4XDZA

Holo structure of ketol-acid reductoisomerase from ignisphaera aggregans
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
328
structure length
328
Chain Sequence
AKIYKDEDISLEPIKNKTIAILGYGSQGRAWALNLRDSGLNVVVGLERQGDSWRRAIDDGFKPMYTKDAVAIADIIVFLVPDMVQKSLWLNSVKDFMKKGADLVFAHGFNIHFKIIEPPKDSDVYMIAPKSPGPIVRRSYEMGGGVPALVAVYQNVSGEALQKALAIAKGIGCARAGVIESTFKEETETDLFGEQVILVGGIMELIKASFETLVEEGYQPEVAYFETVNELKLIVDLIYEKGLTGMLRAVSDTAKYGGITVGKFIIDKSVRDKMKIVLERIRSGEFAREWIKEYERGMPTVFKELSELEGSTIETVGRKLREMMFRGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cofactor specificity motifs and the induced fit mechanism in class I ketol-acid reductoisomerases.
pubmed doi rcsb
source organism Ignisphaera aggregans
molecule tags Oxidoreductase
molecule keywords Ketol-acid reductoisomerase
total genus 130
structure length 328
sequence length 328
chains with identical sequence B
ec nomenclature ec 1.1.1.383: Ketol-acid reductoisomerase (NAD(P)(+)).
pdb deposition date 2014-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01450 IlvC Acetohydroxy acid isomeroreductase, catalytic domain
A PF07991 IlvN Acetohydroxy acid isomeroreductase, NADPH-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3730.40 Mainly Alpha Orthogonal Bundle ProC C-terminal domain-like fold ProC C-terminal domain-like fold 4xdzA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xdzA01
1DXYA 1F0YA 1YDEA 4YT8A 3U9LA 4DLAA 1WPQA 1X0VA 1R15A 1HYHA 4R9RA 2V7PA 3JYPA 4BNZA 3ITDA 4HNHA 4DPMA 1DRVA 1R4MB 3GPDG 1WAMA 2Y1CA 3I6QA 1PTJA 2VNSA 2NU9A 3IJPA 1UZMA 4J4BA 5L7WA 5EL0A 4YXFA 2CUKA 3PWKA 1JKJA 1DIBA 2ZB3A 5C37A 3JQ7A 5EQDA 4Y98A 4UUMA 3QHAA 4XYEA 4BHTA 1HETA 4E0BA 2WE8A 3VH3A 3WIDA 1E3IA 5KKCA 3LYLA 3R3JA 1Z7BA 1N1EA 5CDTA 1RKXA 3GT0A 5JMPA 4BO1A 2P9EA 1ADCA 2J5KA 3SXPA 2W8ZA 4IY1A 2OORA 4XX0A 1ZMTA 3RROA 3GG2A 4XRGA 3SJUA 1T2EA 2GO1A 2HLPA 2QZZA 3WYCA 3D4NA 2WDZA 2I9PA 1X1EA 3PPIA 4CMGA 1GAEO 4HFNA 1QORA 3VC7A 4FS3A 2YYYA 3IL2A 3RBVA 3D7LA 4FW8A 1FXSA 3OF2A 4TSKA 4WOJA 4QSMA 1B14A 2QHXA 1ID1A 4RL6A 4RVDA 4DYDA 5JY1A 5HS4A 3MJVA 4A26A 3UCEA 5JS6A 3GVHA 3UXYA 2AE2A 4OSOA 4JX8A 2YHIB 3RASA 3RBZA 5KTKA 3BIOA 1HZZA 4ZU3A 2EW8A 3LVFO 5A9SB 2AQ8A 5JDCA 3DDNA 3BHJA 1MXHA 2HDHA 5AOVA 4F6CA 1VRWA 4PCVA 2P9CA 4UEKA 2PD4A 2PH5A 4BO8A 1Y9AA 3VHRA 2IEDA 4CQMD 1CRWG 4Q3DA 1HEUA 1QYXA 2GN4A 1KC1A 2O48X 3AOEA 4UVDA 4ZGWA 3HQ4O 5A3JA 4Z9YA 2ZB8A 4FN4A 3WICA 4E32A 4E2XA 5JBIA 1N9GB 4NBRA 4HV4A 1E7SA 5DP2A 1DJNA 4IMPA 1WW8A 3L4BC 1ISHA 3ETDA 1PL7A 3P5SA 4RVSA 1U1IA 4GX2A 1AGNA 1DRWA 2NVBA 2BELA 4FSHA 3WIEA 1XSEA 2AG8A 4RQTA 3AI1A 4YB8A 4JIGA 4B4OA 2JAPA 3E18A 4OIMA 2OP0A 1ADGA 4PRLA 3NT2A 4NNJA 3RFXA 2PKQO 3OFSA 1BG6A 1YJ8A 3K73O 2VUTA 3EYWA 3OJLA 2E48A 3DZJA 1B3RA 2DBZA 1I10A 2X1HA 3GA0A 1TA4A 2NU6A 5EMHA 4BB6A 1DIRA 4OOFA 1ONNA 1H0KA 3P2OA 2EKQA 3PK0A 3TFQA 3RSHA 2PGLA 3AUTA 2OZPA 4F45A 2B83A 1GYPA 5TRTA 4ALLA 1WZIA 5A3VA 3VAZA 3Q11A 3IP3A 2G5CA 2P4QA 5BQFA 4XD2A 4CM4A 1HDCA 3D5TA 3ORFA 4IJKA 1SB9A 3I4FA 4KOAA 3ZWMA 3VPFA 1EBFA 1YXMA 3C1TA 2G1UA 1YONA 4NMHA 4GWGA 4IIUA 4OXKA 3I23A 5DN9A 4A10A 1MGOA 3GHHA 1NASA 4XYLA 2VRCA 3LU1A 4RVGA 4XJSA 3TN7A 4IDBA 1A9YA 3KOUA 3W8EA 5G0VA 4M89A 3HWRA 1PX0A 4BB5A 3JTMA 2Q99A 2DUWA 4AICA 3O38A 2VCYA 5G4KB 1U3VA 3AFMA 4A2CA 4CQMB 2EGGA 3DAGA 1ISIA 2PZMA 2Y0DA 3RC2A 3H4VA 1E5LA 1NQOA 4YCAA 1E6EA 3PWSA 1E1KA 1P44A 3JQ6A 5CDSA 2VTEA 3WR5A 3VZQA 2WYVA 5IAAA 2Y93A 1XIVA 1XR3A 5CPBA 1F17A 1P77A 2CDAA 1I32A 1E3WB 3WGQA 3DBRB 2IDZA 1C0PA 3UH1A 1YH3A 1CQJA 1VL6A 4YQZA 4XQCA 3CTMA 4FGWA 3ZGYA 5JC1A 5HWSA 3ETGA 4AJOA 4YVFA 1BTOA 2B5VA 4II2A 2WM3A 5EERA 4CMIB 4XWYA 2DKNA 4I5EA 2O2SA 2GYYA 4O59O 3PQDA 3OIDA 4RPLA 4R16A 5I7SA 1O8CA 2JHFA 1R12A 2UUPA 2AQHA 4ID9A 4M54A 9LDTA 2RHRA 1QLHA 1PGOA 2ZTUA 3FBTA 3BMCA 4O6VA 5F1OA 3Q3CA 1VM6A 3JQGB 4M8SA 4XGKA 3HFSA 1KIFA 4PVCA 1BVRA 4Y6SA 5TJHA 1U3TA 2FWMX 1HSZA 1WDKA 4IXTA 3ZWBA 4DQVA 2BFPA 2Q46A 4MVJM 4A7PA 2DBVO 5L4LA 2A94A 4WEOA 4B4UA 4OM8A 4M1QA 1GEEA 3MZ0A 2HU2A 2FPPA 3RFTA 3F5SA 4DIBA 3ZWCA 2VYVA 3F3SA 3OQ6A 3FTNA 2JFGA 3AY7A 1IE3A 3CXRA 3F1KA 5B4TA 3RU9A 1ZIDA 2BRUA 4KZPA 2AXQA 3GUCA 4GX0A 5AXCA 1B2LA 1DB3A 1I36A 4LISA 1GYRA 1ML3A 3EDMA 3L9XA 4MJLA 4YJDA 3INRA 3E8XA 2WD8A 1IB6A 3A4VA 2CVQA 3OA0A 2O3RA 3CUKA 1J6UA 3EK2A 3H5AA 4Q3AA 4ND4A 1D3AA 1F06A 2YV2A 2IE0A 3V8BA 3KZVA 3COSA 3UGKA 1ISJA 1HE3A 1HXHA 3ZV3A 4OHUA 3PFWO 1ZZEA 4IDCA 5EPOA 1HLPA 5L40A 4CLRB 3JQFC 3IAHA 4BO0A 2QIOA 3FHLA 1KY4A 1KEPA 3SLGA 4W7IA 1P1JA 1E3EA 5FFFA 4BVAA 5CDGA 1DC3A 1ZEJA 4QECA 3QJ5A 4E33A 1PQUA 4AFNA 3Q6IA 3KB6A 3C3XA 1HDRA 4R5HA 3E1KA 1QYCA 1SBYA 1TB4A 4JJFA 3WWZA 4HXYA 4BNMA 4FFOA 4IQ0A 3GG9A 4NPCA 1NNUA 3FNHA 4HFJA 3I5MA 4ZQFA 1NXQA 5CEEA 3M2TA 4DGSA 4KQXA 1BRMA 2PZLA 1DO8A 1VPDA 2DT5A 3RU7A 4F46A 3MJ4A 3WTBA 4J91A 1YBAA 1W0CA 1WP4A 1A7AA 3MOIA 4NFYA 4I5GA 3BTUA 5KIAA 1I5RA 3AW9A 2JHGA 2EW2A 1WDLA 4DBZA 1LUAA 5ER9A 3N74A 4YAGA 1GCUA 4LK3A 2D2IA 3NV9A 1IY8A 4A0SA 1NVGA 2PV7A 5TT1A 5BSGA 3I1JA 2YDXA 1YVEI 3SBOA 3W4IA 1E5QA 3WMXA 1R0SA 5FF9A 5JCJA 4IPTA 3F5QA 3PJFA 3S2EA 1X14A 5EIOA 3AJRA 4O1MA 4CMKA 5C7LO 3RUAA 3HB5X 2XXJA 1HWYA 3ZNPA 