4OBEA

Crystal structure of gdp-bound human kras
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
169
structure length
169
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In situ selectivity profiling and crystal structure of SML-8-73-1, an active site inhibitor of oncogenic K-Ras G12C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords GTPase KRas
total genus 62
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2014-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4obeA00
3FWYA 4H1VA 4V0OA 1VG1A 2WICA 3SI7A 5J40A 5C1BA 4LYFA 2ERYA 3EPHA 4BPBA 2FWRA 4Z1MA 2C98A 3U3OA 5EP4A 4TZ0A 1WRBA 2K5UA 4BE7B 1OFUX 1LW7A 4B6EA 4DBLC 1KI1A 4OI0A 2WWHA 4P3YA 4TMXA 1L7VC 1G8FA 2IUSA 1KK3A 3A1TA 3MAAC 4Q7LA 4JIMA 4IXMA 3ZVNA 3REGA 5FUVA 3A4MA 2YWGA 4IKEA 4NU0A 1FX0A 4TMTA 4OKSA 2D2EA 5FL7D 1I2MA 3ONWA 4UJ5A 1T9HA 1KDPA 4X8OA 3WYFA 1US8B 3KKOA 2OCAA 4I1SA 2RGDA 3ADDA 3QG1A 4AY2A 3PJRA 1KI8A 4ASUD 2QT0A 1Z06A 1KI9A 3CNOA 3GEEA 1UKYA 3NH6A 1W36D 1Z3IX 1G18A 3EG5A 2AKAB 1NJGA 1E2PA 1G1MA 1EFUA 1GNQA 1KO1A 1QHSA 1KO5A 1VCIA 1COWD 4CRWB 4Y0VA 5M04A 2IUUA 1P6XA 4D81A 1QG2A 5FI0B 1TF2A 1KI7A 3ND9A 3OFNA 2HLDD 5J47A 1GSIA 1QHXA 2BWJA 2GXUA 4DDWA 2OZEA 1NSTA 2C96A 3IUYA 3L0OA 2H8KA 4RJLA 1OIWA 5GJBA 5C18A 5FH9A 4NCKA 1EESA 5CJ2A 1P7CA 5CYOA 2CDNA 4Q9KA 2WMOB 1FX0B 3X1DA 1GG2A 5CLQA 1RE0A 3QPVA 1GUAA 4IXNA 3SFVA 1YRBA 2Z0MA 4G5QA 3EW9A 4RD0A 3WMEA 1CKEA 5J4KA 4XOIA 3ZVMA 3HYRA 5JS8A 4TN1A 4BWYA 4DLXA 1NIJA 3MFYA 4W5WA 2ZE7A 2ZJOA 1MKYA 3CO5A 5LD2B 3B1YA 4Z1MD 2ZYUX 4LPSA 4PR0A 2YVUA 4YMSA 2QI9C 4LHVA 1VIYA 4ON9A 3SZRA 2BEKA 4WW0A 1KI4A 3WBJA 2RGAA 3C15C 4L9WA 4W5JA 4A6XA 4DLYA 1TQ2A 1QHYA 1YVDA 3R9IA 3OZXA 1AKYA 3VX4A 1DAGA 2WWWA 3GLGB 2WSSD 3GMTA 1FOEB 4A2QA 4HZIA 2JJ2A 4W7SA 1SVIA 3PVSA 1P75A 2VP0A 2ZRGA 4MUAA 4PZLA 3M4YA 5DI3A 3GPLA 2Q21A 2IK8A 3CKLA 4LJ4A 1SVKA 4XVRA 3G0HA 1U8ZA 2PMDA 4PHFA 1NKTA 4JKIA 2FGKA 1KJYA 1RKBA 4A0FA 3KKQA 1G8PA 4PSKA 3GJ0A 1QHGA 4OJQA 2IL1A 2OUKA 2FFHA 3GEIA 4GT1A 5FBQB 1VHLA 2RKOA 4ARZA 1OH5A 5FTLA 4OHYA 1W36B 2MSDB 1F48A 5DI9A 1G8HA 1QHHB 4WA7A 2ZYWX 3REFA 1E0AA 5L3VA 1RYHA 5JRZA 3R7WA 5G41A 1DO0A 3AVQA 1W1WA 3C16C 3KL4A 4GL2A 2PLRA 2QPTA 3WY9A 4A0RA 5J4VA 1RRGA 3GP8A 4MDEA 3FKSA 4DUGD 5FPSA 3KB1A 4GP6A 1TTTA 3SJAA 4C0JA 3CRVA 4PAMA 2P6UA 3QEOA 4TQAA 1TF5A 1JEDA 2YYZA 2JLVA 1LTQA 2PLFA 3FMFA 3KXKA 4DIDA 4PZYA 3X2SA 3BB4A 5EZ6B 1G19A 1QVRA 2HT6A 4Q4JB 2O8FB 1MO6A 4ZIRA 1JJVA 1KMQA 3QKSA 3GJ8A 3BFKA 4V02A 4RFSB 5TXGA 5CIQA 2WIBA 4HATA 1S2MA 2QUZA 3GFOA 1C4OA 3SNHA 3ETLA 1SKQA 4RD6A 4MYUA 2ZJBA 1YZKA 4YMVA 2ZE5A 4KVAA 3GCGA 1ZU4A 2Z4RA 1AGPA 1YZQA 5JWRA 4ABYA 3OEHD 1K5DA 2JDID 4OHWA 1XXHE 1HQCA 1M7GA 2J0UA 1ZINA 3H2YA 1E2KA 1VIAA 2BMJA 3QG5A 4MKGA 5AJVB 4DLRA 3DDCA 1EFRD 2PH1A 5DN6D 1RC8A 4B32A 4Q4LA 3FHTA 3A6PC 2HUPA 4U5XA 4OYHA 4DLTA 3VKGA 5CYPA 3T1OA 2QU8A 2JJ1A 4Q9IA 2Q9CA 4LRWA 4WZBE 4FN5A 3UMSA 5B58C 3QKRB 4QL3A 2VEDA 1DS6A 3NIBA 3FE2A 4Q03A 2J87A 3GJXC 4JT2A 2IYSA 3T5GA 2AR7A 2CEAA 2LWIA 1JXOA 2QQEA 3B1XA 4JL8A 4RFVA 2OCBA 3CF0A 2YV5A 2ZAMA 3VR5A 4BFYA 4US2R 3AVXA 3NWJA 4A0GA 4BGDA 3DL0A 2DFTA 3P1JA 5JI3E 2G88A 2FSIA 3W5IA 2QM7A 5JZVA 4AKIA 2BMDA 2QRNA 3QQ5A 1GL7A 5B30A 2G3YA 4KBGA 5KSOA 4HB0A 1G4UR 3NG1A 4TSFD 1S0UA 1U2RA 4E22A 4KI0A 1NBME 5LPNA 1VDZA 2A5JA 5AJZA 2NO6A 1MT0A 1G3IA 1FNMA 2ZU0C 5FOWA 2O8DB 1NY6A 3TUIC 3LBIA 1T3LA 2AN9A 2CVFA 2QE7D 1T6NA 1UM8A 2VP6A 1WXQA 4M53A 3RS5A 5BYJA 4EFLA 3ZIAA 5GADl 4AKEA 4QXAA 3GLIB 4QBFA 1HT2E 2J7PA 1EX6A 3THWA 3D3QA 4EJSB 1G41A 2RMKA 1SKYE 5FR1A 3TW4A 4BLRA 4JLMA 1RZ3A 3BH6A 4MRNA 2C78A 2JLSA 3ZLJA 1OT3A 1PUIA 1QBKC 4ZKDA 4JL5A 2GXQA 3VFDA 2FU5C 2ZR9A 2BBTA 2R8RA 4I81A 3C7KA 1CULC 4M9XA 3ZVLA 1LF5A 1IN5A 4B2PA 2FJUA 3X1ZA 1Z0IA 3GLFE 3KXIA 3O47A 2JJ1D 1ODFA 2R9VA 4UXJA 3NBFA 4URVR 1CIPA 4TL8A 5FUXA 1GVNB 3QXXA 2IS6A 1YZUA 4UKDA 1UBCA 1JAHA 4PC2A 1XNJA 3SYNA 2G1KA 4LCBA 1VG8A 4A8JA 2GEUA 1E2HA 1XCMA 3CR7A 3K70B 1CJVC 1JR3E 4W5HA 4K81B 4C0KA 1ZW6A 3MWJA 5SZJA 1AJEA 4NE2A 4NONA 1N6HA 5A0FA 2IC5A 4EJSA 4V0NA 4QHTA 2GETA 4MKHA 2VHUA 4RZ2A 5AJXA 2IA5A 3SBEA 3U3RA 1QG4A 1E4YA 2X1VA 3THOA 4DDTA 1WMSA 4U02A 1Q1EA 2J46A 1XD9A 5CJPA 1M7BA 4EFMA 1N2CE 4NHOA 1DOAA 2B8WA 4Q1AA 4BZPA 1A1VA 4OQNA 3RLFA 1II9A 3H0KA 4OQMA 2J0VA 2EU8A 1AN0A 4HB2A 2FNAA 3C4JA 1ZRHA 3S1AB 2ZS8A 4II7A 3TNFA 1NSFA 1E98A 4YLGA 3AVUA 2WM9B 5JWOA 4ESVA 2JDIA 3TR0A 2WV9A 5CDFE 1PV4A 2G83A 2QBYA 4Q1FA 4R98A 1TNDA 1OIVA 5G53C 1ZC3A 3PUYA 1IBRA 5BW8A 2XZLA 3CNLA 1ZM2A 3LNCA 3U7FB 1QF9A 1LS6A 1GNPA 1UBEA 2AFIE 2F1RA 2Y8EA 2ZJ2A 4OQFA 5H68A 3RYTC 3W9YA 4ASUA 2DFKB 3P4YA 3VX3A 2QMEA 4L16A 2F1JA 1XPOA 1DAFA 1ZP6A 2IYXA 4GNKA 4WXRA 5J5CA 2PCJA 4ACBA 1XEWY 1E3MA 2ZSBA 5IRCD 2IYTA 4LY6A 3NHBA 1G6HA 4P33A 5FBVB 2FSGA 2ODNA 1DARA 2NZ8A 2CNWD 3FMPB 4ZI3A 1XCPA 3R8FA 3R8CA 2H16A 4D82A 1F6BA 3D8BA 2IWRA 2PZEA 3NEJA 4BEBA 4YMWA 5D3QA 3HP1A 2C5LA 2WJJA 4FMDF 2JLWA 1N0UA 1T0JB 1JPNA 3BS4A 4BFSA 4F4JA 4URZR 4BFVA 2A30A 4KV9A 1IHUA 2PL3A 4MH0R 3PUXA 1ZUIA 4HI0E 3AUYA 4HZUA 2QMUA 4DCTA 3PFIA 4L4UA 3TVTA 4POAA 1J7KA 