4XDZA

Holo structure of ketol-acid reductoisomerase from ignisphaera aggregans
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
328
structure length
328
Chain Sequence
AKIYKDEDISLEPIKNKTIAILGYGSQGRAWALNLRDSGLNVVVGLERQGDSWRRAIDDGFKPMYTKDAVAIADIIVFLVPDMVQKSLWLNSVKDFMKKGADLVFAHGFNIHFKIIEPPKDSDVYMIAPKSPGPIVRRSYEMGGGVPALVAVYQNVSGEALQKALAIAKGIGCARAGVIESTFKEETETDLFGEQVILVGGIMELIKASFETLVEEGYQPEVAYFETVNELKLIVDLIYEKGLTGMLRAVSDTAKYGGITVGKFIIDKSVRDKMKIVLERIRSGEFAREWIKEYERGMPTVFKELSELEGSTIETVGRKLREMMFRGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ketol-acid reductoisomerase
publication title Cofactor specificity motifs and the induced fit mechanism in class I ketol-acid reductoisomerases.
pubmed doi rcsb
source organism Ignisphaera aggregans
total genus 130
structure length 328
sequence length 328
chains with identical sequence B
ec nomenclature ec 1.1.1.383: Ketol-acid reductoisomerase (NAD(P)(+)).
pdb deposition date 2014-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01450 IlvC Acetohydroxy acid isomeroreductase, catalytic domain
A PF07991 IlvN Acetohydroxy acid isomeroreductase, NADPH-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3730.40 Mainly Alpha Orthogonal Bundle ProC C-terminal domain-like fold ProC C-terminal domain-like fold 4xdzA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xdzA01
4CM7A 3VZSA 3R6DA 4II2A 2O7QA 2B37A 4NZ9A 2J3JA 2YYYA 4K9DA 1BXGB 5TRTA 3JQ6A 3L4BC 2ZB7A 1SOWA 3MJ4A 2NU7A 3DBHB 1EDOA 3GG2A 4J4BA 3AUTA 3H2SA 1I2BA 4YACA 2UAGA 4B8WA 4J7XA 2IZ1A 4MDHA 1VL8A 3PHGA 1QKIA 1NPYA 2Y1DA 5T6BA 4P22A 4FQ8A 1ENYA 3K8ZA 4KOAA 2OFPA 4ZQHA 3TDKA 3WGGA 2VUTA 1GADO 2FWMX 3I9OA 4JN6B 3E48A 1HF3A 4A27A 4GL4A 1HZJA 5BR7A 1XHLA 4PLZA 4RLSA 2PGLA 1NAHA 3TNLA 1I10A 4OXNA 3TQHA 4BGEA 4GX1A 2YW9A 4IDGA 1VPDA 2D2IA 3HB5X 5JE8A 1ZK1A 1P1KA 1I8TA 2VHYA 3ZNQA 2P5UA 2QRKA 5TC4A 2NSDA 4DIFA 3O26A 4I5GA 1YL5A 4MO2A 4ZQGA 5ITVA 2Y1CA 1NQOA 3PK0A 1HLPA 3C85A 3ZCXA 5JAIA 1EUZA 1IOLA 1XSEA 4LW8A 4AJPA 3OM9A 2E49A 1DHTA 2C82A 1LBEA 1DBVO 1N9GA 1E3JA 1SC6A 1WZEA 3KYCA 3NTRA 3E9MA 3RBZA 3ZWCA 4AJEA 1F8FA 1AHIA 1PJBA 4NBTA 1E6EA 4PG6A 2GF2A 4BO7A 2JCYA 1SAYA 3DFZA 3FF4A 2W8ZA 4GX5A 1N92A 2IXAA 9LDBA 3STHA 1E1KA 4XR4A 4FDAA 1XU7A 2XXJA 2Y0EA 4HUJA 1O95A 5IFLA 2NLOA 4YJGB 1PGJA 1W6UA 5F21A 1GY8A 1E6WA 5I7EA 1YVEI 3V5NA 3RFTA 3IP1A 1QV7A 1GZ3A 4EITA 2VWHA 1N7GA 1R0LA 1X7GA 1N1GA 3RWBA 4D0SA 4J7CA 2ZATA 1H5QA 3CKYA 2AW5A 4ZA2A 3ZNOA 1YKFA 3FR8A 4Q3CA 5EESA 2AQHA 5I8ZA 2FMUA 2VYND 3GGGA 5ENDA 1GEEA 4Z0TA 1NVGA 4ALKA 1BGVA 3OP4A 1U3WA 4AFNA 2C2YA 1PQUA 4CQLB 1UZLA 3DAFA 3VH3A 3LQFA 1PJ3A 3KLPX 2O3QA 1P3DA 1ID1A 1GR0A 1L1FA 3WGQA 3K96A 2UV8A 1R0KA 4GLLA 4CM3A 4YRBA 3RFXA 3W8DA 2WM3A 3LT1A 2BH9A 1EDZA 1HDOA 2Y05A 4PLYA 1S7CA 1LDYA 4QX6A 4BKRA 5KJ1A 4AJIA 5AQ1A 1LX6A 1V3UA 4XWYA 4HWKA 1C0LA 4HFMA 2Y0DA 2R6JA 1ISIA 2P9GA 1SB9A 4M49A 1ZK4A 4EYEA 2C59A 4A7PA 2OP1A 5IZCA 3ZU5A 4XDZA 3AU9A 3IIEA 3ZHYA 3N58A 3NJ4A 2A4KA 2BGMA 4TRJA 1A7AA 3KRTA 3GPIA 4P8RA 3DHEA 4Q9NA 3KTDA 1H9BA 3V1YA 2RHRA 3EHEA 3RKRA 1GEGA 2ZB3A 4AJJA 3LC2O 1NM5A 4HKTA 3H6KA 4YQZA 4AJNA 4W7HA 2XXBA 4OOEA 3TL2A 5I8WA 2ZB4A 3M1AA 1PR9A 1KEWA 3JQ9C 4K1LA 4XYMA 2NADA 3RC2A 4TMFA 3FPLA 3ZV6A 3GVCA 1V3VA 5HS6A 4EUFA 1LLCA 3GAFA 4TQGA 3ASUA 4XJTA 4D79A 3QV1A 2ZQZA 3GGPA 3DBRA 1YDEA 3VPSA 3TSCA 3KYBA 4HFRA 1LSJA 4I9HA 4DQXA 2IXBA 1LDMA 4INAA 3P2YA 4HFNA 5ILGA 2NACA 2X9GA 4UREA 4IQ0A 4IJKA 4E12A 5KKCA 5U4QA 5BQFA 3KYDA 4ID9A 1YB5A 2Y68A 4LISA 2Z5LA 3SC6A 3EYWA 2VT2A 4PLVA 4MVJD 1EEHA 2OGUA 2Q3EA 1ADCA 1I2ZA 1LLQA 4GPD1 1LC0A 2I65A 4B4WA 4D42A 4IIUA 4FCCA 1I36A 1VRWA 4KQWA 2HK9A 5KWEA 1I30A 4K28A 1EVZA 3JQFC 2H9IA 1KVSA 4YPOA 2J3IA 3ORFA 1EK5A 3I4FA 1OOEA 4JBIA 5L7WA 2TMDA 1I24A 2BD0A 3VZQA 4YXFA 1R37A 3LT2A 4FFOA 3I6IA 1UXKA 4CUZA 5HS4A 2GN8A 4BQPA 5H81A 1PTJA 2OOSA 3JSAA 2O2SA 4NQZA 4IJVA 5L3ZA 2BKAA 2DPGA 4EDFA 3PQFA 3C1OA 3WGTA 4DVJA 5GZ3A 2Y93A 2BELA 3U09A 1ISMA 1R4NB 3AY6A 1Z6ZA 3JQ7A 4RZHA 1PJSA 1YB1A 3RU9A 1E1MA 3ANLA 1QYWA 3EDMA 4UUNA 4Y98A 1MG5A 1YXMA 1K2WA 4EJ0A 2NWQA 5KCZA 1A27A 2D5CA 1L7DA 1WP4A 4FB5A 4GLOA 4FJ1A 4FFLA 3IUPA 3GPDG 1KVRA 2NUAA 2Q1WA 4WNIA 1GZ4A 2X4GA 3K2BA 4MVJF 3WBFA 1UXGA 3O38A 4FFRA 2FHSA 3VAZA 3L6EA 4E30A 3VHRA 2Y99A 3QIVA 4J1NA 4M89A 4D0RA 2HO5A 3CEAA 1MX3A 2EKQA 3O8QB 3RUCA 4XRGA 3QVSA 1WDKA 3JQGB 1Z45A 3D64A 3S1LA 3CSDA 4U0KA 1N5DA 3ETGA 1CF2O 1S6YA 2C5AA 4DUPA 3FTNA 4YAJA 1BHSA 3INTA 3AOEC 3P7MA 2C7VA 2E37A 4J90A 2CNBA 1KEVA 4Q3BA 3HQ4O 4NBVA 2HK7A 5T8KC 1P9LA 2V6GA 4B79A 1MP0A 3BTSA 1NX6A 4PLTA 4I9NA 5IDWA 3PZRA 3JD3A 2NU9A 3EK2A 1B15A 5ICMA 4BO9A 1T2EA 1MXHA 4TWRA 3C1AA 3ROMA 3WFJA 3ZI0A 3L6OO 1GYRA 3UAGA 1J0XO 4RL6A 3WX0A 2YV3A 1EMDA 1AGNA 3ADOA 1GUFA 4TKLA 1FXSA 1YOVA 4HV4A 1ISGA 3FNHA 1SB8A 3HFSA 3LVFO 3AFNA 4R9RA 1U2DA 4L0QA 3GN1A 4LN1A 4ZQEA 1GV0A 1KETA 1GAEO 3HB4X 2RH8A 3QSGA 5CAEA 1LLDA 4G2NA 3VKVA 5L95A 1CJCA 1Q0LA 1O0SA 2HMTA 3JV7A 4XD2A 4R54A 3QRWA 3GDOA 3VC7A 5JBIA 3TFQA 3JQAD 4MVJG 2P5YA 3UW3A 1U5CA 1BWSA 2DPHA 1HZZA 3B1JA 4IQGA 4QO8A 3NDIA 3W8EA 2B35A 3DHNA 1EE9A 3A4VA 3GEDA 2ZB8A 4E2WA 3NV9A 4D3SA 1SEPA 4BUCA 4YAIA 