4JVSB

Crystal structure of lepb gap domain from legionella drancourtii in complex with rab1-gdp and alf3
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
170
structure length
170
Chain Sequence
EYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase activator/protein transport
molecule keywords Putative uncharacterized protein
publication title Structural analyses of Legionella LepB reveal a new GAP fold that catalytically mimics eukaryotic RasGAP
pubmed doi rcsb
source organism Legionella drancourtii
total genus 59
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2013-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jvsB00
1NN1A 3HPRA 5F98A 3DO6A 1ZM4A 1N25A 4C0SA 1Z0IA 2C98A 2ODEA 3FGNA 1XXHA 2GTPA 3OEED 1R8QA 2QY9A 4MRNA 3TW4A 3Q7QA 5FUYA 1GNPA 2YC4C 3B78A 1G20E 4QJ3A 4V0KA 5DI3B 1CF4A 3TK1A 4C3ZA 4EAQA 3AKCA 2ZJZA 2F1JA 2GVDC 2EYQA 2J0UA 3AEZA 5CIWA 2FF7A 2R65A 3GEEA 4B3GA 1K8RA 4I4LA 2ZAMA 1ZNZA 2GVZC 4PHFA 2CCJA 2XJ9A 2WM9B 4MKGA 4UXIA 3LLUA 2GK6A 5AUOB 3MGCA 3RRZA 2JJ2A 1FTNA 3PVSA 1UDWA 1UKYA 2QMHA 2HUPA 3PUYA 3H0KA 3THXA 1XTRA 1F2UA 1UBFA 1T0HB 3QBVA 2JLSA 2CHVA 4TQAA 4GL2A 2ZVQX 4A82A 3OIYA 4IDHA 4JYCA 3SQWA 2VSXA 3TE6A 3KQUA 4MKHA 4IVRA 4YXWD 5J40A 2HT1A 2GCOB 5EE1A 3WNBA 3AKYA 3U44A 1AIPA 3BE4A 3GJ5A 1GRQA 1N6NA 3KL4A 1KO5A 2WWXA 2EW1A 3IPXA 1KSFX 3BGWA 3TJZA 4DVGA 5H8WA 1U2RA 3CX7A 3B1YA 4TZ6A 2WICA 3T1VA 2DB3A 3ZD6A 1E0KA 3PCRB 4OK3A 3R9XA 2O8CA 1TUEA 4KYIB 1YVDA 4E5UA 3N70A 4FMCF 4JVNA 4UJ3A 1BS1A 4QHYA 5D3MB 3QPUA 5B2ZA 1IY2A 1NG1A 4MGKR 2IF0A 4PPNA 1G18A 2PCLA 1ZCAA 1T6NA 5AJXA 2ZJ8A 1UAAA 4AG5A 4OHXA 1QG2A 1XEXB 2OT3B 3MLEA 4E03A 1U99A 4PQFA 2C03A 4A2QA 2VSFA 2XNDA 1LB1B 2GZHA 2P67A 2VL7A 4P32A 1GG2A 1RC8A 4JBYA 5KDDA 2EFHB 3GLGE 5KPDA 2JDIA 3EPKA 2OHFA 