1E6UA 3OJ0A 5THKA 2QYSA 2C2YA 1PZHA 3PDJA 5C7OO 1YBMA 2HAEA 3P7MA 4TKMA 4JXKA 4IDDA 5CP8A 3PHJA 1XHLA 4FQ8A 3Q2KA 4ALMA 4XKJA 3RBXA 2JFHA 1ZSYA 1XA0A 4ONEA 2VT2A 1GQQA 4WJZA 1YL7A 1SAYA 4QTZA 1MP0A 1BW9A 3KSDO 5JAQA 2D4AA 1O95A 2GZ2A 2JCYA 4RZHA 3GAZA 2CVZA 4NBUA 4Y6PA 1LSSA 3OP4A 4PG4A 2A4KA 3QWAA 3LZ6A 4DIFA 1A72A 4J1NA 1KYQA 4J4HA 1A71A 2XOXA 3WLFA 4ZVVA 4BOYA 1LTHR 1BVUA 4LMRA 1U8XX 1NFFA 4S3MA 1K2WA 3Q1LA 4QFCA 4MO2A 1B15A 3H6KA 3OQBA 4PLZA 1ISFA 3AM5A 4QQRA 3TOZA 1E3JA 3IDSA 3F4LA 3PTZA 4KUEA 1UXHA 3ZV4A 4TKLA 4CLHA 3DMYA 2NU7A 2AA3A 4NFHA 3GC6A 1PGJA 1XCBA 5ILOA 3JD4A 3O4RA 3KYCA 4NDNE 3R0IA 5IDQA 4ITUA 3DBLA 3TJRA 3UICA 1B26A 3PHLA 3QV1A 1EZ4A 2WWRA 3VPHA 3H3FA 4YEDA 3K30A 1A9ZA 5TGDA 4BUCA 3CZMA 2O3JA 3QP9A 4Y67A 3ZH2A 2EHDA 4TVBA 4XQEA 4YRBA 5IF3A 1AHIA 3EY4A 3EZLA 1N9GA 4IJUA 1RM3A 2Q1TA 1KC3A 4II3A 2CZCA 5BNFA 4A5OA 2FRDA 3FWZA 2FZEA 1C0LA 2PGDA 4BNIA 2X86A 5I7EA 5T5QA 1WDMA 2JL1A 4IS2A 1PQWA 4P38A 3PYMA 1I3LA 3UAGA 4GWKA 3CH6A 4Y6RA 3QVXA 2YHUA 4YJFB 3HN7A 1P1IA 3RKRA 5ES3A 5A02A 5F3RA 3AI3A 4IM7A 1DPGA 1ZK1A 4DBVO 3TZ6A 1ARZA 2E49A 3BMNA 1NPYA 5DCUA 4BGVA 1HZJA 4X54A 3NGLA 4K6CA 1DJQA 1LDMA 5DCYA 4QFDA 2IODA 4KP7A 4F6LA 3DTTA 3GDFA 2X22A 4CM8B 1ZUD1 2WD7B 1F8FA 3RQSA 1VE9A 1LLCA 5COBA 3DHYA 3QWHA 5K9ZA 3DOCA 4TRMA 1DIAA 3PGXA 1QV6A 2D5CA 2BHLA 4BV9A 3QA9A 2EWMA 4WK6A 4KWHA 3JQ8A 2FSSA 4PLWA 2Q1WA 4MVJD 3I9NA 4GMGA 2ZQYA 2YDYA 1Q0HA 2ZYAA 1LX6A 4UREA 1DBVO 1KEWA 5COQA 3PVZA 1G0OA 1VL0A 2QG4A 3JQFA 4G5HA 4KUHA 1ZK2A 1M2WA 4QUKA 5G4KA 1LLDA 5HA5A 4YAIA 2Y68A 3UOGA 5DBFA 4GX1A 4B4WA 3I9KA 3JQ8B 3TWOA 1FDWA 3M1AA 4WCFA 2PZKA 1SC6A 4LW8A 5KVCA 4L75A 1CYDA 3KM0A 3ONFA 4NJMA 3DMTA 3GVPA 2DUUA 3ADOA 1ORRA 3TDKA 5B12A 2VNAA 3HDQA 4HBGA 1QP8A 3JQAB 3RUEA 4YQYA 1X1TA 4BNLA 2J5RA 3AWDA 3IS3A 1C1DA 1ADBA 1MFPA 1Z74A 4HFRA 2HKIA 5F21A 1GDHA 3L07A 2AMFA 1KERA 5BR7A 1ZK3A 4L4SA 3VKVA 2NSDA 2RCYA 3UF0A 1YBVA 4FC7A 4FCCA 4XZ3A 4FOOA 2CNBA 4ZQGA 1D4FA 1JU9A 1V3TA 3DC2A 3OHSX 4C7JA 1V3UA 4E12A 2Y1EA 1XU7A 2EJWA 3JSAA 4A03A 3PJGA 3DZIA 3W8FA 4P4LA 5I8WA 1HL3A 3AK4A 2GN8A 4IDEA 3M2PA 2W90A 2UV8A 1HDGO 3QVWA 5T64A 3AUUA 3B6ZA 1NM5A 5KKAA 2GERA 3VKUA 4BNWA 3V1UA 4PLFA 2R00C 3PEFA 3JD3A 4Q9NA 2X4GA 3QLJA 1YO6A 4EJ0A 5K0ZA 3KVOA 3N7UA 3C1AA 4P4NA 1LC3A 4EUHA 3H9QA 3WWYA 3U4IA 4TRJA 2O3TA 5ICMA 3MTJA 3KO8A 2VRBA 1SOVA 1BXGB 1U9JA 3QQPA 2VWQA 3PZRA 4ZQEA 5AVOA 4DRYA 3C85A 4AJJA 1VLLA 2IZ1A 4CMAA 4JBGA 1ZSVA 5TSDA 1JLLA 1T1RA 2OUIA 1JWAB 1LDNA 1HKUA 4R9SA 4J1QA 3O8QB 2OO5A 3C24A 1YOVA 5KCZA 1Q7CA 4WLOA 4YJHB 5DZSA 2H63A 5THQA 4YRAA 5FWNA 1FDTA 1R4NA 2I6TA 4P8RA 1SMKA 4B8ZA 4R69A 1S7CA 4J2OA 5I9LA 3OM9A 2VHXA 4RVFA 1JDJA 1I8TA 5BSEA 4DYVA 2EKLA 3T7CA 4E2YA 3W4KA 4MVJG 1ULUA 3BYZA 4BNKA 4IZIA 4BNXA 4BNHA 3OETA 5CG1A 1R16A 1UDCA 1H6BA 4AL4A 5LCXA 1CETA 1QYWA 3OJOA 5IJZA 4MIYA 5AXAA 3QWBA 1XQ1A 1CERA 3FBGA 5HTOA 3K2BA 5DOVA 1OOEA 4YPOA 5KJEA 1LSJA 4CV3A 2GGSA 3SC6A 1ONPA 2CVOA 1RWBA 2FMUA 4Z0PA 1UP6A 4DA9A 3MTGA 3E48A 4J9VA 1XDWA 3DTYA 2EG9A 4AJIA 1V6AA 2P9GA 4BKQA 5LC1A 1EVZA 3ZZNA 1BXZA 2VZ8A 5L7YA 4AG3A 2IYOA 3L0DA 1LNQA 1U4OA 3JD2A 2OBYA 2Q2VA 4ZQHA 1GUFA 3GMDA 1J5PA 1FDSA 2J3KA 1TI7A 3GVIA 4EJMA 5L4SA 2YFQA 3R1IA 1YJQA 3L6EA 1ZK0A 4CUKA 5KWEA 4JGBA 4RJTA 2UDPA 3ETEA 2GASA 1A4UA 1GV1A 2IRWA 3EMKA 2X5OA 4L73A 4BNGA 4CQLB 2DLDA 4RLSA 5I7VA 4DMMA 2HJRA 2DBRA 4NU6A 2GRAA 4R1TA 4L4RA 3V2GA 4BNYA 5B4UA 1DSSG 1QKIA 4RF3A 1KOLA 1KVTA 4D3DA 4HADA 2D8AA 2GZ3A 4PG7A 1JKIA 2IZZA 2AEFA 4JN6B 2O3UA 2CDCA 5JO9A 1R6DA 4ND3A 3RUDA 2GZ1A 3PP8A 5DCWA 3BMQB 4HNGA 3UCFA 4RO0A 3X2FA 2W4QA 1VSVA 1OC4A 4J7CA 3KYCB 3V5NA 1U3UA 2HSDA 1ZBQA 3DBLB 1MB4A 1VKOA 1GL3A 3HDHA 3F6YA 3QRWA 4LMPA 4XB2A 2P68A 2GD1O 2I67A 4Q3CA 2B69A 2DFVA 1U7TA 2V65A 4BO7A 4D44A 2ZJ1A 1T24A 2NTJA 3RD5A 5JAZA 4MP8A 5ER6A 1DEHA 3WNQA 3BMOB 1HF3A 1IZ0A 4J9UE 4CLDA 2Q1UA 2X5JO 4EDFA 2ZB7A 2BFOA 4RVUA 4U0KA 4Y9DA 4IDFA 1X0XA 3GHYA 1Y1PA 5CEFA 5GZ3A 3ICCA 2C07A 3DZHA 4XYGA 2CD9A 3N58A 4IIVA 5B4VA 5C3MA 5J23A 1YS4A 2Y1FA 5CFZA 1P1HA 3CINA 4Q3EA 4DC1A 2AEMA 1MLDA 1AXGA 1WNTA 2Y0CA 4QXMA 4CV2A 5T67A 5BNTA 1E1LA 1DIGA 4EUEA 1SEVA 4D0RA 3R3SA 4W82A 3KEOA 3ON5A 3WSWA 5JDCC 2OMEA 4WLEA 3ZNNA 2B36A 1RM5A 4YACA 3WFIA 1P1FA 4J3FA 1BGVA 3FPLA 1XGKA 3AU8A 3GZ4A 1YL5A 4I8XA 5F1PA 1EUCA 4CM8A 4YT4A 2O4UX 2OL4A 3UKOA 4AJ2A 3PIDA 4YBZA 3ZNOA 4BO5A 4FD3A 3WGOA 3AI2A 1PR3A 3WX0A 2VT3A 4MINA 4GL4A 4U6QA 3DL2A 4S1VA 1Y9EA 1XU9A 3RCBA 3DB2A 4L76A 3KYDB 4J43A 4AJPA 4RGBA 1D1SA 2PLAA 4RZIA 2R6JA 4BNTA 1LC0A 3HE3A 4JLWA 3PYXA 5EESA 4YWJA 1YB5A 4XR4A 3MEQA 1PZEA 2X9VA 2EV9A 1I2CA 2P2SA 1YB4A 4XR9A 3TPCA 4Z3KA 1ULSA 9LDBA 4EGFA 1A4IA 3ZWWA 3PLNA 3NGXA 3GFBA 4DQUA 1FMCA 1C0KA 3NEPX 3JQEA 4HFMA 4FFNA 3JQAA 2C5EA 2D59A 1WWKA 4WGGA 3F1LA 4TMFA 5IDWA 4XIYA 2DM6A 2PD6A 4IJWA 4RPJA 1LQUA 1HDYA 3DZBA 6ADHA 4N54A 3U4HA 3DXFA 5A06A 3DFZA 4QO8A 5JLAA 2EIHA 2PWZA 4BGIA 1LSOA 3TRIA 3GZNA 4MKXA 3ZWNA 5IDYA 4IQGA 1UAYA 5JDIA 5JXWA 2J3JA 3RAJA 2GPTA 2HRZA 3QSGA 2VUUA 2YY7A 4BKUA 4OYRA 4W6ZA 2HMSA 1N5DA 2Y0EA 4HKTA 5B1YA 2WYWA 2E6UX 1JQBA 3HB4X 1XYGA 4JJGA 5L45A 1QRRA 1YDWA 1UJMA 3RKUA 4GQAA 5CPFA 4AJ1A 2AE1A 3BHIA 5L7TA 2WEKA 4E5NA 2FN7A 