1FP7A 4XVQA 5FBLB 2VBCA 1MO4A 4RFSA 3F8TA 1P2TA 2O8BB 1OB5A 3GFTA 4B3BA 2NO7A 3AVWA 1RJ9B 4HLUC 3AF4A 4ZIRB 2RGXA 1XJQA 3N2EA 2ANBA 1QHIA 3B5JA 2ZJZA 5CB8A 1IN7A 1OXTA 1U99A 1DG1G 4PO1A 4KJZA 2RB4A 5B2ZA 2FA9A 1P60A 4H1UA 1CR2A 4NMMA 1RRPA 2R44A 2OLJA 1KMHA 1F2UA 2FEOA 5F9HA 3CRRA 4PPGA 2FPMA 1XTRA 3GLHA 2JLXA 4IEEA 3RWMB 2VYFA 3SJZA 1KDOA 2V8OA 5IF9A 4DSTA 1I2DA 4I4LA 4N0EA 1KY3A 4D4KA 2QG6A 4TT3A 1KNXA 4YQFA 1W0KA 5C4GB 1SZPA 1U98A 4M22A 3CF6R 2ZS9A 4LHXA 2B92A 1W7AA 1NVWQ 4LPKA 3GJ7A 2GCOB 2EW1A 1G4AE 1HY3A 2CNWA 4Q19A 1T5LA 2B21A 4QHYA 5BQ5A 4RD4A 5TVKA 4D4MA 1UKEA 5KTYA 5GVRA 1XMJA 3AUXA 1YZNA 1G8YA 3HPRA 1KK2A 1T4GA 3GLGE 3P27A 3HR7A 4YMTA 3VAAA 4OJKA 4C3ZA 2XZOA 2GJAA 4DDVA 1PLJA 1QZXA 2QP9X 3UMRA 2GEDA 2A5DA 2YC2C 2ZITA 1DVRA 4FCVA 2YKGA 3GLGA 1D9ZA 2XSZA 2H92A 3PXGA 4LJ5A 4TLCA 3BFVA 1EFHA 4N1AA 3RWOA 1JAIA 2X8AA 4JVMA 4IOKA 4FW9A 3MJRA 3VQTA 4CEIB 3AVVA 4EPTA 4B74A 2XOKD 1IN8A 2ZE6A 3A1WA 3IBYA 1G5TA 3NBYC 2WAYA 1YZGA 3LVQE 3LO5A 2CL0X 1FQKA 2W83A 3Q7QA 3CZPA 3T15A 1UPTA 1Z6AA 5EJEA 2A2ZA 1ZAKA 4IDOA 1XZPA 2G9NA 1XDBA 3FOZA 2C9YA 1L4YA 4Y0AA 1N6RA 2ZVQX 4HYYA 4O25A 1XWIA 1YU9A 4Q4HB 4DZZA 1CJTC 1N5KA 1HV8A 3GLHE 2CK3A 4N3NA 2D7DA 1ZUHA 1CLUA 3CUEF 4M9ZA 4QKQA 5JWHA 4PC1A 5KNCA 2O8EA 3CR8A 3FVQA 4EQ6B 4DEXA 2XZPA 3DPUA 5FPYA 3A4NA 1OF1A 2XNSA 2CE7A 3HJNA 3IHLA 1UKZA 2GDJA 2L0XA 3KFVA 2C03A 3A37A 4B33A 3DM9B 2WZQA 4Z54A 2F9LA 2AK3A 2JATA 4HAUA 5G40A 4FI3C 4CDGA 1CJUC 1EFCA 5GJCA 1YE8A 4IDHA 3ZZTA 1X6VA 1JQLB 2CL6X 1AZTA 2GJKA 4GMDA 1US8A 5DLQC 4DEYA 2P6RA 2N1BA 3UMFA 3QF4A 5A5GA 3A4LA 3WMGA 4ZDJA 1KY2A 4EPVA 2C95A 2QMHA 2JIZA 1EG7A 1IONA 1VCMA 3CX6A 5HR5A 2ZSDA 4AYWA 4PHTA 3I32A 3AKDA 3Q9LA 3UANA 2H17A 1S1MA 4IOLA 4KXFB 1TPZA 1FFHA 3HYTA 4IFBA 2GILA 4GBMA 3U44A 1S9HA 1A7JA 4M1OA 3K0AB 1UEIA 1Y63A 4HDCA 3DM5A 1AK2A 1MABB 2GK7A 4PC3A 3RRMA 1HTWA 3MJHA 4F4CA 2I4IA 1NY5A 1XEWX 3ZIAD 4A0HA 1DEKA 5B57C 3KQHA 4G5OA 1DAHA 1YKSA 2ZI9A 5GJVC 2ZUBA 1W49A 3W6PA 4P4SA 5FTJA 3UWKA 1OXVA 1W2GA 1IAQA 3B1ZA 1MO3A 2GBLA 1NI3A 1YR7A 1VG9B 1BIFA 3TSOA 2F1IA 1GRRA 4BZXA 2DYKA 1MH1A 2ATXA 2NO1A 4KFSA 4Z51A 5J4LA 4TMVA 4K8OA 3AF3A 2NIPA 2PMKA 1J8YF 2ONJA 4KFRA 4TLDA 4C0SA 4DLZA 1VTKA 2PT5A 3LVRE 2F6RA 4TYPA 2OO7A 4AWXA 3PCRB 4IHQA 4O3MA 1ZNXA 4N0DA 2VSFA 4C2TA 1SVSA 2HCJB 4FMCF 3AVTA 5DISB 5EE0A 2AD1A 1Z07A 4UNPA 3RS3A 1WBDA 4NH0A 3TK1A 1MABA 2ZRNA 4MYCA 1N0VC 2MMGA 2O5VA 4Z8XA 1FTSA 1HT1E 4IDPA 3R9XA 4OI2A 4CEJB 1Q1BA 5JJKA 3OEED 4Q18A 3ASZA 3U44B 3WHLA 3BK7A 2BKUA 3FTQA 3HU3A 1FMLA 2NG1A 2REOA 2NTYC 2ZJYA 4OL0A 2G6BA 4WAUA 3MRSA 4LHZA 5BXQC 5CITA 1Q0UA 4LHYA 2D62A 1JR6A 3T1VA 2HYDA 2WPDD 5JS7A 4D26A 1GDDA 3C5CA 3IPXA 2JCSA 3ICEA 2FH5B 2ZAOA 2NGRA 3K1JA 4JBXA 2FEMA 3NC1C 3L0SA 4PFSA 5JI2E 1UF9A 4FXPA 1Z63A 3KKMA 1YRAA 2Q0HA 4P31A 3MLEA 2D2FA 2XJ4A 2C04A 3ZS9A 4TWZA 4OHVA 2VPPA 3TBKA 2HF9A 2YHSA 1SULA 4QM7A 2IYRA 1E32A 1A82A 2PCLA 1NBMA 1R2QA 2R6AA 2ZANA 2QNRA 1H8HA 4JVLA 5L3QB 4JSTA 2ZU6A 1OLOA 3FKSD 2LKDA 2ZRBA 4NCIA 1OFTA 1XJCA 4IVQA 2ZJ5A 3LBNA 4LHWA 3U61B 3V9PA 1AGRA 5HE8A 3UG7A 4DHEA 421PA 5AJYA 2OHFA 1TL7C 2CCKA 1GOTA 1J90A 2J41A 4M9SA 5E4FA 1MRNA 4CGZA 4DCSA 2GBLC 2OESA 4HUQA 2G1JA 1KAGA 2IYVA 1IQPA 3GLFA 2VTKA 1LF0A 2KWIA 3RAPR 4M4SA 4KAXA 3RS2A 1YZTA 2QTFA 3QY0A 1CU1A 4M1SA 4Q00A 3BJIC 4OHZA 1Z29A 3KX2A 3RANA 3BBPA 4PHGA 1AQUA 4I1VA 4F91B 1M1YE 1P4SA 3CZQA 4GRAA 5KNBA 3RRNA 2W6ID 3TQCA 5IT5A 1DAIA 3LA6A 2VF7A 2JLQA 1SXJE 2IBMA 1Q57A 1UFQA 1PUJA 3HPQA 2W2XA 2ECKA 1WCV1 2A5FA 1EFTA 2RAPA 4G5RA 1XU4A 4QBHA 4M1KA 4LBWA 3BB1A 2PZFA 3AVPA 4IOJA 1WP9A 1G5RA 3B13B 3VMFA 3KDSE 4DIEA 4IJMA 2R6DA 3BORA 3FDIA 3ZZUA 3FB4A 2QEQA 2GCOA 4M1WA 1BS1A 4AG6A 3DMNA 2ZRKA 1AKEA 3LDAA 3KJIA 2GAAA 3P20A 4FWTA 3VR1A 1LVGA 1RYFA 2ZEJA 1EWQA 2VF8A 1IN6A 5KDDA 3ZYCA 4A92A 4XTRA 1ZUNB 4DLVA 4PZZA 1CRQA 1E9AA 4FD2A 4B47A 4Z8YA 5DYGA 2ZRHA 5FOTA 2OBNA 4ZV4A 4IVRA 2AFHE 4OK3A 2E87A 2HXSA 3K8YA 3QOFA 4LV6A 3WRXC 2PZGA 5KSZA 2BEJA 4M21A 3BWDD 4HLCA 3TUZC 1IY1A 2H57A 3UK6A 1TAGA 4TL7A 2QZ4A 1EXMA 3B2EA 4G3XA 2WKPA 2JASA 3J81k 2ZRIA 4KO8A 2ONKA 1N6NA 3LD9A 4DT1B 4HUQB 2OFWA 3K70C 2WSSA 1XX6A 5EE5B 3CH5A 5JHHB 3KQLA 3QSYA 1I4DD 2XSZD 4UNSA 3U7HB 5FL7A 2GAOA 2IYLD 1O3YA 1Z0DA 1X8KA 2W2VA 1E2GA 5BN5A 4RSGA 3I73A 1VG0B 1S3GA 1DO2A 4DDUA 4DLUA 5LB2A 1CBUA 1HEIA 1GL9B 2FSFA 1L8QA 4F92B 1M2OB 1TADA 4B3XA 4CZ2A 1VECA 2P5SA 3M0EA 3PEVA 5AR1A 1S96A 4I1OA 4ZI2A 3AB3A 3WHKA 3WNDA 1Z0FA 5TB5A 3HR8A 2GHIA 1Z28A 2W00A 2WBLC 4G1UC 4YXWA 5CDFA 1XPUA 1IXRC 2CK3D 4DCNA 3IIKA 3C41J 3LW7A 4E5UA 5FFMA 1JQJC 2BM1A 1XTJA 2ZRDA 1OFIA 3AEZA 2ZRFA 2VP9A 1U8YA 4P4UA 3K9LA 2V55B 2WWGA 1XD2B 3BIFA 1N6PA 3K9NA 5CK4A 4RZ3A 2WJGA 3THYA 1NVUQ 3Q72A 4G0NA 4LZZA 4RY2A 3GJ6A 5DHAA 5DO9A 1YR6A 2HDNB 2WJVA 2X77A 1TF7A 2JIZD 2QL6A 3I1FA 3JVUA 4JLBA 4WZAE 5HCNA 4OI1A 4XVUA 2EQBA 3IPYA 4D0NA 1RVDA 3FMIA 3HDTA 4EDHA 1DAMA 3QF7A 4KU4A 3CX7A 3LAWA 3OAAD 2GA8A 3K0FA 1XEXA 2VLIA 4M0LA 3IDQA 4JMPA 3QPUA 1TUEA 2TMKA 1B23P 1A2KC 5HZHA 1E9SA 1FNNA 3W8NA 3OIWA 1CXZA 2BJVA 2FZ4A 4R2IA 1P2UA 3JZMA 1KAOA 2V1UA 1S1CA 