4OBEA

Crystal structure of gdp-bound human kras
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
169
structure length
169
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
publication title In situ selectivity profiling and crystal structure of SML-8-73-1, an active site inhibitor of oncogenic K-Ras G12C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 62
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2014-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4obeA00
4HAXA 3RRZA 4MDFA 3KJIA 3TVTA 5JSZB 2FGKA 4FCVA 2WMNB 5GJBA 2IK8A 4MKIA 3SYKA 1AS0A 1G9XA 2B92A 4PPFA 2OE2A 1WF3A 3PG5A 4CW7A 2WBLC 1YZTA 4WZAE 2Q9CA 5KSPA 3IO3A 1JR3E 3QPVA 5AJZA 4R98A 2ZRKA 1JJ7A 4O2RA 4PC2A 1AGPA 1RYHA 4ZIRA 4BQSA 5EE5B 1R0XA 3GJ8A 1Q20A 2EFGA 4PZYA 4P32A 2ODBA 3KTAB 4US2R 4A36A 4ZDKA 2W2XA 4Q9HA 4AK9A 2F1HA 4R71A 3WMEA 4POAA 1GG2A 1MR3F 4KFUA 4W5WA 1QZXA 1T3SA 3KKQA 2P65A 4I4LA 4QGAA 4EDHA 5SZJA 4BLOA 4HDCA 2GEDA 2OBNA 4BECA 2PX3A 2O8BA 2QE7A 2IXGA 3KXKA 2RGAA 3THWB 5CB8A 1JXMA 3G0HA 1SVIA 1HQYE 3N70A 1NL3A 1KZ7B 3QQ5A 2KB0A 4FINA 3VKGA 2OFOA 2JASA 1GOTA 4E03A 1E1QA 4YXWA 4FXPA 2DFNA 1G16A 2ZETA 5A0FA 3UANA 1SKQA 1NN1A 1R0YA 3QKRA 2YKGA 2AFIE 4ZCLA 3AB3A 3FWYA 3QVUA 1U0JA 4PO9A 4HUQA 2XZLA 2JIZA 2B8WA 3O8DA 5DN6A 1JPNA 5ANRB 2V7QA 1N6PA 3VKHA 3WYGA 1CJKC 1XTSA 5DE3A 3NC0C 1OV4A 1C1YA 3OF5A 1YRAA 1JQLB 1G7SA 2QRZA 2XX3A 3VR6A 4LV6A 1A82A 1C4OA 1LVGA 1QVRA 2ZSAA 1P4SA 3C15C 1ZP6A 2IHBA 5DISB 3WP1B 4B6EA 4DSNA 4PZZA 2BV3A 4PX9A 4B32A 4HLQB 3AVQA 3RANA 1JALA 5EP4A 1BH2A 1CRPA 2R6FA 3OAAA 4D26A 1M34E 4IHQA 2AN9A 4GMXA 3RDPA 1XF9A 4AC9A 4D2IA 5G3YA 1XWIA 3QE0A 4WXPA 4ZPXA 2WM9B 1R5BA 1S1MA 3L0OA 4LHYA 2O8CA 4YXWD 4G5RA 3DZ8A 4GI7A 4F4CA 3BH6A 4NCKA 1EG7A 2WAYA 4EFMA 1KI1A 1P5ZB 4TQAA 3A4LA 5DN6D 2AL7A 3ZJYA 5GVRA 3KQUA 1T8TA 3KXIA 5DI9A 4D0LB 1D5CA 2P2LA 4J0QA 4CGZA 4ZKDA 2OXRA 1E9BA 5BW8A 1OIWA 1UEJA 1NBMA 2EVWX 3GP8A 1PZNA 2XB4A 1IN5A 4GT1A 1HYQA 1W0JA 4JLJA 3GEIA 1KNXA 4KSBA 4V03A 4DDUA 4RCZA 4XIGS 4L15A 4CT5A 2HF9A 1OXUA 3QEOA 3THXA 2WPDA 4C7OA 1SKYE 2D62A 3OAAD 4PQRA 2G77B 4Q7KA 1E0JA 4TTPA 1LV7A 4AKHA 3EIQA 1KJYA 4JKIA 2HUPA 1JBKA 2AKYA 4DDTA 3IIKA 3CWQA 2HJVA 1JEDA 1ZM4A 1T5LA 3AVTA 2F7SA 3W90A 4QNMA 3UKDA 1XXHE 2EFCB 2EWWA 3ZYCA 3JZMA 4NYMQ 1EFUA 5FTMA 1G18A 2ORVA 2WJHA 3LX5A 5FOWA 2GRJA 5G53C 2V8OA 1NJGA 2DWOA 8OHMA 3PVSA 3KX2A 3NIBA 2AD1A 2CMKA 4C3ZA 5H8WA 1KI4A 1RE0A 4LZZA 2ZI9A 4DBLC 2ZUDA 4UJ3A 4AYWA 2VH5R 1ZM2A 2OUKA 4EPWA 2REBA 2QT1A 3TE6A 5E7IA 1VYUA 2ATXA 1VKJA 3BE4A 3CUEF 1KK1A 4AKEA 4IEEA 4A0RA 4GSYA 5JS8A 4AIIA 1BYUA 2QP3A 1P2UA 3CRMA 4QXAA 2AR7A 5KSOA 3LAWA 2G0TA 4OQNA 4MKHA 1CP2A 3MWKA 3GJ3A 1S2MA 4IDNA 1S96A 1A4RA 5DYGA 5CM9C 1UM8A 2BBWA 4C2UA 2PT5A 1OT3A 4HAZA 1CRQA 1LNZA 1K5DA 2GK6A 1DAIA 2MSCB 4DEYA 3L43A 5KDLA 3TSWA 3B9QA 1HA3A 2VHUA 4IEIA 4BFSA 1ZU4A 5HZKA 3HP1A 3N2IA 1Z2AA 1IXRC 4LPSA 4RFVA 1MKYA 1QHNA 2DY1A 1RRGA 1FX0A 4U02A 1UBEA 2DYKA 4M4SA 4MRNA 4OQMA 3IILA 1COWA 3KKPA 1T9HA 1XU4A 3AF3A 4YMWA 3F0TA 5AK0A 5FL7D 1P9WA 2FG5A 2RB4A 4ON9A 5KTYA 5FBLB 1LW7A 2CL7X 2J5XA 2WWGA 2AD5A 3RHFA 4LOAA 1E9FA 1M7BA 4A6XA 2WWHA 1NLZA 4UJ5A 3KZ1E 3W8NA 2Q0HA 4C0AC 5DSZA 4TSFD 3UK6A 1FPMA 2JDID 1QG2A 1ZRHA 3DM9B 2IYLD 2HYIC 4NE2A 1YVDA 3K8YA 3VX3A 1ZD8A 4DUGA 3CR7A 1SHKA 2J1LA 5EP1A 5H1YA 3QG5A 3KKMA 1K5GA 3NVAA 3RS4A 2RMKA 2O8FA 4BFVA 2WIBA 4BFYA 1K6MA 2UKDA 1T3LA 4B3XA 1TF2A 2ZYTX 3CH4B 4P4SA 1NVVQ 3CX8A 2GJKA 2JJ8A 2VP2A 2J7PA 4Z1MA 4OL0A 4TL8A 1G291 4C0LA 1TMKA 1KIMA 4KFRA 1U2RA 2V55B 2QMUA 1NI3A 1UBGA 1Z2CA 3DDCA 3KJEA 4LJAA 2UZIR 2VF8A 3ADDA 3BFKA 2X2EA 1KDTA 1AQUA 3T06B 2JLRA 2NQ2C 3I1FA 4IFBA 3MFYA 3MWJA 2VP5A 3EZ2A 2BM1A 1G8GA 1P2VA 3AP3A 4GOKA 4UNNA 1UKVY 2ZAMA 4YDHB 2WJGA 1GRNA 1UEIA 3WP0A 3UPUA 3I72A 3FKQA 4HZUA 3EPHA 3NBYC 2J87A 3DKPA 1ZIOA 1KSGA 1GIAA 1N3BA 5JJLA 4LYAA 4A4DA 4JLDA 5BN4A 2GZDA 3D7MA 4ZCIA 3GJXC 1TEXA 1LF0A 3GLGA 5L3VA 5M04A 4TTRA 5BN3A 3QBTA 2FZ4A 1E2NA 1LFDB 4URVR 3GQBA 2RGDA 2BCJQ 4B48A 2J7PD 2VL7A 3ASZA 4HAUA 3AKEA 1AK2A 4BRUA 4DDWA 1GL7A 3T1QA 1E9SA 2D06A 2RGCA 5FTKA 2DB3A 4LJ4A 3L8ZA 4DIEA 4XD7A 2BHRA 5E7MA 1N2CE 3AV0B 1WP9A 5FI1B 4YC7A 4NH0A 5D3QA 3U7FB 1G6OA 5JCZA 1GUAA 1H65A 5FPKA 2ZRHA 3VR1A 1VCNA 3IIJA 3QEJA 3U3KA 1CLUA 3ASYA 2CK3A 2QZ4A 3C7KA 3Q8XB 3IPYA 1VG0B 1P6XA 2H8KA 2NPIA 2ZJ8A 5CYOA 1GFIA 4Y0VA 3TBKA 2V4ZA 3WNDA 2J9RA 3SE0A 5E4FA 1P9NA 3QPUA 2QGNA 3SDZA 2HCJB 4XH9B 2BM0A 2XSZA 1N0WA 1N6IA 1QHHB 5DH9A 1XPOA 1VG1A 1IN4A 2H5EA 2OESA 1ESMA 1W49A 1XEFA 2DPXA 2R44A 4I1VA 4V0ME 3T1OA 1HUQA 5AUNB 4CEJB 3RWOA 2OFXA 3SJCA 4Q9IA 4RVCA 3I73A 1Q1ZA 2AHOA 2ZXUA 3NEYA 1NMXA 3ZVMA 3OEEA 1G4AE 5KSYA 2FE4A 2ZJ5A 3U6BA 4XWKA 2Q3FA 1DS6A 2XB2A 1KI2A 3KQNA 3F5FA 1N6OA 2GVZC 1GITA 4PAOA 2W6IA 2ZITA 1E2IA 3UWOA 2ONJA 2IL1A 2RCNA 1EFHA 2CNWA 1KY2A 2WMOB 2QEQA 2WWFA 3KDSE 3LFUA 1NVUQ 5J4KA 1E2MA 2XNDA 1WRBA 1XD2A 2P5SA 1CF4A 4KLNA 3X1WA 3VNUA 4WZBE 4HAYA 2GAAA 2RKOA 3PEWA 2PLRA 3KFXA 4Y0AA 1F60A 3T12A 3KQHA 3W6PA 3CPEA 4QJ5A 4PHHA 1E69A 5AJXA 3O8CA 1S3GA 3PENA 4DWJA 2XSZD 3BJIC 3K0FA 1NG1A 