1O6ZA 1NTOA 5U1PA 4CR7A 3KSZO 4ZRMA 4EEZA 2C59A 4MPDA 2OHXA 3F4BA 4NU5A 1GFSA 4K28A 1EDOA 1QG6A 4E21A 2H6EA 3LLSA 3WXBA 4C7KA 3IUSA 2IXBA 1BDBA 3VPGA 2VHYA 2I3GA 3KSUA 4K9DA 2X0RA 4OKNA 1UZNA 4J7UA 4U0JA 4K1LA 1MUUA 1LLUA 3P19A 3D3WB 4XYMA 3F46A 3WB9A 3AOGA 5JAMA 2AHRA 1M66A 3WMWA 1DDOA 1UDAA 1PJTA 1G6KA 5DP1A 1UXJA 2V6FA 4J1SA 4CQMA 4MOWA 1U2DA 3PHIA 4LRSB 4MVJE 7ADHA 1Y8QA 5IDXA 5HRUA 2AG5A 4FJ0A 3GEDA 4XIJA 1KVSA 5DBGA 3U4DA 3GRKA 2VWGA 2O2YA 5IG2A 1NAIA 3L6DA 1TT5A 4BGEA 4BNJA 1HLDA 3HDJA 3FCOA 5AXBA 5B37A 3E9NA 4D46A 3C7DB 3E9MA 1EE2A 4R1SA 4PN3A 3HSKA 6LDHA 1J4AA 5ENDA 5LDHA 3H9EO 1PGPA 5JYEA 1GY8A 4CLRA 3EUWA 3GN2A 4IBOA 1B0AA 5A4DA 1LI4A 3D1LA 3GGOA 2JFFA 1YKFA 1QSGA 2E37A 3AM3A 3K92A 1JVBA 5L4NA 5TNXA 4MDHA 3FSRA 1T1SA 2Q4BA 3AUAA 3WGYA 3MWEB 5EINA 3C7CB 4WNCA 4LCJA 3L4SO 1AUPA 3ZI0A 3FNEA 1L7EA 1P1RA 4W7HA 2BI8A 4NZ9A 1E1MA 2BI7A 3DBVO 3ZW9A 4I9HA 2UVDA 4BV8A 2DTDA 5IXYA 2OGUA 1W8DA 3PIIA 2BFAA 5H81A 1ZVMA 4BKPA 3JYOA 5KJFA 5KVVA 2NTVA 5MGBA 1JA9A 3UVEA 1E7QA 1GUYA 2SCUA 5A9TA 3KLMX 2QX7A 4B4VA 4G81A 1L7DA 4C4OA 3IKTA 3I3OA 4FIZA 2Y1GA 4PG6A 2YV3A 1T25A 4YJHA 4CM7A 3EVTA 3H9JA 2IXAA 1PZGA 4W99A 4E3ZA 3TL2A 1E3LA 3JV7A 3GK3A 1VKNA 1EQ2A 4PLGA 2HK7A 3MJEA 4CMHA 2W2KA 3T7EA 3DR3A 3HG7A 3U09A 1I3NA 1K6XA 4WCDA 3EHEA 2H1SA 1DFIA 2FR1A 4FJ2A 4E5YA 2W2LD 2HK9A 4IJVA 1FDVA 1O94A 2BFMA 2ZKLA 1YL6A 3HHPA 1P1KA 3CMCO 4I5FA 3AFNA 3STHA 3BMQA 1JVSA 1EBUA 3CE6A 3WGZA 4Z6KA 3OEYA 3RUIA 2Q1SA 4JBIA 1O0SA 1IL0A 4BNNA 2A9FA 3NAQA 4XQ9A 3FI9A 1X15A 1U2GA 3LC1O 4J49A 1GADO 4EZBA 5G4LA 1PGNA 2O7QA 3A28A 3F47A 4FFMA 4J90A 3AOEC 3OMLA 3WS7A 1HYGA 4DTIA 4ZN6A 3BA1A 5K6AC 3ZHBA 4OKIA 1A27A 1I0ZA 3BTSA 4HUJA 4CJXA 3ZHYA 5CDUA 3SVTA 3L6OO 1PJLA 4W4TA 3TNLA 2AQIA 3D64A 4U5QA 3V1TC 4ZHSA 5IZCC 2PK3A 1BXGA 1I01A 4NJOA 4PZEA 2NNLD 4L4XA 4B79A 1ADFA 2B0JA 4JCOA 4NI5A 2VYNA 1BW9B 2PGJA 3ROMA 4B7XA 2Y05A 1I2ZA 3NUGA 4J7XA 3EVNA 2YW9A 3E5RA 3GNSA 1AHHA 1TXGA 3O8QA 2X23A 1ENOA 5KJ1A 4IDGA 5F5LA 3TZHA 4R54A 1UH5A 3WYEA 1RYDA 1GV0A 3KBOA 3HDYA 1RPNA 2VQ3A 4MP6A 4MIEA 3SJ7A 1HDZA 3G1UA 4XEHA 4CMEA 3PFFA 1VJ1A 4R3NA 2AW5A 4BNFA 4PLHA 3UFXA 3IUPA 4I08A 1V35A 1NQAO 3OA2A 2NVUB 1GU7A 4FPXA 5IN5A 5GY7A 3GUYA 4IXWA 2BH9A 2ZCUA 4CM3A 4AJLA 1PJBA 1MG5A 3BMOA 4U7WA 1UP4A 3I83A 4E5PA 2GNAA 4UEOA 4IQ8A 3PJDA 1WLYA 1XKQA 3RUHA 8LDHA 1IOLA 4G65A 5CG2A 1C1XA 1GYQA 3U62A 1JAYA 4PIVA 1LA2A 1X7HA 1NQ5A 1G1AA 2H9IA 1I3MA 2Q50A 3IQDB 5IFLA 1NPDA 3NTOA 4PG8A 1E7RA 3TQHA 3PDUA 4LGVA 1ENPA 3H9GA 1DC5A 1QYVA 4B3JA 3NT5A 1LDBA 4TROA 4D3SA 3C1OA 1E0DA 2VUSA 3ROQA 4R41A 5L3ZA 1O9BA 1NX6A 4A27A 5I9NA 3RUFA 2VZ9A 2NQTA 3G49A 1O89A 2VHVA 2ZB4A 3JQ7B 3ZU4A 4TQGA 4XDYA 4TZKA 3E6AA 2Q4EA 4PFJA 4KTVE 2J3HA 2PFGA 1QV7A 1NVMB 1PSDA 4J16A 4E30A 4NQZA 1VC2A 1NPTO 2EGHA 3AUSA 2D3TA 2FHSA 3I52A 1HE5A 4FOSA 2VN8A 2IEBA 4GVLA 4WCFC 3BTVA 3WDSA 1M6HA 5KOIA 4KQWA 3CZRA 3DFUA 3GEGA 4GKBA 1U4SA 1C3VA 5JYDA 1CDOA 4FJ1A 4PZCA 4YYZA 1EFLA 3TZQA 4CMCA 2F1KA 1PIWA 3IKVA 1B7GO 1EVIA 1Z73A 2B4TO 2NTNA 3U49A 4L9RA 2Q49A 1B3BA 2BLLA 3DBHB 1M75A 1P31A 5MDHA 5I7FA 2CY0A 4EJ6A 3ZU2A 3JQ9C 1IYZA 5A9SA 5JFOA 1PWXA 4Z9FA 3DZFA 4J0FA 4PLCA 4CMJA 5JMWA 8ADHA 1EK6A 1LLQA 1TLTA 1ENYA 3ENKA 4RPGA 4IZHA 3GVCA 1R4MA 1UXIA 3LK7A 2WYUA 1KVUA 2HK8A 2I66A 3WYBA 2X9NA 1E3SA 1SZJG 3DAPA 3AM4A 4I1IA 4JP2A 4GLLA 3IJRA 2I65A 3WBFA 4UVHA 3OIFA 3ZW8A 2Q2WA 4Q3NA 3A9WA 2ZATA 4M87A 1A5ZA 3PQFA 3GOHA 3UHAA 1ISMA 2YQ5A 2QRJA 3CSDA 4BO3A 3B1JA 2NQ8A 5DNAA 2VHWA 5A5EA 4CL8A 1PJ4A 4OJNA 4U6SA 4W9NA 4JP3A 1K6IA 2OBNA 3JQDA 4JBHA 1KBZA 2Y1DA 1X7GA 2GN9A 4GBJA 1NAHA 4YT5A 1DHTA 1FF9A 3UN1A 4CLOB 2WD7A 4UUOA 4NR0A 1CEQA 1H93A 3EC7A 1Y7TA 2D5AA 3TZCA 2B5WA 2EEZA 4RLHA 1CQIA 2FZWA 3LT4A 1PJQA 3LF1A 4Y8VA 4GMFA 4DUPA 2HO5A 1F8GA 1WMBA 2GLXA 3ZWYA 2DQ4A 1BSVA 3MWDB 2Q3EA 1R66A 4XRRA 3GH3A 2AEJA 3HFGA 4UAGA 5I8ZA 3VH2A 1YE3A 3QW2A 4RV9A 1UR5A 5EJ2A 3W8DA 3PYLA 3ASVA 1GZ6A 3LT1A 4N5NA 4WECA 4CM4B 4H16A 1YQDA 3ZU5A 1U8FO 2X0NA 1IZ9A 1DIHA 2WMDA 1I3KA 1YGYA 3M6IA 3U4CA 2DBQA 4OQYA 2E82A 5COAA 1PEDA 4WCFB 5F1KA 1PU2A 2CMDA 3FR8A 4ZICA 5JO0A 3VPXA 4H3VA 4BMSA 2BGLA 4BNVA 1SCUA 1DLIA 1H6DA 1Y81A 4MP3A 3R6DA 3HZZA 1KVQA 4MVJH 4OGWA 2R00A 1XELA 3DZKA 4NG5A 3A06A 3HNPA 2C20A 3GGPA 2JJYA 4KDFA 3B20A 3BMNB 3ONDA 2O23A 4BMNA 1C1DB 1Y8RA 3OQ1A 3K2EA 4DQXA 3B1KA 3W4JA 3INTA 4KWIA 4RCVA 4Z0TA 1X13A 1K5HA 3K9QO 1P33A 1DHRA 1P74A 1LJ8A 1LBEA 3H65A 4K26A 4NK5A 5KVQA 1GCOA 4KMSA 1NHGA 4FFPA 2D1YA 3CPSA 3QVOA 3DHEA 5CHEA 3PJEA 3KUXA 4WLFA 2V6MA 3AY3A 4J0EA 5DF1A 3U0BA 1RM0A 4DL9A 2POQX 4IGFA 5T8KC 3INGA 3LT2A 2FY8A 3IC5A 2YHIA 4UEJA 1KS9A 5BSFA 5GZ1A 3D3EA 3K96A 5IN4A 3K8ZA 3V1YA 5JCJD 3WGIA 3LDHA 1H94A 4CR8A 3PXXA 4D3FA 1E1NA 3CIFA 2YJZA 3ONEA 3NJ8A 2WE7A 4PZDA 1R0KA 2OXIA 2HMUA 1NFRA 1OMOA 1SNYA 2W2KB 3KXDA 5EN4A 3ZDFA 2DVMA 4D0SA 1T2CA 2Z5LA 4OXYA 4CPDA 4FBGA 5JW6A 1NVTA 3LQFA 4P4GA 3IOYA 2X6TA 1JAXA 1MFZA 1PL6A 1K3TA 4CV1A 1LRJA 1ZXLA 1M67A 3G3EA 4XA8A 4D7AA 4BIIA 4LSWA 2EXXA 3I9MA 5TS3A 3RC1A 1GZ3A 1N92A 4NBTA 2JD2A 2NVWA 3NTRA 4DLBA 1HE2A 1DC4A 3NDJA 1YQGA 1FDUA 4RF2A 2PH3A 1YOVB 2GSDA 2UYYA 4BQPA 2OOSA 2ZIZA 4MIOA 3RJ5A 5CDYA 1J49A 1EUDA 2FPGA 3RIHA 3I9OA 