 2IY9A 5FBRB 1N1GA 3BD9A 5LA6A 4GR5A 1KI9A 1IUKA 2Q5IA 3AWDA 3RVMA 1YCGA 3TCNA 5LZ5A 2FZ4A 1VKZA 1TLLA 2B7CA 3AR5A 1BQ3A 3W4IA 1NKVA 3ZLBA 3E4CA 1FOEB 4E5DA 2GCOA 3I5AA 2VBCA 3ROEA 3DMHA 5F4ZA 2DY0A 1BS1A 4HVAA 3QE3A 2UUAB 1UQRA 2XEXA 2O5RA 2P27A 3K5PA 1ULBA 2F67A 5F21A 3COJA 4TLEA 5E6UB 4B3GA 3HDHA 2NUTB 3X1DA 3N8IA 5EUMA 3I2HA 3IBYA 1I30A 5F76A 1FTSA 4WHMA 4CLOA 1YNSA 3DAOA 4N8DA 5LXTF 2JIQA 4NCIA 1FTYA 5E7MA 4WK0B 5GGYA 2VP2A 3HEBA 5JCPA 3GQBA 4GEGA 2RHRA 4WKNA 4IH9A 2I1LA 4A0GA 4EO9A 1GR0A 2Q6TA 2QD2A 2WAOA 2QD5A 3EUAA 3MIZA 5MFPA 4CEHA 5I8ZA 2IYFA 4GZ3A 5L53A 1SBTA 1NMYA 2GK4A 2PH1A 1M5UA 3NC0C 3P9QA 3ETHA 2O3RA 2Z95A 4N5IX 4ALMA 1TGVA 3D7SA 3ESXA 2VTEA 3V1LA 4BIIA 4EKNB 3OAAD 2VPZA 1U2GA 1QIMA 4HK4A 3EQZA 1VLQA 1OLSB 3IHWA 4KN6A 1DAHA 1RWMA 4YP7A 4DR6B 1MEOA 3HR8A 1XTVA 4W8GA 3OZAA 3E2MA 3Q12A 1ZJJA 2QU7A 1PJRA 2QVZX 4N49A 4AP9A 1G0OA 2VYVA 3MJ4A 5FLEX 3ZI7A 3HK2A 1E1MA 1Q11A 1W581 5KZMB 3PLAE 4YGXB 1L5ZA 2FW1A 1LBSA 5C37A 3U1TA 5K3EA 1RWXA 1DC4A 4GAEA 1I3KA 1NVBA 1VCIA 1VJDA 2C5GA 2ZJAA 3B85A 3A1TA 3FBGA 3FMIA 3O47A 4O4LB 4QBFA 3W5VA 3I30X 1WCV1 1ECGA 4ZOBA 5ADVA 2D2FA 2GBCA 2YVUA 2ZUVA 1RJWA 4X94A 1LF5A 3T9BA 2I03A 3MS4A 2QQEA 5DM4A 3CLUD 3IVRA 3I32A 2F6RA 4K9PA 4DCTA 5A5GA 1XTRA 5F2NA 2K7FA 5A4KA 4HWKA 3UY4A 1SUWA 1XG5A 4M8NE 3K1TA 3K1AA 4O4HB 4TVOA 5JBIA 1EP1B 1PFQA 3BHMA 5IKEA 4ZVPA 4G5XA 4LOLA 1L8LA 2PZGA 2R8OA 3ESDA 1TMYA 3NJ8A 2WKSA 3QVSA 4WESB 3SVLA 1CDOA 1K4MA 1BW9B 2H1WA 2HGZA 2C7PA 1CUDA 2I4TA 1VDZA 3SDSA 2WK1A 4RWZA 1J8FA 3O95A 1EUYA 2PRSA 4MGEA 1V9SA 1YOVA 2PUTA 3FDJA 1SVNA 1GNRA 2PM8A 3TQQA 4FZ5A 3L4BA 4M49A 4KN5A 2ZIFA 5ERYA 5THKA 3ZWNA 1S2NA 1SIWA 2QRKA 4ZPJA 