3OIYA 1GNPA 1E0SA 3QNUA 4B3DA 2B6HA 1AGRA 4JBXA 3B85A 5KOYA 3UATA 2RGEA 3AP2A 4V0OA 1OFTA 1Z6XA 2WSSA 3LO5A 4GP6A 4FD2A 3OEED 4D80A 2ZRCA 721PA 3CF0A 3TGPA 4G5OA 3S1AB 3T35A 3WBJA 1KI6A 2IUTA 2MSDB 4DXAA 4BWYA 1KSFX 1JNYA 3ADBA 5K8LA 2A7QA 2HCBA 4DLUA 4JL5A 1EWRA 4URZR 6Q21A 1NBME 3U44A 3NBZC 4TT3A 2HYDA 2YV5A 1CULC 2YC2C 2JLXA 3U61B 4ERNA 5CK5A 2VP0A 2XNDD 1Z28A 4KI0A 4LRWA 2GCOB 2WOOA 1Z0AA 4G0NA 1KDOA 4OQLA 4A2QA 2IA5A 5FUVA 3RVBA 1NN0A 1KYIA 1KSHA 2W0SA 4LHXA 1J8YF 3L82B 4CVNA 3GCGA 5LPNA 3TMKA 4I1OA 3AKDA 3MGCA 3FKSA 4IOMA 4XVUA 1RC8A 3EWAA 5IHPA 3DHWC 4DCSA 2QROA 1C9KA 1M8PA 1TPZA 3KB2A 1ZM7A 4GOXA 3SR0A 1MOZA 1D8TA 1UBCA 3D3QA 3A6PC 2GXQA 2ATVA 4TL6A 1X1RA 3B7GA 3SEAA 3ZZ0A 4ZCMA 1E99A 2QMHA 4XWOA 2BVNA 3P27A 2IYZA 5JFGA 1G19A 4EPRA 4DB4A 1LTQA 4C2TA 4L16A 1KK2A 4D4KA 4JLPA 2NO7A 3W6OA 1VCIA 2X77A 1H8HA 1GAJA 3FHCB 5J4LA 4TT3D 5EE0A 4JVMA 5KNBA 4LCBA 1U81A 2BCGY 4TYPA 5CIWA 3RS2A 1ZAKA 4BLPA 2IYXA 3B1ZA 3B2EA 3BRWD 5HPYB 1E0AA 5CLLA 5CM8B 4JSTA 2NZ8A 2DBYA 2WKRA 3CPJB 4HAWA 4KCGA 4RFSB 5GJWC 4D82A 5JSZA 1E98A 1OH5A 4LI0A 2ZYWX 1XP8A 2HV8A 3ETLA 2IUUA 3VNVA 4TZ6A 5HR5A 4OHVA 3NBFA 1RFLA 2V9PA 4CRWB 1TUIA 4RSGA 2EWVA 3REGA 1KO8A 2RHMA 5FPYA 4IRUB 1S9DA 2QTVB 4FI3C 5TY0A 3DMNA 1OXSC 3JVUA 1P7CA 5BN5A 5TXGA 3U3RA 2J3EA 4KHZA 4DKXA 4IDPA 2YOGA 4EFNA 1MH1A 1G21E 2TMKA 4PHGA 4MKGA 1Z6AA 4UXIA 4QNRA 4D0GA 5CK4A 1E6CA 3SJZA 2SHKA 1AN0A 2C2HA 5TVKA 4QGFA 2DCUA 4M21A 1E94E 3P4YA 4KYIB 3I5XA 1IY1A 3W8RA 2XZOA 4A15A 4TLAA 2GXSA 1EX6A 4EQ6B 1AA9A 2CXXA 3K70D 1N0VC 3U3MA 5EXXA 2G0NA 4EFLA 2AWNA 2IC5A 1IONA 4DZZA 4IVPA 1FUUA 4NCHA 2WJJA 4KXFB 1FUKA 3CPHA 3NWJA 3SBDA 2WTUA 3KFVA 1X8LA 1GM5A 4Z54A 3LV8A 3TUJC 2GJ8A 2C5LA 2Q6TA 4M1MA 4W9MC 4PZLA 1OFHA 4ILEA 4BZQA 3HPRA 3K70C 2E1RA 4A8JB 2G9NA 4N1AA 2ZR9A 3EASA 1M1YE 3P1JA 5JECA 3VHLB 3U3JA 2BBSA 2C98A 1SZPA 1DBSA 5TMPA 2J0QA 1Q3TA 4WVFA 1NMZA 2IYSA 1RRPA 1E0KA 4LV5B 3GFTA 1WB9A 2I4IA 3EAQA 2HXYA 4TN1A 1CU1A 5FL3A 3CNLA 2L0XA 1GL9B 4LJYA 3RS7A 4DIDA 2HXSA 1XJQA 1NG9A 5EXTA 2HDNB 5J4YA 4C0HA 1M7HA 2VIIA 3EW9A 5AWFC 2C9YA 1GKIA 5F3WB 3IHLA 1BOFA 1XBTA 1FQJA 4NCJA 1NJFA 2NTYC 1NVWQ 1WXQA 3KQLA 4O25A 3AF0A 3EIEA 2VBCA 4NTZA 3ICQB 1VDZA 4PC6A 3PUWA 1XDBA 1F5NA 1ZD9A 4S35A 2A5GA 2OCAA 1KTVA 2ZE6A 3IO5A 3PITA 4NBSA 4WZ6A 4YMSA 3GLHB 3NBXX 2PCLA 4GNKA 4B35A 4F4IA 2IYWA 1HY3A 1SGWA 2IYQA 3X1YA 2ZRDA 3BK7A 2FFBA 2VA8A 3GLGE 1VIAA 2X8AA 2GEUA 1D2EA 2VP9A 3KUDA 1Z29A 1CJVC 2J7KA 4M1TA 2A3RA 3O8BA 2YOHA 4Q1CA 4RD4A 3KUCA 3QXCA 2D2EA 1Z63A 2QORA 2JCSA 1ZCBA 2QPOA 3NDBB 1DAHA 2Z4RA 4QFMA 2OSBA 3TR5A 2ZRAA 2VSOA 1OKKD 2D2FA 2ZSFA 1TUEA 1SVMA 2F3TA 4TTQA 5DI3B 4GPTA 2J41A 3PEUA 1JEEA 4XSHA 2ZI4A 1E1RA 4NYJR 4RCYA 1XNJA 4F91B 4CEIB 121PA 4M2LA 1CTQA 4M9ZA 3W34A 4OJKA 2ORIA 3SQXA 4X8HA 2J0UA 1E9AA 2P5TB 3OESA 1P62B 4MRSA 4M8NE 4E09A 4TYWA 3UWKA 3K0CA 3WRYC 1YE8A 1EWQA 1NMYA 4RD0A 4BEJA 5AUOB 3CF2A 1FZQA 1FMLA 2NG1A 1E2JA 4Q1EA 1SKYB 4H9GA 3AF1A 3CNOA 2PZFA 3JZAA 2BMFA 4NONA 4RD1A 1HQCA 1NNEA 3K70B 1I4DD 5LDDC 4LGMA 2XOKA 2ZAOA 3RYTC 4HDQB 4B2LA 2D3WA 3VR5A 2P0EA 3DOEA 4US1R 4HSEA 2C04A 2WV9A 4M22A 2JJ1A 1W5TA 3HYRA 4C9BA 3RSOA 1WBBA 2REOA 3C5HA 5D3MA 4DCUA 1ZVQA 2QBYB 4ZDWA 1XXHB 1UFQA 4LV8B 4G5QA 2R6DA 3GFOA 4DT1A 4GOJA 4XJXA 3W6NA 4QBIA 3U60B 1SVWA 2A5DA 2OEPA 3IHWA 3NHBA 5GJVC 1G6HA 4Q4AA 3G5UA 5G41A 5DHFA 1DO2A 2QQ0A 3AUYA 4AURA 2CHQA 4JYBA 1OB5A 3IBYA 2GBLA 1DVRA 1L4YA 3GEEA 1MABB 3A1WA 4R9UC 3OIUA 1F3OA 3L8YA 4WW0A 2WWYA 3K9NA 2VTKA 2UZ3A 1W4BA 3U7HB 2OBMA 1ODFA 3R8FA 2WKPA 2F43B 1XCPA 4B3FX 5KPJA 3EPKA 3T1TA 1DELA 1N6KA 3THYB 4L5BA 3OIWA 1Q22A 2PL3A 4Q9LA 3GLFE 1KMQA 1PLKA 3B13B 1Q1BA 2QT0A 4DLTA 3HPQA 2FV8A 4PPGA 1IN7A 4E5UA 2QE7D 4OJQA 4QBGB 4QHSA 4ESVA 2O5VA 1JI0A 1UJ2A 1N5LA 3BS4A 3EZFA 4M1SA 1II8B 3PQCA 1HEIA 1GTVA 5J4VA 2QAGA 1E1QD 2O8EB 1XJCA 2FEOA 2WZQA 3T15A 2GCPA 2BEJA 3AKCA 1XFAA 3LLMA 5J4HA 1ANKA 1SXJA 5EE1A 4B34A 4E07A 2IEYA 3AVPA 2JIZD 1US8B 2YWHA 4A0HA 2B8TA 4QG7A 1OXVA 1R4AA 2V7QD 1YZKA 4HLCA 3VTKA 1N0UA 2C9CA 3UMSA 4ZI3A 3SHWA 2AKAB 4AY2A 1HV8A 2CHGA 1KZGB 4B33A 3VKWA 2W6JA 3W5JA 5JHHB 1Z0IA 1KAGA 1JB1A 3Q5DA 4M9SA 4EPYA 1S3SA 1FW6A 1A1VA 3OEHA 3CNNA 2D4HA 3QXXA 1FFHA 4MDEA 2FNAA 2N42A 4Q1DA 2FN4A 4HB4A 4V02A 1Q1QA 3Q7PA 4NPHA 2JA1A 3M6AA 3DEFA 2YC4C 4M0LA 1H8EA 4X8LA 2MMGA 2VHCA 1G41A 1GDDA 1Z0JA 3RRYA 4A0GA 1W5SA 1Q3HA 1E2QA 4HB0A 4JJZA 4TMXA 3TAUA 5KU1A 4MRVA 5KYKA 2XXAB 1SXJD 1XMIA 5B58C 1AQYA 2UVQA 2GKSA 2KBEA 4G01B 2C78A 3AGQA 1WCV1 3UIEA 2IXFA 1F2TB 1HE8B 2QAGC 1BO6A 4O0MA 1OYYA 4K8OA 4PANA 4P0TA 1NBMD 2LKDA 2QSZA 3PUZA 4B74A 3K0EA 1CKEA 4RZ2A 2KE5A 4DRZA 2RGBA 1SXJC 2W6JD 2ZIAA 4TMVA 2FX3A 2CVHA 1W0JD 2VHJA 4G3XA 4LPKA 2H18A 3DVLA 2YOFA 1F6BA 3AGPA 4F7WA 5K8UA 2G83A 2GJ9A 2WPDD 2I1QA 3LW8A 4O2LA 4HLDA 4EKDA 4CDGA 3BIFA 3AM1A 4FIDA 3ADKA 1KDRA 3RS5A 5JS7A 4N0DA 5A5GA 2WWWA 4KLZA 3M1IA 4NYIQ 2GESA 2EQBA 2C77A 2ZSEA 3B78A 4C30A 5EJEA 2IXEA 1QF9A 3V00A 1OPXA 2FFQA 2ANCA 1Z83A 1PUIA 3I8XA 5EE9A 1KNQA 5AUQA 4ZIRB 3SYNA 1XX6A 1NLFA 2ERXA 4Q21A 3CIOA 5FOUA 4LC0A 5EQTA 3N2EA 