1DAOA 1PS8A 1T4DA 1LXCA 3FRJA 3ITKA 4TRNA 1GD1O 2LDBA 3Q2IA 2FP4A 3RJ9A 5FI3A 1T4BA 2CSUA 3L9WA 1BMDA 3V2UA 1D7OA 1J0XO 3OSUA 4IGEA 4B8WA 4ROSA 1SO8A 5JY6A 2J6IA 1MG0A 2GN6A 1W73A 4OOEA 4EI2A 3AY6A 5L95A 1EFKA 3WFJA 2ZK7A 2I99A 5G0SA 5IZCA 1HYEA 1F12A 1K0UA 1MXFA 2BMAA 5F5NA 1LQTA 4ALKA 3WGGA 5K6AA 4WEQA 1V9LA 2GR9A 2VHZA 3E5MA 4NBWA 1E7MA 3LF2A 2C82A 3UUWA 1XG5A 4JJIA 3MJCA 2HMWA 1NYTA 4IDAA 2X0IA 1E7WA 3ADPA 1RYEA 3A1NA 1ZJZA 4PLVA 1NR1A 4ALIA 1PS0A 3VTZA 1Z7EA 3ANMA 3OJFA 4OO3A 3TF5A 4MVJI 1H6AA 2C7VA 4CM9D 1I33A 2PY6A 5FI5A 4BQRA 1PL8A 5AXDA 3JQCA 3W6UA 4YAJA 3BTOA 3T4EA 1PWZA 1OI7A 1YB1A 5KJCA 4YAEA 3ZWOA 2Z1MA 4CODB 3OH8A 4L74A 4RPHA 5GZ6A 3DWFA 1X7DA 3BXXA 4NFSA 1DC6A 3H5NA 1VL8A 4M55A 3ULKA 3ST7A 3LC2O 1HE4A 2YV1A 4WPGA 4H7PA 2BGKA 3NJ4A 1AXEA 2EJVA 2TMGA 3JYLA 1WXDA 1CIVA 3TZKA 4D41A 1T26A 4UVEA 4E2ZA 3GAFA 1BWSA 3DONA 1H2BA 1HDXA 4ND5A 4ZQBA 5BT9A 3VDRA 1E3WA 5KVSA 4YJGB 3E9QA 3PQEA 3ZU3A 4HP8A 1VJTA 1EUZA 2O3SA 2G76A 2NADA 3E03A 5BNIA 4GI2A 2WSBA 1EMDA 1P0CA 2BD0A 3UCXA 2X5KO 4UULA 3JYNA 2YQ4A 1PR9A 4CMIA 3QIVA 4LCEA 2DC1A 1C0IA 4PG5A 1HDOA 3LT0A 2FR0A 3ZHXA 4DC0A 1KY5A 4PRKA 1CWUA 2W98A 4H15A 3AU9A 3OBBA 1PJ2A 1MV8A 3I6IA 1OAAA 1I30A 2GCGA 5FEUA 3WJAA 2B35A 5HS6A 2FOIA 5JCXA 1B16A 1KVRA 2VWHA 4CV0A 1JWBB 3JQGA 1DRUA 3Q0EA 3D5QA 3EAGA 2P4HX 3GNTA 3P2YA 4UUPA 5H82A 3S2GA 4EEXA 4OL9A 5JC8A 2RHCA 1LRLA 3IIEA 2VZ0A 1RJWA 3GGGA 1WMAA 4GPD1 4BO9A 5DDIP 3G79A 3G1TA 4CMBA 1IHYA 4E4YA 3RC9A 2NV6A 1OBFO 1I2BA 3QY9A 3RUCA 1SB8A 1GZ4A 1DOHA 3VOSA 1R37A 3GPIA 3KEQA 3DQPA 1TEHA 2NM0A 2BGMA 2DFDA 3VVCA 5A9RA 3GZNB 4R68A 1NFQA 4B3HA 2ZTLA 3T4XA 2WTBA 4UUNA 3A14A 2PA3A 3EW7A 1P0FA 5TJ9A 5C7IO 2I5PO 1JKFA 2J5QA 4GLOA 4GVXA 2NLOA 4OAQA 4MKZA 1NP3A 3WGTA 3GY0A 2C2XA 4K6FA 5TQVA 4MVJP 2NU8A 3IP1A 4WLVA 4CUZA 2CF6A 3VH1A 4Z9XA 1CF2O 3WNVA 2QRLA 2JD1A 3GR6A 4FR5A 4QX6A 4NH4A 5JE8A 3ZWVA 3ROKA 1LDEA 2I3AA 4YRDA 4ILKA 1FJHA 4NBVA 4XYBA 2JD0A 1QMGA 2CF5A 1GQ2A 2C5AA 4KTTE 1XEAA 2Y67A 4E31A 4YTEA 3TSCA 5LDGA 4E5MA 4OSPA 1UDBA 3H2SA 1H2HA 4MKRA 4ZA2A 1LRKA 4LVUA 3C8MA 1ZCJA 2FPIA 2IYPA 1K89A 4DREA 1EK5A 5TLSA 2LDXA 4I9UA 4N5LA 4B7UA 2HUNA 5CEJA 2GDZA 1XWFA 3O26A 1T2AA 2VRCD 4XB1A 4GSKA 1Q1NA 1QR6A 4E13A 2I76A 2C0CA 1Q0QA 5KNLA 1L1FA 2VYVD 3PHHA 3S8MA 4E2WA 1O5IA 2JCVA 4Z0HO 3L77A 5AYVA 4FC6A 3BAZA 3FR7A 3X2EA 2UUOA 4GAEA 1Y8QB 2J3IA 3K5PA 1UZLA 2NACA 4AJEA 1EQUA 1NWCA 4FFRA 4OXNA 1EE9A 4WE3A 4YJFA 5ENVA 4WLNA 4CLOA 1QLJA 1BHSA 4IMRA 2PKRA 1DAPA 1NQTA 1TT5B 3H9UA 4CL3A 4RQUA 2C54A 2QW8A 4E5KA 4EUFA 1A7KA 1OC2A 2DPGA 3I4CA 4RORA 1E92A 3SX2A 3DOJA 1D8AA 5G0WA 1W6UA 1ZEMA 3LLVA 1EDZA 2AQKA 2G82A 4XDZA 3GMSA 1XLTA 4AJHA 4CM5A 1AE1A 1D1TA 4NK4A 1ZKMA 1UAGA 4MVJA 5T57A 2Z1NA 4N18A 4YA6A 3FNGA 1PJSA 2G17A 4DWVA 3NDIA 3MCVA 4URFA 4QO7A 3L4BA 4CLEA 5ILGA 3ASUA 5A03A 4NHEA 5KJ6A 3GFGA 5BSHA 2X0JA 1ZXBA 4CM9A 1HSOA 1U7HA 2DPHA 4TVOA 3SEFA 3H5RA 5U4QA 5TIIA 1W4ZA 2WJPA 1Y5RA 3FPCA 3ENNA 4D79A 2EP7A 4A73A 3D3WA 1IULA 3G0OA 4KUGA 1ZFNA 2VOEA 4BKRA 3OICA 4D45A 2P91A 3QWIA 1H9BA 1HT0A 2PNFA 2C7GA 3MJTA 1GPJA 5A5FA 1E77A 4HWKA 3UW3A 4DMLA 4ZJUA 5L53A 4PLPA 4RF4A 5TF4A 5EQFA 3WQSB 4EBFA 5L9AA 4B3IA 1NBOA 1KEVA 1BXKA 5GMOA 3S1LA 4CUJA 5CAEA 4WLUA 2Y99A 4DPLA 1PZFA 3JCZA 4O0LA 3CKYA 1EEHA 2HRBA 1LDYA 3BHMA 2DAPA 4WUVA 3QE3A 4RDIA 4LVCA 4XGIA 1IHXA 1Z82A 3WLEA 4GKVA 3VVBA 1P9LA 1V3VA 2HMVA 4XGNA 2OP1A 3WG9A 2BKAA 5G0TA 2JKVA 2IZ0A 4N7RA 4JK3A 3KHUA 2O3QA 4AJ4A 4JROA 1S6YA 3JQ9A 1NHWA 3S2FA 2EP5A 2QQ5A 3GEMA 3PI7A 3PWZA 3K6JA 4ALNA 3I9JA 5T6BA 3W1VA 3TOXA 4DVJA 1MX3A 1Z45A 2YFHA 5DT9A 3QWFA 1P45A 1LSUA 2J8ZA 4XJTA 1DFGA 3OEWA 3WSVA 1JTVA 1EVYA 1ZMOA 1UXKA 3GQVA 4TRRA 1H5QA 1Q7BA 1U5CA 4B7CA 5JAIA 2B4RO 3GVXA 2Y66A 3FN4A 4AJNA 1T2FA 3FNFA 3DMTC 5A05A 4J4TA 4R4JA 2ZJ0A 4GGPA 2HMTA 3QVTA 2P5UA 2X8LA 3PHGA 1E6WA 1Y8RB 1ISGA 1Y5MA 1ENZA 2F00A 3ABIA 4DXHA 1K6JA 4NJMB 3WQQA 4CLXA 1OFGA 1VSUA 1YWGO 1PQPA 2BF7A 3H3JA 3EZYA 1AN9A 4J6FA 4R1UA 2B37A 1B8UA 1UXGA 1R4NB 2EKPA 3D4PA 2PD3A 3CMMA 1FK8A 2NVUA 3WQRA 4BKOA 1GQYA 4I5DA 4XCVA 3KRTA 2ZYDA 3FWNA 3H7AA 3KV3O 5ITWA 4TZTA 2P5YA 2DTXA 3S55A 4GGOA 3DBRA 5IZ4A 5C5IA 4U8GA 1OZAA 3Q9UA 3OECA 4HY3A 2A35A 5L51A 3OIGA 4EW6A 1H9AA 4BL5A 3WJ7A 2RH8A 2ET6A 4GSLA 3RC7A 4R3WA 3ZWXA 4CR6A 1PJCA 5G0UA 3JYQA 2RAFA 3NRCA 4IS3A 3GLQA 3GF4A 2X58A 1E7YA 4BO2A 1EVJA 3VDQA 1SOWA 4DLLA 2ILTA 2PZJA 3MJSA 5TX7A 1U28A 2Q45A 1N7HA 1N8KA 3WBBA 4F3YA 3GRPA 3CEAA 1BDMA 1ZSNA 3K31A 1XQ6A 4LSMA 4BMVA 1KEUA 2V6BA 2VTDA 1T2DA 3Q9NA 3C7AA 3ROPA 2XPCA 1ZNQO 3QVSA 3KLPX 1TT7A 3JD1A 2ZTVA 4MVJF 4W9NC 1ONOA 1CJCA 2Q2QA 5G2OA 3W6ZA 4PLTA 4CQLA 3ZWPA 1MC4A 4D42A 3GDGA 4GX5A 4QT0A 3ZWAA 4WKGA 3KYBA 4Z3DA 1R0LA 5HM8A 3RFVA 1IUKA 2PKQP 3FTPA 1IPFA 3D0OA 4YAKA 1YQXA 3EGOA 2ZCVA 4ND2A 4DPKA 5I9MA 3VZSA 4G2NA 3GN1A 5HBRA 5T8KA 3DEYX 3JD0A 1QXSA 3KETA 3ICPA 4HX5A 4QEDA 4R51A 2VWPA 2VYND 4PLYA 4R5MA 1IPEA 4I9NA 3KTDA 1UP7A 2O50A 5ICSA 3D4OA 5U9CA 3WGHA 3HUDA 3RI3A 1C1XB 2HJSA 3SLKA 3F9IA 5JSFA 2NUAA 2QRKA 3HJAA 3VTFA 3NTQA 5FYDA 4D43A 4P22A 4CM6A 3ZV5A 1DFHA 4BS9A 1TVEA 1WZEA 3B1FA 3LC7O 1C14A 4LRTB 2OFPA 3GDOA 5JPIA 4BGUA 3DOOA 4ZRNA 2YUTA 2GF2A 4PGFA 4RPKA 4R01A 4KDEA 