3LX8A 3MG9A 3K9GA 4KHZA 2DB3A 1ZD8A 4OI4A 3IGFA 3QPWA 3GQBA 4IDNA 3CF2A 5DN6A 1HURA 1GM5A 5IK2A 3RC3A 3Q5DA 3E70C 4NYMQ 1LB1B 1HH4A 3UG6A 2ZYVX 1EK0A 1OPXA 1R5NA 2XAUA 3EXAA 2AL7A 3QBVA 2ODEA 2PBRA 1VMAA 2WWFA 4MRVA 4M1MA 3U3KA 1Z2AA 1X3SA 2FPLA 2R6FA 3B78A 2IHBA 4KSCA 4QNMA 4D0LB 2UKDA 1ZIOA 2W6JA 4KBFA 3BOSA 2HLDA 1E0KA 1P73A 4GFDA 1GIAA 1Q44A 3WNCA 4KYUA 1TEVA 2Q3HA 3KQUA 2YZ2A 4QGFA 2HJVA 1WE2A 1DELA 1G3RA 4PC7A 3GLIE 1Z22A 1A2BA 5G3ZA 2IYQA 2REBA 2ZRMA 1E9RA 3EWSA 4DSNA 1CJMA 1H8EA 4KLZA 3RHFA 2QMOA 2QTVB 3SJBA 1W4BA 1QDEA 2GVZC 3TQFA 4B3GA 3H1TA 5HTKA 4A2PA 4LYHA 2ZI5A 1N3BA 4ZDWA 3GJ5A 1JJ7A 1KGDA 1E0SA 1NVXQ 3QF4B 4FCWA 1XTQA 3OAAA 1OYWA 2REXB 2O0KA 4HAVA 4XSHA 4CEHB 1NMYA 2LKCA 1Q3HA 2GWHA 4LJ6A 3T5DA 1RFLA 2BHRA 2CVHA 4ZDIA 3DOEA 2EFEB 2AWNA 4PSVA 2KJQA 2GJ9A 2UZ3A 3PEWA 2WSMA 3EAQA 4Q01A 3FKQA 3FHOA 1EX7A 3PITA 2NO0A 5EXSA 2GVDC 5FI1B 4LYJA 3TAUA 1Z8FA 2J7PD 3LV8A 4IFEA 2ZRJA 3AF0A 2JJ2D 5SZHB 3VHXA 3CNNA 3VR2A 2F3RA 3T06B 3LLUA 4BUJA 1X1RA 4LJYA 2IEZA 3N70A 3PIRA 1E6CA 5P21A 3VKWA 2ZYTX 3H86A 1LFDB 5EXPA 2O8EB 1GAJA 2VHCA 5IK2D 3EZ9A 1TEXA 2H5EA 1W5TA 2PX0A 1P72A 2OFOA 1M34E 1XMIA 2QSZA 1P9WA 4FINA 2CHGA 3NKVA 2EFDB 1CF4A 2WAXA 1NF3A 2KBFA 5E3HA 1UEJA 3U4QA 3GJ3A 4JLVA 1JEEA 2CXXA 3VTKA 2A3RA 4JLOA 4L15A 2BM0A 4IEIA 2IXFA 2WIAA 4TYWA 2VP2A 2CHQA 2FG5A 5FOVA 4CVNA 4A15A 3CB4A 4AG5A 3BGWA 3UPUA 1GILA 3AVYA 2GCNA 4LDJA 2OAP1 3EZ7A 4JLJA 5EE1A 4NYMR 4DUGA 2F9MA 1NLYA 4C0LA 4DLSA 1BOFA 2EWVA 2W58A 1X8JA 2OCYC 3RDPA 1BMFA 4JZKA 4DCUA 2OXCA 2NOAA 3CM0A 4Q1DA 4CW7A 2GXAA 3Q85A 1ESNA 4PAOA 1Z83A 2DWOA 3KUDA 4TSFA 4Q4AB 3W5JA 2FFBA 2DFNA 2RHMA 4B75A 2IUTA 4XD7A 5KOYA 3W8RA 5DNYB 4PAQA 1C9KA 1J2JA 3EZ6A 1GKIA 4FCTA 4PC6A 2O8FA 2FZLA 2YJTD 3QI2A 4JLKA 4Q4JA 1E2DA 4G5GA 4EUNA 3TGPA 2GRJA 1G9XA 3CPEA 4DJTA 1U0LA 1ZYUA 3Q7PA 1KZGB 2B7BA 4LC0A 3EIHA 3LX5A 4BEJA 2ERXA 2QQ0A 1Q1QA 1XD8A 2OSBA 4FMDB 4DLWA 2C77A 4B43A 1QVAA 3Q5EA 4ESHA 3IQWA 2NQ2C 2QAGA 1NMZA 3IO3A 5AJWA 3W6OA 3T1QA 4JSYA 4EFNA 1T3SA 3CX8A 3GLHB 4UNRA 4HAYA 1V43A 1XTSA 2QAGB 3EIQA 1KMHB 4B34A 4TYNA 1KOFA 2PT7A 5LBIA 3C8UA 1QHHA 4Q5IA 4RZUA 2RGNA 2Z6VA 4LJAA 3HWSA 4C30A 3BXZA 4FIDA 3ZH9B 4P0TA 3ASYA 1KDTA 4KFUA 4WVFA 2IX3A 1NN3A 2VO1A 2OG2A 4B2LA 2QGZA 1KO4A 2Q3FA 5KDOA 3BH0A 1KK1A 1K8RA 1RJ9A 4QJ3A 2V6IA 2C8VA 1F5NA 4GOKA 2WWYA 2O8BA 2OLKA 3LFUA 1P61B 2ZPTX 1IOZA 4GZMA 3KKPA 4EPXA 2KSQA 2GJSA 2O0HA 2ZVPX 4PXAA 4URWR 5EE3A 1H8ED 3ZQ6A 4MRPA 2QPOA 1MOZA 4LSGA 1S3SA 3W3ZB 3A1VA 1R8QA 1TX4B 4HDOB 1VCOA 1ZIPA 1SVOA 1RIFA 3BD9A 4G01B 4JS0A 2V3CC 2DY1A 2Z43A 3K53A 5KDLA 2VRWA 2WOJA 3QE0A 3MWLA 2NPIA 2FSHA 2XB4A 1T5IA 3THXA 3QXCA 1AQYA 3AKEA 4XTCS 1KO7A 1W0JA 5F3WB 3M1IA 3ICQB 3EX7C 1D2MA 2ORVA 3SC3A 1KZ7B 1G64A 3LXRA 3QJYA 3PEUA 4TMWA 4K46A 1G291 1KJWA 4M9QA 4S2EA 5JRJA 4URXR 4H9GA 1Z08A 4P32A 3ZS8A 4E09A 1JBKA 1OHHD 4PX9A 3A1SA 1FW6A 2W0SA 2G0TA 3FMOB 2BIFA 2P3SA 5JEEA 5EUMA 3RS4A 3CH4B 4Q66C 2LCFA 4V0LA 4D0GA 2A9KA 5F98A 1GL6A 3O8DA 2HV8A 3TE6A 1UDWA 1ZU5A 1ZNZA 5DE3A 3KJEA 5HE9A 1GITA 2I1VB 2YWEA 2O0JA 3S1AA 5BN3A 1D8TA 2QM8A 4GOJA 2YC4C 2JEOA 4GDFA 4AI6A 4BASA 3U6BA 1IN4A 1N5LA 3NDBB 2VP4A 4MDFA 1N25A 2P5TB 4NBSA 1S8FA 3IBGA 2BBSA 4KCGA 2CE2X 1OE0A 2D74A 2VL7A 4YMUA 1NKSA 1KSJA 3IEUA 1T91A 1E69A 1OH7A 4Q02A 2ODBA 3FGNA 1P2VA 1D5CA 1Z5ZA 2A7QA 2WPDA 1DPFA 2IW3A 1E79A 4OK5A 2PJRA 4ITRC 2GZAA 4C2UA 2Q6TA 3OE7A 1NG1A 4QGAA 2R65A 2AKYA 1NN1A 3IO5A 4V0KA 1FMJA 3CRQA 1N6IA 3TRFA 4R9UC 1P2SA 2UVQA 1OXUA 3B9QA 4A8JC 4URUR 4XH9B 5DHFA 2DPXA 3NDPA 3VR4A 4JBYA 5GJWC 2F43B 3EZ2A 2CCJA 3AGQA 1II8B 4M1TA 3B1WA 3L0IB 2QGNA 2CJWB 3QNUA 4D4JA 3AKCA 4HUTA 5JLJA 3LRPA 1OKKD 1H8HD 2FN4A 1FZQA 2EFCB 1NJFA 4XWOA 1IXZA 1W36C 2IS1A 2A5YB 2XTZA 8OHMA 1XMVA 3I5YA 2IF2A 3MMPA 5JCPA 4DC9A 3DMDA 2OAQ1 2WMNB 3KJHA 5K8LA 1E99A 5FTNA 5CLLA 3ADBA 3THWB 1R4AA 5EUQB 4LC1A 5SZIA 2GK6A 1D6JA 4RD3A 1ANKA 2EWWA 2DBYA 1UKVY 3U2QA 3H4MA 3OIYA 5JJLA 4RD1A 4TMKA 2IXGA 4BRUA 2WKQA 3ZD7A 4NCNA 1W4AA 1W2HA 2AXPA 3BH7A 1N5IA 1XEXB 3K0FB 3SFZA 2CLSA 1ETUA 1XCGB 4A36A 3ECCA 2FFQA 3DKPA 2H7VA 3KXLA 5JSZB 3AM1A 3I62A 2VQSA 1FP6A 3P4XA 4MUBA 4PPQA 3AGPA 3DO6A 3Q8XB 4A2WA 2HF8A 2C2HA 4KFTA 1HA3A 4JVNA 4MGYR 2WVJA 4AKGA 4PPNA 5FTMA 1TMKA 3THYB 1RPZA 2IS2A 3TW8B 3F0TA 1XD2A 4D6PA 2OFXA 2ZI6A 4R7ZA 2F7SA 5FBRB 3JVVA 5LB4A 3CONA 1YQTA 5JMTA 3F5FA 4AK9A 4BZQA 5HKKA 1M8PA 1SXJA 3BE4A 3TKLA 5E7JA 4US1R 3LLMA 2FGJA 4E03A 1EWRA 2P67A 2Q9AA 2GXSA 4QBGB 1F2TB 1ZM7A 2FE4A 5D3MA 4R2HA 2BMFA 1X86B 1G7RA 1B0UA 1T8TA 3R9WA 3U7GA 3RRZA 1E2FA 4B71A 3WP0A 1T3HA 2BBOA 1XRJA 4HLQB 5AUQA 1K6MA 3CPHA 4EPWA 1COWA 2GF0A 3T35A 2I3BA 1A4RA 1BYIA 1PLLA 2SHKA 3OFND 4I99A 2I1QA 1SQ5A 4JLNA 1ONBA 3RVBA 4RCZA 4NYIQ 4LWZA 4NKRA 2BKEA 1U0HC 2ZUCA 1WQ1R 2WJIA 1ZC4A 4D80A 1W0KD 5C4MA 3GEHA 3BFXA 5JBQA 4L5BA 1U90A 1ZNYA 1WA5A 2CLCX 2N46A 4FWIB 5D3MB 1YR8A 4QGGA 1F2TA 2J59A 1VYTA 4BFXA 4DT1A 3F3YA 4XWKA 2WKRA 1RRFA 1H65A 1R5OA 3K0CA 5G3YA 1SXJB 4TL9A 2ZSEA 621PA 5KU1A 3OEEA 3AQ4A 1GZSA 2E1RA 2AWOA 2BCJQ 4AURA 3QKSB 5K8UA 3O8RA 5DIFA 5KUTA 5L8VA 4O0MA 