2ZRMA 1ZUNB 4OK5A 3FFBA 1MO6A 4DLVA 3K9LA 4BFUA 4JS0A 1VCMA 3PR1A 1Z06A 2QM8A 2CL6X 2VSXA 3VU9B 2DWPA 1G3MA 2F9MA 5B57C 1VPLA 2WSMA 3FMOB 3D6TB 3FTQA 5FUWA 4QM6A 3U4QB 4PTLA 1AM4D 1D9ZA 1JJVA 1V43A 5JWRA 1RW4A 3Q5EA 2ZU0C 1GKYA 3FMPB 3Q72A 4K81B 821PA 4DLXA 1UDXA 5GADl 3ZD6A 4PSKA 4XTRA 3BAFA 4HUTA 3T5DA 4DLWA 1DAEA 4NCIA 1KHTA 5H70A 3RAPR 4W5HA 1DEKA 2FZLA 4W5JA 2OM2A 1HTWA 1GVNB 1Z08A 2FPMA 3CRW1 4URYR 3Q7QA 4DLRA 4UXHA 3S1AA 1G64A 4U7DA 2NZJA 1LB1B 2O0JA 2YNMA 2K5UA 3WYFA 2GHIA 2FWRA 1R8QA 3QIAA 1G7TA 2IWHA 4BUJA 4U5XA 4LWZA 1S8FA 2AFHE 1I2MA 4IOLA 4PC1A 4WOPA 2QY9A 3GJ7A 4LDJA 5CITA 3L2OB 3X2SA 4A1FA 1KI8A 1VHLA 2FPLA 1PV4A 3QI2A 4AKIA 3LQQA 2PZEA 1ZUHA 3TVDA 3DOFA 1G8PA 1T0JB 1N6LA 1T91A 1COWD 1XJ0A 4NP6A 1P2SA 2B7BA 4YQFA 3GLIA 2VPPA 3WMFA 4KITB 1ESNA 3I5YA 1BS1A 1O87A 4QC2A 1OJLA 1Q0UA 4TMWA 4A6PA 4B44A 1Z5ZA 1II9A 1P75A 4D4MA 2XNSA 2OFWA 1IN8A 5B2ZA 2EW1A 2F3RA 2ODEA 4MYTA 1G3RA 2V3CC 1KKLA 1G7CA 3FHTA 1VCOA 3REFA 2BBOA 4DUGD 4IDHA 3C16C 3KJHA 3FFAA 4IOJA 1E2FA 1FP7A 4M1KA 3LXXA 3K0SA 3SN6A 2BIFA 4ZDJA 4OHZA 1TADA 2WVJA 4ZO4A 2ZPTX 4Q4JB 1G5TA 1UKZA 2OCYC 4X8MA 3SQWA 1TEVA 2EYQA 2O0KA 4D4LA 1YZUA 2OHFA 4Z1MD 4II7A 1NY6A 3EA0A 4W7SA 2ZE8A 3I32A 4NL4H 3THXB 4Z8YA 4EPVA 2GAOA 4OHYA 3B8HA 1CXZA 4D4JA 4TYYA 4JVSB 4RFSA 3E5HA 3CX7A 1TF7A 3B1XA 1NSTA 4HATA 2ZYVX 3KL4A 4LJ6A 3I92A 4B71A 1KY3A 4EJSA 4KFSA 3EXAA 1AS3A 3MMPA 5FPTA 4BEBA 5F9FA 5L3RA 5TARA 1DE0A 1OFIA 2KBFA 4PAMA 4CZ2A 3DZDA 3HU2A 2PX0A 4G1UC 3SYLA 5FBVB 1ZMXA 3GPLA 2RGGA 3AVYA 3ZVRA 1RJ9B 4JLAA 4Q7JB 1G5PA 1KI3A 1W46A 3PXGA 1D9XA 2F1IA 2F9LA 3AKYA 3NEJA 5P21A 4NCNA 1O3YA 1Z22A 1RKBA 3PUYA 1V5WA 4IVQA 5CDFA 3TR0A 2IS2A 1KI7A 1E2LA 2WAXA 4RD6A 3FMFA 4I81A 2REXB 2FH5B 4KODA 4QBFA 2ZRGA 4HEJA 4Z8XA 1WQ1R 3NC1C 3GJ6A 4BFTA 4KVAA 5DIFA 4AYXA 4EQ6A 1N6NA 3K9HA 2Q9BA 3CH5A 3Q9LA 4LJ9A 1XCGB 2ZJ2A 3MUFA 4XD7D 1QVAA 2NO0A 2VO1A 4JZKA 4K46A 4UKDA 1FNNA 5C2JB 1NY5A 2OAQ1 2P6UA 1MO4A 3MD0A 1E32A 4OI4A 4URUR 1TQ2A 3CR8A 2CK3D 1MO5A 1SVSA 1W47A 2CJWA 4NYMR 1Q44A 5KPDA 2EFEB 3QF4A 2ZREA 1S9HA 5J47A 1F2UB 4A8JA 1G3IA 2V1UA 2JLSA 1RZ3A 2QQEA 5SZHB 4HLUA 1KAOA 1IJFA 4YONB 2F6RA 5C4MA 5L3QB 1W1WA 2VSFA 1OH7A 1RRCA 1R10A 4I1UA 2AK3A 4PQYA 1ZNXA 5CJPA 3I62A 3E2IA 1VIYA 1SHZA 3EZ7A 2C8VA 5EE3A 1SXJE 1FX0B 2CL0X 4ACAA 3LD9A 4QOSA 4Q4HA 5EP3A 1Q12A 1GL6A 4XSGA 1KK3A 5JI3E 4LJ5A 2LKCA 4QM7A 4TQ9A 2JEOA 5FR1A 5JBQA 1W36D 4JL8A 2MSEB 5HE9A 2W6ID 4Q03A 3PJRA 2IF0A 2IF2A 2CNWD 4LYHA 3LDAA 2FSFA 4JVLA 5CB6A 3DPUA 4ARZA 5JZVA 1EXMA 4GMDA 5FR2A 3B82A 1P2TA 4ASUA 3BERA 4DVGA 3K0AB 2MMCA 4LBZA 2QA5A 4Q18A 3Q3JB 1W36C 5C46F 1ZM9A 1WMSA 1XTJA 2CCGA 5GJCA 3QSYA 2O8FB 2R8RA 2ZRLA 3GLHA 4D81A 3R9XA 2VP4A 4F92B 3K9GA 3U7GA 3TIFA 2QP9X 1ZU5A 3AVUA 5KDOA 1DG3A 4PPNA 1T0HB 1KMHA 5JHGB 3CB4A 4TYNA 2WSSD 1KK0A 2FMXA 4AG6A 1MO3A 1Q1EA 3BGWA 2OCPA 4X8OA 4Q1FA 4IXMA 3PUVA 2ZI6A 4OKSA 2QPTA 5DYIA 1PLLA 1U98A 3U2QA 4EAQA 1MRSA 1P61B 3R20A 2FFHA 2GXUA 4LHVA 3ZVNA 2F1JA 3EPJA 3O8RA 3EA5A 2ZANA 4LJ8A 4Q66C 1FP6A 2Z6VA 2OO7A 5BQ5A 4RZXA 4C0KA 1U94A 3KB1A 1OHHA 3HDTA 1TX4B 3CZQA 3G82C 4HZUB 5EP2A 5K8IA 3OE7A 5IK2A 1EFRA 1IQPA 2JLYA 5F9HA 1QHYA 5IF9A 2HLDA 1NVVR 4CEIA 3ZD7A 2QM7A 3PEYA 2FU5C 2BOVA 4XWAA 2CBZA 3FKSD 5EXSA 3VR4A 1L4UA 1XTKA 3GLGB 3E1SA 2AX4A 4OHWA 3WNCA 4F4JA 1VG9B 2CEAA 2IYRA 1KO5A 1TF5A 3RRMA 3SC3A 2CCJA 2WIAA 1CR1A 4NU0A 4I99A 3TH5A 3X1ZA 2CLCX 2QSYA 1MV5A 2ZRPA 3U3OA 4Q47A 2ODNA 1A2KC 3V9PA 2OILA 4LY6A 1X1SA 5BYKA 2JGNA 4JLOA 2YVUA 1G4UR 4AG5A 4L9WA 3THOA 1GZSA 1G3QA 2H16A 3ADCA 3KTAA 1DOAA 4MGZR 4FN5A 4Q5IA 3IEVA 3B1VA 1XB2A 1Z07A 4TMKA 1H8HD 5HZHA 5E7JA 1L2TA 5FBQB 2IX3A 4MA4A 1KSJA 2QTHA 3R9WA 3LWNA 2NO1A 2XJ9A 5J5CA 3ZQJA 1RIFA 2QENA 1ZNZA 3LBIA 5EUQB 1EFRD 4C0JA 4N0EA 3AVVA 1XEXB 4NKRA 4TYQA 4UNSA 3THWA 2DWQA 4WIAA 2AXPA 2EYUA 4JL6A 5JMTA 1D2NA 4PR0A 5EZ5A 2CHVA 3DL0A 4FMCF 5JEDA 1BYIA 1OSNA 3LX8A 1DAGA 4JLBA 1W4CA 2Q3MA 3W3AA 2YZ2A 3H86A 1AIPA 4G5GA 3W5IA 3W3ZB 4H1UA 1QHIA 1XPRA 1IY0A 1EK0A 1RRFA 3AH8A 1M74A 2ZJBA 2ZRIA 2C99A 2NOAA 2GJAA 3HYTA 3VR2A 1E79A 3RLFA 2A30A 221PA 3B1YA 3NG1A 3RS3A 2NO6A 4CT4B 2O8DB 4GRAA 4C0BA 4M9XA 1BMFA 3WHKA 3U7EB 2HEIA 5HKKA 3FHOA 2FEMA 4C4PA 1J2JA 1GNRA 3AUXA 2P3SA 5AR1A 5FOTA 3X1XA 2Z5FA 4B2IA 1KKMA 2ZS9A 3KKNA 4A2WA 1OF1A 3TLXA 5B64A 4PXAA 2ZRJA 1VHTA 2DR3A 4HI0E 4KFTA 5IRCD 4B3BA 1T4GA 1ETUA 2Z83A 4HB2A 1KJZA 4DCVA 3MCAA 4JBYA 2ZRFA 4BE7B 3GLIE 2DHRA 3NXSA 2ZI3A 3M4YA 1II8A 2R62A 2WJVA 5DGXA 2ZI5A 2BMDA 3K0FB 2OLJA 1SVKA 4O3MA 3NH9A 2HT6A 1R5NA 2ANBA 3CM0A 3E70C 2JJ2A 2IHYA 3A1SA 3A1TA 3AVWA 4QJ4A 1DAFA 3AQ4A 1US8A 1T3HA 3FYHA 4HB3A 1DO0A 3TUZC 1YR8A 4IJMA 1R2QA 2FOLA 1B0UA 1BMFD 1Z0FA 3LLUA 3TQCA 4YLGA 5JJKA 3NH6A 3SNHA 3ZH9B 5HKKD 2NGRA 1GRQA 3U44B 3GLFB 3T34A 3CRQA 3TNFA 2IS4A 1SULA 2G3YA 4JYCA 3SBEA 2GCNA 3BFXA 4FMCB 2VRWA 2ONKA 4RD2A 3K09A 1BKDR 1CJMA 3JVVA 3QKSB 2BDTA 1VECA 1E2EA 1SVOA 1NLYA 2A5YB 2P6RA 3CRVA 3H0KA 1PVOA 2D7CA 1HT1E 4U00A 1ZJ6A 2O52A 1W7AA 3LBNA 2JJ2D 4ZI2A 1RPZA 4RKEA 2FDCA 4PSAA 1DADA 1E9RA 4KBGA 1W2HA 1ZC4A 4XVQA 1XD8A 5EZ6B 2GILA 