3GA0A 3RASA 4W6ZA 3U4HA 3O9ZA 4R68A 3NX4A 4Y6PA 4B7UA 2PH3A 5G0WA 2H6EA 2C07A 2OL4A 2DBQA 3JD2A 3LF1A 4Y8VA 3OJOA 4I5EA 3M1LA 2O3TA 5T5QA 3TPCA 2SCUA 4Q3EA 3WYEA 5ITWA 3JQAB 4R01A 3RC1A 1F06A 1R15A 1E3SA 1WPQA 3OQ1A 4BNLA 4QQRA 1ULSA 2I99A 3QVTA 4F46A 4CV3A 3KO8A 3U9LA 2JD0A 2ZTVA 1PJ2A 2WE7A 3X2EA 4BO5A 4EJMA 3SVTA 2I6TA 3FWNA 4WCFC 3JQ8B 4LRTB 3JYLA 1EK6A 5JDCA 1SNYA 4R3WA 3V1TC 3UCEA 1MC4A 1X0VA 3EZYA 4YJFA 4U5QA 5LC1A 3GVHA 4J1QA 1X13A 2V7PA 4XB2A 4DPLA 3NGXA 3PYXA 2Q49A 3ZV4A 5ILOA 3I9MA 4BNVA 2JFFA 3W4IA 3A14A 3ENKA 2DVMA 4NFYA 1P33A 3D5TA 1P1RA 1D4FA 3HSKA 3E82A 1FDWA 1H2BA 3QWAA 4UUOA 4FFNA 4MVJM 5DDIP 4DWVA 1WVGA 5EN4A 1QYXA 3V1UA 1RM4A 1T4DA 2FRDA 3GG9A 3PP8A 4NK4A 4EUHA 2I3AA 3D3WA 1Y8QA 4CUJA 3UFXA 3PHLA 3AY7A 5FEUA 4IXTA 3MJSA 3M2TA 4E5MA 3SC4A 2PTGA 4RZIA 3WSWA 5H82A 1XDWA 1YQGA 3ANNA 2Y1GA 5IXYA 3OECA 1QYCA 2YV2A 4IS2A 4TSKA 4YRDA 1I2CA 3PVZA 5K6AC 4DPKA 1JWAB 2J3KA 1JDJA 4BO0A 3WGZA 2H5LA 1QYDA 2Y67A 2IEDA 1T2CA 3PGJA 2FZWA 4EEZA 5THQA 4I5DA 4BNMA 4GX0A 1NTOA 5K0ZA 5JSFA 2AG5A 1KY5A 2EERA 3R1IA 4GI2A 2Y1FA 4N7RA 3TRIA 5TSDA 2JFHA 4CLRA 2PZLA 1IPEA 1KVUA 3BMOB 1LDEA 3D5QA 3BAZA 2VYVA 1P31A 4FPXA 1U8FO 3RCBA 1HE5A 3ZWPA 4MP8A 1OFGA 2J6IA 1HDRA 3ZHZA 5TLSA 3MWEB 3DZFA 4R1NA 1DAPA 1Q7BA 4BO4A 2O48X 4RPJA 1R0SA 4DGSA 3TF5A 4M8SA 3AJRA 3WJ7A 4R1TA 1T25A 2GGSA 4TRMA 3PYMA 4O6VA 3G79A 5A06A 3LT4A 3WOHA 1P44A 2X58A 2X0RA 4RDIA 3UHAA 4L74A 4Y6SA 3E1KA 3P5SA 1JA9A 3ZWVA 1G0NA 4PLCA 1U5AA 1BXGA 4FD3A 4OQZA 2HRZA 2PD4A 1P0FA 3NKLA 4JGBA 4M87A 2I67A 4MIEA 3S55A 1RM5A 3DBHA 2AEFA 4HY3A 1NQ5A 1XLTA 5CDTA 3UCFA 4CLOB 3DOCA 3GMSA 4NFHA 2G76A 2WTBA 5IZ4A 2JAPA 5CPBA 1JN0A 4RQTA 1PZFA 2WYUA 3TOXA 4NJMB 4IUYA 4RPKA 4OAQA 2CSUA 1P1HA 4BVAA 3D4NA 3ENNA 1NFQA 1X1TA 2DLDA 4NI5A 4ZQFA 4J2OA 5DULA 4XYLA 3FI9A 2QHXA 4IQ8A 4A0SA 3LSYA 3TZHA 1KEPA 1ADFA 1VL0A 4IMRA 4D41A 5LDGA 1ZKMA 3LLVA 1HE4A 2QQ5A 4RVDA 4UULA 3RUAA 4BNGA 2G1UA 4PRLA 2EF1A 3EW7A 4BQRA 1GYPA 1RYEA 3AM3A 4C7JA 4UAGA 2V65A 4CQMD 2DKNA 5GMOA 1KVTA 3I9LA 3ANMA 5A03A 3S2GA 4L4RA 3CUKA 1GFSA 2QYSA 2VQ3A 1B26A 1BG6A 2NV6A 3I4CA 5JY6A 5KJFA 3AW9A 4DQVA 4BIIA 5JAQA 2C29D 3GFBA 2JD1A 1E92A 1EUCA 3PXXA 3W6UA 4R1SA 1LA2A 1T2DA 4G81A 3JQEA 4ZRMA 1FF9A 3F1KA 1ZH8A 4JCOA 4N5LA 3VTFA 2PNFA 4CQMB 4DBVO 1L7EA 4WOJA 4ZGWA 3ON5A 4LVCA 2YHIB 1OAAA 3AUSA 6LDHA 4A5OA 1WDMA 4FJ2A 2EG9A 3FN4A 2FOIA 1V0JA 5C3MA 3CE6A 3HDQA 2AE2A 3TWOA 4YJGA 7MDHA 1DJNA 4E2XA 3FR7A 1VE9A 3B6ZA 2X9NA 4AJHA 4EGFA 2HLPA 2JAHA 3B1KA 4JNKA 3VVBA 5F5LA 3NT4A 1BDMA 1CWUA 3MJVA 3ICCA 3KB6A 4DBZA 4GGPA 3G0OA 2JL1A 1AUPA 3H4VA 2Y0CA 1UZMA 1E5LA 5IZCC 4JBHA 2FR1A 2GN9A 4NU5A 1ZEJA 4WLFA 3H9JA 4ZVVA 3PZBA 3WTCA 1O9BA 4DLLA 1I32A 1T2FA 4DREA 1NQAO 4CQLA 3OJFA 2GCGA 1LQTA 5L9AA 4XQGA 4IM7A 4BMNA 2D3TA 5I9NA 2X7HA 4E2ZA 5JYDA 1GV1A 3M2PA 4PVCA 3WIDA 4WLNA 4FFPA 2VYNA 3OICA 4OSPA 1Z7BA 2A9FA 1U4OA 3EY4A 1DIGA 3JYOA 5JO0A 3HWRA 3K92A 2CDAA 2D4AA 1A5ZA 1WLYA 2VOEA 4UEKA 2FY8A 4R5MA 3TOZA 1T4BA 1PS9A 4CR8A 4J0FA 2EW8A 3T7CA 1FMCA 4D45A 4DPMA 1IY8A 4H7PA 1D3AA 4QEDA 1PZEA 4MP6A 4NG5A 4WLOA 3IKTA 1ISHA 4JK3A 3UF0A 1VKOA 2VWQA 1ZXBA 2FP4A 5DF1A 4CUKA 5CFZA 5K9ZA 1AN9A 1PS0A 1TB4A 3N7UA 4DA9A 4XYGA 5A02A 4Y6RA 1GD1O 5T64A 3PJEA 3T7EA 2DBRA 2X9VA 4ND4A 3A9WA 3DL2A 3PQEA 1K89A 1JKJA 2PWZA 5G4KB 2NTVA 4DC0A 4OKIA 3WQRA 4RF3A 1V35A 4W9NC 1PS8A 3UICA 3NTQA 3RQSA 4CMBA 1TVEA 1LRKA 2ZQYA 5G0TA 2C0CA 3OQBA 2XF8A 1CDOA 5L40A 1FDTA 1MUUA 1UZNA 1XCBA 4TROA 2NM0A 1WXDA 5IXSA 3WQQA 3JYPA 2O2YA 5T57A 3VVCA 2EP7A 1TI7A 3GMDA 4KDFA 1GUYA 4HADA 2EEZA 4BL5A 1T2AA 2GZ2A 4BNTA 2JJYA 3RUDA 5G0UA 1KERA 4GKBA 3H3FA 5HRUA 2AG8A 3BTOA 1P45A 1B8VA 3DOJA 2WD7B 3GHYA 4RGBA 1M6HA 3RUIA 1ZW1A 5B1YA 5IDYA 4IGFA 1AXGA 3LC7O 1DIHA 2JHFA 3R3JA 5A9SB 1QORA 3I9NA 1YBVA 4J1SA 1E3EA 3KSZO 1F14A 4ALNA 3DZGA 4GKVA 2CVQA 4MVJA 4XGNA 5KKAA 1ZZEA 1U3UA 3GC6A 4AJ4A 1SEVA 1ZO8A 3Q9UA 5BNIA 1F17A 5BT9A 1PEDA 3QVOA 4DLBA 3KSUA 3OETA 3PRJA 1QMGA 4DYDA 3U4CA 1R4NA 3BHIA 1JW9B 4Z0PA 3HJAA 3RVDA 5C5IA 1K6IA 1X0XA 3DWFA 4CM9D 3NGLA 4CM5A 3ZWOA 3ZN2A 1UAYA 4R1UA 5G0VA 1H93A 1O8CA 3IP3A 1NAIA 1F12A 7ADHA 4NDNE 4RF2A 3RBXA 4IMPA 3F46A 1Y5RA 4LMPA 4OJNA 2Q2VA 3PYLA 2OO5A 1U2GA 5FYDA 3RUFA 3V2GA 4YT2A 2D0IA 1UP6A 3L9XA 2G0TA 1E7MA 3SLGA 1FDUA 5ER6A 5C7IO 3WLEA 3DR3A 3MZ0A 3NYWA 5ADHA 3GEMA 4BO3A 5G2OA 3JQGA 5T67A 1ARZA 4GSKA 3MOGA 1P77A 5AXCA 4BNFA 1UDCA 1C0PA 3F5QA 2GSDA 5JCXA 2CUKA 2YY7A 1J6UA 4OSOA 4KZPA 5J23A 5DOVA 2HMSA 3OIDA 5CEFA 4ZN6A 3FNGA 4U0JA 5G0SA 4YA6A 4LK3A 3V2HA 4UEJA 3UVEA 3GOHA 4DTIA 3E18A 3CZMA 4L4XA 1QRRA 2J3HA 1NHWA 3RD5A 2CF6A 3L07A 3IOYA 3B20A 1Z7EA 5KVQA 1WWKA 3L6DA 4AL4A 1JU9A 2O3SA 2VTEA 1HYEA 3DDNA 4DC1A 3RI3A 3ZH2A 1MFPA 3VPHA 4I08A 3IMFA 4OYRA 3PQDA 2PK3A 2X5JO 2NQ8A 3K5PA 3ONFA 5TJHA 3G49A 3AFMA 4OO3A 5A5EA 1NP3A 4J6FA 4Z0HO 5LCXA 4B3JA 3H9GA 4EEXA 4DYVA 1YQDA 5HA5A 4AJOA 1IL0A 2V6BA 5IN5A 4BHTA 1YB4A 3FBGA 3GLQA 4JP2A 5JCJD 5KVSA 3EVTA 3T4XA 2OXIA 3G1TA 2AXQA 1CIVA 1XEAA 3CPSA 3WGHA 4CMEC 1WMBA 2VHVA 4PLFA 1BTOA 4KUHA 4BNKA 5JS6A 3QHAA 3RAJA 2Z1NA 1NVTA 1NR7A 3GR6A 2D5AA 1HDYA 4BNXA 3WWZA 3GFGA 2VOJA 1H6DA 2GYYA 4GQAA 1BXZA 1NR1A 3A1NA 1Q7CA 3KEQA 2X8LA 