4JVSB

Crystal structure of lepb gap domain from legionella drancourtii in complex with rab1-gdp and alf3
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
170
structure length
170
Chain Sequence
EYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analyses of Legionella LepB reveal a new GAP fold that catalytically mimics eukaryotic RasGAP
pubmed doi rcsb
source organism Legionella drancourtii
molecule tags Hydrolase activator/protein transport
molecule keywords Putative uncharacterized protein
total genus 59
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2013-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jvsB00
1OYYA 4B44A 3DDCA 2CK3D 4D26A 1FQKA 1F6BA 4Q4JA 1OB2A 1GITA 1SGWA 5FBLB 1J90A 2O52A 3PUZA 3DO6A 3K0EA 4DC9A 1KO5A 1Z5ZA 1ZVQA 2VO1A 4LHWA 1ZUIA 1YQTA 2JASA 5J47A 1PUJA 1QHIA 4M2LA 5J4VA 3W6NA 1P2UA 4IEEA 2PT7A 3NH9A 1KIMA 4CEHB 2J5XA 1US8B 1TQ2A 2LWIA 4GOXA 2J0UB 3OIVA 1RPZA 1SXJD 4C7OB 2IT1A 1M2OB 2RGGA 5GADl 5ELXA 4A0HA 2WJGA 5KUTA 2X8AA 1P6XA 4MDEA 1XXHB 5H68A 2KB0A 1LY1A 1AZTA 3CZPA 3TVTA 2NMVA 2PLRA 2C8VA 2LCFA 2QRNA 2Q3HA 2AX4A 3NBZC 1C9KA 4RY2A 1E1RA 1M74A 3SJAA 1IN6A 4FINA 5A4JA 2RH5A 2QPOA 2VLIA 4URUR 5M04A 1ZINA 1JR3A 1AGPA 1MH1A 3A1SA 3I73A 1U2RA 3GLIE 5C4GB 1P4SA 3QIAA 4WZBE 3GLGA 3FFAA 2BBSA 1Z07A 4UKDA 2Z6VA 4PC2A 4XIGS 4QNRA 1E2DA 1G291 2G1KA 4UXIA 3IO5A 1NSTA 4JVMA 4RD2A 1FNMA 3MAAC 4IOKA 2WZQA 4UNQA 5DH9A 4D80A 1NKSA 1UEJA 4QGAA 4QM7A 4AURA 2R6GA 5CB8A 2DBYA 2MSEB 5FPYA 4RD6A 2AFIE 1DOAA 4NHOA 3UANA 1Z63A 3TMKA 5EP2A 1F2UA 5FUYA 3ZD6A 4PHHA 2H7VA 4G5QA 3LXXA 2PZEA 3FPAA 1AK2A 5KPJA 4CEIB 1KSHA 4KHZA 3UMRA 3EPJA 2A9KA 2NQ2C 3RWMB 4JT4A 1OXXK 1Z3IX 4GPTA 3THOA 4IVRA 1GILA 1XXHE 2IYXA 3VR5A 1CR1A 2XZPA 4TLBA 3U7EB 4DLZA 621PA 4Q9JA 3SQXA 1VYTA 4QJ5A 1QHXA 1BKDR 4ZO4A 1OV4A 5JRZA 4P3YA 4WXRA 3EIHA 4PC7A 3B5JA 4TT3D 4GMXA 2B8WA 3VX3A 4DCSA 3REGA 3AF3A 4L9SA 1S96A 1VPLA 3BFKA 1YHNA 3K0CC 2JAQA 3UWOA 4D81A 4YXWA 1WQ1R 4RD4A 4Z51A 2BVNA 3Q7PA 3TE6A 3GJ7A 4DUGD 2YNMA 4JVNA 6Q21A 1DAMA 2PX3A 4H9GA 2IS4A 4M1WA 2R44A 3SJZA 1FTSA 2JCSA 4NYIR 4X8MA 3W9YA 3QF4B 4FWIB 4DSUA 2X1VA 2ZYWX 2G9NA 4Q9IA 2ODWA 2RKOA 3DHWC 4FMDF 4ZDWA 2F7SA 1ZC4A 2O0HA 3O8BA 4V02A 3R8CA 4KBGA 1KGDA 5KPDA 1UADA 3G82C 2WWIA 1XMIA 1QG2A 1XXHA 2QMEA 1PJRA 2WOJA 2ZVPX 3MGCA 2F55A 5HPYB 3X2SA 1KO8A 3LVRE 4AIIA 3AKCA 1WB9A 1OHHA 4GBMA 1A2KC 1W49A 1VCMA 1VTKA 2G3YA 3Q72A 1BMFD 1Z6YA 3U6BA 1NY6A 2JLRA 1OFUX 3EWSA 4MKGA 4Q21A 2CNWD 5JHGB 3HWSA 2XOKA 3IIKA 1L4UA 2FGKA 1FQJA 5G40A 2DWQA 3NBFA 4I81A 1MABA 2ONJA 2VP6A 3K70C 4ERNA 3BC1A 2QP9X 2PMDA 3L2OB 4ZKEA 1RRFA 3PUYA 4HLUC 1EX7A 5DSZA 1S3GA 1G7RA 2OV2A 3NC1C 1RIFA 4W5HA 1T8UA 2ZRDA 4JL5A 4LSGA 4JBXA 2WICA 4LC0A 4WVFA 3DPUA 2JLVA 2WSSD 5FOUA 3QBVA 5JZVA 5KDLA 1GKUB 4ARZB 2O8FA 1KDTA 3QVVA 3T1TA 1EFHA 3PJRA 1PVOA 3CPJB 4MYCA 2D62A 4DWJA 4J0QA 4DLYA 3THXA 2QGZA 3VTKA 4I1UA 1NLZA 2C2HA 1D5CA 2A5JA 2HT1A 1H8EA 1OJLA 1JJVA 2IC5A 5CK5A 4Q4HA 5SZJA 3ZJYA 2QL6A 3OEHD 1E3MA 5L8VA 1X3SA 4YMVA 2K5UA 2VSFA 4BFVA 2AK3A 4BLQA 3CX7A 1DE0A 2FMXA 2HF8A 1NY5A 2IYRA 3IQWA 3RRNA 3UMSA 3QG5A 4B32A 1I2DA 2B8TA 2XZOA 4XWOA 2WTUA 4ASUD 3R9IA 2W2VA 3L0IB 3GJXC 2E87A 1GZSA 1Z29A 3AKYA 2VHQA 4Q48A 4HATA 4IVPA 4B43A 2FGJA 3U60B 1SXJA 4Q66C 5KSPA 1ZM2A 3B60A 1Z0KA 2DWOA 2ZRIA 4KFSA 4KFRA 2WKRA 3LH5A 3UMFA 5KTYA 2WV9A 2ZVQX 4IOJA 5FPTA 5UKDA 4ACBA 5DN6D 3IILA 1N5KA 4BECA 2YC2C 3SQWA 4LK2A 2RGBA 1CJKC 3PEUA 3I72A 4M1OA 1G3UA 1XCPA 3BERA 1GWNA 1PLJA 2ODBA 1U9IA 2PLFA 3B2EA 4JLPA 4B3CA 3HU3A 1N6IA 4F4JA 4TL6A 4QBIA 5BN3A 1E98A 1SHZA 5J5CA 4BGDA 2GEDA 1P75A 4QG7A 5F9FA 2ZUBA 3M4YA 3V00A 1NF3A 3TQFA 2N42A 2FF7A 3HDTA 2FE4A 3E2IA 3AH8A 4MDFA 2GBLA 1SQ5A 3TUIC 4M1TA 1YZQA 2JLSA 4C0SA 2B6HA 2PJZA 2F3TA 2GVDC 4QBFA 1NNEA 3TUJC 4LUCA 1YE8A 2OG2A 1UKVY 3BOSA 2FFHA 1R6BX 3QG1A 1IN4A 2ZSFA 2NO9A 5FUVA 3AVYA 1E9AA 2GAAA 1HT1E 1XJCA 4HAZA 4NE2A 2W2TA 2CK3A 2WSMA 2OILA 1FOEB 5B57C 1XTIA 3KB2A 2ZTSA 4P4SB 4Q03A 1E1QA 1FL9A 3A37A 4XJXA 2W0SA 3KJGA 1XD8A 1TMKA 4E07A 1OIVA 1ZW6A 2YC4C 3CR7A 2B7CA 2A30A 1YZTA 1X8JA 4R2HA 1DAEA 1OPXA 4QHSA 2TMKA 3AF1A 3X1XA 4DRZA 4CT5A 1YVDA 4DKXA 2V6IA 5HZHA 2FX3A 1II8A 1N5IA 1YZGA 4PSAA 4RD1A 1KY3A 1VMAA 2BEJA 1HQYE 2BWJA 3HR8A 4BFYA 4R9UC 1OSNA 5TV2A 3K0CA 3N2IA 3P1JA 4TQAA 3T35A 3CRW1 4GI7A 4C7OA 2W6ID 2QMOA 4Z8XA 2KSQA 3KKQA 3D6TB 4AG5A 4MUAA 3VFDA 1CLUA 1G3RA 3K0AB 1IN7A 2VHTA 1ZJ6A 4B71A 4GSYA 5JHHB 3B9PA 1Z22A 3GLFE 4DT1A 4OHYA 4Q9LA 1E9CA 1I4TD 4Y0AA 3TH5A 1XRJA 2RB4A 4CT4B 4Q7JB 3LX5A 2GHIA 3B9QA 4BFWA 2WJHA 2XTMA 5CIQA 4LPSA 5FBQB 2YHSA 3S1AB 5KNDA 2EU8A 4C0AC 2H18A 4IHQA 4FMDB 2FEMA 5L3QB 4PC3A 4MYUA 1T6NA 1T3HA 3BS4A 2WJJA 4TL7A 4HAUA 1U8ZA 2HLDA 3DL0A 3VNVA 1EX6A 1J99A 1KAOA 4LYFA 3QQ5A 3CIOA 1A2BA 1OXVA 1VKJA 3CNOA 5CITA 3QVUA 3LQQA 3WMGA 2JLXA 2ZJYA 2GF0A 3ICQB 1IAQA 3QPWA 1DVRA 2XNDA 3FYHA 5DHFA 1OH8A 2GVZC 5AUPB 1Z47A 4US0R 4DLUA 2AD1A 3QF4A 4JLDA 5KU1A 3T5GA 2QBYB 3CWZA 2C9YA 4OQMA 1G1MA 4D6PA 1DS6A 4DJTA 4W7SA 2GKSA 3WYFA 2IF2A 4GOJA 2QA5A 4RCZA 1KI2A 2ZJBA 4NCKA 4JBWA 4EQ6B 4KSCA 2JJ1A 1DEKA 2V55B 