4JVSB

Crystal structure of lepb gap domain from legionella drancourtii in complex with rab1-gdp and alf3
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
170
structure length
170
Chain Sequence
EYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analyses of Legionella LepB reveal a new GAP fold that catalytically mimics eukaryotic RasGAP
pubmed doi rcsb
source organism Legionella drancourtii
molecule tags Hydrolase activator/protein transport
molecule keywords Putative uncharacterized protein
total genus 59
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2013-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jvsB00
1TF5A 3UWKA 1SKQA 3NWJA 3O8RA 3FGNA 5KYKA 4EFMA 1KDPA 3LDAA 1E9EA 4KJZA 2YKGA 3T1VA 4DCUA 4U02A 2IF2A 2XITA 3LBIA 5FTLA 3PEYA 3KXLA 5DN6A 3FOZA 2WMNB 4TYWA 1XFAA 2BBOA 2QT0A 2ZI3A 2C9YA 2J1LA 2CLSA 3CRMA 2CE7A 4JIMA 4UKDA 1QHGA 2A5JA 5FUWA 1XD8A 3H1TA 2ORVA 1CRQA 1NJFA 3AV0B 4DT1B 4OQNA 3AH8A 3ZVNA 5EUQB 1KY3A 3I32A 4EPXA 3Q8XB 1UDWA 1M34E 2CXXA 4Y0VA 2IS6A 2VSOA 3A1WA 2D3WA 2XTNA 1W2GA 3ICQB 1IXSB 1TEXA 5JEEA 5KSOA 1JXOA 3KJGA 1N5LA 1PLJA 3QVVA 3R8CA 2PCJA 4QBHA 1G3MA 2JJ2D 3PUXA 5DO9A 4A0RA 1Q3TA 2GJKA 1EWRA 3KQKA 2VLIA 2VSXA 1I2MA 1H8ED 2ZRCA 2Z4RA 4HDQB 3A1VA 4IKEA 1VIYA 1ZM7A 5FTKA 3NBYC 3RS4A 2ZE8A 4LPKA 1LV7A 3L8YA 4JLKA 4EJSB 1XCMA 4TWZA 1T5LA 3U3JA 4FIDA 4V0OA 4ZCIA 2RGNA 1JAHA 2W00A 4QNMA 4XWKA 2EU8A 2BIFA 3JZAA 4DDWA 1UJ2A 2ZYVX 2OG2A 3RC3A 1VCIA 2ZM5A 1OXSC 3DKVA 3IQWA 1YVDA 4A2PA 3SS8A 5FBRB 2BEKA 1FP6A 3AKEA 3U4QA 3HR8A 4HLUC 2IUSA 3SFZA 3VR1A 3VX4A 5C18A 4YDHB 5EP1A 2FGJA 2GVZC 4LJ5A 1G8GA 4NCKA 5CITA 5FH9A 3O8DA 4LWZA 3FMPB 2IEYA 1XEFA 4CEJB 3MFYA 2ZU0C 3D6TB 1G5PA 5BN5A 2FU5C 3U61B 1K5DA 2ZJZA 4CEIA 4HAUA 1HT2E 2QU8A 4LK2A 1MABB 3DM9B 2NG1A 5AJXA 3KQUA 1BS1A 2Z0MA 2JLRA 1EGAA 2JLUA 4AYWA 4OHWA 5AJWA 1FMLA 2R2AA 3KKNA 3LBHA 4Q21A 4E09A 2F9MA 3ADCA 2CCJA 2F55A 1UBCA 1Z6AA 3K0AB 4B33A 3GLFA 3VQTA 4RFSA 1N5JA 4E03A 3SEAA 4HSEA 2RGXA 2B6HA 2QBYB 1NIJA 4AI6A 1FZQA 4C0JA 4DCVA 2IX3A 4AG5A 2V4ZA 1YZUA 4LJYA 5L3SB 5EP4A 1NI3A 4KO8A 1II8A 4OKSA 4W7SA 3LH5A 2QM7A 4JLPA 1Z8FA 4GRAA 3R9WA 3DPUA 5BQ5A 3C15C 5B2ZA 5J4HA 3CF6R 3T1OA 4QJ3A 4IXNA 4BRUA 3P20A 4MITA 2REBA 2H57A 4Q18A 1SVWA 4DLUA 5EE3A 2VHTA 2NPIA 1Z83A 4PQFA 2J0UA 1IY0A 1WXQA 2NO6A 3SNHA 4YONB 1UKVY 2GZAA 2OBNA 1XF9A 2EFDB 3WYAA 4TLCA 5HR5A 4LYAA 2ZITA 1CTQA 4Q1BA 4PPFA 2WOOA 1DAHA 4TMKA 4DIEA 3T35A 1TEVA 5CIQA 4KHZA 4MA4A 3DDCA 3TH5A 3K1JA 3TIFA 4A6XA 3W6OA 2BV3A 1S9DA 3K70D 1KDTA 3HR7A 2WIAA 3QPUA 4YXWD 4EJSA 3EWSA 5B30A 2QTVB 3TVTA 4CEJA 3TSOA 2RHDA 2MMCA 4A0FA 4MGIR 4L16A 3HPQA 4BLSA 1R10A 2HJGA 2LWIA 1NNEA 3LAWA 3EW9A 3MJRA 2YWEA 1DOAA 1Q1EA 3MUFA 1OIXA 2A9KA 1E79D 1X8KA 4HAVA 1PUIA 3QKTA 4BFYA 1J2JA 3N2IA 2HDNB 4OHYA 1AJEA 3Q85A 2HLDD 3QXHA 1YZNA 4JVLA 1XCPA 3OEED 3WRYC 1DELA 2GCPA 4C4PA 8OHMA 3CNOA 2WSMA 1VMAA 4JKYA 4PC6A 3ZZUA 4Q19A 2C04A 1Z07A 4NYJR 1NBMD 5JLJA 1ZAKA 4GMDA 1KO4A 5LB4A 1S3GA 5BN4A 3T1TA 4LHXA 2P5SA 2ZI4A 3G0HA 4Q4LA 4JBWA 3GJ3A 3JZMA 1XEXA 2ZETA 3I73A 5C4GB 3AVUA 2Q3HA 3IGFA 1OFTA 1UBEA 2CE2X 2GHIA 1YZLA 2DR3A 1XXHA 4JS0A 5EE9A 4BFSA 4U5XA 1KMQA 1SXJD 5EP2A 3S1AB 3ZVRA 3DMNA 2IS1A 3R9XA 2AHOA 3QPWA 1OLOA 2IWRA 4ZIRA 2XSZA 3OFNA 2ODBA 3B2EA 1J90A 3QUSA 3GLFE 1E2QA 1VG1A 1GNPA 4ZCMA 3CH5A 3RVBA 1IXZA 1XPUA 1N6LA 1TF7A 2B8WA 3RS5A 1GFIA 1CR2A 2JLWA 2HYDA 3IIKA 4JLVA 1BH2A 1LVGA 3GJ8A 2VHUA 3RWOA 4KV9A 2E87A 2IF0A 2J7PA 4A2QA 4QGFA 4B74A 1XJ0A 2CDNA 4Q9KA 4PAMA 3UWOA 2XXAB 4PO9A 2GZHA 3OFND 4UNRA 1BYUA 2DB3A 1OFHA 3U44B 1KZ7B 2W6ID 5FTMA 4B44A 3EZ7A 1L4YA 4NYMQ 1T8TA 4F7WA 3ND9A 3EA0A 2DBYA 2RB4A 2ZUBA 2HF9A 5B64A 1LS1A 3A4LA 4GZLA 4EAQA 2AWOA 1ZCBA 3VHLB 5IRCD 4D2IA 3FE2A 2MMGA 2EFCB 1JXMA 3L0PA 3RSOA 3HU3A 2HYIC 4XTCS 1IN7A 2QN6A 4DIDA 1CRPA 2VA8A 3V9PA 4JLJA 4CVNA 3I3SR 3GD7A 4BLRA 4DUGA 2YVUA 4IEEA 1AS0A 3AF3A 2FFQA 5H1YA 1P72A 2WWWA 4NKRA 3VR4A 1LS6A 4AYTA 1D6JA 5SZIA 3WYGA 2I1VB 3K0CC 3THXA 1HQYE 2XGJA 1G41A 2YWHA 3PUYA 4WZAE 4B43A 1T3SA 5JI3E 3C7KA 4WZ6A 5JWHA 1RW4A 4ASUA 1HH4A 5BWMA 2GXUA 3CONA 721PA 3EC2A 3EA5A 4II7A 1QVRA 3WBJA 4L9WA 3HWSA 2XNDD 1ZC4A 1J99A 1N5KA 3DKPA 4DVGA 5C1BA 1ZIOA 2YC2C 2WMOB 1NG1A 3X1YA 1GG2A 2ZEJA 2VPPA 4G0NA 5GJWC 4AWXA 2WWHA 4GT1A 5TDHA 4BWYA 4BE7B 4OL0A 3A8TA 4N1AA 2ODEA 4DB4A 2GBLA 2F3RA 4M53A 3BC1A 4XTRA 2P67A 5DYGA 1P2SA 5FOWA 1LNZA 2Q9AA 3MGCA 4D0LB 1N6IA 5D3QA 4LYFA 2F43A 3RS7A 1E9BA 1DO2A 4FCTA 1OH7A 2D2FA 1E0SA 3FWYA 5TB5A 1HE8B 3AUYA 2WAXA 4DCNA 4YMVA 1EFRA 5EZ6B 3B9PA 4C0HA 1UDXA 4DJTA 1GNRA 4MDEA 1RE0A 4JT2A 3B1YA 1IN5A 3EARA 4Z1MD 1G19A 4TZ0A 4RZXA 5EJEA 2X77A 2CJWB 4PC3A 1CR1A 1MR3F 2J41A 3VU9A 4Q48A 4AY2A 1QHSA 1P9WA 2IYQA 2ORIA 1L7VC 2EFGA 1QHXA 3GJ7A 4PTLA 3QOFA 4G3XA 1U99A 3GQBA 1RKBA 4M1TA 3GPLA 2FG5A 4WA7A 1CS4C 2JLYA 1XRJA 3UANA 3Q9LA 1QG4A 2QSYA 1HTWA 5DIFA 4TYNA 2FH5B 2QMEA 1ZNWA 2VO1A 4UJ5A 1KIMA 4AKIA 4LHVA 5FL7A 2D74A 1ZUNB 1Z0FA 2CCKA 3KZ1E 3K0EA 4JLBA 3PEVA 1FTNA 2QSZA 3P4XA 4BFVA 4CGZA 1D9XA 4OI1A 5GJVC 2XZLA 1GRNA 4OJQA 4DLVA 2PX3A 2JAQA 2JDID 4D26A 2FDCA 3FVQA 1N6PA 