4JVSB

Crystal structure of lepb gap domain from legionella drancourtii in complex with rab1-gdp and alf3
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
170
structure length
170
Chain Sequence
EYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structural analyses of Legionella LepB reveal a new GAP fold that catalytically mimics eukaryotic RasGAP
pubmed doi rcsb
source organism Legionella drancourtii
molecule tags Hydrolase activator/protein transport
total genus 59
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2013-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jvsB00
1TX4B 1JQLB 2WJYA 3GFTA 3HU3A 2VHQA 1SULA 2ZSEA 3F0TA 1R10A 1SXJB 1XNJA 4QG7A 1KDOA 1RRPA 3GLHB 4DCTA 4URYR 1W4CA 2QQEA 3ICQB 1RE0A 3W6NA 1S1CA 4DSOA 3VTKA 4OQFA 3TQCA 2CHGA 4NCNA 2W6IA 2YZ2A 2EU8A 2R6AA 5JBQA 5CK5A 2ZANA 1N6NA 1S2MA 2H7VA 1YR6A 1EK0A 3F8TA 4D80A 4PZLA 1VYVA 1RRFA 2HJVA 2H92A 1FUUA 3SBEA 3AVUA 5CDFE 4PSAA 1XXHA 4R98A 2X77A 4Q9LA 1E2QA 1E2PA 2ZITA 3CH5A 1KI7A 4GRAA 4UJ3A 4KJZA 5TARA 4MGZR 1G64A 1SXJA 1CRQA 1BYUA 3U7HB 4DLXA 2CCJA 3NBZC 1TNDA 1YZQA 4OKSA 4ZI3A 1UBCA 4DCNA 3W5IA 4B3CA 4JLJA 4JJZA 5CLQA 4HSEA 1OE0A 4FWIB 4YXWD 3K9GA 2WJVA 1IXZA 3D6TB 4QXAA 2DPXA 4KITB 4TLDA 4PPFA 3WNBA 4A92A 1SHKA 2PT5A 5JECA 3IEVA 2OXCA 4BLOA 1AIPA 3AQ4A 1XXHE 1G6OA 1A2BA 3LLUA 1FTSA 5DYIA 3EC1A 3AKDA 1GNPA 1E9CA 4DKXA 1P3JA 4LSGA 5ELXA 3IPXA 4NYMR 1SXJE 5FPHA 1LF0A 2GWHA 5JCPA 2XGJA 4B2PA 3VNVA 3GLHE 4ON9A 1KI1A 4JL5A 1G7SA 4FI3C 1S3SA 2IYYA 1JJ7A 4LJAA 1GRRA 3OIYA 3B13B 2OXRA 3DM9B 2HJGA 4II7A 1E0AA 4DSNA 5G40A 4PQYA 1KI2A 2EFGA 2Y8EA 3K1JA 3ZD7A 4RKFA 3VQTA 1H8EA 1DAFA 2I3BA 2XTNA 5G3ZA 2NG1A 2J1LA 4MKIA 1JEDA 1XZQA 3JZMA 3AKCA 5E95A 1NP6A 3IHWA 3PUZA 4PTLA 3AF3A 1S96A 1WA5A 2F1JA 3V4FA 4EPTA 2JIZD 3VR4A 5TV2A 1R0YA 2C98A 2NO0A 3U7GA 3I32A 1KZGB 2D06A 4JL6A 5FL7A 1WQ1R 2YJTD 4BFZA 3IDQA 2W0SA 2FGJA 4WOPA 3RWOA 4TL6A 4HLUC 4DUGD 1JB1A 1G7RA 4LYHA 3Q5EA 1DG1G 1Z0DA 1M7BA 3OIVA 4D0NA 3SJAA 1ZINA 1E1RD 2MMGA 4ZKEA 3PITA 4MKGA 4W5HA 3E2IA 3NIBA 3RRMA 2JLUA 1T5LA 2J9RA 3AUXA 3LBNA 3RWMB 2F7SA 3I4LA 1PJRA 3VR6A 3EIQA 1HE8B 1T0JB 1AK2A 1KO1A 3U7FB 4QM6A 4BE7B 2AKYA 3FDIA 1T3HA 2UKDA 3ZZUA 5DN6D 2PJZA 2CK3A 2IL1A 1OXTA 2REBA 3DO6A 2GETA 4TYPA 1JECA 3KJIA 3RS5A 2FSFA 1FMJA 3B6EA 1MABB 5KDDA 1OKKD 2GHIA 4B33A 4LPSA 1KYIA 2CMKA 5IHPA 2ATVA 1Z5ZA 2ZJ5A 2AK3A 3NWJA 1JI0A 4FMCB 5B2ZA 4JYBA 2WSSA 4ABYA 1ZD9A 3VR2A 2FF7A 3U60B 1D9ZA 5J40A 4Q5IA 1T3LA 3T15A 5TMPA 4AKIA 1GILA 5FUYA 1HV8A 2GJKA 3R7WA 1KDRA 2O0JA 4MDFA 4WW0A 4E22A 3ZQJA 4JYCA 2E9SA 721PA 1NY6A 3WMFA 1IONA 1KJZA 3HU2A 3DZ8A 1A5TA 4QGFA 1XJ0A 4I4LA 1QHNA 4YC7A 2YOGA 3ND9A 1PUJA 3T61A 3GLGE 2NIPA 3K0SA 3O8BA 2REXB 2ZE6A 1MABA 4M9ZA 3ASZA 2Q9AA 2GTPA 1SGWA 3VKHA 3AF2A 3CM0A 4OK6A 1E9DA 2GXQA 3NHBA 1Q20A 1S4QA 4TTRA 1S3GA 1ZVQA 2ZRJA 2VHUA 1US8B 3BAFA 4OQXA 4LV8B 3DZDA 2ZUCA 2FV8A 4MRPA 4B32A 1D5CA 2F9MA 3OEHA 1G21E 3TUIC 1UADA 5BQ5A 1E2DA 4YONB 1N5LA 3O8DA 2OBNA 3CNNA 4JZKA 2PT7A 2IHYA 2VHCA 2R6CA 2AKAB 4M2LA 1C1YA 4G5QA 3W34A 1ZUIA 1FMLA 3BIFA 1LS1A 2AXNA 2O5VA 2QE7D 2YWGA 1AZSC 1JR3E 4KVGA 4KFUA 2OG2A 2VF8A 4GZMA 1AS0A 3BFXA 2OCAA 4IEEA 4R7ZA 4DDVA 5JMTA 4O3MA 4GOXA 2BMDA 2JJ1D 4NKRA 3X1DA 4I99A 3B85A 3A1WA 4NCIA 4IHQA 2OAQ1 2YHSA 4AYTA 1NF3A 2X1VA 1NMXA 3QKSB 2FEMA 4HATA 4M22A 4ASUA 3O8RA 3L2OB 2W6JD 2ZVQX 4ZPXA 3SE0A 1MKYA 1P2TA 1CKEA 2OM2A 5FTMA 3U5ZB 1FX0B 1G3IA 3PUVA 1XF9A 4OJQA 3NTUA 3THWB 1XPOA 3ZD6A 2O8FB 5EP3A 1J8YF 2XITA 2ZRNA 4MUBA 3V9PA 5IF9A 4CEJB 2E87A 3KKMA 1R5OA 3FVQA 3B2EA 4M1MA 2ZM5A 2DWOA 5AUOB 3BD9A 1TUIA 4D2IA 4A4DA 2ZVPX 3CR7A 2X19A 1U90A 2ANBA 2V7QD 3W8RA 4TTPA 1KSFX 5E7IA 3BRWD 2UVQA 2VP0A 4IVRA 2VSXA 4OI1A 1FW6A 3QKSA 3LO5A 3U7EB 2IYSA 1N3BA 1XMJA 5HKKD 5KNCA 3B9QA 4LHWA 4DLTA 1VIAA 3EPJA 1YRAA 3BC1A 4YMVA 3PENA 1FX0A 3ZVRA 4BUJA 3KKOA 1Z22A 2R6DA 3THWA 4PPQA 1T9HA 4LZZA 1FP7A 4B43A 4CEJA 3WBJA 3BS4A 4Q21A 2J7PA 4CEIB 3AGPA 3DM5A 4UXJA 3RRNA 1A82A 3H2YA 1MOZA 4TT3D 4H1VA 5A0FA 2BC9A 3TVTA 1H8HD 2GDJA 1A7JA 1QVRA 4TTQA 3X1XA 3C7KA 2ERYA 5GJWC 1RYFA 1NMZA 1FZQA 4QGAA 1L8QA 2GAOA 1NKSA 4N0DA 4Q7MB 3OIUA 4KO8A 2ZEJA 2X2FA 1JR6A 2IXFA 4G3XA 3C16C 3QPUA 4KBGA 4QJ4A 3KQLA 1WCV1 1ZNYA 1E0SA 5GJBA 2REOA 5AJWA 2VO1A 3D31A 2JLVA 2BIFA 4XWAA 2FOLA 4O2RA 2XZOA 3KJHA 4GT1A 1OH8A 2F43B 1UEJA 2ZAMA 3EIEA 3AVPA 3WYFA 4LRWA 5L3QB 4PSKA 4MA4A 4CEIA 4L16A 4Q4LA 5G3YA 3B78A 5SZHB 2GEVA 1GITA 2LWIA 4LJ6A 3SN6A 5B30A 2RCNA 5HE9A 1NVVQ 2RGEA 3REFA 3L8YA 2GJ9A 1YE8A 4BFWA 5JRJA 4TSFD 1G5RA 3NG1A 4PQFA 3IHLA 1L4UA 1CRPA 4XTCS 1BMFA 1VG9B 3FKSA 2ECKA 4S35A 3QG1A 1M74A 3W5JA 1U94A 2WIAA 2ZRAA 4KYIB 4YQFA 4L5BA 2ZI7A 4GI7A 2QN6A 3KTAB 2QUZA 4FMDB 5FBWB 3SHFA 1G9XA 2GJ8A 1FP6A 5E7JA 1YHNA 1E2JA 1G8GA 4DLSA 1MV5A 2F43A 2GBLC 2WWFA 4Q9KA 3VR1A 5JEEA 2IX3A 2VYFA 5EP2A 5L3QA 1KI9A 1LW7A 3BORA 4JT2A 2P3SA 2KE5A 1W49A 3QG5A 4LYFA 1ZM4A 3RSLA 5L3SB 1NMYA 2QA5A 1KMQA 1N0VC 2IF0A 3TE6A 4JIMA 4PHFA 3K70B 1T8UA 3PEVA 1Q57A 1N6RA 3B1ZA 3P27A 2CXXA 1CBUA 3OE7A 3W6PA 3AVOA 1GSIA 2RH5A 3A37A 3CPHA 3NBYC 3RC8A 1XWIA 1DPFA 1BO6A 