2RH4A 3RWBA 2A92A 2TMDA 5DULA 3OJEA 3HADA 5DOZA 1YRLA 4Q39A 3NT4A 3IMFA 1JW9B 3FF4A 2QYTA 3U3XA 2ZYGA 4AJKA 3ZCXA 2JCXA 3H2ZA 2YZ7A 1F14A 5ITVA 1Q0LA 3ZN2A 1MC5A 2V6GA 3VZPA 4BNUA 1U5AA 2O4CA 1B8PA 4UVIA 5A04A 4WASA 2ZTMA 1Z6ZA 4CMEC 1LU9A 1GUZA 3RVDA 4YJGA 4EITA 4ND1A 4RVHA 4OH1A 3DHNA 1P3DA 3V2HA 1PJ3A 4OQZA 1ZK4A 3G17A 1M76A 4J1TA 3NKLA 3JQBA 3PGJA 4BO4A 1HRDA 3SC4A 5JDIC 2W2LA 2B4QA 2RBEA 4FB5A 3TFOA 4TWRA 1VI2A 4LN1A 1ZH8A 4EYEA 1WVGA 3H8VA 2Z95A 4L0QA 1LEHA 4IINA 5TC4A 2QZ9A 3NYWA 2CDBA 1U3WA 3VH4A 4OMUA 2X7HA 2DTEA 2EERA 4UVGA 3KYDA 3GNQA 1ZJYA 1PS9A 2PR2A 1B8VA 3DO5A 4O5OA 1I24A 2G0TA 4M49A 3O9ZA 2XXBA 3ANNA 2D0IA 2O7SA 3I9LA 4RF5A 4XQGA 4YDRA 3S2IA 3PRJA 4GH5A 5A1TA 1VJ0A 4NIMA 2ZQZA 2FSVA 1Z75A 1MA0A 3DZGA 3PZBA 3VZRA 1Q7GA 4WNIA 5ADHA 1ZW1A 5JNLA 3JQAD 3ZHZA 2DU8A 3BMCB 1GR0A 4PVDA 4E6PA 1JN0A 2UAGA 2XF8A 7MDHA 4FDAA 1UUFA 1V0JA 1Q2XA 4FGSA 2Y1OA 4Q3BA 4DIOA 1LDGA 2C29D 2HQ1A 2GUGA 1M6WA 2NWQA 3DAFA 1GPDG 1QYDA 2E4AA 1N2SA 1N7GA 2H5LA 2HCTA 2JAHA 3E82A 1NR7A 1GTMA 4L8VA 1SPXA 4J2HA 3WTCA 4YT2A 1G0NA 3M1LA 4N5MA 1PGQA 2VOJA 1Y6JA 1SEPA 4JNKA 3WOHA 1V8BA 4ALJA 1NWHA 2EF1A 3NDRA 4WOKA 3ZV6A 4ESOA 3ZNQA 1DLJA 2FR8A 2X9GA 5AQ1A 3TL3A 4JQCA 3MOGA 2R2GA 4BO6A 3U5TA 4RDHA 1ZO8A 4R1NA 5IXSA 2RIRA 4INAA 3ANLA 3HN2A 5TT0A 4CM1A 4YR9A 2PTGA 3BZUA 3NX4A 4FFLA 4AVYA 3O03A 2CFCA 5DBIA 1RM4A 2XAAA 3DBHA 5H83A 4M86A 1KETA 4IUYA 1GEGA 3FD8A 3PLRA 4O63O 4ZD6A 1N1GA 1H6CA 3VPSA 3B70A 3JQBC 3LSYA 1HTBA
chains in the Genus database with same CATH superfamily
3M9LA 3PFIA 1F0YA 4K9NA 3WWEA 2G1PA 1Z0JA 3U9LA 4YT8A 5CYGA 4ETWA 1CRZA 1HYHA 1GN9A 1SCDA 1VMDA 2H0RA 3JYPA 4AS2A 3EHDA 4HNHA 2AZTA 2XH8A 3DW3X 4NMXB 5C8YB 5EE0A 4QDJA 5FUMA 2Y1CA 1J20A 4KSCA 2W00A 3AXTA 2J7PA 3LYHA 4HYYA 1JRLA 3IOCA 2IBSA 1UBMS 3X1YA 1M1YB 4J4BA 4KN9S 2AT1A 2G83A 1MNQA 4RZQA 5H80A 3R7NA 4G41A 1UPBA 5C37A 1NT2A 3ZVRA 5ULLA 1L5SA 4Y98A 4JLVA 2C88A 2BEVA 4UUMA 3BG5A 3LQKA 3WIDA 1T35A 1Z0DA 1OFIA 4EFDA 5LN1A 5H7XA 5KKCA 5BWOA 4N3BA 5DWQA 1XYVA 1ODCA 3RARA 1FNBA 2PGAA 5HIKA 4BUJA 4PX5A 5H02A 1RQ2A 3TW8A 4UNSA 2QM8A 2HFJA 3U3OA 2HD4A 2VSFA 1ADCA 3IVCA 1T36B 3SXPA 2ONYA 2W8ZA 1O4WA 5I47A 4WXHA 2D2EA 2G5TA 3FXAA 3SZRA 4XX0A 1ZMTA 2MT9A 4IGAA 3NHUA 4MVYA 2GO1A 2VYCA 4DLSA 3W04A 2GKGA 4CMGA 5AVRA 4CIBA 1QORA 2DWQA 3VC7A 3U3MA 1EVLA 4GF5A 4HX2A 1Y4SA 4YRIA 2Q5EA 1L3CA 5JRZA 4RL6A 3CWCA 5EEGA 2Y76A 3LW8A 5JY1A 4NDZA 3OFVA 2H3HA 4QLBA 5JS6A 4X95A 1U0EA 3UXYA 2AE2A 1TIPA 4JI3B 3TGLA 5EP4A 3D81A 3ENQA 1MEJA 3CPJB 4KE8A 4LHVA 3FUUA 4QVGA 1FSGA 2V55B 2ZWVA 3USZA 3R24A 4OHVA 4YFYA 4DC9A 1C9NA 2WT9A 3BIOA 4OQPA 2WZDA 1HZZA 1R7RA 2V5AA 1W96A 2QSZA 3FAKA 3LVFO 4N9WA 3ELBA 4KNYA 2W58A 2HUPA 4OJMX 4TOIA 4HZIA 1SPBS 5AOVA 1QCZA 1XCGB 3EPRA 3V4SA 3UPUA 1EINA 2EKZA 1G8JA 2ZBVA 2I2WA 2AI1A 4KXNA 4FNMA 1QJ4A 4F8JA 1X7XB 1BXRB 4YRLA 4G0WA 1DKOA 1NY6A 4EAAA 2V3VA 2OC4A 2F1IA 1QYXA 1NZFA 2PU7A 1TJ5A 2O48X 3AOEA 4D0LB 4Y0NA 4ZGWA 5IC4A 3K70D 3A2LA 3QKSB 1T9CA 2ZB8A 4FN4A 3L0SA 2FK7A 4NICA 3KEGA 3DCJA 3EVDA 1NBAA 3QYPA 4IMPA 1KRXA 1KDYA 4F12A 1MQSA 4JASB 1CNMA 2XVYA 1YZNA 3BE5A 4GX2A 2JLQA 1AGNA 2E1RA 2V1XA 3G2OA 5ALKA 4JXZA 1FYWA 2V7BA 3DVSX 3WK6A 5AW2A 1Q3TA 4PO8A 1S2MA 4DCSA 5C32A 1SHZA 1U8ZA 2JJ1D 4JIGA 1CJKC 3UC9A 4ZP1A 4B4OA 4DA8A 3U61B 4OIMA 4CEHA 5KHOC 3UJCA 1WDTA 3O1JC 2H1FA 4NNJA 3O8CA 1VKHA 3L0OA 4L2IB 3QUQA 1IUNA 1K9VF 2XDQB 5CLLA 1WV0A 3HKCB 4M9RA 3G8CA 3MUFA 3EYWA 4LYGA 3IAUA 3PHCA 3P26A 5FKJA 3FPAA 1B3RA 1V11A 1WB5A 2NU6A 2JW5A 4BB6A 1DIRA 4OOFA 2H18A 3PNYA 1EP3B 5ED0A 3T3MB 3H8JA 1H0KA 1STOA 2EKQA 4G2TA 5REQA 4E94A 5JJBA 3MSCA 3RADC 3C74A 1YBHA 1NUUA 2HF8A 3GV0A 4KGDA 4F45A 2B83A 3PC7A 2Q9AA 2FW1A 3U7RA 4P7GA 2ZUSA 3PCRB 2WJGA 4Y7DA 5ANRB 3UZUA 4PAWA 4FUTA 4RFLA 3VAZA 2XLBA 5KKNB 3E58A 4TN5A 3HS3A 5LKRA 1HDCA 3ORFA 2ILVA 3T9CA 3IUEA 1NVVQ 1EBFA 1OBVA 3QUTA 2CHGA 1JILA 2JNWA 3MWGA 4IIUA 4K9OA 4C0JA 6AT1A 1KI8A 1YUNA 5CD1A 2AH5A 2WI8A 5HE8A 3X2SA 1JLSA 1SU4A 5BVGB 3RYHA 5I45A 3JWIA 1XCPA 1E6CA 4E2FA 1SQFA 3VI4B 3AM1A 3A0UA 3PCXA 3RF6A 5G0VA 4P4TA 1OU4A 3IP8A 1NLFA 4AICA 4RH0A 2VCYA 4XWGA 4II7A 3L8DA 1L5HB 4F85A 1QQ6A 5B30A 3K0KA 4GBMA 3BWCA 3FSGD 1SBCA 3DHWC 3Q72A 5AIBA 3T5PA 2EGGA 3C5WP 1UT6A 1XWWA 2NAFA 3AB7A 5AK4A 2J32A 4BAUA 3RC2A 2LIPA 4RFVA 1E5LA 5LQMA 1XQXA 4M46A 3STXA 1NQOA 2DULA 1UDWA 2OB2A 2WYVA 1ZJJA 4EKNB 2CV1A 2Q2OA 4AKIA 1M83A 1XR3A 4P4SB 4RTNA 1F17A 2CDAA 1I32A 1E3WB 2UZ1A 3U4MA 1KK0A 5C52B 4X62B 2QROA 3FUXA 1VL6A 5AM0A 1GA6A 1VJ5A 3RSOA 5BN4B 4YQZA 5BWCA 2AWOA 3WLHA 4Y18A 1RZVA 4AJOA 1K3FA 3U48A 4AZ3B 1XZ8A 5EERA 1Y82A 4WN3A 4FKZA 4CMIB 4UUBA 2WJYA 4XIFA 1DAGA 2B5OA 3KQWA 6CHYA 5FLKA 5BSMA 1JJVA 2OHJA 1OZFA 2FWJA 3PQDA 1M6NA 4BLRA 5FWXB 4OGKA 2JHFA 9LDTA 1JWLA 2FWNA 2AQHA 3DP7A 1DWUA 1PKEA 2RHRA 4DCTA 3DKRA 3L1KA 4PHFA 1PGOA 2VCHA 4GOMD 1A8SA 3BMCA 4JL6A 5F1OA 4BZXA 1YA4A 4KIUA 4Q66C 5EKXA 7REQB 1U1GA 1ECLA 2GCEA 3JQGB 5DHPA 1OUMA 4IMIB 4M8SA 4XGKA 1KIFA 5HJ5A 1WE2A 3PR1A 5TJHA 4PAOA 1T3SA 1WU7A 1BD4A 1HSZA 2HMAA 4UXHA 3EDYA 3LBNA 2Q46A 4WZ6A 4ZT6A 3PG5A 5DNYB 4TXNA 1H9CA 4OB8A 1Y7HA 1RYNA 1RYYA 4L72A 5CR9A 1DVRA 3KT0A 5I3ZA 2R65A 3BFPA 3HBAA 3F5SA 5AJXA 1NSYA 3ZJ5A 