3JQEA 3ONDA 2FSPA 3IL2A 3T0IA 2HK9A 1BWSA 3FGPA 4PNPA 1EIZA 2EEPA 4FKMA 5KHAA 2Q2OA 2GXUA 4K9QA 1EFKA 1Y1LA 4JBYA 4N3CA 3ZIAA 1U3TA 4ENTA 3L1JA 3OP4A 1FB5A 2AWOA 2GM9A 5CEFA 1VL0A 2V54A 1KJZA 2D62A 4FOOA 4E6PA 3CGGA 1ND6A 2HRQA 3DP9A 5CFPA 4JBXA 1OASA 4D0SA 3LOPA 3EZLA 3TINA 1RJEA 2ZBDA 3R9KA 3RROA 4QJBA 1XNRB 2E1RA 2ZXFA 3HKCA 1ULUA 2ZSIA 3ETNA 3D1LA 2CJWA 4EKIA 3RYFA 5EL0A 3GNTA 1NT4A 3A3PA 3HRIA 5GONB 5K8CA 2GYUA 3ZZTA 5GIOE 3CZAA 4HYQA 4H60A 1G8JA 4V0MA 2BFMA 5D5PA 3BFKA 2YNMD 1FVXA 3MS2A 2D1FA 2PUEA 2OP0A 1W35A 4KXUA 2ONZA 5G4LA 4NNPA 3GW8A 5FBWB 1NE7A 4LX0A 3PUHA 1XMJA 1I13A 3C8UA 1C2TA 2ACVA 2EP8A 3ECAA 3FVQA 3QPVA 1X3SA 4NC9A 3GUHA 2G67A 2EW8A 3OCCA 3W05A 1NR5A 2Q3EA 3OLZA 4BTEA 5M34A 3T0FA 1MQ8B 5LDDC 1KMHA 3IKTA 3O38A 1QRSA 1M2OB 2YY7A 4QG7A 3AUSA 5ESWA 3EVEA 3WTBA 1JHRA 2X5XA 3FNGA 5AHOA 4NG5A 121PA 3FPEA 3K6JA 4IGFA 1T0PA 5IJZA 3VR2D 3G5AA 1SCKA 3T7IA 3ZQKA 4FT4A 2AR9A 1QRAA 4EY4A 1BMFA 3E03A 3GZ4A 5JS1A 1FUKA 1P91A 2IYUA 3LK7A 2Q6KA 2B83A 2OZLA 3VZPA 5KYXA 3BMNA 4PC7A 1YH3A 1BCSB 1V35A 3IVMA 4WJZA 4PHGA 4RY9A 4NMXB 3ZGLA 1H2RS 2CLFB 3Q41A 2WWVD 4GR9A 1P7ZA 2B61A 1OH6A 3B36A 4YYEA 4RBNA 2GUGA 1GZ4A 1XO1A 1VOTA 1D2AA 1QF6A 3SQWA 3K2QA 1V0JA 3K8OE 1G8HA 1N2CA 1AO0A 3HA3A 4HR7A 2IUEA 5INTA 1VHQA 1WKCA 3SEQA 4ZI7A 2W2PA 3CU5A 4HH3C 1ES9A 4TM7A 3AKEA 5B1DA 9ABPA 4AN1A 1TZKA 3PDJA 3BICA 1UP4A 1KTVA 2YXDA 3SZRA 4O4IA 3ZU6A 3UJBA 1A9OA 2XVAA 1HM5A 1E1NA 1RBQA 1YL7A 2CNWA 1I6WA 3QHAA 4Q4DA 4DVJA 1GZ6A 3ZZNA 1U90A 1KZYC 1T3GA 1TD1A 2JCXA 2JNWA 2UYGA 4CETA 4DE5A 4WAUA 1HDIA 1JG7A 1QLJA 1Z2EA 2ZSHA 3LGAA 2VP3A 3CVXA 3OZGA 3DDOA 3WQRA 3QF7A 4ZALA 4BNTA 4GKAA 4OJMX 4YVFA 3D0OA 4K1XA 