1S0UA 1XCMA 3BH0A 2G1KA 1F2TA 4M1WA 4OBEA 5CDFE 1U0HC 3UMFA 4JSYA 3RRNA 3KXLA 1UAAA 2NMVA 2XJ4A 4YDSA 5L8VA 2LWIA 3MG9A 4PFSA 4BRWA 3SU8A 1DG1G 3I4LA 4IFEA 2GZAA 4MH0R 1QDEA 2V54A 4DSTA 3UMRA 4KO8A 2R6CA 4JVNA 3A4MA 1VYVA 4Q9KA 1JAHA 3D31A 4A9AA 3ND8A 4V0NA 3V4FA 3U5ZB 2WICA 2G6BA 1UADA 2ZJZA 1F48A 3BBPA 1P60A 3GMTA 4JT2A 2XZPA 5KHOC 4UXJA 1AZSC 3CRRA 1KJWA 4DLZA 3R7WB 3IPXA 5FOVA 1AKEA 4MRRA 3U6KA 621PA 1II0A 3BFVA 3L0SA 1FNMA 2IYTA 2G1JA 2VEDA 2IWRA 1G7RA 3BB3A 1U90A 1E1RD 3K09C 2WJYA 3P32A 4MQBA 4PC7A 5EUMA 4OI0A 3Q85A 3IQWA 3TW8B 4TQUS 2PJRA 3CZPA 1X3SA 3ZLJA 4AKGA 4UNQA 5ELXA 1YR6A 5FFMA 4PO1A 2GVDC 2ZRNA 1LY1A 1P3JA 1S4QA 2CCKA 3VU9A 2ODWA 1GWNA 1N5JA 1XD9A 2CLDX 2Q3HA 3AF2A 4TLDA 2AWOA 1GRRA 4TMTA 3U4QA 1G20E 3SS8A 2XOKD 4D0NA 1TQ6A 5CLQA 4WAUA 1E9EA 4V0MA 3K0CC 2IS6A 2JJ1D 2YHSA 4PC3A 4URXR 5KNCA 3GFPA 1E2GA 1JAIA 2ZUCA 1N6HA 3UG6A 3TK1A 1J7KA 4BFWA 2ZUBA 2J46A 4TLEA 4V0LA 2JLQA 2QP4A 4PPQA 4TLBA 4QHYA 3HJNA 1VTKA 5HTKA 1IJEA 4OQFA 3TSZA 2ASEA 2CLSA 3GLHE 1D2MA 1Z6YA 3VX4A 2YWEA 4Q00A 4IOKA 4ZKEA 4N3NA 3VHXA 2IW3A 4FMBB 2J0SA 1XZQA 3B5JA 4PHFA 2Z4SA 1CEEA 3H84A 5FPHA 4P31A 3R8CA 2GK7A 1TTTA 4JJKA 4LYJA 3WMGA 2QRNA 3DMDA 4CEHB 4B6FA 2FSIA 3ZGXA 3LA6A 4US0R 4A2PA 2VHTA 4JLKA 4ABYA 2GZHA 2A78A 3PFIA 4GP7A 1G1MA 3CLVA 4LC1A 2GBLC 3KQKA 2VQSA 3B60A 3F8TA 2ZSDA 3VR3A 3EPLA 1ZIPA 2PT7A 4GZMA 5L3SB 3ONWA 1D6JA 2QMEA 4OK3A 1ELOA 5H68A 4MRPA 1SQ5A 2X2FA 5SZKB 3A58B 3LVQE 2A9KA 4WXRA 4Q4JA 1Q57A 4BZXA 1CIPA 4D6PA 2GJSA 2IT1A 1P9RA 3GJ5A 5FPSA 521PA 1P73A 1Q21A 4QGGA 2XTMA 2ZU6A 3QKTA 1PUJA 4ITRC 3PUXA 421PA 4RY2A 1XMJA 4A92A 2GEVA 3SFZA 2ZROA 2OBLA 2QN6A 3RNLA 3LH5A 3MSXA 2P67A 4LSGA 3ZDQA 4QKQA 2ERYA 1IN6A 3C41J 4FWTA 1I2DA 2IYUA 4RD3A 2IUSA 3HU3A 1ZNYA 3RC8A 2DFLA 4L4UA 1OH8A 3OEHD 3VMFA 3GJ4A 1W44A 1T6NA 1TL7C 1Z0KA 3LY5A 4QGHA 3C4JA 1W4AA 1RJ9A 2J59A 1SVLA 2YJTD 4OQXA 1YQTA 2PMKA 4LBYA 4Q1BA 5JJIA 3C5CA 1IY2A 2J0UB 2JAQA 4L8GA 1H8ED 1QHHA 1EX7A 2OAP1 5F2EA 1XTRA 2YINC 5IDVA 2IS1A 3FGNA 2PBRA 5IT5A 1OW3B 4CEJA 3T5GA 5AJYA 4KAXA 3WYAA 4F93B 3VAAA 1JQJC 3FPAA 1U0LA 4KVGA 5C4GB 4Q7MB 2EFHB 3F3YA 2OCBA 2ORWA 4FMDF 3VFDA 3IIMA 3BOSA 1CS4C 1RYFA 3CW2A 5FL7A 5C1BA 3FDIA 1G8HA 4AYTA 4YMTA 5FI0B 2I3BA 4P4TA 4YMUA 5JRJA 3CF6R 3HR7A 2AXNA 2PEZA 3L0IB 2IEZA 1CR0A 5JI2E 4TSFA 3ZQ6A 1UBFA 5TDHA 1UKYA 3OIVA 5DHAA 1Z6TA 2JDIA 1NVXQ 2Z0MA 5D3MB 5LB4A 3LVRE 2O8BB 5BXQC 2GA8A 4DT1B 3W9YA 1F2UA 3IGFA 3ZZTA 4FCWA 4MGKR 5FUYA 1XZPA 2W83A 1QHXA 2R6GA 1EFTA 3H1TA 3TJZA 4LX0A 5L3QA 3MJHA 4BLQA 1OFUX 4DHEA 4Q4AB 1E2KA 3IEUA 3QKRB 1PLJA 2VF7A 3EX7C 1NN5A 1E96A 1ZC3A 4HUQB 1WE2A 4S2EA 4EUNA 4JIMA 1ZBDA 1HE1C 5LB2A 2ZR0A 4OK6A 1LS1A 1N25A 4FCTA 1CJTC 4M9QA 2YWGA 3NKVA 5CJ2A 1AKYA 3OHMA 3B1WA 3ECCA 4F38A 3SFVA 4B75A 4Z51A 3NTUA 1G3UA 1FTSA 1R6BX 2QAJA 3SJAA 3AF4A 1YR9A 3IKJA 3RABA 4B76A 3WHLA 1GP2A 1L7VC 4P4UA 1OIXA 2IBMA 4RZUA 1IAQA 2H17A 4LK2A 4R2IA 3B9PA 4IDQA 2EU8A 3MAAC 5G3ZA 4M1YA 5JWOA 3K0AA 2GCOA 3A36A 4JLNA 3BWDD 3CBQA 4MGIR 3BD9A 3PEVA 2RAPA 4ESHA 3ND9A 1OH6A 1AZTA 1YR7A 1W2GA 2QAGB 1R5OA 3EARA 2O8CB 2W0MA 3SJBA 1FMJA 4P3YA 5AJWA 1EFCA 1SXJB 4DEXA 4FMDB 4BASA 3QENA 3UG7A 2H92A 2IYYA 4GZLA 2ECKA 2DFKB 4DCTA 1Z8FA 4B73A 1OXXK 1Z6GA 2GF9A 3C8UA 5UKDA 5KO2A 2FGJA 1PJRA 3H4MA 3O47A 4JBWA 1LS6A 2PZGA 4LBVA 3LQRA 2JATA 5LD2C 1M7GA 3ZS9A 4Q9JA 1IXSB 1ZNWA 3PV0A 1ZD1A 1ZYUA 1XMSA 2E9SA 4BGDA 2WKQA 1NKSA 4QHTA 3C14C 1NRJB 1IOZA 1BIFA 1OLOA 3HR8A 2OV2A 5DNYB 1G5RA 5AUPB 1DAMA 2EFDB 4C7OB 2CE7A 3EZ6A 1Y63A 2AK2A 2ZR7A 4FW9A 1HH4A 1TAGA 1ZW6A 2QMOA 2X19A 4JT4A 4M1OA 1JR6A 3N5CA 2N1BA 1G8YA 3QOFA 3T61A 3PIRA 2XITA 2BEKA 5K8TA 1NIJA 3RSLA 3QG1A 1DAKA 4EPXA 1KOFA 4MYCA 2FSHA 4QBHA 4PAQA 3HWSA 3IDQA 4URWR 4LBWA 4L9SA 1HT2E 2W2VA 5B30A 1K8RA 1YZNA 3BB1A 2C95A 4DSOA 1YU9A 2BMJA 2W00A 2OXCA 3QKUA 1XEWY 2WOJA 4GBMA 3WXMA 3EG5A 2BJWA 3QPWA 4M53A 1TQ4A 3ZZUA 2BBTA 1YRBA 1M2OB 3GEHA 1KDPA 1E2PA 2GTPA 2R2AA 2YYZA 3DM5A 4OYHA 2WJIA 4Q19A 3T1VA 1GNQA 3GJ0A 2QI9C 2ZJAA 1NKTA 4R2HA 2ZI7A 1M6NA 2VP6A 4DLSA 1E4VA 1CBUA 4Q4LA 1XEXA 1T5IA 4TLCA 5TB5A 4DC9A 4HDOB 3MRSA 1N5KA 1Y3AA 1X6VA 4KBFA 2NIPA 4TMZA 4LYFA 2XTZA 4BLSA 5FTLA 1T8UA 1XEWX 5JEEA 1QHGA 1KO7A 5JWHA 1KI9A 3K53A 1GILA 1QHSA 1JR3A 4I1SA 2BMEA 2W2TA 2C03A 2V1XA 2PCJA 2ZSBA 3J81k 1U8ZA 1XRJA 1I4TD 2VYFA 1ZM3A 4XOIA 4G5SA 1QG4A 3TQFA 1UF9A 3QXHA 2O8DA 3AVXA 2V6JA 4DLYA 1WBDA 2A5FA 1X86B 5C18A 1A5TA 3P4XA 3WBKA 2QGZA 4Q01A 4EJSC 1U8AA 1E9CA 2Z43A 1EESA 2QNRA 3EC2A 2XGJA 2FSGA 2ZVPX 4CF7A 4XVRA 1OXTA 3V4RA 2NPFA 3WNBA 3BH7A 1DPFA 3VQTA 4BFZA 3ICEA 1KO1A 4NYIR 1YZGA 2PLFA 3SOPA 1OE0A 4LHWA 4ACBA 2H57A 2NO9A 2R6AA 2ZE5A 3EZ9A 1P72A 1OYWA 5J40A 3K1JA 3QF7A 2N46A 3LXRA 1CR2A 5KNDA 2XAUA 2CVFA 5LD2B 3ZIAA 2ZTSA 1QRAA 3QBVA 3ZS8A 2J0VA 3BC1A 2GNOA 4RKFA 3FOZA 2GWHA 4AWXA 1VMAA 2FFAA 1U9IA 3PCRB 1DARA 1JR3D 4XTCS 3OZXA 2BJVA 3GD7A 4BLRA 2H1LA 3FB4A 3CKLA 1TU4A 2JLUA 4JLMA 5LBIA 1IBRA 3CO5A 4H1VA 3B6EA 4KU4A 3TKLA 2ZJYA 2Q21A 3KJGA 2ZVQX 4AI6A 1QBKC 2G88A 2HJGA 5BYJA 5EXPA 4B2PA 4DJTA 4IKEA 4NMMA 4P4SB 4NYJQ 4Q1AA 2C96A 3IBGA 