3BCUA 4HB0A 3DMRA 3F3SA 3OQ6A 4P53A 1JHZA 2QR3A 4RS3A 4XIIA 1FLVA 3AY7A 4MRRA 1Y3AA 2QE7A 5EJEA 2H2AA 3F1KA 4I1YA 1P2GA 3BIJA 2B34A 1ZIDA 3T1YB 2IH5A 3QNWA 1UKEA 4GX0A 3NIGB 4JVOA 1I36A 2QJTA 4G5SA 5HMLA 5I4BA 5DKFA 3EDMA 2QL7A 2G06A 1JPUA 3LY5A 4JVNA 3ZTYA 2AL7A 5ADUS 2BEUB 1JR3E 1ONSA 3M70A 2O3RA 4HO1X 5DLQC 3ZHUA 2XUOA 3H5AA 3FFAA 1KBQA 1P18A 5B55A 3A3NA 4QVIA 1D3AA 1F06A 221PA 4Q0MA 3V8BA 3COSA 3UGKA 3HPQA 2O7RA 3DFIA 5I4IA 5C5EA 2FWPA 3M82A 1P2TA 1ZZEA 3C8HA 1HLPA 3PFWO 5EPOA 3W5IA 3JQFC 3N5CA 4U4AA 4CI0B 1BS1A 1X7YB 1F8XA 3O75A 2RHLA 4HPWA 1AUQA 2VPYA 2J59A 2ZBFA 3EIUA 4QYSA 3SLGA 1OROA 4KW7A 1E3EA 5EWMB 2C78A 4BVAA 1KF0A 4PRYA 3R3HA 2GQ0A 3BBPA 2IDJA 3RVOA 3NAZA 2ZVJA 1KK3A 4ZVLA 5B6PA 2VQ6A 3C2QA 2W7TA 4DMHA 1K86A 2I1LA 4ILEA 1EKXA 1TB4A 4JJFA 3WWZA 1M2JA 1U99A 4HGNA 4HXYA 4KV9A 1HNWB 2EBHX 3AEKB 3N86A 5TS2A 4LJ5A 4IQ0A 2G36A 3GG9A 3Q88A 3FNHA 1G16A 2PKWA 4R0MA 3P9SA 4R9VA 2I2AA 2ISCA 5DH9A 4DGSA 1K5PA 1DDIA 3BFVA 1DO8A 1VPDA 1EAYA 5IM5A 5A3RA 2P0EA 4RQAA 3MIIA 2NUBA 4B71A 2VH1A 1VIAA 4J91A 4D9CA 5B5SA 2IKQA 1JDPA 1OTYA 2ZTSA 2NO7A 3B9RA 3G9XA 2X0KA 3U81A 5JQWA 1T1JA 1T36A 3IQWA 5KIAA 3LOQA 2R44A 1DAHA 1EDDA 2JHGA 3BSFA 1TC1A 3JAKA 4OFWA 5EVCA 2O0HA 4C7OA 3HVJA 1UBGA 4PPNA 5C5CA 3PDIB 4YAGA 2HNKA 2QN6A 2GO7A 1KKMA 4O8CA 4PXYA 1P29A 2AOUB 2XE6A 1JHYA 1CY8A 3NV9A 4L57A 1A8HA 3N3AC 3W5UA 3W5AA 1YVRA 4V0ME 4EEKA 2GUWA 1KIAA 5HK9A 2PV7A 4PC7A 2ZR8A 3T3HA 2BFEA 1RAHA 2C4NA 3O95A 5BSGA 4K87A 2OV2A 2OYRA 4X44A 4WJKB 3ZJVA 2O8DA 3DM5A 3H42B 1H0HA 5JV5A 2M98A 1Y1SA 4J2TA 3W9SA 2EOAA 4JUBA 1L5FA 5B57C 4ATNA 5EIOA 1YFJA 3NORA 4NZMA 4O1MA 3MYRA 3AH8A 3SJAA 3TLCA 3HB5X 5I7WA 3QVJA 2TECE 1VDZA 1NSFA 2QYSA 4WZBB 3ZDBA 2ZYHA 3GUUA 4GPIB 1AKEA 4Z3OA 3PDJA 1SG9A 1NUAA 5C7OO 3P7MA 4H60A 4JXKA 1FMTA 3MWDA 1SXGA 5E9AA 1SZPA 3DSRA 1AKMA 13PKA 1F48A 1T9DA 2LUOA 1ZSYA 1RZ3A 3PKIA 4FDLA 4JC4A 4MQ6A 2PNJA 1VPWA 2G72A 4ONEA 5EY5B 1WXHA 1W94A 3LHIA 2DERA 1A82A 3OO0A 1I6WA 5FNVA 2AF3C 3HVIA 4QTZA 1MQ9A 3DAOA 5JAQA 1G4HA 1O95A 2ZUFA 1HH4A 1PRYA 2IHBA 4EVIA 2CVZA 3RSFA 2ECQA 4Y6PA 5LMZA 4ENQA 4OQFA 4U7HA 4BJ5A 1TIKA 3JZFA 4WBNF 2HJVA 2A4KA 4F72A 4XB6B 1E4VA 1X2BA 2XUGA 1LTKA 1YMVA 3LZ6A 3VO8A 5BSVA 5BUQA 3TEMA 4OFZA 4J1NA 1Z2NX 1X9IA 4WFKA 2GJ4A 4J4HA 2VDQB 1A71A 1G8PA 3TKAA 4Z7NB 2ALJA 1CR4A 3HC7A 4ZVVA 1LVHA 4NV0A 5KYUB 4JLUA 1C8KA 4BOYA 1KMIY 1O9HA 2HZBA 4P0QB 2FUG6 5AJYA 3OUTA 3ZU6A 4N12A 4DV7B 3SOZA 1REQA 1U8XX 1NFFA 1J1IA 4MW9A 3MIZA 3NZEA 4MPJA 2GEUA 4OMCA 1PG5A 4E11A 4HB4A 2D0DA 3LPDA 4MO2A 4WX2B 3TNYA 3H6KA 4PLZA 3N07A 3EPLA 1R8JA 2C7QA 3P9KA 5DM60 4ANFA 4X24A 4QQRA 1Q2UA 3AFHA 4DCJA 5HKKD 2ETVA 3A4TA 3QVLA 4TKLA 1N2OA 5E2AA 1RBYA 3H5WA 2WQ7A 4EHHA 1JU4A 4BQNA 1WZ2A 4C4SA 3R6LA 4UD6A 2NXJA 2QG9A 2RG7A 3Q8XB 4NENB 3PV0A 4NFHA 1XCBA 1DAMA 2F43B 3SLRA 5ILOA 3UJAA 5HOQA 4FZJA 5J2UB 5GGYA 3V4FA 4C6SA 4M0EA 3UJ7A 1UKBA 4YV1A 4KFUA 3UICA 3FLAA 1ESCA 3PHLA 3ROEA 1EZ4A 2I22A 2YNMD 2BE7A 2FE1A 2WWRA 2HLDD 3MTEA 4YEDA 1A9ZA 1L7VC 3WRXC 3CZMA 4OAPA 4Y67A 4BUCA 2EHDA 1YDMA 5CLHA 2JA2A 2WWXA 3A4LA 2RD2A 1T9HA 2J9YB 4DQKA 2D00A 2VYQA 2GB4A 4YUAA 2GOYA 4IJUA 4BVJA 4YP9A 1C2YA 1CKEA 1W52X 2ODWA 4TYQA 4ZQCB 2BUBA 4QA9A 2CZCA 3UMJA 5HW0A 1UADA 5LU9A 4K2HA 2FZEA 1C0LA 1M1YE 2IJGX 2X86A 3KDSE 1OYWA 1WDMA 2BBSA 4DWOA 2J45A 3IVRA 1B76A 3DV2A 4PCUA 3BB3A 3HRKA 4G85A 4IS2A 1I9CA 2VP0A 4P38A 1TM1E 3HSYA 4U00A 4KR0A 2IXFA 3FH0A 3QVXA 3VSEA 1V1RA 2VF7A 2YHUA 1X1AA 4HAIA 4O8ZA 4YJFB 3HN7A 3NVAA 2HB6A 4RXMA 3RKRA 5ES3A 2YIJA 4LE0A 2FGKA 3LOUA 3AI3A 3C3JA 3R23A 4I1UA 1Z33A 5F3RA 4HS9A 1W0JD 4TKUA 4ZAZA 1ILWA 2XYPA 1T5TA 1L3IA 2E49A 1O9GA 4OHBA 2W6JD 4BGVA 2EL7A 3MGAA 3EXHB 4LXYA 1HZJA 2AUTA 4X54A 4TKVB 1DJQA 1ZGAA 5DCYA 5HF8A 3SR4A 3KZNA 2WMNB 3H19A 1NP7A 2IODA 1DO2A 3L7AA 5IDVA 4MO9A 3CCBA 4F6LA 5JU6A 3GDFA 4DUGD 3C48A 1EUCB 2IHVA 1USIA 4V0KA 3WHIA 3GAAA 3BGSA 4LSZA 1UDXA 4Z7JA 1FUIA 2AZDA 1PT9A 4ED9A 1LLCA 3E53A 2DKFA 4P80A 3FCSB 3LWDA 3DNFA 4GU5A 3PGXA 3WB0A 5D3KA 3WAJA 2W2NA 3OIVA 4CKCB 2FETA 1RLMA 4YI3A 3H6HA 2A9PA 2EWMA 2HHJA 1V8PA 2V6JA 3JQ8A 3ZHQA 4DRZA 3L84A 3NM5A 1J0AA 1NXVA 4EB6A 1QQBA 3MD9A 1I6LA 3K0FB 1KDOA 3SBDA 2XD4A 3C14C 1Q0HA 1LX6A 2OCBA 3BDIA 3IIKA 1ZWLA 5COQA 5IP5A 2JLAA 5GPBA 5F2KA 1KI6A 1VL0A 2QG4A 2R4UA 2XB8A 3DT6A 3CVUA 1JR6A 1X39A 2RI1A 2Z2IA 3RSQA 4YAIA 5HA5A 2DOKA 1E2UA 5IT4A 2CHUA 1R0XA 3U7FB 3TSWA 4J03A 5DBFA 4GX1A 4URUR 4B4WA 3I9KA 1WDWB 3M6AA 1M34B 1W5EA 3M1AA 3RH0A 3GNLA 1II8A 1SC6A 3EXIB 1TZKA 4LW8A 3VTAA 1L4GA 1U5BB 1FQOA 5KVCA 5ELXA 1CYDA 3KM0A 2F6RA 4PE5B 3IMKA 4KK4A 4OLJA 2DUUA 4P82A 1AU9A 4U2EA 5F3WB 2R97A 4ARUA 4UD2A 4LAFA 3B13B 3HDQA 1NRIA 4PBRA 1J70A 5KNDD 4AUNA 2DCMA 4IIEA 2DR3A 1T3GA 2XJ9A 3L04A 4P93A 4IOLA 4QODA 3LK6A 4I66A 1AS3A 4BX2A 2J5RA 2RGEA 1D5CA 5FOQA 2Z3ZA 2YWBA 3IS3A 4QLAA 4X00A 1Z74A 2BJHA 1S3GA 1NVAA 3DLTA 3M5DA 1H23A 1ONBA 1SULA 5BMVA 1GDHA 4BFXA 5DLDA 5DI9A 3VYUB 1XHFA 1ZK3A 1GHTA 4J76A 4L4SA 4B76A 3O1IC 3ESCA 1NBMD 5JARA 4IGKA 3K6RA 1YBVA 2JFWA 2GNPA 4PHHA 2PV0A 4FOOA 5FWAA 1W0JA 4ZQGA 2XCIA 1JU9A 3DC2A 4C7JA 2O14A 1JT9A 1YV9A 4UHJA 4DCVA 4EY4A 2Y1EA 1WVMA 2ASEA 2EJWA 3JSAA 4A03A 2E2WA 1CRLA 2WJHA 3ENVA 3W8FA 