1YJ5A 2V8OA 3DZ8A 2CMKA 1JR3E 2BHRA 4AURA 4LHYA 2QZ4A 4ZPXA 3KTAB 3GP8A 4QKQA 4MGZR 3BD9A 4TMWA 1CBUA 4Q7KA 3FHTA 1FX0B 2OILA 1AZTA 3A4MA 1NVWQ 2AX4A 2KI5A 1OFIA 1XBTA 1EG7A 3KJIA 4JYBA 1CULC 3UKDA 3VX3A 4WXPA 4KFSA 4ZDJA 2A5YB 1G6HA 3R8FA 1E69A 1F5NA 3LVQE 821PA 3ZH9B 1OH8A 2W0SA 3LNCA 1E2DA 4KVAA 4QC2A 3THWA 2QAGA 4JL5A 1R8SA 4LSGA 1XNJA 2QGZA 2Q3MA 1JALA 3WXMA 4D0NA 3BBPA 1ZJ6A 2FGKA 3PXGA 2WWIA 1X1SA 3VKWA 3AP2A 3VR3A 3REFA 3FKQA 3QKRA 4PR0A 1AN0A 5SZJA 4XD7A 1XXHE 1RJ9A 2G1KA 2V54A 4TMXA 4D4LA 1UEIA 3PCRB 4EQ6B 3O8CA 1CLUA 3CRW1 1D2NA 2VBCA 4LY6A 2QRNA 1U98A 1G8FA 3CR7A 2IT1A 2WWXA 4NTZA 2QMOA 2YOFA 1IOZA 1TNDA 3AUXA 3ASYA 1ZRHA 3HPRA 2OCBA 1E98A 3VR6A 2UKDA 2ZRPA 3IHLA 1KGDA 2MSEB 2QPTA 3T1QA 3SHFA 3BAFA 5LDDC 1KNXA 1B0UA 4HUQA 4Q4HA 2PJRA 1SXJE 4UNNA 3PQCA 2GAAA 3B13B 2ECKA 2CHVA 5A0FA 2XOKA 1W7AA 2FV8A 3SC3A 2GKSA 3IILA 4LJ7A 1YRBA 4KLNA 4P31A 1ZD9A 4LJ8A 2GESA 3NG1A 1ANKA 5EXXA 1CJKC 1E99A 1A82A 5GADl 2P6UA 2IYVA 1WBBA 3IKJA 4DLYA 4OI4A 2BOVA 4WXRA 3GLGA 4KYUA 2ZSAA 1HURA 3LQQA 1WMSA 4ESHA 5DHAA 4HZUB 3AVQA 4LUCA 4PC7A 2J0VA 5FUYA 1ZNYA 4EJSC 1NVVQ 2C2HA 4BLQA 2CK3D 4HAZA 3MMPA 2WSSD 2BMFA 3WHKA 4NP6A 1G5TA 4CT5A 3FFAA 4RKEA 2FFBA 4G5QA 1NRJB 1TQDA 2ZJBA 2OV2A 2RGDA 1N6NA 2JIZD 2Q9CA 5KNCA 4ERNA 5L3RA 3CW2A 1E1RD 3AF1A 3D31A 4L8GA 5FOSA 2QMUA 3MWYW 4GI7A 4NONA 1UKYA 3TR5A 2OLJA 5JRJA 3THYB 1OE0A 3DOEA 2FSIA 4UQOA 5IK2A 1P2VA 3AVPA 4M1OA 5DE3A 3W9YA 4EIWA 4X8MA 1TTTA 3HU2A 5EUMA 4O2RA 2KBEA 5L8VA 2WSSA 2BBWA 2CCGA 1NVUQ 1IJEA 1ETUA 2CHQA 3NHBA 2ZROA 4S2EA 4IOMA 1JR6A 5GJCA 3B5JA 1OKKD 4RZ3A 2C77A 5DNYB 2IYYA 4A8JC 1QHYA 4PO8A 3K70B 3NBXX 3SFVA 1Z2CA 3F0TA 4LBYA 4QNRA 1JJ7A 4JVMA 2ZSDA 1G21E 2FJUA 1OH6A 4DEXA 4IVRA 5JFGA 3MCAA 4FMDF 2BKUA 2ZR7A 3QENA 3WNDA 2ZVQX 1YRAA 3TE6A 4UNPA 2ZE6A 3SYLA 3BFXA 3VR2A 1KYIA 3CBQA 1Q1ZA 2E1RA 3CNNA 2F1IA 3IPXA 3SJBA 4UNSA 3AKCA 2GETA 2WJYA 3ZD6A 1R6BX 1PLLA 4DUGD 3H0KA 2QM8A 3U60B 2WPDD 4OQLA 1IXRC 3D7MA 2NMVA 1U8ZA 1N6RA 3WNCA 2F1JA 2ZRNA 2G1JA 3P4YA 4IVQA 1WF3A 3U2QA 3EIEA 3O8BA 4W5JA 2BM0A 4XVUA 1CR4A 3K53A 4PZYA 1O3YA 3I62A 2ZREA 3QBTA 2QL6A 4G5OA 5JMTA 1KI6B 3C14C 2BCJQ 1WB9A 1E96A 5E7IA 3EPJA 1WCV1 1KO1A 4PSKA 4EUNA 4KFTA 4XWAA 1CR0A 4DXAA 2JJ8A 3TUJC 2PMKA 4TYPA 2J59A 1GILA 1AS3A 4Q9IA 5KDOA 5ELXA 2ODNA 3K0CA 5EXTA 3DOFA 4WAUA 1IQPA 4P0TA 4D82A 1IN6A 3QF4B 3K9GA 4K8OA 4C3ZA 4W5WA 2BM1A 2ZRAA 4MYCA 3TK1A 1UBFA 4NH0A 4ZI3A 3IEVA 1W49A 5A4JA 1MRSA 1SGWA 1XD2B 2HV8A 1RPZA 3AQ4A 3DEFA 4EFNA 5JCZA 4DLXA 2D06A 4W5HA 3EPHA 4TLEA 3PG5A 2NZJA 4MQBA 3GCGA 4EPVA 5JECA 1VIAA 1XMSA 1OV4A 5GJBA 2IHBA 5FPTA 2X8AA 4MYHA 1DAFA 5IHPA 2GK6A 1Z6TA 2GBLC 1JQLB 1VYVA 2P5TB 1XB2A 1E0AA 1KO5A 2KE5A 3BE4A 1GM5A 1XTJA 2WICA 3NIBA 1SKYE 1T8UA 3A1UA 4U7DA 3M6AA 2GVDC 2GK7A 2YOHA 3RS0A 1US8A 3LA6A 2GEUA 3CX8A 1CJVC 2YWFA 4V0ME 3PIRA 2ASEA 3LVRE 2AK3A 2VYFA 4A6PA 1E2FA 2OHFA 3QI2A 4W9MC 1IY1A 5TARA 4PX9A 2VP9A 4YDSA 2D4HA 3B7GA 2X1VA 3N2EA 3JVVA 5E7MA 1GL6A 4HLQB 4TMTA 4C0QC 1L8QA 2GTPA 1YR6A 3OEHD 2IUUA 2ZPTX 3ICEA 1Y3AA 4XD7D 1QZXA 4PO1A 3QSYA 1HY3A 1G18A 4BUJA 2V7QA 1XDBA 5TXGA 1TL7C 3I1FA 4V0KA 2ZJ2A 3F3YA 4I99A 2ZRGA 1XMJA 3L2OB 4I1OA 1GTVA 2Z4SA 2GCOB 4EPWA 4YQFA 2XXAA 1E9RA 1GDDA 1BYIA 4DKXA 2ATVA 4Q1CA 1YR9A 4DSNA 1S3SA 1DEKA 1D2MA 4Q4AA 2JDIA 4JZKA 2H1LA 4BEBA 4BFXA 1ELOA 1Z08A 3RRMA 4LYHA 4AK9A 3PEWA 2IHYA 3DO6A 4JVSB 1EX7A 2VIIA 2W6JA 2ZANA 3TAHA 4CW7A 2DWPA 2IK8A 4QOSA 4NPHA 4TSFA 4A15A 1GZSA 3H4MA 3WHLA 4KI0A 1DAKA 4LJAA 3ADDA 4QBIA 1XTRA 3KXKA 2FZLA 4R2IA 4M9QA 3UK6A 1Y63A 1Q44A 5F98A 1OFUX 3AKDA 3SJZA 1CJTC 5KHOC 1P2TA 4JL6A 2B7BA 3OZXA 1D2EA 3TLXA 2NIPA 4R7ZA 4P32A 3L8ZA 2ZRDA 1G4UR 4URYR 3NDBB 3QXSA 3SDZA 1II8B 2ZRFA 2BDTA 2GJ9A 1U0HC 2HT1A 3T06B 2BEJA 1XD2A 2ZRMA 2GF9A 4K81B 1VCMA 4WVFA 3HYRA 4RKFA 1QHIA 5M04A 1E3MA 3RANA 3LXXA 3B1WA 4JMPA 4YMWA 4L5BA 3OEEA 1XP8A 5KTYA 2ONKA 4Q4AB 1ZIPA 1ZP6A 4JBXA 3ETLA 5TY0A 1P73A 1EFTA 2OBMA 4HB0A 1Q1BA 4G1UC 1W5SA 2XZOA 2RGCA 2ZUDA 2O52A 3IHWA 4C0AC 2NPFA 2J0QA 4RD0A 3K0FB 3KFVA 3BOSA 1SVMA 4MGKR 3SJCA 2XZPA 4MH0R 1W0KA 3W5IA 5H68A 3I4LA 4FW9A 4Q7MB 4B34A 4DB2A 4QM6A 1FP7A 3BWDD 4EPYA 2QGNA 1KK0A 2EFEB 1S9HA 3TRFA 2H17A 2XNSA 4JLNA 3PR1A 1XMVA 4Z8XA 4IRUB 3UG6A 3AVYA 4KYIB 3V4RA 2GNOA 1W0JA 2AKAB 3RLFA 2XJ4A 1N6KA 2AKYA 5UKDA 5EE5B 3VR5A 2CBZA 1V43A 3TUIC 2IYRA 3TW8B 3P26A 1T0HB 1OW3B 3KKMA 4XVQA 2J7KA 1DADA 1RVDA 2ORWA 3B8HA 4Y0AA 4JLAA 4A0HA 2OFXA 5G41A 3KB1A 1P9RA 1CJMA 1HYQA 3CZPA 4F4IA 1X1RA 1TU3A 2EWVA 1UFQA 2WJHA 1VCNA 3NH6A 1I2DA 3NH9A 4LDJA 4C2TA 3TMKA 4BRWA 3CPJB 3Q5DA 1MOZA 1VCOA 2RGAA 2REOA 1J70A 1K6MA 1M8PA 2QP3A 3UXMA 1XXHB 1KI2A 2A5FA 2H5EA 4QGHA 3GFTA 4X8LA 3LY5A 1WP9A 2XTZA 1K5GA 2QT1A 1G9XA 3ZDQA 3DL0A 2G3YA 4FCWA 3ZVMA 5JJKA 4LJ9A 4KSBA 2GWHA 2ERYA 1IN8A 5KSZA 1OF1A 2RMKA 2W6IA 4P3YA 4MRPA 3EZ9A 5IK2D 2C8VA 5LD2C 3NDPA 1A2BA 1E1QD 4PXAA 1E4VA 2AXPA 3KXIA 2G0TA 2C03A 5J4YA 4GOXA 1GP2A 3QKUA 1KSFX 1S1CA 1RRFA 2CLCX 4EDHA 5J4KA 4HLUA 3J81k 3NTUA 4KBFA 1KNQA 3W34A 2O8EB 1AQUA 3LW7A 1SQ5A 3A1SA 1G1MA 3A4NA 3QIAA 5G3ZA 4B3FX 2QORA 4GDFA 3KX2A 5JS7A 1OH5A 