1NVVR 1E2MA 4WBSA 3K0CC 4Q9LA 3BB3A 4C0QC 2HCBA 1JB1A 3AVOA 3CRW1 3GJ4A 1ZNWA 4CF7A 2C99A 4WXPA 2B6HA 4PANA 2AHOA 4OK6A 3GFPA 2X19A 4TTRA 3WP1B 1IY0A 4TTQA 1T8UA 4TMZA 3V00A 3WYGA 2GCPA 3IHWA 4HAZA 2BOVA 4IDQA 5L3SA 1ZM9A 3QENA 1NN0A 1VKJA 3GD7A 5FPKA 4MQBA 2GKSA 3EIEA 5H1YA 4HLDA 5EP1A 3OF5A 4C0HA 1G3QA 4JJKA 2XOKA 3R7WB 3SN6A 2ZR0A 1KSGA 3EA5A 2F55A 1FL9A 4DKXA 5FOSA 4JYCA 5J4HA 2ZJ8A 2QTHA 2XXAB 4YXWD 1OW3B 1XZQA 4V0MA 4TYYA 1L2TA 2IT1A 4LJ7A 2RCNA 3RNLA 2NMVA 1M74A 3QXHA 2GF9A 5H70A 3OIVA 4JBWA 1ZCBA 3WRYC 1T0HB 2QPAA 4IOMA 5AUNB 3DHWC 2QSYA 1RW4A 4AKHA 4Q21A 1FUUA 3L8YA 2J5XA 2QY9A 5DI3B 1N6KA 2XB2A 5DYIA 2KBEA 3V4RA 1GFIA 4S35A 3WNBA 1G7CA 3LQQA 3UIEA 3LY5A 2CJWA 4LV5B 5H8WA 2ZSFA 4CIDA 1P9RA 4NZYA 3QEJA 1E1QD 3A8TA 3E2IA 1GWNA 2ZETA 1KTVA 4EKDA 3G5UA 3TSZA 1G6OA 5HZKA 2CBZA 4DWJA 5KPDA 4B73A 2VH5R 3AP2A 4V0ME 4AC9A 3GLFB 3AF2A 2J9RA 1XF9A 4MGZR 3ZZ0A 2AXNA 2Q9BA 4URYR 3TJZA 1AZSC 4U7DA 1XP8A 2C9OA 2VSXA 4Q9JA 3B7GA 5CM9C 1QRAA 4TLAA 3JZAA 3I8SA 1YR9A 3QBTA 4EJSC 2IYYA 4F38A 1XTKA 1W0JD 1UAAA 5EQTA 1R7RA 4TZ6A 4F4IA 5L3QA 1N0WA 3CWZA 3X1YA 1EFRA 4EAQA 2CLDX 2JLUA 1Z6XA 1Z0KA 1E2IA 1ZD1A 2FF7A 4MGKR 3SQWA 4PQRA 2BCGY 2PEYA 4Q7MB 1Z0AA 1IY2A 3SYLA 4UJ3A 4LJ8A 1IM2A 2FV8A 4UXHA 1LS1A 2ASEA 3CBQA 2YOGA 4XSGA 2PX3A 2ZRAA 3RS0A 3SDZA 4NYIR 2WWIA 1DBSA 1YHNA 2ZE8A 1G8GA 1Q1ZA 5EXXA 1UBGA 3EC1A 2V6JA 1XFAA 1JPJA 4MGIR 2ZI3A 1ZVQA 1XXHB 2QP4A 2WJYA 2QA5A 2R6GA 4PTLA 3L82B 2QRZA 1JI0A 3DVLA 3QXJA 1LV7A 1E2LA 1KI6B 1TU3A 3ADKA 2P6NA 5CM8B 3THXB 2HEIA 2X2EA 721PA 2D3WA 2QP3A 4ZCMA 3NHAA 3IQXA 1G16A 2OM2A 3U3MA 3SQXA 2J0SA 3FHCB 2F1HA 3QVUA 3UXMA 2GTPA 2JAQA 1W5SA 2YWFA 2IEYA 3RABA 3U3JA 3W6NA 4BLOA 4NDZA 3U60B 5LDDC 3X1XA 1N5JA 1MR3F 2AD5A 3H84A 3OEHA 4TQ9A 3KQNA 2V54A 4MKIA 2GZHA 1KNQA 4M2LA 3NBZC 1OKKA 3QKTA 2CMKA 4ILEA 2HYIC 2Z4SA 1KKMA 4IVPA 3EASA 4A9AA 3QVVA 1AS3A 1UDXA 2ZUDA 121PA 5FR2A 1G5PA 2QT1A 1GRNA 2NPFA 4B35A 3D7MA 4P4SB 2WHXA 1EGAA 3I8XA 2OILA 3PR1A 2ZRLA 3VHLB 1OH8A 3PEYA 3I3SR 1X1SA 1KJZA 3IIMA 2P0EA 1NMXA 2YWHA 3U7EB 1Y3AA 1P62B 2OXRA 2WWXA 4QJ5A 3K0AA 1HUQA 5EZ5A 1P5ZB 1NG9A 4ZCLA 1DAEA 1FTNA 1OYYA 4UQOA 3SU8A 3X1WA 3L43A 4KITB 4QNRA 4TYQA 2J7KA 4HSEA 3TSWA 2WOOA 2VA8A 3NC0C 4Q1BA 3FYHA 4Q9HA 1JR3D 5KO2A 3BC1A 3B60A 3OESA 1JALA 5TV2A 2BMEA 1E9CA 1JECA 1VYUA 1W4CA 2H18A 3NEYA 4GP7A 4A82A 3I61A 1X8LA 4BECA 3TLXA 4C7OA 1E2NA 1LNZA 1SHZA 4PSAA 1IJFA 5C46F 2J45A 4LJ9A 2OBMA 3KKNA 2OT3B 3G82C 2VSOA 4MITA 1OB2A 5DGXA 4XJXA 4B44A 2ZQ5A 1SGWA 1VCNA 3DKVA 3UWOA 4KSBA 1Q12A 1SHKA 3D6TB 2N42A 1UADA 2DFLA 4Q4AA 4GMXA 4BFZA 2QE7A 1HQYE 3OIUA 1P3JA 1ZJ6A 2XTNA 4NP6A 1KI3A 1P9NA 4ZPXA 1TQ4A 3L0PA 3B82A 5JHGB 3QKUA 3QIAA 5AK0A 3MSXA 1OV4A 4UNNA 4QFMA 3KFXA 3O8CA 2KI5A 5HKKD 4EQ6A 5JCZA 1VYVA 5A4JA 1AM4D 1N6OA 4HAWA 4O2LA 4EPRA 4TT3D 4PPFA 3CPJB 1FPMA 4OQLA 5F2EA 2PJZA 4Q4HA 2CCGA 2V7QA 4A4DA 4GZLA 4LYAA 3U4QB 1PZNA 3SBDA 1PJRA 2IYZA 3NH9A 4TLEA 1G3UA 2XNDA 1KI2A 2IYWA 2W0MA 3EC2A 1DADA 3EPJA 3B6EA 1RRCA 2ORWA 3VKHA 2RH5A 2W6JD 3TR5A 3EWAA 3T12A 1NRJB 1OXXK 3KTAB 1HYQA 5IDVA 4CEIA 3DZDA 4RVCA 2R2AA 1GNRA 3TAHA 2GZDA 2B7CA 1U8AA 3LWNA 4JT4A 3IEVA 3O8BA 1JR3A 1E4VA 4QM6A 1SXJC 1BKDR 3E5HA 1E9EA 2KE5A 4LX0A 3AKYA 1GTVA 5FOXA 5ELXA 3VR3A 4XIGS 1HE1C 2A5GA 3QXSA 5FL3A 2ZI4A 3SS8A 5AUPB 4LBVA 1MRSA 2XTMA 4XWAA 4GOXA 3SEAA 3LQRA 5JJIA 3BRWD 4TL6A 4OHXA 1R10A 3M6AA 3NXSA 4JYBA 4CYMA 4BLSA 5JEDA 4HAXA 4CEHA 1R6BX 1D2NA 4BLPA 1FUKA 3RC8A 1QHNA 1PLKA 1R0WA 5FBWB 2ZXUA 1E2JA 1SVWA 1R0ZA 2MSEB 4RD2A 1CJKC 1XTIA 2B8TA 2BBWA 2ZTSA 1CEEA 1K5GA 3C14C 4LBZA 1F60A 1XMSA 2BV3A 3NVAA 2JLZA 4DSUA 1E94E 4EIWA 1E2EA 2ZSAA 4QOSA 2YINC 3LH5A 4KYIB 3UKDA 1OIXA 4EPYA 1F2UB 3IILA 1NP6A 2DWPA 4IRUB 4MYTA 3V4FA 1SVMA 3C5HA 4CT5A 3WYAA 1R8SA 2XNDD 1UJ2A 1W46A 2D7CA 2EFHB 1SKYB 3K0EA 3LW8A 2FFAA 4OBEA 3LBHA 1DG3A 3RRYA 1SVLA 3K9HA 5TY0A 4KODA 1G3MA 5KHOC 1G20E 4C0AC 4TQUS 4M1YA 1E2QA 2IYUA 3LXXA 4D25A 1C1YA 3MCAA 1GKUB 2FOLA 2NO9A 3P32A 3HU1A 5FPTA 3U5ZB 4J0QA 4GPTA 3AH8A 1PVOA 1ZCAA 4JLPA 4NCJA 4OQXA 4RCYA 4ERNA 3SE0A 3EZFA 2XITA 5KSPA 5TARA 1E1QA 2O8CA 3W34A 4HZUB 5E95A 2QAJA 2F3TA 4RKFA 2J1LA 4LBYA 3NBXX 1E79D 1MV5A 4B48A 1J70A 2IWHA 4FMBB 2RGBA 4JLAA 1KSFX 4RKEA 1ZM4A 5L3RA 2ZREA 2V1XA 4NYJQ 4BLTA 4M8NE 3ADCA 4FMCB 1KI6A 2OCPA 2ZROA 3EARA 3B9PA 3RSLA 3ZVRA 4F93B 1XXHA 1Z6TA 3QUSA 1CTQA 2W2TA 3VU9A 1U94A 3NTUA 4O2RA 4US0R 221PA 2JGNA 3CWQA 2KB0A 2ODWA 3DEFA 3MD0A 1IJEA 3BAFA 1CS4C 1MO5A 3SR0A 1KDRA 5CB6A 1E9DA 5JFGA 4LUCA 3FFBA 2V7QD 2JA1A 1YJ5A 4RZXA 4B2IA 3EPKA 3A36A 3PUZA 4Q48A 2QBYB 1CRPA 3VU9B 1KK0A 2VHTA 3PUVA 2R62A 2ORIA 5TMPA 2YOHA 3AV0B 2OBLA 2RHDA 3KJGA 3MWYW 6Q21A 1Q22A 2IF0A 3CIOA 4PO9A 4MKFA 2C9CA 1CP2A 1W48A 1TQDA 2WJHA 4HDQB 4L9SA 2IXEA 4PO8A 4DB4A 4HB3A 4DSOA 1JNYA 1CR4A 3RSOA 3CRMA 4HLUA 2H1LA 2RGCA 4CT4B 1KHTA 5KSYA 2DCUA 5CK5A 1WF3A 2HT1A 3U6KA 3AP3A 1S9DA 4QG7A 4MYHA 3SJCA 1OFHA 3I5XA 1YZLA 4BFUA 4GSYA 3KB2A 3ZJYA 4U00A 1ELOA 2NZJA 1DE0A 3R20A 2X2FA 1XB2A 1L4UA 2JJ8A 2G77B 2YOFA 3VR6A 4LI0A 2EVWX 2HJGA 2O8CB 2QENA 2QAGC 3SOPA 3PUWA 3K0SA 