3HHPA 3JQAA 2Y1EA 1LC3A 4M86A 4BGVA 1KC1A 3GNSA 4LRSB 2Q4BA 4G65A 2QG4A 2P68A 2VZ9A 1ML3A 1PL6A 3WR5A 1IZ0A 3GVXA 1ZNQO 1XKQA 3O4RA 4KUEA 3VPFA 3ZU2A 3W4JA 4D3DA 1D1TA 3H5RA 1BW9B 5JPIA 2VWPA 1ENZA 2CDBA 3JQ8A 4Q39A 2HSDA 4S1VA 3I6QA 1LTHR 3FNFA 1YRLA 5A1TA 4RPLA 1GTMA 1NBOA 1N8KA 1WW8A 1TT5B 4YQYA 3B70A 4HNHA 1C14A 2CDCA 3BMCB 1JKFA 2WD8A 2YDYA 3U4IA 5GY7A 3ZWXA 3GUCA 2BF7A 2BGLA 3KBOA 4N18A 4GVXA 1CRWG 1T24A 4HNGA 2P9CA 2ZTMA 3NDJA 1GCUA 3RJ9A 2QX7A 3KLMX 5A5FA 1V8BA 5L4LA 4L8VA 4R51A 1SCUA 1N2SA 1XELA 5FI5A 1B2LA 3AU8A 4YAKA 4R4JA 1ISFA 4AVYA 3F47A 5AVOA 3JQBA 3WICA 3GH3A 4NJOA 4L73A 5FF9A 5TT1A 4X54A 1K5HA 2OHXA 3OJLA 5KJEA 3ITKA 1UP4A 3OEWA 2ZCVA 2FSSA 4FS3A 2A35A 5TX7A 3NUGA 2EP5A 1GQQA 4P38A 3E6AA 2DTXA 4B3HA 2W2LD 3QY9A 5L45A 1E7SA 3BMQB 1CYDA 1YE3A 4NR0A 2O3UA 4PG7A 4NK5A 5JYEA 1HDGO 2PZMA 1ZCJA 3E8XA 1UXJA 4H16A 4AJ1A 4J0EA 3QP9A 1B8PA 1YQXA 3KZVA 4BNJA 3HG7A 3BTUA 3JD1A 4J9UE 5A9RA 1NWCA 3HN7A 2J5KA 4A73A 5C37A 1BSVA 3WMXA 2BMAA 3PHIA 5TT0A 3LZ6A 4NIMA 3BMOA 3A06A 1GYQA 4BO2A 5GZ1A 4PRKA 4R5HA 5BSHA 4S3MA 1IUKA 4LMRA 5B4UA 1QYVA 1EFLA 5ICSA 3DO5A 1DLIA 2PKQP 1Z82A 2E4AA 3F6YA 4W99A 4FFMA 1OBFO 1U28A 4FW8A 3PHJA 1HYGA 2VRCD 2CY0A 1NFFA 1YGYA 4W82A 2VHXA 2AEJA 4B4OA 1DRVA 2F1KA 1ZK2A 2PZKA 1X7HA 3EUWA 1PJ4A 2GPTA 1PIWA 1DJQA 4IDEA 2B4QA 3AOGA 1HDCA 3K6JA 3MWDB 1YBMA 3WLFA 4ESOA 4NBUA 3CH6A 1PX0A 2E6UX 2X5OA 3IKVA 1KBZA 1BMDA 1WZIA 1LDGA 5G4LA 3PWSA 1PJTA 1WMAA 1EZ4A 3UXYA 4CLOA 1XWFA 2R2GA 1W8DA 4AICA 3CIFA 3BZUA 3QE3A 5L53A 1SO8A 2DTEA 2YFQA 4DRYA 2XPCA 4NJMA 3I83A 1Z73A 2FR8A 5JMWA 4Z6KA 1UDAA 4J4TA 6ADHA 2P9EA 1AXEA 3H5AA 2HU2A 2FPPA 3RKUA 4ZRNA 1DPGA 1RWBA 4P4GA 1SZJG 4BNUA 4NU6A 1C3VA 3KXDA 4JBGA 2D1YA 4ZQBA 3AY3A 1IHXA 2I66A 4YT5A 2B83A 3GAZA 3TN7A 1A9ZA 4RO0A 1G0OA 4JJGA 5AXBA 3Q2IA 2QZ9A 1PL8A 3ZWBA 1TA4A 3DBLB 3C24A 2CD9A 3RC7A 4IZHA 5TNXA 3RROA 4GVLA 2YUTA 1DIBA 4YJHB 1HDZA 1UJMA 4Q3DA 3F4LA 4E33A 4IZIA 3E5RA 2BRUA 3GDFA 4ONEA 4MOWA 2WSBA 3DEYX 4CQMA 1R4MB 3NDRA 3NTOA 1KYQA 2B5WA 1HRDA 1QSGA 1Y8RB 3PPIA 4UVEA 2YHIA 3OHSX 2DU8A 4KP7A 1H6AA 4DQUA 3DONA 4QFCA 4E13A 1G1AA 4E5NA 4IDDA 1E3WB 2NVWA 4TRRA 1B0AA 3GZ4A 4C7KA 1ENOA 4FOSA 4MINA 1ZVMA 4PN3A 2AQIA 4QSMA 1QXSA 3AI1A 4P4NA 4ZJUA 5B4VA 3FWZA 3ETDA 5F3RA 2EJWA 3ASVA 1MG0A 2YDXA 5I7FA 5MGBA 1CERA 1YS4A 2X86A 3GZNB 3JCZA 4F45A 1OI7A 4M54A 3WG9A 3IJRA 3RBVA 3BHJA 4ZD6A 5HBRA 2C54A 5KNLA 4B8ZA 3IC5A 1HEUA 2HUNA 2EKLA 5HTOA 4GX2A 5TJ9A 1Y9AA 2OORA 4CJXA 3I1JA 3PDJA 2PGDA 2PD6A 3G17A 4FN4A 5COAA 1EE2A 2C20A 3ICPA 1JTVA 4EBFA 1DB3A 2UUPA 4PG8A 1R6DA 1A9YA 3FPCA 4NBRA 3K73O 3ZZNA 1PJQA 4PCVA 2IYPA 2IE0A 1LU9A 3QVWA 4BNYA 4E4YA 2AEMA 3VKUA 1XG5A 4RVGA 5DOZA 4GGOA 1HT0A 5F1KA 4MVJP 1M66A 3W4KA 5I7VA 1ZSVA 4MVJI 2EIHA 5BSEA 1MLDA 5CDUA 2RAFA 4CMIB 2B4TO 2ZYAA 1H9AA 2C2XA 4CLHA 2X6TA 3DZIA 4N5NA 5CDYA 1DFHA 2QZZA 1U7TA 8ADHA 2W2KB 4W7IA 5JAZA 3SX2A 3MOIA 3BIOA 3ZWMA 4CMCA 3I23A 3D3EA 3IDSA 2R00A 2EGHA 2PH5A 1UXHA 4GBJA 4NH4A 1ZFNA 4BB6A 1QP8A 4NMHA 1ZUD1 2CVZA 2H1SA 4GH5A 2ZJ1A 4YT8A 1VJTA 1YBAA 1M2WA 1GDHA 4MKRA 5AXDA 3TZ6A 1K6JA 1ADBA 3K2EA 4G5HA 4ZHSA 4PGFA 3VDRA 3OSUA 4CPDA 1GZ6A 4MKZA 5B37A 4FSHA 5G4KA 4OHUA 4BNWA 4F6LA 1MFZA 1R12A 3OJEA 2DT5A 3WB9A 4MP3A 4OM8A 1E5QA 2AHRA 3PIDA 1Y81A 1AHHA 2X1HA 1R66A 2O3RA 4E32A 2TMGA 1RM0A 4XIYA 4CV0A 2JHGA 2IEBA 4TZTA 1TLTA 4IPTA 2X22A 4BKOA 2E48A 4ALIA 1RM3A 5TGDA 4RDHA 4RF5A 4IGEA 1JVSA 4UVDA 2NVUB 4ITUA 1YOVB 3DZHA 4U7WA 1DDOA 1UP7A 2DM6A 4BKQA 4FC6A 5AOVA 5A04A 3BTVA 3SLKA 4FGSA 1BDBA 3I9JA 4RVUA 2QYTA 2VUUA 1NYTA 5FI3A 2VCYA 1SBYA 2WD7A 5TQVA 1UDBA 2ZIZA 5B4TA 1PU2A 1TEHA 4MJLA 1GPDG 5A9SA 3WJAA 2EXXA 5LDHA 4BO8A 5L4SA 4BO6A 2G17A 2IDZA 3M6IA 1DC5A 1QV6A 4TRNA 1ZK0A 4U6QA 1U3TA 1LXCA 1PGQA 1T1SA 3DAPA 3FSRA 1NVMB 1U8XX 3Q11A 4OQYA 1U7HA 3KVOA 2CFCA 2NNLD 4JJFA 1YWGO 4YYZA 2B4RO 3MJTA 1FDVA 3PTZA 2VWGA 2WJPA 1V6AA 1V9LA 4ND5A 2C5EA 3AUAA 3T4EA 3RC9A 3PFWO 1NPDA 2HJSA 1K6XA 2OUIA 2W4QA 3OFSA 2HQ1A 1CQIA 5A4DA 1UXIA 1YDWA 5A05A 4YT4A 1V3TA 1DLJA 3WIEA 1IB6A 1CEQA 1YJ8A 3TL3A 2EW2A 3BMNB 4CM9A 2DUUA 4KMSA 4MKXA 3Q9NA 4Z9YA 2DBVO 3I5MA 4XA8A 1C1XB 4XRRA 5DBGA 3ZU3A 3PWZA 1H0KA 3C7AA 4HFJA 2WE8A 4ND1A 4WEOA 1QG6A 4OL9A 3WS7A 2DUWA 2IYOA 2HMUA 4MVJE 2XAAA 5JFOA 1CQJA 5CP8A 2NU8A 1MC5A 2VHWA 4AJLA 1J4AA 1PZHA 5EMHA 5TIIA 1ZJZA 1N1EA 3DOOA 1CETA 1HWYA 3K30A 5EQFA 5IN4A 3AUUA 4JP3A 3EMKA 4F3YA 1E3LA 3Q2KA 1Y7TA 2NTJA 3VPGA 3PJDA 3ZWAA 2NVBA 1SOVA 1UAGA 3VZPA 4H15A 3ZW9A 2PA3A 4BMSA 3LU1A 1C1DB 4PVDA 2GLXA 3OMLA 1UH5A 4N54A 4O63O 1LNQA 2RBEA 1ZSNA 4MPDA 3ZWWA 4ZU3A 1ZEMA 4PIVA 4JLWA 1E7QA 2RCYA 4ALLA 5THKA 1BRMA 4B7CA 1YJQA 3OBBA 4N5MA 1KS9A 2AMFA 3H3JA 1LSSA 1X15A 4O1MA 3UCXA 1D7OA 3ETEA 2UUOA 2FZEA 3P19A 4Q3AA 3GVIA 3C1TA 3C7CB 4TVBA 4F6CA 2PGJA 1FDSA 3UKOA 1XA0A 3HDHA 3HNPA 2AQ8A 5COBA 4CL3A 5KIAA 4WLEA 3I52A 4CM4B 4FJ0A 5EIOA 2I9PA 3LLSA 3ZV3A 4DLAA 4OXYA 1BXKA 4LSMA 5L4NA 4XX0A 1EVJA 3K9QO 5CDGA 2YFHA 1PQWA 5JCJA 5GZ6A 1SMKA 1PGPA 3E9QA 2HRBA 3QWHA 4A26A 4XKJA 1DRWA 2IRWA 2VUSA 2HMVA 3QWIA 2BGKA 1E7WA 2YJZA 3JQBC 3KUXA 4CODB 1BW9A 3RJ5A 5BSGA 4DL9A 3UUWA 2IZ0A 1QLHA 1I01A 4DXHA 1U4SA 1ZK3A 3GT0A 1O5IA 4A2CA 5KTKA 1TT5A 