3D3QA 2Q9BA 4G5SA 5EP3A 1XPRA 5A5GA 3PVSA 4MKGA 3GLHB 5FI1B 1C4OA 2PZEA 1BOFA 2ZQ5A 4NYMR 4DLWA 3TQCA 2FPKA 1Z6YA 2CL0X 2IBMA 2ZVPX 4FMBB 5AUPB 4MRRA 1XMIA 3FYHA 5KO2A 4TQUS 4A8JA 3BERA 3KKPA 1YZGA 1KI9A 1W4RA 4BZQA 2EW1A 4E07A 1X8JA 2ZRLA 3QY0A 4TL6A 1GIAA 2ZRKA 4B32A 1G5RA 4I4LA 1VG8A 1JR3A 3PV0A 2ZI9A 3PFIA 4B2PA 3N70A 1BIFA 4RZUA 4ZI2A 2VF8A 1CXZA 1JEDA 3X1ZA 5CYOA 5HZKA 4TTPA 2FSGA 2OT3B 1X8LA 2DFTA 2KSQA 4H1UA 3I8XA 3QXXA 3CRRA 4LZZA 1VHLA 4M1MA 1TADA 4Q03A 5FPHA 1S4QA 3MSXA 2XSZD 3IUYA 1LF0A 1KHTA 3B1ZA 1SVIA 1G20E 2UVQA 4EPTA 1ZM9A 5FR1A 2ZSBA 2HF8A 2OAQ1 4MYTA 1XJQA 2N46A 2BCGY 2GZDA 3AVOA 1R5BA 2ZR0A 3CX7A 4V0NA 2FNAA 2RGGA 1RZ3A 2J7PD 1Q0UA 5SZKB 1E2JA 3BB4A 1AGRA 2F9LA 2KB0A 4M1KA 2V7QD 4NCNA 3GJ5A 4Q1FA 5E4FA 3KQLA 4AKGA 4BFTA 5LBIA 3O47A 2ZRJA 1ZD1A 3W6PA 1VKJA 2BKEA 2SHKA 1G17A 4QHSA 4IDOA 4XOIA 5CK5A 1KI6A 5JRZA 1IHUA 3QKSA 4QBGB 1E2NA 3KL4A 3KKOA 4D4JA 3GFOA 1ZMXA 1YR8A 2UZIR 1WRBA 4Q00A 3THXB 5AUQA 1KKLA 5FOXA 1WDTA 5G3YA 2HCJB 3SQWA 3GJ6A 4QFMA 3L0OA 1CU1A 4BLTA 3R20A 5CM9C 1KZGB 3LWNA 3C16C 5TV2A 1HQCA 2VRWA 4LRWA 1XEXB 1OJLA 1XEWX 1K8RA 1UADA 1YZQA 2NZ8A 2QI9C 1W47A 2OXCA 521PA 4NMMA 2IW3A 3AF0A 3OE7A 2EVWX 4AKEA 1W46A 4Z1MA 2QP9X 1G8PA 1PLKA 1MABA 1E2KA 3T12A 3TSWA 4D81A 2C9CA 1Z28A 2FPMA 3BS4A 4LJ6A 3AF2A 1ZU4A 3THYA 1H8HA 1AZSC 1R5OA 1U81A 1IBRA 2PLFA 1MO6A 2YHSA 4HEJA 2ZXUA 1DS6A 1JBKA 3W90A 3FFBA 5AUNB 1TUEA 2AR7A 3TKLA 4QJ5A 5G53C 1S96A 1HE1C 1UEJA 4KITB 1FTSA 2ZRHA 2MSCB 2KJQA 1I4LD 2CVFA 421PA 4B3DA 1A5TA 4LHZA 4AIIA 5FR2A 1E2HA 4A36A 4IDNA 3DHWC 2ZIAA 4ACBA 1Z0JA 4CF7A 5F3WB 3UPUA 1UAAA 3EPKA 1ONBA 3IPYA 3HU1A 2PZFA 3B60A 3E5HA 3HP1A 3ZIAD 1NY6A 2ZRBA 3ZQ6A 3BFVA 3IDQA 3SU8A 1F48A 1DARA 3KTAA 1XPOA 3L43A 2W6JD 1QDEA 1CEEA 1VECA 1W36D 1W0KD 3EG5A 2GXSA 1UF9A 3OF5A 2YV5A 2JGNA 4GFDA 2X2FA 1G8YA 4HAWA 2CNWA 5LB2A 3S1AA 2F1RA 2JLXA 3DZDA 4DSUA 2ZTSA 2V9PA 3E2IA 1P60A 3SOPA 2DHRA 1M74A 5BW8A 3RHFA 1U94A 1NVVR 3LXRA 2QPAA 5EE1A 1BKDR 5C4MA 2EQBA 3HDTA 5KOYA 2RHMA 4OQFA 4A1FA 2QAGC 4GSYA 2RKOA 5AJYA 4TQAA 2IUTA 4GL2A 4RY2A 1Z2AA 2O0JA 1KJYA 2ZJOA 1GKUB 2OESA 2PZGA 1R0WA 4URXR 3FMIA 4QL3A 3SHWA 1SVLA 4FINA 3U3MA 1XWIA 1KK3A 1NMZA 1XTQA 2ZSFA 1T4GA 2WAYA 3VU9B 4A92A 4DDUA 3RS2A 4DRZA 3TR0A 3I8SA 2GJAA 1RIFA 4DDVA 5L3SA 2I4IA 1SULA 2Z83A 3CIOA 2IYSA 2HXSA 4LC0A 3Q5EA 1RRPA 3PUWA 4Q7JB 3WP1B 1UKEA 2P65A 2DPXA 4QGGA 3PJRA 1D8TA 1N0WA 3EPLA 1DAGA 4Z8YA 4NL4H 1DAEA 1HUQA 2AK2A 2OZEA 2AN9A 3B1VA 5K8UA 3X1DA 2HEIA 2FA9A 4KBGA 1KJZA 1Q20A 2FFAA 3AF4A 5KSYA 1E2LA 1OPXA 4Q5IA 2YC4C 2I3BA 2TMKA 3THOA 3VHXA 3ZVLA 4FN5A 1KTVA 2H18A 2GA8A 2ZU6A 3B1XA 3K9LA 4NZYA 1X6VA 2XOKD 3UMRA 4UXIA 4CRWB 1NLYA 1FQKA 1W44A 4M9SA 4B6FA 2EWWA 1YE8A 4B48A 1MO5A 5IT5A 2O5VA 2HXYA 3C4JA 3RAPR 4QM7A 4O3MA 4ON9A 3CF0A 1KMHB 1T9HA 5KPDA 5FOTA 1XZPA 1FNNA 4AG6A 1R7RA 1KO8A 1OHHD 3Q3JB 1SHZA 5EZ5A 1A4RA 1D9ZA 1ZU5A 2PEYA 2QG6A 3PEUA 4V0LA 2ZAOA 2JLSA 1M7GA 2JLZA 1GKYA 1ZUIA 4IHQA 4TYQA 4P4SB 1HT1E 4BPBA 1NKTA 2CHGA 2D7DA 1D5CA 2WWGA 3CF2A 2XTMA 2DFKB 1OIVA 1KI7A 4GP6A 3ADKA 4A4DA 2JA1A 3ZGXA 3C5CA 1VYUA 3TBKA 2O8FB 2J3EA 4OK6A 4BFUA 3T61A 3U3OA 4JLOA 2XB4A 2D7CA 4QGAA 1ZBDA 4JT4A 3ZZTA 1KMHA 4Q9HA 4C9BA 4ACAA 2DFLA 3NXSA 1E9FA 4AD8A 3VKHA 4HAXA 2FEMA 4GOKA 2H8KA 2C9OA 1DE0A 2JLQA 3AEZA 1R4AA 3LBNA 1E6CA 1QHNA 2F6RA 4X8OA 2R62A 1SVSA 4LV5B 5DH9A 3TNFA 3JVUA 3U5ZB 1PV4A 3IEUA 2YNMA 4IJMA 1T3HA 3CZQA 2ZJ5A 1XZQA 2IXFA 1NSFA 4MRNA 4HI0E 3AKYA 3DVLA 1E0JA 4G01B 1MV5A 3H84A 3TSZA 4MGYR 5AR1A 2PEZA 5FOUA 1KKMA 2OFWA 5JJIA 3LV8A 1P3JA 2GCNA 3QEJA 4KFUA 5J47A 1MT0A 1EFUA 1M6NA 4LBZA 2OCYC 3FKSA 4PHHA 5CB8A 1Q21A 2O8FA 4PHFA 2NQ2C 2R6AA 2QAGB 4NYIR 3RWMB 4F93B 3EZ6A 1NKSA 2C95A 5AJVB 4MDFA 1GOTA 3OE7D 1P4SA 3EZFA 4JYCA 3EX7C 3OAAA 4C7OB 2GILA 5HPYB 2AWNA 3CPHA 4KODA 2D2EA 1E2PA 2G77B 3U3RA 1DO0A 1RYHA 3SYKA 2BMEA 1I4TD 2KWIA 5GVSA 3OESA 1E0KA 4TZ6A 2O8DA 1WA5A 4IOKA 2Q6TA 1G3IA 2WKRA 3UG7A 3U3KA 5FBWB 4M1WA 3GEHA 3HJNA 2J5XA 4PPQA 2FX3A 4C0BA 2QTHA 2NO0A 4ZKEA 5KNBA 5DI3B 2QY9A 4B6EA 2WJVA 2Z6VA 1WQ1R 1AQYA 3ZIAA 4LI0A 3T34A 2ZE5A 4XSGA 4E5UA 4Q9LA 4UXJA 6Q21A 3KJHA 1U90A 2V55B 1JAIA 1AS2A 4C0SA 1ZNZA 1W36C 1MH1A 2QQEA 2IEZA 4XWOA 2D62A 3ZS9A 3RC8A 4V02A 1VYTA 3GJ4A 1N0VC 3FHOA 1G6OA 1TX4B 4FWIB 3W5JA 2PMDA 2VP5A 3I92A 2O8BA 2YZ2A 4B3CA 4TT3D 5FTNA 2RCNA 4DWJA 1E2IA 4B3XA 3AVTA 3B82A 1E9SA 1H8HD 5ANRB 3UIEA 4Q4HB 1SVKA 5C46F 4JSYA 2IXEA 3VTKA 4TSFD 3AVWA 4DLTA 4IFEA 2YINC 4OK5A 5JWOA 3TJZA 4HAYA 1G291 2B8TA 3F8TA 5KU1A 1EFRD 4ZKDA 2BBSA 3AGQA 1DTSA 1NF3A 1COWA 2C98A 3ONWA 4LCBA 5DI3A 2BJVA 1NBME 3RS3A 2GEVA 1Z47A 2FN4A 4F4CA 1T91A 2P3SA 1ZUHA 3K9HA 4UNQA 4BGDA 2A5GA 4TT3A 1Q12A 3X1XA 3GLHA 4UXHA 1DVRA 3OIYA 5LPNA 1N2CE 3QE0A 1XEWY 3MWKA 2A5DA 3BH7A 4DSTA 5FPSA 3R7WA 1Q22A 4PSVA 1LTQA 4JBYA 2EFHB 1COWD 1F60A 1ZINA 3EIHA 4G5RA 5D3MB 3MRSA 1VPLA 5BYKA 1JECA 2IYWA 5JWRA 2W83A 3U6BA 3ND8A 5EXSA 5FTJA 2VQSA 2YWGA 4AC9A 1Z6XA 5B58C 1G7TA 2R6CA 4RFSB 2WKQA 4ZV4A 1CJUC 4R2HA 3SJAA 4HLCA 4IOJA 5F2EA 3MJHA 2WTUA 1XU4A 5BYJA 4CT4B 1CKEA 2GXQA 3F5FA 5EXPA 2GJSA 2R6DA 4PC1A 1Z0IA 