4OBEA

Crystal structure of gdp-bound human kras
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
169
structure length
169
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GTPase KRas
publication title In situ selectivity profiling and crystal structure of SML-8-73-1, an active site inhibitor of oncogenic K-Ras G12C.
pubmed doi rcsb
source organism Homo sapiens
total genus 62
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2014-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4obeA00
4CT5A 1IY2A 1GILA 2A5DA 4KFSA 2HLDA 3D8BA 3E70C 5H70A 5BYKA 5KSOA 5J4LA 3LA6A 5FL3A 2OLJA 2NTYC 3NTUA 1P62B 1T9HA 1NY6A 1CR1A 2AKYA 2BMFA 4WAUA 4LJ5A 1ZNYA 2ZYUX 2PLRA 4US0R 1KO4A 1MR3F 4HZIA 5BYJA 2PL3A 5KNBA 4C3ZA 2VH5R 4BRUA 4C0BA 2ZUBA 4IXMA 3LH5A 4HEJA 3AP3A 4NYIR 2B21A 1RC8A 4EIWA 3SS8A 1VKJA 2ODBA 1PUJA 5KDLA 721PA 4JVMA 3CX6A 4LYFA 2QU8A 3Q8XB 4KLNA 4NYIQ 1CKEA 2GK7A 2VP9A 4NHOA 3T5DA 4JL5A 2V7QA 4E09A 1PVOA 1CJMA 4QL3A 1XNJA 2AK2A 1XJCA 3LW8A 1IJFA 3B1WA 1VHLA 1US8B 1O3YA 4GPTA 1SVMA 1MT0A 3B9QA 4MQBA 3QKTA 3A1UA 1KOFA 4D2IA 1KNQA 4NBSA 2FZLA 4HUQA 3TSZA 2XZPA 1AGPA 4PC6A 3SQWA 3FMIA 1E32A 3GLFE 2FPMA 2AFIE 2EFHB 2YWEA 1E3MA 1NIPA 1OIWA 3SYKA 2ZRLA 1OXXK 5J4KA 1ZIOA 4A8JA 4HB3A 3UMFA 5FL7D 1CXZA 4XVQA 4TSFD 2AHOA 4M53A 3TUZC 1OFUX 2YNMA 1JXOA 3SC3A 2ERXA 1Q0UA 1PUIA 2AL7A 1C9KA 2QMHA 4EPVA 2GF0A 2O8FA 1OLOA 3W6NA 2XNSA 1Z3IX 4L8GA 4V0OA 1A82A 2IHYA 4KSCA 2QQ0A 4TWZA 4R9UC 3VKWA 2CHQA 3KZ1E 4YONB 3QXXA 1F6BA 3T34A 1WB9A 1OKKD 1E0KA 1KY2A 3CWZA 1L4YA 1AKEA 5D3QA 3Q7QA 2XZLA 1E9SA 1E2GA 2O8BB 2ZYWX 1G4UR 5LDDC 1NLYA 1VG8A 3OAAA 2ONKA 2PCLA 1N25A 3HWSA 3NBYC 3ETLA 2D2EA 2GTPA 1HURA 4WZAE 3LAWA 2EYQA 3QPVA 2C77A 4DCVA 2NGRA 1IY0A 1ODFA 1OIVA 2FH5B 3VKHA 4QNMA 3O8DA 1GP2A 1D9XA 4JS0A 4RD3A 1BH2A 5EP3A 1P2UA 3SFZA 2XSZA 3C14C 2RKOA 4FMDB 5H68A 2VSXA 3Q85A 2OESA 1R0YA 4Q1BA 3KB1A 4FCVA 2REOA 1ZCBA 4M9QA 4N0DA 5DO9A 4ZIRA 1Z6TA 1QHYA 4TLCA 1F2TA 4F7WA 2ECKA 5JI2E 2IXFA 5IF9A 3AH8A 5FR2A 2IYXA 4HAVA 2V6JA 1KAOA 3E2IA 3EIHA 2QM8A 1W36B 1AGRA 1EWQA 4A92A 3IUYA 4LJ4A 4R71A 4PHGA 5JFGA 1KO7A 5G3YA 2RGGA 1V43A 2GVDC 4JYBA 1J2JA 3CF0A 4JLKA 1Q1BA 2WICA 3MWKA 4GT1A 1YZGA 2XNDD 1KI7A 4PXAA 1RKBA 5JSZB 2J0SA 1SXJE 4TZ0A 1FTSA 3T5GA 2QRZA 1RPZA 5EJEA 2R6DA 1G1MA 2FG5A 2QQEA 3I32A 1NVVR 3W6OA 5JWRA 4RD1A 4HAWA 2WJYA 3K9GA 1WXQA 2H5EA 4URXR 3P26A 1YR7A 4B2PA 1NVVQ 4I1OA 5KNCA 3SJZA 4JL6A 1U9IA 4TYWA 5KOYA 2QROA 1GG2A 4JBYA 1J7KA 4L15A 1P2VA 3OEHA 2ZM5A 1ZC4A 2RMKA 3H86A 2P67A 3U5ZB 1W5SA 1Z29A 4DSOA 2OFXA 1MO4A 1NBMD 2VP6A 1KMQA 4WXRA 5BN3A 2ZI4A 1ETUA 3EWSA 1G291 2NG1A 4JL8A 4QHTA 3DL0A 3BH6A 4IJMA 4Q9KA 2QSZA 4B75A 4XSHA 4DEXA 5DISB 1XPOA 1KSFX 1Z8FA 3N5CA 4PC2A 4NDZA 1CBUA 4DCNA 3QENA 3AVVA 1XEXB 4QKQA 3PUZA 2G3YA 1JB1A 3VU9A 4O3MA 1TU3A 1CULC 3I8SA 4DT1B 1XZPA 2NO1A 4PAMA 1E4YA 2DCUA 1R4AA 4Q4AA 1E2MA 1Z0DA 4UNRA 1W4RA 1U8AA 4EPRA 1UAAA 3EARA 1G6OA 4FW9A 4Q9IA 4D4JA 3UK6A 2ZANA 1MO3A 2XITA 2FN4A 3T12A 2VHTA 3B60A 1Q1ZA 2OLKA 1NN1A 2QMUA 3I4LA 4B3CA 5FPTA 2IS1A 4B76A 1BMFD 2R9VA 5DYIA 3THXB 3NH6A 1X6VA 3PENA 4GBMA 4NH0A 2VSOA 3I73A 4TT3D 4D82A 4CEHA 1SKYE 5FBLB 3A4LA 1AZSC 2W6IA 4EJSA 3IEVA 1PJRA 3L0IB 4HB0A 4JT4A 3L43A 5L3VA 1W46A 4K81B 1GDDA 3M6AA 2FFAA 1IXRC 3ZGXA 1BYUA 4CF7A 5IT5A 1WBDA 2FU5C 2O0HA 4ZI2A 4LUCA 4TYPA 1M6NA 2IF0A 3A1SA 1KI8A 4Q4JA 1N6HA 4NZYA 5JHHB 1OXUA 3PXGA 1U2RA 3B1XA 4NKRA 5JS7A 4MDEA 2HLDD 4Q01A 3RHFA 2VRWA 3HU2A 2PBRA 4DXAA 2OEPA 5JMTA 1G6HA 1R0ZA 4RFSA 3TW4A 1H65A 5JECA 5DSZA 1KKLA 4GOXA 4QJ4A 4GFDA 3TR5A 2BJWA 4GNKA 1S9HA 2AX4A 4AYXA 4BGDA 3BFKA 1E0JA 121PA 3DMNA 4LYJA 5FR1A 3UMRA 2GHIA 2R44A 5GJWC 3CNOA 2JLXA 2ZRHA 1G5RA 2IYUA 3CWQA 3B1ZA 1TADA 1MRSA 1NLFA 2WWHA 2XX3A 2AWNA 2AXNA 1NF3A 2QAGC 2ZS7A 2A5FA 4XJXA 4YXWA 1XTIA 2ATVA 2C96A 2WOOA 1VHTA 2WMNB 1NJFA 2BDTA 2QE7A 3QEJA 1HH4A 1E94E 1KI6B 5TXGA 1Z0KA 2Z5FA 5FH9A 4F4CA 2WJVA 1P2SA 3LDAA 3ONWA 4RY2A 2CBZA 1KDPA 1Y63A 2LKCA 4C7OB 3ADCA 4A9AA 3AF2A 1QRAA 3W34A 4DLUA 4HLDA 2HYDA 1GNQA 1TF7A 2GEUA 2L0XA 3SJCA 3NEYA 2G1KA 2WSSA 3T61A 3QG5A 2JJ2A 3AKCA 4LPKA 4GSYA 1BIFA 4UNQA 1GZSA 3I72A 4KJZA 5DIFA 2AKAB 4FN5A 3GJ4A 2JLYA 2Q0HA 5C4GB 4Q47A 1MABA 2G1JA 4JJKA 5JLJA 4A1FA 5KTYA 5GJVC 5EXTA 1DG3A 2BMJA 1EGAA 4RD0A 2CEAA 4OYHA 2ZYVX 5FUWA 1E1RA 4DLRA 1P72A 4RKEA 3F5FA 3P32A 1E96A 2DYKA 2YOGA 5AJZA 1FX0A 1E0SA 3EG5A 1KHTA 2ZJZA 3T06B 3MWLA 2E9SA 5EE9A 4CZ2A 3WRYC 5L3SB 1GRRA 3CW2A 3OAAD 3K8YA 3OEED 4V0NA 4CGZA 3DOFA 3AM1A 2JLVA 2GXUA 5JRJA 4K8OA 2H17A 1H8HA 4B3FX 2J87A 2IYQA 2P6NA 2GJAA 3DMDA 4MRVA 1YR9A 4PHTA 1RVDA 5D3MB 4QJ3A 2MSDB 3LBHA 3AKYA 4NYMQ 2XSZD 3DKVA 3HPRA 4BLSA 1RRFA 3SU8A 1EFHA 1WE2A 1TUEA 2WBLC 3AV0B 4URWR 3DM5A 4QOSA 2CDNA 4I4LA 4E07A 2AN9A 2VF7A 1KI9A 3GEEA 2Q9AA 3FKQA 1Z6YA 2GXSA 2BCJQ 2J5XA 3CRVA 3QKRA 2O8CA 1TQ4A 4D81A 4IFEA 4II7A 2WIAA 2DWQA 4M4SA 3X1WA 2DPXA 1NY5A 1FNNA 3V9PA 4F38A 1SVSA 4JVSB 2IBMA 5BN4A 1UEIA 1R2QA 2H7VA 3F3YA 3KJHA 1G8GA 2D2FA 2XEXA 4URZR 4A82A 2CVFA 3EXAA 4B6FA 4AWXA 5J4VA 4NP6A 1S8FA 4A6XA 5JI3E 1UF9A 1W4CA 2AXPA 3CNLA 