2B7BA 1ZAKA 4IDHA 1QRAA 3UPUA 4B2IA 3ZIAD 1R0ZA 2CNWD 2ZRGA 4LC0A 5AUQA 5JHHB 4AI6A 4KYUA 4LCBA 2FEOA 1RRCA 3KFVA 1Z0KA 221PA 2I1VB 2PMKA 3AP3A 5AR1A 3SC3A 4PO9A 2W0MA 5JJKA 3PVSA 2FZ4A 1U8AA 2H57A 2F6RA 3SBDA 2PCLA 1KK1A 1KI6B 1P73A 4RFVA 1EG7A 1L4YA 2ZRBA 4YDHB 5H70A 4MKFA 2W2TA 1R8QA 2C96A 3B5JA 4AY2A 2GRJA 5L3SA 4Q1BA 4XSHA 1OSNA 4IXMA 2QNRA 5F98A 3I5XA 1NN0A 1UKEA 1KK3A 4A8JC 3OFND 4A2QA 1CIPA 1N5IA 3R20A 3KKPA 4M1OA 3T1QA 3QEJA 3IUYA 1XMVA 2ZJAA 1IN6A 1HUQA 4A36A 3R8CA 2VP9A 1JXOA 4B6EA 2OV2A 4DT1B 3U6KA 1Z3IX 1ZM9A 4K81B 5EUQB 3QKTA 1OB2A 4W9MC 3CX8A 3LQQA 5CIWA 2DFLA 1LFDB 2WWXA 1W4AA 1T8TA 5C18A 1KI6A 1R0WA 2D74A 3N2IA 1KKLA 3CX7A 1TEVA 2GZDA 3SZRA 3SFZA 4LJ5A 1J8MF 4WAUA 2JLRA 2H18A 1NG1A 1D9XA 1Z6XA 2F9LA 1P2VA 3L43A 2CJWB 1KI4A 4IEIA 5AUPB 1YZNA 1WE2A 2G1KA 3PV0A 5D3MB 3K0CC 5KDOA 2OBMA 3BFKA 3DVLA 3CONA 5FOTA 3SOPA 4X8OA 2H1LA 4LHYA 4OL0A 4I1OA 1HT1E 3GJ5A 4QHYA 2BOVA 2WHXA 4XD7A 2IYXA 2DR3A 2ODBA 3FPAA 4PHGA 2FA9A 4LPKA 3TNFA 1E1RA 1NSTA 2VPPA 4AKEA 5JSZB 4XJXA 2EFCB 5BWMA 5FI0B 1XTJA 4D4LA 1XPRA 2HXSA 4OQLA 3P20A 3C4JA 1NVVR 1P9RA 4X8MA 1Q22A 2AN9A 4TWZA 4BASA 1CR2A 2BBOA 3WY9A 4HAWA 4C4PA 4B44A 3S1AB 2FG5A 4GBMA 4DEXA 4LBWA 4I81A 2CJWA 2GCPA 1X6VA 1Q1ZA 1ZP6A 1AJEA 1ZIPA 5D3MA 1VMAA 1NLZA 2FSIA 1IY0A 1IQPA 3BXZA 3NKVA 3EZ6A 2OFOA 5JWOA 5C4MA 2DBYA 1JAHA 5G41A 5HR5A 1IM2A 2ZSBA 3LWNA 3FMOB 2BEKA 3AKEA 2CHQA 3BBPA 3M4YA 4JLVA 2PLFA 1V5WA 1RYHA 1G8YA 4POAA 2RHDA 2A5JA 1WXQA 1KKMA 1P7CA 2B92A 3QQ5A 4LK2A 2JLZA 2QQ0A 2RGNC 3LXRA 2A2ZA 3L82B 3AF0A 3Q72A 4BZPA 1K5GA 3AV0B 3S1AA 3A36A 4C0KA 1RZ3A 2OLJA 3BERA 4HLQB 4NCKA 4DLRA 2QPTA 3K9HA 3VU9B 2AL7A 4A6XA 4DCSA 4Q1FA 3IKJA 3LX8A 1S0UA 2FWRA 2JLYA 1GAJA 3AKYA 2IC5A 4KBFA 4OQNA 4X8HA 1WF3A 3WP1B 2AWOA 1DE0A 4LJ9A 5KYKA 3AF1A 2JDIA 3L0PA 5L3VA 1ZIOA 4QRHA 3U3JA 2GVDC 4MGYR 2ODEA 2VP2A 2GK6A 5KPJA 1G1MA 2GF0A 5FTKA 3GLIA 5DO9A 1LTQA 3THXB 4NHOA 2NZ8A 2VHTA 2CE7A 5KSOA 2GXUA 2IK8A 2JLQA 2WSMA 4ZCLA 3TIFA 1P62B 2ZU0C 1E2KA 2ZRHA 1R0XA 1YRBA 2BKUA 5DHFA 4RSGA 5TXGA 2J0UB 3KFXA 1U9IA 5LB4A 3RABA 4JSYA 3VU9A 3WHKA 2QE7A 2MMCA 4B35A 4BEJA 1O3YA 2CEAA 3LNCA 2DB3A 1N6HA 1Z8FA 1P9NA 2WAXA 2B7CA 1Z06A 3DPUA 2NO1A 5F9HA 4BLQA 3VKGA 4TMZA 4EPWA 3ND8A 3OZXA 2JAQA 1C9KA 3RVBA 1EFHA 3THXA 4DEYA 2QI9C 2W6JA 1IY1A 1ZBDA 1R2QA 3D8BA 3T12A 4KSCA 3U3MA 3T06B 2RKOA 1ZNXA 3Q9LA 1N6PA 2HYIC 2EYQA 3CH4B 2J0UA 1DAGA 2XJ4A 3LVRE 4GNKA 1PZNA 4JLDA 4Z8XA 1Z47A 1IBRA 3OAAA 4D82A 2ZE7A 3CIOA 3CUEF 1Z6TA 2PZGA 1AGRA 3KUDA 2A30A 3QKUA 5JJIA 1G4UR 1Z29A 3TUJC 3BH0A 4M9QA 3VHLB 2A5YB 5JI3E 2QSZA 3NEJA 5DIFA 3U44B 4AK9A 1X1SA 4OHYA 2WOJA 2ZR0A 5JZVA 4DB2A 4W5WA 2WKQA 1UDXA 5DNYB 2WWGA 4V02A 4TLEA 4BLSA 1YR8A 4AURA 3PUYA 2KI5A 1ZC4A 4WA7A 4NPHA 4PPGA 4U5XA 3LH5A 1XEWY 2X8AA 2ZR7A 4BECA 1OB5A 2IS2A 4D6PA 2VA8A 2V6IA 4C30A 2R65A 5F2EA 1RC8A 1ZYUA 2AD1A 4BEBA 2AXPA 3T5DA 2BM0A 4TT3A 1AGPA 3OHMA 4B6FA 2OAP1 5E7MA 1H8HA 1KMHB 2DFNA 1SVWA 4BFSA 1ZM3A 5B58C 4AG6A 2IW3A 4LHXA 2QBYB 4F38A 3W9YA 1N6KA 1TU3A 4PC2A 3U44A 4EPVA 3B1VA 1EX7A 1QHYA 3RANA 2WMNB 1DTSA 3B1XA 3F3YA 4EPRA 1WP9A 1Q12A 3RAPR 2O8BB 2WJHA 1IN4A 3EC2A 4G5RA 5EQTA 1GVNB 3WHLA 4P33A 2VTKA 5TY0A 1HYQA 1LV7A 3I61A 1KI3A 3EARA 1ZUNB 5EXSA 1TAGA 4DLUA 1LB1B 4JLOA 1F6BA 3WBKA 1OJLA 1Z0IA 2QP3A 4FW9A 4G5SA 1EWRA 5KU1A 4P4SB 1F2UB 4JVMA 3FMPB 1KMHA 3EPLA 4ACAA 4UNRA 1OIVA 2TMKA 3CRVA 3BK7A 2G88A 4ZDJA 2QBYA 1CJTC 4M1YA 4I1UA 3U2QA 1CULC 2BKEA 3IQWA 2ZS8A 3MG9A 5ANRB 4OQMA 3TW4A 3C5CA 2WKRA 2WOOA 4F4IA 4ZDIA 2AX4A 5IRCD 1E2LA 4LV5B 4RD0A 2O8BA 3Q7PA 1E1QA 2PX3A 4GPTA 1SQ5A 4WZAE 3FHTA 4QOSA 4QBIA 5LDDC 5JJLA 3KJGA 2JGNA 4QHTA 3SNHA 1YZGA 1X8JA 2WPDD 2ZU6A 2ZUBA 4PXAA 3WMEA 2LKCA 4IDOA 1UEIA 3TRFA 2HT1A 5DISB 4UNNA 1A2KC 1QVAA 1GNRA 2HLDD 4OI4A 5AJXA 1XPUA 2QPAA 1P61B 3SS8A 4ACBA 4P4SA 2J0QA 1F2UA 2P67A 3H4MA 2IWRA 1HT2E 1HQYE 3LW8A 4RD3A 4QM7A 3R9XA 1OXSC 2XOKD 4MRVA 1E2GA 1HA3A 1GOTA 4RD2A 4ZCMA 3NVAA 1GKUB 2UZIR 4U00A 3DHWC 1VYTA 421PA 3ZIAA 2MSCB 3V00A 4A15A 4BGDA 1XJCA 2ZXUA 2HF9A 3FHCB 4OHXA 4Q1CA 1W0KD 4B76A 1KK0A 1E0JA 4CF7A 1NBMD 4ZCIA 2ZRIA 2GNOA 3R7WB 4MGKR 1B23P 2Q21A 4C0QC 4PAOA 3CRW1 4FD2A 4JT4A 4EJSC 3EA5A 2P0EA 3HU1A 2QTFA 3ZVNA 1RPZA 1A1VA 5KO2A 1U0HC 2V8OA 4AC9A 821PA 2XTZA 4TLBA 3I8SA 2GK7A 2OSBA 4MYUA 4JLPA 3OFNA 1OH5A 1G3MA 2K5UA 2G6BA 3NBXX 1VPLA 4F93B 2EFHB 2EYUA 1JNYA 1GRQA 2JJ2D 4IVPA 3U3KA 3GJXC 2ODWA 2QENA 1IN7A 5FUVA 1LS6A 4QKQA 4D4MA 4IDQA 2QT0A 3J81k 4B3GA 1WBDA 1FQKA 2QM8A 3MRSA 4X8LA 1CP2A 1OPXA 2GEUA 4US0R 4L9WA 5J5CA 4BFUA 4OI0A 3UIEA 1ZNWA 4QC2A 4PQRA 5HE8A 4TYNA 5C2JB 4A6PA 3DKPA 5KDLA 1NY5A 4RD4A 2OILA 5AJVB 3E70C 3JZAA 4OHVA 3VKWA 3M6AA 3LXXA 1KO5A 1N5KA 2QPOA 2W2XA 3KQKA 5P21A 3SYNA 4JS0A 4IDNA 1XEFA 2W83A 4QNMA 1CEEA 1R4AA 2AWNA 1EFRD 2C95A 3X1ZA 4M4SA 4A0HA 2WVJA 2OCBA 4LJYA 3WYAA 1W36C 1UAAA 3P26A 3GPLA 3V4RA 6Q21A 4WZ6A 2J7KA 3LFUA 2XNDD 3GEEA 4EQ6B 1N5JA 3IGFA 3K0AB 1LVGA 1NJGA 1TF5A 3CNOA 3KQNA 1E6CA 1CS4C 2GVZC 2O52A 2P6UA 2Q3HA 2VSOA 2Z83A 2IS4A 1YR9A 1KZ7B 4URWR 1P2SA 2NO7A 2BMEA 1OLOA 1YQTA 3TAUA 3UATA 4Q47A 4DIDA 2VSFA 