3OA0A 1JVBA 3BMCA 2GD1O 3JTMA 4QFDA 1PJLA 2X0NA 1MV8A 2VZ8A 4P4LA 4YAEA 1B7GO 4LSWA 4PLGA 3H5NA 3SBOA 1A4IA 2I3GA 4UVIA 4YR9A 4CM8B 5FFFA 4E0BA 3VZRA 4PG4A 4J16A 1B14A 4WK6A 5COQA 1SPXA 2ZTLA 1KY4A 4MIOA 2NU6A 4WUVA 4E5YA 2V6MA 3V8BA 4CMJA 2PD3A 4XR9A 1DO8A 3ROPA 3DZKA 3PI7A 1JQBA 2FR0A 3E5MA 2DQ4A 2O50A 4IDAA 3B1FA 3FNEA 3LDHA 1R16A 3BMQA 1HKUA 1ZIDA 5DZSA 3DZJA 1X1EA 2EJVA 4GSLA 1KC3A 1ADGA 2E82A 2HJRA 3ZGYA 3GHHA 2HKIA 1NQTA 4I1IA 2ZCUA 4ROSA 3TZKA 3ZHBA 5KOIA 4CR7A 1LI4A 3NRCA 5DT9A 4TVOA 3WDSA 4KTVE 5H83A 3I3OA 3HFGA 4E6PA 2IZZA 2GUGA 5DCWA 1GQ2A 4KWHA 4BS9A 1KIFA 3KV3O 4Y67A 1RYDA 2W2LA 2DBZA 3NEPX 3O8QA 1OC2A 3PJGA 5JDIA 4U8GA 4IIVA 2Q4EA 4QO7A 3AM5A 5JY1A 4WE3A 5EINA 3WNVA 3VPXA 1DIRA 2PR2A 4L9RA 4Z9XA 1E1NA 3JD0A 5JO9A 3ZHXA 1QLJA 2J8ZA 4WKGA 2UDPA 1VKNA 4B4VA 3ZWYA 2AE1A 1D1SA 3TZQA 4XGKA 2X0JA 4J43A 4IINA 4WNCA 1ZMOA 1E7YA 1U9JA 1YO6A 4RV9A 3SJ7A 3VOSA 3WQSB 2JCXA 1M6WA 1NWHA 1RJWA 3GRPA 3MTGA 3VH1A 3EC7A 3S2FA 1GCOA 4AJ2A 4WCFB 4XYBA 3TFOA 2BFAA 3GUYA 3WYCA 1VI2A 1W73A 5DCUA 1H6CA 1VSUA 1MXFA 3AM4A 2VRCA 3DMTA 4PLPA 5DP2A 4Z3KA 4XEHA 1LRLA 1M67A 3C8MA 3JQCA 3ONEA 4OIMA 1PJCA 2DFDA 4B4UA 1IZ9A 5DBFA 4RPGA 3O03A 2ZK7A 1P1JA 3QJ5A 3UGKA 4M1QA 3QWFA 3W6ZA 3F9IA 1VLLA 2ZJ0A 3CMMA 3ZNPA 4XIJA 1U1IA 2VZ0A 4FIZA 5JDCC 3PFFA 4UVGA 4L4SA 1BVUA 1Q0HA 3DB2A 1XR3A 5L7TA 3ZNNA 1A7KA 3U62A 3CMCO 3DAGA 1NFRA 2Z1MA 4WJZA 2XOXA 5DCYA 4H3VA 4XGIA 4BKPA 3GF4A 1I3MA 4ND2A 3IUSA 1PL7A 2VNAA 2WWRA 3OIFA 3K31A 3DBLA 3FBTA 3UH1A 4RCVA 3JYNA 3VH2A 3U49A 4QXMA 4YJHA 4EZBA 2HCTA 3TJRA 1ZSYA 5IJZA 1EQ2A 4J91A 4GWGA 1C0IA 4QTZA 2PZJA 5JW6A 2J5RA 4CLDA 1HSZA 3CZRA 3IQDB 1R4MA 4J9VA 1DIAA 1FJHA 1AE1A 1DC4A 1G6KA 1P0CA 4CMKA 1Y8RA 4XQ9A 4D7AA 2NTNA 4JQCA 1VC2A 5ER9A 3U0BA 4RPHA 4BNZA 3AK4A 5CPFA 1TT7A 1LJ8A 2ZTUA 3NT5A 2O23A 3CTMA 2WYWA 5CHEA 1E3WA 4FR5A 5EL0A 1T26A 2FSVA 3WXBA 2JD2A 3KOUA 3KEOA 4GMFA 4WASA 1I3NA 2EV9A 3OF2A 3Q0EA 1O94A 2GDZA 3R0IA 2Q1UA 3GZNA 1Q7GA 3MTJA 1H94A 4WPGA 1O89A 4BO1A 1I5RA 2RHCA 3L4BA 1RKXA 2I5PO 4YJDA 3WSVA 3INRA 4QECA 1ULUA 1P1IA 3PJFA 4W9NA 4YBZA 2R00C 4TKMA 2P91A 1GUZA 3ULKA 4K6CA 2UYYA 1MB4A 1WNTA 1HE2A 2D59A 4CMAA 4FC7A 3QA9A 4EW6A 1N9GB 2PKRA 2F00A 1J5PA 1I0ZA 1JWBB 4Z3DA 5KVCA 3KYCB 3KSDO 1HTBA 1J49A 1ZMTA 2FPIA 3AI2A 1YL7A 3L9WA 3OH8A 4GWKA 5EERA 3GDGA 3L77A 5DP1A 3VDQA 3WMWA 3FCOA 4AJKA 1JAYA 4CMIA 3RUHA 4BNNA 4NPCA 2A94A 3Q6IA 4R69A 2GZ1A 4MVJH 4J7UA 1GPJA 1B3RA 2W2KA 1M75A 4IBOA 1YH3A 5HWSA 1DAOA 5DN9A 5JAMA 3KHUA 4OGWA 3W8FA 3H8VA 3TZCA 3GK3A 1YL6A 3OQ6A 5BNFA 2G5CA 1E1LA 4E3ZA 3DHYA 4JXKA 1KEUA 4WGGA 3H2ZA 3ZDFA 4R41A 3RIHA 1PZGA 2AQKA 2RIRA 2X0IA 4URFA 4XZ3A 3WGYA 1DRUA 1LUAA 3QVXA 3ROQA 2C7GA 2ZYGA 4YWJA 3DC2A 2PY6A 2CMDA 2I76A 2GASA 4DIOA 1EUDA 5F1OA 5CEEA 3BXXA 1HE3A 5U9CA 3GRKA 3PHHA 4CLEA 4UEOA 2WEKA 1Z74A 1HL3A 1X14A 3D4OA 3NJ8A 1RPNA 1XQ6A 2HAEA 2GN6A 2VHZA 3HDJA 1EBFA 2GNAA 3HUDA 4J3FA 3S2IA 4Z9FA 3WGIA 5A3VA 3WGOA 4XYEA 1PWZA 3ONDA 2FN7A 3U4DA 1LDBA 2OZPA 1PQPA 3HADA 3I9KA 4BOYA 3FD8A 4CR6A 1UR5A 3R3SA 1HSOA 1Q2XA 4GMGA 2Q45A 4UUMA 3WTBA 1A4UA 2AA3A 1LQUA 3PDUA 5EJ2A 2NVUA 1GU7A 2YQ4A 4II3A 3AI3A 2PLAA 3C3XA 4OOFA 3S8MA 5KJCA 3IL2A 4E5PA 4I5FA 5FWNA 4WOKA 4ALMA 3FHLA 2Q99A 4RQUA 2O3JA 1VM6A 4O59O 4IJWA 3MEQA 4XJSA 4RF4A 3RFVA 1ONPA 4IS3A 1A72A 1LDNA 3INGA 5I7SA 3KETA 4RLHA 3PLNA 1X7DA 1B3BA 1O6ZA 2HMWA 4YTEA 2VRBA 4OH1A 2O4UX 3EVNA 3NT2A 5EQDA 1W4ZA 4CM6A 3HZZA 2GRAA 4RORA 4RVHA 4YB8A 3DTTA 3ZWNA 4J1TA 1B8UA 1P1FA 4DIBA 4WLVA 1VL6A 3KM0A 2QW8A 1I3LA 1NPTO 1JKIA 3WFIA 2BHLA 1TXGA 1DSSG 3DBRB 3DZBA 4YVFA 3BYZA 3IAHA 3U3XA 3P2OA 4LVUA 4CV1A 5CG2A 4XQEA 1LLUA 3L4SO 1LEHA 3CINA 3F4BA 2W90A 4PZCA 3KYDB 2YQ5A 4ILKA 2QRLA 1MGOA 2ILTA 3BMNA 1N7HA 5BSFA 1GQYA 5DNAA 1U3VA 1ORRA 4CMEA 1HXHA 4L75A 1C1XA 1XYGA 1JLLA 2A92A 4BNHA 3JQ9A 3W1VA 4B3IA 1F8GA 3DMYA 5F5NA 3EGOA 5CDSA 1UUFA 2NQTA 2PV7A 4D43A 1Y6JA 2Y66A 3L0DA 1HDXA 2BI7A 5JMPA 5IDQA 3GNQA 5I9LA 4GAEA 4HX5A 1DFIA 3Q1LA 4TZKA 4E2YA 1IYZA 1C0KA 1DFGA 2CZCA 4K26A 4RJTA 3OEYA 1DC6A 1E77A 2LDBA 2VT3A 1HETA 1Y9EA 1EVYA 4A03A 1Y5MA 2QIOA 5JC8A 2CVOA 1HLDA 2G82A 2BFOA 4AG3A 3F3SA 3PIIA 4OXKA 5JXWA 3OIGA 2H63A 5F1PA 4HP8A 1K0UA 3JQ7B 1C1DA 2BFPA 2P2SA 1XIVA 5A9TA 4E31A 4PLWA 3GQVA 3D7LA 3ST7A 5KVVA 2Q2WA 5HM8A 1Z75A 1HYHA 3ZU4A 4PFJA 3WBBA 3IS3A 1DXYA 1LRJA 1D8AA 1WDLA 2YHUA 4RVFA 4XDYA 3D1LA 3JQFA 4BB5A 4I9UA 4XCVA 1LSUA 3Q3CA 2X5KO 5CEJA 3DQPA 5A3JA 1VJ1A 2GR9A 2YZ7A 3V2UA 3U5TA 3ZW8A 4ALJA 4BKUA 3E9NA 1PSDA 3S2EA 3JD4A 3PLRA 1E6UA 2DAPA 1E3IA 3UN1A 2QRJA 4R3NA 3GY0A 3D0OA 4CL8A 2BI8A 3VH4A 3D4PA 3EZLA 3ROKA 4A10A 5ES3A 1DC3A 3QQPA 4CM4A 3QW2A 2B0JA 4UUPA 2Z95A 4J49A 3QLJA 3JQDA 3MCVA 4K6FA 1VSVA 2DFVA 2DC1A 1VJ0A 4HXYA 3OJ0A 1B16A 3HDYA 4QUKA 4UVHA 2GZ3A 3DFUA 5U1PA 3WWYA 2VNSA 4D44A 4QT0A 4MIYA 2Q50A 2B36A 4XB1A 5IF3A 2EWMA 4FGWA 1GL3A 3LYLA 3JYQA 2X23A 1IHYA 1Q1NA 3F1LA 1Q0QA 4FBGA 1NXQA 2EKPA 1I33A 2PKQO 1JAXA 4NHEA 4PZEA 3PEFA 5JLAA 4J4HA 4FOOA 4CV2A 1BVRA 3WNQA 4BGUA 2HDHA 4BGIA 4BNIA 1LSOA 2EGGA 4Q3NA 1EFKA 2Q2QA 2OBYA 4O5OA 4NBWA 4OMUA 2JKVA 5TS3A 2Q46A 4CMHA 4PLHA 2B69A 3AOEA 1OMOA 4CM1A 4E5KA 1H6BA 4CMGA 2BFMA 2ZYDA 4CM8A 2UVDA 1XQ1A 5T8KA 4CLXA 