4P4TA 3EPKA 2GEVA 2DFTA 1ZYUA 1GM5A 4EPTA 1FFHA 3KL4A 2J46A 2DYKA 3GFOA 4TLEA 5AJYA 2G88A 3B1VA 4PPFA 2DHRA 2P6NA 3OESA 5GJVC 3EZ6A 221PA 4OK3A 3ZS8A 1EWRA 2W58A 5EP3A 5H8WA 4LV5B 4V0ME 1KMHA 4WOPA 1AS2A 1C4OA 4PPGA 3BH7A 3BH6A 3CRMA 1Z28A 1BMFA 1XTRA 4O0MA 5BWMA 4BZPA 4IKEA 2FZ4A 3BD9A 5SZIA 4BWYA 2CNWA 4ASUA 1HV8A 2CL7X 2EFDB 3D3QA 2RHMA 3IUYA 3T15A 2OBNA 4LC1A 4RZUA 2OBMA 5JLJA 2AXNA 2O8EB 3EIQA 1E4VA 1E32A 4TQ9A 2GTPA 2ZI4A 1HQCA 1XEXA 2GK7A 3LY5A 2ODEA 4A1FA 1G6HA 1E2KA 3GLFB 1N6LA 2AKAB 3WNDA 1SVWA 5H70A 4DT1B 1R5OA 2RHDA 2QU8A 2FJUA 4QGHA 1UAAA 2CLCX 2IEYA 2ZR7A 1UKYA 3WRXC 1W5TA 2JATA 4Q02A 1UFQA 3TGPA 2VP4A 2NPIA 3WNBA 1KI7A 1WF3A 4LYHA 1RZ3A 2XSZD 1DG1G 2GCOB 3OFNA 5JI3E 3A1VA 1D8TA 4A8JA 3CRVA 2Q3MA 2IUTA 3AV0B 3BB3A 4UJ5A 5G3YA 4A2WA 3WY9A 1W4CA 4NTZA 3L0SA 4JLJA 4BUJA 1KDPA 3AGQA 2XAUA 4JLBA 3U4QB 4C30A 4RFVA 3RAPR 4HI0E 1H8ED 1JXMA 2WAYA 1COWA 3R20A 1RJ9B 4OQNA 5CJPA 3OEHA 2RMKA 3AF2A 4MRNA 2ASEA 4L9WA 3VU9A 1OH6A 4NPHA 4B2LA 4V0KA 4KXFB 5TY0A 4CEJB 2A5DA 4XVRA 2IS1A 4KLZA 3QKTA 1B0UA 1E2MA 2J3EA 1MO3A 3VR6A 2IXGA 1CF4A 3TNFA 1RRGA 1IN5A 2Q21A 3L0PA 1E2PA 4P32A 3ZS9A 3AKDA 3BB1A 1E0AA 4V03A 2OHFA 2MMGA 2OO7A 4KU4A 1W5SA 3O47A 3K0FB 4BFUA 2MSCB 1OLOA 2CJWA 1XTQA 4HZUB 3I5YA 1P2TA 4UNPA 3AVWA 4A4DA 3TLXA 4EPXA 1U98A 3KKNA 5LD2C 3WMEA 5KDOA 3U3JA 2OCPA 2CE2X 2WIBA 3IGFA 1SVKA 2KI5A 2QPTA 4GZLA 1A7JA 4B6FA 1S3SA 3AUYA 5L3VA 3CNNA 4R98A 3QY0A 4OJQA 3OIYA 1KTVA 4TLAA 1ZCBA 4P31A 2IXEA 4Q9HA 5IK2A 5JSZA 4H1UA 1N6PA 1F2UB 4ZV4A 3A4MA 2AL7A 4NP6A 2IL1A 4Q00A 3I8XA 3P32A 4MRPA 2J0QA 2H8KA 3MWKA 1Q3TA 4OL0A 4Q47A 2JJ2A 2O8DB 1JR3E 2A5YB 2VYFA 3BXZA 3F5FA 5CB6A 1IY0A 2Z83A 1FP6A 2ZYVX 3CPEA 1E2QA 3KKPA 4BLOA 3N5CA 4PTLA 1ZC3A 4UXHA 5E7IA 3CH4B 2HXSA 4C0QC 3GJ0A 1T4GA 4L16A 3MCAA 2NZ8A 1WCV1 4P0TA 3SBEA 2WVJA 4DVGA 2QBYA 5DYIA 1GG2A 4CDGA 1D2EA 2ANBA 1TTTA 1AN0A 2BJVA 3A4NA 2G77B 1KK1A 1P73A 1E1QD 4BPBA 1NN5A 3FHTA 4G5RA 5KSZA 3S1AA 3AKEA 1NIPA 3MJRA 3DKPA 4B35A 1F2TA 2GNOA 4R71A 2VHUA 1A5TA 5HZKA 1YJ5A 4WAUA 2BMEA 3K9GA 1ETUA 4PAMA 1M7GA 1ZM3A 2VPPA 3JVVA 4XOIA 3SHWA 2G1JA 2OESA 1EK0A 1WP9A 4URXR 2H16A 2V7QD 4LJ9A 2Z5FA 4NL4H 2VP2A 1GTVA 1Q21A 3LQRA 2Q0HA 2R9VA 3RRMA 3CW2A 2JJ8A 4R2IA 4H1VA 5JCZA 2KBFA 4AKIA 2WWGA 2ZI3A 2J0VA 3U44A 3C15C 3DVLA 4PXAA 2ZETA 4PQYA 5HKKD 4CEJA 3VNUA 1K8RA 3B8HA 2N1BA 4PO8A 2ZU6A 5LB4A 3AQ4A 3H4MA 5JJIA 2IYQA 3LBIA 1E2NA 2V1XA 3IBGA 2Y8EA 1SZPA 2ZI5A 4TWZA 1CR0A 1D9XA 5HE8A 2ZAMA 1QHNA 4LJ8A 3RS7A 1Q57A 4QJ3A 1MKYA 3U4QA 3T1OA 2J7PA 3CRQA 3DM9B 1PV4A 4BFZA 2OXRA 1N0UA 1CRPA 3NEJA 4JLVA 4TL9A 3AVVA 1DAKA 1A4RA 1G8FA 1Z0DA 3A1UA 4G5GA 1XTJA 1TU3A 4P33A 3FMPB 3SC3A 3W3ZB 1HA3A 2EVWX 4OBEA 1Z2AA 3K9HA 4B75A 1T5LA 3EZ9A 4DXAA 2D3WA 1LTQA 3BAFA 1N0WA 1SXJC 2QTVB 2AKYA 1E79D 1T0JB 1TF2A 3C14C 3X1ZA 1U0LA 3I8SA 1YU9A 1EWQA 1S9DA 3WYAA 4LYJA 3TW4A 4DB2A 4MRRA 3KZ1E 5C2JB 3CF0A 4B48A 2WWWA 1Z6GA 1J8MF 3TSOA 3GP8A 2BV3A 2MMCA 1Z0IA 4DLRA 4OHZA 1T9HA 3F0TA 4O2LA 4C2TA 1JECA 2HJGA 3C16C 821PA 3CWQA 1E2EA 4ACAA 5B58C 3C4JA 1W7AA 2YWFA 2J1LA 2I1VB 3KQHA 5BYKA 2CVFA 2O8EA 3C8UA 4YONB 4DLTA 2JJ1D 3AM1A 3LW8A 4GRAA 2GJAA 3K70B 5FL7A 2QTFA 3K1JA 1Z0AA 2XZLA 4Q18A 1NMYA 1IY2A 4GMDA 4PPNA 5KNCA 4V0OA 3VAAA 1N2CE 5CYOA 2IYYA 1EFUA 4I4LA 4RSGA 3A8TA 3RSOA 1G7CA 3THWA 4QKQA 3PENA 3ZIAD 2XOKD 2ZI6A 1OF1A 2VSOA 1KNQA 1PZNA 2CDNA 4OI2A 3CX8A 3GFPA 3SI7A 3QI2A 1MO6A 2FFBA 2D4HA 2GILA 4YLGA 3GLGE 2CE7A 4C0JA 3U6KA 2DFKB 3NVAA 2D2FA 3Q7QA 1AJEA 4CEIA 5E4FA 2F1IA 1L2TA 2C95A 1W0KD 1VDZA 5DHAA 2R6FA 3E1SA 3WBKA 4Q1FA 2ZRBA 4DIEA 4LHZA 1A82A 1F48A 2ZITA 3HPRA 4XD7D 5AJZA 4B34A 1JQJC 3RRZA 1AGRA 2DB3A 4LHVA 2JDID 4AYXA 1LNZA 1S1CA 2EFGA 4FMCB 3TAHA 4LHXA 4LWZA 2PL3A 1P3JA 2RGAA 3I61A 5AK0A 4GP7A 3AP2A 1U8YA 3HJNA 4TTQA 1UDWA 4B74A 2PX0A 4MITA 2C9CA 4HLDA 1TUIA 3LX8A 2FFAA 2OSBA 3IPXA 1ODFA 5L3SB 4ZIRB 4WZ6A 2P5SA 2EYUA 4E03A 2HCJB 3LDAA 2P6RA 1ZNXA 2O8CB 1H8HD 1KI4A 5FTKA 1G7SA 2IYUA 1R0XA 3DM5A 3L43A 3PEVA 3TBKA 2P0EA 2YINC 5C18A 4PAOA 2NGRA 1XZPA 1T3LA 4QJ4A 3VU9B 2UZ3A 4Q4AA 1BYUA 2QN6A 3O8CA 4AY2A 1GRQA 3QKRA 4HLUA 4A8JB 1P7CA 1COWD 2RGCA 3A4LA 3FWYA 3K9LA 3EXAA 1QHSA 5IDVA 3BH0A 3W5IA 1E6CA 3U2QA 1TEVA 2GESA 4V0NA 2GF9A 2HV8A 1DARA 3ND8A 4JSYA 1W0JA 1S1MA 1P9WA 4RZ3A 4C0KA 1YZKA 2PZGA 3SJBA 3FHOA 3KFVA 4B3BA 2BDTA 2NO1A 3B6EA 5TXGA 1U0JA 4XH9B 4HLQB 1QHHB 1VHTA 5BYJA 5DN6A 4FWTA 1T3SA 1VG9B 2RGXA 4F93B 1V43A 3IHWA 2RCNA 4IOLA 4MKFA 2ORIA 1ZIOA 1G3MA 1IXRC 4RKEA 5EE3A 2VQSA 2V54A 2SHKA 2ZUDA 1E99A 1G17A 1N25A 4B33A 3DMDA 4OK5A 3I92A 1AKYA 2HJVA 2KWIA 4QGFA 1P2VA 1TEXA 4DLVA 2FZLA 5AJXA 2QMUA 2GCOA 2VEDA 3QUSA 2XJ9A 4O25A 4LYAA 3X1DA 3GJ6A 2I4IA 4BZQA 3R7WB 3LRPA 4NYJQ 4WBSA 5HKKA 5JWHA 1FTNA 3GLFA 2BIFA 4I1OA 2ZRHA 3ZVLA 4AYTA 4MKHA 1OXSC 2HXYA 1W48A 3WP1B 1NMZA 5EXPA 1IHUA 1G16A 2JA1A 3NXSA 3JZAA 5CJ2A 3TAUA 1Q1ZA 4HB4A 4JBYA 2Z0MA 3WYGA 4A9AA 3K0SA 1W1WA 2EWWA 4XVUA 3H86A 3RDPA 1VIYA 3C7KA 1XFAA 2GJ9A 1E2LA 1E4YA 2VTKA 1KJWA 2GETA 3V4FA 5JS8A 3NHAA 4N1AA 3LVQE 5B30A 2ZJ8A 1UBEA 4TSFA 4DDVA 4F4CA 2AR7A 4MH0R 3HPQA 3FGNA 4YMUA 5FTNA 3D8BA 