3P26A 3RS7A 3TIFA 4Q7KA 5K8TA 5DSZA 4G5SA 1Q21A 5EE9A 1XPRA 2OEPA 1Z0JA 2GJ8A 4YC7A 2GNOA 2CHVA 4NYJR 4C4PA 3DOFA 3TMKA 2ZM5A 1ESMA 1V5WA 4A8JB 3MWKA 4C9BA 4QBIA 4LV8B 4HEJA 5C2JB 4YDHB 3W3AA 5ANRB 4PQYA 1BYUA 2DWQA 2ZRCA 5HCIA 3FFAA 5E7MA 1OHHA 1GKYA 1NLFA 5BN4A 5EXTA 2DHRA 1NBMD 3AP1A 3HU2A 3KQKA 1KKLA 2XGJA 5FPHA 1D2EA 4W9MC 2FDCA 4X8HA 3WBKA 3UATA 1Z47A 4IW3B 4D2IA 1R0XA 4A6PA 1ZMXA 5GVSA 1G21E 5KYKA 1NL3A 5TDHA 4X8LA 1CR1A 3N5CA 1WBBA 5JECA 1TU4A 2ZJAA 1TQ6A 1I4LD 1E1RA 3EPLA 1I4TD 2WTUA 3GLIA 1D9XA 2VHJA 2XXAA 1Z2CA 2Q3MA 1BH2A 1U0JA 2CL7X 5UKDA 1E9BA 2P65A 3ND8A 2R6CA 4UXIA 3B8HA 1AS0A 3I92A 1FQJA 2O8DA 2J3EA 5CIWA 4I1UA 1WDTA 5LD2C 1A5TA 3D31A 5FTKA 4AYXA 4R71A 1II0A 1NVVQ 2EFGA 4E07A 3SHWA 5L3SB 2V4ZA 1AS2A 2W6IA 3ZD6A 4B3CA 3B1VA 5DH9A 4TTPA 4BFTA 1CR0A 3SYKA 2VHQA 2A78A 1NNEA 1Q20A 4Q47A 1U81A 4B3DA 4B6FA 1AIPA 5HPYB 2E9SA 2Z83A 1VPLA 4JLDA 1LY1A 1KYIA 1BMFD 1ZM3A 4V03A 1OH6A 2XJ9A 2GESA 3ZGXA 4KVGA 2P2LA 4DVGA 4NCHA 4DXAA 1F3OA 1BO6A 4ZCIA 4X8MA 3W90A 1GRQA 1UBFA 4NTZA 2OE2A 3KTAA 4XD7D 3K70D 1E0JA 5EP3A 3L2OB 1S4QA 3MUFA 4ACAA 5BYKA 2QORA 4MA4A 3T61A 2FX3A 3A58B 3QKRA 1DTSA 4NPHA 2RGEA 4JL6A 1OSNA 3WMFA 4L8GA 3ZDQA 4MRRA 2J0QA 1AA9A 4C0BA 3CLVA 2Z5FA 3PQCA 5KNDA 4D4LA 4BFWA 4LOAA 4A1FA 2QN6A 4NL4H 2IS4A 2RGGA 5KPJA 1XEFA 3L8ZA 2AK2A 2MSCB 3VNVA 2HXYA 2BC9A 2J0UB 3PENA 4Q1CA 4QC2A 4B3FX 4WIAA 5AWFC 521PA 1E1RD 2UZIR 4ZDKA 1ZBDA 2BJWA 4QHSA 3SHFA 3WXMA 4PQFA 2OV2A 1HE8B 1JXMA 1G7TA 3KUCA 2ZR7A 4ZKEA 4BRWA 1GP2A 1WB9A 1NLZA 3IKJA 2VIIA 3E1SA 2PEZA 2QROA 4QJ4A 3TUJC 3CW2A 4KLNA 5EP2A 3IIJA 1VHTA 1ZD9A 3DZ8A 2IHYA 3AF1A 3TVDA 1G17A 1XJ0A 1Z6GA 1R5BA 2V9PA 4UNQA 2BVNA 2AX4A 3BERA 4QRHA 4C7OB 4F7WA 5BWMA 4WZ6A 1O87A 1E9FA 1M7HA 1G7SA 1J99A 3I72A 2MMCA 2ZIAA 2XEXA 5FUWA 1KSHA 4JVSB 4BLQA 1N6LA 2G0NA 2FMXA 3OE7D 2JLYA 3A1UA 1NIPA 1M6NA 1E96A 3K09C 4LK2A 3TH5A 5JSZA 3PV0A 2FPKA 4DCVA 5J4YA 3ZQJA 1SXJD 2ANCA 2RGNC 3Q3JB 5K8IA 4CEJA 2ZI7A 4Q1EA 5SZKB 2O52A 2YNMA 3K09A 2JLRA 3T1TA 4HB4A 4JKYA 1NN5A 4LGMA 4WOPA 4ZO4A 4TLBA 5FUYA 2ATVA 1DAKA 4MRSA 4AIIA 4ARZB 3KZ1E 5FOUA 1KO8A 1XBTA 1IXSB 3VNUA 2D06A 1Z6YA 4Q7JB 4GI7A 4P4TA 1W44A 1Q3TA 1W47A 4YONB 3EA0A 4PHHA 2GEVA 5F9FA 4B76A 5IHPA 2ZRPA 3OHMA 3I4LA 2D4HA 2VP5A 2ZS7A 2BDTA 2EYUA 5AUOB 3T34A 4DRZA 821PA 2EYQA 5E7IA 1KIMA 4QGHA 1U9IA 1TUIA 4DB2A 3MGCA 1R0YA 1OXSC 1II8A 2XX3A 4JJZA 2F43A 4AYTA 4YDSA 5B64A 1J8MF 2DR3A 3N2IA 1U9IC 1OJLA 3FPAA 4AD8A 4BQSA 1W4RA 3PG5A 3B85A
chains in the Genus database with same CATH superfamily
4G8CA 1NUSA 5AHRA 4V0OA 1BDBA 1VG1A 3SI7A 2IEGA 2SBTA 4Z0HO 3CMCO 2JL1A 4LYFA 4MCHA 5HF8A 4BPBA 1FDTA 2FWRA 4Z1MA 3BGOS 2BR3A 1U6JA 3KT0A 1T9BA 2PWAA 2I91A 1ONOA 4TWJA 4TWRA 4DBLC 2BEUA 4R6XA 3WG9A 1Z6ZA 2WWHA 1RJDA 4P3YA 3TBFA 1Z8NA 4DXDA 3LXMA 3RIGA 2VH2A 4JIMA 4IXMA 2XYRA 3OJFA 3REGA 4C04A 3ZVNA 4NF2A 3A4MA 4J0JA 2MOKA 2XGOA 2YWGA 1TRHA 2JBWA 4TMTA 4JEMA 4L76A 4EHFA 1I2MA 1GQQA 2C88A 2R00A 4KPGA 4UJ5A 1QIDA 1T9HA 4U2BA 4X8OA 1FQWA 4ZJYA 5LQAA 3IALA 1SHJA 4MUXA 5BSRA 2JAUA 2ZLBA 2QDKA 1BDJA 1NJ5A 3OJLA 1GT91 3K5HA 4KQGA 5IKOA 5AW3A 4AY2A 2C84A 4AZSA 4R6WA 1KI8A 1X14A 4A8PA 2GZ1A 2OWEA 2QT0A 1Z06A 3GIDA 3CNOA 3NHMA 5FBKA 5DTRA 3PHIA 4IGEA 4LWPA 1G18A 1JDSA 1NURA 4QDTA 3PDIB 3N8GA 1JQKA 4MWGA 4YTEA 5DMHA 1NT4A 3SSNA 2C3YA 1HQKA 1VCIA 1POXA 5M04A 1K6XA 1N2ZA 4U5QA 5FORA 4LFBB 4CM1A 1TF2A 5CFOA 1Z6PA 3MJDA 3UJNA 1Z2EA 3MT9A 4H4EA 4W5NA 3MMXA 2I8CA 2AVNA 3GRYA 2OXFA 3ZU6A 4ZT6A 3VZBA 5EYPA 5JXJA 1O5TA 4DV3B 1P7CA 1C4XA 2ZBFA 3VBEA 4A0SA 3PC8A 4GLBA 5KJFA 2GEKA 4Q9KA 1FX0B 1GG2A 1ISSA 3VVCA 3W5VA 4M60A 1UM9A 4AZTA 3PC2A 3EA4A 4XOIA 3A9WA 3HSKA 1P6UA 3WV4A 2WMYA 3HYRA 3JRNA 4BWYA 5JS8A 4KE9A 4BGUA 4HMPA 1JNXX 2ZE7A 2C97A 1EWTA 4MAAA 3DH0A 1DAPA 1AQIA 1GADO 2JAPA 3CISA 4LHVA 4HC4A 4LTMA 5LUAA 1LLDA 1VIYA 3HCDA 4ON9A 4PIPA 4CMJA 1P77A 3H42B 2XQFA 3NHPA 3HEAA 3H2GA 3P9XA 3UTCA 3AR5A 3G7NA 5DNEA 1C3XA 3C15C 4TZKA 3OJWA 4W5JA 2FG7C 1TQ2A 1QHYA 1ST2A 1E60A 2J30A 2WZBA 3UK7A 1AKYA 4RJJA 3WO1A 4EO7A 2L82A 1HDIA 5E2AA 4YCLA 1XR3A 4J76A 4Y1FA 4H08A 3EUWA 3GMTA 1FOEB 4WDRA 4A2QA 4D41A 3IESA 3VISA 3WLMA 4E33A 3R0QA 2IXAA 3O5AA 3QVTA 3N05A 3CTMA 4W7SA 3R9KA 4FM9A 1Y42X 3KV3O 4QPNA 5KYVA 4H2DA 3PICA 4OMCA 4QUGA 4Y7DA 5F9MA 4MQLA 4CL3A 2YNMD 4Z7QB 1RI4A 2JA2A 1NVDA 3CH6A 4XVRA 3WADA 1V9LA 4D9GA 4YAIA 1M3SA 2Y1OA 4JKIA 2GFHA 1G8PA 3ABRB 4PSKA 1I13A 4DIFA 4FB4A 4MWTA 4OKIA 4TKVB 2RBEA 1HPLA 1Z5UA 1OLSA 3VJLA 2ODAA 5CA0F 1NBEA 3EC7A 1U7UA 1VHLA 1WHTB 2G82A 1KXJA 4X7BA 5FTLA 1B3RA 3ESZA 4HTFA 4JGIA 5KOJA 5DI9A 1QHHB 3VDMA 3S40A 5BWNA 1ODIA 3CUSA 4D3XA 1RYHA 2O5CA 3VSCA 3OT1B 2HJHA 5G41A 5MF6A 4EKNB 1DO0A 1WPRA 2AFHB 3DGEC 1KJQA 1W1WA 1Z4JA 1EKXA 2QD4A 3NVMB 4XQGA 4EI9A 1AY0A 2K4MA 3HNOA 4NECA 3H1AA 2A0KA 1B6TA 1TT5A 2ZUWA 1DT5A 3BVPA 3FKSA 1AHPA 4JJEA 3S28A 3RF6A 4KIGA 4RV9A 1U5CA 3VC7A 1AZWA 3GT3A 2G1AA 1KEEA 1U7XA 3IBCA 3KOUA 1D1QA 4MP8A 3GUYA 2JLVA 1LTQA 2B8NA 1T0UA 4IO0A 2PLFA 4LJKA 5BQOA 1L6RA 4DIDA 2UVPA 3X2SA 3BB4A 3E0QA 4J9VA 1ADBA 2BZGA 1QVRA 3KYDA 4N82A 2NV2B 3OM9A 3QPCA 