1WMSA 2CVHA 4TYYA 1OV4A 3C5HA 3W6PA 3RWOA 3C4JA 4M9ZA 5DYGA 2QZ4A 3A1TA 3IO5A 2ZSAA 1E9EA 3N70A 4YDHB 1ESNA 4PZLA 1UBCA 4JLVA 1DO0A 4HAZA 4F92B 3KFVA 5BQ5A 2BBSA 1OH7A 4W9MC 3DKPA 4EQ6A 1D2EA 1GIAA 3GEIA 1GWNA 1MO5A 2EFGA 4PC3A 4LYAA 3QXHA 4TMXA 1IXZA 1GNRA 1VIAA 3LQRA 4ESHA 2F1IA 3SOPA 5HZKA 1KKMA 4V0MA 1VCNA 1II8B 3K09C 2HCBA 1ZM7A 3OEHD 4B6EA 2Z4RA 3BERA 3DVLA 3EZ9A 4ZDIA 2QSYA 2EWVA 1E79A 2VTKA 3JVUA 1GKIA 1OF1A 2OCYC 2C8VA 1YZTA 4KO8A 1N6KA 2GA8A 4OK3A 2W83A 1EWRA 2GEDA 3ZS9A 1TMKA 5SZIA 5M04A 3KJGA 3FFBA 2PZFA 3KXLA 5FUXA 3KUCA 3W90A 2XTMA 4HAXA 3RRNA 2OCAA 3LBNA 4IEEA 2GCOB 1LTQA 221PA 4M1YA 3OESA 3GFOA 3VX3A 1X1SA 3AKDA 3AVQA 3BFVA 1ZVQA 3H2YA 2QGZA 2VHCA 5TV2A 5CITA 4ZDJA 5BXQC 1P75A 5KSZA 5DLQC 1IN5A 1S2MA 2QPOA 4YMWA 4OKSA 5TB5A 4A0GA 2QBYB 3OHMA 2OZEA 2QN6A 3EIQA 5JJKA 3L8ZA 2ANBA 3IBYA 4POAA 3FMOB 1DAEA 3CF2A 4R98A 1OJLA 4YQFA 5CB8A 2DBYA 3K9LA 2QAGB 4N0EA 2R6CA 3R20A 2C98A 2IYSA 2FMXA 3CPJB 1Q1QA 2WAYA 2WM9B 2W6ID 4JLOA 4DDTA 3QF4A 4OQLA 1TTTA 3W9YA 4BFTA 1T8TA 3F8TA 3VR6A 3PUYA 2AK3A 4PPQA 2IYZA 1HQYE 2Z43A 1QHHB 2JA1A 1TF2A 2XXAB 2GK6A 4ZO4A 4D80A 2OFOA 1KO1A 3A1VA 3TLXA 3U7GA 3EPHA 2XB4A 4M21A 2IXEA 1XF9A 4JIMA 5EZ6B 1N3BA 1G17A 1QHXA 2CNWA 2ODWA 4IHQA 4PPGA 1UPTA 3IILA 3RSOA 4BWYA 1XMVA 2QMOA 1SVWA 4X8MA 3LLMA 2F43A 3U3JA 2WPDA 2PX3A 1OYYA 1KJYA 3QJYA 2B8WA 2Z0MA 3BB1A 3GD7A 1D2NA 2YWHA 3GJ8A 3R7WA 3ZZUA 4JBWA 4O2RA 3GLFA 2ZRFA 1QHGA 2PEZA 1OFHA 1XD8A 2ZIAA 8OHMA 1JJVA 2FSIA 1FUUA 3Q7PA 3WHLA 2HDNB 1I4DD 1CEEA 2FSFA 4OBEA 4M1MA 2WAXA 4YXWD 1DAKA 3KXIA 4ERNA 1G21E 1CJTC 3K70D 4MGYR 3IIJA 2BC9A 4KU4A 2QE7D 3MSXA 2HYIC 1LFDB 2VF8A 4RKFA 2C9OA 4DCUA 2BV3A 1P7CA 4PAQA 5IDVA 4MYUA 5CYPA 1WA5A 2FFHA 2RH5A 3LRPA 4ZCIA 1GL7A 1HYQA 3ADDA 5FPSA 2BVNA 1XFAA 5F9HA 4WXPA 2GBLC 3PUVA 1FUKA 1ZP6A 1KMHB 2P2LA 3ZS8A 4GMXA 2EFEB 2C99A 2VP5A 2C03A 3DHWC 2WSSD 4LRWA 1G7SA 2JJ2D 4URUR 1P5ZB 3PEYA 4AKHA 1E9CA 1G20E 1XEWY 5FTJA 2QEQA 1DAFA 2FF7A 3FVQA 3ZVNA 1DAMA 1QF9A 3DO6A 1Z07A 4CEIB 1CR0A 2ANCA 1KYIA 1TU4A 5AJWA 2ZI7A 3CPEA 4IFBA 2A7QA 3MGCA 3QOFA 4YDSA 1XX6A 4HATA 4GDFA 3LNCA 3PEUA 3ZZ0A 4CIDA 1DBSA 1E1RD 4AKEA 2ZE5A 2ZSFA 3M1IA 4XVUA 3RC3A 1OB5A 3QQ5A 3HR8A 2F1HA 2IUTA 1G3MA 2K5UA 2P6UA 2W0SA 1NG9A 2F1RA 2RGDA 4DLYA 3IKJA 4Q1DA 4B34A 3LW7A 3KX2A 1XTSA 4PPFA 3HJNA 3LVQE 4OI4A 3UIEA 2IYYA 2MMCA 2DR3A 4IDPA 3DM9B 3S1AB 1UKVY 1OFTA 4A0FA 2YC4C 1DAHA 1H8HD 2XOKA 1Q21A 1JNYA 2W2XA 2J7PD 3GLHB 1KNXA 3SE0A 4JKYA 3ZQ6A 2VHJA 1GOTA 2IK8A 2IF2A 3FHOA 4OJQA 1K6MA 4TLEA 3J81k 4RCZA 2VBCA 1KZGB 3CRRA 4QBHA 2OT3B 2HJVA 2JJ8A 3E1SA 3U7EB 1UDWA 3BS4A 2BEJA 1SXJA 2JIZA 3MMPA 4ZPXA 4Q7JB 3SJBA 2P6RA 5F3WB 4NU0A 3NWJA 4QJ5A 5DI3A 2ZJOA 3QPWA 3BWDD 2JLWA 4PTLA 4BEJA 4MKGA 2FEOA 4QM7A 4FMCB 3FHCB 3O8BA 4FI3C 4LGMA 4D25A 1HT1E 1FQJA 2A5GA 4QBFA 4HUTA 1IHUA 2KBEA 5CM9C 5KDOA 4DSTA 1CU1A 4LOAA 2FFBA 2OO7A 4LHZA 4D4KA 3OFNA 2H18A 1HT2E 1AQUA 4LK2A 4FMDF 3WP1B 2A78A 2QT0A 2G0NA 2ZR7A 3VKGA 2FPLA 5G41A 1D6JA 1ZNWA 2IWRA 1NKTA 1E4VA 5A0FA 5AJVB 2NZ8A 3PFIA 1XEFA 4CW7A 1G8PA 2CCGA 3A1WA 4P4SB 1UEJA 1D9ZA 1A5TA 2Q21A 5J47A 3B2EA 4M1KA 5FPKA 3FHTA 4X8OA 3ICEA 4LHVA 4A36A 2JAQA 5EP2A 4TTRA 1UJ2A 3H1TA 3B85A 1P9NA 1XB2A 2ERYA 2HF9A 2ZTSA 4YMUA 2J41A 3UG6A 1BS1A 1W1WA 2BIFA 4EPYA 2GVZC 2FJUA 3IO3A 1QHSA 4S2EA 4BEBA 3U6BA 2ASEA 1JR3A 1VECA 4Q4HA 1W4AA 1ZUHA 2ZJ2A 1Z6AA 1WP9A 3FMFA 4L16A 4XD7A 3PUWA 3VFDA 2KWIA 3SHFA 2Q9BA 1DAGA 1W5TA 2QM7A 3AUXA 3CH4B 3AF1A 1N5KA 1M74A 3REGA 1XRJA 1JBKA 2NPIA 1YQTA 2RGNA 5E7MA 3O8CA 5FOXA 1XXHE 3K0EA 2XZOA 4KYIB 2PEYA 3OIYA 2J1LA 4W5HA 4KODA 5HR5A 2REBA 2G83A 3SHWA 2XJ9A 1XD9A 1T91A 3FE2A 4EFNA 5KO2A 2A3RA 4V02A 1EK0A 2ZI3A 2VYFA 2P65A 1LV7A 1ZNXA 3EASA 4EAQA 3U44A 3Q72A 3BB4A 3GPLA 3KKMA 1SVIA 4Q4LA 2NZJA 3FB4A 2CLDX 4M0LA 1PZNA 5L3QA 1BYIA 3ND9A 4ARZB 4L9WA 5KPJA 4E5UA 3GMTA 5KUTA 2ZJ5A 3MD0A 3EPJA 1U98A 1PLLA 3CZQA 4AYWA 4B2IA 2ZPTX 5K8TA 1E9RA 2JLSA 3EZ2A 5IK2A 4BFZA 4AKIA 5DHFA 3GJ7A 4Q5IA 3PVSA 3GJXC 3NH9A 5DN6D 1XEXA 1YRAA 3K0AA 2ZJYA 2HCJB 1JECA 1PV4A 4BZXA 1X86B 2ZJBA 1JEDA 4LJ8A 2F6RA 1SVKA 2ZVQX 1P61B 2QT1A 4Q02A 3UWKA 4B48A 4C2TA 2VHUA 2IHBA 2PH1A 4NCJA 1XPUA 4ACAA 1RJ9B 4LCBA 3KKPA 4Q9HA 4F4JA 2O8DA 4PO8A 2CNWD 1G8HA 1JALA 3THXA 3MCAA 1SQ5A 2J0VA 2ZI9A 4PC7A 1AS0A 1OPXA 4PX9A 1P3JA 3LLUA 4BLTA 3TE6A 4CYMA 4KVGA 1ZMXA 4C0LA 5FOUA 1K8RA 2N42A 4C0AC 1Z5ZA 1CF4A 1VG0B 1TQDA 2WPDD 3CNNA 1ANKA 2IX3A 1E9DA 3V00A 1S1CA 1CJKC 1A2KC 3G5UA 3K0CA 3EZ6A 5DH9A 4MKHA 2QENA 5SZJA 1A4RA 1NN3A 1II9A 1G19A 4TQAA 4IKEA 4WZ6A 2ZRCA 1J90A 2YINC 5FTLA 1IM2A 4D4MA 1MOZA 1LF5A 3LY5A 5DE3A 2IS2A 2YWFA 1U9IC 1VIYA 1T3HA 4Y0AA 5KHOC 4HAYA 3U4QB 4DCTA 1LB1B 2KI5A 2OM2A 4JVLA 1XTQA 6Q21A 4NCIA 4ZKEA 4K46A 4H1VA 4BE7B 4A0HA 4EDHA 3AVUA 2E1RA 1J70A 3SZRA 1ZIPA 4LYHA 1JPJA 4JJZA 1AK2A 3I1FA 4LI0A 3WNDA 1EX7A 5AUQA 2MSEB 2B7CA 1Y3AA 3LO5A 1KO8A 1L8QA 3QVVA 3GEHA 4PSAA 3TIFA 3UG7A 1ZNZA 2XAUA 2CL0X 4Q7LA 4P0TA 4Q1EA 5CM8B 5GVRA 3RSLA 5HPYB 2ZI6A 2QP9X 3WMEA 2RCNA 2GDJA 3BRWD 2ZRIA 4MYHA 4W7SA 4GZMA 1EFRA 3IDQA 2Y8EA 1R5OA 1WRBA 2J0UA 2P3SA 2IUUA 