3QENA 3ZZUA 1N6KA 2OXCA 2PBRA 1SKQA 3ADCA 1GFIA 2N46A 2GBLC 2GZDA 4HUQB 1SVSA 1FNNA 3PV0A 1N3BA 1W36C 5L3QA 1CJUC 3TW8B 3THWB 3OE7A 4LBWA 1Z2CA 5KDDA 3QKSB 1A1VA 3Q3JB 4PX9A 4URWR 3IKJA 2QY9A 4LJYA 3OZXA 3VKWA 1BO6A 3WP0A 3OHMA 2BJWA 2X2EA 4A0RA 4DCUA 4XVQA 2IYVA 3BK7A 5DE3A 5FL7D 3CRRA 3KJIA 1NBMA 4X8HA 1NKTA 2AHOA 2FSGA 1N5JA 5G3ZA 2RGNC 4JLOA 1US8A 2HUPA 4EDHA 5GJCA 5K8LA 1YKSA 1G8HA 5HCNA 1TADA 4ABYA 1E0KA 4XWKA 5JRJA 1LFDB 3MSXA 3VHXA 4V0LA 3UXMA 1DO2A 4A82A 3X1YA 1UPTA 4IVQA 3K09C 2ZR0A 1D2MA 4OJKA 1NN0A 1DBSA 3HYRA 4EJSA 5L3SA 3THXB 1FX0B 2CXXA 3KJHA 1ZU5A 3U44B 4IOMA 4LJ7A 1XD2B 1NJGA 3C41J 3A58B 1SULA 5FTLA 1E2FA 3I5XA 4DSTA 4P4SA 3OEED 4XD7A 1Q44A 3JZMA 1QHHA 1W4AA 4X8OA 1JPNA 1DAFA 2JDIA 2J59A 5FTJA 4EFLA 1JXOA 1ZU4A 4M22A 3H84A 5FI1B 4CVNA 3EA5A 3TQCA 1EFCA 4IFEA 3CB4A 1WMSA 2BBTA 1Z06A 1S8FA 2V9PA 3KB1A 1FZQA 4HB2A 4JJKA 2ZQ5A 1OH7A 3AVTA 1AKEA 3B1WA 5IF9A 2CHQA 5DLQC 5LPNA 1J2JA 3PXGA 3KQKA 3PITA 2IWRA 1TU4A 4AK9A 5J4KA 4OKSA 1H8HA 4OHXA 3NDBB 1TAGA 1MABB 1R10A 1IONA 1VG8A 4GP6A 4XWAA 5FPSA 4ZKDA 5IT5A 4CZ2A 4U02A 3N2EA 4QNMA 5EP4A 1NRJB 3QEOA 3T34A 4AC9A 3H2YA 1IQPA 3KXLA 1KI3A 2UVQA 3NWJA 1D9ZA 4A6XA 1VG1A 3J81k 2XJ4A 1LB1B 3UATA 1OFIA 1XCMA 2GCPA 3GLIA 2EYQA 5ANRB 3EW9A 4ON9A 2ERYA 1KO1A 4DDUA 1G8PA 1Q0UA 4OHVA 2A5FA 2RAPA 3U61B 3QOFA 3KDSE 5CM8B 5FBRB 1DPFA 3B78A 2ZR9A 1EFRD 2ZUCA 4PFSA 2OT3B 2J45A 3HYTA 2OAQ1 4A8JC 5HR5A 4KFTA 1F5NA 3VKHA 1R7RA 4M9SA 2WWHA 1Q1QA 1XJQA 2VHCA 4ZCLA 3Q85A 1KK2A 2WWFA 3R7WA 1RRCA 1IOZA 2WAXA 4LI0A 1FUKA 1MRSA 2BM1A 2ZJOA 4HAYA 4MYHA 4RD0A 3RVBA 1W36D 4EPWA 4F7WA 1KDOA 1DO0A 1E0SA 2GZHA 3FDIA 4AKEA 4B76A 1KK0A 3RS4A 2WWXA 4TZ6A 4TLCA 4Q7MB 3U3RA 1NN3A 2OEPA 1XMSA 2ORWA 2ZIAA 4QBHA 4TMWA 4NDZA 1GNRA 4NH0A 1GL9B 3W3AA 5B2ZA 1K6MA 1SKYE 2A2ZA 4PQRA 521PA 4CIDA 3CLVA 3EX7C 4BQSA 1CBUA 4OYHA 1JNYA 1X6VA 3CM0A 1XPOA 4CGZA 3KX2A 2R6CA 2ZYUX 4D25A 4HDOB 2BKUA 4MGIR 2B92A 3EAQA 3UIEA 3KQLA 5AUQA 4KSBA 2BMJA 5FR1A 1GOTA 3RS5A 3EIEA 4IW3B 4JT2A 1Q12A 421PA 2WIAA 5F2EA 3HU2A 4DCVA 1SKYB 1KMQA 3FKSD 3KKMA 3QPVA 2DY1A 2IA5A 3LXRA 5FUXA 3EPLA 2OE2A 2L0XA 2VHJA 4MUBA 2XTNA 2OCAA 5HE9A 3THYB 5KSYA 2IS2A 3PEWA 4AI6A 2BOVA 5EQTA 1TQ6A 3QKRB 4MGYR 1GVNB 3DOEA 3SZRA 5HTKA 3NBXX 1MO4A 2C96A 3QBTA 3ONWA 2IYZA 1RE0A 2BCJQ 4TSFD 3KXKA 2GXSA 4JVSB 4BLPA 1AA9A 4HZIA 2E9SA 5CLLA 3P4YA 1ESMA 4YDSA 4FN5A 3RC8A 2OUKA 2AN9A 2BBWA 4Q4AB 3SDZA 2XTZA 1ESNA 4QHTA 1AQYA 4NYIQ 4S2EA 3SN6A 1ZMXA 1UBFA 2QQ0A 3Q9LA 5FOTA 2NZJA 1HURA 4IDOA 2P6UA 1N6RA 2VSXA 3LWNA 1XMJA 3ADKA 1JR3D 4EIWA 5IK2D 1H65A 2JLWA 1R2QA 2FU5C 1G6OA 2W00A 4F4IA 2FPLA 4UJ3A 4YMSA 5EJEA 1NG9A 1C1YA 2X77A 2ZROA 2V4ZA 5TARA 4ZDKA 3DZDA 3A6PC 2WM9B 4II7A 1JB1A 1NLYA 4V0MA 2CHGA 2OFOA 2D74A 2UKDA 4PR0A 3IIMA 4D82A 4KYUA 2WMOB 1Z83A 4Q4JB 3U5ZB 2QI9C 2ZRJA 1ZM7A 2IEZA 3H1TA 4FW9A 1LS6A 2C03A 5TMPA 4M4SA 3B13B 5FOVA 1E9SA 5D3MA 3ZGXA 1JJ7A 4KCGA 1KY2A 1CP2A 3LBHA 3BORA 2WWYA 3MMPA 3CZQA 5JS7A 1OFHA 4OK6A 4HAVA 3MG9A 3D31A 3V4RA 3EZ2A 4PC1A 4NYMR 1ZUHA 2GA8A 3NH6A 2ZI7A 1Z08A 1KHTA 2DFNA 1R5NA 2ODNA 2O0KA 4Q1DA 5EZ5A 5H1YA 4RFSB 4AKGA 4LJ5A 5E95A 2J9RA 1T8TA 4M53A 1VYVA 4CRWB 1E0JA 3GCGA 1MOZA 3SYLA 4BFXA 2CCJA 2BM0A 4MRSA 4YMWA 2F9LA 2ZE5A 2GAOA 4P4UA 4PSVA 2ANCA 4GT1A 3RANA 2CLDX 4Q9KA 4DEXA 4PANA 2FFQA 4LOAA 3RLFA 5JMTA 4L15A 1RYFA 4LBYA 1VECA 1JEDA 1TL7C 1CIPA 1LW7A 3QXHA 4Q19A 1ZRHA 3UPUA 2QQEA 2ONKA 5FPHA 2CMKA 3VR1A 1IM2A 4EPYA 3T5DA 2O5VA 5CLQA 1HT2E 4E5UA 2YV5A 2FPKA 4TMKA 1MT0A 4KBFA 1MR3F 1UEIA 3B1YA 3TRFA 2YWGA 4PQFA 4WA7A 5JSZB 5C4MA 2Q6TA 1G21E 4XTRA 1JBKA 1ZNYA 1G19A 2F3RA 1GDDA 5E7JA 3BB4A 3GMTA 4OQLA 2ZXUA 3B1XA 4IDPA 2ZEJA 3WHKA 2F1RA 1S9HA 2C78A 5BXQC 1BYIA 1R0ZA 4K81B 1PUIA 2VP9A 4AG6A 3GJ5A 3EC2A 1KO7A 1X86B 2BHRA 1GRNA 1R4AA 5DO9A 5F98A 4O3MA 1ZM9A 2FEOA 3PFIA 5E3HA 1FUUA 4LV6A 4QBGB 2BKEA 2NO0A 3EASA 3K8YA 3PEYA 1N0VC 1WRBA 4LJ4A 4PC6A 4PZLA 3SOPA 3WXMA 2UZIR 2CCGA 4Q1EA 3MFYA 3SBDA 4LRWA 2XNSA 3W34A 2FH5B 4OQFA 4TMTA 2BMDA 4Q4HB 2G83A 2KBEA 3P20A 1M7BA 1CS4C 1FMJA 1Z6TA 3ZVMA 4URZR 2PJRA 4ZPXA 3NKVA 1KDRA 3QXJA 1JAHA 1KI9A 4Q4LA 2AXPA 1NVVQ 1XD2A 3MWLA 3U7GA 1DAIA 4NU0A 4EAQA 4HUTA 3HU1A 4GFDA 8OHMA 2F43B 4LDJA 2ZM5A 3IEVA 2BEKA 3P26A 4M1YA 4MA4A 5FFMA 2ZRPA 4D0GA 1U8AA 2IF0A 1LF0A 3GPLA 1RFLA 5KNBA 2OFWA 3NTUA 4ILEA 4UNNA 2QE7A 1E2IA 3GQBA 4W9MC 5AWFC 5DIFA 2FDCA 3ASZA 2GCNA 3CO5A 1RJ9A 1Q20A 1O87A 1KOFA 4U7DA 5FPKA 4QFMA 5CYPA 4QL3A 2NIPA 1NJFA 4BLSA 1G8YA 3K09A 4C0LA 2ZANA 4HB0A 1WE2A 4NCNA 3ZDQA 2DR3A 4DLWA 3ADBA 2FNAA 1P2SA 3EZ7A 3AVOA 1Z6AA 2LKCA 3ECCA 4PHFA 1RYHA 4LY6A 5DI9A 1B23P 1S4QA 1TQ4A 4LV8B 4ZIRA 1NBME 4HUQA 4DZZA 2QGNA 5DNYB 5GJBA 2QROA 4DIDA 2ZAOA 1U81A 2OAP1 4JJZA 2ZSEA 3FE2A 4XSHA 2JGNA 4XSGA 1XEWX 2JLQA 5EZ6B 1KAGA 3CONA 4G5SA 2JLZA 4TZ0A 4D2IA 4LX0A 2IUUA 3OAAD 4ESVA 2GJKA 2AWNA 2OZEA 3GD7A 2BCGY 3GEEA 4HEJA 4B2IA 3RS3A 1KSFX 3T1VA 4F92B 5JEEA 1TNDA 3WNCA 3A36A 2DPXA 4DLSA 4FCVA 3I3SR 1Q22A 5FL3A 2ZJZA 3BIFA 1P61B 2Z4RA 5KHOC 2IYSA 1TQDA 5EXTA 1ZUNB 3N70A 4BLRA 2ZRCA 2PCJA 3QPUA 4EPVA 3FHCB 1N6NA 3W5JA 4RVCA 3GEIA 4KYIB 1QDEA 