3UOGA 5JZ9A 1Q7TA 1M75A 1MO6A 3EDOA 1H9BA 1FK8A 3PT9A 3FAKA 1GD1O 1ZEJA 4NWIA 1FDUA 1TM7E 1GUBA 2BFBA 4WECA 5LZ5A 4CKCA 5C5EA 4X66B 1VSUA 1RYDA 4RH0A 4CN8A 5TXGA 2XCQA 1T2AA 4N18A 1TYEB 1Z38A 3NO4A 4JB2A 1S2MA 4AJ4A 1Z16A 4RC9A 2J3KA 1J33A 1HFEL 3CVVA 1R8JA 2DKOA 4YO7A 3BUSA 4JEIA 4FVTA 3Q8WA 4AJPA 1N0IA 1AGPA 5BNFA 1O58A 4ABYA 1HKHA 1K5DA 3UC9A 4U1RA 4OHWA 1FVFA 3T1NA 4QTTB 1BS9A 1ISJA 2A14A 2JPDA 3EJWA 3PNOA 3TOSA 2VDNB 1E2KA 4IH4A 4MKGA 5AJVB 2P9CA 2PX8A 3QFHA 5FFFA 4DLRA 3T0IA 1EFRD 4OBWA 1V5FA 1A5BB 1DXYA 1RWKA 2JKYA 2QUIA 4Q4LA 3TSYA 3ADOA 4U5XA 4BVLA 5AO9A 4DLTA 3DP9A 5IDXA 1H0SA 5IAGA 4H7DA 1GTG1 2VYNA 1ZH8A 5K8CA 1GV1A 1UC8A 3A2NA 4WNCA 1ESCA 1F0PA 3E3NA 3JALA 4QL3A 1UXIA 4ROSA 3HB0A 3SM3A 3CVXA 3FYUC 5C5DA 2IHUA 2O14A 2PUHA 1IN1A 3ESBA 3UC5A 2DE0X 1JSCA 1OUMA 2LWIA 2DUMA 5IP5A 3UBMA 4F4UA 3B1XA 2L69A 2OXEA 3CVYA 2PLNA 1EUQA 5IJWA 3H19A 3DGFC 4ONEA 3CS3A 2KLHA 3B6KA 3TW8A 1FP4A 2OORC 2QNIA 5EUBA 3ZNNA 1OA0A 1U8XX 4BFYA 4BGDA 3P1JA 3HS3A 2GPWA 1M2FA 1QYCA 4GVLA 1SD5A 4KQXA 4RKWA 3WDKA 3KTOA 1XP5A 3EEIA 3V1UA 3W5IA 2QM7A 5H9WA 2XGSA 3RJTA 2BMDA 3DTVD 3E23A 3ZW8A 3K3PA 1RIIA 4MQ6A 1Y6QA 4WQMA 2G3YA 4JKOA 4KBGA 1B1CA 2F8LA 2HJSA 5CXUA 5A2GA 1A9XB 1NBME 5ITWA 1MT0A 1CZOA 2QUHA 3TIVA 3KYJB 3JARB 5EZQA 3GV0A 4GR4A 3WA6A 1GU7A 1NY6A 1Y1QA 1VL2A 1QCYA 2AN9A 2IOQA 4OMDA 4A8HA 4EFLA 5BYJA 5KS2A 5KNBH 1A96A 2WUEA 4RF5A 2O23A 4LXQA 1XVVA 3G9TA 1VPEA 3TLJA 3PL1A 3DLCA 5K0JA 3NW9A 4EH1A 3THWA 2X7XA 1O95A 2PKWA 2WVHA 3K8ZA 2XNJA 5CYGA 2EZTA 1F38A 3ZYZA 1DIAA 1L5ZA 3PD1A 1ISRA 2JLSA 3D0OA 1ML4A 2O2GA 1J97A 3WC4A 4BVGA 3AF6A 2P7HA 4GGPA 4IHJA 4D57A 1KFCB 3S3TA 4ZKDA 3FYDA 1LNSA 5A1JA 3C7KA 4XGKA 1YVRA 1O96B 1GAWA 3U17A 4MNTA 1ODFA 2NU8B 4HN2A 2R60A 3ELYA 1UJMA 3GUCA 4TL8A 3TBHA 1W88B 1X7HA 3E05A 4EHJA 1W76A 5LKAA 3EEBA 1ZOSA 3AU9A 1UDAA 5CPFA 4PLFA 4QODA 1MP0A 2GEUA 3N2ZB 4G8BA 3MJ4A 5TGZA 3CR7A 4O63O 2IP2A 2BJHA 4IHJB 4JI0B 1JR3E 2YFQA 4W5HA 4O02B 1YL5A 4YCAA 5ALIA 3BKXA 1O9GA 1AK9A 4IMRA 1EVEA 3UHFA 4GXQA 3LDHA 1ZW6A 3KB6A 3FHLA 4WXMA 5KWIA 2X42A 5BSGA 1GVHA 4NONA 1HDXA 3TTVA 3DT9A 3NGLA 4X24A 1PWYE 1EQ2A 3W5BA 3KM0A 4YR7A 3HYLA 1TU0A 1E4YA 4ITVA 2X1VA 2Z58A 5T4EA 3TVYA 4U02A 4BQIA 1XD9A 4OY3A 4KPUB 2G63A 2PZ8A 3TGLA 4OA8A 2VJNA 4S0ZA 5KQLA 1QFMA 1DOAA 3F5MA 5FNVA 1P1JA 6LDHA 3FUTA 1UAYA 5DNUA 4L5IA 1SBHA 2EU8A 1AN0A 1CNEA 1T6XA 3FPHA 4I9GA 2VHYA 3C4JA 1DKMA 2N1MA 2YWDA 3K6SA 2CJFA 3GFRA 3WOVA 2GCGA 4YLGA 3OQMA 3V4RA 3LY7A 2WM9B 3SPXA 4P7KA 3OKCA 4RXTA 4KV7A 2JDIA 1V6AA 5DSXA 1CUEA 1F8YA 1O94C 2XQVA 4GNRA 4TLLB 4ZRNA 2FP3A 2VAWA 5A5DA 1TNDA 4GLLA 1N2BA 4MWSA 3AUUA 1IBRA 5BW8A 4NFSA 2QVXX 3DBHB 3LNCA 4ZTZB 1LS6A 1GNPA 1UBEA 2AFIE 2HO4A 2Y8EA 3JWIA 5H68A 5TNXA 1FS6A 5BQXA 4JFRA 2XDQA 3UAYA 3HB7A 2GO1A 3FLEA 1DAFA 2IYXA 3HCAA 4FQ8A 2I0FA 1R4MA 2X6QA 2Z2XA 4ACBA 2HWWA 3H9GA 2IYTA 4A73A 1E66A 1MFZA 2JIQA 3CEMA 2V7TA 1DXHA 5IDQA 1GG8A 4EVIA 3KJQA 5JVDF 1VJGA 2EEPA 2GZ2A 2C3UA 4ZI3A 3R8FA 1JHAA 4DYVA 1PL8A 1F6BA 1Z15A 1GGVA 2Q07A 2PZEA 3NHJA 1PS8A 1KY4A 4YDRA 4Q82A 3RUAA 4DCPA 1XZCA 1GZUA 5D3QA 3IFSA 4ZO7A 2O9JA 3TNJA 4PZ0A 1T0JB 2DTEA 1B8VA 1ZK1A 2JGAA 2ZB3A 4F4JA 2ZUFA 1HNXB 1V37A 3WYEA 1XZAA 1X7WB 3AZQA 3DBLA 1TT7A 4K1XA 2IGTA 3PUXA 1ZUIA 1H85A 2CL5A 4K6OA 4KK3A 4JXXA 1PL0A 1BHSA 5E0KB 4NBLA 5F7XA 3OIDA 3PFIA 3TVTA 3ZWQA 3GJTA 5AOBA 2Y9PB 3OZFA 1MO4A 2D1SA 4LOIA 4RFSA 5EWJB 4GWLA 5I9SA 5BV0A 3HJBA 3ELWA 5A4AA 4IMJB 2CFOA 1Z7BA 4HWPA 5EJGA 3K20A 1UMDB 4RO0A 1J1ZA 4WZAB 3W3AH 4GLOA 3QGMA 3IUNA 2DRIA 5SICE 3H65A 1EE1A 1R9MA 2ZJZA 4IXDA 1G0NA 1PT9A 2MWMA 2Y1GA 5DT9A 3WGMA 4BIMA 5CB8A 1U99A 1DG1G 4L73A 1IXYA 1DLIA 1KQPA 2QZZA 3HA7A 1KYXA 1O89A 4MLPA 4CBVA 1RXWA 1A4XA 2HDHA 2IBSA 3ZE7A 1CR2A 1RRPA 2R44A 4FHEA 2IZ0A 4XR9A 3ELDA 4FDVA 2IIVA 2FEOA 1TW2A 5F9HA 1TT5B 4E3WA 4XSVA 2CBXA 2CNKA 1KDOA 4IAOA 2V8OA 1S4MA 2V03A 3D9QX 3HXOA 2EX0A 5F5LA 1I2DA 2H85A 3RUEA 1KY3A 2EBFX 4JNCA 4TT3A 3OT1A 2Q0SA 1QPBA 1TZKA 1KNXA 2NVUA 5J1SB 1OLXA 4B7UA 4Z9YA 2R8ZA 5C4GB 4CN9A 1WP4A 4M22A 8LDHA 4DXHA 5AVUA 4XGNA 3TEFA 1P7WA 5KOJB 1VFNA 2FSUA 4LHXA 3WGZA 1WHTA 2C29D 4F4FA 5CBKA 1W7AA 4RXUA 4LPKA 1MG5A 3SCZA 4UREA 4L5CA 2EW1A 1G4AE 1HY3A 1UDBA 1QS0A 1T8WA 2B21A 2CNWA 4FKMA 1GQFA 1XQ9A 4FJ2A 4RD4A 3I0NA 2R8EA 3PTZA 4C7BA 1L0BA 3FCSB 1UKEA 2W2LD 4PYIA 5E9WA 3TCKA 1Z4IA 5KTYA 3HXQA 3AUXA 3KQTA 1PVVA 3HPRA 3IT0A 1KK2A 3DMTA 4EA7A 4KQCA 3WGLA 1RHKA 1NJ8A 3NRCA 3R74A 1FW8A 3E2PA 2IVFA 4OJKA 1XDZA 4E11A 4NQRA 2O3UA 1H23A 1A69A 1MAWA 3NS7A 4YJGA 2YW2A 2XSZA 4RAOA 3RIHA 4FHGA 3PXGA 2QYHA 1M54A 4KPEC 3E8MA 4LJ5A 1Z9BA 3ZBUA 5LM3A 1JKMA 2AOVA 3KRTA 4L3OA 4A10A 3VQTA 3MJRA 3KDAA 1YQUA 3T0FA 4CKWB 2HK9A 1IBMB 4K28A 1ZK3A 2ZE6A 3A1WA 3HMKA 1M66A 1DRWA 2B4AA 2WAYA 5E6RB 4J3FA 4NJOA 5EFZA 2IHNA 3FI9A 3NYRA 3CZPA 1SMKA 4KSYA 3FGPA 1RQXA 1ZAKA 1XZPA 3C7DB 1TCAA 3BG5A 3FNGA 2VZ8A 1Q0HA 2C9YA 1BAPA 3A25A 3IS3A 4UM7A 4Y0AA 4HYYA 2RHCA 1WUYA 2JFQA 1VSQA 1O94D 4AN1A 1CJTC 1N5KA 2VDWA 3L3BA 1UMBB 2J9YB 5EYPB 2CK3A 3L6CA 3PQ4A 2E1PA 5I7WA 1WXFA 4ZYZA 1GGJA 1RTTA 2F9FA 2D7DA 5LIRA 4HF7A 