3F5SA 3H65A 4KUGA 4O0LA 1IULA 1Y1PA 1OC4A 3E03A 3GVPA 3X2FA 2Q1TA 3H7AA 4WCDA 2JCVA 1A71A 1NASA 1YONA 2V6FA 1PWXA 4BV9A 5IAAA 5AXAA 5JDIC 1DEHA 3COSA 3MJEA 3CXRA 5IG2A 3ABIA 4ZICA 4KQXA 1H2HA 1M76A 3BHMA 3DBVO 4BV8A 1W0CA 4EJ6A 3ADPA 4C4OA 4IXWA 3PGXA 3SEFA 4YEDA 2Y1OA 3EAGA 2VN8A 4IDFA 2OP0A 1EVIA 5L7YA 1IE3A 3A28A 2GO1A 2ZKLA 5B12A 2GN4A 2RH4A 1EQUA 2J5QA 5IDXA 3GN2A 4B7XA 5AYVA 2PFGA 4NNJA 1ENPA 4LGVA 2Q1SA 4ND3A 3G1UA 4BMVA 3AWDA 3FRJA 2P4HX 5CG1A 1QR6A 4IJUA 9LDTA 4L76A 4R16A 3GEGA 4LCJA 3ITDA 8LDHA 1XGKA 2D8AA 4YJFB 2B5VA 3DMTC 3VTZA 2P4QA 1PR3A 3GGOA 3N74A 4WEQA 1F0YA 1P74A 4I8XA 1DHRA 3DTYA 1NHGA 4WECA 1MA0A 4WLUA 4IDBA 5DBIA 2OBNA 5L51A 3G3EA 4YDRA 4LCEA 3LF2A 3LC1O 3HN2A 3RSHA 5JNLA 4U6SA 1ZBQA 4Y9DA 3SJUA 2FPGA 2GERA 4PZDA 4JROA 2DTDA 5JC1A 1EBUA 2O7SA 1ISJA 1ZJYA 1IPFA 3RU7A 3IJPA 3D3WB 1Y8QB 3H9QA 3LK7A 4HBGA 4NFSA 1ZXLA 3RUEA 1ONOA 4KDEA 4R9SA 4WCFA 3FTPA 3ZV5A 4D46A 1XU9A 1KVQA 1PGOA 2YV1A 4OKNA 3WYBA 1DOHA 1FK8A 2HK8A 2VYVD 3MJCA 1I3KA 1KOLA 5BNTA 2IODA 3LT0A 4DMLA 5C7LO 4EUEA 2VTDA 1ONNA 2POQX 2WDZA 3NAQA 4XQCA 1NNUA 4JX8A 1E0DA 4PG5A 5KJ6A 4W4TA 2ET6A 4KWIA 1T1RA 3PWKA 4JIGA 3UOGA 4DMMA 4JJIA 4M55A 4IY1A 4YRAA 2OMEA 3SXPA 4CLRB 5EPOA 5MDHA 3C7DB 3H9EO 3HE3A 4IDCA 3BA1A 2BLLA 4EI2A 4YAGA 2JFGA 5TF4A 5C7OO 2WYVA 5ENVA 2CF5A 4YCAA 3OA2A 3QWBA 5I9MA 2WMDA 4J2HA 2EHDA 4RVSA 3H9UA 1PGNA 1OZAA 5K6AA 4E21A 1WAMA 4KTTE 3DXFA 1K3TA 2W98A 1E7RA 3GNTA 4D3FA 2O4CA 2LDXA
chains in the Genus database with same CATH superfamily
3UZUA 2HLNA 4QL3A 2I6FA 2ORVA 4PNPA 2PUHA 2BFBA 3Q7TA 4MCJA 2B37A 4NZ9A 3F6CA 2ZW9A 2J3JA 3RH0A 5TRTA 4IG9A 3UAVA 2AFIB 1AHNA 1QH0A 1DT5A 1JE1A 1L5SA 3JQ6A 3L4BC 2V74B 3GLGA 3BD8A 4J4BA 2FSPA 2DH6A 3HU3A 1I2BA 2WJ4A 4YACA 3RQIA 2UAGA 5CU7A 5C80A 3IIMA 2E4ZA 4JODA 4IL5A 4BQOA 1E1RD 2NUTA 4FYMA 4LNHA 4BAGA 4C43A 2PRKA 1VL8A 2Q7OE 5FB3A 2HGZA 4GKKB 1T4GA 2WHYA 2RH5A 4EA7A 4B3CA 1ENYA 1N2IA 4HWTA 2OFPA 4KE8A 4NQRA 5DHTA 3OM1A 4Q4CA 3RSLA 5KTSA 3IVMA 2N46A 2QZ4A 4R40A 5AW7A 4G0PA 4BUJA 3SQXA 1Y4DE 2Q2OA 5K3OA 4A27A 5E1MA 1HZJA 1KI9A 5BR7A 1XHLA 2YOHA 1G6HA 3FDXA 1OTXA 3M5WA 3PDIB 4KAXA 4RLSA 1NAHA 1TUIA 4IUCS 4YS6A 3TQHA 4EPYA 2PWAA 2R8BA 3COZA 3WKDA 1A97A 4IDGA 3FYSA 3RS2A 3LGXA 1PT5A 1O6CA 1MH1A 3N3AC 1P1KA 1I8TA 4FK8A 1MAUA 2YINC 5EIHA 2O0JA 1F20A 3NC4A 4GOJA 2EG5A 2P5UA 2X4LA 1FTWA 1Z33A 2X8JB 3K8OE 5I01A 2DZDA 4L6AA 1ACJA 1NQOA 4LE1A 3Q85A 3PK0A 2H17A 1HLPA 4RA6B 2Q6LA 2B8NA 5GIOE 3ZCXA 1MO4A 3E3AA 4FEYA 5JAIA 4QFMA 4FI3F 1NBHA 1IOLA 1XSEA 1Z29A 4MYCA 2V0GA 4WK4B 3T3DA 2WAOA 1SC6A 3FMIA 3MLAA 4H1TA 4EF6A 3BH0A 3KYCA 3NM5A 3NTRA 1UZUA 1M0EA 1EYZA 1AKVA 1CFJA 2I03A 1PT9A 1E6EA 5JAPA 2AV6A 2GF2A 3FJYA 3H4MA 1DO0A 1F6WA 3NC1C 1C3OA 1G5HA 2GJ9A 2NT4A 1RWPA 2ZFUA 4JYMA 3AFHA 4P0TA 4EJFA 3BB1A 3LQYA 3ZZ0A 3FWPA 4BLWA 2EZ4A 1KXJA 2P3LA 3LDFA 4EMBA 1Z2NX 2H16A 4GM0A 4MS4B 1RXIA 3S99A 4CKEB 5CD1A 1M8JA 1Q0ZA 3HXPA 4MWTA 1N92A 9LDBA 4C0LA 3STHA 1HTTA 1USWA 3D7NA 4N3NA 5LUAA 4F3TA 1LZKA 4MUYA 5HEKA 1DTSA 3HR4A 4B6QA 1Z15A 6Q21A 1M74A 2COUA 3BXEA 1GIAA 4YJGB 3CO0S 3PUVA 1OI4A 2OO3A 4H3HB 2XA2A 2QLJA 1VYHA 2P5SA 3FSGD 2P62A 3NO4A 1E6WA 2QW0X 4P3PA 3SOPA 4K9QA 1YVEI 1U94A 3NALA 2V5VA 1NXWA 3B13B 3IP1A 3N2KB 1QV7A 4Z53A 1Z0KA 4ZCPA 1CUUA 2GM5A 2L69A 4J7CA 1L5LA 3CKYA 1NVKA 4OK6A 4ZA2A 1I1HA 2JLUA 2TRSB 1N6NA 3NHUA 1FC0A 2A0KA 3SU8A 4QQ8A 4BJ6A 1DMRA 3GL9A 3I2KA 4HZUA 4CCSA 1OILA 2EQBA 3R74A 3WYGA 1L5HB 2A1TS 2V4ZA 1CDEA 3N6VA 5FOWA 3ROFA 4UJ3A 5E95A 2WFLA 2WPDA 3LCUA 4FHFA 1BGVA 4ALKA 3AR5A 3I58A 1SHJA 1C4OA 3T0IA 2G1KA 4NXMB 3MLEA 2P0AA 1EFPA 3KTAB 3DAFA 1RD4A 3VR1A 3LQFA 1H2EA 4EAAA 5LZ5A 1L1FA 3WGQA 1G8AA 3K96A 1R0KA 1CUFA 3FA2A 3SD7A 2HA2A 1RZVA 1PUIA 2FWNA 4ZP1A 1HDOA 2EDAA 4OMDA 3H6GA 1LDYA 1SURA 2Q4DA 2VDKB 2YMLA 2O7VA 3HSSA 4W63A 4BKRA 5AQ1A 1OFTA 1X7ZB 1W0JA 2BM1A 1C9NA 3H17A 1ZBDA 1S2OA 3WIOA 2ASVA 3DWGA 1CLUA 2PWPA 2QI9C 2XW6A 4AMVA 3ZDDA 4BVJA 1PLKA 1A2OA 1J70A 1TCAA 1XP8A 1K92A 1R8XA 1SHZA 4CTNA 2BFDB 5HF5A 5TQJA 4OP2A 3T1NA 2OP1A 4BN0A 5CB4F 3HP4A 4YREA 4OM7A 1YR9A 1FVOA 3AU9A 3VR4D 4BX3A 4YRIA 3N58A 2VP5A 4F97A 4X61A 1FMFA 2QPOA 2A4KA 2BGMA 1VHJA 4HDKB 3KRTA 1YA6A 3TOCA 3EXHA 4LWQA 1F7UA 1E3QA 2NO4A 4Q93A 3U40A 1I7PA 3KTDA 3GFRA 1H9BA 1CU1A 1UBFA 1XZAA 4PZAA 2WTNA 2UZ3A 3S4YA 4EG3A 4ZJZA 1GEGA 1W88A 2ZB3A 5TARA 4AJJA 2JANA 5EUCA 3I5XA 3O8DA 4XARA 1JQKA 2ZQ5A 3TL2A 4BEJA 1Q1ZA 1NURA 2QNRA 5I8WA 1PRYA 1P4JA 3M1AA 3WK9A 1RLIA 2PUWA 2OYRA 1TVKB 3QG5A 4TMFA 1T0JB 2AUTA 3HJBA 3DW1X 3JQQA 4EPVA 1XRNA 5I48A 3FHCB 4JUBA 1PR4A 2ERYA 4J75A 1R0RE 3GAFA 4U2CA 3ASUA 2O5EA 3JASB 3BDVA 3VNSA 4AB1A 3I34X 3KP1A 4URUR 3GGPA 4HDMA 3DBRA 1NVXQ 1BRTA 3OOSA 4AO7A 1NRXA 4G4SO 4IXMA 4HDSB 5HUQA 3TSCA 3EDQA 7REQA 2PS3A 4L8GA 1NJ2A 4RH3A 4HFRA 2PJDA 2FQQA 1BFDA 2HD4A 3MS2A 2IXBA 1LDMA 2X5XA 2VNIA 4RKEA 1PQYA 4Z99A 1ZM2A 2HJWA 3G2HA 4ZANA 1PEAA 1UK6A 2X7XA 4IQ0A 2DQYA 2YVKA 5BQFA 1DBQA 3IKJA 3GJ6A 3KYDA 4N8EA 4JASB 1SK9A 2R9VA 1Z7GA 1UANA 2WK1A 3A3YA 4YASA 3O47A 4MUJA 4D4JA 3BSYA 2O20A 2VT2A 3OZSA 1G5FA 2NT3A 4MVJD 1N7IA 2AOTB 4XOIA 1L4EA 3TSWA 4B4WA 4IIUA 1VRWA 1ODFA 4M7RA 4R7GA 3I4LA 5L3VA 2Y92A 2CUNA 5KHOC 4WWHA 5JNVA 