2VF7A 1XTKA 1Q1QA 4CEHB 1GAJA 2QAJA 4QHTA 3AM1A 1RFLA 2V6IA 4N3NA 3T5GA 1QRAA 4N0EA 4Q4JB 1JPJA 3M0EA 3BORA 3ZLJA 3H2YA 2XB2A 1E9AA 1GSIA 1GVNB 1UPTA 3WBKA 2R44A 3M4YA 3BB1A 3BB3A 2IYUA 4HZUA 4YLGA 2J0UB 3AGPA 3CLVA 5K8IA 4YMTA 1F2TB 1SXJA 4B3GA 2WJJA 1C1YA 1XTIA 3BGWA 2DFNA 2JATA 2QROA 2XAUA 5HE9A 4D25A 3NBFA 4H9GA 4DEYA 3ZD7A 4TMZA 1W4AA 4Q1DA 3V00A 1LF5A 5HKKD 3GLIB 1IAQA 1N5IA 3GEIA 1R5NA 1GKIA 1NY5A 3VKGA 4M2LA 4DHEA 4RD3A 5CLQA 4C0KA 5TMPA 2JASA 5FL7D 5FUVA 1M7HA 3RSLA 3LO5A 4POAA 4IVPA 4Z51A 4LJ4A 1Z0AA 3RABA 4DZZA 3FMOB 4MYUA 5CYPA 5B57C 5G40A 3A37A 1E1QA 3E1SA 4KU4A 3EWAA 4Q02A 5DYIA 1OB5A 1TQ6A 4OI0A 4RFVA 1ZVQA 4NYJQ 5FBQB 3QJYA 5FFMA 2X19A 1YKSA 2ZS9A 3PUVA 3TAUA 1W36B 4R71A 1PZNA 3LRPA 4LHWA 5HE8A 1RJ9B 5FPYA 3BH0A 2RGEA 1ZNXA 4M1YA 1NIPA 4TLAA 1OXVA 3KB2A 2VHCA 4P33A 4FI3C 3GMTA 3VFDA 4EPRA 2XX3A 1US8B 4DCTA 4FXPA 2QTFA 1EFHA 1QHHA 4RCZA 1Q3HA 2JJ1A 1KDRA 3RRNA 5BXQC 1GUAA 3K8YA 3PUZA 5E3HA 4D0GA 1QG2A 1T5IA 2B21A 1F2UB 2ZUCA 1TUIA 3EAQA 3LQRA 4BFZA 5JHGB 1I4DD 1KI4A 3CWZA 2UZ3A 1YR7A 4RCYA 1KDOA 4C0LA 1LFDB 2GRJA 2Q3FA 1P9NA 2AFIE 1MKYA 1XX6A 4MRVA 4RZ2A 3LLUA 1LB1B 4PFSA 5DHFA 1FOEB 5CIWA 3ADBA 4HZIA 2OFOA 2VL7A 4ASUD 5JJLA 2JJ1D 3FB4A 3Q7PA 2WM9B 2QRZA 3LW8A 2JIZA 2ONJA 4URVR 4URUR 5CDFE 2A7QA 1GRQA 2XNDA 1W0JD 3GJ0A 4WIAA 3QVUA 2P0EA 2QQ0A 5CK4A 1N0UA 3N5CA 4ABYA 1L2TA 5KNDA 1GNQA 3AVXA 5FPKA 4M1SA 1P7CA 2R6GA 2VP4A 2FZ4A 2G88A 2E9SA 4B3BA 2WKPA 2AFHE 4PPNA 1NN1A 1F2UA 1HEIA 1R0XA 3VNUA 1EXMA 3BXZA 4HB4A 2HT6A 3U44A 3X1WA 3MWLA 3OIUA 1Z06A 3KFXA 1OXUA 4IDPA 1OKKA 4PQRA 4B73A 4OHXA 4KFRA 3K0AA 3QF4A 5JI2E 4B75A 3GLIA 5KDDA 1JR3D 3I5XA 1PUJA 3D8BA 3SZRA 2DWOA 3KKQA 4TL8A 3OIWA 5JEDA 1NVXQ 2F7SA 1R0ZA 2V1XA 3BJIC 5TVKA 4HDOB 4F38A 4Q9JA 4FMCB 1Z63A 4M0LA 5J4VA 4DDTA 4BLPA 3G5UA 4RVCA 1EESA 1KAGA 2WOJA 3C41J 4TTRA 3IIMA 1ZCAA 4TLBA 1ZM2A 4ZIRB 3U7EB 2NO9A 4LV8B 4JL8A 1MO3A 3TGPA 1UM8A 4CEHA 4PZLA 4FCVA 3I5YA 1SKYB 2F43B 1MO4A 4G5GA 4CZ2A 4KLZA 5DISB 2VEDA 4PAOA 3LLMA 4Z54A 4HYYA 4A8JB 3SE0A 1KSGA 3REGA 1KO7A 4URWR 3IO5A 4XSHA 3B9QA 3M1IA 1JB1A 1SVOA 5K8TA 2H16A 1G3RA 1G7SA 2OXRA 3SQXA 1F2TA 1SXJB 2AD5A 1OXXK 2FSHA 1DG3A 2J46A 2JJ2A 5FUXA 4US0R 3QF7A 4PC2A 4GOJA 3QG5A 5HZHA 3WNBA 1H8EA 1R8QA 5DN6D 4M8NE 4HUTA 2XJ9A 1G7RA 1FUKA 5H70A 4PPGA 1TF2A 4B2LA 3P27A 3QXCA 5J40A 1W4CA 4F91B 1E9CA 2F3TA 4XVRA 2ZRIA 5F9FA 5FBVB 2CLDX 1P5ZB 2GDJA 3AP1A 3OIVA 2WBLC 1KY2A 1E2GA 4MRSA 1AIPA 1A7JA 3QQ5A 3QG1A 3U7HB 4H1VA 1ZM3A 2C5LA 1AK2A 2ZAMA 4LC1A 4B47A 2HJVA 2OE2A 5KUTA 3TUZC 5JCPA 4A0GA 4QHYA 4O0MA 5HCIA 2BVNA 1VHTA 1OB2A 4BECA 1DAMA 1F6BA 1AM4D 1MRNA 3I72A 2CNWD 2IXGA 3K9NA 3UMFA 3ASZA 4CIDA 5JSZB 2C99A 2WJGA 1KAOA 2WPDA 1DPFA 1RRCA 4Q1AA 4B2IA 1YZKA 2R6FA 4YMUA 2O0KA 4JLDA 2G83A 4GMXA 4DC9A 5DLQC 2OLKA 2GXAA 2J45A 2WWFA 4ITRC 4US1R 1N3BA 1X3SA 4RD6A 4TYYA 4PHTA 2J9RA 1EFCA 4O25A 4NU0A 2C96A 4WZBE 2QENA 4GP7A 4US2R 1UBGA 2Q0HA 3EZ2A 3L82B 1II0A 2NO7A 2RH5A 5DSZA 3TQFA 4OHZA 3WYFA 2O8CB 2ZE7A 4NCIA 4DLZA 1ZW6A 1SHKA 2LKCA 2OEPA 4OI2A 1Z22A 3QKRB 1AKYA 2FPLA 2QE7A 3W3AA 1W2HA 2QP4A 4PHGA 3P32A 5JBQA 2FE4A 1YHNA 3RRZA 1AGPA 4A82A 1QF9A 4YXWA 3IBGA 4P4UA 4I1UA 4NBSA 3U7FB 1GITA 3E70C 1OT3A 1W5TA 2K5UA 4V03A 3TW4A 1P61B 1NN3A 3GFPA 1FNMA 2N1BA 2FOLA 2ZYUX 4NCJA 1O87A 1NLFA 2DWQA 3VMFA 2HUPA 4LPSA 2FMXA 1VG0B 4ZDWA 3RDPA 4B71A 1Z3IX 3QBVA 2QE7D 3IIJA 5CM8B 5EQTA 5HCNA 2X2EA 2QMHA 4O2LA 2CL6X 4BASA 4OBEA 1T6NA 4BZXA 2B7CA 1W1WA 1FW6A 1Z0DA 4IOLA 4A9AA 1E4YA 3DM5A 5AUOB 3NBZC 3BFKA 2QPOA 1RC8A 3VNVA 1EWQA 2RAPA 1HA3A 4CEIB 2QNRA 1II9A 2O8BB 3OEHA 2VHJA 3NEYA 3KUDA 2FF7A 2ANCA 1EX6A 3K09A 1G4AE 1DBSA 3A6PC 1GRRA 3AVVA 5HTKA 1CIPA 4WOPA 3RNLA 2G9NA 4DSOA 1M7BA 4BQSA 2CVHA 1VTKA 3AP3A 3CPEA 4LBWA 3EIQA 1S2MA 2WWYA 4I1SA 3RRYA 4TMVA 1FX0A 1RYFA 1AKEA 4LX0A 1M1YE 2F1HA 4JLMA 2PT7A 3LX8A 3WMFA 2PT5A 4TLDA 2Z43A 4B35A 4NYIQ 5JS8A 5CDFA 3NHAA 3U4QB 2N42A 1S0UA 2BMDA 1E79A 1SZPA 5J4LA 4ZO4A 4PANA 2J87A 1KI3A 1OHHA 1Z5ZA 2BWJA 3LD9A 3SBEA 4QBFA 3LFUA 3KQHA 4ILEA 3THWB 3NEJA 4L15A 5E7JA 2ERXA 2FEOA 3WY9A 1ZC3A 2JLVA 3AB3A 2BC9A 4PZZA 1U0JA 1OYWA 4DLSA 3NKVA 2V6JA 2PBRA 1H65A 1R0YA 3CNLA 3FMFA 1JNYA 4FMCF 4C30A 2NTYC 4BZPA 4GZMA 1NN0A 4MKFA 4B76A 1DG1G 2AL7A 4LYJA 2IWHA 2IC5A 2G6BA 2OAP1 1P62B 3GLIE 1C9KA 4C7OA 4IDQA 5CLLA 4F92B 5L3QB 2DY1A 2REXB 2WJIA 1EK0A 4JVNA 2C78A 2VHQA 4DLRA 2IYTA 5K8LA 3R7WB 2PCLA 5IF9A 1NG9A 1A2KC 4QJ4A 4DT1A 3K0SA 3B6EA 5JHHB 4I81A 4NCHA 3SR0A 5JSZA 2CJWA 5P21A 2MSDB 3NC1C 3WP0A 2B92A 4PAQA 4PQYA 1U2RA 2P6RA 5FL3A 3P1JA 1G8HA 2J0SA 1T0JB 3BRWD 3ZJYA 4MKIA 4QRHA 5AJZA 2EYUA 2IL1A 1XTSA 1FUUA 2VP2A 2ZYWX 1YU9A 3CO5A 1A1VA 2A3RA 3CX6A 1CP2A 2ZI7A 2I1QA 4BFWA 4OQMA 121PA 1IY2A 4WBSA 5CB6A 2L0XA 4HDCA 5KDLA 2O0HA 1IJFA 1OYYA 4OK3A 2IA5A 4MUBA 1NN5A 2YOGA 1V5WA 2IYZA 2WHXA 3B78A 4IXMA 4QG7A 1KSJA 1U9IC 4ZDKA 1SXJC 4GPTA 1FL9A 2VH5R 1KK2A 3FKSD 3W3ZB 3K09C 4X8HA 2R9VA 4D4KA 1GL9B 4Q1EA 1ZD8A 3Q7QA 2GF0A 2O8EA 2NOAA 1NP6A 1JQJC 3A58B 1P75A 4XH9B 3ECCA 4LV6A 3C5HA 4JJZA 4CYMA 2LCFA 5E95A 2PJZA 2YJTD 3G82C 2VP0A 3CRQA 1FPMA 5H8WA 3QPVA 4P4SA 1G16A 