4QKQA 3H5WA 4PC1A 3CR8A 4EQ6B 4LQ4A 3E5NA 3ZJTA 2BSQA 2LTAA 1HDZA 1RWMA 2UAGA 2Y2VA 2KX7A 3V3KA 3IHLA 3VHXB 2XOEA 4CG3A 3EFOA 1UKZA 3VH3A 2IH2A 2Q4EA 1K92A 3K1AB 3OM1A 3DM9B 4POOA 1UKAA 2EFYA 2F9LA 4HAUA 3DTYA 4S24A 4TWBA 3TQTA 1JHOA 1TZ2A 2D8MA 1KDYA 3FHJA 1IQ0A 3ZK7A 5ITZB 4Q9NA 4MI6A 2JVIA 1XG5A 2H9IA 3SSMA 1CQXA 4OFWA 4EHBA 3D6UA 4D4GA 4XXHA 5FYDA 1I3KA 1E3WA 4HGRA 2N1BA 3KS9A 5GMOA 4JENA 1CZLA 2X8JB 5DHPA 1DV1A 2IHKA 4ZDJA 4X64B 5DX0A 2DULA 3ZY6A 2JCGA 3OCJA 1E6LA 3A4IA 1YACA 4Y2HA 1S3IA 1VCMA 1QZUA 2VEOA 16PKA 2XKBA 4HHEA 3AT1A 3W8FA 2FWJA 1O8BA 3H5VA 3MTAA 2F90A 2OGZA 5L95A 4B9AA 2IUFA 2D6FA 3HVHA 2PO7A 3ZK9A 5EHZA 4OQEA 3JQGA 4FD3A 5C7IO 2BEUB 4AF7A 3DBIA 4AP5A 4WUTA 3DYIA 2JAXA 1TPZA 4PXYA 2CUNA 1U7TA 2Q46A 4IFBA 3UAWA 4GBMA 3HKDA 3K0AB 3I5UA 4ZT4A 1UEIA 1YRQA 3CBGA 5AKLA 5KU7A 1AK2A 1JX6A 2D0PB 2G4CA 3JQ9A 1JJFA 4CG1A 2Z04A 4DDKA 2YHBA 1DEKA 4HXEB 2ZI9A 1INLA 2A86A 1GYQA 2D0DA 3HFSA 5IC5A 1SA0B 4X6XA 1PU2A 1W49A 1ZOPA 3TD9A 5REQA 5FTJA 1C0LA 1SU8A 1T0PA 2JFXA 1YQ9A 1OXVA 3JZIA 3AM3A 3UH0A 4X62B 1ZLXA 1G8KA 4Q4CA 4BNFA 1Z5VA 2O1EA 1KERA 3TSOA 2BFDB 2F1IA 2WVAA 3NALA 5FWAA 1H1DA 2ATXA 2NO1A 1TPYA 3GZTB 1ZD5A 4YMHA 5GONA 3AM4A 3DMYA 2ZBRA 1ID8A 3ICVA 2ONJA 4KFRA 1QCDA 4PZAA 4DLZA 1VTKA 3LVRE 1U7ZA 2F6RA 4MYSA 5JNSA 5KQPA 1ULBA 1H2AS 1GYRA 2BHSA 2F3QA 3NHFA 2QL9A 3PNYA 4L6IA 4F46A 1SA0A 4IHQA 1AMUA 4O3MA 1DJQA 1ABBA 1ZNXA 3ONVA 4N0DA 2D00A 4C2TA 2HCJB 4C0XA 3HUTA 5BRNA 4EO4A 4UNPA 3F8SA 2IUEA 3GBSA 1GCAA 1G55A 1ADJA 2J07A 3DDUA 3GP5A 3TLKA 2HU8A 3ET4A 4Q3KA 4ZMSA 4OI2A 4BNDA 3U44B 3WHLA 2H9AA 5F2NA 4YP5A 1V9SA 4YRZA 1D4OA 2REOA 3OX3A 3L4JA 1Y9ZA 1W6RA 5CHEA 2G6BA 3QMWA 3MRSA 3SKXA 1Q0UA 1FU7A 5LL6P 3U9SA 2D62A 4GYKA 3QELA 4FSHA 3C98A 3MN1A 2ZTMA 4MS4A 4OB7A 1B6GA 1SC9A 1XELA 1GDDA 4MB0A 5LMNB 1JN0A 2CFSA 2NU7A 5AI4A 2JCSA 3ICEA 2FH5B 4JUCA 5AQEA 2NGRA 3P0EA 2FMHA 2OGWA 5HJ7A 3KQOA 1E2BA 2FEMA 3D3NA 1UBUS 1FBTA 3NC1C 4PFSA 5JI2E 4RNDB 1C0EA 1XLVA 5BWBA 4YUXA 3ZC3A 1OGIA 5AVQA 2HWYA 1NMQA 3ED5A 4FXPA 4GRIA 4CKYA 1Z63A 2HREA 4BWVA 1U1IA 4HZGA 2ZSIA 4FSDA 3MLEA 4ZAZA 1HLPA 4ENQA 4IGIA 2XJ4A 4ZOLF 5L4NA 2OG1A 2Q3CA 2P9EA 4OHVA 2VPPA 4JNKA 5BSEA 1NJSA 3AUSA 2IYRA 1E32A 1Z5NA 4YRBA 3E2MA 1NBMA 2PCLA 3CT4A 2R6AA 2ZANA 2QNRA 4GPIB 4HFNA 4JVLA 2W4MA 4JSTA 3KOYA 3JZDA 2ZU6A 3JRWA 2IQ5A 1OLOA 1N4AA 5TIIA 3HWX1 1OFTA 3BF8A 3T4XA 1JHRA 4ENRA 4LHWA 2AIRA 4GIBA 2OHHA 1DQNA 3VRHA 4ZCRA 1S2NA 3V9PA 5HE8A 5JSKA 3UG7A 2RHTA 4RHXA 421PA 2V59A 4CWAA 4MR9A 1GXSB 1HC7A 1TYAE 2J41A 1JTFA 4UTOA 1GGFA 3UK0A 4CGZA 1UKCA 4Y2SA 3GZ4A 1YUMA 2QRKA 5DGCA 1KAGA 3SC4A 1IQPA 3V7WA 3MIIA 5E6RA 1LF0A 2KWIA 5IVIA 3RAPR 4BO9A 4CFSA 4KAXA 1BVRA 3QBJA 3RS2A 1NQUA 3QY0A 5C0OE 1XQ1A 3LRTA 3L7KA 4Q00A 3BJIC 3EIOA 1VE7A 3PE4A 4OHZA 3VC2A 4EA6A 1NNUA 4RK4A 4YAFA 4LXXA 1PAUA 4HX5A 1C7QA 4E7PA 4PHGA 3EF3A 4GLFA 1XTTA 1M1YE 1PWHA 4JUFA 3WHIA 1E3DA 2Y0BA 3RRNA 3S2EA 2WU0A 5ES3A 3TQCA 3L7MA 1Y7IA 1DAIA 5IT5A 2VF7A 3JWJA 4KIFA 5ERXA 2JLQA 4ZYWA 1SXJE 4L7VA 3HVKA 1Q57A 3NOOA 3T6KA 3V8RA 5HGXA 3ZDAA 1A7AA 2RAPA 1YO6A 3GGSA 3ZWPA 4PU0A 4QBHA 1C41A 3BB1A 2GAIA 2FG6C 2XF8A 2PZFA 1J06A 1OROA 4OGKA 1IRXA 1G5RA 1WP9A 3BHNA 4M37A 3VMFA 3Q11A 4IJMA 4QASA 2Z30A 4M36A 2R6DA 3Q2KA 3ZZUA 1Z2NX 1I1NA 3IVRA 2CXPA 1ICEA 2GCOA 4GXRA 2JFHA 1MX5A 2X8BA 3BBLA 3RV3A 5AW8A 3ANMA 3GFQA 5JC8A 3HKBB 4AG6A 2O4UX 4JUDX 4R1PA 3NWOA 4RELA 3WGOA 2D5AA 2YXNA 2QU7A 1NI5A 4E08A 4S1WA 2NVUB 4DWJA 4XPZA 4HXFB 5F7ZA 5ICFA 2O2EA 2YV2A 1RYFA 4HVAA 4JQCA 4OOEA 1M76A 4PBTA 3UWPA 2ZEJA 5KWEA 5KYUB 2VF8A 3D6FA 4L02A 4BNKA 5EJ8A 5AI6A 5I9BA 4NDAA 4NU8X 3OP1A 4BKUA 2E4VA 3BXHA 1E9AA 2A94A 2Q5OA 1L1FA 3C1AA 4Z8YA 1C3VA 2ADMA 3WK4A 4F3KA 3TN7A 1BDHA 4N8SA 2OZLA 5CCXA 4WXEA 4WNYA 4CV3A 2VSNA 4J16C 4QQNA 4TOIA 2AFHE 3H9EO 2E87A 3LQ4A 2ZDQA 3WRXC 5HR5A 5IASA 1N1GA 1AKUA 1CUZA 4NJMB 3WL6A 1EZ1A 3BWDD 2QLNA 3IEPA 4AECA 4AX4A 4K6KA 3U3ZA 1WWKA 1IY1A 3FCXA 2VJAA 3B2EA 2RGYA 3UPDA 4TTJA 4BATA 2P0YA 3ZKAA 4Z4GA 1UANA 2ONKA 1N6NA 4CMHA 4RHUA 4WK6A 1VKNA 1JMVA 2OFWA 4HUQB 3NYWA 3OUZA 3M8KA 1N8NA 1XX6A 3U7QA 2OR3A 1DQZA 1I4DD 4WCFB 2ZSUA 1QTNA 3EZYA 2GAOA 5ESRA 5FL7A 2BGNA 1JEYB 1O3YA 2W2VA 3DBLB 1A27A 2HCFA 1A7KA 1D2CA 1K8QA 4S1OA 5BV7A 1EUCB 5B1YA 1IAVA 1JV2B 4R7TA 4QATA 1DJOA 1IDN1 4Z4EA 5GWXA 4BZWA 4DLUA 5LB2A 1DO8A 4KO3S 3MERA 4RV5A 1YAJA 1M2OB 2C7GA 2WEKA 3GAMA 3EGWA 2VPQA 4N03A 4NOLA 4E5DA 3M0EA 3R4VA 1LTKA 3R6WA 2ZDHA 4PTYA 1QQ7A 2BTOA 3WHKA 4U2DA 5TT0A 4W6ZA 3DMGA 2PUTA 2C9MA 2OB1A 3C1OA 5G0UA 4M55A 1MENA 3B3FA 2FMUA 1UBTS 1ZAYA 1EYZA 4ABTA 2WBLC 4Q6BA 3QKIA 4CLOA 1QIMA 5C5CA 2Y0EA 1C14A 3WK8A 3KSBC 1W6UA 5FFMA 4E6PA 3G8BA 3UA4A 3MWGA 1C7IA 1JQJC 3ADPA 1SC1A 1EINA 4ENSA 1OFIA 1L1EA 2IHJA 3ZJVA 2EARA 2B69A 3K9LA 1K8YB 2WIJA 3HI6A 4MS4B 4N5HX 3BJRA 4E2WA 2WJGA 1NVUQ 3PJEA 3VSEA 5DO9A 1G8MA 2AVDA 3I1FA 1TF7A 2QL6A 3QVSA 4JLBA 3JAKB 1Y48E 2P6OA 2WUDA 4XVUA 2PK3A 3FDZB 3TZ6A 3UJ6A 2CNDA 2QSJA 3HDTA 1S6YA 2VNIA 1PK7A 2Y71A 1JEQA 1WB5A 3GFVA 3SM9A 1HT0A 5TF4A 1B6SA 5A9RA 1ZGZA 2VLIA 4L51A 1JIUA 3A14A 3ORYA 2ILVA 5FNVB 5F4ZA 