3T1QA 5BW8A 2V1XA 4JKIA 4TTQA 1E2PA 5HCNA 4GP7A 1KK1A 3BOSA 2VIIA 1GRNA 2JJ1A 3TJZA 3RVBA 1HTWA 2B7BA 4O25A 2X2EA 5SZHB 5IRCD 4NPHA 2JLZA 2UKDA 3ICQB 2OCPA 4TLBA 2V4ZA 4XWKA 5FI0B 3W5IA 5C46F 1RW4A 2XOKD 4QGHA 1X8LA 1E99A 2QA5A 5K8LA 1E9BA 4TMWA 1Z2AA 3R9IA 1QBKC 1M2OB 1TUIA 2RGBA 4MRSA 2BCGY 5FPHA 2YOHA 3QPUA 3RS5A 1MRNA 4HUQB 4LHYA 4P4UA 2XTZA 3KTAA 1S1MA 5JHGB 4DLVA 2O8EA 3M4YA 3THWA 1ZM3A 1DAIA 1DADA 3NDBB 1JR3E 1SXJD 1E9FA 1ESMA 2OE2A 3QBTA 1AKYA 4OQFA 5L3SA 2FEMA 4LC0A 3IBGA 3ND8A 3RRMA 1PLKA 1LS1A 3TKLA 2GETA 1E2FA 1MO6A 1PLJA 3QIAA 4BPBA 2CJWB 4MRPA 5EP1A 2GZDA 3ASZA 1S3SA 4DHEA 3GJ6A 3EZ7A 3K53A 4PHFA 3UKDA 1XCPA 1W7AA 3KKQA 4U7DA 3T1TA 3FOZA 1D2MA 3ZYCA 4ON9A 1OXTA 5GADl 3D31A 1UBEA 3W3ZB 1RYHA 1XTRA 2EYUA 1TPZA 3NEJA 1G7RA 3CRMA 3K70C 4FWIB 1RYFA 4JLNA 5KYKA 3KQNA 2BJVA 1ZC3A 3KL4A 1GSIA 2ZRKA 2ZXUA 4C2UA 4BFXA 4JLBA 1CP2A 4G5SA 3IIKA 2PMKA 1W0JA 1DELA 2G6BA 4WIAA 1KGDA 3AF3A 4MH0R 2B92A 4ASUA 1QHIA 4BFSA 2FNAA 5G53C 4ZDKA 2FWRA 1FMLA 3UWOA 1U81A 1Z0FA 2A30A 4M9SA 3ZH9B 1GL9B 4JVNA 1FP6A 1KDRA 5ELXA 1VYVA 5CB6A 1KO5A 1OW3B 4M1SA 4R2IA 4XD7D 1XDBA 3EX7C 1N0WA 4YC7A 4FWTA 2RB4A 1F2TB 4Z8YA 2G88A 5K8UA 3R8FA 2YC2C 2QRNA 4JLMA 2DWPA 3I5YA 1AIPA 1NVWQ 2V7QD 1E2LA 4HLUA 4AI6A 1NNEA 3NDPA 1FTNA 1FFHA 1T0JB 2O5VA 1HEIA 4HLQB 3AVPA 4A2QA 5BN5A 3CRW1 1UFQA 3SQXA 2C9YA 4DJTA 5BWMA 1II8A 5JEDA 1OHHA 3Q5DA 4MA4A 2ORWA 4NYJR 1IQPA 2V3CC 1Q44A 4DLSA 1IN4A 4N1AA 1F2UB 4OHYA 1Z47A 2ZE7A 5LB4A 3U61B 4OQXA 4NYJQ 1UDXA 3CKLA 3CPHA 1VCMA 2BM0A 2C9CA 4TN1A 4C30A 4Z54A 3IHLA 4UXIA 3X1ZA 4EPXA 1G4AE 2QI9C 4DLTA 3K0FA 4TZ6A 1FOEB 1ZCAA 2OV2A 1L2TA 2X8AA 4MUAA 3FWYA 3K9NA 5IK2D 3D3QA 4EPTA 1AN0A 3RS0A 1NKSA 3CLVA 4JLDA 2IYTA 2GCOA 1BOFA 4HSEA 5G40A 2AFHE 2R2AA 5EP4A 1AA9A 1YKSA 4H9GA 4LHWA 3I92A 4XOIA 4DC9A 4DCSA 1UKYA 1XP8A 4B47A 4CT4B 1A1VA 5E7JA 2IXGA 2ZREA 3CBQA 2XB2A 1HUQA 2GILA 4A6PA 2MMGA 2V6IA 3CX7A 4I99A 2QGNA 3QXJA 3KJEA 4QGAA 5FBWB 3VQTA 3BJIC 4C0QC 5IHPA 3RWMB 3FYHA 4A2WA 4BFUA 3X1XA 3RANA 2OCBA 4D0LB 1Z63A 2ZITA 4ZDWA 4XTCS 1SGWA 3VU9B 1EFUA 3BE4A 1W48A 3OIUA 4Y0VA 1IAQA 3AQ4A 1G5TA 1G8FA 3FDIA 3VR4A 1HQCA 4Q4AB 1TF5A 3L0PA 1E2KA 1FZQA 3LBIA 1QHHA 2QAJA 4IOJA 2ZSDA 5CLLA 2ZU0C 2EFCB 3SNHA 2XXAA 1RFLA 3VNVA 1XJQA 3RDPA 3WYGA 4JYCA 3KQHA 2IS6A 3GLIB 4C9BA 1DARA 1JQLB 3NBFA 3BC1A 4A0RA 1CR4A 3U3OA 2JGNA 2EFDB 5CYOA 2I1QA 4OHZA 4LZZA 4ACBA 4CEHB 4GOJA 4EJSB 3GJ0A 3WP0A 4UKDA 5GJCA 4BLOA 1WBBA 4HYYA 1U0JA 4QG7A 3WYAA 5DNYB 1G3IA 1NMZA 3VX4A 4DWJA 2WWFA 4Q7KA 5J5CA 2WZQA 2CXXA 2DHRA 4XVRA 3U6KA 3LVRE 2ZRGA 2R6GA 3Q5EA 4G5GA 2GKSA 4BZPA 2A9KA 3UANA 4NCNA 4EPWA 5HE9A 1FW6A 4B43A 2B6HA 3CR8A 2H8KA 5F9FA 1EFRD 3AEZA 4RFSB 3WHKA 4IDQA 4QGGA 1R0XA 3MJRA 3A4MA 2WKQA 4B3BA 1TX4B 1CS4C 2ZRAA 1XD2A 2FFQA 3FMPB 3MLEA 4QGFA 4L9SA 2BM1A 2VLIA 1AZTA 1YZUA 1TAGA 1KMHA 3RNLA 4LY6A 1NSTA 1T0HB 2B8TA 2P0EA 4TMTA 5CDFA 2VO1A 4G1UC 3WBJA 5E4FA 4DSNA 1XU4A 2CK3A 5FUVA 1NP6A 4Q21A 3SYLA 4DDUA 3K70B 3REFA 1M7HA 1ZD9A 2WWIA 4MYTA 1I2DA 2Z6VA 3H4MA 1FL9A 2GJ8A 4BASA 1I4TD 1O87A 4KSBA 3B8HA 2P5SA 3JZAA 3ZVMA 3LD9A 1RRGA 4YMVA 2WV9A 3BK7A 1G3UA 5L3RA 4P3YA 3E5HA 5UKDA 4TMKA 2V1UA 4O2LA 1MV5A 5EE1A 2SHKA 4JZKA 1Q3TA 3CH5A 5AUOB 1DTSA 4FCWA 4V03A 1U0HC 3MRSA 3TW8B 5J4YA 4MKIA 2R6FA 1II0A 3TSWA 1XCMA 1GAJA 1MABB 3LWNA 2OXRA 2ZVPX 1T5LA 1P73A 3VAAA 3P27A 3M0EA 2BBWA 1IN8A 4GZLA 2AWOA 2O52A 2ZE8A 3TQCA 1Q22A 1FX0B 1WCV1 1FMJA 4GOKA 4NTZA 1CRQA 1YRBA 1KK0A 3K09A 4Q19A 5EXXA 3B78A 5FL7A 1P9WA 1LF0A 4TSFA 1XCGB 1KK2A 4TQUS 1KAGA 1W0JD 2FSHA 1ZINA 4LJ7A 1RRCA 2TMKA 3P4XA 1NN0A 3QNUA 2ZQ5A 4B35A 1IXSB 3UXMA 2JDIA 4PANA 1XXHA 4FMCF 4KXFB 4MRNA 4MYCA 1W2GA 1KI2A 3SBDA 4HLCA 3AP2A 2ZI5A 3GLGB 3GFPA 3HPQA 2IUSA 2D7CA 2HEIA 3G0HA 4B44A 4LBZA 3QKRB 3RS3A 2O8CB 2IA5A 5TDHA 3AVYA 4R7ZA 4DSUA 1KSJA 3ZVLA 1GTVA 4D4LA 4TLDA 4QRHA 3FKSA 3K9HA 1KSHA 1L7VC 4QC2A 2CL7X 1EXMA 3TRFA 2D62A 2X77A 3ZZTA 4P4SA 4OK5A 5FUYA 3W5JA 1G18A 1ZBDA 4PQYA 3EA5A 4BLQA 4RD4A 2ZJAA 2OBMA 3EC1A 1QDEA 4OL0A 5EUMA 1F5NA 4Z8XA 4LJYA 1E2JA 3TVTA 1M7BA 1OHHD 1Q57A 1R5BA 3C16C 5C2JB 3AGQA 2V8OA 3L0SA 4JLPA 4E22A 1ZU4A 3B6EA 1YJ5A 2ZEJA 2JLRA 3AVXA 4F91B 1QG2A 5KPDA 2CE7A 4TL9A 4ZKDA 2ZR9A 821PA 4EQ6B 3F0TA 3WXMA 1KDOA 2F3TA 5EQTA 1W47A 1GNPA 1W44A 2HUPA 1UBFA 1IOZA 4OHVA 1DOAA 5GJBA 1JJ7A 2DFTA 1UADA 2Z4SA 4HZUB 3ZIAA 1N5LA 4MUBA 1L4UA 1N6IA 5HZHA 3PEWA 2V9PA 1E2DA 1US8A 3CB4A 4FXPA 4EUNA 3TH5A 3P1JA 1SXJC 2X19A 5CK5A 3GLGE 4LSGA 3EIEA 4Q1CA 2H92A 4LJ9A 3UPUA 3IPYA 1P4SA 2A5YB 3GCGA 2J59A 1VCOA 4OI2A 1C1YA 2ZS9A 2ORIA 4HAUA 4LJ6A 5F98A 5E95A 5J4HA 621PA 2YOFA 2EQBA 4IOKA 4GMDA 3ASYA 4KHZA 4PZYA 4RZUA 4U00A 5AK0A 3SFVA 4LPSA 2CCKA 1Z83A 4FIDA 4G5RA 2XTNA 4V0KA 2GJ9A 2Q3HA 3MWJA 4NCHA 4TQ9A 5J40A 3SDZA 2RHMA 4GI7A 4Z1MA 1Z0JA 4DLWA 4XIGS 1CIPA 3W3AA 5A5GA 4B33A 1NVUQ 2OILA 1M7GA 3SR0A 3I62A 2GBLA 1RIFA 2FSGA 5E7IA 4G01B 5FI1B 5CDFE 3AGPA 2O8BA 3VHLB 3LXXA 3IIMA 3ADKA 4OHXA 3RS4A 2IW3A 1KZ7B 2VP4A 3EAQA 1YZKA 3HYTA 4EFMA 4B71A 1R7RA 2O0JA 1Z06A 4TMVA 4KI0A 5EE0A 1D5CA 2C78A 2NO0A 3NXSA 5FTNA 5E3HA 3L82B 2RHDA 