3MJRA 3GLFA 1FTNA 1YZQA 2KWIA 2WWIA 3A1VA 3CWZA 2QL6A 4KV9A 3SZRA 3A1UA 2E87A 1ZUIA 1UKEA 4A8JC 3EC1A 1B23P 3OFNA 3GLIB 2VHQA 3MWLA 4DCNA 1E2DA 3I61A 2KSQA 4C0SA 2V6IA 4HLUC 2BKEA 4HYYA 4NDZA 5GVSA 3LW7A 2FPKA 2RGXA 2QU8A 3A8TA 4B43A 4EPTA 3QKSA 3WY9A 1GSIA 3NHAA 3ZIAD 2ZM5A 2R9VA 1W4RA 2KJQA 4JLVA 3IQXA 2O0HA 4UNRA 3TRFA 4A0FA 3AP1A 2GDJA 1E9DA 4ASUD 5DI3A 2PEYA 5KSZA 4R7ZA 4B3CA 3WRXC 1NN3A 1R7RA 1A2BA 1FOEB 1TU3A 4P33A 2J45A 3EIHA 4QJ3A 5JCPA 2ZQ5A 4MITA 1U99A 3M0EA 2X1VA 5FUXA 2B7CA 3IUYA 3QXSA 1WA5A 3EWSA 1U9IC 4KSCA 4TL9A 5HCNA 4V0KA 2BKUA 1E2HA 4QL3A 1AS2A 5A4JA 2C9OA 4MKFA 1MT0A 2B21A 3OFND 5FH9A 5FTJA 4LHZA 5E3HA 1XMVA 2LCFA 3A37A 1U8YA 3HU1A 5CYPA 4ZV4A 1YHNA 4JMPA 2ZEJA 5JLJA 1VYTA 4EJSB 2HF8A 2QTFA 3R7WA 2HT1A 3FVQA 4NHOA 2QUZA 4QRHA 5HE8A 4OI1A 1OHHD 4PSVA 2BC9A 3UXMA 2F55A 4JKYA 3OE7D 5IK2D 2QBYA 1J8MF 4D25A 1XXHA 2GXAA 1VG8A 2VLIA 3QUSA 4MUAA 2HLDD 3KKOA 2BWJA 3FE2A 5FBWB 3TSOA 3MLEA 3ZVLA 2JLWA 2H7VA 3SI7A 2ZS8A 5DO9A 4HAVA 5F98A 3A4NA 1IXZA 3CX6A 2WWXA 4Q48A 5TV2A 2PH1A 3CONA 1X8JA 3L0PA 2XEXA 3BXZA 1GKUB 2R65A 3LNCA 2ZYUX 3DO6A 4B47A 4DSUA 2OLKA 4RZ3A 4PHTA 4GDFA 2RHDA 1N5IA 1MABA 3AEZA 1E3MA 1WDTA 4FWIB 4Q7LA 2OG2A 5BWMA 1Z47A 1W36B 1JXOA 3D8BA 1AJEA 4BPBA 2Q9AA 1XTIA 1YJ5A 2CDNA 1ZCAA 2FJUA 2F43A 2JLVA 4RJLA 4DB2A 4Q02A 1J99A 2Y8EA 4A82A 1R8SA 3RWMB 4BLTA 2KI5A 5FOSA 2RGNA 3THYA 1XPUA 2P6NA 1FQKA 4TL7A 3H2YA 2ZJOA 1XD2B 1G17A 1LF5A 2CJWB 5AJVB 4BZPA 2GETA 4ZDIA 1J90A 2FA9A 1RVDA 3QF4B 1R0ZA 4NZYA 1CR4A 3AVOA 5KUTA 3P26A 5FTNA 3QVVA 2OZEA 5HCIA 1W48A 1NSFA 1NIPA 4GFDA 3TUIC 1X8KA 1J70A 2ZE7A 2O8EA 4BFXA 1MRNA 4OI2A 1IM2A 1XTQA 2JLZA 2A5JA 4YMVA 3I8SA 4CYMA 5CIQA 1E79D 4Q4HB 2PMDA 5FOXA 4C0QC 1E4YA 1EGAA 3QJYA 1KI6B 4DDVA 1JPJA 1S1CA 2CE2X 3DKVA 1YZLA 3I3SR 2ZS7A 1W0KA 4CEHA 4PO8A 4MUBA 1I4LD 2ZRBA 2W58A 1TQDA 1OKKA 3NDPA 5FBRB 4EIWA 1Z3IX 3MWYW 4ARZB 5G40A 3BORA 1FL9A 4KYUA 4E22A 4PQFA 1UDWA 1DTSA 1G8FA 4UQOA 2GF0A 2RH5A 4TZ0A 2A2ZA 2F1RA 4MGYR 3LRPA 1ZINA 3FMIA 5E95A 5L3SA 4B3GA 1OB2A 1YKSA 1UPTA 2I1VB 4MYHA 3QXJA 3BB4A 1CJUC 1NF3A 4IDOA 4CIDA 1A7JA 4HZIA 2FF7A 2IYVA 4UNPA 2OT3B 1KGDA 2RGNC 1TNDA 4IVRA 2QPAA 4WBSA 2XXAA 1KO4A 2XTNA 1KMHB 3X1DA 1R0WA 3P20A 5KDDA 1N6RA 2QG6A 1L8QA 4WA7A 3TAHA 4GL2A 2D7DA 2DFTA 2WHXA 1OIVA 2PJZA 4IW3B 3R9IA 1HURA 1W0KD 2D74A 3RS0A 1Z0DA 4IXNA 4LJ7A 3LBHA 3QY0A 4KJZA 3TW4A 1JECA 5JRZA 1IHUA 2YWFA 5DLQC 4OHXA 4LUCA 4MYUA 1ONBA 4AD8A 4TWZA 3RC3A 3SHFA 1NP6A 5SZIA
chains in the Genus database with same CATH superfamily
2XCOA 3RRZA 3PNKA 2ZUWA 3TVTA 1DOZA 1O7JA 3E6AA 1BROA 4FCVA 3VNQA 3ZV3A 5JSZB 2P90A 1T34A 1VL5A 2IK8A 1ZAYA 2DU8A 3U37A 2AJCA 4LSZA 4YRDA 4BBZA 4QPJC 3ROPA 4F1KA 4PGMA 4HT3B 3FOCA 1JP7A 13PKA 3EVZA 4E15A 4GWLA 3KV3O 4G0QA 1QWSA 2Q9CA 1FLVA 4P3KA 1GG9A 5ESXA 3H6GA 4OG2A 1GTRA 3EXG1 3QPCA 4PO3X 1NPYA 2AN5A 1JR3E 3AJRA 3VNRA 2ZRKA 1M0WA 3QFTA 4O2RA 4PC2A 5EQJB 5KEIA 5BN5B 4LTDA 2Q6KA 3LRXA 1AGPA 2D7JA 1RYHA 1T2VA 1ESDA 3BGSA 3M6FA 4KRGA 1R0XA 3GJ8A 5TQJA 4GM1A 1SWVA 1P1IA 4LNAA 4P32A 4ZCPA 1XK6A 3KTAB 3EC7A 3NWEA 3B5IA 4J75A 3BDVA 1O6FA 5HFAA 3IAS1 1XYVA 3WMEA 4B7XA 4POAA 1MR3F 1QZXA 1T3SA 4X1YA 5SZJA 4HDCA 3AB8A 5B3JC 1E3WB 5K4GA 2RJOA 2FN9A 2CDAA 3L8GA 3KNZA 4O4IA 3ZDXB 1Z4JA 3D3WB 1XQYA 3V4ZA 4FX2A 3G0HA 4WOKA 2HMAA 4GPIB 2Y71A 3BJEA 1NL3A 3VKGA 4W9NC 1CJCA 2C7BA 1GOTA 4L5YA 1E1QA 3HI4A 3VAYA 5C9ZA 4JI5B 2DFNA 3ZQ4A 5IXJA 5A0FA 1TMGE 1K4YA 2B99A 2O5CA 1NN1A 1R74A 2AFIE 3DBLB 2B3TA 3FWYA 3QVUA 3DE6X 2P4QA 3OTGA 1Y9DA 4HUQA 4OUDB 4PO9A 1GFWA 2B8WA 1DX6A 1E8NA 1JPNA 3IELA 4H60A 5DN6A 5CDHA 4W1RA 4M49A 3FOBA 3OVMA 3OLXA 1HSOA 1OXKB 4R8KA 4UVDA 1WTAA 5ANRB 2G6TA 3VKHA 4NJMB 4BLVA 1X87A 2R0QC 3IJPA 3WQQA 2Q27A 2C57A 2ODTX 1TUBB 1U2EA 3OF5A 4AMBA 1YRAA 3W5CA 4DV1B 2OB1A 3DLIA 3HO1A 3D7NA 1I6LA 3EBOA 3BE6A 4H2DA 1U2QA 4LV6A 2AMJA 1QVRA 4JWTA 4PYRA 4RAOA 2ZSAA 5DISB 4P4GA 1QH0A 2YVAA 3LY8A 1KQ3A 1IBLB 5DXFA 1S2DA 3RS8A 1G55A 1QH8A 4E1AA 5HW0A 2I3AA 1CRPA 5AM5A 3L7OA 1TGYA 3PSHA 1P31A 1TLLA 4PBTA 4H7FA 4QEDA 4E7OA 1OGIA 5CXQA 1XF9A 3A3PA 4AC9A 4CF6A 5ALMA 3NI2A 4XIJA 1Z0ZA 3U7QA 1PSWA 4WXPA 4YJGB 4ZPXA 3PIIA 5DWDA 4DEVA 4I9FA 4ZJUA 1JVBA 1R8XA 4G63A 3MGKA 5B3LA 5EERA 4OLFA 2WAYA 1KI1A 1KPHA 3QLJA 5BYBA 1P5ZB 2XA1A 3FPSA 4TQAA 3A4LA 4OU5A 3KQUA 3V8BA 4DR6B 5JNSA 1T8TA 2BKLA 2I87A 1SCKA 1U3CA 4YJFB 4LYYA 3QWIA 5DI9A 4LF9B 2P2LA 1Y6RA 1W6UA 1C0PA 1YR2A 3L5KA 2RAVA 2CUTA 2OXRA 4U6NA 2XYPA 3K1AA 1CJBA 3QX7A 4XYEA 3GZTB 3WLSA 4INOA 2EBHX 2I8AA 3ZCQA 3AEKB 3F3MA 3N75A 1NC1A 1T36B 3OY2A 4JLJA 2X14A 2UVPB 3DKRA 5FHRA 4GNRA 1H9BA 1W88B 2VOJA 1EEHA 5IAJA 2YCLA 4RM2A 4CT5A 1KYZA 1PR3A 3EF0A 3H1EA 2PBFA 1D8AA 1EVLA 4J6FA 2PXCA 3K2EA 2WU1A 2GD1O 3WLLA 3G9UA 5AW9A 1SH7A 4GL4A 2J9ZB 1E0JA 2ON6A 2FKNA 5DM60 4BVAA 3B70A 3ROGA 3WIBA 1ZL0A 1SA0A 2UYYA 3EQ9A 2RK3A 1ZM4A 4CLOA 1AXRA 3WHPA 5I9TA 4G0OA 1MB9A 2I7TA 2L18A 2BM9A 1M8FA 3W90A 1NNI1 2D1TA 4NDNE 4YMHA 3EY9A 3IBFA 3DEIA 1FU4A 1WXEA 5CCXA 1W5AA 1F8GA 1EFUA 1O97D 1V2GA 1GU0A 2JIBA 5FTMA 2WJHA 4DA7A 2GRJA 5G53C 4UDYX 4B6OA 3KE8A 4H27A 