1FXUA 3QPUA 3RUDA 4WH0A 4Y6RA 5LC1A 6NULA 4R41A 5LWQA 3M9LA 2WD9A 3LHIA 3MLBA 3OHPA 3R1IA 5HZHA 3GFSA 3OE4A 1KFEB 3L7OA 4R2IA 4PNZA 4XQEA 4BNJA 4HPWA 1P2UA 1RHJA 4LDNA 1EGVB 1MXHA 4YAEA 1U1FA 1OU0A 3GVXA 4PIMA 1SB8A 2GAJA 3VR2D 1LQ2A 5JYDA 2HRBA 5KVCA 3W5SA 4OI4A 3ES9A 5E9AA 3T7SA 3IGFA 3QPWA 3VH2A 1QIFA 4BE9A 4DOMA 2ODTX 4Z2AA 5DOVA 4UVDA 1RABA 3LP8A 4JP5A 3ZK8A 5IK2A 4FFOA 3ZCTA 2FW0A 4QD3A 2FPUA 1KZ4A 3TLZA 4RTMA 1LB1B 1HH4A 4F2GA 1L5QA 4WI1A 3HCBA 5I4CA 2AL7A 3HEBA 3MT7A 4FDUA 5I9IA 5KREA 2GJ4A 3ME5A 3QYFA 1MGPA 5AQ1A 2FPLA 1JJBA 4OXIA 2NTVA 4EX7A 1O96A 4CKZA 2ZJ1A 4UD6A 2Y92A 2DH6A 2JGMA 3BOSA 3ZDCA 3G1WA 1IU9A 2P4QA 2WTXA 1P73A 4ZXFA 1QP7A 5B7PA 3IL2A 1N75A 4KYUA 1R9NA 4H7JA 1TA4A 2Q3HA 3WNCA 1QC5B 4QGFA 1RBYA 3OPYB 3B9RA 2H48A 1C1XB 2QRJA 4TS9A 1CNMA 3S55A 3GLIE 1L8XA 1A2BA 3AEKB 1A5SB 4WLVA 2REBA 5G3ZA 3VYVA 1BEZA 1PNRA 1CJMA 1H8EA 2G40A 1C5KA 2HWKA 2IUYA 2R1VA 2A57A 1SO8A 4RWEA 3S2UA 3H1TA 2EGUA 5K0TA 4I3FA 4LYHA 3D6NB 1FSZA 3GJ5A 4CFYA 2POCA 1NVXQ 2WT4A 3COPA 4FCWA 1TEZA 3G02A 1OYWA 3SVZA 1P1KA 4BE4A 3BCSA 2BTQB 2GWHA 3T5DA 3MOGA 2UUBB 1UWCA 1KU0A 1X94A 1TW3A 2EFEB 4JITA 4OXKA 3ZWOA 5TMDA 2AWNA 1QV6A 1HF3A 2GJ9A 4WY2A 4LF5B 3WWEA 2YXPX 2C7RA 2QG4A 1XYYA 3KELA 4LOJA 2GVDC 3BWVA 2YH2A 3O4IA 4C5BA 1DJPA 3LV8A 1N33B 3A70A 4L50A 1ORRA 2H7XA 2ZRJA 3AF0A 3MWDB 3VHXA 3VR2A 1FP4B 3CNNA 2G1UA 1E5VA 3CB2A 3GMDA 4B4VA 4M1EA 3EQ7A 2PX4A 4K9PA 3WX0A 3F46A 4YACA 5K3SA 5EXPA 2VDPB 1RLMA 5AKHA 3ZCVA 4NBVA 1N2JA 1TEXA 4Z3OA 4M8IA 2H5EA 1LNQA 5EKUA 2F3SA 1TD1A 3D6HA 4GXNA 3TZKA 2OFOA 4BJ5A 4XYLA 1KU6A 1XMIA 2H7CA 2FWPA 3B6JA 2HH9A 1UBSB 4Y7CA 2OKGA 3S70A 3KCNA 4GQIA 1I7PA 2CHGA 4O2AA 2X0NA 3NKVA 5DP1A 1HMPA 3AYZB 4G63A 2WAXA 4RDIA 5B1EA 1BTOA 3O8QB 1Q7GA 2JS7A 4JLVA 1Y0BA 1L7BA 4RLHA 2WTAA 2A3RA 1YVPA 4JLOA 4L15A 2BM0A 4LJLA 5AW6A 1Y4SA 1B8OA 2NQ8A 3EBPA 3OKAA 4JROA 3I2JA 3VPBA 4AP6A 1T6YA 4UZEA 5A3RA 2WF8A 3RRBA 4CVNA 1LPNA 4YI5A 1AGYA 4ZYLA 3K31A 2IY7A 1GILA 2Z9BA 4FBGA 2GAFA 2OPHA 3VNBA 3A9TA 8ADHA 3OU6A 5I3ZA 4JMLA 1RMQA 5EE1A 4DUGA 3C8ZA 2EC5A 3V2GA 3K96A 1K86A 1G6KA 1O7JA 1FZTA 2W58A 1X8JA 2GYVA 3QPBA 4MV8A 5L4SA 4DCUA 4E5MA 4Q1DA 3VO2A 1Z83A 4IS2A 5HRUA 4Q4AB 4HXYA 3H1EA 4ZGBA 5T7BA 4OHKA 1NW4A 2DFNA 4EL0A 1HETA 1TM3E 4GZ5A 4RQTA 4QG3A 2QD2A 1L4GA 2A4MA 4XD7A 5TE9A 3W8RA 3G2HA 5KOYA 3QJ5A 4D45A 3MYRA 4H7IA 3A1DA 3EZ6A 1Z33A 5EKDA 1EWYA 1I80A 4ADSG 1HK7A 4QYMA 3EWIA 4Q4JA 1E2DA 4BV2A 1AU9A 4BDTA 4EUNA 1Q0ZA 1X92A 2DLNA 4AS1A 1OZAA 2HTFA 1IPEA 1YZFA 5K3OA 1LPSA 3E9NA 1CK4A 2I6XA 1NRWA 4AZ3B 4DLWA 4E70A 4FMDB 5K99A 4QAJA 3LHKA 3LS2A 4L3VA 1PZEA 3IQWA 4R05A 5HWSA 1CUJA 1CY6A 2HMTA 3IO3A 1QH9A 3T1QA 5HKLA 3BGSA 5TPWB 1ULTA 1MJ5A 3PQ8A 4L4YA 1M6WA 2C4WA 3CX8A 1S2DA 2P9TA 1FNDA 1HE2A 5AKKA 4BBAA 4JJ8A 4E88A 4DSAA 4H59A 1N5MA 1JFTA 1FP1D 4LZNA 2ZT5A 1DKPA 4PLGA 3N8KA 4RABA 4TYNA 4BVEA 4ZWNA 1SRQA 1V7ZA 3OSZA 5LBIA 4PGMA 3C8UA 5F5NA 3JX9A 4AZ3A 3VVLA 2P1ZA 4LJAA 1Q83A 3JW8A 1G42A 2VDJA 3VHQA 2VBIA 2G9QA 4P0TA 4IL5A 2IYPA 2PGAA 2XIJA 2IX3A 3OE1A 5K03A 2QMQA 3DAOA 4WZAA 1K8RA 2P8SA 4B82A 2O8BA 4LZOA 4OM7A 2OLKA 3OF3A 3R3JA 4TLMB 4XB2A 1GZVA 1IOZA 1RYEA 1YQDA 2ZPTX 1DJNA 1E9VA 3KLNA 4K9NA 4MJ3A 1T3TA 3NPMA 4IIBA 4Z4CA 1PQPA 1JU3A 4MRPA 1CF9A 4XAQA 4LZPA 1RRMA 1O5OA 3OOJA 3CKKA 2Y1DA 4OAQA 4CCSA 3RYHA 5BURA 2W8ZA 2UXCB 1VPWA 3A1VA 3OLZA 3NHZA 4EHDA 4HDOB 4M83A 2HOQA 1DXOA 4KQMA 1MEOA 4G01B 1L7NA 3BSSA 3C24A 1LQUA 3LT5A 3L7BA 4JJ7A 3ZUPA 3PC3A 2V3CC 3O2JA 1MQ9A 4JA0A 2VRWA 2WOJA 3QE0A 1NXQA 3AR2A 2BGJA 3D1VA 1T5IA 3WLIA 3QXCA 1AQYA 2BGLA 3Q10A 1DKUA 3ZZNA 3MK31 2XMGA 5F3WB 2FVYA 3I9V6 5JSQA 3SVTA 4ZD6A 1YFLA 3IBSA 1MIOA 1PCXA 4XQ9A 3A1EA 3QJYA 4UZSA 2X5XA 2V7GA 4P3PA 4K46A 3NJ4A 4URXR 3LYAA 1Z08A 1H2XA 1A8PA 1L3IA 1ZUD1 4P32A 5EQFA 5FL3A 1W96A 2I7CA 2Z09A 3ZE9A 1AC5A 2Y77A 4G4IA 1VA5A 2VK8A 4PX9A 3R3YA 1UBKS 1FW6A 5K2MA 2X0EA 3ZCXA 5A6VA 1LTHR 3P9YA 4NAHA 3DE6X 1CY4A 4X7MA 3F2IA 4F8YA 1ZN8A 2C9BA 1K06A 2BEWA 4J16A 4NBNA 4A6DA 1C7FA 1EEHA 5HK8A 1T13A 1JDZA 3VR5H 3DBHA 2DGDA 1TM1E 1AQLA 2ZIEA 4PZDA 1CYEA 4KQWA 4D0GA 2I2AA 2HK8A 4D99A 1GL6A 2WT8A 3HDJA 3P9PA 4ARIA 2G9VA 1T8YA 3M81A 1WO8A 2W2QA 4G56A 3TE6A 4BVKA 4ZI7A 1TFRA 1Q17A 3PP8A 4LQCA 1UDWA 4J91A 4QO7A 5DE3A 3ZXXA 4CCYB 5HVNA 4R9SA 3N2YA 1NYTA 3OY2A 1GV0A 3HCFA 2G04A 4CM8B 4GSLA 5BN3A 2H4WA 1KOJA 2QM8A 5JZOA 4RTNA 4GOJA 1VPVA 2IH5A 5C53B 1XK6A 3IRVA 3ECSA 3MB8A 5J2UB 3LUAA 4BB0A 1IN4A 1EBBA 2P6MA 3NDBB 4MDFA 2GT1A 1N25A 2JZNA 3K1TA 4WA8A 5IEBA 4DR5B 4NBSA 4CDRA 4F06A 1AF4A 2PN1A 1S8FA 3H9QA 2NTEA 2Y05A 4B3SB 1Y3DE 1SIWA 1PL6A 3CW9A 3WYDA 1F8FA 2OK7A 4LA4A 1YQQA 1L4FA 2W8BA 2QTVA 3W78A 1T35A 1P2VA 2K2QB 3L8EA 4C7MA 4BX8A 4L72A 1DPFA 1E79A 2IW3A 4OK5A 1Y5LA 3RUPA 4OIFA 5TF0A 2PJRA 1STOA 1C1XA 2XBLA 4C2UA 1NG1A 1OOEA 1D1TA 1HYGA 1OAAA 1UOPA 1RPJA 1NN1A 2DM6A 2JZOA 4UFPA 4J4TA 3VA7A 3CRQA 2O8BB 3OICA 1N6IA 4MOWA 3BD6A 5DHUA 4MUHA 2UVQA 5KQGA 4A8JC 4EB8A 5DHFA 3LGAA 5ADHA 1Q95A 2FB9A 2NWQA 4FOOA 1SK8A 3CCBA 2R4QA 4TZTA 4I8DA 4K87A 1OILA 1EWKA 2QGNA 3QNUA 4LSWA 4D4JA 3AKCA 5ABPA 5CFQA 3ZHYA