4D4LA 2WKQA 4M21A 5GJWC 3L8YA 3LO5A 3G0HA 4NBSA 3OIUA 5DI3A 1AS3A 3LNCA 3MRSA 1GP2A 5EE0A 4OI0A 2P67A 4NCJA 2ZSDA 2IBMA 2QMHA 4TN1A 3AVUA 4A0GA 1ZD8A 1G7TA 3WRYC 1YZUA 3U7HB 2ZRNA 5TB5A 2GK6A 1YZLA 3W90A 5BQ5A 3WHLA 4HLCA 5FI0B 5HCIA 2XEXA 3IDQA 3RRYA 2E1RA 1W0JD 1NL3A 1QVAA 3TR5A 1KZGB 2H57A 4B47A 2QT1A 2QPAA 4A0FA 1AM4D 1G64A 2IS6A 1XDBA 1AIPA 2OM2A 3FKSA 4PZZA 3DMNA 2IWHA 2J87A 4LPKA 2XB2A 3ZD7A 3GLHE 5A0FA 2QT0A 3IHLA 2QNRA 3C5CA 1OT3A 2CL6X 2C5LA 3PIRA 4JMPA 5EE5B 3QE0A 1T5IA 1AS0A 2CVHA 1VIAA 4E22A 3FFBA 4FMCF 2D2EA 2Z43A 3G5UA 4NMMA 4B73A 3CBQA 1TUEA 1VCIA 3AEZA 1UKEA 4GOKA 3IQXA 2HCBA 3W8RA 2WOOA 4JZKA 1EG7A 2HF9A 2XB4A 3NDPA 1KSGA 4ARZA 2O8FB 2QZ4A 4BEJA 3F3YA 5C1BA 1ANKA 4TL8A 1T91A 2OBLA 2YKGA 4I1VA 4JLNA 4M1KA 4FCTA 5DGXA 1XU4A 3A1WA 3QNUA 3T06B 2EWVA 2ZRKA 1GKIA 2GXUA 4IDHA 2XGJA 1R0YA 3AGPA 4UQOA 4EFNA 1F3OA 4IXNA 4XTCS 1EESA 2ZE7A 1XWIA 1U94A 3MLEA 2QORA 2FSFA 5LBIA 4Z54A 1IXZA 2W2XA 3W6OA 4IDNA 5BW8A 2R2AA 1OYWA 4B3GA 3AVPA 3JVUA 4BRUA 1WBDA 1G41A 1G4UR 2VBCA 3LBNA 1U90A 1HY3A 2A78A 2IXFA 4Q1BA 3EG5A 4C9BA 1ELOA 3RS2A 4G1UC 1CJVC 4K46A 4AYWA 1HE8B 3CNLA 3Q8XB 4F91B 2ZRFA 2BMFA 2ZRGA 4GDFA 2ZJ2A 2WPDD 1M8PA 3CPHA 2QG6A 2CBZA 4M8NE 5EXSA 1RW4A 1IN8A 3BRWD 1NVUQ 3QXCA 2HLDD 2WBLC 3L0OA 3DKVA 2NTYC 1R5BA 1GNPA 1ZNZA 3GLHA 1UJ2A 1XB2A 4DCNA 1NG1A 4UXJA 5LDDC 3QSYA 1MO5A 3IPYA 3ZVNA 4AWXA 3GEHA 3CUEF 1E9FA 1PLKA 4EPRA 1GAJA 4IRUB 4Q1AA 3TJZA 4HDQB 1KSJA 2CLSA 3NHBA 3ZVRA 1KJZA 3SJCA 1KMHB 2V6JA 1YR8A 1W47A 1M1YE 3AF0A 3NEYA 1E94E 2IYWA 3I62A 2QSYA 3EARA 4KO8A 2GJ8A 5CDFE 2FWRA 2W83A 3O8DA 3AVQA 2VIIA 5AUOB 5KO2A 1NBMD 2YJTD 3ASYA 4BE7B 4M1MA 2F1HA 3W6PA 1NVWQ 4CYMA 2Q9AA 1YRAA 4KFUA 1DADA 1YZNA 2PEZA 3QKUA 3ZH9B 4AKHA 5D3MB 4DDWA 1IBRA 1Q3HA 3MWJA 2PT5A 3PQCA 1XD9A 4Z8YA 2GXQA 4HAWA 1CTQA 2X2FA 1SHKA 1LS1A 1R0WA 1G20E 2NO6A 4B3FX 5JI2E 3SS8A 4S35A 2JEOA 4N0DA 4QXAA 1J70A 1SVLA 3U3OA 2W6JD 5BN4A 2WMNB 4G0NA 2GZAA 1ZP6A 1TX4B 2P65A 5DI3B 3TSZA 4KITB 3R9WA 2WJIA 2ATVA 2VP5A 1KKLA 4HDCA 3PUWA 1W2GA 3OEEA 1IY1A 1P62B 4LJ6A 2AD5A 4BFSA 2WKPA 4A36A 1IXSB 5FBWB 1U0HC 4BEBA 1GRRA 3PCRB 2EW1A 2VRWA 3K9NA 2GRJA 5TDHA 4W5JA 3KUDA 3Q5DA 1DTSA 5FUWA 3GLIB 1JALA 2QEQA 4EKDA 1I4DD 5SZHB 2X19A 3ETLA 3RWOA 2IW3A 1OIWA 3K0AA 1W44A 2XSZA 1XEWY 3FVQA 3OFND 4TT3A 5DISB 1NMXA 5JFGA 1X1SA 3KUCA 4C2UA 1FMLA 1OB5A 1II8B 3PUVA 1KKMA 3BBPA 4M9QA 3RC3A 1OXTA 2NOAA 4DUGA 2OLJA 4HZUA 3RSLA 1R8SA 1ONBA 2FA9A 3K53A 1HE1C 1JQLB 3DOFA 4BRWA 4JKYA 1GL6A 2PEYA 1ZAKA 2F43A 1NVXQ 2QAGA 1KI8A 2ZE8A 1HEIA 2ECKA 3GJ8A 3P27A 1DAGA 1N5LA 1YRBA 1F60A 5J4YA 3SU8A 2J0SA 1CRQA 1OFTA 1QBKC 3L8ZA 2V8OA 4TMZA 2OFXA 3SHFA 3TR0A 4I99A 2CL0X 3VQTA 4DBLC 1ZCAA 4HYYA 1LVGA 5LB2A 4WW0A 5CK4A 5EUQB 1CULC 5J40A 4ZI2A 2PH1A 1HYQA 2C9OA 4L8GA 1K5DA 4ESHA 1S2MA 2J7PD 1TPZA 2QAGB 2ZSAA 1Y3AA 4OI4A 4TMXA 2H1LA 3KKOA 1E9EA 1Z8FA 4BZXA 1OKKA 4OQXA 4PO1A 2NPFA 4TMVA 1NSFA 2Q3FA 4G3XA 1CXZA 2QUZA 4NYMQ 4TTPA 4OI1A 2ZREA 3EWAA 3PR1A 1BOFA 1JI0A 2CEAA 2D7CA 1E9DA 1GNQA 4EQ6A 4DSNA 1GSIA 2R8RA 5K8TA 2J7KA 4HB3A 1E79A 4JIMA 3RHFA 2YWHA 5EE1A 4RKFA 4WXPA 2AK2A 2GEUA 1HTWA 4NKRA 4TYQA 3L82B 2C99A 1IJEA 4HAXA 1K5GA 2O8CA 1QHGA 2Q9BA 3R9XA 1II0A 2H5EA 2HDNB 3BFXA 4LBVA 3AP3A 1XP8A 4LZZA 3E70C 3IEUA 3BGWA 5F3WB 2WSSA 2JLUA 3I32A 2GWHA 4Z1MD 1DG3A 2C04A 3LA6A 3V9PA 3KTAB 2FG5A 3AF4A 2ZS8A 4URVR 3MJHA 3ZZ0A 4C0BA 4ZCIA 5JWRA 2VF8A 1XBTA 1XTKA 2VH5R 3RYTC 2H17A 2FSIA 1RC8A 4TYWA 2PCLA 2W0MA 5P21A 3QXSA 2REOA 3TKLA 3TUZC 1E2GA 1BIFA 1NI3A 5AJVB 3ZLJA 3WMFA 2EFHB 4RCYA 1VHLA 4PAQA 4EFMA 1NVVR 1ZD1A 3SFZA 5F9HA 5JJLA 2YOHA 5J4HA 1XNJA 4POAA 3KXIA 2A3RA 3F8TA 3ZIAA 4TTRA 3NIBA 4QM6A 3Q5EA 1OW3B 2LKDA 5C46F 2EFCB 4FMBB 3ADDA 1TF7A 4CW7A 4DEYA 2I3BA 4O2RA 4FXPA 2VA8A 2A7QA 2V7QA 3BFVA 3EZFA 4RJLA 4X8LA 2FSHA 1HH4A 1W0KA 2VF7A 3I1FA 4KI0A 1JR6A 2ZI9A 2KE5A 2O8BA 2IYTA 4KAXA 4K8OA 2KJQA 4NCHA 4KLNA 4MYTA 4DB4A 1VG0B 4M1SA 3SE0A 4LHYA 2JLYA 1G5TA 2XITA 2CCKA 4RZ2A 2ATXA 2IYLD 4Q7KA 3SYKA 4TQUS 3CR8A 4A6PA 4TYPA 4BLTA 4UNRA 3P4XA 4EJSB 4JYCA 1E9RA 2P2LA 3GJ3A 1CEEA 3K0FA 2ZS7A 4WIAA 1IJFA 1KZ7B 2I1QA 5DYGA 3GLGB 4HSEA 2C77A 4OHWA 2HYDA 4W5WA 2FN4A 3CX6A 2QSZA 1QZXA 1QF9A 4N0EA 1XF9A 3T61A 4YDHB 5AR1A 4PSKA 1X8KA 3AP1A 3BJIC 1KI1A 2C98A 3WBJA 1Z6XA 3ZQ6A 1AQUA 2G6BA 2G0TA 3T1QA 1JAIA 1EGAA 1P9RA 2J0UA 1HUQA 2QP3A 3U7FB 2V1UA 2NO7A 1Y63A 4U00A 2OLKA 3NC0C 3H0KA 2RGNA 3BWDD 4N3NA 4UNSA 1XEXB 3A1TA 1GKYA 1OIXA 1XCGB 3KQUA 1RKBA 5AJWA 1KI6B 1P60A 1UM8A 1Q1EA 1XZQA 2ZU0C 4Q7LA 4C4PA 5FOWA 2EQBA 4NCIA 3VHLB 4WZAE 4ZDJA 4EJSC 4DCTA 1XX6A 3FMFA 5JCPA 3DEFA 3QXXA 4QRHA 2REBA 3O8RA 3R8FA 2QAJA 4CEHA 4NZYA 1DAHA 1WXQA 2CHVA 2O0JA 2ZPTX 4IDQA 5JEDA 2QM7A 2QP4A 2WJVA 4JLKA 3VMFA 4D4JA 2NG1A 1E1RD 2OCBA 3EC1A 3OIWA 1L8QA 3UKDA 2WJYA 3B82A 5AUNB 4QC2A 3THYA 1CU1A 1EFTA 5FH9A 2J41A 4PZYA 1CR2A 3ZQJA 2D06A 3ZYCA 1NIJA 2MSDB 2F6RA 3HP1A 4MKIA 1NLFA 3DZ8A 2W6IA 3B7GA 4A92A 2JIZD 2PZFA 3EPHA 1G18A 1RRPA 1J7KA 1QVRA 1OXUA 5CDFA 5EXXA 3ZZTA 2REXB 1VCNA 4PO9A 1UBGA 1UKZA 1ZIPA 1UDXA 4FI3C 1KO4A 1YR9A 5EUMA 3TIFA 1LV7A 4F38A 2GDJA 5KSOA 2XXAB 3ICEA 