4IW3B 3U6KA 4RD4A 4LGMA 4R9UC 2VSFA 1W4BA 3PENA 1L4UA 4TQ9A 3L0IB 1BMFD 2OCPA 2RGNC 1E2EA 2W2TA 4IFBA 1XD9A 2VTKA 4OJKA 5DGXA 3SI7A 2PH1A 3QKSB 2FWRA 2WVJA 2A30A 4RSGA 2ZSEA 2ZS8A 3UMSA 5KPJA 1J7KA 3H86A 1J8MF 1GL7A 4EKDA 2DCUA 3Q72A 1QHHB 1R2QA 3GLGE 1T3LA 1KI1A 1QVAA 1WBDA 4WW0A 1VDZA 3NVAA 3ZYCA 1U8AA 1N6OA 5FI0B 2LKDA 5L3QA 3EXAA 1BMFA 2OSBA 5D3MA 4U00A 1NSTA 4ARZA 3NC0C 4HB3A 5BN3A 1J8YF 2QUZA 2WZQA 2H7VA 1JJVA 3EASA 1N6HA 1TU4A 1XJCA 1TQ4A 3OAAD 3T15A 1KSHA 3A1TA 1JEEA 4M9ZA 5DI9A 1E32A 4DBLC 2O8DB 4A2WA 5CJ2A 4K46A 2PLRA 3MAAC 3WMEA 1TAGA 4XJXA 1BO6A 5GVRA 3K70C 3CB4A 3CKLA 4KCGA 5J5CA 3ZZ0A 4RD2A 1E94E 2FFHA 5LD2B 1ESNA 4M21A 3GJXC 2W58A 2HCBA 4TN1A 2IYLD 2XEXA 2A78A 3KQNA 4HLDA 3IBYA 1NL3A 2GEDA 4D6PA 1G3QA 4AYXA 4IDHA 2IS4A 4UJ3A 3QEOA 2YYZA 4KXFB 1TPZA 1LW7A 2V3CC 3MWJA 5FOVA 3RYTC 1ESMA 1GWNA 1NJGA 4JJKA 4S35A 4AKHA 4M4SA 4OHVA 2BJWA 3QNUA 221PA 2ZJ8A 4KAXA 4PSAA 2GJ8A 3KDSE 4JKIA 5F9HA 1E2MA 5KSPA 5AWFC 4HB2A 4LOAA 3W8NA 3MLEA 2OUKA 3GLHE 1PVOA 2P6NA 2BMJA 4RD1A 3DMDA 4M22A 3TVDA 1S1MA 1PJRA 2ZR9A 1FMJA 2IS2A 4GBMA 3QXJA 3EC1A 4M9XA 4ESVA 1VG9B 1KK1A 1U9IA 2ZYTX 3A36A 1KJWA 3LX5A 4TL7A 1N25A 3W6NA 3CH4B 1CF4A 2CEAA 2FSFA 2R65A 1P2UA 4XIGS 3HYTA 4EQ6A 1DAIA 1IONA 1OIWA 3VAAA 2RGBA 3B85A 1FFHA 1WE2A 3IQXA 2G0NA 1OSNA 4HUQB 3UATA 1B23P 2OM2A 2NO1A 3KJEA 3CWQA 5L3VA 1NMYA 5JZVA 1ZYUA 4D80A 3BK7A 1YZTA 3IO3A 4NE2A 3ZQJA 4KSCA 2BBTA 4LBVA 4N0DA 2ODWA 2Z5FA 3U7GA 1OXTA 4Q47A 3GLGB 2ZI6A 1U8YA 1Z6GA 4YMSA 2ATXA 1U0LA 2ANBA 2Q21A 1FQJA 2W0MA 3X2SA 2R8RA 4L9SA 4R98A 4YC7A 2EYQA 2PX0A 3SYNA 4Q01A 4Q4JA 1AA9A 2WV9A 1JI0A 4TTQA 2A2ZA 4JSTA 5AK0A 3K0FA 4CDGA 1YQTA 4Q7LA 1ZM4A 2AD1A 4OQXA 1ODFA 3SBDA 4D4MA 2ZS7A 3KUCA 2VP6A 3FTQA 3MD0A 1RRGA 2OCAA 4BLOA 2W2XA 1XCGB 4FD2A 4Q66C 2GAOA 4RJLA 1HV8A 4ZCLA 3C8UA 4OYHA 3T5DA 1JPNA 1KOFA 4BEJA 1NMXA 2QA5A 1W48A 2OBLA 2QBYA 1X86B 2IYXA 1G7CA 3CM0A 1G64A 3SN6A 1QBKC 4NHOA 2HLDA 4QXAA 2NGRA 2PL3A 4IEIA 4ZDIA 3W8RA 5C2JB 4URZR 2DYKA 3FPAA 4ARZB 4HATA 3MG9A 1IN4A 1TQ2A 5IDVA 3L0SA 3CUEF 621PA 2OO7A 1P6XA 1E9DA 2H92A 1NBMA 3CRVA 4MKHA 3FDIA 2KBFA 5HKKA 1F3OA 4P4TA 4EFLA 2JCSA 1IM2A 4FMDB 4TL9A 3ZS8A 2P2LA 2JEOA 4V0MA 4C2UA 3OHMA 1S8FA 2ZI5A 1E1RA 2Y8EA 2W2VA 1LY1A 3BIFA 4NDZA 2AXNA 2CL7X 3I61A 2V1UA 5CJPA 4F4JA 5EE0A 1Q57A 4DCSA 2ZJYA 3R9IA 3GLFB 4FWTA 5SZHB 3CR8A 1Z29A 4MUAA 4L4UA 2ZJAA 5FBLB 1UKZA 4I1VA 2GCOA 2WIBA 3WRXC 1M2OB 3V4FA 1Z0KA 3GEEA 2QEQA 4GNKA 3WMGA 1TMKA 2CK3A 4E22A 1G3UA 1NLZA 4J0QA 3FHCB 4KVGA 1KI8A 3PITA 3BH6A 2O8CA
chains in the Genus database with same CATH superfamily
3PDHA 3HYNA 1J2UA 2P2DA 3LX4A 2OCXA 3O8RA 4P3PA 2V6MA 5M7EA 1DJNA 2G1AA 4HQRA 2HMYB 1G6KA 2J6CA 3D8NA 1KL7A 2I1WA 1AKQA 3KP1A 4M0EA 4OBWA 4TT8A 4WI1A 2BAGA 2FF5A 5F51A 1RWWA 2PR2A 2XITA 3LBIA 3UFXA 1E2UA 3L18A 3FOZA 3HM2A 2XCQA 1XFAA 4W8OA 1WOYA 2BBOA 3DDZX 3KLNA 1NQVA 1XCOA 2CLSA 2IE0A 3EF3A 3FCAA 5BSGA 2WFLB 1Q16A 5FUWA 3HCAA 1TYZA 1DCKA 3IMEA 4WCFA 2JD0A 1R6VA 3RU7A 2GZRA 3JW8A 1T29A 4UCFA 3KDAA 3MBOA 3UJHA 4DT1B 1YQUA 1FRQA 4GVXA 4MV9A 2DHDA 3PU6A 4QJIA 3O4RA 1ZITA 2ADOA 2FRVA 3IE0A 4YWJA 3W05A 5LQJA 1CUSA 4DMKA 3M2TA 3WB0A 1UMDB 1DV2A 4ZVRA 2XTNA 1FYDA 3GI1A 3STXA 1P1IA 3H8SA 3LUAA 3Q41A 1NKVA 1YCFA 3KJGA 1I0ZA 3ABIA 3GH3A 4GM0A 2P6MA 4M0MA 4RLHA 4M7RA 1V35A 4REQA 4QJBA 4BJ6A 3PUXA 4P7FA 1PX0A 5REQA 3W4KA 2QR3A 1FDWA 1JA0A 2B9VA 3PHLA 1Q3TA 4MR9B 1EWRA 4WOJA 4XLZA 2XUIA 2VSXA 4NF2A 4TWJA 5IW8A 3RUAA 4EY5A 2QQFA 2NNLD 2ZRCA 1W93A 2B99A 3DCIA 1TCUA 4YACA 4HDQB 4C1BA 3A1VA 1HG1A 2EJTA 1ZM7A 2X8JB 2YTZA 5FTKA 2CLFB 4REOA 2BT4A 2O8NA 3ITDA 4LPKA 3ROMA 4EZBA 3SC2B 3K5HA 4PQGA 3JYQA 1LX7A 2X8WA 4ZCIA 3WK9A 2QTRA 4AP6A 5SV2A 3NM4A 4XWKA 2MSWA 1QGUB 3EXIB 1JKIA 3GQVA 3H7IA 1L5SA 2AFIA 4DDWA 3FOWA 2Q5JA 4ZYWA 3RC3A 2UUOA 1ISPA 1OLSA 1VKOA 3IFSA 3DKVA 3IQWA 4HT3B 1VJGA 1C7JA 3SS8A 2BEKA 2G9VA 3E5MA 3QVWA 1XLWA 3EXFB 4EA7A 1QQTA 2IUSA 3NU1A 1PW7A 3VR1A 3WQHA 3MXTA 5C18A 2WZDA 4U7FA 5AIBA 2JIMA 3PPXA 4LJ5A 4OLJA 1TXGA 2WE8A 1G8GA 5CITA 4F5YA 1AKTA 2FUG6 3DPIA 2B20A 2ON6A 4M0PA 5CFLA 3OZIA 2IH2A 3FMPB 4UUOA 5CJJA 2IEYA 2ACEA 1XEFA 1ZCZA 4ENVA 1G5PA 2I6QA 5F73A 3NWPA 1W75A 1K5DA 5DZSA 4ECEA 4IZOA 4Y6LA 3UGJA 1T6XA 3G9TA 2X15A 2DSTA 1EP3B 3KQUA 1C3XA 3T4UA 3W79A 5ITZB 4HWSA 1PL0A 3MMNA 3CF4A 4EARA 5I7RA 1ILEA 2ZUWA 4D79A 2PE5A 3HGTA 2FOXA 3UC9A 2IU3A 1FF9A 2R2AA 2OV3A 4JELA 1VLHA 2QRHA 4XWGA 3LBHA 1IN1A 3K35A 2OA0A 1V11A 2JAPA 4GG1A 1V9LA 3ADCA 3DL7A 4XQEA 3T1YB 2F55A 4ALKA 2IZ6A 3V8EA 2R6JA 2OZLB 1ZGHA 2F8SA 1N5JA 2WTBA 1F8GA 2X5JO 1CUZA 4PFJA 3SEAA 3WGGA 2NTVA 3HJRA 2B6HA 1ZA1A 4KKXB 1NIJA 4Y2QA 2VRCD 3RLIA 3PHCA 3OO0A 4AO7A 3G2IA 3Q9UA 4X20B 1SUPA 2CMHA 4AG5A 5HM8A 3L6UA 3RJ9A 2O8FA 2IOFA 3UWPA 4CIWA 2B8NA 5L3SB 1NI3A 3O2JA 1VRVA 2M98A 3H6GA 3O8LA 4OKSA 3T9FA 4EG0A 3TF5A 4W7SA 2EZ8A 3OJXA 2QHXA 1E63A 1PSDA 3C6ZA 3GCXA 4W7IA 4CLRB 1PJ3A 4EH1A 4F4FA 3DJFA 4IMIB 1Z8FA 4G4JA 5I7UA 5F5LA 2HCTA 4R7TA 5BQ5A 3R9WA 5FIUA 5FFNA 4E2ZA 3M3PA 2M6RA 1EDEA 3GL9A 3CF6R 1C8KA 3FIUA 5J5VA 1UZMA 2WF5A 2Y6UA 3P20A 3QWFA 3I42A 5EIHA 4BB9A 2FW0A 2WC1A 