4FU0A 5ED0A 2GZRA 4IILA 5KKCA 4X3OA 2P4QA 4QBTA 3RG8A 4UPEA 4XWYA 2VZ0A 4XEHA 3KUUA 1GM5A 4MR9A 1MJ5A 5G3ZA 4YAGA 3UW3A 1NMZA 3HEMA 3Q85A 4I4NA 1C3OA 3HWSA 2XCTB 5CW2A 2HLHA 5JH7A 1KZGB 1QOQB 4I9FA 5J2UB 4XX0B 4ZZIA 2QI9C 2XX3A 1ZVVA 1PWYE 5AW0A 4C7OB 3E48A 1TJ5A 3UTCA 2FMFA 2IYAA 3C4QA 3L0OA 5D6OA 3RTAA 1GGFA 3BE6A 3HU1A 2COUA 3N0RA 5EWJB 1QF9A 4R9NA 4OI0A 1X7YB 2C4TA 1WY7A 4AZTA 1FFGA 1FFSA 3ZWOA 3S2IA 3RF7A 2J3QA 1AMNA 1KPHA 1J23A 5MGBA 3DEYX 4UOZA 3CUUA 1R0BA 1HFKA 3QFHA 5FWXA 5B12A 3BULA 1D2RA 4QTZA 2Q2VA 5HKKA 4B6FA 1EGHA 2WIJA 1G20E 1NV8A 5H80A 3UJ7A 4DHEA 4HQLA 2YFKA 2ZB2A 4Z4GA 4TMVA 5K7SA 4HUTA 3R7AA 1Z2AA 2GA8A 3ROZA 4O4JB 2QW1A 3PYXA 3OIUA 1LFAA 2VAXA 2CNBA 1QF7A 4P81A 1EEXB 2C9BA 4Q9DA 1YFJA 3FH0A 3BA6A 1PVOA 1HETA 2ZP1A 4EF6A 1NUUA 3H5WA 3LLVA 1P6QA 1FC0A 4K9LA 1HQCA 3PT5A 5HYVA 4TMKA 3IJEB 5KYTA 1IG3A 2HBQA 4BMZA 3RVNA 4US2R 3GLHA 5KX5F 3N8NA 3I8OA 2ZTLA 3UBMA 3EA4A 2XT0A 4ZV9A 2XNHA 4NK5A 4AJHA 1Z4OA 4NBWA 1H2WA 5DI9A 1U94A 1OAOA 4TLCA 5ERXA 5CFOA 1M7GA 2XZTA 3EDMA 3ET4A 4C5CA 3GROA 3ACBA 3UUWA 1UCFA 1ZMBA 1GTL1 2B8JA 2YUIA 3D3QA 1JU9A 4LHZA 4A3SA 3LP5A 2C9YA 3AKZA 2WMYA 3IS3A 3WIBA 4YPVA 1R27A 1PV1A 5BN3B 1OOEA 1NVVR 2DPGA 4MAMA 1HNWB 1E89A 3PDHA 4W63A 3FJYA 4E5KA 1W29A 1EG7A 3LC1O 1GNSA 1K3FA 5ALSA 4A2CA 4JXZA 1GU7A 4G3XA 2BLLA 3LW8A 3R9WA 1K8ZB 2QNRA 3MBOA 2G9NA 4IHJA 3LY7A 2QM8A 2VT7A 1OLOA 1Z0UA 5I7OA 3OF5A 4UUMA 1PJ2A 2EJTA 2IGTA 1C7RA 3HBFA 1B16A 1M8JA 1N8TA 3KEFA 3BH7A 1UAYA 2R65A 4FYIA 4BWGA 3EPHA 3RAJA 3A6HA 4GPIB 1NVGA 4LDNA 2JJ1A 2PX6A 2VT3A 1JLSA 3LBAA 2VJAA 4J1SA 1U0NA 5AUQA 1XL1A 1PTJC 2JGMA 3KJIA 1UMCA 1XK6A 3U7QA 4MHSA 1PZNA 2NSDA 2X40A 4CV3A 3ZHVA 3QVGB 