4RFSA 4NYMR 2F55A 2YKGA 4JYBA 2CJWA 4DSUA 4JLAA 1Z6GA 2ODWA 3PUWA 2J45A 1KMHA 1UBEA 2A5JA 1KZ7B 3C15C 3EG5A 4JL8A 3V9PA 5SZHB 3HWSA 2R8RA 5AWFC 3C16C 1EWQA 4BUJA 1TTTA 4B3CA 3EZ7A 3SHFA 5L3QB 1G8YA 3CM0A 3MG9A 4YC7A 4TYNA 1GKUB 3ETLA 1OB5A 3CZQA 2W6ID 1OJLA 2YWGA 4B48A 3GJ8A 3TMKA 3UK6A 3IIJA 3OHMA 1EK0A 4KI0A 5CM9C 4GRAA 3QXCA 4PR0A 2R9VA 2V4ZA 4ACBA 1OH8A 2A5GA 2ZR7A 4Z54A 3ICEA 1VCIA 2J7KA 3Q3JB 3TGPA 1ZC3A 3WYGA 4BFUA 3UWOA 3IO3A 1NLZA 4E09A 2ZIAA 5J4HA 2VHCA 1AZSC 4BLSA 5BYKA 2I3BA 3B1XA 4HZUA 4RZ3A 4A9AA 3SYKA 1F3OA 1FNNA 1FX0A 2Z0MA 1E96A 4G5GA 4D80A 5FBVB 2XZOA 3ZH9B 4URXR 3QBTA 3D7MA 2A3RA 2CLCX 1KSHA 3EZFA 4X8MA 5FL7D 1EESA 3SE0A 3LDAA 3O47A 3PUXA 2GXAA 3IO5A 3DL0A 4LOAA 2H17A 4XIGS 3IILA 1IXSB 2H16A 3RYTC 1Q1BA 4KBFA 1G7CA 1AGPA 1DEKA 3C4JA 1VCOA 3K9NA 4TSFA 2REXB 1AS2A 2C95A 3E2IA 3U3OA 3I8XA 1PZNA 4CEJA 5TV2A 5EUQB 4CRWB 1IM2A 1XTQA 1JALA 1S8FA 4JL6A 5EXXA 2B7BA 1AK2A 4DUGD 3IHWA 1VDZA 3QE0A 3I8SA 4QBHA 4D4LA 2WPDA 2WV9A 2EFEB 4JZKA 1NF3A 2ERXA 4BLQA 1D6JA 2P5TB 4TL8A 3K0CC 2EVWX 1NN5A 4RD4A 2BM1A 3A37A 1SVLA 2FFQA 1Q22A 2GAOA 1LFDB 1NMXA 4DLTA 3TUZC 3ZLJA 4LBYA 2LCFA 4HLUA 3D3QA 5EP3A 1NRJB 4UNQA 2FFAA 4ZCMA 2J9RA 3CRRA 5JJIA 1RRPA 1EFHA 3CRVA 3P1JA 4JJKA 2WWYA 4JLMA 1TQ4A 3H86A 1UEJA 3QEOA 1R5NA 4Q7LA 3VHLB 2VBCA 2IS6A 1COWD 3CRMA 4CIDA 4MA4A 4JVMA 4D82A 5IRCD 3FVQA 3SQXA 2GXUA 3TBKA 3CIOA 2CL7X 2QRZA 3BERA 4KU4A 5CITA 2IHBA 3E70C 4ITRC 4PC1A 2VHJA 3B85A 4BGDA 2VIIA 1GL9B 3DZDA 3K70D 1LS1A 1W1WA 1E2MA 3EZ2A 4Q18A 3RSOA 2ZM5A 1H8ED 2G83A 2EFDB 3LW7A 4JKIA 2IC5A 1J90A 3O8BA 4JL5A 3RC8A 2L0XA 4PPFA 1W36C 3OEHA 2GF0A 4BEBA 3FKSA 3OIVA 4JVLA 1P4SA 4TT3D 1Z08A 2J0VA 2QPTA 2O8EA 1XTKA 2LKCA 1OYYA 2HXYA 3PXGA 2IUTA 2GAAA 3A1SA 5ELXA 3PV0A 4TMKA 2Y8EA 4B71A 5FTMA 1JNYA 1ANKA 2D3WA 