4IVPA 3CIOA 4D26A 2BBTA 2GAOA 1DS6A 1KJZA 4RZXA 2VP0A 2W0MA 5EUQB 3ADBA 3K0SA 2W58A 1VG9B 2A5JA 1GL6A 3PIRA 2EW1A 4HDCA 2OAP1 2YYZA 4RSGA 3L0OA 1VPLA 4TLAA 3AF0A 1Z08A 1ZAKA 5B2ZA 4C0KA 2RGNC 1T6NA 3KKNA 2FZ4A 1ELOA 3EWAA 3NHBA 5JRZA 2RGAA 4M9XA 4BUJA 1XTKA 1M8PA 4U02A 3TR0A 2YZ2A 3P4YA 1CLUA 2PZGA 5KU1A 3U4QA 3U7HB 1CJVC 2IEZA 3GLHE 2PMDA 4QHYA 1T4GA 1ONBA 3ZD7A 4OK6A 4ESVA 1OB2A 1U94A 1R0WA 4AYTA 1T3LA 5TY0A 3R7WB 1YZQA 1JAHA 4A8JC 2QY9A 1GKUB 1E79D 3TK1A 2VEDA 4DIDA 5JSZA 4I1VA 2WIBA 4GL2A 3NHAA 2ZUCA 2NOAA 2I1VB 3VMFA 2CK3D 2LCFA 4DZZA 4F93B 4OJKA 3UATA 1NRJB 3A37A 1Z0IA 2YJTD 4US1R 2YHSA 4CEJB 4H1UA 1HA3A 3DZDA 1XMSA 3BAFA 5JCZA 3A6PC 5DGXA 4F4IA 5FBRB 4FMBB 2C95A 4Z51A 1VG1A 5LD2C 3K1JA 3DZ8A 3FTQA 1F60A 2J9RA 2WWYA 1EX6A 4D6PA 1R8SA 2QP3A 1EG7A 4YMTA 5EE3A 1N0VC 3CONA 3U3KA 5F2EA 2GRJA 2NO9A 2ZR0A 4Q03A 2CHGA 1LS6A 3QVUA 3QKUA 4DDWA 2ODEA 1AQYA 5KSPA 3HU3A 1XJ0A 5AUNB 3OIVA 2BKEA 3ZD6A 1P6XA 4OQMA 3WRXC 2KJQA 1IONA 2VL7A 4NMMA 3QKSB 2ATXA 5TVKA 1UKEA 1M1YE 3CM0A 1ZUNB 4M2LA 4DUGA 2N1BA 3K0CC 2IYRA 1G3QA 3AB3A 4QNRA 3H0KA 2ZETA 1W0KA 1R5NA 3T15A 2QTFA 2WSMA 4M1TA 4DT1A 2F9MA 2HF8A 4QFMA 4BZQA 4QBIA 4EKDA 3GJ5A 421PA 3MG9A 1G9XA 2OXCA 3KQLA 5FOVA 3RYTC 1EESA 2J3EA 3VR5A 2WKPA 1QG4A 4AIIA 2QUZA 2CJWA 2ZUDA 4DIEA 3I3SR 2JDID 4G3XA 4Q48A 4DDVA 1TEVA 2DFKB 3B9PA 4UNSA 3KJIA 3WNCA 2OSBA 1E2EA 4DRZA 4IVQA 3Q3JB 4IDOA 4A2PA 2ZROA 3BB3A 4P31A 4XWAA 3AVTA 3KXKA 3SYNA 3CF6R 2J0QA 4J0QA 2DB3A 3NC0C 2IEYA 2WJIA 1SXJB 1EFCA 3B5JA 1QVRA 3L8YA 1X1RA 2GJSA 1R8QA 1ZUIA 2UVQA 1TQ6A 2VHQA 1K5DA 3FKSD 5DI3B 3R9XA 3OEEA 4MGZR 1YZLA 1G5PA 1G8YA 2YVUA 3IQWA 3DEFA 3ZLJA 3NKVA 4D0NA 3VHXA 4LV5B 4UNPA 3TNFA 4BLRA 4PSKA 2BOVA 1DVRA 5H1YA 4KFRA 1JPNA 2JEOA 1Q3HA 2IC5A 2CHVA 2CMKA 5G3ZA 5AUPB 3IHWA 1JAIA 1LVGA 1TQ2A 2BWJA 3T1VA 3WNBA 2JLUA 2PJZA 3PCRB 1I4LD 1X3SA 2UZIR 2PCJA 3I5XA 2GEVA 4QHSA 3LQQA 1WF3A 4NE2A 2F1JA 1NBME 2H1LA 2WMOB 4MRRA 4LHXA 1UM8A 3T1OA 1M34E 1VMAA 4C0JA 3SEAA 5DHAA 1Z2CA 1SHKA 1ZM2A 2OBNA 2WOJA 1W4BA 4HB2A 3CO5A 5FTMA 3ZIAD 4XWOA 3EZFA 3V4RA 1BO6A 2GXQA 1KI6A 4JLAA 4WZBE 2ZSEA 3A4NA 4JBXA 3BD9A 2W2TA 2EVWX 5C1BA 4JSYA 4Q4HB 4C7OA 2QNRA 1YZNA 1F2UA 3OZXA 1R10A 5CK4A 3I8XA 4P32A 1OXSC 1KI4A 3X2SA 1GKYA 3PV0A 4TTPA 3PITA 4CVNA 4AG6A 4EJSC 1NG1A 4IDHA 1ZD1A 1SKYB 4KFTA 4NCKA 1IN7A 2XJ4A 4IOLA 3B1YA 1G41A 4Z1MD 2HV8A 5EE5B 2RAPA 2KE5A 3SJAA 2R6AA 1KI1A 2W6JA 3LFUA 4LX0A 3IEUA 3QY0A 3MWYW 1JI0A 2Q9CA 2F7SA 4URVR 3DPUA 1GRQA 4A8JB 2JIZD 1H8EA 1ZU5A 3U44B 5JJIA 1XMIA 5CJPA 1AM4D 2ZRNA 2CLSA 5DI9A 2YKGA 5L3QB 3L2OB 2ZRPA 2IYLD 3TSOA 2FPKA 3VR1A 2MSCB 2IS4A 1U90A 2ZAOA 1FQKA 3NBZC 2C2HA 3HDTA 4OHWA 2IWHA 4BQSA 4DVGA 2O8FB 1E9AA 4TL7A 1BKDR 1YR6A 2X2FA 5D3MA 5FTKA 1QVAA 3K0AB 5EZ5A 4CRWB 4AD8A 1SHZA 2ZRMA 1AJEA 3OFND 5LD2B 4M1WA 1SKQA 3THYA 3LX8A 4PO1A 3WY9A 1CTQA 2GNOA 4S35A 3C7KA 3B1VA 4HLUC 1B23P 1S9DA 2O0KA 3GLIA 4BRWA 1GUAA 3RC8A 2O8DB 3U7FB 4WW0A 4KBGA 1MH1A 2WKRA 3B82A 5L8VA 5HE8A 1AS2A 1HY3A 1ZM9A 1YR8A 2ZS8A 3PUXA 1T3SA 1GITA 3A58B 1W36D 2N46A 4IW3B 4TL6A 2DWOA 3PJRA 4R2HA 3HR7A 1SVOA 2VQSA 4E03A 4LV6A 5K8IA 4MITA 1Q1EA 5AR1A 1JEEA 1JR3D 2WVJA 3DOEA 3PQCA 4ZIRB 5A4JA 1JR6A 3OE7A 3PR1A 4BFYA 4M1OA 3RRZA 3BORA 2OUKA 3NG1A 1N5IA 2WWGA 3HYRA 4KAXA 1U99A 4L5BA 5AJXA 2BMDA 3A36A 2GESA 2OFWA 1XPRA 2ORVA 3C5CA 4RD6A 1P2TA 1E1QA 5TMPA 5C18A 3U60B 1E6CA 2D06A 3KB2A 3W8NA 1IJEA 2NO7A 4DB2A 3HP1A 2PZEA 4HDQB 2GZAA 5LBIA 3TAHA 1MKYA 4GRAA 5JEEA 4US2R 3C15C 5LB2A 5JBQA 4OI0A 4KFUA 2E87A 3CR7A 1VYUA 4G5OA 3THYB 2PX0A 1EFTA 2Q6TA 1S3GA 1LY1A 1FPMA 3CZPA 1YE8A 4PAOA 2HXYA 2J0UB 4DUGD 4MDFA 4B3DA 1T5IA 4UNNA 5AJYA 1W0KD 3GJ3A 1V5WA 1E2HA 4N3NA 3IQXA 2C04A 2ZRBA 4ZCLA 1K5GA 4XTRA 521PA 3R8CA 4L4UA 2W00A 3TAUA 3AKEA 3ZDQA 4KLZA 3FPAA 2QBYA 2FGKA 4TYQA 3W8RA 4LBWA 1E2IA 4Q00A 1YHNA 4C0HA 3GP8A 5EXSA 3SI7A 4TYNA 3WMGA 2Z83A 3KQUA 4Q66C 4DLZA 2QAGA 2CLCX 1NIJA 2QL6A 3WBKA 2R62A 4CDGA 3D6TB 1RRPA 5JS8A 3BBPA 3KTAB 1X8KA 4ZCMA 2GCPA 4IEIA 1E2QA 5LPNA 4U5XA 2O8EB 4NONA 1G7CA 3NIBA 3THWB 1DO2A 2QP4A 2GXAA 4KITB 1N6PA 3FFAA 4KCGA 3RABA 2GCNA 3AVWA 4FD2A 3KQKA 1S96A 3O47A 4LDJA 3I61A 3D7MA 1G16A 1KJWA 4NYMR 4AG5A 1Z28A 3LV8A 4ITRC 2NMVA 4IRUB 2WWWA 2J7PA 2OG2A 3VR2A 4KBFA 3NBXX 3SN6A 3UMSA 2VP2A 1N6LA 1NL3A 1X8JA 2NO6A 4LWZA 3KDSE 4PR0A 5FFMA 5FOSA 2F55A 3BXZA 3X1YA 3ZQJA 2KSQA 2QTVB 1XEWX 3BIFA 3GLGA 3CX8A 3EA0A 4I81A 4IXNA 1F48A 3TBKA 4DKXA 5P21A 1GVNB 1KTVA 4P33A 4UXHA 2WJHA 4Q4JB 4YLGA 2REXB 5JJLA 3QEOA 5FPYA 1OE0A 1HE1C 3NVAA 2Q3MA 1N6RA 4Q7MB 4G5QA 4DLXA 1P60A 2F9LA 1UKZA 4C0SA 1N6OA 1IBRA 3JVVA 1CJUC 3FGNA 1B0UA 1Q12A 2GJKA 1U8YA 1CR2A 3VNUA 1KDTA 1HV8A 1NVXQ 2WWXA 4RZ3A 2JJ1D 3C41J 4B74A 1OFIA 1N2CE 4W5WA 2ZSBA 4ZV4A 4A4DA 1JXMA 1LW7A 4PPNA 3AF4A 5JWHA 1COWA 3NC1C 4BLPA 1A2BA 5HKKA 2DFNA 1E0AA 4PQRA 2P5TB 1DE0A 4RZ2A 3GLIE 1XBTA 2PT7A 2WHXA 5KDDA 2ODNA 1RZ3A 3BFXA 4RFVA 1D8TA 4CEIA 5CLQA 4HZUA 1Z6XA 4XH9B 4IDNA 4WA7A 2QG6A 3BH7A 4X8LA 2JCSA 2BBOA 1UBGA 2RGCA 4G0NA 1LNZA 2W6JD 3U3RA 1SULA 4B32A 1S0UA 2ZE6A 3TMKA 4AY2A 2YV5A 5B64A 4D0GA 4PHHA 1H8ED 