4NMMA 1BMTA 4W1SA 2OXTA 1J0AA 3U7GA 1A8PA 3ZYCA 5L7WA 3EXEA 1XTBA 3QBTA 1EM8A 3YASA 4UPVA 5HS4A 3T94A 1Q0TA 1SN7A 2GN8A 2J4DA 3IVRA 5H81A 1PCXA 1ABBA 3FTEA 1PTJA 3FYTA 5IX8A 4CI9A 3JRNA 2AJ8A 1E2EA 4F91B 1TRHA 5L3ZA 4QGHA 3CCFA 4TYNA 2BYTA 5BR4A 4XTCS 2TS1A 4L95C 3K4HA 5BV8A 4LZAA 1TK2A 2BSAA 2Y93A 3O1JC 1ISMA 1R4NB 3FOWA 4CIVA 3JQ7A 2GDJA 1PJSA 4TL8A 2D1QA 3GBSA 3T3OA 1XRQA 1YB1A 2JIZA 4CT0A 4TYYA 1UBMS 2YC2C 1MG5A 1QJ4A 5KAMA 3M33A 3TNYA 2OHGA 2V5AA 3TOVA 5BVHB 2NWQA 5HRCA 1H1TA 1GZUA 1NMZA 2D5CA 4GF5A 4R71A 1JT9A 3OUUA 1IXRC 1NA5A 4ERNA 4RGVA 4FJ1A 4FFLA 5ALKA 1KVRA 2Q1WA 2K5UA 4WNIA 2X4GA 3K2BA 4P5PA 3NR2A 2ZU6A 1MQSA 4RW0A 4NE2A 2FHSA 4E30A 3L6EA 4RZ2A 4M1EA 4POAA 3OAAA 2QX6A 4J1NA 2A9OA 3EZNA 2BAGA 3MWFA 2RH9B 2HO5A 1SHKA 2HBYA 2HM7A 3AJ8A 4KXVA 1NBME 2RGEA 3QFFA 4LZNA 1MX3A 2EKQA 1NONA 2FUG1 2PU5A 3FCSB 3W2HA 5GVSA 2ZM5A 4MYDA 1FTYA 2Q4RA 1MIOA 1ST3A 2GQ0A 2O0KA 2PGAA 4Q00A 4JOBA 3S2ZA 3T3MB 4PHGA 4KFCA 1ZMXA 3D64A 2UYGA 3A26A 4J0KA 4DUPA 4FM9A 2WHPA 2ZPTX 5SYAA 1VE5A 3NH6A 1E1YA 1CUJA 4CKCA 2GJSA 2CJFA 1Q91A 2Q27A 4Q3BA 3UQZA 2HK7A 4D8TA 1P9LA 3MUEA 1NKVA 1MP0A 3AESB 3A9RA 1K27A 1B76A 1NX6A 2IHJA 2OHOA 3PQ4A 1T1EA 5C0OE 4RTLA 1Z2OX 3PZRA 1O1YA 1EDEA 3DFIA 2P8SA 3MJFA 1I4DD 3O1HB 4JUDX 4C01A 1M34E 3W2IA 3C1AA 3ROMA 2YHBA 5F98A 3WGMA 3R20A 1ULHA 3LUHA 1B6SA 3BGIA 1J0XO 2YWBA 3RIGA 3USCS 5LA6B 2IWHA 3LLMA 2YV3A 4NYMQ 3CLRC 4M7PA 2A3NA 3MT7A 4FSXA 3V3TA 4C7BA 1Q0SA 4J03A 5BOVA 3W5BA 3KYIB 3T3NA 1MH9A 3CLSC 3EIFA 4Y9SA 3ES9A 4ZAFA 1M2JA 2HXYA 1W4BA 2Q8PA 1GV0A 1JXQA 3C15C 4HLUA 4LN1A 3HB4X 1CUCA 2RH8A 3UFBA 3U9SA 2GZDA 2H29A 4GOLD 5DHSA 3Q87B 3C4VA 3WHLA 1Z7YA 2JB9A 3BXOA 4NBNA 1CJCA 5GP1A 1O0SA 5FLXA 4R54A 1OTHA 4EHFA 5ADVA 3QRWA 4KYIB 1UEXC 3WZLA 2IELA 3R7WA 3JQAD 2ZBRA 4MVJG 4TM8A 5JCPA 2P5YA 5BV7A 5JBIA 3OEHD 2Z6AA 2HMYB 3U4QA 3JALA 1Q0RA 1BWSA 1O77A 2DPHA 1KJJA 2FXIA 3EJ6A 1GSOA 3A3OA 4IQGA 4QO8A 5ESXA 4C14A 2HNKA 1EE9A 4A6EA 5J2TB 4FNGA 3S2UA 3N28A 4E2WA 2IHTA 1XJ5A 2GZAA 2QMOA 4D3SA 1QMPA 1H05A 3DD1A 4ARZA 3BCUA 3GA0A 3FCUB 4W6ZA 1UEIA 1WJGA 4P9NA 3VU0A 2PH3A 4L7VA 3CNEA 2OL4A 2DBQA 2XI4A 3LF1A 2VPXA 4H6PA 4MQBA 5T5QA 1SY7A 2AF3C 3T1TA 4QOJA 2SCUA 3DYIA 4DB4A 5ITWA 3E22A 2O6HA 1W87A 3JQAB 1F06A 3I0NA 4P7JA 3H0KA 4BNLA 1S3SA 4JH0A 1ETUA 3ZK9A 1JFTA 2BDUA 4LIPD 4QBHA 4EAQA 4F46A 2QM0A 2OPBA 4ZOEA 1NI4A 2GF0A 3MT8A 4JJ7A 5C1PA 3U56A 1NBAA 4MA0A 2JD0A 1NI5A 1PJ2A 4RSMA 1YZFA 3M4YA 1K98A 3O92A 3T41A 4A8JB 1RAFA 2CBZA 3V9AA 2JFQA 3JQ8B 4LRTB 2IP2A 1Q3HA 2ZRGA 2LPMA 1EK6A 2TECE 3JYLA 3L05A 4REQA 4ZOLB 3RAPR 5CBPA 5EE3A 2FMTA 4CF4A 1W2GA 2WSYB 3AH8A 2QP4A 4LXTA 5BV1A 4YJFA 2V45A 1N2XA 4YR7A 4UU7A 3ONNA 1G21B 1NN1A 3GVHA 2AHOA 3HBJA 3KZMA 5LC1A 3SR4A 4QOHA 2DFTA 1X13A 4OGKA 3T7AA 2P9JA 2LNDA 5EQTA 3STXA 3WLNA 5I9SA 3ETJA 1E69A 4BRUA 3OLCX 1M8KA 1UKZA 5FKJA 4C0WA 4YUWA 3GJ8A 1Z0ZA 1L7NA 2L17A 2QPTA 3AKCA 1AF7A 3ZBQA 1P5RA 3E82A 8ABPA 1E9DA 3EGWA 2V7GA 1H2BA 3QWAA 1KFKB 3O4HA 4UUOA 1W2WB 4N6GA 5AJUA 5IC6A 3VHXB 1X1SA 3H18A 4RMJA 5E1BA 1RRVA 1T4DA 16PKA 5FNZA 1H2FA 2IYTA 4P3XA 2V6JA 3WIUA 2JVIA 2D6FA 1RXCA 1P7WA 2IEYA 4HQNA 5AI0A 3MCZA 5FEUA 1CNFA 4KPUB 5AI5A 1YC2A 4BJ3A 2QUHA 4WACA 4E5MA 3S44A 2PTGA 1OXBB 3GAAA 3WSWA 5H82A 5LP6F 4INJA 1QYCA 5M04A 3S1AA 1I2CA 2V97A 3WBJA 4DDKA 4DPKA 2GAFA 2J3KA 2J45A 2PRSA 5GIPE 4QNMA 1QIJA 3F8SA 2WI8A 2ZXFA 3D8HA 4FDVA 4LNUB 7YASA 1LPNA 1R9JA 1X19A 3D2AA 4M1OA 2FPSA 3I2FA 3EFEA 4FMDB 1TYAE 5JS1A 4Z7JA 4Y1RA 2WICA 1Z62A 1KY5A 2JAQA 1HDIA 5IKPA 2EERA 2CJXA 4RL4A 3W78A 3TRIA 1GKIA 3SM3A 4EO9A 3C14C 1KGDA 1KVUA 4JJKA 3I5AA 3U1BA 4BP8A 1V4NA 3ZY6A 2ODTX 1V95A 4KHPB 1MCZA 1HE5A 3VUEA 3DZDA 2YWEA 1BH6A 2ZRDA 2YIVX 4MP8A 3TLBA 4C0JA 5HXAA 3ESAA 2HHJA 4FMBB 4V0MA 1EWQA 4DR7B 3HKDA 1ND5A 3GJRA 3MWEB 3NFRA 4UUBA 3CF0A 5BNWA 1Q7BA 3HJHA 4KMMA 2O48X 3T54A 2WLSA 5FTWA 1D07A 2YJ6A 4MUXA 1J8FA 2QORA 4AG6A 5LQKA 1QCDA 1D6JA 2GGSA 4TRMA 3WB2A 1KO1A 4DR1B 2WA1A 1VKJA 3LT4A 1J2JA 4IVPA 4OQNA 1TQ4A 4RDIA 4G85A 5D3MA 1O6FA 3D3KA 4L74A 3O2QB 5JI3E 3E1KA 4ILEA 1JA9A 3RFFA 1E89A 1G0NA 2I9KA 3IR6A 3REQB 1QF9A 3A32A 2HRZA 1GG5A 1V71A 1P0FA 4MYTA 3ZHOA 4G5OA 2IYUA 4H59A 4GNKA 4M87A 2QT1A 2I67A 5F2OA 2P35A 3FTFA 3DBHA 3I2GA 1XVAA 3KJQA 5FBVB 2BBOA 4N4AA 1MBZA 1KFEB 1XLTA 4YUYA 5CDTA 3M9WA 1ZHOA 5IT9A 1A4RA 1U5BB 2G76A 521PA 5IZ4A 3F49S 2PGIA 3AUXA 1NOKA 1JN0A 1PZFA 4ZVUA 3L7LA 1VBMA 3GPBA 2JH8A 2WYUA 3N05A 4KBFA 4UBOA 2C5FA 4RPKA 1KZ6A 2IYYA 2QZJA 2YV4A 4OAQA 1P1HA 2HF2A 2BZGA 3ZGXA 5BOSA 2OCYC 1J07A 2TYSB 2VJAA 1Z4MA 5HFJA 3BEOA 5DULA 3N70A 4TOIA 1GGHA 2V1UA 4A0SA 2I3BA 5CNKA 3ONVA 4GIBA 1VL0A 1RXEA 1LVUA 2YMQA 1NU8A 3C3DA 3CZCA 5AUQA 3LLVA 1HE4A 1KI8A 1P7YA 2QQ5A 4BNGA 3Q8MA 1OXKB 2G1UA 3WLAA 5EIBC 3EW7A 3D8UA 1QHHB 1UBLS 2GJ8A 2YWJA 3LYAA 5K45A 2IKQA 2V65A 3IURA 1J0BA 1OLSB 1RHKA 2OAP1 2DKNA 2FX2A 4LYFA 1OKKD 3GJXC 3I9LA 4PS1A 4D8VA 4YRJA 3ANMA 2MSEB 3RDPA 3S2GA 5B58T 4B32A 1B26A 1BG6A 2WVAA 5BN4A 3DL7A 1A50B 1BN7A 1XD2B 2WF8A 2WSIA 2DG2A 3Q12A 5JAQA 2W48A 2C29D 3FDIA 4BIIA 3PE3A 1E92A 1YFZA 2G77B 4NPHA 4DCNA 2OHVA 3RT7A 4KCGA 1T2DA 4NONA 2HBQA 4ZRMA 3F1KA 1IM2A 3GV0A 4JCOA 3B89A 1JEQA 2ZDGA 3OQPA 1PJZA 2ILVA 