2R44A 4TL6A 5FOXA 2EFGA 3K9HA 3CWQA 3EARA 4XH9B 1PJRA 3K0FB 3U61B 6Q21A 1N6RA 2B7CA 3GLHA 3A1VA 2D2FA 2IK8A 4M22A 2BBWA 2W6JD 1UFQA 2OXCA 1S4QA 3GCGA 4BZXA 3M6AA 3WY9A 2GCNA 4ERNA 4CEIA 3L82B 1LVGA 3DM5A 4EDHA 1QG4A 1ZIPA 3RS4A 2BV3A 1VTKA 2PZFA 1BO6A 1QHHA 1YR8A 2RGEA 4R98A 4XWKA 2VHUA 1ZD1A 4P4SB 2H7VA 4ZI2A 4R71A 4QXAA 1J2JA 1D5CA 1U8ZA 1G4AE 3CH4B 3A4MA 3KXLA 1E2EA 4IRUB 4LC1A 1DS6A 2XB2A 5G3YA 5FUWA 4CW7A 4PZZA 3UATA 1KKMA 1NN3A 4NHOA 4WOPA 2XXAA 2RGCA 1W0KD 4BASA 1XTJA 1DAGA 4KFUA 1DTSA 3TNFA 4V0ME 1P7CA 5FBLB 1S9HA 2F7SA 3B60A 4CVNA 3GLIB 5JHGB 3RRYA 2FPKA 4FWTA 2HV8A 3R7WB 3FHOA 2WKPA 4C2UA 3A58B 3MD0A 1PVOA 4A6PA 2XX3A 3MSXA 4BRUA 2VTKA 4GFDA 2ZI4A 4HB3A 4P0TA 3H1TA 421PA 1NL3A 2ZJ2A 1B23P 1HUQA 4HEJA 1X8KA 1XXHB 1YE8A 1K6MA 3SFZA 4QM6A 5FBRB 3SJZA 1SQ5A 4B74A 4P3YA 2JLZA 4IHQA 3FPAA 3AF2A 2D7DA 2W0SA 2BEKA 2PCJA 3KB1A 1SKYB 3FOZA 4NYJR 3W6NA 2J0UB 5SZIA 2H5EA 2Q3MA 2QAGA 3ADBA 2ZROA 3KZ1E 2FGKA 3IBGA 1XEFA 2ZEJA 5KHOC 4DSNA 1S1CA 2BM0A 2JDID 1SHZA 5D3QA 1XBTA 1E2NA 4HB0A 1FW6A 3KUDA 4O2RA 2DHRA 5EE9A 3R9IA 4WW0A 1QHNA 1OIWA 1XDBA 2P6UA 5L3RA 2WJGA 3ZZUA 1T3LA 4HUQA 2CE7A 3SC3A 1GNQA 4DIDA 3THXB 1N5JA 3KJGA 2DFLA 1F2UB 2BMFA 2YC2C 3FWYA 4GZMA 2OFOA 2NPFA 1T9HA 2IYUA 1JB1A 1ESMA 5EXSA 4A0FA 1TF2A 1NSTA 2AXPA 2QZ4A 3W5IA 3GFOA 3AUYA 3QEJA 1RJ9A 2FEMA 2RGNC 1N0VC 3B82A 3PIRA 4KSBA 3U60B 3AVPA 1NLYA 3C5CA 3U44B 3PEVA 1CJVC 1ZRHA 2WOOA 4XTRA 3O8CA 3TAUA 5AUQA 4I1SA 4JVSB 3FMPB 3AKEA 3AVUA 3B2EA 2ZAOA 4LJ7A 5G41A 2G77B 4C7OA 2JCSA 3B6EA 4R2HA 3CONA 3VFDA 2JLXA 3BB1A 3U7HB 5JCPA 4AKGA 2O8CB 3F5FA 5BN3A 4GMDA 3B7GA 3UKDA 1ZM3A 4TMVA 3WMGA 2X8AA 2H92A 1KK3A 4TLDA 5C2JB 4RY2A 4XSHA 5KUTA 1JI0A 4PC3A 1VKJA 4V0OA 5FL3A 1M6NA 4TYPA 3HJNA 3VAAA 4LYFA 2HEIA 5CJPA 1P72A 3LBNA 2WOJA 5JI3E 4DWJA 