2YWGA 2JASA 2I4IA 4JLJA 3P20A 4DB4A 1A7JA 2QORA 5JZVA 1NSFA 2W2VA 3DDCA 4A15A 2ONJA 2J7KA 3K0FB 1ZRHA 1WQ1R 4MGIR 3S1AA 2H16A 4LC1A 2R65A 3B13B 4RD2A 3N2EA 1E98A 3QXCA 2ZJ8A 3GLHA 3BGWA 4HDOB 4ABYA 4O0MA 1C4OA 5CIWA 2RGXA 3VTKA 2X1VA 2VSFA 4KV9A 4PZZA 4AK9A 2CE2X 2NPFA 1OH8A 3AUYA 2VPPA 1I2MA 4BFVA 1KK3A 4FINA 3U2QA 5FOWA 3A8TA 1G64A 3O8RA 1NMYA 4Q18A 4PFSA 1J8MF 2ZRDA 3OIWA 2D4HA 4Q1FA 5B58C 3EPLA 1DEKA 1TEXA 4ASUD 4RJLA 3ECCA 4PQFA 2NIPA 3QF7A 3GFTA 1U8ZA 2H57A 2OAQ1 5DN6A 2VA8A 3MFYA 1R6BX 1OXVA 2UZ3A 4KYUA 4Q9JA 1OH5A 3QSYA 2ZAMA 4QM6A 4ZI3A 1OKKA 3Q9LA 5JWOA 3HU1A 2CCJA 4AURA 1KY3A 1FNMA 3OE7D 2HT1A 1XWIA 3R9WA 2V55B 5C4MA 2D3WA 2QPTA 2WJJA 3C8UA 5KNDA 1ZW6A 2A2ZA 2KBFA 1E69A 2FDCA 2FX3A 3KUDA 3RAPR 3RS2A 5B30A 4M22A 4MGKR 5GVSA 2F3RA 3WMFA 1TNDA 1NI3A 4UQOA 3N2IA 1E1QD 1XMJA 1KSGA 1S4QA 2J45A 1E2NA 4ILEA 4UJ3A 2GZHA 5KSYA 2PT5A 2V54A 2WTUA 3U3MA 4EFLA 5FBVB 3LXRA 2AD5A 2BKUA 3AVOA 3QE0A 1VCIA 4WVFA 1QHNA 3ZVRA 4TL8A 2QTHA 1GFIA 3MJHA 3QBVA 1TL7C 4LBVA 2LKDA 2EU8A 2IL1A 4UJ5A 4V0LA 3T35A 1AS3A 1J99A 2AD1A 2PLFA 2QMEA 3EC2A 3BH0A 5HCIA 4CEJA 3V4FA 1FP7A 2D7DA 3AP1A 4UXJA 5SZKB 1NLZA 3WYFA 2HXSA 3PEVA 4X8HA 4DEYA 4BFWA 2OBLA 3THOA 1OT3A 1XD2B 1J8YF 1Z22A 2GAAA 3IPXA 4QXAA 4PC1A 5FOTA 3QI2A 4RVCA 4HB4A 2XNDA 4QBGB 1Z0AA 2BHRA 2GWHA 2HT6A 2KB0A 1DPFA 2NQ2C 2ZRJA 4NL4H 2BMEA 2C5LA 5B57C 3RRYA 4MKFA 2I3BA 2G77B 2IT1A 2G9NA 4HI0E 1YVDA 4OI1A 2D74A 2DY1A 1F3OA 4IOMA 1OYWA 4P4TA 2R8RA 3PG5A 1G3RA 2WJGA 4PO9A 4Q1AA 4WBSA 4ARZA 1N5JA 3TUJC 3QKSA 2JATA 2DFLA 1N0UA 4M8NE 2IYVA 3LX5A 1HE8B 2GF9A 5H8WA 1ZM4A 1WDTA 1OIXA 1OH6A 3EPKA 3GQBA 2JLQA 4KVAA 3TGPA 1XTJA 5FBQB 1IN6A 2AR7A 1QZXA 4URYR 3MAAC 3RLFA 3TUIC 3ZJYA 3KFXA 5HTKA 1VYTA 1VDZA 4LV8B 1SVLA 4XSGA 2FV8A 1IY1A 4W5JA 4B3GA 3B7GA 4JMPA 4B3XA 1JQJC 4C4PA 3JZMA 1NBMA 3RS7A 1G7TA 4LJAA 1W36C 1RJ9A 1NJGA 2FA9A 4RCYA 4OQNA 4Q9LA 2FOLA 3QUSA 1NMXA 1SZPA 2IYWA 3QF4B 1YU9A 2J46A 4V0ME 1GM5A 3EW9A 5JCPA 4B2LA 3G82C 2RGEA 4JSTA 1VTKA 1OSNA 1XZQA 2XGJA 2CL6X 3QXSA 5TARA 2FE4A 5CIQA 2OHFA 1N6NA 4I1SA 4I1UA 5ANRB 1CRPA 4JT2A 1U0LA 2PJRA 4YMSA 2Q3FA 2BEKA 5EXPA 3VR3A 1BMFA 1KI3A 3CUEF 2ZYTX 2QPAA 1NN5A 1XXHB 2EWWA 3OF5A 1RE0A 2HJGA 3TQFA 3SBEA 1T8UA 4WOPA 4TT3A 3H84A 1P9RA 1W2HA 2ZU6A 2F43B 3IGFA 4TMZA 1Q20A 4DBLC 4LBYA 3X1DA 1KIMA 4AKGA 3MUFA 4BECA 3GLFB 2G0TA 1DG1G 2FGJA 1ZJ6A 3KKOA 1COWD 3QG1A 5AWFC 4PSVA 4B73A 4GP6A 3TVDA 5HKKD 2LWIA 4AC9A 1Z6GA 1ZD8A 4FCTA 1W49A 3CRQA 5CJ2A 4IVRA 1ZYUA
chains in the Genus database with same CATH superfamily
2BLLA 4CT5A 3R76A 4YVFA 2A5DA 5F7OA 2HLDA 3D8BA 1GAEO 1VJ0A 3DXFA 3OZDA 2XD9A 2FPPA 1DIBA 2PAAA 1X9IA 1UEXC 1UJBA 3NTUA 4P7JA 4EA6A 1T9HA 3PHHA 1CR1A 2Z4TA 1GVHA 3IHTA 5AHXA 2ZYUX 3MS2A 1MR3F 3DTYA 1C8BA 4Y2TA 4C3ZA 4ZHQB 1EJ6A 3VAZA 4C0BA 4BRUA 2WT4A 3O2JA 4HEJA 2P4SA 2GT1A 3V8PA 1ZGAA 3AP3A 3SVLA 5IP5A 5CW1A 4CM4B 2MJLA 5ER6A 1PUJA 5KDLA 1CG6A 2RARA 2XHEA 1FYDA 1Z88A 2D7JA 3SAJA 2PKRA 1NFQA 1K9VF 3AM5A 1AGXA 4PIPA 3TI9A 2GK7A 3F47A 1QH1A 2B99A 2ZSKA 2Q3DA 2ZIWB 4GI5A 5D5PA 5I4CA 1P39A 3WLOA 1AK1A 1BRMA 2NV0A 3OZEA 3VU1A 2ACVA 4FX5A 3GNLA 4QL3A 1XNJA 2RI0A 2N75A 3QYAA 1O08A 4W1QA 4ARVA 3B1WA 3KT3A 4BP8A 1YQXA 4ZVPA 3VYRB 2Z9BA 3B9QA 4MQBA 3D8HA 3X1MA 4EO7A 4NBSA 1KMMA 2VT2A 2FZLA 3GXOA 3MD9A 4FDUA 4HUQA 4JDPA 4L8WB 4UNIA 4PC6A 3SQWA 4A27A 4AY4A 5DNEA 5BVGA 2AFIE 4E1BA 3TD6A 2O7SA 1DT3A 5CX1B 4M1ZA 3IE1A 3CVYA 5J4KA 3L6CA 2ZIXA 4QU0A 4OJNA 4R6WA 4NE9A 4I55F 1V26A 1ZRMA 3ABOB 2LP4Y 4HB3A 3O4HA 3KAKA 4XVQA 3K7EA 2AHOA 3GQVA 3IAHA 2VNSA 2ERXA 3NV9A 4N6OA 4YJFB 4DLLA 3LP6A 1TXGA 5SICE 4YDRA 1J21A 4JI7B 1OLOA 4C43A 3DJYA 3TOCA 1L5MA 2C5GA 2XNSA 1A82A 1EH5A 2DTEA 4K86A 4QXMA 1KH3A 2Q3LA 4FOLA 4R9UC 1FDWA 3BIXA 3VKWA 5TQ2A 3QXXA 1NQVA 3V8RA 1X0XA 3EVNA 4RPKA 3BXOA 1Q6YA 1C30B 4YALA 2XQFA 1Y7PA 4N3BA 3VZDA 2PWPA 3K35A 1AKEA 2HIAA 5JOQA 2YDXA 4EGJA 1C1HA 3PHGA 3DZJA 1G4UR 3IJPA 2XMDA 1EUZA 3V8QA 1PGNA 1E3SA 2P35A 3LWZA 4XRGA 4X6UA 4FBGA 4HNQA 1OXKB 1N25A 1E18A 5AMXA 4L3WA 3ZE7A 3SHVA 1E20A 4DMFA 1WMBA 1HURA 3C0KA 3HVJA 3QPVA 4DCVA 4B7CA 1F0NA 2ZSJA 2QJFA 3AR9A 3HRHA 2AG5A 3MTBA 4HDAA 1HPLA 2FWMX 3DDNA 3O8DA 2DZDA 4R8KA 4ZAGA 4FYPA 5KCMA 1BH2A 3TEFA 5KNDH 1P2UA 1QAQA 4MPTA 6LDHA 2IW1A 3SSAA 2CWWA 5C32A 2JH3A 4ESEA 3G7UA 4KUHA 4N18A 3PKJA 4YWJA 5DO9A 1JHUA 5AVVA 3FPGA 3L1KA 3WFZA 1T24A 3FXAA 3C48A 3UOAB 2X40A 4JC8A 4EI7A 3P45A 1MHPA 2C82A 4RMIA 4TOIA 4Q9NA 5D6OA 4Z0NA 2YW2A 2ZULA 4F7WA 2ECKA 4D8XA 2XDQA 3KSBC 1X39A 4X1KB 2GZ1A 2IYXA 4HAVA 2V6JA 1KAOA 7ADHA 3TQHA 2ACEA 1XOIA 2OR3A 3EBOA 4IHKA 1IPEA 5FEMA 4EECA 3WAJA 3S5JA 1AGRA 3JWEA 3K73O 2FPIB 2XCTB 2RGGA 3SC2B 2GVDC 3AJAA 4JLKA 1T5TA 2WF6A 5DMHA 4ZZ1A 3DOJA 5BR4A 4WBNA 3EISA 3ABIA 4V3CA 3JQPA 3DO8A 3D4OA 3H5NA 4ESOA 2EKZA 3ZYZA 3KLPX 5EJEA 2FG5A 2JHPA 3OKFA 4K87A 2HRBA 5LVAA 5THQA 2WJYA 5LA6A 1Q7GA 5F78A 3K9GA 4X7PA 5A5FA 2D59A 2H5EA 3JTEA 2FJPA 3OCWA 1YR7A 3VPFA 1E8NA 1Z39A 1WDMA 5FJIA 5ADUS 3IUEA 4OOFA 4ZVVA 4HH3C 4HNTA 4JL6A 4OCZA 4QGBA 1U9IA 4TYWA 5KOYA 4X1YB 1XK7A 2V0CA 4HQFA 4QIHA 4ITUA 4IXWA 4JBYA 2P3QA 