4H7KA 1XALA 2NXJA 3C6XA 1JU3A 2DWOA 2GPBA 3EUEA 3GN1A 3PVSA 4S1TA 3RVKA 5IEJA 5KS2A 2CMKA 4Z3KA 3NONA 1BC5A 1K0UA 1KF0A 5H8WA 1KI4A 1GARA 1DC6A 1RE0A 3QBEA 4J94A 1SQFA 2ZI9A 2ZUDA 4DBLC 4UJ3A 4RA9B 4OH7A 4CIYA 4YJ2A 4GLFA 2FCRA 2PXXA 1ZM2A 4EPWA 2BGJA 5ITSA 1PQWA 2WD7B 5E7IA 1I3CA 3DF7A 5ELLA 1SJ9A 1VYUA 5KYUB 2ATXA 1CYDA 3BE4A 1O97C 3CUEF 4A5OA 3TJRA 2YFKA 1PNOA 4IEEA 1RAHA 4E4YA 4GSYA 4I8IA 2FX2A 3DBRB 1UWKA 2QP3A 2FB9A 1SCIA 1P2UA 1XRSB 2C3UA 3CRMA 4MWCA 3WGGA 4D92A 2BCEA 1TM1E 1K86A 4WEQA 2G04A 1EFVB 2XWSA 2JFHA 1WD5A 3JYPA 4K9NA 4CU2A 3WNVA 1S2MA 1R88A 1F9EA 5CIYA 3WX0A 1Y7HA 3BTUA 4QU9A 5CM9C 1D4OA 1MIHA 1HDXA 2I71A 1UM8A 2Q3LA 4L6IA 1EFDN 3IAEA 4YAGA 1R4NA 1YHZA 2OPHA 4YRRA 4HAZA 4ALIA 1TYDE 4KR9A 3RAGA 2BH2A 1QAOA 2GK6A 1ZD2P 1JTVA 1NQOA 3FDZB 2MSCB 2ZSJA 2E0IA 4NG4A 4RTPA 3OKCA 5KDLA 2DC1A 3ZKWB 1KE2A 4RVUA 4CMIB 1Y3CE 1O77A 3DQZA 3V3KA 2G9ZA 3AEYA 4L6AA 1BFDA 1ZU4A 2FQ1A 3C7CB 3EVTA 1F3LA 5HZKA 3SQDA 2PL1A 5JC1A 1WKBA 1DHTA 2Z58A 3NOOA 5U4XA 1NXOA 3OZRA 1IK6A 2DYKA 4H6VA 4M4SA 1J7JA 3B48A 4OQMA 3KBOA 4GYKA 3CVVA 2O19A 2Z56A 3KKPA 3OEYA 3AF3A 4G9GA 1UQRA 3F0TA 4C4ZA 5BWBA 5AK0A 3HL4A 4EHNA 3FHLA 5FBLB 1S5PA 1LW7A 4LDZA 2CL7X 1OU0A 3AXTA 4IDGA 3F78A 5IT9A 2Q62A 2PMCA 4RLHA 2ZJFA 3W8NA 2Q0HA 3ZHQA 1OH7A 4XARA 1MMFB 3WL4A 4TSFD 1HDYA 3BN3A 3FM9A 3LHFA 1XLVA 3SMVA 4CHGA 4UFPA 2QNBA 3H2IA 5F1PA 2FE1A 3UK2A 2YZ7A 1U0GA 4OYYA 4P34A 1RS0A 2NVWA 1NBAA 4KPUA 2OHVA 3WQSB 5H1YA 5AI0A 2X42A 3TLGA 1REQA 1VSUA 2RMKA 3OLCX 4PZAA 5ALFA 4BFVA 3D5QA 2M6SA 4NZOA 4BFYA 1K6MA 4X3OA 1DCTA 4B3XA 1TF2A 2ZYTX 3CX4A 1EQ2A 2P9TA 3NATA 1KZYC 1OFVA 1G9TA 2GM4A 4B80A 2J7PA 3PQ3A 3PGMA 2P9BA 3GELA 1JLLB 2CLIB 1KIMA 2XCQA 1OUMA 2JEZA 2X8LA 4KFRA 4V24A 5DBOA 1U2RA 2V55B 3JW8A 5ALZA 5ESRA 5HF6A 4FLMA 5IX8A 3KQQA 4JOCA 3BFKA 2EF1A 2W6MA 1FP2A 3E22B 2X2EA 1AQUA 3RHSA 1QF6A 3EH1A 5T5QA 2D54A 2FWIA 3MWJA 3TFQA 3EZ2A 4P83A 2A67A 1DQYA 1VA4A 3MTJA 3T5TA 4B4WA 4B8WA 2QN3A 3ZDBA 2FW1A 4M8IA 1V26A 2WJGA 2XB6A 1UEIA 4I08A 3RVLA 2UUBB 1ZD5A 1R18A 3UPUA 4AYTA 3I72A 1I14A 2H9IA 1Q74A 1IJBA 1EBBA 1CY6A 1ODKA 3Q5GA 3LKZA 4HZUA 4M0KA 4WE3A 3UJ7A 1U7UA 4BAZA 3NBYC 5K0EA 1HO3A 2J87A 4KR0A 5MDHA 1YDGA 1ZIOA 3ESCA 2I3GA 1X7ZA 4HWRA 1LH0A 4A4DA 4N47A 4NFYA 1JHOA 4WOBA 4ZCIA 5IHXA 4HQFA 5A7FA 1NRIA 2WSLA 1V6AA 3RG2A 1BMTA 1EFLA 4J3JA 5M04A 5KTMA 3Q88A 1U4NA 3MIIA 2WG1A 4URVR 3ZWNA 3K96A 2RGDA 2BCJQ 1D1QA 2HMWA 1AO3A 4KIGA 3AKEA 2JVKA 3FN4A 1DBPA 2HQBA 3EJWA 3HB9A 4R4JA 1TC1A 2POQX 2IY9A 1E9SA 2D06A 3L9WA 4A23A 2KLBA 4RQTA 5FF9A 3DZKA 2UZ0A 4LJ4A 4DIEA 1QLHA 2BHRA 5E7MA 5ICMA 1N2CE 1JYEA 1WP9A 2FW6A 4V3CA 5BNTA 4Y6SA 5D87A 4L5JA 2JNWA 4I50B 1VI6A 1GUAA 2AEEA 4ZU1X 3WAJA 3AG6A 5FPKA 3AR7A 3QTLA 1VCNA 3B2QA 3OPXA 2PSHA 3U3KA 1MVOA 1O0SA 5IBPA 3VU0A 1KRXA 2QZ4A 3E5RA 5WRFA 2ZCVA 2ATIA 3FBWA 2B5WA 4PGFA 4UHCA 3JATB 5BSGA 4ZI7F 4H1WA 2V4ZA 4Z7OB 4HTFB 4D6YA 1I5EA 2E6KA 1SUFA 5E4FA 3S7TA 2CLLB 1IBCA 2NQ8A 2QGNA 1Y9ZA 4HAOA 4K8RB 3NVMB 3QKIA 5PNTA 2HCJB 1Y1QA 3LCMA 3L7KA 2XSZA 3LC0A 1N6IA 3H2JA 5DH9A 1VG1A 1IN4A 2H5EA 2R44A 2XD4A 1W49A 1ZMOA 2WE7A 2XT6A 3FJOA 4JROA 4V0ME 5ALQA 4CEJB 1S8NA 3LIIA 3RWOA 3M6XA 1GNLA 3I73A 1Q1ZA 2ZXUA 1VM6A 3ZJTA 3LWBA 3K15A 1M8KA 4AT1A 2LBPA 3QEAZ 1L7QA 2OC4A 4XWKA 1W581 2Q3FA 3KQNA 1ZH2A 4L5AA 3CVYA 1N6OA 1N2XA 4EJ0A 4IMPA 2W6IA 2X40A 1XQ1A 4IJUA 5IKEA 3MWDA 2RCNA 2G0AA 4YDRA 4O4LA 4RKQA 2CNWA 3M3HA 2HOQA 2WMOB 1V6CA 2WWFA 3LFUA 3ZHRA 1NURA 5DYNA 1MRZA 1NV9A 1V0JA 4S1WA 4Y2JA 5C8DA 1AGXA 5J4KA 2B2NA 4DRXA 5E8JA 1QKIA 1MAWA 2VEOA 3B7PA 2GAJA 3DW3X 4IPTA 4ND7A 4QT0A 3X1WA 1PVDA 5HWSA 1GRCA 2RKOA 1ZJJA 2FG6C 3PF8A 3ZLVA 4LFBB 1BKSB 1F60A 4U3JB 1NQAO 3CPEA 4IQ8A 4WADA 3B9RA 2YZGA 1IOWA 2H1IA 1KMMA 3UAVA 3FJYA 4R31A 4FVTA 3K0FA 4XAQA 1KEEB 2B4KA 4UHFA 2E4XA 1GNPA 4B3DA 1YA8A 4BMCA 1PO7A 5F2NA 4JBXA 3B85A 5KOYA 3H0CA 1XZMA 3PWSA 3OOJA 1OFTA 1ST3A 2OLEA 3LO5A 1U4SA 1RYYA 5KAMA 3URKA 1C3OA 1WEHA 3OEED 3D4OA 5JROA 3C6BA 3CF0A 3KLPX 4BNFA 4G5OA 1YA6A 2GCIA 2J3HA 3RSGA 4AJ2A 3WBJA 4L8LA 2MSDB 2IUTA 2P2ZA 1NQXA 1FUIA 1N8TA 2W8BA 5DIZA 4BWYA 5THXA 1KSFX 2HK7A 2BFDB 4I9GA 5CCEA 2HCBA 1E5QA 1E6WA 3V4OA 4AY6A 1P7WA 1BU8A 2GA9A 3IV7A 3IDOA 1QYWA 4UZFA 4KDCA 4EENA 1NBME 3FY4A 2QWXA 3GJSA 2JPDA 3OD5A 2YV5A 1CULC 2QUIA 2YC2C 1DUIA 4KDRA 2I6XA 4LRYA 4C6RA 1BN7A 3KD3A 1WUJS 3GGOA 3MQ2A 2P3LA 5C7YA 3CR3C 1HYGA 1DJPA 2WOOA 4MW5A 1Z0AA 2AQ8A 4YV1A 2RIPA 3IP7A 2LD4A 4G85A 1QKKA 1YQ9A 1J8YF 1XO1A 3GCGA 4DG5A 4REQB 2OMKA 2VJLA 3Q2IA 4CMEA 2I7XA 3E35A 5JZMA 3MGCA 1RC8A 3SQNA 4NENB 2CMDA 2P7IA 4LMRA 1X8XA 1K06A 3KB2A 3R2JA 4GMFA 4HS9A 4GOXA 4RHEA 4DMHA 4MYSA 4E70A 1MOZA 1D8TA 1S2GA 2O2JA 4CQJA 3G85A 3LKVA 3UJDA 1ZISA 3EODA 4GWGA 4C14A 3AILA 3AEUA 1Y9AA 3B53X 1JGTA 1G66A 1E99A 1T13A 3NU1A 3NYIA 1Z4LA 3DDWA 4QPPA 2PS0A 1G19A 4LJLA 3WDLA 5BVHA 1Z4IA 3EOBI 4TRJA 5LBUA 3IEMA 2BFEA 1DQSA 1X9IA 2YHIA 2Q2QA 4JLPA 2NO7A 4DR5B 5FPQA 3IQIX 3RR2A 1VCIA 3FHCB 4ZT7A 5H02A 3UJHA 4YGXB 1Y3BE 4MVWA 3OJ0A 4GKAA 4ETIA 1Z36A 2X58A 5EHIA 1H9AA 1NWHA 3DE2X 3HSYA 3IALA 5KNBA 4X92A 4JUFA 4GZ6A 5CIWA 