3VKGA 4A2QA 2W6JA 1F2TB 1SVOA 3C5HA 5IHPA 5LD2B 2ZJ5A 2YWEA 4D0LB 3QKSA 1CR4A 2ZRAA 4LGMA 3X1WA 1W36B 4TLDA 1GL7A 5KOYA 1X1RA 4C0HA 1NP6A 2QRZA 4U5XA 1BH2A 1ZM4A 4BASA 3KFXA 2R62A 1L7VC 1OKKD 1ZD9A 3LLMA 4AD8A 3SNHA 1PLLA 1V5WA 3U3KA 1N6OA 5BN5A 4L5BA 4NONA 1E2JA 1UF9A 3HR7A 4B3XA 4KVAA 2WHXA 4IXMA 2HT6A 1Q1BA 4ITRC 1JPJA 4MGKR 5FTMA 1SVMA 1E2HA 1O3YA 5K8UA 2QE7D 1OE0A 1II9A 2DFLA 4M9ZA 1U9IC 4D4KA 2AWOA 1XPRA 2VP0A 2XNDD 4QHYA 5JJKA 2P5TB 3K70D 2ZS9A 3B85A 2RGEA 3OE7D 4URYR 4CF7A 3KQNA 2ORVA 1XTSA 4RFSA 1JEEA 4Y0VA 3GLHB 721PA 1KYIA 1W4BA 3FTQA 3U3MA 2IX3A 2R6AA 4Z1MA 2ZE6A 1FX0A 4BFTA 3KJEA 4JKIA 4DHEA 3EA0A 2ZJAA 2CJWB 4G01B 4DLXA 2QENA 1N6HA 4JLMA 1W2HA 2IHBA 5EE9A 4G5OA 4C3ZA 5FBVB 3REFA 1XEFA 5JBQA 2OCYC 2YOGA 5EP1A 1D2NA 1MRNA 4JSTA 4KVGA 3SFVA 3TVDA 4D0NA 2YYZA 2IUSA 4NYJR 4E09A 1EXMA 2B7BA 1M6NA 3W8NA 1J8YF 4JVLA 4L4UA 3UG6A 4US2R 1P72A 3OAAA 3D7MA 4Q01A 1S0UA 1QHYA 5B64A 5FOSA 2BBOA 4ZDIA 1XJ0A 2DCUA 4I1SA 2ZRLA 1LF5A 3VX4A 4YMTA 4JL8A 1I2MA 3LV8A 3CKLA 3M6AA 2PMKA 2GXAA 1VCOA 5KYKA 1WBBA 1KI6A 4A15A 1TF5A 4B3DA 5K8IA 3FB4A 3LFUA 4PHTA 3I4LA 1QRAA 1E96A 1BS1A 5CM9C 1YR6A 1OH5A 4GL2A 3PVSA 1E69A 3OF5A 3AVXA 4IEIA 4PPQA 3T12A 2FPMA 4YXWD 3RS0A 1ZBDA 2HEIA 4IFBA 1DELA 1P5ZB 1W46A 2R6DA 3MWYW 4QGGA 2D7DA 3ND9A 4MGZR 4LCBA 2G0NA 3NBYC 3NG1A 2ZYTX 2QTHA 3E5HA 1I4LD 2YOFA 3PUXA 4RD3A 5A5GA 3TSWA 2O8BB 5E7MA 1ZNWA 1GIAA 2DWPA 3TK1A 5GVSA 3RABA 4M9XA 4DDTA 2V3CC 1SXJE 1G5RA 4JLAA 4M0LA 4RZXA 3MD0A 5J4LA 5IRCD 1Z0JA 4EUNA 3VR2A 1RVDA 4D4MA 3BE4A 3FMIA 1G3IA 1G5PA 3UWKA 3PG5A 121PA 1G8GA 2A5GA 4ZCMA 1QG4A 1W4RA 1FW6A 3AUXA 1E9BA 1G9XA 2YZ2A 5D3QA 1OHHD 1AZSC 5L3RA 3M1IA 1U99A 5TVKA 3FOZA 1GUAA 3IO3A 3UK6A 2VL7A 2HYIC 2O8DA 1NN1A 2IHYA 1P9NA 4GZMA 2ZRMA 2AFHE 1CKEA 4LJAA 2R65A 5GVRA 2RGDA 3FKQA 3QEJA 1FP7A 1EFRA 4DSOA 3LLUA 2ZSBA 4TYYA 1KNXA 1CJTC 1WA5A 2ERXA 2FOLA 2Z4SA 4JS0A 4KODA 3LAWA 1KJYA 3UG7A 3RNLA 1MV5A 3B1ZA 3CH5A 4JL6A 3VR3A 1FPMA 2FV8A 2F9MA 4KJZA 3QJYA 2XX3A 3GJ4A 4JYBA 4KV9A 2EFEB 4PHGA 4US1R 5CIWA 4YC7A 2B21A 2BC9A 5FOXA 3SEAA 4MRVA 1KK3A 2IK8A 1Z0FA 4Q1CA 4B6EA 1XMVA 4FIDA 4GNKA 2YVUA 2QM8A 4FD2A 5FR2A 2H92A 2Q9CA 2P3SA 5SZKB 3VR4A 4ZI3A 3IBYA 2F1JA 1G3QA 3FMOB 1G4AE 1L4YA 3KTAA 1UBCA 4LBZA 4QOSA 4MQBA 5G53C 5G41A 2XXAA 1SXJB 3LD9A 2JIZA 2QAGC 4A2PA 1SVIA 3CF2A 3GFTA 1D6JA 3SYNA 1VYUA 2WPDA 3CF6R 3M0EA 4TYNA 2GJSA 3LW7A 4R7ZA 5JWOA 3MUFA 3AB3A 4YQFA 1M7HA 4Q5IA 2JJ2D 1CJMA 4FCWA 1X8LA 3SR0A 3IIJA 1R8QA 1T0HB 4IJMA 1XPUA 1YR7A 3QF7A 5JECA 1M34E 4B2PA 1WDTA
chains in the Genus database with same CATH superfamily
4HDRA 1TW2A 4MICA 3ZDXB 4B44A 2CD7A 4F9FA 1HX7A 1FQKA 1F6BA 2NO5A 1FS6A 2O2HA 1SCKA 5FBLB 1J90A 2NV6A 3JWEA 3DO6A 3U0VA 4KHPB 2GN4A 4DC9A 4UCWA 2JASA 1YQTA 3HB7A 5J1TB 3IRUA 2C2BA 4LXIA 1QHIA 4M2LA 5MFZA 3N39C 3W6NA 3N2YA 1P2UA 5BW4A 5CB0A 4CKZA 1KIMA 4CEHB 4WOCA 4O3FA 4R1TA 4YJHA 3IOYA 3OHSX 3VTAA 1ZA2A 3R6WA 4GOXA 2DWCA 1T8PA 1V7ZA 3JW8A 5ADUS 3ORHA 4XJSA 4V1CB 2IT1A 1M2OB 2Z98A 3KJZA 4FZJA 1PR3A 5GADl 4A0HA 2GM5A 3LZDA 1DEOA 1XXHB 3C3XA 2KB0A 3A6GA 1LY1A 2NO4A 2AE2A 1PFUA 1JLLB 1I2CA 3ROGA 3WL8A 2PLRA 4RF2A 4EMBA 1C2YA 1ORDA 1C9KA 3ECSA 2MSLA 2P2SA 1M74A 3V80A 5C3MA 3H2JA 4FINA 4GD3Q 4AM8A 5A4JA 2OPHA 1KIAA 5M04A 1JR3A 1MH1A 3A1SA 1X94A 3HS3A 4LDAA 3N2NA 1Q0ZA 3BXOA 3QIAA 4HGNA 1TIPA 3GLGA 2Z2ZA 4JJEA 2VATA 3CZ4A 3KG2A 1SUDA 1E2DA 2YBEA 3WLLA 3I2GA 5FCDA 5LN1A 1P7WA 2WZQA 1NKSA 2GJ4A 3IYLW 4AZWA 5JALA 1SVNA 3AY7A 3ECAA 1MX1A 2FX5A 2X0KA 3P97A 3Q9UA 4JUCA 2R6GA 2PRZA 4K3UA 4X00A 3CLTC 1RBYA 3W4KA 4RD6A 4YRGA 3W7AA 1DOAA 3ETNA 4D8UA 3UANA 5LLSA 2RHRA 3WGZA 2C7VA 2KYRA 4RL6A 1YIOA 3ZD6A 4PHHA 4O1IA 3LSTA 4LMPA 2GVNA 3ZLBA 2CXHA 1DIRA 3FPAA 4OF4A 1KSHA 4C3VA 4KHZA 5TQVA 1CUBA 2NQ2C 4DM7A 3F3MA 4UOQA 4R41A 1NRXA 1XXHE 2GHRA 2IYXA 4TVOA 2XZPA 1Z5WA 4TLBA 4DADA 3VVMA 2AIRA 1VYTA 3K6RA 3H0EA 3SEQA 1BKDR 5IVDA 1OV4A 1O8CA 3I76A 4LVCA 4EW2A 4IS3A 4P3YA 3L9XA 4WXRA 4ENSA 1HFJA 2QPLA 1I80A 3B5JA 3NT2A 3PD7A 4JMLA 3MQFA 4Y2PA 3N86A 1KR2A 5ALYA 3VX3A 3ZU4A 1NJ1A 5DLDA 4DCSA 3CMCO 4L9SA 5CDUA 3RB8A 4GMGA 1XKLA 3D2BA 1VPLA 3BFKA 2WSYB 3UWOA 1TFUA 1AKMA 4YXWA 1FQWA 1TCBA 2DTXA 1TYCA 3Q7PA 4R2MA 1CV2A 4QYIA 3TE6A 5IXSA 2X0IA 2YNMA 3T3HA 4HD8A 3Q87B 4L85A 6Q21A 3FTEA 3H65A 3LT0A 2A1TR 2YVAA 4UFNA 1DAMA 3H75A 4I2VA 1OOEA 1TQHA 1WXFA 2IS4A 2ZAGA 1LKZA 1UWCA 2R44A 4OSEA 4C06A 4QU0A 1FTSA 3W9YA 4X8MA 5EJAA 2IXTA 2J9XB 4DXDA 4LY3A 5BMVA 2Q9UA 2ODWA 4YRAA 1R5JA 4FMDF 4H6XA 1X74A 3GUHA 1G5QA 3SKXA 1S4MA 4ZOBA 4DQLA 4J0CA 4UAGA 3M1AA 1VE1A 1XMIA 1I4WA 4NS1A 4YJGA 4LRQA 5JBNA 3MTIA 3I83A 3MGCA 4NBUA 2HU7A 2X0FA 3MD9A 2F55A 1A98A 1KO8A 4N5HX 3TM4A 3JWJA 3LVRE 3PE6A 4NR0A 3BEDA 5HKLA 1OHHA 1RI2A 1SUIA 1VKHA 1ACJA 3M5CA 5EY5B 3VZDA 4YRIA 4B5KA 2ZDHA 4BUZA 3AF6A 5CA0B 3C1TA 1DKUA 1XYVA 2PUVA 1AKTA 2JLRA 5BUSA 3EWSA 1PK9A 1CNEA 3IX7A 5A02A 1BHO1 5JHGB 1AGXA 2D00A 2HZ7A 2XOKA 5AVOA 4B0PA 1FQJA 1UMCB 2JGLA 4B6OA 4BKMA 4EG4A 1LPNA 5C9ZA 2UYHA 5DM1A 3CR3C 4COKA 3BC1A 1T4CA 2QP9X 1E6MA 3C6QA 1I3MA 3FLMA 5CNMA 1V37A 2ORED 4DRXA 2C4MA 1JFFA 2AJLI 4LYYA 2ARKA 