2M6LA 2H57A 3A06A 1K86A 5DEOA 5T6MA 3T52A 1S2IA 3IKMB 4A0QA 3HZHA 3B12A 1PVDA 2CLIB 4BQOA 2FR0A 4BO5A 5LBTA 4C4SA 1Q3KA 1WXIA 2I2WA 2WUDA 4G89A 2IU6A 4QPZA 2YYAA 2QVZX 1Y1RA 5LMNB 1U2GA 3A3OA 3SNHA 1Q11A 4HDNA 4L4ZA 4R2KA 1XF9A 2EFDB 1R9MA 1R9GA 3PTZA 1QH0A 4FFNA 1JT2A 5LZ8A 3E4CA 2IELA 3VDQA 3H1FA 4PPFA 3UJ6A 2JD1A 2WOOA 4TMKA 5DNEA 5IC5A 3MLBA 1PQYA 4W6QA 4C89A 1G6Q1 3F4LA 4DIEA 3SC4A 3ET4A 2FR8C 2F9FA 4FNOA 2QUKA 4A6XA 1YMQA 3AXTA 4WOBA 5K5EA 3WO0A 1HTTA 1S9DA 3QEMA 1DKPA 1PL8A 1T6ZA 3HRHA 4JC4A 4DNFA 2C54A 3JSXA 1B74A 5AQEA 1VJTA 2PMBA 2QTVB 1E1YA 4M87A 2RK6A 4CEJA 3EMBA 4DQLA 1UBJS 3KXPA 2RHTA 4IY1A 4JBHA 4MGIR 4L16A 2QSUA 4QPCA 1MG5A 3LAWA 3EW9A 5D01A 2PLNA 5CFQA 1Q1EA 2GK4A 1OIXA 2QTZA 3MUFA 1WB6A 5HFAA 3ZHSA 3ILVA 2WJAA 4Z99A 1SR8A 1J2JA 1K3UB 3N2IA 1JZTA 1RYEA 2NV0A 1ZESA 2HIAA 4NZMA 1J1ZA 4ZEXA 3QVOA 3W5VA 2YJNA 5HJ5A 3JD3A 3LQFA 5GIPE 2OWEA 1N2ZA 2Z8YA 4NBUA 1X1DA 1T2VA 3G8BA 1BDHA 2CLKB 1I1NA 2YWXA 3T95A 3OEED 8OHMA 4LFCB 1Y48E 3UB3A 1ZH0A 1ZOSA 2ZUSA 4PC6A 3R0JA 2A0FA 2I0FA 3DV0B 3O9ZA 4X6UA 3H13A 3PNSA 3HSSA 5CVCA 5K51A 3R7NA 2Y3IA 5JLJA 5EZQA 1ORVA 2KPOA 2JGAA 3OQ1A 3ERCA 1JEQA 2HHLA 3TWOA 4EGJA 2I6SA 2JI6A 4I4TB 2XE4A 2JCXA 1O9GA 1KQGA 3V6LA 1GCGA 3IVMA 1C29B 2V9CA 4Q4LA 3V7FA 4W8HA 3GJ3A 1P5FA 2EXXA 3JZMA 1GUYA 1JQBA 2ZTVA 2K2QB 1D6MA 2GHIA 1UBEA 2DR3A 3AG6A 1WVIA 3TQSA 4BQQA 5EE9A 3HL0A 2YV3A 1ONNA 4G8CA 2J3HA 3O73A 2CWWA 3EBPA 3BXGA 4RGYA 3M6LA 1BRMA 2UUPA 5D1NA 1X94A 4QULA 4RA6B 2NZWA 5IDXA 4RMIA 1SG6A 1DIBA 2R87A 3E1GA 4UCQA 5T4BA 4DG8A 1GNPA 1XVTA 2BEWA 2F1KA 4ZCMA 5IUNC 1KZ9A 3RVBA 4D8VA 1Z12A 2B8WA 3IKLA 1JHRA 3GEGA 2A86A 1TD1A 2JLWA 4FEAA 4BO8A 4JLVA 1BH2A 1JG1A 3SF8A 3T5MA 1B43A 3NI2A 4LDZA 4R9NA 3RWOA 3SIRA 4E2XA 1QP4A 1ZJYA 4YBRA 1NUUA 2G09A 4E70A 2XUGA 2AR0A 3RVMA 4RF4A 2LW7A 1ZWKA 3AU8A 1MXFA 3QSGA 3ZLTA 2XXAB 3P5BA 2GZHA 2V45A 4S05A 1CUUA 1JIIA 3KU4A 1XA4A 1ZRNA 2Z57A 3UPDA 3V32A 1C3VA 3ESCA 5BT8A 1MJGA 2O3SA 1TKCA 1KZ7B 3LSYA 2BCEA 1J09A 1LW6E 1L4YA 2XQJA 3EZ7A 1JSXA 4JITA 2WVHA 1O5TA 4JQZA 1NUTA 3M6WA 3ZJTA 2RB4A 3Q1LA 1N2HA 3L1JA 4R1MA 6PFKA 5KX5F 1W52X 1YS9A 2YJ4A 4KACA 1KDVA 5B64A 3ASVA 1KH3A 1JDZA 1DRKA 3PD7A 4AZVA 7MHTA 1ZCBA 2VH1A 3F7TA 5IRCD 3RVOA 2Q5IA 4D2IA 3DYIA 2UZAA 4AZ0A 2KLHA 4PNZA 1JXMA 4C0WA 3GCZA 4EEZA 3DBHB 1VLJA 4DIDA 1ZICA 2QUIA 3CLTD 3DKKA 2XCTB 1GN9A 1XF1A 4M9CA 3I3SR 4DUGA 4PG8A 1GNLA 3DGFC 2YVUA 4JUIA 2HZBA 3RF7A 3VZRA 3GX1A 2FFQA 5IUKC 3RVQA 5JCXA 3NKLA 1JH9A 2WWWA 4YAWA 3W78A 4NKRA 4QEKA 4A7PA 4AYTA 1K9VF 1NNSA 3GFFA 1BWQA 2ATIA 2LIPA 1ML4A 1HQYE 1G41A 2AMVA 4ALIA 4J0EA 4Y18A 1P17A 4ADSG 1H22A 1SD2A 3C7KA 3RVKA 1C9JA 2EGUA 4ASUA 5BWMA 1ECJA 3OPYA 4QLOA 4ZCRA 1E7QA 4MUMA 3EC2A 3EA5A 4II7A 3BHIA 4WQMA 3WBJA 1Y9AA 4JQSA 4P0PB 3U17A 2YY5A 4QDOA 2YC2C 4M36A 3QU9A 1YJXA 5DCUA 1BCRB 1GG2A 3RG8A 1ZG3A 4BQEA 2ZEJA 1I94B 1AF4A 2LXNA 4XASA 3SFTA 1RJWA 2G4CA 1BD4A 1RJFA 4RNCA 2Z3WA 3A8TA 3HKBA 3K2IA 1R0BA 3FW1A 1QRDA 1DC3A 1EGVB 1EVQA 2F3RA 4ZOLF 3SKXA 3WK8A 5DYGA 1P2SA 4DCPA 4DXHA 3RYIB 4HXFB 3NAZA 3PR3A 4INJA 5EHGA 2PX2A 3WI7A 5D3QA 5ALYA 4R8MA 3RHZA 3QLTA 3WGHA 1OT5A 3AEQB 2ZQYA 3RS7A 3WIUA 4U2BA 5EJ2A 1TFUA 1XAIA 2CT8A 3L7MA 3H83A 4UHBA 1E0SA 3CZ4A 3N6VA 1WS6A 4LSMA 1T13A 5EZ6B 3DZIA 4ND6A 1E6MA 3EDMA 4R51A 2YFHA 3AJEA 1D4ZA 3HVHA 4JT2A 3B1YA 3VU0A 3ZWAA 4R8RA 4Z1MD 4J49A 1G19A 2HK6A 4AM8A 4BV8A 4F3NA 3FWHA 2QUHA 3MTAA 1E64A 1MR3F 3VU9A 4JOCA 3M6FA 1SO8A 3KJFA 4Q48A 3UAWA 4ATNA 3BKWA 2HMVA 4DJEC 5CBPA 1GGKA 5LA6B 2VZLA 1QHSA 1XN4A 5CXXA 1P9WA 3GJ7A 3UV3A 2EFGA 1QHXA 2HQ1A 3JQ9C 4BP9A 4G3XA 3MPUA 1B26A 1FJ2A 3GQBA 2GR9A 1RHMA 2A9RA 5J59A 2ZBEA 2JLYA 1YXMA 3ANYB 1R12A 1XRJA 3UJ7A 1V16B 1KARA 1KERA 3EJWA 4FZRA 1HX7A 2FH5B 2QMEA 2CYAA 4CMEA 1ZNWA 2H2AA 2AG8A 3NNDA 3PGKA 2ONCA 3M9LA 4JWTA 4LHVA 1N2SA 1ZUNB 2JNWA 4A8TA 1N8NA 4EFKA 2A35A 2P9FA 2YVAA 1P8AA 3FPSA 3ENQA 3KZ1E 4P86A 2GSDA 4G09A 3CLUC 1W85B 4LK3A 2QSZA 3TEJA 4CGZA 1DKUA 4B84A 1IAVA 5GJVC 1NNUA 1DL5A 2PX3A 3COZA 4CF6A 2JDID 2FXIA 3LTEA 5DKFA 1GRVA 1N6PA 2V8OA 3B6KA 4KAAA 1GUDA 2FKAA 3CISA 1T6YA 4LHYA 1HL7A 1SOMA 4R8SA 2QZ4A 2ZPUA 3EMVA 4ZPXA 1JU3A 4IGAA 3ZDDA 2X4IA 3KEFA 4MGZR 1V5EA 2R1UA 2RDMA 2Q9UA 1FX0B 1RQXA 2EZTA 3IP8A 4JA2A 4Q7KA 3V2GA 3PGVA 2OILA 4D6YA 4EELA 1PSZA 3DBRA 1XBTA 1EG7A 1PK9A 2W4IA 4X63A 3TNJA 4CV2A 5BSKA 1E4OA 3IE1A 3WGKA 4KFSA 3T1HB 1CD5A 1EP1B 1LKZA 1ATZA 2A5YB 3LUJA 1SQGA 1R9NA 3TD9A 1E69A 1OH8A 1WPXA 1TKRA 3ZH9B 1A7UA 2AXEA 3D3JA 3FX2A 4KVAA 1GT91 2XF8A 3SR3A 1XNJA 2X58A 4NEGA 3P9XA 1HE3A 3FNBA 1DI0A 4KEAA 3BBPA 3RARA 4MICA 4CBVA 3PXGA 4F3KA 1EWKA 1XGKA 2WWIA 3DE5X 4BGIA 5EIFA 3O1LA 1IMJA 4NNJA 3VR3A 3QKRA 4PR0A 4DA9A 4EJ6A 2QLJA 1AN0A 1B0ZA 2GD6A 1HI9A 4XD7A 3NS7A 3ZCTA 4UOEA 2IOFK 2G1KA 2V54A 4D4LA 1AKUA 3O8CA 1ZL2A 5KYNA 3I2IA 2OB2A 3CRW1 1WEHA 2E0IA 3EIOA 3OA2A 1M2NA 2VBCA 2H2FA 4PLGA 4W99A 1NYTA 1U98A 1BH6A 2QS9A 3EODA 3WGUA 1G8FA 3CR7A 4IX1A 4FLEA 2WWXA 4NTZA 4E6PA 2COUA 4MQ6A 2Q5CA 3EXEB 1ZRHA 3OM1A 4DR6B 2VI5A 2BEVB 2I3DA 4DS3A 3G13A 1K6EA 3DDNA 3HJCA 2IW1A 3RFVA 2XVXA 5ER9A 1PFQA 2EIXA 5TX7A 5KTMA 4XJTA 