4N12A 1RIFA 1QS0B 4CQMB 2E87A 1L7EA 1BCSA 1RHMA 5ALPA 4ZGWA 5FWXB 5K8VA 5FBRB 1II0A 6LDHA 4UASA 3RE1A 2RGWA 2WIFA 4KQEA 4OB8A 3HB9A 1T9AA 4ZI7F 2Q9UA 1TPZA 1Z26A 3CR8A 1QR2A 3H42B 5DGIA 1TK9A 2H2DA 1JHQA 3AHHA 4I3GA 3INNA 5DLEA 3TVYA 1JQ5A 1R4AA 2OOKA 3T5TA 1DJNA 4E2XA 1VE9A 4PZ9A 4IGKA 3ZCTA 4P6VF 2B21A 1EAMA 2W5UA 1DADA 2HLPA 1TZMA 1NBMD 4ZKEA 2SBTA 4D0NA 5EZYB 5F5LA 5H1YA 3NT4A 1Q16A 2QN7A 1ZA2A 4GOOD 4BQNA 1BDMA 3H8JA 1CWUA 1QVZA 3CX7A 1FJ2A 2WG1A 3I6MA 3MJVA 1NN3A 2XUKA 2GMWA 3P8ZA 2JL1A 4RYDA 4Q12A 3H4VA 2Y0CA 4RV5A 5HFNA 1UZMA 4JBHA 2YZKA 4LFCB 2PEZA 5C31A 4H1UA 1EVKA 4NU5A 4WLFA 3H9JA 2PMCA 5I9BA 3WTCA 1D2AA 2VK8A 3GRUA 1UK7A 1OWOA 4HGRA 4MIKA 3OZWA 1VLMA 1RABA 1I32A 1SBTA 3MGBA 1LFAA 3MXOA 2RG7A 2GTIA 3Q7EA 3QNUA 4UCXA 4D8XA 5I47A 1GNSA 2UUAB 3D1VA 4M0DA 1MRSA 4I6EA 4H1HA 3A3PA 2W71A 4PGHA 2BKEA 3U7QA 3L1KA 2R751 2D74A 4LYJA 3KSBC 4G9EA 1SBCA 1CBUA 3H87A 4E2ZA 1NM5C 1WUHS 3BILA 3G5TA 3M2PA 4PVCA 3B38A 1WP9A 1IN6A 4HAUA 4PC6A 1VE1A 4ZK6A 4IX1A 1U4OA 3TPFA 5LYJF 4O33A 2CGEA 2EJBA 5KOJB 3ANYB 1IUOA 5HCUA 2IUEA 4D4MA 4R5MA 1ZRNA 1R0CA 3TOZA 1ZNZA 3QH4A 3QEJA 4BWGA 4J0FA 3EBPA 4MUEA 3RS8A 1FMCA 2XCRB 1NATA 1NP7A 4C2TA 1XTTA 2PXXA 3MJRA 4DG5A 4MP6A 4WLOA 4AZ3A 2QVLA 5FA6A 2R6HA 3H9BA 1JHAA 3AO0B 3IVGA 1Z4LA 1ISHA 3GLKA 1CK4A 4JLNA 5HG0A 5I9TA 3TKYA 1NZDA 3UUFA 2NZVG 4CUKA 1OH5A 5K9ZA 5FNVB 3SQLA 4LVOA 1VIDA 3Q8WA 4OHKA 1LBTA 3D2LA 1TB4A 2JBAA 1E6CA 4UHDA 1WCYA 5A02A 3NYQA 1MJHA 2JI4A 4MVCA 3B3AA 4R1MA 2NTYC 3HL0A 5KZMB 3W79A 3PJEA 3DDOA 3OZDA 1M2KA 1ZUNB 3WL3A 4MWSA 1U0SY 2X9VA 1XDDA 3B7GA 3T9DA 5DGXA 4JNCA 3RSGA 3L46A 3AF1A 2JGKA 2ZYHA 5BMVA 2QQEA 4QXQA 4DC0A 5F52A 1V35A 3K6SB 4MH0R 2PT6A 2N42A 4LRXA 3UICA 4YXWD 4GPZA 3BCHA 2Q6IA 2VEDA 4H6VA 4B81A 4DMCA 3BGSA 3P2EA 1ZC4A 2WKWA 3F97A 5FLEX 4OQQA 1FRFS 1FW6A 2JFYA 4RTRA 1DKUA 1A95A 1PR0A 1MUUA 4LI3X 1G5PA 1IXZA 1PG0A 2I3DA 2JLAA 4WA8A 3VJRA 4AT1A 4AS2A 5TEWA 1GJRA 2XJ9A 3ZDZB 5HDQA 5E6SB 2QUJA 2IX3A 2FQYA 3K0FA 2CEKA 4I55F 3ENVA 4QU8A 5EGSA 4RH1A 5P8WA 1GUYA 2HWYA 4HADA 2EEZA 1FDIA 2I0FA 2I54A 4XWTA 5G1PA 4A92A 2EFHB 4DARA 1CQZA 2XRFA 5AOAA 4OHOA 4D6YA 3KSRA 4WOCA 5LXTA 1Q1GA 5IAJA 3RUDA 5G0UA 1H3EA 4GM4A 5EHIA 1M3SA 1JVNA 1QIEA 2CL0X 2QGFA 5HRUA 5KU7A 1J20A 2I7XA 1U9YA 3BTOA 3L0BA 3FDJA 4TSFA 4M0PA 5HMLA 2WD7B 3OT1A 1M6HA 4A4DA 4IGFA 4MAMA 3EX7C 1AXGA 1WE2A 4UBIA 1E2IA 1DIHA 1PX2A 1RMYA 5AUNB 3Q3IA 1QORA 2VTKA 2ERXA 3RKSA 1TOAA 2H57A 2FEKA 2OY0A 3KSZO 3TQRA 3LDUA 1XQXA 4NATA 3GI1A 3RSZA 2CVQA 2ACWA 3A2LA 4K03A 4XGNA 1M72A 3BWVA 4HWSA 5KKAA 1XZDA 1XEWY 2CVFA 3CN7A 1ZO8A 3OCYA 3VJKA 4UHCA 3BXZA 4LRYA 3ZPXA 1F17A 1T36B 2F1RA 2RC6A 2V7BA 3NATA 3HVIA 3QVOA 2JA2A 1J2EA 3H04A 3WL7A 4YYEA 4DLBA 4BP9A 4GOMD 4GRAA 2D2EA 4F9FA 1SVLA 3BHIA 3HJAA 4RIIA 3DWFA 4TMXA 3KOOA 4CM9D 2SICE 1N5OX 1O9GA 3NGLA 2E6KA 2O1SA 3ZWOA 2A5JA 4R1UA 1EWVA 4RGQA 5DWVA 2G71A 1B1CA 3OI7A 4KVAA 1UF9A 2VP3A 3PF9A 3VTAA 1F12A 4RF2A 5ECWA 3GFOA 2JI6A 3ND9A 2HBZA 1FLAA 3RBXA 3TTYA 3WRWA 1U8AA 3SHQA 2OCGA 3F46A 2OVFA 4JA2A 4PZ0A 1X7XB 2O54A 1C9JA 3H13A 3OT5A 4MB0A 3TBHA 4LMPA 3LA6A 4B8YA 5J4LA 2Q2VA 3TG2A 2G9RA 4F92B 1JHDA 2PT7A 3RUFA 3R6TA 4ZDIA 2QL6A 3AL3A 2FHPA 1FX0A 1NULA 3LRPA 4HX2A 4BBJA 3PX7A 4KIUA 1PHRA 3O3MB 3AVPA 1XCMA 5HGXA 3SR3A 3NHSA 5ER6A 1EX6A 3RIXA 3WLEA 1XZGA 3DDSA 3PLAE 1UBHS 3HU1A 2VYFA 1MOPA 3JQGA 5T67A 3K7EA 2BMFA 3FVTA 1ZGAA 3LM8A 1XB2A 1UT6A 5JCXA 2GSDA 4P7KA 3W5JA 4QUIA 3G0IA 2ZPUA 5J23A 4V2UA 1T4MA 3QJYA 3OIDA 4INOA 2F8TA 2WB2A 2CLSA 4I1VA 2PUAA 4MTLA 4U0JA 1RLUA 5CA0F 4YA6A 5KVCA 3SKXA 1T4CA 5IJWA 4QUBA 4BMZA 3SS7X 1CNEA 3L8DA 4DTIA 3CZMA 4HC4A 1F38A 3ZHRA 1QRRA 2J3HA 3MNFA 1K06A 3M6AA 5F64A 1WXGA 1NBEA 5FULA 4C1NA 4D26A 4UM9D 4CF5A 2A57A 5FTNA 4UTRA 1WWKA 2IDKA 2GAAA 3T3PB 1JP7A 4TPKA 2O3SA 4ZI5A 3VVLA 1T6NA 3DPSA 4MLZA 3DDNA 3CVXA 3VZDA 4DC1A 4OXQA 3X44A 2BKVA 3ZH2A 1MFPA 3VPHA 4I08A 4OYRA 3TLZA 1IZYA 1W48A 2X5JO 2NQ8A 3ETLA 3MILA 3ONFA 3PQDA 3VYWA 4UE6A 2WY2D 3VKGA 2I6UA 4ZVSA 3BKWA 3Q5DA 4FVTA 4MKHA 3ZQJA 3RVPA 4NMXB 4NYIR 4J6FA 5LCXA 4CGYA 4DLZA 1JR2A 1U7DA 3HXKA 2OUKA 4WCVA 3VNRA 3LMKA 4GL2A 3H2KA 4Q82A 1KGSA 3ZTYA 4DYVA 2CNDA 2IS1A 3TCNA 1QX3A 2ZUWA 4AJOA 5B6PA 3P9SA 1XZIA 5JCJD 1YB4A 3V6MA 4YJ2B 4DSZA 2D7DA 1EFVB 1KMHB 1C8BA 1GP2A 2C9MA 1K6EA 1GNQA 2JJ8A 3EVTA 2XLCA 1ZU5A 1RWKA 2CHGA 3CFYA 1WCV1 2GBPA 4YJKA 3OKCA 4GWLA 3T7IA 4C4SA 6REQA 1WMBA 2VHVA 4IUDS 3GELA 4DNPA 4BNKA 3QHAA 4I36A 3RAJA 3HXOA 3H75A 4DGQA 2PZAA 1E9BA 4DSOA 4JWKA 2VPQA 4K26A 3TNDA 2NZUG 3GR6A 4XEUA 4AX8A 3O0TA 4BNXA 3WWZA 1LVHA 3A6FA 3VISA 5A3QA 1R1DA 3ASZA 2JBWA 1R0WA 1NR1A 1Q7CA 3KEQA 1TCVA 2HF7A 2X8LA 3HHPA 3GT3A 3O4GA 4XX0B 5EJ9A 2FTKE 2ODBA 3GNSA 4URYR 1C81A 1C29B 4PO3X 1FMJA 2CLDX 1ML3A 2PH7A 1WMDA 1XKQA 4UHHA 1PNQA 3L82B 1BIFA 2XYGA 3NB0A 5AH0A 3OFND 3ZU2A 4AD8A 3DLPX 1QOQB 5I5EA 2QD1A 3J81A 2UXDB 4QG7A 2PQ0A 4IIGA 5JPIA 2E3JA 2H1VA 3AONB 3K16A 4Q39A 1E99A 2NVOA 1EG7A 3P52A 4DQKA 3NLLA 3A9CA 4S1VA 3GGJA 1NJ5A 4D9FA 3FNFA 2CLOB 2XMZA 2F9LA 1NBWB 1ZIPA 2ICAA 4A6DA 5JT1A 4IH9A 1N8KA 2I2WA 4KN8A 4EG8A 1WB6A 4IXDA 1C14A 3BMCB 3HO1A 1JG6A 2B8JA 1V2GA 2WD8A 2YDYA 3OP1A 4L57A 2VJPA 4L9SA 3ZWXA 5LP6A 1Y7PA 