4M46A 5IKOA 3GVCA 2ZJ7A 2X8LA 1MQSA 1QX4A 4I4TA 4I6EA 4MX8A 1VE1A 3LHKA 5FLYA 2UVPB 3OEHA 3WKAA 4ENTA 1UPFA 1DJOA 3GXBA 2RMKA 4EJFA 1HLGA 2C0PA 1YOVA 4BNZA 3WBFA 2FWAA 1P1HA 3RB8A 2ZXEA 4RQAA 4Y18A 1Z29A 1FRVA 3KEOA 3BUSA 5BN3A 3B8EA 3SDSA 3VDXA 3HYCA 1A9PA 1C4KA 1G291 4JL8A 5IVKA 2B4YA 3JSAA 1R4NB 5E6UA 4QHTA 5K0NA 5HM8A 2CBGA 2FPWA 4Q9KA 4HN2A 1TA0A 3ZWPA 1P4JA 1C81A 4KXVA 4Y2RA 4DEXA 4YGYA 4GPIB 4NCBA 4MUJA 3N5CA 4PC2A 2QB5A 5D8DA 3ES9A 4YRJA 2JGAA 2P9EA 1XEXB 4NBNA 4QKQA 4OH1A 4O3MA 3BPSA 4FNGA 3T0GA 2QUKA 1QYDA 4DT1B 3BGOS 2PRYA 4LCJA 1XMXA 1C29B 1XVAA 2CXNA 3DZIA 1YRWA 3H19A 1R4AA 1E2MA 5AVXA 3P52A 3IESA 2XKKA 3ZV4A 3IKLA 1B14A 3QA9A 1DZ3A 1G6OA 3E9CA 3GLRA 4IV0A 3V5NA 4D4JA 4R8VA 1MO3A 3T12A 4OHFA 2WTXA 3S8EA 3BWEA 2BP7B 4X7BA 3RBXA 2L69A 1R9JA 3K16A 4E5NA 1BMFD 3FOFC 2IS1A 3E1GA 3L0CA 5DYIA 3W4IA 1SM4A 2RKBA 1N5DA 3NH6A 1X6VA 3KQQA 4TT3D 1OWLA 5EGSA 3BF7A 3GX1A 4D82A 1VL2A 2G5CA 1ABFA 2W6IA 4EJSA 3IEVA 4HB0A 2EX1A 3BFJA 1QDUA 3HCFA 4NU6A 5KTOA 3OLZA 3PBKA 5IWCA 1W46A 5JD4A 1SC4A 2WFLB 4JJIA 2HLPA 1MG5A 1QOPB 1U02A 1IXRC 2X5OA 2DRIA 1JHMA 5D00A 13PKA 2O0HA 4EENA 4X6YA 1M6NA 2JKYA 1FSGA 1YHYA 4RVUA 5JHHB 1SXGA 3ZK7A 4IQ8A 2F8LA 3AHGA 2HLDD 2WAOA 2H2FA 3AIIA 2VRWA 5BNIA 3EE6A 3GROA 3IR7A 2YFKA 5DHSA 1S8AA 5EWMA 4BNLA 2PBRA 3H05A 2DUWA 1WVGA 1Y6QA 2X4GA 4DXAA 3E05A 2QRLA 5AW6A 3UMBA 1G6HA 4I0WB 4WXYB 1M54A 1JAZA 3TW4A 5LQAA 1CQJB 3M5PA 3JWHA 4GM4A 5ER9A 3TR5A 4GNKA 2AX4A 4G0QA 1ZSNA 4AYXA 4FBLA 2BGWA 1QFXA 5FR1A 3R40A 3PFFA 4GVPA 5EJIA 5HA5A 3GA5A 3ZWYA 2GHIA 1HZZA 3QMWA 3QQPA 2FW0A 5GJWC 4RTSA 4JI6B 2ZRHA 1AX9A 3O95A 4MQEA 4LZAA 3UAVA 2XCSB 1NLFA 1H85A 5B1EA 4L4RA 1QMGA 2DTDA 2A5FA 2QTRA 4XJXA 1F5SA 3ROXA 5KNBH 1XUOA 1CEXA 4ER0A 4FGKA 1KQOA 2WMNB 1XCJA 3DCIA 4OQPA 1NJFA 2BDTA 1YFJA 5ALLA 3UUWA 4CIWA 1K98A 5K09A 1BX1A 3ZU4A 1N3LA 1PTJA 2G9RA 4LW8A 1IBSA 1Z0KA 5U4QA 5JO0A 3WK9A 1TO1E 3E58A 3EAFA 1X14A 2WJVA 3COYA 3G49A 3NDJA 4MJ3A 1YDEA 1KDPA 1Y63A 4IKOA 1XQ1A 4RPIA 4LAFA 1RAAA 2Z9CA 1X1DA 3WJAA 5KNLA 2V7WA 2WG0A 3EVAA 3SHOA 2PU7A 3P71T 4D0SA 1NHWA 5COBA 3INYA 4RLQA 1TF7A 3LHSA 2B78A 3SJCA 3NEYA 2G1KA 4R1OA 2WSSA 1NF9A 1V71A 3MTIA 1JSLA 2YMLA 4LPKA 5EIAA 3VR5D 3U7IA 1Y7IA 1M0TA 1MH9A 1GZSA 1HFKA 1YQWA 5DIFA 2AKAB 1ZK3A 2PS0A 3D8NA 3GJ4A 4FN5A 4LRXA 3LDUA 1X1BA 3E8MA 2ONCA 3DEZA 1SUDA 2ZCUA 4A1FA 5KTYA 4AZWA 3NQ41 2VDPB 4QYIB 1RT9A 4QELA 4YRCA 4P0PB 1HC7A 1Y82A 5HRAA 4WN9A 3GEMA 4DA7A 3N6VA 2JHAA 2DYKA 3G6WA 3RSGA 2CJPA 2ZJZA 1V5IA 5L7TA 3T06B 1ZMOA 3DCJA 2E9SA 3OTWA 1T1EA 3HFJA 3I9V1 3SR3A 5L3SB 3QE2A 2NSHA 1FK8A 1SXPA 1SZDA 3IMKA 1K6EA 4EI2A 1ULSA 3K8YA 4UVHA 5CG1A 3HDJA 2O0MA 3PDHA 4ZVLA 1YUMA 2GWRA 4M9RA 4JQYA 1B7GO 4NWIA 1H8HA 3L0ZA 2K6GA 2ONZA 1YR9A 5B3LA 3AY6A 5D3MB 1JU4A 3TLKA 1DHRA 3AKYA 4IXTA 4NYMQ 1J09A 4JHXA 1D4AA 3MBKA 1Q15A 4BLSA 1IJKA 1O57A 3M4NA 3SU8A 3AV0B 4IMIB 3TB4A 3DM5A 4ZT6A 2CDNA 4DNQA 2AN9A 2VF7A 4YJ2A 1M67A 3LBYA 5B1SA 3SHQA 3P94A 4AB1A 1MW8X 4MAAA 2CNOA 3GU3A 5I4KA 3QKRA 4XVHA 4WX2B 2UUCB 1TQ4A 1F2VA 1A5AB 1JFLA 2WIAA 2G8NA 3F9IA 1Y1LA 2Q07A 4KQHA 2DPXA 5EQJB 4M1QA 3RK1A 3X1WA 2W43A 4DC1A 3V9PA 1FDOA 1WMAA 2X6RA 1UEIA 2XQGA 2I87A 4KLAA 4MHSA 3KJHA 2C94A 2D2FA 2X9VA 4QEZA 4URZR 5ALRA 1GGKA 2CVFA 4EZEA 4DBVO 3EPRA 4WSOA 3UV7A 2PTHA 4ZI7A 5JI3E 1OBFO 3CNLA 4J9VA 3W7VA 1OV4A 4WNAA 4KN8A 4M9ZA 5DYGA 2QZ4A 1I14A 1AVTA 2YWRA 3GJQA 3LUAA 3H42B 3KAJA 3NNNA 4FNMA 4LDQA 3UOWA 2QUJA 3CSDA 3NBMA 3W4KA 4YDHB 1ESNA 4LMPA 4U63A 2E4UA 4A7PA 4JLVA 1DO0A 3EZGA 2L82A 4RENA 4HAZA 4A8HA 2VXBA 2HMAA 3FNFA 4N3CA 4UTNA 1RXCA 4ATNA 2AOUB 1MW9X 5DOVA 1D2EA 1GIAA 2H4HA 3GEIA 4XW2A 5GZ6A 1SVNA 2QZJA 4K8RB 4PC3A 4BVAA 4DQXA 4LYAA 3AEUA 3FR8A 2L18A 3S2IA 3SF0A 3C5WP 3TPZA 5KMGB 5BUZA 5EQDA 3AJRA 3LQRA 1TQ8A 3AONB 4NJEB 5HZKA 3Q41A 5H0IA 2I22A 4O4JA 3E9YA 2RB5A 4OAQA 1II8B 1EDEA 3FCEA 4IDDA 3OEHD 2I2WA 2Z4RA 3DE5X 3EZ9A 4NR0A 1CUDA 1CUVA 3SF8A 4W9NC 5ICMA 2X9GA 1HLFA 4FE7A 1GKIA 4GQBA 1YZTA 2ZBDA 2AMFA 2BFBB 3CEJA 4K2HA 3UC5A 4H77A 1W5BA 4ZYWA 2FXIA 2W83A 4ZYUA 5EJAA 1CIJA 1SCQA 3ILVA 3PR3A 5SZIA 5M04A 2DECA 4DNFA 2POQX 2PZFA 3K5WA 4WK6A 5FUXA 3W90A 1PEDA 2VOJA 1IATA 2R6HA 2XTMA 3UO8B 3IEMA 2GCOB 1LTQA 3IUNA 4NAUA 3G9UA 2FFRA 2R7AA 4YYZA 2BFOA 4EMSA 1GUFA 4FZJA 4D98A 1DJLA 8LDHA 3U3XA 4ROTA 3BFVA 1PP4A 3H2YA 4IX1A 4A5OA 1YNOA 4EG0A 5TV2A 4LOHA 3V2HA 1WP4A 5E7QA 2QPOA 2QBYB 4ZAXA 2X13A 1W9MA 4MP3A 3OCCA 4MZXA 5IUKC 2OBFA 2VRCA 3H8JA 3T3NA 3L8ZA 4A0QA 5JJKA 3R7LA 5TQ0A 5EEHA 3SS7X 5A7GA 3VVBA 5CB8A 1WMDA 5A4AA 3RVPA 2DBYA 3K9LA 2QAGB 3GDFA 3B6IA 2O7VA 3RAGA 1YFLA 2P75A 5NLLA 1NZFA 1NPYA 2ZB8A 3HUDA 3PDUA 2FR8A 2WAYA 1PQPA 1N2IA 1RMQA 3E6AA 2W6ID 3BXFA 1RRKA 3N7AA 4TWJA 2I54A 3UENA 3FDZB 4I9HA 4FFLA 1ECGA 4YTEA 3HK2A 5JXWA 1T8TA 4MMXB 5K0EA 3AL3A 4MVJI 2ADMA 3VR6A 2Q0QA 5LDGA 1KFCB 2AJTA 1BH6A 3K4QA 4MUFA 2HJRA 5IF3A 3L77A 4AJOA 1IQUA 2XXAB 1JGTA 1IB6A 1L7BA 5HBGA 3GJZA 4Q1VA 3U7GA 5DASA 1EG2A 2HH9A 2I6SA 3CZMA 1WBJB 2XUIA 2ZIUB 4XDGA 5K6AA 1N3BA 1G17A 3BWCA 4DL9A 9ABPA 1CZNA 2FB9A 2RDMA 1WPQA 3R6GA 1QVWA 3B6KA 4OVKA 2WHYA 4B2YA 