5H68A 2EFCB 3SNHA 2ZRKA 4AKIA 1P2UA 3X1DA 3ADDA 4EPYA 3LD9A 4WZ6A 4LYJA 1IHUA 4Q9IA 3LV8A 5D3MA 1LS6A 3KJEA 4WXPA 1D2EA 4F4IA 4ESHA 2RGDA 3CKLA 5CK5A 4BRWA 2SHKA 2QMEA 4M2LA 2ZUDA 3TUJC 4DLYA 2JJ1D 4RFSB 3BORA 1E0JA 1T8TA 5JFGA 1TNDA 3NH9A 5J4VA 1HH4A 3AVQA 3BFVA 2CJWB 5FOUA 1IN6A 2ZREA 1W4CA 1Z0FA 4A8JB 2ZRNA 1MH1A 4DDUA 4B32A 4MYUA 4MYTA 3U6KA 2YHSA 3WP1B 4IOLA 3D6TB 4M9SA 4DBLC 2ZRCA 2Q21A 4MKIA 5TXGA 4ASUA 4D81A 1W46A 2R6DA 2EU8A 1Y3AA 4DIEA 2F43A 3ADCA 1ZM9A 2FZLA 4QJ4A 1E9BA 2HYDA 1R0YA 1W36D 1RFLA 2I1VB 2IX3A 3I61A 4ESVA 2CK3D 3EPJA 2FA9A 4HZUB 1FX0B 5JJLA 5FPHA 5FI0B 1XCGB 1NBME 1IJFA 4ILEA 2VEDA 5GVSA 4WZAE 3AP3A 1IAQA 2F1HA 2LKDA 2QGZA 2ZI7A 4JKYA 3THYB 4PZLA 2CLDX 1OKKA 1LNZA 3VX3A 1HQYE 1KZGB 1YR9A 3P4XA 1IBRA 2JJ8A 1VYUA 1KGDA 1U81A 4JIMA 1SXJA 2P5SA 2NO7A 1KDPA 2WWWA 4AKEA 2WWHA 4DCNA 4CEJB 3KXIA 4IJMA 3PEUA 4OJKA 2D06A 3V4FA 3CRQA 5J47A 3LO5A 4KAXA 3RRNA 3GMTA 3KKOA 1IXZA 2RGGA 2IS1A 1W47A 5JRZA 221PA 3CF0A 1Q0UA 3I5XA 5CK4A 2CHGA 1Z47A 5HE8A 1FNMA 2WJYA 1DARA 4TTPA 3HYRA 2IS2A 1TQ6A 2O8BA 5LDDC 5HE9A 4HAZA 2AL7A 3NHAA 4EPXA 3GEHA 2R6CA 2PMDA 1E79D 2IEZA 3SEAA 2IT1A 1JXMA 4KFSA 2ZU6A 4DB2A 1EX7A 2R2AA 1Z2AA 5JZVA 4Q5IA 1P2SA 4Q1EA 4UNSA 2J0SA 3CR7A 1BOFA 3GQBA 5JWRA 2XSZD 5HKKD 4DLWA 3FHCB 2AR7A 1WBDA 3QPWA 5LB2A 5H1YA 1KJWA 2ZYTX 3EZ9A 3W8RA 2QM7A 5GJWC 3KQHA 4JMPA 4BLOA 1W0JD 4IXNA 1NIJA 2JASA 1XB2A 4NMMA 4B35A 1OXXK 5GADl 4G5SA 2I4IA 4DT1A 5FTJA 3WBKA 2MMGA 2ZS7A 2AD5A 4I81A 1B0UA 2HLDA 2QP9X 3BBPA 3KTAA 4IEEA 3TAHA 1P75A 2C77A 2NO6A 1IONA 1N5IA 2FEOA 5EE3A 4C0AC 2ZPTX 4NTZA 2GILA 2DWQA 1UBCA 2KJQA 3R8FA 2A5YB 4LPKA 1KO8A 4U5XA 2DWOA 4E07A 1QRAA 3CUEF 4LHYA 4A6XA 1QHXA 4CT5A 1XTSA 5FTNA 1R2QA 2O8EB 1GSIA 4JLOA 2HYIC 5JMTA 4IFEA 5EE5B 2PJZA 4Q4HA 4RFVA 4B43A 3Q9LA 3MJHA 