4GSYA 1RRGA 1NIPA 3LRPA 1U8YA 4MDEA 1OHHA 3EZ9A 5JEDA 3OIWA 5FPKA 4N3NA 4QFMA 4DBLC 3TK1A 3DOFA 4C9BA 3KQUA 4IVQA 4I1VA 4BZXA 1DO2A 4PSVA 5TDHA 1GRNA 5UKDA 5EP4A 1RJ9B 5AJYA 3A4NA 1XTSA 4F4CA 2IYLD 1DBSA 1YZTA 1EFTA 4C0LA 1OH6A 4HLDA 4M9SA 3MUFA 4PC7A 1ESNA 1E9BA 2ZR9A 3CLVA 2V55B 3SJBA 5EXTA 4EQ6A 2CCKA 4EFLA 2I1QA 3ETLA 3K0AA 4TMWA 5E3HA 3GP8A 3LQRA 2R8RA 2OT3B 2PJRA 4XWKA 2J59A 4YMUA 1Y63A 3E1SA 4Z8YA 4YMSA 1RFLA 1X3SA 3PJRA 3MJHA 1PLJA 3QXSA 2C04A 3RS0A 1EESA 3CB4A 2IUUA 3K9NA 2ZYWX 1FQJA 1XX6A 1Z6GA 2V54A 5EZ5A 4URVR 1KAOA 2DYKA 5FBLB 3GJ7A 2FH5B 2Z5FA 1N6OA 1RJ9A 1ZD8A 121PA 5JWRA 2Z6VA 4IOLA 1D2MA 3C8UA 3T1TA 1OV4A 1S9DA 1PLKA 5CJPA 4NYJQ 1TADA 2ZSDA 1XD8A 2PZEA 521PA 3GD7A 2H17A 2IEYA 5DYGA 4HB0A 5B64A 2XSZD 3K70C 2VHJA 3W3AA 2V4ZA 2D4HA 3PUXA 3C41J 1K8RA 2ZROA 4XTRA 4BPBA 3AF4A 3WRXC 3LA6A 1W46A 3M0EA 2VP6A 3K09A 4DRZA 5EE9A 5K8LA 1BKDR 2GZAA 2C9CA 2VQSA 2YNMA 3CF0A 4RFSB 4DLZA 5HPYB 4D25A 4XVQA 2NTYC 4Z1MD 2VP4A 4LGMA 1E99A 5IK2D 1NJFA 2D3WA 2D62A 4NDZA 4ITRC 1G4AE 2ORVA 3RHFA 3OEEA 3TW8B 2R2AA 2YC2C 1KY2A 1FPMA 2BCGY 2CLCX 5CYOA 3VAAA 2F1IA 2RGAA 4B3BA 2QEQA 3A4LA 4URXR 4ESVA 1ZCAA 3SYKA 4OK3A 2IYZA 1G3RA 3LBHA 3LVQE 2ZSFA 1XD2B 3QE0A 4QHSA 3TUZC 2G0NA 1QHIA 1OW3B 3OF5A 4N0EA 3D3QA 2YWEA 1COWA 1G8HA 1NLFA 1Q3TA 1XCPA 2PLRA 5FPYA 3ZJYA 3OESA 2O8CB 2H8KA 1G20E 1AS2A 2ZI9A 3EWAA 4M53A 2JA1A 4DSTA 5CYPA 2ZI3A 4A1FA 3K0FA 4C2TA 4TYWA 3KQHA 4RFSA 1OH7A 2GJSA 3CBQA 5FL3A 4BQSA 1VHTA 1J90A 1E4VA 1F3OA 2VL7A 4HZUB 3LV8A 2PL3A 1GDDA 3BWDD 4Q4JA 2BBWA 3PEYA 3TMKA 2ZPTX 2DCUA 4U7DA 1XD2A 4NMMA 3GJ4A 4JVSB 4K8OA 1SKQA 3ZYCA 5KOYA 1P75A 1XD9A 4EFNA 2SHKA 1OF1A 2O8CA 1ETUA 1H65A 1B0UA 4KV9A 3QPVA 5EP1A 1TQ4A 3IEUA 5DI9A 4OK5A 4QGGA 3RRZA 4Q66C 3RS4A 4RD1A 4L9SA 2O0KA 3BJIC 4Q1EA 5KSPA 4KVAA 1GKYA 1RKBA 1KNXA 1TF2A 1CTQA 2EFEB 4IW3B 2OFWA 5JHGB 1JQJC 4RD6A 5KSZA 1EWQA 4HZUA 1II0A 2J5XA 4PZZA 4E07A 2GJAA 2WKPA 1UBGA 2Q9BA 1CJUC 2QAGB 4A2WA 3T34A 1F60A 2NQ2C 2WWWA 4A82A 4QJ5A 1YZLA 4CT4B 3BOSA 4M1TA 2IBMA 3HPQA 3A1VA 3EASA 3N5CA 3GJ6A 4TZ0A 4Q9IA 2WJIA 2BDTA 1S8FA 1UDWA 1KO8A 4Q19A 2ZAOA 3CR8A 2ZRMA 4A9AA 1H8ED 2J41A 1TMKA 2QROA 4D4JA 1L7VC 2NPFA 4C3ZA 5FUWA 3BGWA 1GM5A 4YXWA 3EPKA 1II9A 3I73A 3JVUA 1K6MA 4V0KA 5BW8A 5JLJA 5CJ2A 3QVUA 1OIXA 5JS8A 4FWTA 3AH8A 5EXPA 2IYQA 1CJMA 1CU1A 3EZ2A 4HAVA 3UWOA 4BLPA 1MH1A 5DI3B 2QAGA 4K46A 3RRYA 1VCNA 1KO4A 1QBKC 1VDZA 4US2R 5KSYA 3SJCA 4V0LA 1ONBA 2BHRA 3WNCA 4JKYA 2AHOA 4HAUA 1U8ZA 5F9FA 1IXSB 1XP8A 1G19A 1L2TA 3MLEA 2AFHE 3C14C 4FCVA 2FDCA 1OFTA 1SVIA 1KIMA 3DOEA 4TZ6A 4RJLA 4HEJA 2A7QA 2G0TA 1NVXQ 4R2HA 2GZHA 1E98A 2BM1A 1Z28A 4GOJA 1X1RA 4ZKDA 3QXJA 2HLDA 3AVQA 2JIZA 3WP0A 3A58B 5FOVA 3QBTA 2QMEA 5DI3A 4PHHA 1N6IA 3RSOA 3QUSA 1P72A 3IILA 2BEJA 3ZS9A 1OIWA 4LJ4A 1E94E 2DHRA 1OYWA 3HYTA 4RY2A 4V0OA 1TEXA 4PC1A 4C7OB 3PEWA 2FFBA 4JLMA 1G18A 2IS6A 4EPXA 4PZYA 4FMBB 3KDSE 4DUGA 4JSTA 1QHSA 5JS7A 4LBYA 4RCYA 1UKZA 1AM4D 2CVHA 2KB0A 1D2EA 4AWXA 2GAAA 3A4MA 4UNSA 1TF7A 2HUPA 3LY5A 2WTUA 2D7CA 2RAPA 2JLSA 2CDNA 3KKQA 2D7DA 3Q8XB 3H86A 3W6OA 2ASEA 2ONJA 5LBIA 5JWHA 1KSGA 4IFBA 5DN6A 2XTMA 4Y0AA 2IXEA 5CIQA 5LB2A 2C2HA 2HT6A 4TLAA 4DC9A 4LYAA 2RGBA 2BCJQ 4C7OA 4EIWA 4D0LB 3FWYA 2HYDA 4TMTA 3CKLA 1J2JA 3LLMA 1OKKA 4C0JA 5GVSA 3AP1A 2BJWA 1N0WA 1Q44A 3ASYA 3L0IB 1JR3D 1Q1BA 2JJ2A 3N70A 3QF4B 2IYTA 1T6NA 1IN8A 1SVSA 1SHZA 2XB2A 5GJVC 4B34A 2X2EA 3CPEA 1KTVA 3QNUA 4KHZA 1KJYA 2CE2X 4DDWA 2J45A 2F3TA 3PEUA 3VNUA 2VIIA 3QI2A 4XH9B 3W8NA 1MRNA 4G0NA 1TQ2A 4MITA 4UJ5A 3GLIB 1A4RA 4Q9JA 4B48A 1SXJC 3ZH9B 3HDTA 3EG5A 1KJWA 3CF2A 3IQXA 4DDTA 5CB6A 1R5BA 2FN4A 1SKYB 1W1WA 2XJ9A 5C46F 1W0JD 1KSHA 3B7GA 4KFSA 2ZIAA 3GLFB 2QTHA 4C0AC 1Q3HA 3SQXA 4M9XA 1QG4A 2BBSA 3H84A 4B73A 3EIHA 3BE4A 3CW2A 5FR1A 2G9NA 1T4GA 3T35A 1P4SA 1HURA 3BFVA 4PO8A 1ZM7A 3IPYA 4GZLA 3LD9A 5KNDA 3TQFA 3QF4A 1EFRA 4O25A 4TLCA 2ZSAA 1AQUA 1J99A 3GEIA 3Q5DA 3AVXA 1TTTA 1UKYA 1R7RA 2CLSA 1I2MA 5AJZA 2YINC 5SZJA 2CCGA 2EWVA 1ZD1A 2ZREA 3RNLA 4DIEA 4ASUD 3TSZA 3WXMA 2XNDA 3C15C 5J4KA 2GILA 4JL8A 1CR1A 4CDGA 4ZDWA 4ESHA 4P3YA 5EE0A 2BVNA 2GCOA 4OYHA 4A8JB 3P32A 4PAMA 1Y3AA 3ZGXA 4D4KA 3UG7A 4OJKA 5BN4A 4HYYA 3GLFA 5HCIA 1E2EA 3MD0A 4E09A 1KDPA 4JVLA 1DVRA 2WMOB 2ZJYA 2NOAA 2ZUDA 3CX6A 4PFSA 3CZQA 5HCNA 2NO6A 4BRUA 4TMXA 4XIGS 3I62A 1E96A 3Q3JB 5FOSA 4HZIA 2QG6A 2GXSA 4YDSA 2VRWA 2R62A 4GP7A 1II8B 1M2OB 4DCVA 1W7AA 4BLTA 1PLLA 1E0KA 2IS1A 2QORA 1OYYA 1R8SA 2OBLA 1M6NA 2QMUA 2QAJA 1G6HA 3EPHA 1KNQA 1RW4A 2PEYA 2JJ1A 3I8XA 4MQBA 3EXAA 4QBFA 3GLIE 3KXIA 1G3QA 2BMFA 3AEZA 2EFDB 1SKYE 1AS3A 4D26A 2DWPA 3R8FA 5EXXA 4QJ3A 1TL7C 1SVOA 3GLFE 3G5UA 1DELA 4TL9A 3L0SA 3RC3A 4OHWA 2ZRPA 4NCHA 1EX6A 4URUR 4JLBA 4A8JA 1YR7A 3I5YA 1VHLA 2FPMA 4IXNA 2J7PD 1JAIA 1FUKA 3DKVA 4MRNA 1G291 4MRRA 3RDPA 1ZJ6A 4MKHA 3TR5A 5DHAA 4D81A 4HB4A 5B57C 2DFKB 3EWSA 1NN1A 3B60A 3AVVA 3X1WA 1JPJA 1QHHB 2YOHA 1VG0B 1E2HA 2AK2A 4RZ3A 1II8A 4FCWA 5E4FA 1IY2A 1DAMA 4JBYA 2V7QA 1YZUA 4KSBA 3DEFA 2R44A 2PMDA 2WM9B 4WZBE 5FTLA 2YWFA 2XSZA 4QGHA 5L3RA 5DH9A 4QL3A 4MUAA 1FNNA 1EXMA 3KKNA 4F91B 3KJEA 1G17A 