1UPTA 2SKCA 2WYVA 3KOWA 2YRFA 4MIEA 4FT4A 2ZWAA 3MQFA 4BWYA 5CA1B 2JBAB 2QMOA 4GLOA 3CLSC 2EEPA 3LLMA 6CHYA 3U31A 2WPDA 1KJYA 5EGNA 2B8WA 2Z0MA 1D2NA 1LDEA 3GO4A 3O7WA 2Q3EA 2PKEA 1WW3A 3HJTA 1YDWA 2AFIA 1QHGA 1V2GA 3QU4A 1ABEA 4O2RA 3EIFA 3QMPA 5CP8A 4GZ6A 1UBRS 1JP7A 1FUUA 1J6UA 1CK4A 1RPJA 1ZD3A 1QV7A 2HDNB 2IEAA 3Q7PA 5FP0A 1HOXA 4OBEA 4M1MA 1CEEA 5FAKA 2QRGA 3QXGA 3KXIA 3PSAA 4A8PA 5BUQA 2Q50A 1ZH0A 4MGYR 1BGWA 3L7IA 4G2TA 2J07A 3WLNA 1U9JA 2YCLA 4G0XA 5CR9A 1BCRA 3AUKA 1UPBA 2JI9A 3L4JA 3WX0A 4RJKA 1H9BA 4YAOA 4YAKA 2BE9A 4O2AA 1YI8A 1SH7A 3EGXA 3I9V6 5JZBA 1WA5A 4YRAA 3NW9A 3R1IA 4PSCA 3L7MA 5FPSA 3KT6A 4UBJA 4NBLA 1EI9A 2R2GA 4LJSA 4N40A 3EVFA 2C5HA 5C7LO 5CU7A 4DUYB 5JXHA 4KNWA 4PLCA 1HEYA 4HNRA 4LRWA 2WSSD 2C88A 3WTBA 3VO1A 4L78A 2JFUA 1XEWY 4QU5A 2H29A 4GRIA 5FTJA 3RC1A 1H6CA 3ZUPA 4AKHA 2IOQA 4RJ2A 3AR4A 1DAMA 1UPXA 2QN3A 4J16A 3AR6A 3FYCA 1CR0A 2ANCA 3ZKWB 3EEQA 3G8YA 1TU4A 2ZI7A 3UBMA 1BCSA 1XX6A 2FMFA 5KX5B 2OA0A 4CIYA 2V7BA 1V8FA 1VLQA 2R1TA 4N5MA 4XFJA 1KBZA 1OGJA 1LLQA 2PV7A 4CMBA 5IJ0B 2UYHA 1U4SA 1VP9A 3HR8A 4H18A 1NDQA 2P6UA 3FNEA 4ISBA 5HF5A 4DLYA 2RHBA 1P4RA 2GYYA 4UMEA 3DOIA 1QIEA 3R3SA 1XN4A 3AYXB 3LW7A 4XWTA 2PZLA 3HJNA 2CDRA 3IX7A 1C14A 3LVQE 1HM5A 2P9ZA 3PD0A 1PJ2A 3RLIA 3RIYA 2IYYA 3GFFA 2YR0A 4DMKA 1DZIA 2NVUB 2DR3A 4BBPA 1O5TA 4DRYA 3QX3A 2X22A 4RNDB 2Q1UA 4ZA2A 5TGTA 3RUAA 3S99A 3VVCA 3C97A 3H9GA 3PZBA 2QYHA 3HB0A 4TS9A 1DAHA 1H8HD 4UEKA 2YHBA 3CXUA 3D02A 4XIYA 4X1IB 1KDZA 4DN6A 1MC1A 4Y2YA 5CVDA 5HIAA 5K0JA 3H1GA 1VMDA 3IP3A 1N3IA 4QUIA 1K6MA 5KSWB 1EK5A 2ZGVA 4MHTA 3CRRA 5IXYA 4QBHA 4CLRA 3UT6A 1Y9DA 4B83A 2CMGA 2IPNA 1UC5B 3E1SA 4OMCA 4JQZA 3LIIA 2RHJA 3BS4A 1NRWA 4MKRA 3HO8A 4BBZA 4EKGA 2HN9A 1JQEA 1GDTA 5LQCA 4NU0A 3NWJA 3B52X 1SUWA 4QJ5A 1IU9A 4M8LA 2HMWA 4KPYA 1EJBA 2ZJOA 1D1QA 3G88A 2HDHA 1YMVA 5ALGA 2JLWA 1BSVA 4PTLA 4BEJA 4RQTA 1V25A 2BFDB 4FI3C 4OLHA 1HFEL 1I3NA 2A5GA 4KXWA 2KBEA 4UASA 5H9WA 5CM9C 5KDOA 1K27A 4LOAA 2H5JA 1EDDA 2PDAA 1NP7A 1ADFA 5EIEA 3OFNA 2H18A 1AQUA 4LK2A 3WP1B 1ADGA 3A3KA 4XUDA 4OX9B 3VKGA 2IWRA 3G0OA 1LU9A 3PA8A 4J4TA 2OCIA 1E4VA 2XUPA 5IKXA 4JXZA 4P7GA 1C9EA 1K4KA 5DX1A 2IP2A 5KTKA 1NW5A 2NZ8A 4OBWA 3VVMA 2ZLBA 2KX7A 2W8BA 1LFAA 1F6DA 1T0BA 1X42A 3A27A 1VE5A 1XQXA 4OO3A 4P4SB 2DFDA 5KHLB 3JAWA 5FPKA 2AJLI 1M1YB 1N7JA 4LHVA 5BWCA 4KMRA 1JYEA 1FFXA 3GFSA 1E1CB 3FFTA 4PLTA 5CNKA 3RJ5A 3BTVA 1XB2A 1R6UA 2ERYA 2ZT8A 3EA4A 1PJ3A 3L7OA 4FPXA 1Q1AA 1MJFA 1RAFA 2J41A 3QKWA 1BS1A 3UG6A 1J0BA 2BIFA 2VDWB 4IG9A 3NHPA 1E1NA 1Z12A 2FJUA 3GRYA 3I9LA 5DK6A 4JA0A 2AN3A 4B46A 2HPHA 3R77A 1EIWA 1R4MA 1GGFA 3PQ2A 2PUJA 1GQOA 3U6BA 3CN9A 3VZQA 2ASEA 3ZBQA 2YNMC 4DJ5X 3FMFA 1Z6AA 4ZVTA 4EDFA 3PUWA 2VNIA 2XTAA 2RJ3A 1W5TA 4NOKA 1XMQB 2OZLB 1ECJA 1ONPA 2I2DA 3AF1A 1GG5A 3CH4B 3HA3A 3SQDA 3KYDA 5I7AA 3VNRA 1W75A 1CEYA 2NPIA 4G0MA 1JA0A 2CUTA 4PGAA 3TOZA 4CDMA 3O8CA 1K7CA 3ANYB 3ETNA 3TL2A 2EZ9A 2YHIB 2FQYA 2M9MA 2C29D 3NDIA 1GA4A 1FRFS 1T2UA 5ICSA 2YMMA 3N8GA 3G85A 4Q4DA 3KSZO 5LP6C 3CQ9A 4DPLA 4EFNA 4KGVA 2WVAA 5KO2A 1QU3A 3N2KA 1XDUA 2EDAA 2HA4A 3AWDA 4H7EA 3FROA 2ZI3A 3ROQA 4C5CA 5LUAA 3ZBPA 5C31A 4O8CA 1UK9A 1LV7A 5CURA 1DLJA 2VRCD 3LCJA 4ECAA 3IDFA 1UJ6A 2C8LA 4M0PA 4EAQA 3BB4A 3GPLA 3DUFA 1GU0A 3LPDA 3KKMA 1N2OA 4QSHA 3RODA 3DE3X 4M0LA 4LJKA 1PZNA 3ROTA 3ND9A 4AJ1A 2REQB 4G26A 1T0PA 5JVDB 2BW0A 2ZJ5A 3EEYA 3F6PA 1F4VA 1PLLA 2X42A 3H99A 2FOIA 4B2IA 2ZPTX 3QUBA 2VJKA 1E9RA 1B0ZA 2HJSA 2JLSA 1QCZA 5IK2A 5TF4A 2JGMA 3L7AA 4V2IA 3WZMA 4DJEC 1F7VA 4Q5IA 3GJXC 4TT8A 2QZPA 3TRJA 3R74A 1QP4A 1YRAA 1SD5A 3RHTA 2ZJYA 3KEFA 3D3WA 4IYJA 2ECPA 3BA1A 4FKBA 3SJUA 1AXGA 3UHAA 4BZXA 2D1TA 2XYPA 2ZJBA 3DR5A 2HA5A 2WIFA 3BWVA 2F6RA 4Y2GA 2ZXFA 5FI3A 2Y2UA 2ZVQX 4X94A 1O0CA 2BGNA 2QT1A 5DW3A 5AW8A 3MW8A 4HHEA 3HWX1 4B48A 4C2TA 3P9QA 3BJRA 3C6ZA 1MDBA 1IHDA 5C1PA 3ICWA 1XLTA 4MS3B 2O14A 4CLOA 3R5XA 1RJ9B 3Q40A 4LCBA 4YLEA 3T9CA 2WR8A 3UK7A 4DV1B 3THXA 3F78A 3MCAA 1SQ5A 2J0VA 2P7HA 2QPLA 1OPXA 2TMDA 1T15A 1BE1A 3IUQA 2HA3A 3T7TA 3WOHA 3GYBA 2N42A 4QOJA 1LDGA 1QYIA 1UDAA 1TQDA 1VG0B 2IELA 2WPDD 2FYTA 2ZBUA 3ONVA 2ASVA 1W5AA 1P5HA 4M7RA 5E6RB 2IX3A 1HF3A 4UVGA 2NSDA 1SIUA 5HFNA 2HMTA 1PR2A 5AVKA 2FN8A 2SKEA 2Q4EA 2ZRCA 3LBAA 2I29A 5CCDA 3JASB 3N0XA 5EYPB 4D4MA 1VJCA 1FXSA 1LF5A 4HGNA 3LY5A 2Y1GA 5DSXA 2JI6A 2VYNA 5C1IA 2ZCJA 1YC5A 4R1SA 2A1UA 1T3HA 1Y1TA 3AW9A 3UJ9A 3WLKX 2NVWA 3JXEA 2ZR8A 4DA4A 5CYGA 4RHXA 4NHEA 1T9DA 1BVYF 4JVLA 4O6VA 5AIAA 3HJUA 4XR4A 6Q21A 5IH7A 3SQMA 2XUQA 4K46A 5C51B 4BE7B 1I3MA 4A0HA 1Z33A 3GFQA 4C0WA 3UK2A 1B00A 3N87A 1MXFA 1K63A 3GGCA 4PZAA 4J1TC 5FEUA 5HXAA 1ZIPA 2XB8A 4JJZA 2DE0X 5I9BA 3FI9A 3SZLA 3UMCA 3COWA 2Y1DA 1NSYA 1SBQA 1VKOA 4KKVA 3N6RA 3AUAA 2PRZA 5CM2Z 5J1SB 3NUQA 4PSAA 5KINB 5E8RA 3TIFA 3UG7A 1QIDA 5F77A 3N59A 3D8RA 2CL0X 4P0TA 4Q1EA 4YRNA 5GVRA 3BTUA 5HPYB 2ZI6A 1JS1X 4GPAA 4GDMA 1FTQA 3A6JA 2ZRIA 4H4DA 4WESA 1UL1X 4GZMA 3OQHA 2C7PA 2J0UA 1JYSA 2L2QA 3C74A 1R0KA 3KEMA 4RHFA 3LY7A 5FUBA 5BW8A 5A9SA 4XLTA 4FR5A 4Z4IA 2RJOA 1TEHA 4EFDA 4GP7A 1KK1A 1V37A 3BOSA 3KPWA 