3FYHA 5BW8A 1VYVA 3AVVA 3VQTA 1YRAA 1ZVQA 3MWYW 2V7QA 2PT5A 4FCVA 1D8TA 4YMUA 4LC0A 1T0JB 4RKFA 1XNJA 2QUZA 4FW9A 4YMTA 4KYUA 5M04A 1W44A 3BH7A 1G1MA 3CX8A 2PLRA 2W58A 3GLHB 4O2LA 4OHVA 5EP4A 3L8ZA 3DEFA 4NCKA 1TPZA 4B34A 2EWVA 2KI5A 5EZ5A 2VP6A 1E2LA 2B92A 2ORWA 5E7MA 3K0AB 3VR1A 1M1YE 2NPIA 1KO1A 2IXGA 4NYIR 5FOVA 1QHHB 1BYUA 1KJZA 4HZIA 4OI1A 3K0FA 2G88A 2Q9BA 3K09A 4FMCB 2CLSA 5CM8B 4D0NA 4TN1A 3GJ6A 2C04A 4NL4H 5E7JA 4KO8A 3TKLA 4HSEA 1U0LA 2ERYA 4A2WA 2B6HA 3DPUA 3TVTA 2MSEB 4QGAA 4BECA 5KPJA 1OYWA 4BLTA 3H4MA 2XXAB 4MRPA 2Z6VA 3QKUA 3ZQ6A 3A1TA 4TYQA 2OCAA 2ZYWX 3ADKA 3K09C 3BFKA 1SZPA 2ZJOA 1P9NA 2CBZA 3B8HA 2C96A 3AF4A 1X86B 3PUVA 1IQPA 4G01B 4LJ4A 3IQWA 1KNXA 1Z0DA 2V8OA 3MWKA 1A4RA 1NLFA 1SVMA 3Q5EA 3SYLA 3IQXA 1CRQA 3U7FB 4JT2A 5BXQC 5KSOA 5AJZA 4HAVA 5J4LA 3TRFA 4WA7A 1YZGA 4L9WA 1XPOA 2BKUA 1CS4C 2F3TA 2X19A 3R7WA 4M4SA 2BHRA 4LV6A 2NO0A 4GI7A 5IK2D 3K53A 1WDTA 4PPQA 4WXRA 4D6PA 4BFWA 2VF8A 2QAGB 4B2IA 2DY1A 1EFTA 1CBUA 3THWA 1YZTA 4QOSA 1AN0A 3CNOA 2HJGA 5EXPA 1Z28A 3TSZA 3WXMA 2ZQ5A 3SHWA 2GCPA 4HUQB 2BJWA 1VYTA 4Q00A 5E3HA 3SYNA 4G5OA 3RSLA 2N46A 3UPUA 2O0JA 4GBMA 3QF7A 2C78A 1QZXA 3MJRA 1Z07A 3S1AA 1HEIA 5KDOA 2FDCA 5C18A 2ZETA 1VG1A 1U0JA 1VCMA 1G7TA 1RJ9B 2YV5A 3NG1A 4XVRA 5DH9A 4ZCIA 2ZS8A 3NEJA 2XEXA 1S9DA 3QVVA 1X6VA 3LBHA 3T35A 1AJEA 1TU4A 2QU8A 2IS4A 3WMFA 3ZQJA 2DYKA 4JBXA 2AXNA 2Z83A 1E9CA 3TLXA 3T1TA 4AI6A 4IDOA 1ESNA 1FQJA 3KFXA 4XD7A 3U4QA 5JS8A 4TZ0A 4C7OB 4YQFA 1Z6YA 4URUR 2WWIA 1OXUA 2CCGA 3BS4A 1JAHA 3CX6A 5HTKA 1DOAA 4C0BA 2XOKA 3LX5A 3REFA 5AR1A 3TVDA 3IEUA 3GPLA 2E1RA 2HCJB 3QKSA 3SN6A 5CDFE 2DPXA 4CT4B 2FPMA 4IVPA 2ONKA 1YZKA 3VX4A 1OXTA 2KBFA 2ZANA 4R9UC 2XB4A 3B9PA 1YKSA 3UIEA 4V0LA 2ZSAA 2H18A 3A4LA 1G8FA 1KO4A 3MRSA 2FNAA 2G1JA 2BMDA 3KDSE 4C4PA 