3PQCA 5MF6A 4PAGA 2P2CA 4B1FA 3LHFA 5KNDH 5AT1A 1KBQA 3EK2A 3GN1A 5I4IA 2ZWVA 3RSGA 3IILA 4LJ7A 1K7YA 1YRBA 4KLNA 2CXNA 1DTWB 1KPHA 2IPLA 1ANKA 1IEXA 1OY1A 1E99A 3LX6A 4W1PA 4ZT4A 3ZWCA 5GADl 2IYVA 4ZV7A 3FUTA 1NVEA 4OI4A 3A0RB 1OC2A 3GLGA 3HZRA 2ZJ3A 2H65A 3WRWA 1HC7A 1Y5MA 3C3PA 4Z7NB 3CTPA 4RMHA 1Q0TA 4ESHA 3FWPA 2AE1A 5DO9A 1IJBA 3CYFA 2EZUA 1UBTS 3S2SA 1BROA 3FR8A 4BMYA 4RTPA 4HAZA 1IULA 4B3TB 4PPYA 4X6YA 4XPIB 5AVOA 5KVCA 3WHKA 4NP6A 5TGZA 3ZZMA 5FWNA 1PFYA 2ODPA 3CX3A 3V1YA 3NP7A 3SBXA 4HBZA 2ZJBA 4R84A 2RGDA 2BGKA 3UMBA 4JI2B 5C8YF 3OWOA 4S24A 4Z0NA 4KWEA 5L3RA 2H5IA 1RQGA 3UHPA 1E1RD 3D31A 1XV5A 5T41A 3WQRA 3VNRA 4MA5A 2IEGA 2QMUA 1A5BB 3E82A 1BXGA 4C43A 3R74A 5C35A 3KQMA 3JV7A 4GI7A 1H2BA 1SCBA 1U8UA 1YAJA 3R7SA 4X65B 4E11A 4UQOA 4YO7A 1FTGA 1P2VA 1N5DA 5DE3A 3W9YA 2O4CA 4X8MA 3C6QA 4NFSA 5EUMA 3WYEA 4BMSA 4DCCA 4L5JA 3FSEA 3S2ZA 5L8VA 3Q8MA 4L0DA 4RCVA 1IJEA 4UM9D 1O9HA 5DBIA 1GR1A 3NHBA 1Z82A 2W42A 3WNZA 3IYLW 4I3GA 4NMHA 4REQB 5LWQA 4S2EA 3M9XA 4PLFA 4QEZA 3B5JA 1OKKD 4Y30A 1TM2A 4RPCA 4Z2AA 2XOXA 4RZ3A 1I30A 2C77A 5DNYB 5BMOA 3RC2A 5BPHA 1HSZA 3K70B 3NBXX 4KDEA 5HF5A 1JX6A 2VJOA 3F0TA 1MNQA 1ECLA 2PX8A 2ZXEA 4QNRA 2MOKA 3BUSA 4MRAA 4LTNA 5DLEA 3HB5X 1OH6A 4PVCA 1R5JA 2G1UA 4C3VA 1QZ3A 3I2FA 1VFNA 5IJ0B 3OZGA 3GP5A 3MCAA 3WNDA 2ZVQX 5E9JA 3A9RA 2FUCA 3OLVA 4UNPA 2PDAA 4UHDA 2ZE6A 3BHJA 1EDOA 3BFXA 3EDOA 3SYLA 3OICA 4AKTA 2Q3JA 4Z53A 1PS9A 1Q15A 3FKJA 4YP9A 3R40A 2AEMA 3D81A 3VYTB 5F9MA 3I0ZA 3AKCA 3CE9A 2IDJA 2VUHB 3K8OE 3R75A 2PX6A 3VOSA 3U60B 2R85A 2C83A 3UUFA 3JQ7A 4R2JA 1IXRC 1TO1E 2C31A 1J0DA 3QLUC 1KEVA 1N6RA 3WNCA 3ZWKA 2HK7A 4XLLA 3L0YA 2Q3DA 3AI3A 2V7VA 3F71A 1NQUA 5HOQA 1U4OA 4WXEA 4MS3A 2YWCA 4W5JA 3HXTA 1CR4A 4MIEA 3K53A 1EUQA 1O3YA 3I62A 1AQJA 4EECA 2ZREA 5IS2A 3C14C 3ESBA 2YQ5A 3O74A 1JBQA 5K6AA 2BMWA 3WYNA 2YCLA 5I45A 1QMGA 4EUNA 3HTXA 1I5EA 2OORC 4XWAA 1M83A 4XIFA 2WHEA 4DXAA 3OCYA 2F1OA 3BQNB 3HFRA 1JTEA 3IUQA 4N54A 3C1AA 3AILA 4Q9IA 3V4SA 2N9UA 3IJEB 4S3MA 3G2NA 1DQPA 2AFHA 4KJXA 1ZRMA 2HPVA 4RLFA 3M1AA 5A04A 1QRTA 2AV6A 4D82A 2QYOA 1N2CA 1L1RA 3PNMA 4MMXB 5TC4A 1E6KA 1ZZGA 3H6HA 1SG9A 4BJ5A 4YRZA 2OKGA 1J5XA 3SICE 4HXYA 1I2AA 3R5JA 2ZRAA 4YJ2F 5CB4B 4NH0A 5JZ9A 1M2VA 2XRZA 5A4JA 3IR6A 5DBOA 1XD2B 2HV8A 2PGNA 2VOJA 4M60A 1G20A 4TRNA 2JZNA 2BE7A 4W5HA 4KI7A 4TLEA 2BM8A 1CUFA 1ZUWA 4BFCA 4D41A 4HDMB 4KZKA 1OV4A 5L45A 2X8AA 4MYHA 2OCDA 4G0VA 3OKFA 1Z6TA 4XUCA 4ARVA 1VYVA 5IZCC 1SXPA 1KO5A 2GASA 2AVNA 2W2NA 3NIBA 1SKYE 3A1UA 5JOQA 3OQOA 4I9HA 4XPIA 1JQ3A 2YOHA 3H3JA 2ZYGA 4FFVA 3CFYA 5GONB 4D0SA 4IL5A 4JI8B 1Z5WA 1ZJZA 1U6JA 1CJVC 3G59A 4PLVA 1UKCA 3NBAA 5IBQA 2ASEA 4TLMB 1Z5VA 1OGYA 2OKCA 3HZOA 3JD1A 1E2FA 4A6PA 3IDOA 1XKTA 2VFAA 2NAPA 2PUTA 3IDSA 2G17A 5EPEA 2D4HA 4IO0A 3SVTA 1NVBA 1QFYA 4HLQB 4B3CA 2JHGA 1YR6A 1Y9JA 4E5MA 3IMCA 4OQZA 4MARA 4RPGA 4D92A 1Y3AA 2FHPA 2XA2A 4UHFA 2YS7A 4MR8A 4AMUA 4NDNE 1HY3A 1H6AA 1YS1X 3HMQA 3O9VA 5COAA 1XDBA 5TXGA 2FX2A 4CMCA 1TEZA 4XDYA 3F3YA 1DC4A 4I99A 1CUEA 4GU5A 5D1HA 3SXJA 4BS9A 2WJ4A 2CFIA 2POQX 2Z4SA 4DQXA 1UMKA 2D59A 3OUTA 5I7FA 1E9RA 2Y1WA 2XXAA 1NVAA 1YR9A 3VU8A 4DSNA 3VDNB 1D2MA 2FP4A 3P0HA 4JZKA 4D98A 2IGTA 3PEEA 4BFXA 1ELOA 1YB2A 2AN5A 3MNFA 5ILQA 4GMKA 2O2HA 5CHYA 2IHYA 4BB6A 4MLCA 2PRKA 2IIBA 5F2NA 2IXDA 1Q0HA 4HDSA 4TSFA 4A15A 4UNIA 1E8DA 2ICAA 1N7JA 3TR6A 4BBPA 1VLQA 1WL8A 1Q7TA 4G97A 1D3AA 4O4HB 5K0BA 1NZDA 4KQCA 3PLNA 3KXKA 5H59A 2H1WA 1RXWA 5BR8B 1JSCA 5F98A 1X1BA 1OFUX 4OGKA 5IXYA 4BL5A 1CJTC 2KW5A 1HE4A 1P2TA 2AFIB 2B7BA 4JL6A 3TLXA 5KYYB 3IBSA 1Z8DA 1P74A 2GBIA 3E15A 3T7CA 3K73O 1MP0A 4MZDA 1SCIA 4W6ZA 3ZI0A 5AFSA 3B8EA 2BGUA 3T3GA 1II8B 2ZRFA 2H2GA 2W2QA 5AKEA 5AOBA 3HXQA 2XMGA 4NBVA 2XT9A 1OPRA 1RBQA 2WIKA 4RHFA 1U0HC 4HRVA 4ZFNA 4PGAA 4QYIA 5E1MA 1SURA 1W19A 3A9WA 1U02A 2ZRMA 1OA0A 3S7ZA 4UBMA 5FBKA 1QHIA 1E3MA 3FGZA 3KEMA 4K2AA 1EB9A 1TRHA 4I1RA 4O4LB 4OQYA 1KH1A 1Y3IA 4K6OA 5KTYA 3V7NA 2Z6QA 3FCEA 4F97A 5CA0A 2E5LB 1ZP6A 3KT0A 4JBXA 4IDBA 2XVZA 3JVDA 2R6R1 3G0IA 4MJ3A 1N2GA 5HIJA 2VK2A 2XRFA 1PJTA 4K6HA 3UOWA 1V0JA 2ZUDA 2EG9A 2VUIB 3TI7A 3HKBB 1CVIA 4L50A 4ZVNA 2D13A 2WKWA 1A2OA 2EW8A 1CWUA 1KIFA 5AVXA 4EOGA 2W2KA 1P0CA 4ZGWA 1JRLA 2AMLA 1SVMA 2K7FA 3ACCA 4B7AA 3AM3A 3IOCA 4YJFB 1Y0BA 1W0KA 3DWFA 4YI5A 5H68A 3I4LA 1VPVA 4FW9A 2JS7A 4Q7MB 3W5IA 4QM6A 1KK0A 2EFEB 3HBAA 2YZ7A 4IQFA 2H17A 2XNSA 5BV7A 2HSZA 1XMVA 1DPGA 1KC3A 1QKKA 3DAOA 4BBZA 1RMYA 2GNOA 1W0JA 1PR6A 3ZE8A 5DWVA 1CFJA 2XJ4A 1C9NA 1MIHA 5EE5B 1NMQA 1MA3A 4QDJA 4FGWA 3UT5B 1X7XB 2C7GA 2JPDA 1T0HB 4LHSA 3PC7A 4ZQHA 4AB1A 1RVDA 3B8HA 2XVYA 2LZ0A 3KB1A 1PR2A 1ADCA 4F4IA 2MT9A 3ETEA 3GHHA 4UAUA 1X1RA 1FC0A 2WJHA 1EEXB 4YCBA 4AUNA 3INYA 1WXHA 5AXCA 1MPXA 3CPJB 3IB6A 3OPMA 5BSTA 3RYFB 2REOA 1K6MA 4J4BA 4X44A 2IHVA 4C5BA 2XI4A 1WTCA 3ZDZB 1FSFA 3LY5A 4X8LA 3VH2A 4BAGA 2XTZA 5KOHA 2CW5A 4NZNA 1E1CA 3OCJA 4L5IA 3MRVA 2GWHA 3LUGA 3C3AA 1IN8A 3ND7A 4X6LA 1OF1A 3PWSA 3B36A 1U2SA 3TNYA 3I05A 2C8VA 3VNBA 4PFQA 1I6KA 5EVCA 2P30A 4G1CA 3SZUA 4ZI7B 2EJCA 1M75A 5AW9A 3FYUC 2HTFA 4GOXA 3BVPA 4LY9A 1S1CA 1NI5A 