4P4LA 1YQUA 5I8WA 2PKCA 4RNCA 2O52A 1AGPA 2P7HA 4TXJA 3ZYCA 2CNKA 2J48A 2Z08A 2PUTA 1NJ5A 4HUQA 4OJYA 4UU1A 2PX2A 3PX7A 3T99A 2FUEA 1PNVA 2GERA 2FZVA 3VKUA 4BNWA 4DDKA 1QP7A 2W6PA 3GUHA 4LGCA 4PLFA 3WMFA 1PKXA 3TNDA 3RLIA 1XV5A 5IUKC 1VCOA 1AGXA 4EJ0A 2XNJA 2DWCA 3N7UA 5K8JB 4PY2A 1K8RA 4B9EA 2C95A 2O3TA 2A5YB 5ICMA 1L8LA 5K45A 1U0SY 3B1VA 4O4IB 1KDPA 5HK8A 4QHYA 4KEAA 4I4IA 5MN5A 2EQ5A 1RHKA 1VSQA 2VQSA 1XAGA 3C3PA 5AW1A 5BUZA 1P0PA 1DRKA 1AGRA 4FUQA 3WLJA 4FEEA 3AHFA 5ADVA 1KJYA 1FXWA 2Y6UA 3RYFB 4RTOA 4K9LA 2LXNA 1WCIA 2JBAA 4R9SA 1YI1A 3O8QB 3R09A 2QMYA 1VOTA 3TIIA 1B42A 4GQIA 3NLLA 2OMKA 3DEAA 4WLOA 5JAOA 2H63A 1JDBB 2XNCA 4BVKA 2Y92A 2JGDA 2NMVA 1Q92A 2HWYA 3NIFB 5TGZA 4P8RA 1WF3A 3CKMA 4B8ZA 1WZUA 4R69A 1S7CA 4X6YA 1XKXA 3EMDA 3GD7A 3OZIA 3A1SA 3A7DA 1IJFA 2VHXA 4WY2A 4BRUA 4KVAA 1JEYA 3B9BA 4KHPB 1WL8A 1QGZA 4UKDA 3B51X 5ALYA 4ZCIA 3RABA 1GQSA 4DSNA 2VIIA 1ULUA 1AQUA 4MUBA 4QZVA 4FM9A 3AERA 4KGZA 3RK4A 1R16A 1K8QA 4AL4A 3W9BA 5LCXA 1QYWA 3OJOA 3MCTA 2ZJZA 3CC8A 3N3BC 1BKDR 4COOA 5KDLA 5AXAA 5BUCA 3O92A 1PUIA 4D4GA 5KWIA 3AEUA 3K0CC 1W87A 1CERA 2HA4A 3FCEA 4GLJA 2VCEA 1MJFA 5KJEA 1O96B 1WSBA 4GXQA 2GGSA 1X19A 2IELA 4IDOA 2ICAA 4Z0PA 1FPMA 4DA9A 3KFLA 1XE3A 3MTGA 2YWRA 1KQGA 4ZAXA 4NE7A 3V48A 1TCVA 3DTYA 3H3XA 2EG9A 3KWMA 1V6AA 2P9GA 4JUDX 5E9JA 4AJIA 1YR6A 6GPBA 1ZRHA 3KVYA 1FS6A 3I5AA 2O2ZA 4EZIA 1R5NA 1YS1X 2VAXA 1BXZA 1KR5A 2GPSA 3N2ZB 1DGQA 1QH8B 1LNQA 2QPTA 5EE1A 2CHVA 3V6MA 2BYTA 1XVLA 3M6XA 2KI5A 3IRUA 5FL7D 4C7OB 2OBYA 2OXCA 1YR1A 2QXTA 4LRUA 5BXQC 3TE7A 1YJ5A 3GMDA 2XSZD 3RIYA 1DKQA 3OX2A 1GVNB 2P2LA 4I6GA 2J3KA 4JVSB 4RKRA 1N0IA 1TI7A 1W0KA 4CKXA 2YFQA 3SZGA 3ZEAA 5E4FA 4CUKA 2QTWB 5KWEA 4JGBA 3W1WA 1KEKA 2I9KA 3ETEA 3JU3A 1IZYA 3T0IA 2ONZA 2Q5HA 1W76A 5DV9A 2X5OA 1JG1A 4BNGA 1GKUB 4FWBA 4RLSA 4X0EA 3IV9A 3UY4A 4CKBA 1L4NA 4NU6A 4TS9A 2UUAB 1YJAA 5E7QA 1EFVA 3V2GA 2FP3A 3BD8A 4GM4A 4JSTA 1DSSG 3SXUB 1QF7A 4RF3A 1JHAA 1P5ZB 4UE3S 1X42A 2D8AA 1QE3A 2OQRA 3QJYA 4P81A 3OQHA 3BIXA 2ISQA 5HUQA 3SIRA 1E2KA 2KQUA 5AK5A 3RS5A 1GDTA 2QAGA 3DVLA 4ND3A 3RUDA 1S2OA 1N0HA 4R6XA 1CVLA 4MTLA 3Q0TA 2W4QA 3AIKA 1VSVA 5FCDA 3NV7A 4OHYA 1XUOA 4J7CA 3KYCB 2O19A 4EG1A 1VSBA 1U3UA 5BWBA 1ZBQA 2WAYA 4LJAA 3TX2A 3OESA 2BKXA 1SBQA 4BEJA 1WMDA 5A04A 3KOZA 4KXVA 3QRWA 4LMPA 3V1NA 3A9CA 4ARZA 2GD1O 2I67A 4Q3CA 1GARA 3IAEA 4F84A 4G5YA 1I94B 4GIBA 5LFAA 2SICE 1IJEA 1POXA 1ZC4A 2ZJ1A 4HN4B 4P3NA 5DNVA 4NBSA 1YHYA 1R8XA 5AOCA 2WOJA 5ER6A 3W5VA 2CLMB 2DPLA 3BMOB 3WNQA 4BQOA 1HF3A 3BE8A 1IZ0A 1KEZA 4BMCA 2BGWA 2AI2A 1BEZA 2Q1UA 2ZB7A 2BFOA 4J16C 4Y9DA 1MVOA 3RG2A 3RTCA 4AMGA 1Z68A 5BMOA 1GPLA 2GXAA 1F51E 4UMFA 1P6QA 1X0XA 3OZRA 2ORIA 4AZTA 4EWLA 1BX0A 1QK3A 2F9LA 2PT9A 3M4NA 2WWVD 4RYDA 3U9SA 3WKAA 1HEYA 5FBWB 2C07A 5B4VA 1NY5A 2QU8A 5J23A 3WHKA 4Q4DA 2GPBA 3CZ5A 3PUIA 4Q3EA 5IAJA 4DC1A 3ZGZA 1WNTA 2Y0CA 4WL0A 1VA5A 1KRWA 1DIGA 4F4JA 1OXSC 1SUDA 3PICA 4UW9A 3RODA 1SEVA 3GA7A 3WLPA 1CP2A 2FOXA 4PRZA 3R3SA 4W82A 3KEOA 5FTLA 4D92A 2DFPA 4EYOA 3UGTA 4P84A 1L4EA 3RYIB 3W05A 2B9EA 3UAWA 1PTKA 3LE8A 4RULA 1RDFA 4Y0VA 3BL8A 5T4BA 4AO6A 2WICA 2W6CX 1NW3A 5BR8B 3R74A 1P1FA 2IYYA 1BGVA 3JAWB 1SHKA 2FFQA 1DELA 1Z4NA 3CEMA 2O8EB 4G1UC 4UDNA 2NZ8A 3U3JA 2HXYA 1S2NA 2BGRA 3LVBA 3ZNOA 2QTFA 2V4UA 1DC7A 1EFRA 1LWNA 4FD3A 1R9NA 5H8WA 1IG0A 1MCZA 1TPYA 3AVYA 1PR3A 3W34A 3AESB 3MOSA 4X1YA 4PFSA 4F4UA 3RCBA 1C7IA 1E2HA 4L76A 1THGA 2Q6TA 1G2QA 3LVQE 3AKCA 5KYWA 1XLTC 3L6BA 1WPRA 2WFLA 4YIKA 2I4TA 1TK2A 3HE3A 4JLWA 4K1XA 1XVTA 1DKRA 2KB0A 1SBNE 3CW8X 4TT3D 1NSTA 5EESA 4ON9A 1XHEA 3Q8WA 2XV1A 4UQOA 4XR4A 1D2CA 2PUHA 1ETUA 3L8EA 1R50A 2Q27A 4X63A 1D9ZA 1PZEA 3V6LA 5BN5B 2XB2A 1VLJA 2IYRA 3SQLA 3L41A 2P2SA 1YB4A 3THSA 4FONA 1WPGA 4WXYB 2RGNA 5K0TA 4LF9B 1ULSA 2QLJA 9LDBA 2ATXA 4A0GA 4ZVQA 1MN6A 3BWYA 3NGXA 1S9DA 3CY6A 2OD2A 3GWGA 1XZNA 4DQUA 4KO3S 4QYTA 1UWLA 1VHWA 3KALA 4NYMR 1Q50A 2X8BA 4H3SA 3WDMA 4ZYWA 4XWKA 2WLTA 3SXJA 3E8MA 4TKVA 3VJLA 1Z25A 4Y1RB 2PD6A 2DM6A 2IHKA 3FNQA 4HDRB 3GXBA 2WSYB 1RWQA 2CHFA 2PMCA 3COZA 4L4UA 4DV6B 3BWMA 1JHMA 1T0HB 1F2DA 2MSLA 3RVPA 3U4HA 3DXFA 1KZ7B 1DBSA 5A4IS 5KYXB 5MN4A 1E4YA 1KZYC 3OEED 4MAMA 4MW7A 1VMKA 5JLAA 3KD2A 3NVMB 2PRIA 4LF8B 1PNQA 3FHJA 1EGMB 2RC6A 3GLIA 4RVNA 4CEHB 2BMWA 2W6OA 1G8AA 3NIDB 1CDZA 2L2QA 5CM9C 1TUEA 2AGVA 2G0NA 3D6NB 3MJRA 3P0FA 3RVQA 2FX2A 2ONJA 4JXJA 3OX1A 2OB1A 1CQZA 3HKCA 3SNHA 4UHKA 5I5EA 3AF4A 1N3YA 4M0MA 4BKUA 1BWRA 2YY7A 2H7YA 2ZBQA 3NHMA 4S1OA 4C6HA 1JVNA 4RA6B 1N5DA 5B1YA 1J1UA 2O8BA 2WIGA 2B2CA 2Z3WA 1KSJA 3S70A 1YDWA 1UJMA 2W48A 4FYMA 4JOSA 1HQDA 1P75A 2LW7A 3RKUA 5KMGB 1O0CA 1JHUA 2AE1A 2G9RA 5CCEA 1S9HA 2PYDA 5K20A 1KYXA 1Z5OA 4A6XA 4E5NA 4BAGA 1O6ZA 1QM5A 1H66A 3R6TA 4QT4A 5JS2A 1TF7A 2YCLA 4MI1A 4O4HB 2FMFA 4O4IF 4PZAA 3NCHA 2OORC 2V7WA 3CLKA 5GGXA 1E0JA 2C59A 4MPDA 2OHXA 2GJ9A 4BLSA 4ISBA 4Y9TA 5BN3B 2BAGA 4BWYA 4DA4A 1MAHA 3WXBA 4C7KA 3IUSA 2IXBA 4ZT3A 1QYRA 1F60A 3LPNA 3C6XA 1IPHA 4G0UA 1L9XA 1CF4A 2Z2XA 2GBGA 2AI3A 1OX4A 4QGAA 2X0RA 2PQ6A 1UZNA 3EQ6A 1DCMA 4J7UA 1E1RA 3EIWA 2PQ0A 4U0JA 3IDZA 5CNJA 3CCCA 4R7TA 1MUUA 3P19A 4DLKA 3AEQA 3D3WB 5C80A 1ESZA 4S0XA 2H31A 4RZXA 5AW5A 1UF9A 3GJYA 