4GMXA 5FOUA 1KK2A 5BN3A 1QG2A 5HKKA 1WDTA 2QRNA 1E2NA 1N0UA 4JBXA 4Z1MA 1DARA 2ZI4A 5J4VA 3TSWA 2I4IA 3GJ3A 5SZKB 4DSUA 4PR0A 4CGZA 1K5DA 2ZYUX 5A5GA 4JVNA 1ZM2A 5IDVA 4M1SA 2E1RA 1W36D 1CR4A 4G01B 3DL0A 1IN5A 3BB4A 4EFMA 1QHHA 2EQBA 1G16A 2QTVB 3U3OA 5CDFA 4CIDA 4G5OA 4B47A 4Q7LA 1NRJB 4F4JA 1X86B 5BYKA 2Q9CA 1VECA 1BMFD 3FKSD 2IYUA 4V03A 1DADA 3WRYC 4CVNA 3CRRA 3ZZTA 1I4LD 4F7WA 3ZDQA 1TUEA 5EE5B 5FTJA 3A6PC 2WICA 2OESA 4CYMA 4V0NA 2HCJB 5M04A 5CK4A 2QL6A 4ZIRB 3IIJA 4P4UA 2ZJ8A 1U81A 2OFXA 1E9SA 1KOFA 3MCAA 4HAZA 4TQUS 3KZ1E 1QZXA 2R9VA 5DSZA 2G83A 4L8GA 5LD2B 4B3XA 4DHEA 4NP6A 1W5TA 3PG5A 4AD8A 1GNQA 1VYUA 3TVDA 3OE7D 2W2VA 3KL4A 3T1VA 3UKDA 3GLHA 2P65A 1S1MA 4DWJA 1NN5A 1XMIA 2RGNA 4TSFA 3W90A 1Z0FA 4J0QA 4Q4AB 1ZW6A 4B74A 4BFVA 3THYB 1PV4A 2RGCA 4V0MA 1PVOA 3K8YA 1Q21A 4KFRA 1XTKA 2ZS7A 1E2IA 3GCGA 4MYCA 4ZI2A 4ZIRA 1BS1A 5G53C 4DVGA 3SDZA 3A1UA 5CM9C 1VTKA 2FE4A 2OHFA 4DXAA 3ZLJA 1SZPA 1ZCBA 1E2FA 1EFUA 4DLYA 4UKDA 1N6LA 2Q3FA 3K70D 1UM8A 2Z0MA 3NC1C 3AGQA 2ZRCA 2ANCA 4G5GA 1OT3A 1P6XA 1J7KA 2OLKA 4V0ME 3CRQA 3NHAA 2P6RA 1LY1A 5FR2A 2C5LA 3THYA 4Q4AA 4ARZB 5FPSA 1W47A 2O0HA 4P31A 1Z0AA 2VH5R 4A0FA 2CNWA 4Z51A 2QSYA 4LY6A 5FFMA 1Z63A 1VCIA 4M21A 5FOXA 4GFDA 2A5FA 1T0HB 1MRSA 2FPKA 2P2LA 3FOZA 1ZUHA 4EKDA 4H1UA 3SYLA 3KX2A 4HLCA 3BB3A 3AUYA 3K09C 4FMCF 2NO9A 4LBVA 2HCBA 3HR7A 3TJZA 1DEKA 1OXUA 4P4TA 1NG9A 2KBEA 2OE2A 3T1OA 1E69A 1GG2A 1HTWA 4XVRA 2B8TA 3GLGB 1UBEA 2WWIA 3I3SR 1X8LA 4XD7D 2IWHA 1X8KA 3U3RA 1HEIA 3MSXA 2FU5C 4ARZA 1F2TB 3QENA 3BH7A 1S9HA 2XNSA 3NH9A 5GADl 3GEHA 3CZPA 1UJ2A 4TQ9A 1Z6YA 3AVTA 1UKVY 3BH6A 4PPNA 1I4DD 2QGZA 4E5UA 4BZQA 2CL0X 4C2UA 1ZNZA 1ANKA 4JLAA 4DB4A 5L8VA 3TR0A 2VBCA 2AFIE 1Z2CA 4BRWA 4IOJA 3FMIA 2YYZA 4QNRA 1W5SA 3E5HA 3PIRA 3TBKA 1WBBA 1R6BX 3M1IA 1W4BA 5BYJA 2DY1A 2GXAA 4L4UA 2A5GA 3GLGA 2C99A 4M1KA 1XEWX 1I2DA 3BB1A 5TB5A 4BFTA 3B82A 1YVDA 2FZLA 2MSEB 3SJZA 5K8UA 2IT1A 4IRUB 1GZSA 2EWWA 1UPTA 4OI2A 3MWYW 4NBSA 2QMOA 5FH9A 1OFIA 1F2TA 1NSFA 3B1YA 2PH1A 4Q7JB 2F3RA 1E32A 3IIMA 3MFYA 4CZ2A 1G8FA 2ZJZA 1IJFA 4TN1A 3NH6A 4EPYA 1FOEB 2XAUA 1XTRA 4NONA 3CRMA 1D2NA 1DG3A 2Q0HA 2XX3A 2IA5A 3UG6A 1SVKA 2FSHA 1M7HA 3PR1A 4JJKA 1AKEA 2JLXA 1ZC3A 2ZS9A 3A8TA 2FFQA 3CNLA 4LJ7A 3WMGA 3HR8A 2QZ4A 3EW9A 2WAYA 4KFTA 2GKSA 2HV8A 5J4HA 4HUTA 3MJRA 1XTQA 1VCOA 5FUXA 4URZR 4UNPA 2EVWX 3TKLA 3ADDA 1E3MA 1QF9A 2JDID 1JR3A 2HF8A 2ZE8A 3VX4A 3WYGA 2ZJBA 2N46A 1VG8A 2KBFA 4DCUA 2YC4C 2F1RA 5TVKA 2XZLA 4TL8A 1IXRC 3FFAA 3SI7A 4PANA 4Q4HB 5C1BA 2KWIA 2WWHA 4F92B 1U98A 4PC3A 1FFHA 5GVRA 3NDBB 2VEDA 3AM1A 2FSGA 2ZRDA 2V3CC 4DZZA 2ZETA 3QBVA 3EZFA 3SR0A 3TLXA 4P0TA 1XDBA 1E79D 3RS3A 1NN3A 5FOWA 2VLIA 1XCGB 2ERXA 1W0JA 2C78A 5DLQC 1W44A 2FNAA 1ELOA 2WJJA 3Q85A 4D0GA 4CRWB 3R9WA 3ADBA 1GWNA 2ZI6A 4BFXA 5CITA 1OXVA 2XXAB 621PA 1PUIA 2RB4A 2ZI5A 4JBWA 4RKEA 1JALA 1J70A 1QHGA 4AYXA 2QGNA 3CWQA 4UQOA 1FTNA 5K8TA 1KGDA 3WNDA 3TAHA 3GFPA 3I72A 2O8DB 4DJTA 1T5IA 4NU0A 1GFIA 3FE2A 3Q7QA 3SFVA 3PUWA 2V1XA 1AKYA 2QAGC 1US8A 1ZU5A 1GL7A 1JJVA 1XEXB 4Q4HA 1E2MA 4TL7A 3A1SA 3FFBA 4EJSB 5J47A 1DAKA 1MR3F 3QXCA 1MO4A 3K0EA 1E9FA 4RZ2A 3CPJB 2CLDX 2H16A 4NYIQ 1IHUA 5KNBA 1D8TA 1RVDA 1U2RA 2FX3A 4EUNA 4QBGB 3HPRA 3P4XA 1KDTA 1IOZA 3CWZA 3K0FB 5JCZA 4HLUA 2YOFA 2XXAA 3EA0A 2OEPA 5EE1A 3RYTC 5BXQC 4FCTA 4BLRA 2NGRA 1V43A 2KJQA 2C8VA 3EZ7A 3OAAD 4Q1AA 2A78A 4TQAA 2IEZA 4JKIA 2H5EA 4N1AA 1F5NA 2OCYC 1IAQA 3ADCA 1G8PA 2C03A 1WRBA 2O8DA 4Q4JB 2YKGA 2RGGA 3QF7A 1YJ5A 4HB3A 1MT0A 1OFHA 4AIIA 3IO3A 2GESA 2IF2A 5H68A 1XEXA 1ZMXA 1BH2A 2ATXA 1Z2AA 3D7MA 1XFAA 4LI0A 4LYJA 4EJSA 2QP9X 8OHMA 1KHTA 4HDOB 4LBZA 2VF7A 5FBVB 2BWJA 2WV9A 4O0MA 1KSJA 2QM7A 2G77B 3U6BA 1T3SA 5GJCA 1VKJA 3TH5A 1VCMA 1QHXA 2O8FA 3JVVA 2W6ID 4Q02A 2IYWA 4Q00A 4UXHA 4KLNA 2A9KA 4ZV4A 3SQWA 3U4QB 2ZTSA 1C4OA 2J3EA 3KXKA 3L8ZA 5FBQB 3ZQ6A 2W00A 1GUAA 1FNMA 1DAEA 5F3WB 4LDJA 4Q7KA 1JPNA 4L15A 3IIKA 3NEYA 4ILEA 1W36B 1G3UA 2CL7X 3LBIA 5A4JA 4C0SA 3FTQA 5C4GB 2YV5A 4LHVA 1NVUQ 3ZVMA 4TMKA 3UMSA 1RIFA 4IOKA 4NCJA 4R2IA 3B1WA 4U02A 4CW7A 2FFHA 4FMDF 2IUSA 3B9PA 1SXJD 4MYHA 1XU4A 1LNZA 4M8NE 4Q01A 2BV3A 3I1FA 2JJ8A 4US1R 2IUTA 3LW7A 2PCJA 2EW1A 3X2SA 3ECCA 1Z08A 5DE3A 3EAQA 1ZU4A 1EFCA 3TSOA 1MO3A 4HDCA 4P32A 4Q48A 3RS7A 2D2FA 3U4QA 2CVFA 5IT5A 4PC6A 3MGCA 4Z54A 1HH4A 3CF6R 1GP2A 1NVWQ 2AR7A 2WWYA 4GDFA 3NDPA 4EAQA 1CLUA 2RGXA 1UFQA 1W48A 1XCMA 5CM8B 4PX9A 3ONWA 1Z6AA 4AG5A 1YKSA 2FMXA 2ZJ2A 4YLGA 2V9PA 3SU8A 1HY3A 2ORWA 2JASA 2YWHA 1ODFA 2G3YA 2PEZA 2R6FA 3QXHA 2J0VA 2P5TB 4RVCA 5EE3A 5J4YA 2ZRFA 4FIDA 3R9IA 2A5DA 4AKHA 1E1QD 3CO5A 1Q1EA 1YU9A 3FGNA 4Q18A 2PBRA 4YMTA 3THOA 2XEXA 2CHVA 3RLFA 3RS2A 4AYWA 4GL2A 1TPZA 5HZHA 2QP4A 3T5GA 4PO1A 5KHOC 4ZDKA 3IO5A 1O87A 1SVMA 5DGXA 3VFDA 1G7CA 3B8HA 1IJEA 1GIAA 4W7SA 4XSGA 1UBFA 1G41A 1N25A 5JRZA 1NKTA 4NYJR 4GP6A 1ZRHA 2JLWA 5FL7D 4HUQB 5H1YA 2NZJA 1GL6A 3QY0A 4TYQA 1W4RA 3QVVA 5J4LA 4IFEA 3G0HA 4O2LA 5AUNB 4NYIR 4MRSA 4HAYA 1MO5A 4XOIA 2OZEA 1E9EA 4Q1DA 2Z43A 1DO0A 4IOMA 2O8EB 1U9IC 4H9GA 4OHZA 2Q3MA 3VHXA 4WXRA 1NIJA 4CEHB 4Y0VA 2CL6X 2WZQA 2NMVA 