3AYXB 4HLUC 3PUYA 2OQIA 3N8HA 5FA5A 4OHUA 4A91A 1JTFA 1S3GA 2EKDA 2OV2A 1LSSA 2Y1KA 3NC1C 4EHBA 4BEWA 3P9XA 1LTKA 1CZHA 1L7EA 2SKCA 4ICIA 5EIBD 2BF7A 4XLZA 4L07A 4N7JA 5AW0A 4ZAZA 4J94A 4F85A 3DPUA 2J32A 1YC2A 3TLGB 2WSSD 3K8QA 1U1GA 4NNOA 5CA1A 4MP8A 2EW8A 3HVIA 1E59A 2QN7A 3SFTA 1KDTA 1ZSNA 3G0DA 1S2OA 2XYHA 4DWJA 3OURA 4LVUA 4EBFA 3GN2A 1NBHA 3I9OA 4XM1A 1REQA 3INYA 2YTZA 4I1UA 2ACEA 1DWOA 2FY8A 3BIWA 5ALLA 1BGWA 4MV9A 2IW1A 5HBGA 3RVKA 3S7ZA 1E3WA 4KZPA 5CT4A 3W77A 2GM3A 3OZWA 3ADDA 2Y77A 4Q4HA 4MR9B 3ZJYA 3WQSB 4BNGA 3M6VA 2OHGA 2R5NA 4PWZA 1ECCA 3PHJA 1ZOPA 2OHOA 5FNZA 5FUBA 4ZVOA 3KO8A 4JU8A 4F04A 1D5WA 2VSFA 5KWSA 4BFVA 4U7PB 4IM7A 1LZKA 4P83A 2EV9A 4U2EA 3HFGA 3KYJB 4AJ2A 1NY5A 2CFIA 2IYRA 3K5WA 4NAVA 2XF8A 4X91A 1RZRD 1XZFA 3FPSA 2XVAA 3BREA 1UT8A 2JZCA 4OUDA 4ASUD 1SJ9A 3CJRA 2EKBA 3QELB 4XW2A 3L0IB 2AR0A 1QO0D 3LVFO 3S28A 4DDHA 3UUEA 1I3CA 2XUZA 3AKYA 4YCJA 4LQ4A 3OCJA 2FEXA 4JNCA 4Q48A 3V2GA 4I4IA 4D5GA 2W70A 5KSPA 3EEFA 3IESA 3EGIA 2TS1A 2DWOA 2ZRIA 4KFSA 3GFVA 4H1TA 5KTYA 3UMFA 3ROXA 1OU4A 1SQ6A 3BJRA 4GMFA 2W2NA 4KDCA 1TVKB 3LPAA 2VJYA 5IJ9B 2H31A 4BO3A 4H3HB 4FP9A 4Y2UA 1L7NA 2DTDA 3BBLA 3ZD8A 1UMBB 4BKUA 3AHHA 3I72A 3FI0A 1YZVA 3E6AA 4M1OA 1CSEE 1G3UA 1ODLA 1XCPA 5TMDA 4CFYA 5BNTA 1GWNA 1PLJA 1U9JA 4JLPA 4WJKB 1Y8QA 2O57A 4EI2A 3AR3A 3KJQA 1SNYA 3HU3A 3P2MA 2ETVA 3W2GA 3BAZA 3OU7A 4J3JA 1JLSA 3CZ9A 4YMIA 3WAKA 5DM2A 3IAM1 4BGDA 2H5LA 4LSMA 2ZUBA 3M4YA 2ET6A 3UICA 4BV9A 4LJKA 3WYNA 2EBHX 1FBTA 3IEIA 3NKLA 3WLQA 1GPAA 2FF7A 4D79A 1E3SA 5AKYA 1X1TA 1EP3B 5DK4A 3TUIC 3WK8A 4M1TA 3CE9A 4H1WA 1N0HA 2J5BA 3RRJA 1Z4OA 5T4EA 3X1KA 2F3TA 1OZGA 5AQEA 5LUAA 1NNEA 3HLKA 3JX9A 3TUJC 3NU1A 4QPNA 4QZVA 5K20A 3RAJA 1CFJA 2FFHA 5KWIA 4HN2A 2ZSFA 1S8AA 2FWBA 4GXQA 1O54A 5FUVA 1FMTA 1GU0A 3AVYA 1E9AA 3PL1A 3FHLA 4IHJB 3DF7A 3FM9A 3E9DA 3L0CA 4FSDA 2OILA 4JLWA 3UQYS 3CA8A 1FOEB 3LOUA 3R6LA 2PR7A 1RM4A 1T0UA 1E1QA 3H5NA 3WLRA 1YJ8A 3ESQA 2OAEA 2XE6A 4AULA 3UK2A 3NIFB 1EFAA 1O4VA 1CRZA 2B7CA 1Z8DA 3E15A 3KAJA 2VWGA 2XWBF 1YZTA 3LP8A 3GBPA 1DAEA 4MUFA 4QHSA 4R2XA 1U3FA 3AF1A 4RHFA 3VYVA 3X1XA 3HBMA 4CT5A 1U7DA 5E9WA 4DRZA 4MINA 1YV9A 1DV1A 2V6IA 3LWBA 3WO1A 2HDHA 4EVSA 2FX3A 4PSAA 2IXDA 2V0NA 1H3FA 2WJZB 2ZT5A 4RD1A 2N9UA 3KKLA 3PLNA 2OQVA 3BTUA 3HR8A 3EDOA 4TVSA 1CCWA 1NNSA 3BIXA 1HDXA 2BISA 2D0DA 4TQAA 1GSOA 1JIKA 4WA8A 3T35A 2GH1A 3GFFA 2XH8A 4HNAA 1OASA 4C7OA 3C2QA 1C3OA 2QMOA 2W6ID 3LKBA 1V7CA 2KSQA 3EC7A 3VYSB 4F46A 3I39X 2A67A 2ZB3A 1G2QA 1QTNA 2O50A 4ER5A 4K2AA 1EDDA 1ZZGA 2VHTA 3K0AB 4TROA 4GSYA 4B71A 5JHHB 1RZVA 4BLPA 1NQAO 1PZGA 1JU4A 1SA0A 1T9GS 3C4QA 4R8RA 4DT1A 2CHUA 3EHEA 3MMNA 2XUGA 1E9CA 5HQTA 2RB5A 3TF5A 2PUEA 4KR7A 3D3NA 3IDSA 4NVRA 3TH5A 5IJWA 2ZDQA 4B6JA 4FBLA 4CT4B 2JA2A 2YJ5A 5IPFA 3L4SO 2OOSA 3LX5A 2GHIA 3C39A 5L53A 2WJHA 2EP8A 2XTMA 4RW0A 4LPSA 4OKNA 2VNKA 1KEPA 1U5BB 3ZXIA 3A3OA 3RUPA 4KR6A 5G0SA 4ECEA 5KNDA 1MVNA 2X5KO 5AKZA 3HJGA 3RI3A 2R87A 1BCSB 2YWJA 4O8CA 5L3QB 4RXUA 5ILGA 1KQPA 1S7GA 1HT3A 3D02A 1PGPA 4HAUA 2P41A 4J2OA 4O4LA 1U8ZA 2HU8A 1IPFA 4LQLA 1EEXB 1JKJB 2B30A 3EUEA 3ZBPA 1J99A 1LWOA 1YB5A 3T95A 1V1RA 4JOQA 1DKNA 2SCUA 3A6JA 3U37A 4CI0B 1H1TA 5AM3A 1MB0A 2E5FA 1IH8A 2H7YA 4E33A 4YYZA 1A9XB 2LUOA 3A3KA 3DEKA 3STVA 5A0TA 3KV1A 3ICQB 4AX4A 2QZ9A 2WZCA 1CNFA 3FYHA 2HC9A 4DLUA 1N2BA 4RPKA 2AD1A 3QF4A 1N3LA 4TSKA 3ZH2A 3D5QA 4IH1A 3JQCA 3T5GA 4BQRA 2QBYB 4OQMA 2EZ8A 3CF4G 2XDYA 1F0PA 4JEUA 1D2AA 1I8TA 4UAUA 3WYFA 2IF2A 4QOJA 2IHTA 2ZIGA 2O0LA 4NCKA 3BA1A 4JBWA 3TQRA 4ZVNA 3S81A 1NA5A 4EECA 3TL2A 3EPKA 4QYWA 3WB9A 1W88B 1WNFA 3I05A 3L93A 1ZYUA 4GMHA 4RDXA 1GM5A 3M4XA 5TVGA 5KVVA 4PPYA 2J46A 4TXNA 1X87A 2NM0A 1LNQA 1I7LA 2DYKA 3GFOA 4D92A 1JIJA 1TVEA 1HI9A 3PDJA 2DHRA 2P6NA 3OESA 2PZKA 3Q3IA 4Z4FA 2XTJA 3EZ6A 3RW9A 1GZUA 3MELA 221PA 4FT2A 4OK3A 3ZS8A 2CNKA 1E3IA 5SY9A 5A1TA 1BU5A 4V2UA 5DFAA 5JVDB 1PL0A 2XV1A 5EP3A 4XIFA 3O8NA 2NVBA 3KL2A 4LV5B 3ZK8A 4CM8B 4NLLA 2WD7A 2CJFA 4HQOA 4M6WB 3BH7A 3BH6A 3U48A 3CRMA 5F3DA 3L7AA 2UZ1A 1U65A 3NONA 4L78A 1ACLA 4G0MA 4AZ3A 4PZCA 4B4OA 4F6CA 4U6SA 4LF9B 3OKPA 3IUYA 3TJRA 3T15A 1EUCB 2O5RA 1QO0A 2WD8A 4PHCA 4RZUA 3E23A 3TTWA 3U7RA 3EQZA 5JLJA 2FLVA 2PMEA 1AUQA 4BKRA 2H4ZA 3O91A 3EIQA 3OMXA 2C7RA 2GGSA 5D87A 2FUG6 2O2YA 1CE8B 1EVYA 1U2TA 2QLJA 1HQCA 1CRWG 3LY5A 4FSHA 4ZOEA 4ZT7A 3ZIUA 4BO2A 1WABA 2ODEA 1FS5A 2JFQA 3FBWA 1X7XB 1E2KA 4CMJA 4ZEVA 1RJWA 1N6LA 2AKAB 2DQKA 1F0NA 5L4SA 5H70A 3UT6A 3W5CA 4R8LA 4QGHA 1EDEA 2JS7A 1Y7PA 1MORA 2WUGA 2CLCX 1ZD4A 1M6WA 1ZN8A 3C7AA 4OGGA 4BV2A 4BO1A 3K71B 2GX6A 1T24A 4LGYA 3EJ6A 2BTQB 5CA0F 1TM5E 2VP4A 3WNBA 5T5QA 1WF3A 2AFVA 1U2GC 2H1RA 1RZ3A 1UDBA 3O1LA 2GCOB 1NBIA 2CFTA 3PFKA 4LYHA 3VR2D 3A1VA 1D8TA 4A8JA 1ODJA 4R8MA 3OZVA 1VRWA 3TIIA 3OQMA 5REQA 2IUTA 1ZCJA 3AV0B 3HCOA 3TXYA 2V5UA 5B6IA 3S8EA 2AF3C 4A2WA 4KUGA 4DZTA 3N0RA 4NTZA 4KIJA 1W6RA 3JD3A 1DRVA 4WZAA 4F0JA 4JLBA 3U4QB 4C30A 2XMZA 3EODA 1N2IA 4P92A 5AK4A 2PGLA 2NAFA 1VKOA 3ESZA 4WKGA 2I2WA 3F8WA 4HI0E 3VDRA 3M49A 4F5WA 4ZVMA 4B6RA 3BEOA 3R20A 4OQNA 4ZI7F 4NX2A 1L5MA 4DIFA 3AF2A 2ASEA 