5AOAA 3DLAA 3T94A 3NTUA 3J81k 3AY0A 4W5RA 4IDEA 1I2CA 1SQ5A 3A4NA 5G3ZA 3QIAA 5C51B 4GDFA 1S2GA 3NYQA 4DMHA 5CDSA 1UMBB 2H3EA 2PFGA 2XTJA 1KZ1A 2XMPA 2HV9A 3ONVA 2UVPB 2JBAB 3TQCA 4JR1A 4FEGA 2QN8A 1Z6YA 2VNIA 2OQIA 1SBTA 1SZJG 4R01A 2ZVPX 5T67A 3NV7A 3R9XB 4DMLA 3FYHA 4UD2A 1B6TA 1YU6A 5KTOA 4TQUS 4A8JA 4OUDA 3PDJA 1Z2DA 2CXQA 3J81A 3L93A 4J16C 1EM8A 1XAGA 5HJ2A 3WL5A 4QVGA 2FE1A 1GIAA 4WY8A 5ABPA 3GUHA 3DOIA 1MCZA 1KEEA 3K6SA 3PFIA 4JQOA 1IQUA 1RBMA 1RYDA 3HABA 4FC7A 5AMXA 1BIFA 3ABOB 4RIFA 4RZUA 5JAQA 1CXZA 5IM4A 1NW9B 3LPNA 4ZP1A 1JEDA 5CYOA 3D4LA 3WL4A 2OT3B 4LZZA 2DLDA 1E1DA 2KSQA 4JC8A 2CV1A 2GD0A 3ENNA 3RKSA 3PB3A 4HWOA 3SX4A 5ICSA 1NYRA 1KFJB 1OTYA 3L49A 1BXKA 1VE3A 5CU7A 4FKBA 2UVQA 3DLCA 3P9IA 1B2RA 2YV4A 5FR1A 1NOJA 2ZSBA 5JIBA 2OAQ1 4LF9B 3EXEA 4HTFB 1M1YA 3BQMB 1R5BA 3RK0A 5B6JA 1J0XO 3F5QA 4YJ2A 3THRA 1YUNA 3FSJX 3BN3A 3PYLA 4LIPD 5JPIA 5FA5A 1P2FA 4P54A 3RJMA 2HHCA 5FULA 1EDDA 3LBAA 4M1KA 4Q1FA 1F8UA 1ENZA 2V7QD 3GJ5A 4UATA 3VI4B 2WDPA 4QUHA 3G9QA 3O47A 2ZRJA 5BNZA 4MJLA 3W6PA 1QO0A 4QHSA 4XOIA 4IDOA 2SCUA 3PSHA 4QBGB 3ZPXA 4NJMA 1JEAA 2D1SA 1JDBB 1WO8A 2D1RA 3H18A 4ZOBA 4CMIB 5JTUA 4D4JA 3MBIA 1GZ6A 2CJXA 2UZIR 4PF1A 5EGSA 4ARUA 4TUYA 3THXB 1Y3HA 4P5EA 1AO3A 5BWOA 2P0AA 5ALWA 3OX1A 3HUEA 1E8NA 3GJ6A 3WKAA 3D54D 4BLTA 3JD0A 3LWNA 3PCTA 3C16C 4B17A 4E88A 4YRMA 5TV2A 1BQ3A 4JY7A 5E1OA 4RQUA 2VRWA 4B3IA 2SECE 1OJLA 2CBGA 3AM5A 3D0QA 1YZQA 3LT4A 1J4AA 2QI9C 1RAGA 3MSCA 3QNMA 2C57A 521PA 4YT2A 5JAIA 1LDBA 1CEQA 3AF0A 4GKAA 3LZCA 2EVWX 4LRXA 4O1HA 4YP1A 3U9TA 2GN6A 3WLLA 4EI7A 4YCSA 5A3JA 5C7OO 3AUKA 4CM7A 1G8PA 1PLKA 2FR1A 5IYZA 1MABA 3BHMA 3OX4A 3O90A 1IHDA 1OFGA 2C9CA 2N0SA 4G0YA 2YFKA 4GLBA 1H8HA 3F78A 4ARAA 1IBRA 4HEJA 3H65A 2ZXUA 1JBKA 3BDIA 3K3PA 4BN5A 4I50F 4LOJA 4PCUA 3TKLA 1TEHA 3PQEA 1JNXX 1PJQA 3JZFA 1XRNA 5K9ZA 4A6EA 2LPMA 1EHIA 1XVLA 3K9CA 4BNNA 5JCOA 2WUWE 3S2IA 4RF2A 4WZAA 5IKPA 3EDRA 2NACA 3PGLA 1JYFA 3DT8A 4LHZA 1V6AA 1E2HA 1SY7A 2YXPX 2W6QA 3H4IA 5FR2A 5KWVA 2XUQA 4OMDA 1LQ2A 2W8ZA 1Z0JA 1N3LA 3OTQA 1GSOA 3E3NA 5FHRA 5H83A 4CF7A 4B8ZA 4CMJA 3EPKA 1ONPA 1JHVA 3HU1A 1S6YA 1T36B 1L4KA 1LZLA 1RI5A 1SQ0A 1LJLA 3B60A 3RBVA 3UK1A 4IEFB 1WXEA 3T3EA 2JZCA 5LOVB 1NY6A 1A69A 4XGQA 4E5NA 3DVQX 1K7SN 2AW5A 3BMOB 1FNBA 3GZ4A 4DNPA 2I8LA 2R8PA 4PGHA 2A3NA 2BM9A 4MO2A 4CU2A 3EG5A 2GXSA 5CXSA 3OF5A 4YDQA 3KV3O 1QCZA 2FCRA 2YV5A 4DG5A 1IIBA 4YCNA 2WUFA 3L0DA 3PE3A 4WGGA 3GLUA 4B5KA 5I3ZA 4JGIA 4D9IA 2C2BA 5SY4A 4C5CA 2WTAA 4EMTA 5I3CA 5BVHB 2RIRA 5DNVA 2WUVA 2B69A 3DZDA 4DSUA 5AI5A 5C8YB 1YB7A 1GTRA 3IAM6 5DASA 3JPYA 1M74A 5BW8A 1J5PA 3IH5A 3E9QA 5FLYA 1GPDG 3E9MA 3I6BA 2QPAA 4DYHA 2W90A 4L0CA 4O2AF 4WXMA 3S5JA 2O8VA 4TKZA 1MF7A 3RPEA 5B7QA 1RC0A 2RHMA 3ICWA 5TE9A 2QAGC 4HNHA 5LQAA 4LF6B 1LPMA 1NXOA 1GYQA 2IUTA 3G2PA 2NZ2A 1EWYA 4KWIA 2VT7A 4JEIA 3S99A 2CFTA 2VSNA 1NSYA 2Y0CA 2ZJOA 5JASA 1TLTA 2DQSA 3U7JA 4WADA 4YUWA 1KR5A 1NXVA 4CLOA 3ZDFA 1XTQA 2JHCA 2ZTUA 3VU9B 4A92A 4EBBA 3WAGA 3IMFA 3I8SA 2GJAA 4O1MA 3DFUA 1U8EA 4GRDA 4K2HA 4FFOA 4FQ7A 3U4AA 4DDVA 1OGIA 2I4IA 3O1JC 3WGVA 1SULA 2Z83A 5TEWA 3E9EA 2O3TA 2BEVA 4O3FA 1AHIA 2CB9A 2ZBQA 4MVJI 4B8WA 4GF5A 1UKEA 2P65A 4K9RA 3KPWA 1PTJC 4YJHB 5TMBA 1D8TA 1N0WA 3GT3A 1DAGA 4P08A 2IDKA 3I2JA 2ORYA 4PTYA 1R0RE 1GCAA 1HUQA 1R8XA 1SJ9A 2QV7A 3B1VA 4QQNA 4D97A 4F8YA 3N0XA 3UO8B 4KUEA 1RJGA 1GARA 3PQ2A 4KBGA 4WACA 4X7MA 5FUBA 1SCJA 1E3WA 1IFXA 3DV2A 4MUNA 2ZBVA 4Q5IA 1NR5A 3A9UA 4RX1A 3WSTA 3ZVLA 1UDAA 3KB8A 2XQKA 4MDHA 4D4GA 4RY9A 2OPHA 4FM9A 2XMDA 2Q4OA 1X6VA 2VBFA 3I2KA 2GHRA 1P4GA 2D0PB 1FQKA 1W44A 2WT4A 1KVUA 3PCXA 1YE8A 4B6FA 1MO5A 1FLVA 1X7GA 1T2AA 2HRDA 2HXYA 2OO3A 3CZAA 2ZIFA 1LDEA 1Z4MA 8LDHA 1XWWA 1WPRA 5C32A 1PGJA 2I7VA 1T9HA 2A84A 2EOAA 4QG3A 3FUVA 5DWQA 3I01M 2EKDA 5FOTA 1Y6GA 1NJ5A 2RE8A 1NBAA 2C5FA 1DWUA 3H16A 5HKBA 4ZCPA 3LUDA 1JPVA 3DOUA 3LFHA 1SHZA 4HRAA 4R2MA 4Y9UA 3GVPA 3WMWA 1EVLA 1UT8A 2P79A 1UJ5A 4UTXA 2IIVA 2R8XA 2JLSA 2JLZA 1KKUA 2EEZA 2RBGA 3OJ0A 3KWLA 2WV7A 1IHXA 5DOVA 1ADGA 1GKYA 1U9JA 1JIJA 4ZA2A 2WIDA 3PPVA 1HT1E 1QPGA 3V8QA 2ISQA 3I9V1 3N3AC 4LMPA 5IFLA 2LD4A 1KI7A 5IAOA 1ZVVA 4A4DA 5IVDA 1AVTA 1QOZA 1X7ZA 4HFNA 2C59A 3FDZA 3G3EA 4HGPA 4I6EA 4RH3A 1VYUA 1FXWF 4AX4A 2CXUA 5F33A 2C2WA 3G89A 4OK6A 3E3LA 3GJQA 1XK7A 5CX1B 4BFUA 3FPCA 5D86A 1XAJA 3VR2D 3X2EA 3VR6D 3ZZTA 1KMHA 5JZSA 1MAUA 1KJNA 1GPH1 3G0CA 4C9BA 6REQA 5LOVA 3X0DA 4YFYA 1SU6A 2JBWA 3S81A 1Z37A 4EHJA 3VKFA 1YF3A 4PSCA 4AD8A 3VKHA 1KOGA 2H8KA 2C9OA 2FEWB 2WJZB 2GPNA 2ZSKA 5INTA 4ICIA 1GZ4A 1WUJS 2OZVA 1E6CA 4TKMA 4X8OA 1OA1A 3WLMA 2AFHB 3GFVA 4LOKA 3Q10A 5K0JA 2XWJI 3JVUA 3QUQA 1PV4A 3IEUA 4IGIA 4RVHA 3FPLA 4IJMA 2RAUA 3L4BC 1T3HA 1XZQA 1QYRA 2IXFA 2P2SA 3FFXA 3TKYA 4CCWA 1NSFA 1OZ0A 4J7CA 1FYFA 1UZNA 2JFPA 2YDYA 3AKYA 3H1PA 4MRNA 3LY8A 1AH2A 4YP7A 5IM4F 3TSZA 4MWBA 5AR1A 1E4EA 4FFRA 4X3OA 1KKMA 2JCYA 2EG5A 3CUTA 3I6ZA 5G0WA 4UQLA 5J47A 5DIZA 2OCKA 1WABA 2ZT7A 4LZWA 1T9CA 1CRWG 1EFUA 1M6NA 1DLJA 3OCVA 2OCYC 3FKSA 2YDXA 4F93B 4FW8A 3STYA 4Z6KA 1C0IA 1UPFA 2D54A 2VCYA 2C95A 3FF4A 3KPUA 2BKLA 2IRWA 3PL5A 4WH0A