3KTAA 2B21A 3FYHA 3X1YA 4MH0R 4B71A 3IBYA 1DAHA 2LCFA 4WIAA 3REGA 4LX0A 2OCPA 3NC0C 3SHWA 2FJUA 2JCSA 3FHOA 1AQYA 3EX7C 2ZE5A 2GA8A 2UZ3A 1NLYA 2WPDA 4AKGA 1AA9A 5KTYA 3QEOA 2CK3D 2ZJOA 1SVLA 1W2GA 4HUQA 3P4YA 4MGIR 3U61B 4B75A 3UMFA 4S2EA 4E03A 3UXMA 2FFAA 3O47A 4OBEA 2ODNA 4KU4A 4UXIA 3QKRB 2O8EA 2NPIA 3ZS8A 2XOKA 3FB4A 2WBLC 1XJQA 4DDUA 4CEHA 2WSSD 1NL3A 4M0LA 3GMTA 3UMRA 4C0HA 2Z4SA 4R9UC 5KPDA 1TU4A 4LOAA 4WBSA 3QIAA 1YZKA 5FI1B 1W0KA 1M8PA 2F55A 1JEEA 4B3FX 3KB2A 1NBMA 4LJ8A 4NL4H 4B2LA 2XZPA 3IBGA 4KODA 1XBTA 3KXLA 1XTIA 2QRZA 1CJVC 5EJEA 1CXZA 4IKEA 2ZRLA 2F1HA 3NXSA 2ZQ5A 1KI8A 1CF4A 3HWSA 3QKRA 4KCGA 4Q03A 1HQCA 1DOAA 3VR3A 2N42A 2RHMA 4ERNA 3MAAC 4DT1A 4FXPA 5AK0A 4G1UC 1P2UA 4HB2A 1W2HA 1E4YA 2A3RA 2ZYVX 3AB3A 4FN5A 4I1SA 4HAXA 1Z0JA 1JBKA 1NBME 2C9YA 1DAIA 4NTZA 3OEHD 3PCRB 2DFTA 3LX5A 2QY9A 2FGKA 4A0GA 4NZYA 5HTKA 1G5TA 3ADKA 1G5PA 1WB9A 4PAQA 1OHHD 4A0RA 2GCOB 2OUKA 3K9LA 1GTVA 4TMVA 3NBFA 2BBTA 4GOKA 4LHZA 2JATA 3G82C 3DMNA 3QXXA 2PX0A 1GKIA 1N2CE 5FPTA 4DLVA 4LWZA 1OXXK 4BFYA 2G1JA 2IHBA 2Z4RA 3FKQA 2W58A 4KI0A 3ICEA 3VMFA 1Q0UA 4M1WA 3ZZ0A 3GQBA 5HZKA 4XVUA 1MO6A 1I4TD 2B6HA 3LAWA 1P9WA 3N2EA 4YMWA 5JSZA 2DWQA 5KUTA 2IYVA 4JLKA 2B8WA 2J0SA 3HJNA 5AWFC 5H8WA 4TYYA 3DDCA 3GFOA 1HE1C 1Z07A 3MWLA 4QBHA 1LF5A 4KAXA 4IDPA 5EZ6B 2GBLA 1BYIA 1M1YE 2LKDA 3C5HA 3K53A 1AN0A 2BMJA 1KO7A 4PHTA 3DMDA 3UK6A 1UF9A 5LPNA 3F5FA 1E9AA 3QOFA 4NE2A 1BOFA 5K8IA 2BJVA 1TQ6A 1U99A 4DLWA 2FPLA 2R6GA 4JMPA 1KY3A 1P60A 1ESMA 1EGAA 5CB8A 2QMHA 3PFIA 2XB4A 3GJ0A 1NNEA 3O8CA 2PZFA 4JLNA 2L0XA 3QSYA 3MMPA 2P5SA 2QT1A 1NI3A 3LDAA 3QJYA 2QU8A 3H0KA 5LD2C 2IXGA 4B3DA 2V1UA 3UWKA 1WMSA 1AZTA 2HDNB 4UNQA 5CLLA 1XZPA 2GEDA 4XWOA 5FBRB 1QDEA 5FTNA 5BN5A 2KSQA 4C0BA 1F48A 4LC1A 1D6JA 4W5JA 1U0JA 1XRJA 4NYMQ 3TGPA 1OFUX 3HYRA 1E79A 2WJGA 3AVWA 3W3ZB 2RGDA 4HDQB 3ZVLA 3HP1A 4IJMA 3VX3A 2JEOA 4CT5A 1JXMA 3VR5A 3OEED 4RCZA 1VIYA 1XMSA 3QPWA 2N1BA 3L0OA 1FL9A 3PXGA 1U0LA 2RMKA 1R5NA 1Q1QA 3A1TA 2AD5A 3FMFA 4LUCA 1Z83A 3AVYA 2V6JA 2VP5A 3SEAA 2YVUA 3MWJA 4A2PA 2C77A 2D2EA 5JFGA 3AP2A 1M34E 3H1TA 3GJ8A 1XB2A 3KUCA 1BIFA 1COWD 3I92A 3KB1A 2HXYA 2ONKA 4FINA 1DS6A 1TQDA 2MSDB 3PQCA 4MYTA 4Q9HA 3P1JA 1P5ZB 2ZYTX 2CBZA 4BWYA 4LV6A 5D3QA 4R71A 4RZXA 1KAGA 2GF9A 4KLZA 4ZO4A 2WIBA 1E9RA 2IYRA 2J46A 5JI2E 5SZIA 4WXPA 2C9OA 1CJKC 2GCNA 2ZRKA 3MWKA 5IK2A 3K0CA 4HI0E 1T91A 1VG1A 4KXFB 1CR0A 3UANA 1G7TA 2J87A 4WVFA 1M7GA 2ORIA 2OO7A 4NH0A 4GMDA 2P6NA 2Q6TA 1GL9B 1XXHB 4RZUA 5EUMA 4EDHA 2HEIA
chains in the Genus database with same CATH superfamily
3GELA 1JQLB 1UBLS 1ZPDA 3HU3A 3E81A 4IH1A 4WDQA 3TTSA 1SXJB 5KQGA 2BE7A 2JBWA 4O4LA 3D59A 4QG7A 4ZQCB 3ZNOA 1EUYA 1TT5A 2F62A 4DCTA 3EVFA 4AY3A 1MB3A 3OO1A 4W7IA 3ZDAA 1W1UA 5I7OA 1H2WA 3AR9A 3JQCA 1KE2A 3C6BA 3W6NA 3VTKA 1RLMA 4LQCA 5BW4A 5K0ZA 5HQ3B 3CIFA 2CHGA 5CFNA 5J9FA 4BGUA 3KALA 1EVLA 3Q0TA 4F1JA 2YZ2A 4ARCA 4P2GA 2ZUFA 2ZANA 3ZKWB 1N6NA 3OT5A 1EK0A 3F8TA 4TV8A 4PZLA 4YJ3F 1VYVA 1QR6A 3S7TA 1ZAYA 1E59A 3KEFA 3OTGA 4ND1A 2GYUA 1F1BA 1PU2A 2XTAA 4B1FA 3SBEA 2C5SA 1NQ5A 3MB8A 5DNCA 5JSKA 4YP9A 5EFOA 2X77A 5SICE 4C5BA 5IUJC 1JU3A 1TKRA 1UT5A 2FMFA 2ZZKA 4GRAA 4UJ3A 4KJZA 3WL4A 3F98A 4JR2A 1ZN7A 4Z49A 1ECBA 1ZMTA 4DLXA 1K7YA 2PZ8A 4JC0A 4ETIA 1HORA 4DJFC 1TNDA 2B4RO 5A7HA 3TS1A 3MM4A 4ZZ1A 4G56A 4DCNA 4MQMA 1QO9A 5EERA 3DVAA 3L7YA 4B3CA 4CCSA 4P83A 1A9QA 1R4ZA 5CLQA 3K9GA 1NYTA 4RFLA 2WJVA 3LP8A 3ROEA 4YRTA 2EZUA 1ORVA 5IFKA 2QJFA 1ZX1A 3I2IA 4D74A 4A92A 1JHUA 1SHKA 4E94A 5DNAA 2FTKE 2H52A 4XD2A 4J0KA 3IEVA 3AV3A 2OXCA 1KP3A 1ISRA 1JFFA 1FFBA 1WMDA 1WZNA 2X4IA 4RVOA 1AIPA 3ZWPA 5KJFA 3HCWA 3TM5A 2CZQA 3HH8A 4HDRB 3QU5A 5KVSA 4X20B 5DGDA 3KUUA 4MKZA 3DFFA 5CA0A 3RC2A 4KIJA 1E9CA 3HDJA 1P3JA 3RK1A 2OD7A 2FN8A 3IPXA 4I6JA 1SXJE 1ZQ9A 4NYMR 2X1MA 3M7IA 1MHPA 4Q24A 5FKJA 4CM9A 4G4GA 1BD4A 3VNVA 2QVCA 1EQ2A 2OKCA 3N8HA 1UPAA 1WCIA 3LT2A 5CH5A 2IYYA 4UASA 4CU5A 4B6SA 4WQMA 1E5VA 2VK4A 4RDHA 3EEFA 3C5EA 1IBMB 4F3NA 4WXHA 5BQPA 3DM9B 2HJGA 2W71A 1E0AA 4DSNA 3HL0A 3OPMA 3ZD7A 2H4FA 4ZWNA 1M0TA 1OAAA 1K6IA 5G3ZA 3H0EA 4QPNA 5AH0A 5E95A 1NP6A 2WU1A 1WA5A 2F1JA 4CM5A 2FOXA 4COKA 1X80B 3T8YA 3AM5A 1R0YA 2C98A 4MVXA 2E82A 3U7GA 3O4IA 3LRXA 1APBA 1O5OA 3EJWA 3H5WA 1RVV1 2W43A 2P30A 4JL6A 4O1MA 2EJVA 1CEQA 3DBLB 3HNOA 3L0CA 4OUDB 3WISA 2AQ8A 4D02A 4II3A 1ENYA 1ECGA 4K6KA 1YIOA 4WOPA 2HI0A 2H2GA 3VNRA 2GM5A 4KOAA 3HFSA 1AXEA 1TC1A 3JASB 1X42A 3I52A 1UBKS 1ITZA 2C1XA 2L42A 3KV3O 4FLFA 2VDRB 4WK0B 4KRFA 5FWXB 1BE6A 5DNVA 3G3EA 1SCAA 3T5MA 1M7BA 3RFCA 3OIVA 2B69A 1I4OA 1LJUA 1DFHA 1ZINA 1WG8A 2AJBA 4KQJA 4FGZA 5CIYA 4ZKEA 8MHTA 2F1OA 3NP9A 2YFYA 3DHVA 3PJDA 5AKHA 3RRMA 1G1AA 1GDHA 2IY7A 4N65A 3WRVA 1WXEA 3W1WA 2QN7A 1EUCA 2HA7A 2W98A 3L01A 1B6GA 2F7SA 3I4LA 3HM9A 2ZWOA 2MSNA 1OC4A 1T0JB 2FWJA 4PLCA 4Y9TA 3QYPA 5SV2A 4BE7B 1IN1A 1G21B 1T3HA 3ET5A 3KXPA 4I19A 2PJZA 4OUKX 2CK3A 5BSRA 1OXTA 3C6YA 3RG2A 4BLUA 1M67A 1E9VA 1O0SA 5CYFA 3RS5A 3KJIA 5EPUA 3PLAE 4BXOA 3B6EA 1THGA 1G8SA 1MABB 2IXAA 4KITB 4GPAA 4JR1A 4D45A 5LZ2A 3UK7A 4JEMA 1M1NB 1N5OX 1RTTA 5IHPA 