1J33A 2RAUA 3R2JA 4B2LA 4Q82A 3CJQA 4KXFB 2AEMA 2XYQA 3OOJA 4IV8A 4FDVA 2MDTA 1W1IA 1TZKA 2J3EA 4FEYA 5K01A 3DHEA 1CF4A 1L1EA 3ZHUA 1VGVA 4QUBA 1IN5A 2NWQA 3H4IA 1K5HA 1U0OC 5ALWA 3ZWAA 4EUFA 2J6CA 1HBJA 2OHFA 1GUZA 4NK4A 1DUSA 3LG2A 1IQRA 2RDMA 2MSCB 4D4GA 4Z99A 4XIYA 2R96A 3F3KA 4L5CA 3H1AA 3AR5A 4HZUB 4XPIA 3WLPA 4EPXA 3I5YA 2F4VB 4LOIA 1IPEA 1QGOA 3QPBA 2C29D 4X85A 4J7UA 2A1UA 3EXIB 3G1TA 1WDLA 2CE2X 2WIBA 4X20B 3R7SA 2KI5A 2JI4A 2CDAA 2QPTA 2QY6A 2CWWA 5AVSA 3ZU5A 1D0VA 1LUAA 4H4CA 4B6FA 3SS7X 1FK8A 3O3OB 3KE8A 4QU8A 2ZT6A 3CNNA 3DKIA 2HMVA 3QY0A 4RJTA 5DTMA 4Q9DA 2VJBA 1CR6A 3C5EA 1C3JA 2XY4A 3ER8A 1N78A 1KTVA 4TLAA 3PSHA 4P31A 4Q9HA 1JHDA 4D3DA 1U80A 3CLSC 3VAYA 1KJ8A 3A4MA 3R5XA 3G13A 3YASA 3OPNA 1J06A 4NP6A 1DFIA 1CG6A 1WW2A 3I8XA 1YAHA 2OWEA 4G0QA 1MIHA 5KBYA 4OD0A 1M8GA 4YV1A 2NU8A 4XFDA 4ZT6A 3M34A 3KQPA 1PZHA 4UHJA 2A5YB 1VKNA 2V98A 3F5FA 3IEMA 1IY0A 5FEMA 4XJTA 1E2QA 4BLOA 4F8JA 4PTLA 4MQMA 1ZC3A 2I2AA 3CH4B 3H5RA 3ZLUA 4HWGA 1PWHA 1H5QA 2XKAA 4L16A 3V6MA 3MCAA 4WT7A 4P0TA 2R751 4DVGA 1TEHA 2DHCA 2WYWA 1D2EA 4BQFA 3GX1A 2BJVA 2VJMB 2YDXA 2IZZA 2HA4A 1REQB 2G77B 2O6HA 1KK1A 2XA1A 4KQGA 3B6KA 4C78A 4ENQA 5BQ3A 1QC5B 1UPBA 5A2GA 3ZV4A 4MQFB 1E1QD 1Z39A 2VXOA 4N0PA 4QU9A 3WGJA 3FHTA 4BYMA 5I9NA 3NHMA 1QGYA 1XHLA 2FPXA 2F9FA 3BGIA 1HG1A 2GNOA 3DZFA 5CT5A 4R71A 5CFRA 2P9JA 1N5DA 2VHUA 2ZBUA 2VK2A 3ZDZB 1BE8A 1Z45A 4WAUA 1QTIA 5LLTA 2Z8YM 1VZ3A 3I1YA 4PAMA 1M7GA 2E4ZA 2ID9A 3F90A 4GU5A 2XDWA 4HMOA 3CFYA 2VPPA 5JPCA 2G1JA 1WP9A 3JWHA 2BPOA 1ZK3A 4RWZA 2C54A 1T1IA 2D0OB 3QP9A 4DA6A 3MT7A 4MB2A 3EGDA 3ROEA 1NZFA 5K4HA 4MIOA 3DQZA 1VPEA 3RRMA 4D8YA 3CW2A 4LTMA 2P7IA 3JAWA 2B94A 3HCRA 3DLBA 4UUOA 2KBFA 3LLCA 5BSUA 2QLMA 2ZI3A 4X1KA 1ZIDA 3DVLA 3H9BA 1EFVA 5HKKD 4UBMA 3M5WA 3VZQA 3UA3A 1O97C 2ZCVA 3B8HA 2N1BA 3I52A 4PO8A 3OLYA 3AQ4A 2HSZA 3TQTA 2IYQA 1E2NA 4II2A 2UDPA 2Y8EA 2Y1OA 2GZ3A 2ZI5A 3OPQA 4RLQA 4TWZA 2OA0A 3RUHA 3ZOKA 5HE8A 2E0IA 2ZAMA 4Q39A 3ABSB 4YN3A 1QHNA 1VI2A 1GEGA 4HADA 1P1FA 1PDOA 2HM7A 3DAOA 5ALNA 5KVQA 4BNUA 2O2DA 5D5QA 3U4QA 2O14A 2FQQA 3HUEA 4EHLA 1C2TA 5AM0A 1AT1A 2OXRA 3WGQA 3VC2A 3NEJA 3GCDA 3S8MA 5DMHA 3G7UA 4HSGA 2JARA 4O29A 1G8FA 5KNDD 3NHZA 4G5GA 3OTOB 4XE5A 3AX6A 1XTJA 2PX2A 1NYRA 4LMBA 4NJMB 4RORA 3FMPB 3B2NA 1GN9A 3OZAA 2IYEA 2GN2A 4IMIB 4OBEA 1Z5VA 4QTUB 4BQOA 5BQFA 4NXMB 1NZDA 3K9HA 4REOA 2OXTA 1UZMA 3EZ9A 1G8AA 4TTSA 2I4RA 3ZE8A 2D3WA 3BWCA 3GC6A 3IT3A 3QFHA 4R54A 5T41A 4BDTA 2CV0A 3HMQA 1E79D 3X1ZA 2Q4BA 5IT9A 2YMPA 1W8IA 5HG0A 3O7WA 2VF5X 4GBED 3TW4A 3IP7A 5HK9A 3AI3A 3E5NA 1F6WA 1ZKMA 2E89A 1ADYA 2WWWA 2JLBA 3OIFA 4ILKA 1P44A 4PYKA 3RSQA 5CVEA 1Z0IA 2O1EA 4QQRA 4FFNA 2UZ1B 1T3GA 1T9HA 1WMDA 3CKMA 1MAWA 1Q2UA 3CUSA 1JECA 2NXWA 1KYZA 2FN7A 3C4JA 2C83A 3TFOA 2YWFA 4W8HA 1GT6A 2J1LA 5J59A 1KQNA 3KQHA 4XQ9A 5HEKA 3AB7A 5LZ4A 2CVFA 3L8FA 5D86A 4YONB 4L8WB 5B37A 4BFLA 2JJ1D 3GLFE 1I7QB 1KJIA 4JB8A 2H2AA 1QPBA 2G5TA 4ZQFA 5HQJA 3K1JA 4HVLA 4FOOA 2XZLA 4R0MA 1DSSG 4EARA 5J4KA 3WSVA 1KZ4A 4CQLB 5J2UF 3VAAA 2OK7A 4LVOA 5E9AA 1UXGA 3NOOA 4U63A 1IQ0A 1EFUA 3HDGA 2E4UA 4RSGA 2NUAA 4HLNA 3RT7A 4NRDA 3S55A 4MQLA 1PZNA 1ESZA 4XYBA 5KC9A 3SI7A 1CLEA 3QI2A 2EF1A 3B1FA 3IT1A 3ILVA 3G2KA 1PJ2A 2MT9A 3VHQA 2NADA 3PLAE 3T7DA 3GLGE 4TT8A 4YGXB 2WNSA 2K7FA 1M5RA 3BMCA 3NVAA 3E1GA 2C31A 4PQEA 3HUDA 1JGTA 5BWBA 1G20A 1FTGA 3IJPA 5E4FA 1W0KD 4MLPA 5DHAA 5KKCA 3CLUD 4XLLA 3I6BA 3V7FA 1TCAA 2PVCA 5EA2A 1PR9A 1TGVA 4H0NA 3FJ1A 5AJZA 4ENVA 1VJRA 3HBLA 3RRZA 1O8BA 4ZOLF 2DB3A 1X1DA 5U4QA 1S1CA 2EFGA 4LHXA 2OHIA 2YMLA 2G08A 2PS3A 1B8PA 4HDMB 4LWZA 1O6ZA 2IGTA 4WNAA 3ROTA 2HH9A 3NAQA 3ZE6A 3RSOA 2R6R1 1G8KA 5AM1A 2RGAA 4OTZA 2IYAA 3GT3A 3AP2A 1U8YA 4B74A 3GK3A 2QTAA 4XWWA 5TT1A 2F67A 1TUIA 1QGUB 3BCRA 1KP3A 3IQZA 5J2TA 1JEYA 2OSBA 3SD7A 3IPXA 2GLUA 1NLUA 3KK0A 5T8KA 3GGGA 2QLTA 4JFRA 2NU6B 4RFLA 3LDAA 3R77A 4E4RA 4YAGA 2P6RA 1CQJB 4FFOA 1KI4A 4TTAA 4MR7B 4D74A 3MS4A 2EWMA 2IYUA 2XXAB 1D6SA 2XGOA 2D2VA 3DHVA 3KWLA 2QR3A 3MILA 3PA6A 3PEVA 2QUJA 3TBKA 2P0EA 5FB3A 2PYZA 5LZ5A 4JU9A 2NGRA 1C0KA 3QRWA 1T3LA 2YDYA 4RIHA 5EHGA 4Q4AA 3O2NA 4L4XA 4AY2A 3VM6A 2JAPA 2O8NA 2RHWA 4PZDA 4C7KA 3HUFA 2RGCA 2VSQA 3FWYA 1BXRB 5IDVA 1ULTA 4M98A 1NUSA 2ZWIA 3WKEA 4PZ0A 1L5HA 3ZE1B 4CDRA 5BWNA 6LDHA 3QSGA 2HO5A 2BH9A 1SY7A 1V48A 5L7TA 4MVXA 2WQ7A 2VPQA 2HV8A 3AHJA 2Y0BA 4I46A 4JSYA 1T6BY 4ECAA 3K30A 3OP4A 4RY8A 1USUA 3SJBA 4OXXA 2IIVA 4RKRA 4LXXA 5A7HA 3SX2A 2BDTA 2NO1A 3B6EA 1FDVA 3VR6D 1UAGA 3FOEC 1X9HA 5TXGA 2IY8A 2DP4E 3IE0A 3PZBA 1YUMA 2WD9A 2FZ5A 4C22A 1O0BA 2WF5A 5DP1A 3EQ6A 1O0SA 4IWYA 3TVYA 5C8DA 5ER6A 5AVTA 4XUDA 4BGVA 3FSGD 2RGXA 1OX4B 1ULBA 3EGDB 3ESXA 1XKTA 4QASA 4X7BA 5JO0A 3JWGA 3OFSA 1GYQA 3E05A 1GKLA 1IXRC 3OQVA 5JROA 2VQSA 4PYNA 2V54A 5DHPA 3VTFA 3PQ2A 3WICA 2ZUDA 1E99A 1XI2A 3E9RA 1N25A 1MCZA 1BE6A 3DMDA 3DMTA 3H8WA 4X1KB 3RC1A 1U31A 3I92A 1Q15A 1I01A 3O38A 4LXQA 4O2BF 4AJNA 4AZ3B 2KWIA 4F97A 1P2VA 2QD1A 4WN3A 1TEXA 3G23A 1QVWA 3GARA 1YE3A 3WRXA 3ZWDA 1MC5A 1ZVKA 1P9LA 4U7FA 4WBNF 4ER6A 4O25A 4LYAA 1V7PC 4XB2A 2QJRA 2G28A 3H6GA 1SXQA 4D8XA 