3HL0A 4QU0A 4C22A 1W36C 3ICWA 4CZ2A 4MWEA 2GDJA 4D9IA 3GT3A 2ZR9A 4X7MA 1G21A 1GKKA 1YB7A 4MRVA 4LWOA 2FW7A 2C9BA 3CG4A 5AI5A 1U2DA 3PHIA 3UJBA 2C58A 5B58C 3EZ2A 5CH3A 4PO9A 4YCDA 3ITEA 1ZM4A 1T9GS 4FYXA 2HPVA 3OZ7A 4UM5A 1AY0A 1Q74A 3CNNA 3GJ0A 2J9ZB 4YP7A 3U4DA 5CXUA 3K1JA 4GMKA 2JEZA 1T5OA 3AEXA 5JSZA 5B1HA 4B87A 2XMDA 1GNRA 1NAIA 2QD1A 3EWIA 2JFOA 3L6DA 5ECYA 3VX3A 1JTEA 3HDJA 3G68A 3O5AA 5EJMA 3E9MA 3OZEA 4R1SA 4UNPA 4CTMA 3HSKA 4PN3A 5AVUA 5BR1A 3WLAA 5ENDA 3H9EO 1KO5A 1A8PA 1PGPA 1BN7A 2GESA 1JQ5A 4PM4A 4RAQA 4JYMA 3LQ1A 2R3SA 1SK9A 1ACLA 3G0IA 1GCAA 1G5TA 1KYZA 3JTEA 1JVBA 3L18A 4LV8B 4P3YA 4V1CI 3Q3IA 3RKSA 3PR3A 5EE9A 2CBXA 3MWEB 1JYSA 3EWNA 3M6WA 4LCJA 1AUPA 4LA4A 1UM9A 1C4OA 2BI8A 4NZ9A 1Q6ZA 1XWIA 4M1EA 3GLTA 3IODA 5FLYA 3GDHA 2EJUA 2Q6VA 3B1YA 1H1LB 5AJVB 4DEYA 4X97A 1IBKB 3CB4A 3PIIA 4IHAA 3S7TA 2BFAA 2C3MA 3K05A 5H81A 1OYOA 1PSWA 1EZZA 1PG0A 3JZMA 2VSYA 5KJFA 2R85A 2XMRA 1JA9A 5LYYA 1E7QA 2YFYA 3TRJA 4ZZ1A 5LXTA 3BSWA 1YQWA 3UUGA 2YV3A 2C0PA 3L8GA 1N3BA 5DTEA 5EHIA 3OOSA 1OJLA 3H9JA 3QVMA 3WLSA 4B6EA 3MWJA 3TL2A 4D8XA 4EA8A 5JAPA 4KMOA 3E3MA 3GK3A 4U7GA 4ZTBA 1C0EA 1EQ2A 3VYSB 4XXHA 1ORVA 5TMDA 4AP9A 1Y7IA 3FFXA 4IFEA 3DR3A 3F3KA 2EZUA 5DHUA 1K7EB 5HUJA 1BEEA 5K4GA 2NT4A 1SWVA 1E9FA 4UFOA 2IY8A 2VDMB 3DEIA 1RHMA 1ZD5A 2XTAA 2EBUA 5CFRA 3WWPA 1YC5A 3COPA 3LKZA 1K7SN 3V4RA 4E5YA 2W2LD 3FZQA 3F8TA 4L5CA 1FDVA 1O94A 2BFMA 5HDQA 3IE1A 5L3SA 4RMJA 1W30A 4LMBA 2OWEA 2OYCA 1ZGGA 4AMBA 1CU1A 1VIYA 2GVNA 1T3HA 3K8YA 4UQPA 3IKMB 3OEYA 3QFTA 2PYIA 3RUIA 1AZLA 5KYTA 4MW4A 5H4HA 2A4MA 1A0OA 1X15A 2ZJFA 3QKWA 3TEJA 3LC1O 1VA4A 1SCIA 1YR9A 2G25A 1J42A 2A5JA 2G88A 3QYJA 3LH5A 3A4IA 3CNBA 4HUQB 2AHOA 2ZYWX 2GF0A 3A28A 5EXEA 4AN1A 4IDQA 1IZ7A 5ARBA 3TZBA 4PNPA 3OMLA 3N0TA 4TL6A 4DTIA 4ZN6A 4RS4A 2VEDA 3IQEA 3KJQA 1VPTA 1U2SA 3CGGA 2PZGA 1GRCA 3N0VA 3ORSA 4GYYA 3T4PA 1Z4IA 4HUJA 1QVVA 3BTSA 4CDGA 4QDXA 4CU5A 4AWBA 5CDUA 2EP8A 3L6OO 2RJ3A 4W4TA 5D7NA 3D64A 3S4YA 4U5QA 4WKNA 3PITA 4EX6A 2GWRA 2DB3A 3RHZA 2WUGA 5H3HA 5KOJA 1Y0BA 4QDKA 4QUIA 5AKGA 1X3LA 5AUOB 2B0JA 3ZJ4A 5CA0F 4NI5A 4IWXA 3SYKA 1BW9B 5F23A 3EH2A 3T7KA 1XFAA 4K86A 4B7XA 1PDVA 3UHFA 2Y05A 3DBOB 4J7XA 3JWJA 2DUNA 2QF7A 3GNSA 1BVHA 1G6HA 1EA5A 2XVXA 2OE2A 3O8QA 1QLWA 1ABBA 3QBEA 2AD5A 4C05A 3SQNA 1WSAA 4FKMA 5KJ1A 4S35A 4PS0A 1I3OA 1SHUX 3IDFA 2LGJA 4EUKA 5FWDA 3DF7A 5BXYA 1JQJC 3HDYA 2V7GA 2PHZA 4G0YA 1XTRA 3OX3A 1F5NA 1RPNA 1NUQA 1MRNA 2OVFA 4J1TC 5JZ9A 4ASUA 2O7NA 1AG9A 3C43A 4DBLE 1E3QA 4YMTA 1Q20A 1HDZA 4HRAA 2BFEB 3G1UA 1QBGA 3SHFA 5JPCA 4XEHA 2C1XA 3WKCA 2ZRKA 1UBRS 1HZZC 3PFFA 5IM4A 1NBWB 4ZGGA 2O06A 2JASA 2RK3A 3UFXA 4I08A 4HNTA 1T29A 1V35A 2AN9A 3GRYA 3CVVA 1PFYA 3OA2A 4NKRA 4HEJA 3RRZA 2V7VA 1PFWA 3E70C 1N2JA 1EK2A 3GUYA 3IOBA 5AKKA 3R8XA 4BE4A 1Q1BA 2ZCUA 5CGZA 2CNNA 1E1CA 2GNOA 4EF4A 2XADA 3I83A 4E5PA 2GNAA 1EFPA 2KYRA 2GARA 4UEOA 2AR9A 4EGCB 2Q7XA 4G65A 3I1YA 1GYQA 2YMPA 2NW6A 3KQPA 4R2LA 3M6LA 4BLQA 4MHOA 1AO0A 1X7HA 1NBIA 1NQ5A 3R5HA 1G1AA 4RTPA 2H9IA 4HEA1 3AJAA 3IQDB 5T3YA 8GPBA 2EKDA 2ZIEA 3O2NA 5HFAA 1E7RA 4X8MA 1ENPA 3H9GA 1QB7A 4PR3A 4DDVA 3NT5A 2YY6A 4TROA 4WN9B 1E6KA 3DCYA 1S2GA 3MBKA 5DMXA 4ARSA 3GBVA 1NYQA 1XDSA 3BKXA 3L3BA 5TARA 4A27A 1L7NA 1U28C 1QONA 2NQTA 3JX9A 2WQ6A 1O89A 2ZB4A 1N32B 2WVJA 3VZBA 4TMKA 5SZIA 3JAWA 5JVDA 4TQGA 1VIVA 5C4IA 4TZKA 2FWRA 2MYPA 3ZY3A 1D2MA 5FULA 1XVAA 2J4CA 2EYQA 2Q4EA 1G7RA 3E6AA 3G1WA 1RWXA 2J3HA 2XUQA 3X1ZA 2VK4A 4YRGA 3BCSA 2EFDB 3I8OA 3P2MA 1SFRA 2BBTA 2VDJA 3T5TA 2JLWA 1CRPA 1NVWQ 1PQ4A 3HKEB 2IEBA 4UHEA 2VHEA 4L5AA 4GVLA 3JR3A 4U9HS 4AB1A 5CT5A 1CEXA 4NYMQ 3BTVA 3KZOA 2HL6A 2V98A 4RA6A 3IQZA 1ZGBA 3ELWA 5KOIA 4QARA 3CT6A 3GEGA 2FZCA 3WB1A 3CH4B 1OX5A 2PPVA 4PZCA 2B82A 1IEWA 1CZLA 1EFLA 2VATA 4UUAA 1X7WB 4XTRA 5BURA 3V97A 1PIWA 2EAUA 1NXXA 1YRYE 3HYTA 5EKDA 2BCJQ 4KIJA 5EJAA 1GTG1 1E2DA 1GG9A 1SKQA 5JCZA 1B3BA 4DUYB 3HVKA 4ZZIA 5IRCD 4PPYA 2OCGA 4E07A 2GFIA 5K0FA 4FWTA 1M75A 4GYKA 3T06B 4RTRA 2V1UA 1TRKA 1H1DA 5E95A 2OCAA 3LZCA 1RZUA 1TU0A 2D1SA 3EGEA 3K1TA 3Q9SA 3SSMA 1DL5A 1YAHA 2Q4OA 2HRRA 5A9SA 4OB7A 1L5ZA 1C9DB 1DIOB 2JGLA 4NCIA 3EGIA 2LBPA 3G8BA 3GUZA 3ZDAA 3FHCB 3VJMA 2J46A 4K6OA 3NOOA 3LK7A 2BSXA 4HWOA 4CYMA 4AI6A 1DWOA 3G5TA 1VE1A 3CLSD 1AKTA 1QHFA 2EJCA 4ZC1A 3HMKA 5HE9A 1ZRSA 1T5HX 2VXCA 4I1IA 1U1DA 3CCFA 3MCAA 4IYRA 1RZRA 3VJRA 2ERCA 3G13A 2I1WA 3PL5A 3VHLB 2P0YA 3O8DA 4LJYA 1KR2A 4CFZA 1U63A 4WH0A 1CW2B 5I7HA 2JIPA 1A5ZA 1LB1B 1V1RB 4KXYA 10MHA 3PT5A 1ISMA 3MAAC 1ZCBA 2NG1A 3O2JA 3D3KA 3C5VA 2NQ8A 4PXAA 5DNAA 1P8JA 4CRWB 5KTOA 5A5EA 4YECA 2OFXA 3BRWA 4JBXA 2IP1A 4OJNA 3H1PA 3ND6A 4U6SA 3F5MA 3IEUA 4DY6A 4BFCA 2FR8C 2H2DA 1DJOA 3JQDA 3FDIA 3NGMA 1TK3A 4JBHA 1KBZA 4QAQA 4AMYA 3N8KA 4L51A 3WC4A 1RMYA 4G4IA 5F77A 2QX6A 2J0SA 3IMCA 4GBJA 4UE6A 1TZBA 2G1KA 1FF9A 5CBPA 2OSVA 2PGXA 3QXGA 4P58A 4UUOA 4CLOB 4YJ3F 1QFJA 2YWXA 1CEQA 3OQMA 2P1DA 2SKDA 4O4HA 3EC7A 4YHBA 1N5OX 2I4LA 4BU0A 3G9QA 2D5AA 3AG5A 4MV9A 4J0GA 4RLHA 3OPYA 1CQIA 3F7MA 4YMUA 4C0XA 2QTVA 1SBHA 2AEEA 2ZP1A 2DUMA 1H1LA 1FJXA 2CNOA 1F8GA 1CV2A 1Q84A 5H5JA 3ZWYA 5MFZA 3GYBA 3MWDB 1BSVA 5HGXA 1R66A 3LQYA 3M4ZA 1X7ZA 3MWYW 5CM8B 4AUEA 1CQWA