2ATVA 2R3SA 2XDWA 2PLNA 2FK7A 5ETJA 2F3UA 5K8VA 1U3UA 3K96A 1DQSA 3IR5A 4PYOA 3DS8A 3UC9A 2D8AA 4ABYA 4NZMA 1PF7E 1XQWA 4OTZA 2WWVD 1A4IA 2X7XA 2YRXA 3DBOB 3QLUA 4IGAA 5K3EA 1BMTA 1CUVA 3EW7A 2BFEA 1L4NA 2YHBA 4TUYF 3EEIA 4C78A 5BPFA 2GJKA 4MV8A 3R7WA 4DTIA 3DCNA 6CHYA 1QORA 5EUBA 3T7SA 2E9SA 4WESA 2AOTA 3UOGA 4LJSA 5JS6A 4GR9A 4YAOA 4S0ZA 5IVIA 5ALXA 1A5TA 1BXKA 3TSYA 4HH3C 1XJ0A 4G89A 4I4LA 5DZSA 1ZHOA 1NV9A 1WPGA 1ISFA 3GLGE 4P3OA 1TK2A 3KJQA 2AZXA 2REXB 2H51A 3L6CA 2QJTA 5EZYF 1Y9DA 1LFAA 1I51A 5I6DA 1NNI1 4NRDA 2C3UA 3E2MA 2YWBA 4DVJA 3WAGA 2JIRA 1Q20A 5ALHA 3AYXB 1HO3A 2DUWA 2QN3A 5TX7A 4MICA 3IUMA 1CDOA 3DOOA 2ACKA 3ZNPA 3WK4A 5THQA 1ZVQA 2WWRA 2CXTA 2ZRJA 1GR0A 1WCXA 3A6EA 3P9XA 4LV8B 3DZDA 2R8BA 3FYTA 3EVCA 3FFXA 4CETA 4FM9A 1XAHA 5CGZA 2F9MA 1H5QA 1G21E 2ARKA 2R68A 3TUIC 4BO6A 2AIRA 1KXJA 4BB5A 4YJFB 3O8DA 1E8DA 2GM4A 1EBFA 3A05A 3D7SA 4QPZA 4INZA 3P2OA 4ABTA 2ZLBA 1C3EA 3I58A 2HIGA 1TA9A 5KSWB 4M2LA 4DNOA 1GCIA 1C1YA 4G5QA 5B1HA 5KJEA 3U62A 3IFSA 4ZYXA 1QMPA 5P8WA 5BNIA 5AHXA 3T52A 3OTIA 2QUBA 4C14A 2YWGA 1K2WA 3HY4A 3EGWA 2ZWAA 4JQCA 4RF4A 4NEHB 4I3HA 3YASA 1DHTA 3FG9A 1U6IA 1LK0A 4ZEWA 1Y7LA 3D6UA 3IHKA 2VF8A 3VC7A 2NNLD 4GZMA 1XRRA 3DXZA 3X1MA 4N6NA 2BGJA 1AS0A 4IEEA 4YMLA 4QDOA 2E18A 5AJUA 4F72A 1W73A 2XAAA 3PD7A 4GOXA 3ZDXB 1U11A 5IH7A 2QOEA 1WOMA 4RYLA 3PX7A 3QFTA 3WWEA 1J20A 4MQEB 1MZPA 4DIFA 4EW3A 3VSCA 2G63A 2A9FA 2XMPA 3B89A 2X1VA 4M22A 1NMXA 3U9SA 4UBIA 3RYHB 2V03A 4PG6A 3EQ8A 4BAGA 1RWNA 3L2OB 4CKWB 5CM2Z 4IYJA 4RTOA 1I3MA 2ZJ7A 4ZPXA 3SE0A 4YJHB 1P2TA 3EWNA 4LDZA 1QQ7A 2OM2A 4OXQA 5FTMA 3KLMX 1FX0B 2IU0A 1UBOS 2VJBA 3PUVA 3ONVA 4OJQA 1C1XB 4QYSA 3ENVA 1MA0A 3ND6A 4MINA 3ZXYA 5HUJA 2ZRNA 2FRDA 4FKZA 4D9KA 5IF9A 4HCJA 3UM9A 3KKMA 5EWMB 1ES9A 2P4QA 3KEGA 2HBZA 2GB4A 3B2EA 4HFRA 1QLWA 1OFGA 3ELDA 4HVLA 5IJWA 1Z2OX 4TS9A 1MGOA 3BD9A 3PHIA 1TUIA 3EC7A 3TXXA 3P0IA 3BXFA 1B6SA 3CR7A 1T4DA 1YZVA 4J16A 1U90A 3IXLA 4Q82A 4TSKA 4W1PA 2WZDA 3W8RA 3A4VA 2BGTA 5E7IA 1J2YA 3I0NA 4AZ3B 3T7KA 2ZSKA 3CEHA 4EL0A 3TQOA 4F5WA 4F11A 1ABEA 4IVRA 1AUVA 1GGFA 4FNOA 5K2MA 3J80A 3AXTA 1OY1A 1O89A 1PE0A 2V97A 1N3BA 4UE2A 1IRIA 4FGWA 1SCQA 3KSDO 2EL7A 3M6IA 5FADA 1U7XA 3ZLVA 1Y1SA 1SIWA 2R4QA 5KJCA 3H1FA 1KIFA 4FOSA 1QKIA 1P4JA 5IU6A 4GYWA 3P0EA 1FNBA 5ESRA 3X1KA 1FP7A 3QRWA 1YKFA 1HOXA 4GUAA 5M3BA 1T5TA 4CLOB 5CDTA 2P40A 4U7GA 2ILVA 3FPBA 1A82A 1LZLA 4IQ8A 4CDMA 3BA1A 1XZDA 1UXOA 3I42A 4Z6KA 4OKNA 1FXSA 1RWVA 5A0FA 2NUAB 4BNGA 1LJLA 3PJEA 3FTEA 2HIAA 3H83A 1PYDA 3GMIA 4TTQA 3V4OA 3H5OA 5JYCA 3SSOA 2ZT7A 3E7DA 1UKBA 1AH2A 3MIZA 4PZAA 3H2GA 1AKVA 5ALNA 3IURA 2GAOA 1A9SA 2YZKA 3EMBA 1NKSA 2JIBA 4D42A 1QFZA 5CDGA 1E5LA 1N78A 5KYNA 2EZ9A 4RTNA 4RQAA 2IXFA 5EY5B 2C7RA 2VT7A 3BXEA 3KQLA 2IKQA 2FP3A 3RFVA 1N3YA 2DR0A 3KCQA 1N1GA 2CDAA 1T25A 2OV6A 2O48X 1JYEA 2XVMA 2ZUUA 1E4EA 3AEKA 3EIEA 3KJHA 4GLOA 5JMOA 5JD3A 5LBUA 3PJGA 3WYFA 1PHPA 4LRWA 4PSKA 2R00C 3MS7A 2QZ9A 4Q4LA 5G3YA 2R1TA 3AERB 1U4OA 3U80A 4BKMA 4ETMA 3PFFA 3UFXA 5SZHB 4GXTA 1GA1A 4LJ6A 1P1CA 3DYIA 2AMLA 3SFTA 4KO2S 2RCYA 4FEYA 3UEOA 4CKEA 3KETA 2XGSA 4KGXA 2OWEA 2GLTA 3G9XA 1ZUD1 1M1ZA 1ZJJA 3JQGA 2DTEA 2P5UA 1LJ8A 1L4UA 1JJIA 1T9GR 1BMFA 1QIJA 1UZNA 1YGPA 2D00A 2GASA 2R8XA 3FKSA 3IBSA 2MOKA 3JW8A 4ID3A 3C3MA 4DLPA 5KYUB 1FF9A 4KYIB 5FOQA 3ZJTA 2OCDA 5AXDA 2QN6A 4LZPA 3UNXA 1NZJA 2QUZA 4YUVA 3D3NA 4QUHA 1YJCA 1G9XA 1ESEA 2GJ8A 3AEYA 5E7JA 5CR9A 4HDMA 1E2JA 4ZP1A 1ATIA 4F84A 3FJYA 1MV5A 2F43A 2GBLC 3FPEA 4LTMA 4UBJA 4V2IA 2P3LA 2VYFA 4U2GA 1KAEA 1JBEA 1KI9A 3JSXA 1VGVA 2WVHA 3FLBA 1NVTA 3MC1A 3N1UA 4MHSA 3QG5A 3UW3A 4LYFA 5KOHB 4CMEA 4ZVPA 1LX6A 3EE6A 3F6SA 3HJTA 3A14A 3IQIX 1IEWA 1L6IA 2R7MA 3SZOA 3TE6A 4F12A 1Y5LA 1ZJWA 4L74A 3E9ZA 2Y0BA 2A1UA 1WMBA 1XZEA 1E3QA 1SRRA 3I2JA 1EUZA 1CBUA 3PI7A 4DRXB 2RH5A 2QUIA 3RC8A 4E88A 4EY7A 3GR6A 2L2QA 2B7BA 3ZWBA 4YRKA 3H75A 3Q40A 3OPYB 5D7NA 4B2IA 4R51A 1R0ZA 2CNWD 2ZRGA 4LC0A 3VDXA 3NV7A 4N6OA 1DJPA 4AI6A 3EDRA 4G26A 2R1ZA 4LCBA 1WU7A 2VEOA 5IC5A 5B1YA 2WR8A 2I1VB 3AP3A 1NC3A 3LFHA 2EJBA 1SQSA 2W0MA 1ADFA 2PVSA 3FI0A 4M0MA 2FZ4A 1U8AA 3COYA 5CPBA 2X22A 1JHPA 3SBDA 1KK1A 4DBVO 4EI9A 3F1KA 2SBTA 2ZRBA 4B7XA 2C96A 1WHTA 3KOYA 2QNIA 4IS2A 1KEEA 1F8XA 3E4DA 4KTTE 1Y5MA 2IP4A 1YR1A 1OSNA 1V5EA 2OBFA 1EK2A 4IXMA 2UUPA 3V1MA 2W6PA 1NN0A 4JWTA 2YDYA 1IDN1 2FKAA 2VF5X 2WLTA 2YCLA 4PYJA 4A2QA 3T1QA 2R6HA 4M1OA 4BBAA 2I4LA 4YLEA 5JIBA 1YI1A 3QMVA 4PLYA 4FSXA 5K3BA 3OZEA 2ZJAA 5ERXA 2FMKA 1HUQA 4QPPA 4IH9A 4BDSA 3N74A 3RFXA 4UUMA 1JG7A 4CIWA 3VR5H 4OFXA 1Y7PA 1W85B 5IVDA 2XBMA 5FFFA 1K7FB 4LFBB 1ACMA 1NRXA 4RF2A 2EZ4A 3U6KA 3HZHA 3F3SA 1K86A 2C8KA 2B1JA 4GLJA 4PRKA 5EUQB 1MIOB 3OD5A 4J0HA 3OE4A 4F85A 3LQQA 1PT9A 3K7EA 3ZHTA 5B55A 2VCHA 4KXLA 4U7PB 1T8TA 5C18A 1KI6A 5LYJF 4D0SA 4LYYA 5LNK1 1CZHA 4IF6A 4IIYA 5AK3A 4A8HA 4BX0A 4CV3A 3S2EA 2GZDA 2W2KB 1RPZA 3MT7A 3SZRA 3SFZA 4LJ5A 5C1OA 1E8NA 2P1DA 5KCZA 3P9SA 2TYSB 1NG1A 1D9XA 1Z6XA 3ELYA 3DL2A 4DV6B 1TMGE 5KYVA 1KI4A 16PKA 1Q92A 3RREA 3WWCA 1UM9B 2FW6A 3MJSA 4AMGA 3V3KA 3OA2A 5D3MB 1OX5A 2VP3A 3DVLA 4TROA 4GRDA 4RQUA 