4IIDA 2H7XA 1W73A 2EQAA 2I4IA 2X3FA 2H2FA 3GJ6A 3VDMA 3LKZA 3IJ5A 5KNLA 1RWMA 3EBPA 4NYJQ 5FA8A 3C3JA 3OU6A 3P9IA 1B8NA 5HKKA 1H2HA 2VJOA 4GAEA 3UJHA 2H52A 3TW0A 2BIFA 1MC1A 1JDSA 1H05A 2IELA 3ZVLA 3L77A 3CZ5A 5DXJA 4CIAA 2AQKA 2LW7A 2PNFA 3UXYA 3RSCA 3OCUA 3T1YB 5GGYA 1W48A 2B2XA 1PEYA 3NBKA 3WP1B 3EVFA 2PAAA 1SHTX 2PGDA 1NSYA 2HQRA 2HSDA 5D1HA 3LZCA 1ZD3A 3OY2A 3ABZA 5CB4A 5KINB 5E6SA 2RARA 5F7ZA 4R8VA 4HB4A 3TAUA 1XRQA 3K0SA 3C5VA 1FMCA 1N9GB 3G6KA 5CNJA 1W1WA 2EWWA 2P68A 2WHEA 3QE9Y 5T4FA 4YB8A 4HH0A 2V45A 2ILVA 3S99A 5ER9A 3PQ4A 3TZEA 2QT9A 4FLEA 3ZGNA 4FKBA 3IQGX 4YRSA 3TOXA 4DA7A 2YV2A 1CUXA 5EWMB 4R3WA 4CM7A 4PN3A 3LVQE 3ZHOA 4F3KA 1LLFA 2ZJ8A 4GM0A 1UBEA 4TSFA 3K2EA 1QQTA 2VWPA 2ZIVB 1WCWA 4JP2A 3HPQA 3UCXA 3B48A 5ALPA 3D8BA 3QENA 3LUDA 4UD6A 3W5SA 1KQOA 2OXCA 1JT2A 2YUTA 3IE2A 4ZXPA 2H1OA 4G56A 5DP2A 2DF8A 3HCAA 2GBLC 2Q41A 3OLVA 3VYTB 5C7LO 5HQ3B 4HUQB 1FNNA 1RKQA 3HKCB 3U4CA 1ES9A 1QV9A 3D3EA 3TW8B 3THWB 3HEMA 5I7SA 2H0AA 5KDDA 1A1VA 2JFUA 1KJQA 4LJYA 3U81A 4UEQA 5A6SA 2XOXA 3WP0A 5K0FA 1VMIA 1XTBA 2R00A 1XDGA 3BMQA 3FTNA 4A0RA 3OCXA 3H19A 2YXEA 3AV3A 1HDYA 4HNSA 4XVQA 1B43A 1E6LA 1W87A 4EUKA 3ZKWB 4E5NA 1YH3A 1PT7A 3KJIA 5EIWA 4Z3DA 1WTAA 2B34A 4F56A 2AHOA 5EEGA 2JGRA 1N5JA 1SM4A 2O7RA 2QTZA 3OZTA 1T5HX 1RQLA 2XKBA 4HQLA 2GOYA 1LSJA 1EK2A 1US8A 4H17A 5IZCC 5DDIP 3D0OA 4W63A 1QIDA 3WR5A 2BW0A 1HYEA 1SRQA 4C04A 4XWKA 1LFDB 5JFTA 4YJFA 4XZ3A 2XHEA 4IPTA 2HK6A 1CY1A 3C6ZA 3JQQA 1WSWA 2I78A 1XQYA 4IVQA 1UC5B 4R1SA 2O7NA 1T8YA 1AHPA 1MZPA 1Z38A 1RQGA 5ALKA 2NSJA 2PTGA 3KALA 4AJJA 3W7VA 2H59A 1PJZA 5L3SA 1HYGA 4GWKA 1FSSA 4ZANA 5CEEA 3KJHA 2XWQA 1ZU5A 3U44B 2YFYA 3THXB 4LJ7A 2CMGA 3FF1A 5HS6A 5D5PA 1SULA 1EX9A 2MOKA 4DSTA 2G8LA 2H1IA 4WX2B 3RIXA 5LYJF 1D6NA 2FPGA 3L7JA 3ZXXA 5JD6A 3JZMA 3MHTA 1W4AA 1E3TA 4PCUA 3OJEA 1DKPA 3SWWA 4BN5A 1JSZA 4PRYA 4CVNA 1OWOA 3C98A 2HTEA 3N2ZB 4PE5B 4CM9A 4FI3F 4IFEA 2FX2A 3PQFA 4K2HA 1IOVA 2PK3A 3R40A 4ZVRA 4YNBA 5EWJB 4JI7B 2BBTA 1WCIB 1QVZA 4ND4A 1HRKA 1XK6A 1ZITA 5H3CA 1T8RA 1W76A 2MR6A 3IB3A 1AKEA 3DCIA 2JG3A 2CHQA 1Q6ZA 3P2YA 5LPNA 4XGKA 4LOHA 1YASA 1J2JA 2R6JA 5B58T 1WD5A 4Q3NA 5EL0A 2SBTA 4JOCA 2IWRA 3KQKA 1GUBA 1V16A 2ID8A 4H18A 5GM1A 2PXCA 4DXHA 5IKPA 3CLRD 2PQ0A 1TAGA 4XWAA 1R10A 1IONA 4NZOA 2C82A 2A0YA 1FU7A 2J3KA 1E60A 3SDSA 4CU2A 5CLJA 4NEGA 1Y1TA 2CN1A 2FSVC 4GWGA 1AXGA 3U40A 3H2YA 4OHFA 3KOOA 1BVRA 1CZKA 3VR5H 2Q6IA 2DUMA 1YK1A 4W1QA 4A6XA 4OQPA 1VG1A 1YQEA 2CJPA 2WF9A 3IKMB 5I01A 1VMDA 2M6KA 3TLZA 4JOSA 4EFKA 2EYQA 3D6VA 3RJ9A 3O4GA 4N5DA 4KK3A 2WF8A 3EW9A 3FBTA 4ON9A 3EE6A 3AFGA 3T3NA 1G8PA 1Q0UA 1Z73A 4J75A 3FOAA 5DM4A 4O4JB 1Q19A 1NTRA 1VBFA 2XA9A 3CTPA 3GV0A 3KDSE 1G59A 1DPFA 1GG9A 3B78A 1L3BA 1TM4E 4J0JA 4PFSA 1RXEA 4UEJA 3C8MA 3CT4A 4EB6B 3HYTA 3TLKA 3T1NA 4PS1A 1PEDA 5LWHA 2OAQ1 5J1SB 2AQIA 4GO1A 2DQSA 4HFRA 2G06A 2C2YA 1QJCA 1VM6A 1SXGA 5IKXA 1XJQA 3TSCA 1Z0ZA 1GRVA 1RAGA 3N28A 4UUMA 1TZMA 3PRJA 2Q28A 4EG0A 5JZ9A 1AKNA 3ZHSA 4C5AA 1J49A 1FUKA 4RD0A 1W36D 5G1OA 5F7XA 4EPWA 3GHYA 3SK0A 1E0SA 5BV1A 4MB6A 4LF7B 1KK0A 4BJ1A 1H9AA 3RS4A 3T6KA 2GBIA 3KBBA 4CMBA 4CNBA 1XMSA 2VN8A 2W37A 4M0PA 1KJNA 3R7BA 3R76A 1GL9B 1U0BB 2V6BA 1OBCA 5G0TA 1OWMA 3LO8A 521PA 4CIDA 3CLVA 1HTBA 5THXA 4RK6A 1WTCA 3VNBA 2NZ2A 1NM5A 5JH7B 4EHFA 5INTA 4OYHA 3CM0A 3AR6A 1DX4A 4BMOB 2B1JA 1H3EA 2IE0A 4D25A 3EAQA 3KQLA 2AN1A 2I4MA 2I62A 3V1UA 1H2RS 4YT2A 3U4DA 4PNPA 3V8EA 3G5TA 1RC1A 4UDYX 5FORA 1QYVA 421PA 1IWPB 1UBSB 2DM6A 2EF0A 3ZJ4A 4ZJYA 2WIAA 2HL6A 5F2EA 2HKIA 3I1JA 3FKSD 4IUCS 1IXKA 4IX9A 1EFLA 2D1QA 3ACBA 4AX8A 4DIOA 1M8FA 2VHJA 2XTNA 3PFBA 4IKPA 4D9NA 1ZHOA 1JFTA 1YS9A 2RD2A 3AYZB 2IS2A 2FW6A 2CJYA 1JIUA 4GH5A 2DFDA 2FWMX 4I9FA 3ZCRA 1CHNA 2E6UX 2WY2D 2AUNA 1UANA 1WHTB 2BCJQ 4TSFD 3KXKA 2B99A 1AA9A 1CF9A 4UBLA 1QX4A 2E9SA 4YDSA 5JATA 1OGIA 1Z2OX 3AEKB 3GDGA 3M4JA 4FN5A 2AN9A 2XTZA 1I0IA 1YVRA 1QIEA 5HYVA 4RK4A 3AUAA 3Q9LA 3H4TA 3FCYA 4NIMA 4O8ZA 4YRQA 2HUNA 1WSBA 2VSXA 3ZZMA 3LWNA 4ATNA 3ADKA 5TPZD 2JLWA 2EZTA 1R2QA 1R9GA 5AK6A 2FU5C 3H1PA 1QWOA 4QU5A 2DBZA 2FPLA 4YMSA 3EDMA 2HA2A 3HKDA 4UPDA 5GINE 1C1YA 1C41A 3GAAA 4QOFA 7REQA 3L6RA 3A6PC 2ZQYA 3HB4X 4FCCA 3GGCA 2WM9B 1G8SA 5DGHA 1YA4A 2CHGA 2HREA 2V96A 4YJ3F 1QLJA 3E7WA 3PNSA 4M9CA 4UW9A 2Q4RA 4J4HA 2ZSUA 3IIMA 5TJ9A 4D82A 2FVXA 3CBGA 4HDMA 3AUUA 1BHQ1 1Y3IA 2OZKA 4TGLA 1BMQA 1KPHA 4EI7A 5KNBH 3U5ZB 1N7JA 3DNFA 3LWDA 5HKAA 5JOQA 2BFWA 1ZM7A 2GAJA 4HGRA 2IEZA 2QI9F 3H1TA 4FW9A 1XTPA 4DEVA 4DWVA 4BXOA 1QANA 1GU1A 3QE2A 3B13B 1EXVA 3SZ3A 4KCGA 3CUTA 1MX9A 4OHPA 2L18A 2WWYA 4RHTA 4OFXA 3OX4A 5A5FA 4LJLA 1IUPA 3V4PB 3MG9A 4BNHA 1EU1A 3IDOA 3PF9A 4MR7A 4PC1A 4ZYWA 5JAOA 3ZJTA 1P29A 1ZUHA 1Z08A 2Q5IA 1PL7A 3KHUA 5FLXA 3EFOB 1YVEI 4WECA 5CT8A 5IAEA 3TINA 3UFBA 1JILA 5IVKA 2ZAYA 1SD2A 2WWRA 2IIQA 1WU7A 5E8JA 5EZ5A 5H1YA 2QUHA 1SUFA 4ND8B 4U5QA 5D6OA 1YUNA 2Z04A 3VBCA 1FJGB 3DW1X 3GCGA 4CI9A 4Z4CA 2WIFA 1X3LA 1RLIA 2QX7A 4BFXA 4EZBA 5J4LA 4PCAA 4YMWA 2JJQA 3UWMA 2H48A 3EGXB 3CVOA 4IMJB 1CY4A 4X95A 3QYPA 2ANCA 4GT1A 3UW1A 3JYHA 2AN3A 3KSUA 2FFQA 2I67A 3QHQA 4LOAA 3VKVA