1NDQA 1EUDA 2YW9A 4JFAA 1U7DA 3SJZA 1KI6B 3A1WA 3JRXA 4HAUA 3LQYA 1G5TA 2VSXA 4G56A 2CCKA 1OFHA 1SUSA 2WTBA 4MYTA 4RVCA 3SPXA 1OZFA 1THMA 3PR3A 4O2AB 4O4LF 1WU8A 5J1TB 4EDHA 3UFXB 1SUCA 1UUFA 1ZN2A 1Y3AA 2AFRA 2ZYVX 2C59A 3SHFA 1M76A 1KH3A 4X71A 2ZM5A 2OGSA 4IO1A 1JYSA 1Z5GA 3FI0A 4NS4A 3GJZA 2JS7A 1WD5A 3C7DB 3RE1A 4CTMA 5C18A 1NW8A 5CLJA 1B1AA 1OBCA 3PNLA 4I9GA 4GI3A 4WRRA 5FR1A 1BTOA 1UKYA 4ZEMA 5F4BA 4NEGA 5FPYA 2C31A 3BWEA 2NV0A 4ZA2A 1NUPA 4EFNA 4J1NA 3QLUA 4O4HF 4XDYA 4KQWA 3OZUA 4WNCA 2P0AA 3RYCB 3BD8A 4OHKA 1M1YB 4BZWA 4X63A 2PFSA 1RM3A 2RSLA 3AL3A 3MBIA 1DFIA 1H0SA 2DH5A 2I7VA 5IC6A 3HDYA 1YRWA 1P2VA 5TSDA 1EFHA 2BV3A 4J3FA 1GKLA 4BE7B 2HF8A 4EMBA 1ENPA 4XWAA 1BJRE 1NP6A 2V0NA 2PK3A 2WU1A 1Z7EA 1T4GA 3D3WA 3F9CA 3FZQA 3KQOA 3TSWA 1XTQA 4YT8A 3KL4A 2KHZA 1J22A 1NXWA 3DBHB 3ENKA 3NGMA 2IDJA 4BEWA 1OHHA 2Q0QA 3OEWA 5I9IA 2A94A 2WB2A 5DWQA 3TUJC 1KYYA 2PBZA 2XGOA 3LVFO 5CHYA 2EL9A 2WSSD 4JH0A 3ZKWB 1YZGA 2A0FA 1Z26A 1JX6A 3GJYA 1SOWA 3FFWA 3HKBB 4K03A 4O0LA 1RI5A 1ZRMA 3RUEA 3TH5A 3QXHA 6ADHA 1VRWA 3ORYA 4LA4A 3ER9A 4DV2B 3RRNA 3F7TA 3M9LA 1B8NA 4MB0A 3KLOA 1Y42X 1Q1EA 1JJBA 3CPJB 1Y8CA 2V59A 3KB1A 1KRXA 3TIGA 3PUWA 2HSGA 5KNCH 1JEYB 1XUOA 3KJGA 2HRBA 1IBCA 1K0FA 3R5KA 3X2SA 1KBQA 2A0WA 4JOBA 1BFDA 2MSCB 4LSMA 3IEUA 3D6VA 2AMLA 4ENUA 2VQSA 2CBZA 3O4JA 2PZMA 2PKWA 2AV6A 1YZUA 4V03A 3L6RA 3ICPA 1JKFA 1TRHA 2BFBB 4JLSA 2O20A 4ZAXA 4CF7A 3I61A 1OC2A 4TN5A 5T4BA 2AFVA 3GRYA 1FMJA 2OXCA 4HLNA 5GONF 1M8KA 2W6PA 2ZGVA 3DE0X 1DKLA 2P2LA 2Q1TA 4CE6A 4M37A 4H18A 3Q8KA 1GTRA 1HE5A 1B41A 2HYIC 2D8AA 1LI4A 3AM3A 1FXUA 4D3ZA 2JGAA 2P9FA 4YV2A 3K30A 1A88A 1F6DA 1U0TA 2X4IA 4JEUA 5H3HA 1H94A