4X00A 3RVPA 2H1LA 4ITVA 4OL0A 5T41A 5CDHA 3R5XA 4I1OA 2UYOA 3GJ5A 2WHXA 4YV2A 1XNGA 3FPAA 1RWMA 4YRZA 5JSZB 2VPPA 3QELB 3V8PA 3LDFA 4OPMA 5TSDA 1Q7EA 4LNAA 4MJ7A 3RS0A 1WNFA 5ADUS 3CW9A 4D4LA 2J6CA 1XRPA 2BRUA 5JPDA 5BY2A 4OQLA 3P20A 3WGUA 1P9RA 1V3VA 1JFVA 1Q22A 4N01A 5LXTB 3T5CA 5C52B 4ENTA 2RI1A 1VGRA 3RTDA 4C4PA 3DBIA 2FG5A 3ZXIA 1I13A 2Q41A 3GT3A 1P29A 2FP4B 4G4SP 3WG9A 2AE2A 4EAAA 4ZMRA 3B9BA 2CJWA 1X19A 3E9RA 2GCPA 1Q1ZA 1ZP6A 5TC4A 3K5IA 4K3VA 3B5EA 4CIYA 4K9NA 1V16B 1VMAA 2WILA 1PQYA 1VZ2A 2FSIA 1DXYA 2C20A 1U8TA 3VVCA 3U4MA 1AHHA 4NQZA 2B6NA 5JWOA 1KARA 4HNHA 3U4DA 1ZOPA 5CU7A 5HR5A 3NHKA 1RXYA 2C42A 1KR2A 1PQWA 2ZSBA 3LWNA 3OECA 1ODLA 1XVVA 2AW5A 3TTWA 3EK2A 3FGZA 3M4YA 1WDKA 2OORA 1X3LA 2FR1A 2J9FB 3OU7A 1YE5A 4H7HA 2PLFA 3BHNA 3TZBA 4DCCA 4EZEA 2VOJA 3OFJA 1QE5A 4N3CA 3GUCA 1NVMB 4JK3A 1KKMA 1P7CA 2CJFA 1CERA 3I0MA 5K0EA 2QQ5A 1WW8A 1K88A 3DLTA 3CKMA 2CXPA 1U28A 4J49A 3AV0B 1RZ3A 4DLRA 3BERA 1ZGJA 1Z4LA 1RLTA 4R4JA 2O5EA 1B42A 2ID8A 4DCSA 5KTSA 4G8JA 3IKJA 1V8FA 3LX8A 4L95C 4BNDB 2JI7A 2FWRA 4QFBA 2QR5A 1QJ4A 4RY9A 3SBXA 3LLCA 3NTVA 3QFRA 5IJ9B 5I9LA 1YT5A 2AWOA 2RBGA 3UG6A 2B30A 4HSGA 4NCXA 4PYIA 5KYKA 3JYLA 3D4IA 2GVDC 1UXHA 1VL1A 2HWWA 1TJNA 2ZYHA 3PEEA 3T7CA 2OHJA 5KPJA 9ABPA 1FUYB 2YRFA 1M8FA 1OYVA 3W3AD 3GLIA 2H1WA 5DO9A 4PZPA 4NHOA 3FDZA 1YVRA 3AUTA 3C39A 1XRNA 1IBCA 2VHTA 3JZFA 2NVUB 4F8YA 4ZCLA 5CD9A 4H2DA 1FBTA 4LAFA 3TIFA 1P62B 3C8DA 2ZU0C 3RJMA 4WOKA 1VE5A 1R0XA 3FMGA 4MDYA 4OLJA 5DHFA 5TGDA 1U9IA 2NU7A 1DC3A 5LB4A 1VXRA 3WYDA 4LRTB 1RWBA 3TTXA 2PS3A 3VU9A 4AMYA 3KWFA 2MMCA 4RPKA 1O3YA 3LNCA 4LK3A 2DB3A 1Z8FA 5TQ0A 3A0RB 4TXHA 1C0PA 5KAMA 3RSHA 1A0OA 4LVUA 3WGMA 2FG6C 4LMBA 1XI2A 1CQIB 4BLQA 3GWGA 4P3PA 3HACA 2NUPA 2E6KA 4MHOA 1C4WA 2I3ZA 3GN1A 1C9KA 3ABIA 1X0VA 5BOSA 4L5IA 2P79A 4HR7A 1D2RA 4OXKA 4WZBA 4BAZA 3THXA 1L5ZA 4W1SA 5I4IA 4ESOA 3PSHA 1RM4A 1T35A 3RRJA 2A0UA 1NMSA 3LWBA 3D8BA 3W7VA 4DR4B 3IA7A 4U1RA 1BCSA 1JDVA 2OVBA 4E4YA 1X1AA 1YBFA 4RWZA 5C7YA 2JZOA 3X3HA 1ZNXA 1Z8HA 2V7EA 4K8RB 4DA9A 1O7JA 5LMZA 2XJ4A 1U3CA 1V39A 1QIEA 3HVJA 3H5TA 4KK3A 4IZHA 1JQKA 1RYNA 2O05A 4ZK6A 1QO7A 1FDWA 5FRDA 4ZTZB 5HIKA 1YULA 1YXMA 3PGVA 1N7GA 4MW6A 4PIVA 4ZQBA 2ZE7A 3CIOA 3O2SB 1AGRA 1R74A 1NX6A 1U2DA 1FEZA 1ADJA 4MI1A 5EESA 3KR0A 4YV7A 4B6GA 2SCUA 3SC6A 5LOVF 5JI3E 4CV2A 2QSZA 3UXHA 1JLKA 5DIFA 2DVMA 2IEDA 3WGIA 1RYYA 5CNKA 2WKQA 4LF5B 2W9XA 1UQRA 1PDWA 7MHTA 2NU6B 2ZB2A 3NUZA 1Y4DE 2WWGA 1LW6E 5E0KB 3VU3A 1UT8A 4ALIA 1N33B 4R1PA 4AUKA 3FDFA 4QGSA 1N8SA 4ZI5A 1GQYA 2FI1A 2AR0A 1KFJB 1XEWY 4R6XA 4U5XA 4WERA 4ZV7A 5BWBA 4C89A 5AK4A 1LWNA 2VA8A 2FYTA 4ZC8A 1GQFA 4CXMA 3K35A 3PHJA 4QELA 2JGAA 3HJAA 4UAUA 3AUUA 1OD6A 1UAGA 2K4MA 4BEBA 4DMLA 4G0UA 1ONNA 3MBKA 2BM0A 1K3TA 1RLOA 4N9WA 3L8EA 4XVHA 1L5GB 4D7AA 6NULA 4ND6A 5KINB 2C7BA 5E7MA 1GGVA 1QUFA 1KMHB 2DFNA 3ICOA 2GSDA 4BFSA 4E0BA 1IIBA 5B58C 4AG6A 2IW3A 5BNWA 2ZUVA 2VNJA 3BWEA 1N6KA 1P7VA 3NI2A 4ZI7B 4PZ9A 5ALKA 2HSJA 3RHSA 5JAIA 3B1XA 2VJQA 3BSWA 1IY9A 3PE4A 4PZ0A 3F3YA 5DLYA 5E8JA 5EUCA 1T3ZA 1QLHA 4E5YA 1Q12A 3EDMA 3E05A 3RAPR 3ZE9A 2C8JA 1FDTA 1S8OA 1AU9A 4KYVA 3EC2A 3TOXA 1CQPA 1GVNB 2JFPA 2QRJA 4P33A 1CUGA 4H17A 3OWOA 4X1IB 5AKIA 5DIZA 3WJAA 4AY4A 1XTPA 5HFAA 3VNSA 3P4UA 1HYQA 2AFRA 1LV7A 1Y3BE 3EG9B 4CHGA 3I61A 2O1EA 4UMDA 2QRGA 5EXSA 2GHRA 1TKAA 1P45A 2VPIA 5CFRA 4AKTA 5E7QA 1RTKA 4KWIA 4B5KA 1ZGZA 1IQ0A 3TBHA 1I8TA 3ESRA 4EY5A 4DCPA 2AF3C 3T0IA 1X0XA 1KWKA 4O5AA 3CRVA 2G88A 2QBYA 2QRVA 4L78A 3ZY6A 4M1YA 5K6RA 2WRZA 1GXSB 1PBNA 1JKJA 2BKEA 3AI1A 1YV9A 5ANRB 5IJXA 2WKRA 3CUYA 3H2ZA 3UMBA 3MT0A 4LRQA 2FWIA 3RTBA 4PSDA 1R88A 2WFAA 3OMXA 4HVAA 4LV5B 4RD0A 4UCFA 3WYBA 3GDFA 3K2BA 4QOSA 5JJLA 3A6FA 1RXVA 3D2CA 3ZWNA 1JQDA 3BZWA 3TGWA 4WCFA 5D51S 2JHFA 1MB4A 3ROGA 4NENB 4BBPA 2RAVA 4H0NA 2ZU6A 2LIPA 2ZUBA 5FCDA 4KPYA 3RYCB 2HU8A 3H18A 4IDOA 2HT1A 4AWAA 1JZQA 1QVAA 3ANXA 2HLDD 3VU1A 1FJXA 1GGKA 1WXGA 2V96A 2ZSUA 3M2PA 3SS8A 3TDKA 3H11B 3H4MA 5BSVA 4Y1EA 4F60A 3UHJA 1XCJA 4QM7A 4L0DA 3PQ3A 1OXSC 4Y2QA 4C1BA 3KKEA 3OKPA 1H22A 4MRVA 4NBLA 1E2GA 1RQXA 1XTZA 4RD2A 4TXJA 4YRFA 4ZCMA 1BNCA 1YRLA 1UWLA 2F4VB 4U00A 2MU1A 4X1KA 1GZUA 2IGTA 4ND2A 2PBFA 2MSCB 7AT1A 4A15A 3MTQA 1XJCA 5D1HA 3ZHOA 2XUDA 4BGDA 3IIIA 4MUGA 3TTTA 2O2EA 1MF7A 4LNUA 5ES3A 3HVRA 4Q1CA 1T29A 3GPCA 2RJNA 2O59A 4IP0A 4B76A 3WYEA 1KK0A 5CXSA 7GPBA 2WB4A 1Y8QB 2ZWMA 1HDGO 1NBMD 5CXQA 1U63A 4TRRA 1BGWA 2FWAA 1WB6A 2GTIA 4PAOA 1AQIA 2BR4A 4GM1A 4FD2A 5LP6C 2XLBA 3PRYA 3IAM6 4XW2A 3EA5A 2P0EA 3N8IA 2HTEA 1T6XA 3PVCA 4U6SA 1CYEA 3REQB 3ETJA 3ASUA 3WDSA 1K8ZB 3Q7EA 4Y2VA 3S2FA 1RXIA 4BO1A 2QJRA 2W2QA 1SA0A 1WW2A 3KSMA 4WKBA 2LCQA 3I6QA 3MF4A 1XLTA 4JLPA 4DR5B 4XB2A 4F6RB 4TKVA 3LPLA 2G6BA 3EH2A 4KUHA 1T2CA 5B1DA 1U3GA 1NVFA 5DLDA 1GRQA 1ID8A 1PR9A 4I3FA 1AA6A 3GJXC 4UM9D 2R86A 2DLCX 2ODWA 5KZMB 2M98A 3GFBA 4MLZA 1OQAA 4HZGA 5FUVA 1GQ2A 3NEPX 4P2BA 4D4MA 3J81k 3BJZA 1FQKA 3MRSA 5BUCA 4CIBA 4US0R 1VE9A 4L9WA 4KQ2A 4GC5A 1QFJA 3UIEA 1DFIA 3NS7A 1BQ3A 1CY0A 2O7RA 3G5AA 4QTXA 3GOHA 4O2BA 2P9ZA 2BZ1A 5FPQA 1QH8A 5C1DA 2BONA 