2N42A 3MMPA 4G5RA 3W90A 2HF9A 3QPVA 1XMSA 4UNPA 5B58C 5E7IA 1YU9A 2MMCA 5FTKA 4KODA 3B1WA 1JR3A 5FPKA 5TY0A 4MUAA 1OXSC 2OCPA 4JSTA 3HU2A 4TQUS 4W5WA 1ZW6A 3AGQA 3B1ZA 3A4NA 2ZRHA 5KNCA 3CNLA 5LPNA 4TMTA 3WNCA 1KI9A 5EE0A 8OHMA 1ZNXA 1OXVA 3MWLA 3U6BA 3E5HA 2OESA 3DDCA 3C41J 4OYHA 2AD1A 2QT0A 2FFHA 3QXSA 4Z51A 2C5LA 4P31A 2UKDA 2IXFA 2BCGY 2ORIA 1JR6A 3GFPA 3KKQA 3VR5A 2ZE5A 3P32A 4WVFA 2AHOA 2H1LA 5FBWB 3TW8B 4RD0A 3GP8A 3BRWD 2JLUA 3OESA 2F43B 4UNNA 1OT3A 4A8JA 1UKEA 3DM9B 3QENA 4DLUA 4BFVA 2QGNA 2FJUA 1E9RA 1T3SA 3OAAD 1R10A 1M74A 2DCUA 4HLDA 4X8LA 5LB4A 3W3ZB 1J7KA 1FUUA 3EC2A 2FG5A 3BB3A 4KXFB 1MT0A 4DHEA 3OFND 4BLPA 1HE8B 1N6KA 1QBKC 3FFBA 1S3SA 4HUTA 4F38A 1NVVQ 2AWOA 1XPRA 3BH6A 1NIPA 2C2HA 3CPHA 4IVQA 2RGXA 1E4VA 1F60A 1Z22A 1MOZA 3M4YA 4A8JC 3PJRA 1WF3A 2J59A 4K46A 5K8UA 4BZPA 3KKNA 2PH1A 5AK0A 1VMAA 4I1VA 3JZMA 1PLKA 2R6AA 4BFSA 2CNWA 1YZLA 4D4MA 1SXJB 1YQTA 4LBVA 4ARZA 4MH0R 5L8VA 4ZKDA 1CRPA 1MO3A 1FP6A 2D74A 2ZRBA 4Z1MD 2I1QA 5CB8A 5FFMA 5CYOA 4QBFA 3THYA 1G5TA 2QE7D 3LWNA 3ZIAD 4MGIR 2V7QD 4ZO4A 3EX7C 2OO7A 1RE0A 2QQ0A 2QTFA 2W2XA 4LGMA 4AYWA 3AGPA 1A5TA 4JLVA 4DCVA 1A7JA 2IA5A 2XTNA 3EIQA 2O8BB 1GIAA 2VP4A 1QDEA 3LW8A 4ZDWA 3KUCA 1KI2A 2J5XA 3D8BA 5HZHA 2JIZA 3CPJB 4Y0VA 1P6XA 3JVVA 5CLLA 1BMFD 1E2JA 1EG7A 4C0JA 3SBEA 3WYAA 2W2TA 3LXXA 2OXRA 1OPXA 2RH5A 2V54A 4FI3C 4I1OA 4KV9A 4B76A 3IPYA 2ZRLA 1IN7A 1SKQA 4S35A 3W34A 2OCBA 3QUSA 821PA 4KVAA 1P3JA 1EX6A 2HXSA 2IYVA 3R8CA 4GOXA 2GDJA 4LV5B 3ASZA 2Z43A 3NBYC 4TLEA 3W8NA 5HR5A 4M1YA 4K8OA 1FZQA 4DT1B 3FTQA 4HAYA 2QAJA 3L0OA 4G5QA 3GJ3A 2GRJA 4OHYA 3KTAB 3ZZTA 4TYWA 1WP9A 3KKPA 4HLUC 3DKVA 4N1AA 4W7SA 1BYIA 5AJWA 4Q4LA 2OEPA 3VU9B 1JAIA 3OE7A 3K0SA 4R2IA 1DELA 5AUNB 4QFMA 4A4DA 2ASEA 4A36A 1EFCA 2MSCB 4PO8A 3ND8A 4URYR 3SU8A 