4GVXA 4GXQA 1CRWG 5CM2Z 2XVYA 2G6BA 2ZTMA 3NDJA 4ANFA 4M9ZA 1BJKA 1E9AA 1H2XA 4AIRA 1CE8A 2QX7A 1XHFA 2XAUA 1DS6A 3AZPA 4QFBA 1V8BA 1G60A 2PZBA 1T34A 2Z8ZA 4FNMA 2GS9A 5A5FA 3F73A 2EX0A 4KO2S 2YN2A 4UHFA 2P9QA 4KIFA 5ARDA 4G36A 2WTEA 1TMKA 1V16A 4LPSA 2NU6B 4PS0A 3DDZX 1ZC3A 3WICA 2FWJA 3EJWA 3CNNA 3KUCA 1USVA 4QHYA 4W6QA 3FHTA 2AC2A 1N0IA 3GLUA 3ICQB 4YCLA 1MAVA 1WMSA 4N47A 3PNMA 4NE9A 3KJEA 1UP4A 5IHPA 1BX0A 1ZR2A 4F2HA 3V4RA 2G1AA 4IDQA 2FZ5A 4TMKA 1PLJA 4PR0A 1WDWB 5K0BA 2DTXA 4CF3A 1AZTA 2W2LD 3QY9A 5L45A 2Y4OA 2AMVA 4NR0A 4NK5A 4DANA 2O06A 4EFLA 3C16C 3DV0B 2BJHA 4O08A 3WRYC 3C7KA 4B6OA 1MT0A 1JBKA 4EEKA 2C5HA 2JIQA 3IHWA 4RD4A 2KSQA 1QNFA 1DKMA 2CHEA 2PGOA 4BVEA 1XN4A 5A9RA 1JMVA 1NWCA 1C7JA 2X3FA 1J2UA 1G18A 2Q5EA 1RQ2A 2XZTA 1BSVA 3D0KA 4GZLA 5C37A 5ELXA 2BMAA 3TBFA 3HM9A 4R1LA 2Z3VA 2ZSDA 3BMOA 4NIMA 3EW9A 2ZYRA 1QFJA 3A27A 4ZO7A 5FLKA 1GYQA 1YF3A 4Q4DA 4XVRA 3BD6A 1KQ3A 3R8FA 4PRKA 3EA5A 2FN4A 4LOJA 4S3MA 2P6UA 3MRXA 4LMRA 5JH7F 1IBCA 5ICSA 3PG5A 3SFTA 3NHKA 4D97A 3KKMA 1T2VA 4FFDA 1BZYA 1Z82A 1GKLA 1XNJA 1QQ6A 4FW8A 1N78A 4KQIA 1K66A 3RTDA 1T1GA 3EFHA 4WAUA 4YDSA 5CXSA 1FVXA 2XBMA 1T5OA 1QZTA 2AOWA 1F2UA 2O2HA 4D6XA 3CT4A 3NWBA 5T7BA 2XCSB 3O0DA 2P6OA 1ZK2A 4DRZA 1NY6A 3PRHA 4JXZA 2GPTA 2Q0HA 4TS9A 5C1BA 4XFJA 1DJQA 2W43A 2FCAA 1QDUA 3FIJA 4DIEA 3Q1KA 4BNDA 1XT6A 1YBMA 2AVDA 4N0QA 3WLFA 3ZDYB 1WHTB 2OD2A 1HT2E 1K5GA 2VG8A 3F7NA 5DBOA 4Y2XA 4ESOA 3IKVA 2KS6A 1KBZA 1RBQA 1TJ5A 3R3XA 7ABPA 1Y4SA 3CLTD 3IP7A 4TL7A 1YR7A 4MRMA 5F73A 4ENSA 1TRKA 1POWA 3DF9A 4BBAA 4C6TB 2XOKA 4EYGA 3BZUA 3QE3A 4ZVTA 4ZFNA 3K4QA 3ORQA 5L53A 4P2BA 4FOPA 2L2QA 1P62B 3S3TA 3HR7A 4DRYA 2F8SA 2XTJA 1Z73A 1PFGA 3IDFA 4MQEA 2RAPA 3WC4A 5CD9A 1UDAA 5BSMA 3ZBTA 3MCWA 1J00A 1S89A 3CUWA 2VSYA 3HBNA 1VJDA 2XRMA 2P9BA 2VRWA 4MQUA 1AXEA 1AUVA 2JLQA 3EF1A 3WNZA 1SH7A 5KNCA 4GO1A 2RC5A 5K3CA 3W6OA 5JROA 1SZJG 1X1AA 4BFYA 4X20A 3THYB 2C3OA 2B0CA 4UOEA 4NFLA 1BNCA 1E9EA 3P9KA 4GKJB 1TKRA 1OZ0A 2WJIA 4P08A 3LW7A 4PSCA 2PMEA 1AK2A 1P6UA 1WCXA 4CG1A 4QPJC 5CT4A 4GGMX 1QRDA 4ACAA 3UATA 1G0OA 1P7ZA 5EJGA 4ZI7A 1VMAA 2QE6A 2XYQA 1PL8A 2WIKA 1TA4A 3C24A 3OY7A 4CKWA 2IH4A 3D31A 1F8UA 4GVLA 2QIPA 3SJAA 2YUTA 4BFSA 5C34B 3AERB 4EP1A 1BOOA 2Q2NA 3IQWA 1KRXA 1QZXA 1UJMA 3ZHCA 3UK2A 3F4LA 4FXOA 1OXSC 3CO5A 4BMDA 4N39A 3CUEF 4YQFA 5AVUA 4NX2A 1FS6A 1KP9A 2NYUA 1VHQA 4HRXA 3RVBA 3T5BA 3F5DA 3EVFA 4ZRDA 2NZJA 1B8NA 5JARA 1QV9A 1AD2A 5KOHB 1QSGA 3PPIA 4UVEA 4XWAA 1D04A 2YHIA 2WUEA 2GKSA 2IHNA 5FUQA 4DQUA 2BGWA 1WZCA 3DONA 2NP7A 4UEWA 4JKOA 2F3QA 2FRXA 4E13A 4EY6A 1JR6A 5AHWA 3IOBA 2XCIA 4IDDA 2PUTA 2NVWA 1CJVC 1B0AA 3EH2A 4L22A 5I8PA 2FAXA 4C7KA 1YZYA 4L0MA 3KJGA 3W2TA 3GJYA 3NVMB 2DHQA 4P4NA 1RYHA 2YJ3A 5EKDA 2O8DA 3KQWA 3FWZA 4C3ZA 5K6RA 1DBIA 3FY4A 3HPRA 2YDXA 3G02A 1CY4A 5MGBA 1ZPDA 1NVEA 1ODLA 2BCJQ 4YONB 1BU5A 3R40A 4X7RA 5LBTA 2FPWA 5B5SA 1OI7A 4M54A 2V4MA 3RVJA 1WZUA 4Z2AA 4S2EA 5LYJA 3QX9A 1Z34A 4D9NA 2C54A 2WM2A 4OH7A 2B98A 4UM8B 4B8ZA 1HEUA 4LJYA 2EKLA 2QMEA 3COVA 3G8YA 1WKCA 1KJWA 4E15A 5K99A 1TZJA 1VG9B 4WDQA 3PDJA 3T9FA 1FUEA 3F8TA 2J3EA 2J48A 4LTNA 4MAFA 3B3QA 5KSWB 2PX8A 2XUIA 3ICPA 4GOKA 1OHHD 2G8NA 1DB3A 1Z37A 1SG9A 1HRKA 2P9FA 2R48A 1A9YA 3FPCA 4GR4A 4LGMA 3IMGA 1E5VA 3LGAA 4HUQA 5IDVA 2ZTHA 4EPWA 1TDJA 4BCDA 1PJQA 4PCVA 2IYPA 5H9VA 2O8BB 2I34A 2FPIB 1Z07A 1N1DA 1ZY2A 3VKUA 3ZWQA 4E4YA 3OEEA 4M1ZA 4RVGA 3REOA 1TEVA 1HT0A 2R65A 3IBSA 3N0XA 1M1ZA 4MVJI 4G9GA 2WHXA 4R3UC 4UDNA 4J0DA 3V48A 5ALOA 5CDUA 2VDPB 2WTUA 3C3YA 2ZB2A 5C2JB 2C5GA 4X00A 2ZYAA 2JIPA 3KKKA 4MEJA 2V58A 3LBFA 3DZIA 5CDYA 3GZJA 1E8MA 4C4PA 3WVNA 2QZZA 4YRRA 1E2BA 1JAHA 4DLKA 4HF7A 3SX2A 1WQ4A 3H1EA 2XQFA 2IXDA 4KKXB 4R2XA 3ETNA 3KFXA 4RK5A 3ER8A 1RC8A 1CUBA 3DR5A 3IHTA 2CHFA 2OAQ1 4Y18A 1YQTA 3LIPA 4DIUA 1CIPA 1XQYA 2J32A 1RWVA 1UXHA 2WUFA 3EOAI 3MUOA 4NH4A 3RIYA 4DJJA 3UJPA 4BB6A 3KQNA 4YRTA 2YN4A 2Q3FA 4GH5A 4YT8A 4RTMA 1VJTA 1M2WA 4V3BA 3O4IA 2J6BA 1MB2A 1K6JA 5ESWA 3TZ6A 1ADBA 2E55A 2EKDA 4FLFA 1W94A 4EKYA 3QEOA 1TE2A 4FTWA 4PGFA 2IZ6A 4JEUA 1QGED 3I64A 4I55A 1SQ0A 1W5FA 3NBQA 1N5RA 2PMWB 3HM2A 3N39C 1EUDB 2FFJA 1BAPA 1TF5A 4F6LA 5IEJA 1AKNA 2QN3A 3EH1A 2GFQA 2CCKA 2W6ZA 2PMKA 4UCFA 3OJEA 4R1QA 4MP3A 4MV3A 1BS9A 3B9QA 3H5WA 2JFNA 2GM9A 4TKUA 4BECA 4ROTA 2X1HA 1R66A 3HZOA 4P34A 1IWBB 4U9HS 2DOKA 1PK9A 4M9RA 1KAMA 4Q9KA 1SWVA 3EWAA 3BWXA 4RK0A 5K2MA 2QSYA 1P60A 1M2NA 1QIGA 2JHGA 2ZUUA 4QYXA 5DM0A 3NBKA 3KLBA 1XXHA 5CLHA 4EMUA 4I50F 1MKYA 2J5XA 3ADCA 2X22A 4BKOA 1KSFX 2G4LA 4DR3B 1RM3A 2G0AA 2IT1A 1ZCZA 5J2UA 1JVSA 3ZGZA 4ITUA 4R2KA 2VO1A 1DAMA 2AXEA 2IHUA 4BKQA 1XA4A 4O8CA 5A04A 3EUAA 2GN1A 1PE0A 2ARKA 4N65A 4OMCA 4RVUA 1T3TA 3ICWA 1J8MF 4E11A 4S1OA 2IITA 3D5EA 2VQFB 1O95C 2GFIA 4G0MA 2C7RA 5IK2A 4DE5A 4WQMA 2QVGA 2ZBVA 2XUOA 5A71A 3K1JA 4E08A 1KFCB 1TEHA 1ML4A 3S5JA 2NP6A 1RPJA 4ATNA 4QDKA 1QHNA 1EFAA 2DJIA 4BO8A 3OE1A 2FPRA 2G17A 5CNMA 2SKEA 2VZLA 3VAYA 1XWWA 1KMQA 1V8OA 4FBMA 1DC5A 1QV6A 3ZKWA 1SQGA 1TFRA 1OV4A 3UMFA 3LVQE 3VSCA 1C7EA 5J3JA 1FSPA 3RVOA 3STUA 2OO7A 3K05A 3Q11A 3QV2A 1J0CA 2D0OB 4N40A 1RAEA 2PTHA 2PL5A 4JJFA 3QPBA 4ON9A 1Y7IA 2XMCA 1J97A 3DYBA 4ARBA 4YYZA 4MW5A 3NWPA