2HC9A 1T1SA 5HPYB 3SHTA 5C7LO 3KSMA 3JX9A 4ROTA 3GRVA 5AI4A 3RBVA 3D6UA 3TZCA 4KDFA 2WKRA 5BN1A 4D82A 1NBOA 2AE2A 1N5DA 5DT2A 4F8JA 4J1QA 2HV8A 5AXBA 2IUUA 4IO0A 3DSRA 3PC7A 3N2LA 1WHSA 3WZMA 5HR5A 1YH3A 3Q6IA 5CD9A 3UY4A 1BMQA 4D44A 2PUEA 1J39A 3P8ZA 4Q12A 2EWVA 2FPIA 2ENWA 5AKHA 2RHMA 1AHNA 1DJLA 3REGA 2D1YA 3WKBA 4FI3C 4MROA 3DMNA 1MVLA 4LRQA 5IZCA 2BEUB 3F2VA 4I6JA 4A2CA 3GF4A 4P36A 1W5BA 3L49A 4EZIA 4RFLA 3GEDA 3W4KA 3SSOA 2QSUA 2XA9A 3EVEA 1KDYA 1QPZA 1V3TA 4RX1A 1J22A 1QV7A 4D9HA 1Z6AA 4UXIA 2W2QA 5KYTA 3FPBA 1AN9A 1ZBQA 1F38A 3HCCA 5CK4A 1E6CA 2SHKA 1TZCA 1KR2A 2QZJA 3H9BA 4LMPA 4QRDA 5HK8A 5L6MB 5L9AA 4UMVA 3A06A 3E9QA 4R1OA 1NI4A 3I5XA 4A15A 1RLIA 3G2OA 4ZT5A 2X5NA 2WZDA 4DNFA 1EX6A 3DB1A 3JU3A 4X1IA 3A4TA 3DOUA 4UUBA 2OCDA 3DFIA 2AKEA 2G0NA 4IH4A 2IC5A 2UZ1B 1FFAA 4L0MA 2Y1XA 3CUTA 5EPEA 1JPVA 1CNEA 4NBRA 1T2UA 4I9NA 4JUDX 4YAUA 3CPHA 1QXSA 1QMPA 4XQGA 4HHEA 1GM5A 4XX0B 3LV8A 3TUJC 3X2EA 2VPZA 2GJ8A 3JSAA 1LLQA 2Q6TA 4G0ZA 4RSHA 4RDXA 3WS7A 3DTVA 2JBHA 3QBDA 4L3VA 4LY9A 3RYFB 3WTCA 1V5EA 3MRTA 4OMCA 4YHHB 3MVEA 2ZTVA 2G9NA 4N1AA 3EASA 5ARDA 3WIUA 2GPAA 3G8YA 1T9KA 5HMMA 2OR3A 4JU9A 4BAUA 2G5TA 2LTAA 5EXEA 1RRPA 1E0KA 1XRMA 4FYMA 1V3UA 4LV5B 4UM9B 5ALNA 3DMFA 2JRCA 4XCQA 2HXYA 5C3MA 1CU1A 4HWTA 4RKWA 4AMZA 5IBCA 1LCIA 1UPAA 4HNAB 2GQ0A 2RHGB 4M87A 3VZSA 4CR6A 3BE8A 3D6HA 3NV9A 2HXSA 5F35A 5HUJA 1GCGA 4BIIA 3OT1A 2XKJE 2JC3A 3JV7A 1GZHB 2VIIA 4ES6A 3A2KA 1JLHA 2PAAA 2VNJA 4RBNA 2HA7A 1QGZA 4P3NA 5AOVA 5FIUA 4PYNA 2CYBA 1W59A 3IHLA 4J1SA 1BOFA 1JEYA 3W2TA 4MV3A 3FVVA 1NJFA 2NTYC 1NVWQ 3V6LA 4POOA 4A6EA 5CVCA 4WL0A 4PX3A 5DB4A 3FCSB 2NVUB 3VJKA 3DBHB 1GGJA 1QUEA 3V4VB 3PUWA 3RC2A 1XDBA 1F5NA 1NW4A 2O2EA 1FF9A 2XVAA 4WZ6A 1JR2A 1PUXA 3MJ4A 2DX7A 2VJKA 3I9NA 4AZWA 3GLHB 2AFHA 4YBZA 2PCLA 3GMIA 4GNKA 2JGFA 1ES9A 4F4IA 4F9GA 3GDWA 4IFIA 1HY3A 4YP7A 1RBZA 2EZTA 3OHSX 3UH1A 2ZLBA 4RQUA 2EKLA 1YDHA 1D2EA 4HN9A 2VN8A 3QQPA 1N92A 4BC0A 3TTTA 3LDGA 1U1FA 3PQDA 2J7KA 3OFKA 5HP4A 5BUSA 4FBLA 1A4XA 1A88A 2YOHA 3MQ4A 4C1BA 2WF9A 3DEKA 1EE2A 1HSZA 4EA7A 4DFDA 2BGIA 3DV0A 3C6ZA 2P5UA 3NO4A 3Q7SA 5BNFA 3VUFA 1DIAA 3E9RA 2DTDA 1Z45A 3LLSA 3H3XA 4B09A 1CW2B 3F5DA 2QX9A 2QPOA 2Y92A 1P2DA 1Z88A 2Y1OA 2I2XB 4EK9A 4C43A 2Z4RA 4QFMA 3TR5A 2HGZA 1DEAA 4WWHA 5ERYA 2D2FA 4OHFA 3H3JA 1XNRB 2BZSA 2X3FA 3G5TA 3JQRA 4H4DA 4R2XA 5BMVB 4LXXA 3FSRA 1NJ1A 4J1NA 1XZGA 4GPTA 2OB2A 2HU5A 1EINA 2J41A 2QY6A 2M98A 2W6ZA 4N4AA 4OJYA 4XSHA 2ZI4A 3KP1A 4NYJR 5KNCH 4CEIB 1G42A 1OI4A 2AYZA 121PA 3D5EA 3GEGA 3KQOA 4HQ0A 3ND7A 3TZBA 4M9ZA 5LVAA 1V71A 5KNDH 3CNHA 4DABA 3GYBA 2NQTA 4JJEA 3WWPA 1E9AA 3BZWA 3OESA 4BNNA 3IAXA 1P62B 3L1JA 4PONA 5E3IA 1VPTA 4TYWA 3E1KA 4FB5A 2VH2A 1G60A 3K2IA 3QUAA 4GI3A 1IIRA 4JGGA 1NMYA 5AUOB 5KYNA 1QK3A 5CNKA 1C1DB 1FZQA 1FMLA 2ATCA 1GCOA 2B1RA 2QD5A 2ZDGA 4Z3DA 1SKYB 2P9EA 3CNOA 5BR7A 4ML3A 1INLA 2MYUA 3NAMA 1OTXA 3JQBC 3DPSA 3QOWA 4AJOA 1Y8RA 3EDYA 5HIMA 4LGMA 2QAIA 2ZAOA 4WKBA 1X80A 1Y81A 3LPNA 3WB2A 2P0EA 3DOEA 4HQ6A 5MGBA 2X41A 2A9FA 4G4SO 4ZAXA 1U0TA 2JJ1A 3C45A 4NBTA 2CVQA 2HRQA 2PK3A 4D79A 4ZZ0A 2F3SA 5D3MA 4NAHA 3HSSA 3LFHA 4DCUA 3KDPA 4ZDWA 4C0XA 1XXHB 2ZUUA 1UFQA 2YBEA 4G5QA 4LV8B 1XQVA 3JRNA 4GOJA 1E3SA 4UE3S 1K4KA 4M7RA 4RPGA 3A1EA 5IDXA 2GWRA 3W6NA 1UC4B 3BWVA 1B3RA 2GN4A 2J6HA 3O6VA 4QBIA 4ZQGA 4BFCA 3U60B 1H1DA 3IHWA 5GJVC 5A6SA 1ZI9A 1YGYA 2AG5A 4LZOA 4YLYA 4DV5B 2Y0EA 4I9UA 2L19A 4OHRA 5JBIA 1LI7A 3LECA 1Z5VA 1DO2A 1U2ZA 1WQ4A 2DQYA 2QQ0A 3FGPA 1U4OA 2QTLA 3DZIA 4AURA 3L7NA 4YT4A 4O8ZA 3WAKA 4BUZA 4CNQA 4NK4A 3KOYA 4J4BA 5I6DA 1I2AA 1T1IA 1SHLA 1XGKA 2VT3A 3C24A 4HFNA 2G5PA 2BLLA 1I9CA 1TYEB 2QRMA 1ZVKA 1QVVA 2V59A 1ODLA 3KEQA 3L7IA 1TJNA 1ZMTA 3B8EA 4KQFA 4QYSA 4TT8A 4WKPA 4C7MA 3K9NA 2VTKA 2W22A 3AJEA 3BVPA 3I83A 1W4BA 4D8XA 2OBMA 4EW6A 5H9WA 2H29A 2EJWA 3G9ZA 4O4HF 3VPHA 4B3FX 1SIUA 3EPKA 2NAPA 3H4IA 3K9FC 1CDZA 4MP8A 3ER8A 4N40A 1ORVA 1FDWA 2AZ4A 4L5BA 5K3EA 2PL3A 1FDUA 5EFZA 3LLVA 3B13B 5G1OA 5ILOA 1Q1BA 2V9CA 4LEIA 2H5JA 3Q9UA 4IM7A 5KWJA 2ID7A 1E5XA 2Y9MB 1TAHA 4DARA 2WZBA 3M81A 4OJQA 3B1JA 4QBGB 4ESVA 5FAKA 5JZBA 3AUTA 2RHJA 4BVHA 2PE5A 3F98A 1NONA 4NRDA 2Q2NA 5J4VA 1F20A 4CTKA 4ER6A 2AE1A 4EI9A 2FEOA 2IW1A 3PC3A 4ETMA 2WZQA 4DADA 4TZTA 3BE5A 5DRYA 3AKCA 5BP7A 2XGMA 5J4HA 4H08A 1L4GA 1SXJA 3RI3A 2PMFA 1D2HA 4IIFA 4NECA 1G1AA 4MSUA 4QDTA 5CFPA 5KOHB 3IOEA 2IEYA 4JAVC 2JIZD 3ZBPA 3ANMA 1JIJA 4UDXX 3ZGOA 4DV3B 2CZQA 3NWBA 1R4AA 2SNIE 4H7PA 4JJ6A 2NYRA 1ULSA 1I80A 1N0UA 5AHWA 4UVEA 4IJWA 3RBXA 4XB2A 3UMSA 3SHWA 1H3EA 5A0VA 3LHSA 2VUUA 3ORQA 1WUYA 4FEYA 2H48A 1KZGB 3AKZA 4U7GA 4C7XA 4IF4A 4HGOA 4YFVA 4AZVA 1CDEA 1J56A 2BW0A 5DXAA 2JARA 4HRAA 4M89A 4M9SA 2UUPA 5AHRA 4JA2A 3UGJA 3B6MA 4JT9A 2ZB2A 3DCJA 2IZ6A 3QU4A 5BWCA 1QRUA 3CNNA 3Q41A 4JUBA 2FNAA 1OAOC 3SP1A 2GEBA 4HYEA 1M2FA 5TPZD 1Z82A 2PZBA 2IELA 4RLFA 5BW6B 3Q8KA 5DCWA 1I24A 4Y2YA 2JA1A 5I9LA 3E7WA 1TJPB 6REQB 5AIBA 4B3MB 5TEWA 4M0LA 1A9SA 2VHCA 4ZODA 2PUTA 1ZGAA 1USIA 4A0GA 4DR2B 1W5SA 3I3OA 3WWOA 5KYWA 4JJZA 4RJIA 4Y1EA 2AJ8A 4BATA 5KX5B 2ZULA 5B58C 