1GRNA 2JJ1A 4B84A 1I32A 3HVIA 4KK3A 1OT5A 1HTWA 2B7BA 1FNBA 1VL1A 2X2EA 5HQ3A 4KREA 3N75A 4UU8A 2X0DA 1TIKA 3J80A 2ET6A 2UKDA 4NOMA 1EE1A 3OF3A 2O05A 1KE1A 4FGLA 2VJPA 1Q7RA 3EF1A 3FZNA 2ZP1A 4FR2A 4TLBA 1EQAA 2P0AA 3EW7A 1EDOA 1FSZA 2V4ZA 4XWKA 5FI0B 1NWCA 3W5IA 5K4AA 1Q16A 3YASA 4LHEA 2GD6A 2O23A 2H1CA 3FNIA 5C46F 2OB2A 4IUDS 1X8LA 2WV7A 3KZMA 1H9AA 4NV3A 1DP4A 2C2XA 1EXNA 4O4LF 4ZT5A 5AHKA 2JEYA 5FORA 3UAGA 3WQHA 3DBLB 4Z2AA 2Q2NA 1QIFA 4PG7A 3PYLA 1U11A 3RS5A 3SR4A 1MRNA 2FAXA 4KUEA 3REOA 1L7QA 4P36A 1FA9A 1E1KA 1R50A 1EE9A 3DNPA 1P7YA 4L74A 3ESAA 4KRGA 3AHEA 4DLVA 5LWHA 1DQSA 3KB6A 3R3ZA 2O8EA 3M4YA 1ZM3A 1DAIA 1DADA 3NDBB 4W82A 1CFZA 1E9FA 1K7XB 1KU6A 1TK3A 1VIMA 3NAGA 2WHPB 2OE2A 1J22A 3QBTA 1AKYA 3E3AA 4OQFA 4WADA 4LI3X 3IBGA 3Q3GE 1E3QA 1LS1A 5A71A 1DRUA 1E2FA 1O96B 1E6WA 1GXSB 2Y27A 3AY3A 3QIAA 4G1MB 5FAXA 2CJWB 1MEEA 3OZVA 4MWSA 4D9NA 5AHRA 3RFFA 5KQLA 4FSHA 4KDCA 5ENDA 1GPMA 4CTMA 1KQNA 3GJ6A 3KR2A 4EBFA 1LJLA 2XW6A 4YX9A 4A0SA 4C07A 3PNYA 4UW9A 2RGRA 3EUFA 1ZI9A 4REOA 1ULBA 3JQEA 1XCPA 3KYBA 3ED5A 2B9VA 4IZIA 3QFTA 3F71A 4AIRA 4ALKA 2ONYA 3T1TA 1D2MA 3ZYCA 1JHVA 4RU1A 2IFTA 2J85A 4MULA 1RWQA 2IQ5A 2FPOA 4DC0A 1XTRA 3M81A 4AUNA 1TPZA 2O3QA 4JUIA 4PX5A 4RK6A 1G7RA 4UAGA 3RUCA 2JH8A 3GGDA 4FWIB 1PSDA 4JLNA 5JC1A 3DEHA 3K70C 1NUTA 3KL4A 1RZRD 2BUBA 3UUFA 3C1TA 1BXRB 1ECLA 4KH0A 4ZOEA 3TW6A 3M4ZA 1EVJA 4BFXA 2O7RA 4NESA 2A5LA 4WIAA 1ISIA 1KGDA 3E3LA 4U7HA 2UZAA 5AVYA 3H1AA 2UYGA 4J7AA 2BGJA 1Q74A 3HB7A 1QHIA 2PYDA 1XHEA 3NOQA 4ZDKA 4U5QA 4BQOA 3BMQB 3ISVA 1F6WA 1U81A 1Z0FA 2AFHB 2O48X 3G0BA 1GL9B 2D8AA 2ZAIA 5B3JA 1Q14A 3AFHA 4M8SA 5ELXA 4ZK2A 2GR9A 1KO5A 1X2BA 3EF0A 2VSQA 1CQIB 4AQDA 3LKDA 4QUBA 5ESRA 4FWTA 4QULA 4C21A 4P86A 4UD6A 4Z8YA 3TTUA 3PXCX 1OZ0A 2G88A 2JAWA 2QUAA 5K8UA 1ZOIA 4DKJA 1NQWA 3R8FA 1ZN2A 2W7TA 4HBZA 4X20B 1JA9A 1RZVA 3PJGA 5TPWB 2G6TA 1NVWQ 3FOBA 2V7QD 2O57A 3LNTA 1Z5GA 4JLUA 4MCAA 1DAOA 1DXHA 3H1BA 5D3ZA 5AKKA 4H6PA 2V59A 4TSRA 4P3NA 4GOND 3NDPA 2VSNA 4GGMX 4N12A 1V4NA 3HBAA 4MUHA 4G5FA 3AVPA 3P9YA 1M5TA 5BN5A 5EWJA 5I8ZA 3M9LA 4EF5A 4DJTA 5BWMA 5LP6B 5JEDA 1NYQA 2V0NA 2Y66A 5IAEA 4WKOA 3TR6A 4N1AA 1C7JA 3IMEA 3V9AA 4BZWA 5AVWA 2UYCA 3HKDB 1UDBA 4MPPA 3RT9A 3CKLA 1VBNA 3CPHA 2B2CA 2GK4A 2JH9A 5DBGA 1NA5A 3HRKA 4N7RA 4COOA 5LNK1 2OHHA 2ZQZA 2OQRA 2P4EA 1V1JA 2OVFA 2HXGA 4LGYA 4BVGA 3LPCA 4TZ6A 1KJNA 1RABA 3TCNA 3ZHRA 2GBFA 4BNWA 3F7OA 4ZT3A 2IHZA 2X8AA 5IK2D 3D3QA 3I28A 4KGXA 2J6BA 1LUAA 1JMKC 1QH8A 1KQGA 1DLIA 1U3WA 2DM6A 1BOFA 3I9FA 4RANA 1IFXA 2VJMB 5IYZB 2GN8A 2MTBA 3FR7A 5JCOC 2R2AA 1FSPA 4LXGA 3FYTA 3DP9A 3NIGB 2Q27A 3LO8A 3W5UA 1M2EA 4DC9A 1ECFA 3IYLW 1SXIA 3D2LA 1TW3A 4M38A 3NVMB 1A1VA 2UXDB 2FX2A 2J3LA 4OIMA 2ZREA 4QJIA 3EFBA 3WFIA 3ZX5A 1M1UA 2XB6A 4RO0A 1HUQA 3JX9A 4UHKA 3GUHA 3D7NA 2QGNA 1V5FA 3QXJA 1CETA 3KJEA 4QGAA 2FRDC 5SV2A 1NE2A 2BUAA 3N7TA 5KIAA 5J2UA 4QTTB 4IAOA 3BJIC 3NB0A 1JF8A 1NQUA 4II3A 2ZPUA 3RWMB 1GCOA 3TDNA 3AF5A 2PVSA 1Z63A 3JQBA 2ZITA 3VNSA 5ALTA 2DLCX 1QS0A 5HNKA 1EFUA 3CINA 5LZ7A 2HU8A 2LGJA 1OFGA 1VKZA 3VTAA 3ZU6A 1AMOA 2P41A 1RWOA 1Y6JA 1WUYA 2VAWA 1IUKA 3BMOB 2RHRA 1URPA 3FDIA 4RDIA 4P4NA 4CE6A 4Q4AB 3L0PA 5BNTA 1UJ5A 1X7WB 3VBEA 1QHHA 2QAJA 1KEEA 5CLLA 3VNVA 1XJQA 1FYVA 1PV1A 2WZBA 1ILWA 3PVCA 4QDTA 3PCXA 2HAEA 3S27A 4B4VA 1RKUA 1Y33E 1VFNA 1XAGA 2BI7A 2EW2A 2VYND 3NBFA 4RPGA 1UT5A 4UDNA 3OCJA 2JGNA 5DP2A 1T8WA 1FRNA 4XCVA 3OT1A 2I65A 4OHZA 2PSFA 3CKMA 1H2FA 4WWHA 4UBKA 5KTPA 5GJCA 1MOPA 3EDQA 4QATA 4QG7A 1Z73A 1AD2A 2CVOA 3STUA 3WYAA 1FFCA 4KWEA 5I9SA 1ZCJA 5IKEA 3Q6MA 4OHMA 1B74A 2VHYA 2WSLA 3EGWA 5FTWA 3KDPA 2WZQA 1FF9A 5AM1A 3K1ZA 5LDHA 2CXXA 4XVRA 1U7OA 3BILA 2X9NA 3IP8A 4CKEA 4G5GA 4O4HB 1NU8A 3SE7A 2GKSA 2VK8A 4EGAA 3G1WA 4QDUA 2DUUA 4NCNA 2BMVA 1C8LA 5KOJB 5HE9A 3ROGA 4DMCA 3SZMA 3CR8A 3MN1A 3DEJA 1P5JA 3RGGA 2NZXA 2WWYA 4NMHA 3TZCA 1YULA 3W05A 4MWZA 1RYDA 4AJ2A 1Z7EA 3C8DA 3NGMA 2V5AA 1CDDA 2R4QA 3FMPB 5ARCA 3MLEA 1XTTA 4QGFA 4L9SA 4WV3A 1AZTA 2O2GA 2OZKA 3ZN2A 4BKUA 3WNQA 2OO5C 1TAGA 3NYWA 1ZOLA 4HS9A 4R8LA 5AJUA 3BZWA 4EMUA 3K71B 1GPNA 2A0KA 1QV6A 5KWVA 1S01A 4E15A 4C22A 5K9ZA 9GPBA 1PKXA 2DXIA 4ZCQA 4C7JA 1XU4A 2CK3A 5FUVA 1NP6A 4BJ3A 4DDUA 3GBSA 3REFA 1ZD9A 1JILA 2F3SA 2WWIA 3BWBA 1I2DA 5JY6A 3FOWA 3LHDA 3SX4A 4E2YA 1GPUA 5DBOA 1KY4A 1XKQA 3B8HA 2GPSA 1KQ3A 1E8DA 4TWRA 1N57A 4DQKA 4DA9A 5KX5F 1LQTA 3JQAA 3K9CA 1X9GA 1Z74A 4JEIA 3V4ZA 1RRGA 2JKZA 4LZJA 1QP7A 4B3MB 3VZRA 4D3XA 1WB6A 1NAHA 4UHDA 4ZXPA 5JFTA 2ECQA 2WSBA 3DAGA 4TMKA 2P2CA 3HC7A 1XQVA 4MV9A 1MV5A 2ZZNA 2XLBA 5EZYF 1Q3TA 3MUEA 3WJ1A 1ACMA 1C3OB 4KQKA 4RTQA 1DTSA 2NTNA 4F6CA 1L7RA 4FCWA 4I5IA 3VPDA 1U0HC 3GI1A 3GT7A 3L5OA 1DEAA 1S3IA 3PNOA 4UU7A 4MKIA 2WF9A 2YYAA 3X3HA 3A3NA 1QO7A 4R31A 1UZMA 1P2BA 2OXRA 3P9PA 3VI3B 2CXSA 1GR0A 3HL4A 4AXBA 2A3NA 1YZFA 2XDYA 2FPUA 3OTQA 3ZC3A 3OCYA 1JZSA 4GZLA 2AWOA 1NJSA 2YWJA 4J0DA 4NG5A 3ZHOA 2QD1A 3GOHA 5I9IA 1WCV1 3SJ7A 5J23A 3KWFA 3QUAA 3L05A 5F7ZA 2V7GA 2FMTA 4NOJA 1ZKDA 2CNLA 4CM3A 4DQDA 2BISA 4OMUA 3W2EA 2QSUA 3HYSA 5BSEA 1B8VA 5J2TB 2E1PA 4IILA