1XV5A 4Z9FA 2WTMA 3N7UA 2Y1CA 2BFDA 3M4NA 5T8KC 2OZLB 2VTVA 1SC4A 2WFLB 3DE1X 1GCOA 4NOMA 5KDLA 3TD6A 4BVFA 5DX8A 1U7OA 2OILA 3T3PB 3E3NA 3E70C 3IL2A 1RPTA 5ALUA 3KJFA 1N8KA 2Z3VA 1IUNA 4IDNA 4O4HA 2VJAA 4KKXB 4UCWA 5U4XA 4HN2A 4HMOA 2WG1A 1WV1A 5C8ZA 3RTEA 2AWNA 5HJ5A 1CEEA 3OPNA 1B76A 1FVHA 2DHCA 1WUKS 4M8KA 4YGXB 4ZO9A 5LKAA 1WUJS 2NO4A 2Q9UA 3OZGA 3TINA 3W05A 3WLMA 4OBBA 1L5WA 2W6MA 1L7BA 3WYAA 1UAAA 4GBED 1J1ZA 3P26A 3GPLA 1XQYA 2C9MA 4WZ6A 1WTCA 1JA9A 3GEEA 1HTTA 4KE9A 1X39A 1N5JA 3IGFA 4TV9A 4D8UA 1A5BB 2LBPA 2PGAA 4F96A 4JC4A 5ADWA 1D7AA 1E6CA 4CM4A 1WPQA 2I8AA 4M0EA 1WZ2A 1OLOA 1RIIA 1YQTA 2PM8A 2V7WA 5KU7A 4PGGA 4DIDA 2VSFA 4I9GA 4GSYA 4RF3A 3ZCPA 1U8YA 1PT7A 1EX9A 3MTJA 3OIWA 4QFMA 5FPKA 1S2NA 3VZDA 2WZBA 2GM3A 1PS9A 2M6SA 3JZDA 1FVOA 5K4HA 4UU1A 3TMYA 3U7JA 1EXWA 1DO2A 5TDHA 3LCCA 5LP6F 1ICEA 4ZYYA 2H1FA 5UKDA 2ZM6B 5EP4A 1J49A 4UULA 1J7JA 3A4NA 4IYRA 4ZYWA 4ZVOA 1PCXA 5E9WA 1GPYA 4ZCQA 2R79A 4WMLA 3OIFA 5T4EA 3EJ6A 2YJZA 3C48A 3CZCA 2YMLA 3MUFA 1D0VA 4G9GA 4GNRA 4RXMA 4N49A 3UGJA 1E9BA 1U4NA 2PKEA 4WGFA 3J7TA 5B36A 3SJBA 1JAXA 1O96B 5EXTA 4EQ6A 5K0JA 1BW9B 2I1QA 3ETLA 3ORSA 5REQA 5E3HA 4C43A 1IZZA 4EL5A 2R8RA 2WUFA 2GPTA 2P9BA 2PAAA 3NHUA 2VHYA 5HVNA 4D9CA 1QIIA 2PANA 4XWKA 1YFJA 2J59A 5HDBB 3VH3A 3CVUA 4DUYB 4YMSA 2PRJA 1RFLA 1G9SA 3PJRA 2X0EA 3M5PA 5F2NA 1OA1A 5BSUA 3II6X 4FYMA 3ZQUA 3KDAA 4H7EA 1FQJA 3NWOA 5C31A 5IYZF 1T1GA 2IEBA 2DYKA 3DYBA 3C3KA 3CUSA 4Q6WA 5CH3A 1MFPA 4E30A 4PO3X 3RE1A 1N6OA 4ZYLA 2RARA 3H16A 3K5WA 2UXBB 1RJ9A 1E3SA 1U3FA 4L02A 4A16A 4F3RA 1LLQA 2O9JA 1YDWA 2PVCA 5EQDA 3T41A 1S9DA 1I2ZA 1DKLA 2PZEA 1DU4A 3L7CA 4K87A 3JR3A 3GD7A 5E4JA 4JHXA 2IOYA 4CM8A 4ER6A 3KOZA 4HB0A 5B64A 3FWZA 4HOYA 2OYCA 3W3AA 4AL4A 2V4ZA 3EUWA 3BTVA 3JXEA 3PUXA 2OENG 3C41J 3LDGA 2VVTA 4HDNB 4MCHA 3T3MB 2PKXA 3ZVKA 1DUSA 3DD5A 3IKTA 1KFCB 1P1KA 1VL5A 4X0EA 1IMJA 3WRXC 3EPRA 5EE9A 1BKDR 4I36A 3W79A 3L02A 2GZAA 2VQSA 3MMNA 3Q3VA 4QNNA 5JT1A 2HCFA 5TE9A 2NTYC 1B26A 3L0BA 5BP7A 3M1YA 1FLNA 4YDRA 5IK2D 5EHIA 1MC8A 2D62A 2EHDA 2NVOA 3O8NA 3TNDA 3UB2A 2JAOA 3TW8B 4X65B 3DAYA 3PNVA 4RL4A 2BT4A 4E13A 4RDCA 5E3IA 3C3YA 2PMCA 5FA8A 4CBVA 3D8RA 4KDEA 4YCBA 5TJ9A 3LX4A 5FLKA 2AVDA 3TKYA 1A3CA 2ADMA 4CCYA 4OK3A 3SWWA 2IYZA 4ESVA 1FSPA 2PL9A 4OH7A 4OHBA 5A4KA 1W6RA 1GQQA 1XD2B 1GPUA 3LVQE 1RXUA 3CLKA 1OOEA 1QHIA 2WAAA 5IW8A 1Y98A 3C3XA 4KZKA 4QXOA 3PFWO 4II2A 1YQDA 3LSYA 1A97A 1M2JA 1G8HA 1Z12A 3WGYA 3WLTA 1Q3TA 2CXQA 1MB0A 4DEVA 4IMPA 4RAQA 2XT6A 3R75A 1PSZA 4R9RA 4EHLA 1FE8A 4MO9A 1BEEA 2BTQB 1VPVA 4YPFA 2ZI9A 4OGFA 5HJEA 5IVHA 2JA1A 4C3OB 5CYPA 1DNPA 3C74A 4RFSA 1OH7A 2GJSA 3URKA 2WYUA 2P9TA 5E3JA 1J90A 2CW5A 3AY6A 2TRSB 1O0BA 2BISA 2GWRA 1KC1A 2XVAA 3GLSA 3N05A 3QMPA 2MCFA 3ANTA 4GLLA 4MUYA 2YIDA 2JBHA 3AUJB 3BWDD 4X97A 3ZK8A 4UPDA 4A0QA 4OFZA 2IIPA 2BGLA 2ZDQA 4UFNA 2ZPTX 4DA7A 4U7DA 4BGVA 3IP8A 4FB5A 3GJ4A 4TT8A 1SKQA 2UVPA 3WGVA 4EF5A 1O9BA 1XD9A 3I5AA 2Q3CA 3TTYA 1KVTA 1H65A 2Q6LA 1B0UA 5EP1A 2O3QA 3IP1A 4ILKA 4FYYA 1WM1A 2UXCB 4J03A 4OK5A 4LJRA 4RGVA 3RS4A 3OTHA 4G9BA 3OKAA 5HILA 1CUCA 3UFBA 1J9EA 4AQDA 4OAOA 4IDFA 3KWJA 2FUEA 1TK9A 1KNXA 1TF2A 5DSTA 4HQFA 5A5FA 5JHGB 1JQJC 5E2IA 1KTIA 4HZUA 2C61A 3LPNA 3UWSA 2J5XA 4RTJA 1CE8B 3JQAD 2XCRB 2GJAA 1RM3A 2G70A 3QPDA 1TYZA 4X54A 3TOSA 3WHPA 4OU4A 4S1OA 3T34A 2IHTA 1F60A 2NQ2C 1YZLA 1BD3A 1BGVA 1X1DA 1B4DA 3FVRA 5CHYA 3B3GA 2FQWA 3BMCB 3N5CA 3GJ6A 3W0LB 4D9MA 1S8FA 1GTG1 1LA2A 2VPTA 3ZHUA 3CR8A 2ZRMA 1TVEA 3VOTA 3OI7A 3E0XA 4A9AA 1H8ED 4LRYA 3R0VA 4R16A 2Q1WA 6GPBA 1GNSA 1M8KA 2DUMA 2QROA 4IH4A 2X5OA 4PYNA 4RVDA 3BGWA 3L1KA 4M7PA 3SQMA 1GM5A 1C7JA 4YXWA 2CDCA 4UEJA 4OY3A 3OQNA 5AM3A 5JRDS 1MUUA 3JVUA 2PSJA 1VJDA 4NWIA 5DYWA 4NJMB 2W8ZA 4PNZA 3PDIB 5CJ2A 4DMUB 3MCZA 4RLQA 3OQJA 2DR2A 3TLAA 2B34A 2Q1UA 4X6UA 3RARA 3NIWA 4EO9A 5B4UA 3URMA 4HAVA 3UWOA 3I9JA 4L28A 4HRXA 4JI1B 2B5VA 1KO4A 4PWZA 1KMIY 1QBKC 2I1WA 2P0YA 2XDQB 3D5EA 3N2NA 4US2R 1ONBA 3ESCA 3KOOA 2E4AA 1DTEA 1EVKA 1ENPA 1XMPA 2O4CA 4ZAFA 3TRDA 1HQDA 3WNCA 4YQYA 4AO8A 5F9FA 2YV2A 3DMPA 4WEQA 4A6PA 1ECJA 3IE2A 1IXSB 4H3SA 5I9SA 1RYDA 1K63A 2EG9A 5IASA 3PHLA 5C5DA 2GD6A 1RI3A 3MFQA 1GPH1 1XHLA 4M7RA 4FCVA 1LPSA 3EHDA 2OYSA 4XUEA 2FDCA 1UC5B 3L4BC 3UGKA 1WR8A 4MSUA 3DOEA 3IRUA 2DG2A 3JAWA 2GD2A 5LVAA 4TZ6A 2CNLA 2A7QA 2G0TA 1NVXQ 2I2FA 1AXGA 3LS2A 1G8KA 1UH5A 1WVIA 4PXSA 5HX7A 1E98A 1ZH8A 3IBFA 1J2TA 2A4KA 1Z28A 3ZNQA 1EUDB 1RBQA 5BSEA 4AJNA 1PW7A 5B3JA 5LN1A 2HLDA 3WP0A 2JIZA 3TAXA 5J3JA 4N5LA 2QMEA 5DI3A 4K0RA 1N6IA 2VJYA 3QUSA 4R1TA 4F8JA 5C8DA 3K4PA 5AOAA 1SZJG 1PEDA 3AESB 3N7TA 4RY2A 2PUBA 4MUHA 1MNAA 3LUFA 3ZV3A 1VBKA 3MPOA 3FYDA 1MV8A 1V45E 1UC9A 1G18A 4EECA 4EPXA 4PZYA 4I4TF 3KDSE 2I87A 4JSTA 1KEWA 4N18A 3WADA 1FNCA 4LBYA 4RCYA 3FYUA 1AM4D 2DUJA 2WU4A 2KB0A 4ZQEA 2X42A 4NG5A 3S44A 3EFOA 2WJPA 2FZKA 1FRQA 3P9ZA 1M2FA 1BDJA 3KDPA 2BZSA 4Y98A 2UYHA 2WTUA 2I0FA 3NLLA 4KRGA 5CXXA 3AJ8A 3VU0A 1EM6A 1M1YB 1CNFA 2CDNA 1UOQA 3UOAB 2D7DA 1DBWA 1O03A 2OB2A 2ASEA 3WSWA 4R1QA 3CEMA 4MB6A 2PX4A 3B9RA 4KXNA 2FMTA 4Y0AA 1Y1RA 4LZOA 3E8MA 2OBXA 2C2HA