4K1LA 2UVQA 1W96A 4YO8A 4YS6A 2R8ZA 1T43A 4PTYA 2JCBA 2A9OA 1MB4A 3OU2A 1ZK3A 4G01B 3WB9A 1YOVA 2QS9A 1XYYA 5LU8A 3JQ9C 2G7MC 4QWMA 1HE8B 3V6MA 2FX5A 3PHCA 2VSNA 5I5EA 1MQAA 3WQHA 3RBAA 1LC3A 4HGPA 2FEKA 4P0TA 4PANA 2LKDA 2CLFB 2VYND 1DDOA 3K0EA 1CKEA 2R1TA 2KE5A 2W6JD 1BHQ1 2VDNB 3WA7A 4XCVA 1W0JD 2VHJA 1GGNA 2YOFA 3L8MA 1TUGA 4D45A 5K8UA 1UH5A 1EK1A 3AHIA 4YASA 2D5CA 1EIZA 3GNQA 3ZGYA 4R16A 5K20A 1Q0TA 1P5RA 2QQGA 3BIFA 3N8DA 2ETVA 3BTVA 2WNIA 3AM1A 1RWNA 4ZT2A 1T8RA 5JS7A 4J16C 4KLZA 3CG4A 1NT2A 3Q7EA 4JV5B 1K75A 2C77A 3B78A 4C30A 2VUIB 4IHAA 3PNQA 1F6WA 2YVLA 2YBDA 1TO6A 4OXNA 4KUHA 3HC7A 3V00A 1WB6A 3LUDA 3GMSA 1Y34E 1Y7LA 3H99A 3HP4A 4FFDA 1VBFA 1XELA 2HO5A 5DMHA 4X54A 2GM3A 1HDGO 3I8XA 4MP3A 3BIJA 3DUFB 5EE9A 5AUQA 2GF2A 3TB4A 1XX6A 1TT5A 1NLFA 1QZZA 1XU9A 4OFWA 4C4XA 4QPNA 4LC0A 2C5FA 3Q3VA 5EQTA 3WGNA 2RONA 3B9BA 2CSUA 1ZUD1 2QQFA 1MO6A 2O14A 2ECOA 2P4UA 3BIWA 1LRJA 3F6SA 2IKQA 2O2ZA 3HUTA 3PWTA 1YD7A 4JS0A 5GM2A 2WF8A 3KJFA 4C07A 2CL6X 2VSXA 3BRQA 2DUMA 3SD7A 2HSDA 4Z6KA 1S2LA 1TVKA 4DCPA 1UPCA 5FUWA 3WLMA 5JZOA 1GZ4A 5LFAA 3V4SA 4UBMA 1HDOA 1D9ZA 3GJTA 1Q2XA 1JJVA 4N6NA 1L5FA 2VCHA 3CUKA 4R2MA 2JLBA 3DVRX 3FMPB 1TD9A 1XA0A 3GVIA 4GBGA 3UOGA 4IKOA 3HACA 3IV6A 1FSFA 2G17A 2H1RA 4EMBA 2JFYA 4IMJB 1ZHFA 4XTRA 4LHEA 4ZYTA 5CG2A 1RHUA 1LDNA 3LUBA 5KHAA 1W5EA 1H2EA 3SK0A 3PPXA 3CRW1 3E84A 3DL4A 3KB6A 3RJZA 3S1AA 1G64A 1OLSA 3DOOA 3MFQA 5FPTA 3VSBA 2PFSA 4PIVA 4FILA 5EWMA 4F6CA 1KQGA 2GHIA 2FWRA 1R8QA 1G7TA 3CXRA 4WOPA 3EGDA 4FE3A 1L5QA 3UJCA 1RHKA 3MJEA 4JR0A 1XNGA 4A1FA 3HV0A 4ZI7A 3AI2A 4GBJA 1DWOA 1IL0A 1JDJA 1A8SA 2O7QA 2PJUA 3M5CA 3PS9A 4RJJA 5B36A 3EVAA 4WZBB 3NUGA 4R54A 1H2XA 1Y6QA 2IHVA 4NP6A 5HKOA 1COWD 2RH8A 4J4TA 2B7BA 4YQFA 1EI9A 2QLLA 3R3ZA 1HE4A 3W6UA 3WMFA 1VYHA 3MC1A 5K0CA 3R7DA 1ESNA 3A7EA 5AW0A 1BS1A 1X7WB 1USKA 3E3AA 3FR7A 4HEA6 4N3GA 1E3QA 1GPUA 1OJLA 2W8ZA 1BA3A 5CUQA 2GM5A 2B1IA 3MWEA 2F90A 4IO1A 4K9OA 4TS3A 3TQFA 4WRRA 4A6PA 1IN1A 2EHDA 1YB7A 1VBNA 2VT6A 4Z49A 4UOZA 1P75A 2CF5A 4N5DA 4KR6A 2NZXA 4QUHA 1PJQA 2XZTA 5E8RA 1FUYB 3QSGA 2F3RA 5DCLA 5HFJA 1KKLA 2C3MA 1G7CA 2IOQA 2C1EA 2I22A 1YVPA 4NFHA 1U80A 3SXPA 4C21A 1EFAA 4LYGA 1P8JA 2HBZA 4O2BA 2AR9A 2X1MA 3BXOA 1E2FA 3FFAA 1WB5A 3LXXA 4UAGA 1NBHA 3K0SA 3HRHA 1SUDA 4X20A 1RHQA 1KZHA 3SN6A 4D56A 4ZDJA 5A9RA 1GRVA 3ADPA 3AHHA 5CPFA 4OYLA 4ZO4A 1XNQB 3A6EA 3I34X 1JTEA 3BWYA 2WQ6A 4MTLA 4R84A 3OX1A 3NLLA 3EXFA 5C34B 3S6JA 4YX9A 1U0SY 2OHFA 4KWTA 1NY6A 1RYNA 5LUBA 4XYBA 1DV2A 4XWWA 1HLPA 4DCCA 4P54A 4R5MA 1FBTA 1XTUA 4XEUA 1EGVB 4JP5A 5EHQA 4AJKA 4OHYA 2NAFA 4GE3A 4HSGA 4AMUA 4JVSB 4ZD6A 3GUZA 4IH9A 4G0YA 5DM2A 1BVYF 1FXWA 3A9VA 3GLQA 4UMFA 1NSTA 3DHEA 2ZYVX 3PVCA 2NXWA 1T5TA 4HO1X 5IU6A 2Q3CA 4EGQA 1KY3A 2OXEA 4KX3A 2PKCA 5F73A 2HJHA 1KP3A 4U7TB 1ZDMA 1E0DA 2CL5A 3W5DA 1OFIA 3KUUA 4QYIA 3HU2A 4QUBA 2P0YA 4R69A 3T3MB 4CQMD 2JAWA 4KXLA 3JQFA 2X8JB 1G5PA 3PKIA 3H1GA 4U8HA 2XUGA 3QYFA 3L41A 3NEJA 1O3YA 3PUYA 2X5OA 2CNBA 4HH0A 4IVQA 3ZU4A 3TDKA 4ARIA 4NBUA 3I6BA 4LWQA 1FFGA 4PVDA 4DXHA 1EWYA 5HRUA 5LYJB 3NGMA 5IAEA 1RXUA 3F4LA 2REXB 2E4AA 1GUZA 1H0HA 2ZRGA 4Z8XA 2O2DA 2FOIA 1XLUA 2RSLA 5AVQA 5KQRA 3NC1C 4P0PB 3SC2A 1L7NA 3QJGA 5ULLA 5DIFA 3CH7A 4EQ6A 3HGMA 3CH5A 4OPMA 5CNMA 3MUFA 2IZ1A 2NO0A 2VAVA 4FHZA 1GZDA 4JZKA 1MJHA 4UKDA 1ISHA 1NVAA 3C3PA 5D6OA 1W75A 5ALVA 3DT6A 4HVCA 4GU5A 2LDXA 4IIDA 1TYCA 3NFRA 1E3TA 4BO0A 3ISTA 2F8LA 2YJNA 5A3VA 4M6WA 3IBTA 2CK3D 2BGTA 4XQCA 2ZYAA 4W8HA 3EG9A 1VC2A 1X42A 4F2WA 5KPDA 5EZYA 1RYZA 1EB8A 3EUWA 5AFSA 2EFEB 3QF4A 2YRFA 2ZREA 5J47A 2QIOA 2RGYA 3OZEA 1UK8A 2G67A 1PR4A 3O1IC 3PDUA 4MGHA 4A8JA 1G21B 1PR2A 1QO9A 2EX1A 2JLSA 5SZHB 3LY7A 4LGVA 1M33A 1SXGA 1X7YB 2LE0A 4IQ0A 4KXVA 4ZXFA 1RR6A 4D9BA 3A70A 4CM8B 1ZOOA 2UUOA 4PQYA 1H6CA 1ZNXA 3JQ8B 4I2VA 3ENVA 3I62A 3G0DA 2XUQA 4ETNA 4ACAA 5J5AA 3BMCB 4B6SA 3M4NA 1UJ4A 3B51X 1KFBB 7REQA 1L1FA 4D5EA 4OOEA 1P0CA 2O05A 3C4QA 4U7FA 4YRPA 3N2GA 1XZJA 2TMYA 1C1HA 2WYOA 4EP1A 1L0BA 5KYXB 4C1NA 2LKCA 5FO0A 4NBKA 3E4CA 3KELA 4TQ9A 3ETDA 2FW7A 5ALXA 3GLVA 3MILA 3LI2A 5HE9A 3D4IA 1C7FA 3EMKA 5C31A 3T7JA 4D97A 2NXCA 2IF0A 1P1BA 1NLMA 1QFYA 3M82A 3BMQB 3RROA 3DPUA 4TXLA 5CB6A 5JZVA 2BDUA 4DPLA 5FR2A 3DOCA 4NNOA 3S55A 3HE3A 1CUCA 2X2OA 3NGXA 4XQ0A 3JQAD 3K0AB 4IJVA 5T6MA 1L7BA 4LBZA 1OFUA 1WMFA 3FYUB 5FJIA 4AL4A 3Q3JB 2J5BA 3GGSA 4R3UC 4YUZA 3LKBA 1TEZA 1T1GA 2PS1A 1N2OA 4QDOA 2VAPA 2K6GA 3ZNQA 1WMSA 2GPTA 2O8FB 3V1YA 2VTBB 3ANXA 4D81A 5CLIA 3HBMA 2VP4A 3F3SA 3U7GA 2BZ0A 1TOAA 2PKYX 4IDDA 5D84A 3TIFA 3L7AA 3U13A 5KX5F 2Y0PA 4FUTA 3T7DA 3W5VA 4PPNA 1ADBA 3AVUA 3QEKA 5JHGB 3HBFA 3CB4A 1CY1A 4YV2A 1IEQA 2FVXA 2WSSD 2FMXA 2Q6LA 4LXQA 4WUVA 1BCSB 2PMEA 3S28A 1MO3A 1Q1EA 2ZT8A 4KK3A 1V8ZA 4AMVA 4WOJA 4AXBA 1U9JA 3DMGA 3OCZA 4X7BA 4IXMA 2MINB 3UXYA 3FB1A 4OKSA 4OJMX 1PLLA 2MOKA 1WSDA 1MRSA 3R41A 5E9WA 4GHWA 3TL2A 2C2KA 3PQFA 2D2XA 3WJ2A 2WWTA 2F1JA 5IUJC 4Q66C 3MTGA 1HOXA 3BZUA 4FPXA 2JFPA 3G5MA 2GN2A 5BQ5A 3GWZA 2PD6A 3HLYA 1D03A 2ZWOA 2WIGA 2A14A 2OORC 3AETA 1Q17A 2YWJA 2N0SA 3CZQA 5IJXA 3PGVA 3USCS