1NNEA 4LYAA 4Q4HB 2PEYA 1SGWA 3DHWC 1VG8A 4LUCA 3X1ZA 1M7HA 1Z83A 2VSOA 2QPOA 3RS3A 5J4KA 4Q01A 4LWZA 3T1QA 1KKLA 2IYLD 3I62A 1TEXA 1OH7A 1T5IA 3NIBA 5CYPA 1C1YA 4ZCLA 4L4UA 1Z3IX 2BOVA 2LWIA 3EZ6A 1ZIOA 1W2HA 3D31A 3I4LA 1OE0A 2QROA 3L8YA 4UJ5A 3RNLA 3L0PA 2YOFA 2XJ4A 3C14C 3PENA 5F9FA 4NE2A 5JLJA 1NY5A 3IKJA 4US0R 3QVUA 4MRSA 5L3VA 4NZYA 3LXRA 3BOSA 3EASA 4HDQB 4D4JA 1G5PA 3V00A 3SFVA 3GLFE 2JJ2D 4TYYA 3BC1A 2ZUBA 5KYKA 2K5UA 2ZS9A 3K0AA 4AKHA 4OQMA 4B47A 2NOAA 4B75A 4C0KA 5J4YA 1WCV1 4EIWA 2BKEA 4TMXA 2P65A 4M21A 1OIVA 1G3UA 4LBZA 1JPNA 1ZU4A 2YINC 1DO2A 1TMKA 5H70A 3N5CA 4KCGA 3NC0C 1CXZA 4POAA 1S0UA 3HR8A 2ZJBA 3FMIA 5HZKA 4QL3A 2YVUA 5DSZA 2GJ9A 1G4UR 4BPBA 5G53C 5A5GA 4OKSA 3Q72A 1DAHA 3F3YA 3M1IA 1HA3A 3AF0A 3LFUA 4BFTA 5DI9A 3LLMA 4NCIA 3SDZA 4IOJA 2P3SA 2GZDA 1AGRA 2ZRPA 4Q4JA 4YDSA 4W9MC 4JLPA 1CJMA 3IBYA 3CBQA 2Q3FA 2V1XA 4MRRA 3EWAA 2NMVA 4Q9LA 3GLGA 2PZEA 1JPJA 3THWB 4DZZA 4I99A 4L15A 1L2TA 1IN4A 4O0MA 1NVUQ 2QQEA 3QJYA 4NPHA 3AVYA 4MKFA 1Z2CA 4D0LB 2VP0A 2XNDD 3S1AB 2Q0HA 2IF2A 1MABB 3VKHA 1C4OA 1F2TA 3FHTA 3FE2A 4Q48A 3QXHA 2WSSA 4GOJA 3RS7A 2BMJA 3OZXA 5K8LA 4TLAA 1M8PA 1Q57A 1FTSA 2BDTA 1W2GA 1KAOA 4ZDJA 3CNNA 1AKYA 1JXOA 1UJ2A 3DKPA 1Z6AA 3TQCA 5FTLA 1G291 3U4QB 5F9HA 5DN6A 1Q12A 2ZRMA 2ZSDA 1AZTA 2QAGC 2YZ2A 1CIPA 1G3QA 5DHFA 2ZE6A 2DFNA 3SBDA 2Q9CA 2CHQA 2ECKA 2N1BA 2AKAB 4LYHA 3AVWA 1WMSA 1H8HA 4LHWA 4O3MA 3QKSB 2WAXA 3FFAA 1D2MA 1TF7A 2KBEA 4QHSA 3NDPA 3RABA 2A2ZA 2PX3A 1XCMA 5DIFA 2RKOA 3BWDD 1CTQA 2RAPA 1KI3A 4WAUA 4RZ2A 1IXRC 2A30A 4X8HA 4AURA 1XD9A 2Q6TA 2OFWA 1DAIA 3VHXA 1E1QA 2WIAA 4OI4A 3VMFA 3UANA 4KJZA 1OW3B 4US1R 2F3RA 2RMKA 4QNMA 3U3KA 1G3IA 5LD2B 4TSFD 4G0NA 4A15A 2F1RA 2IYRA 2FN4A 2A78A 2QN6A 4OJQA 3BD9A 3HU3A 5FOTA 1SULA 3KJHA 4ZV4A 2V3CC 1P9WA 2VRWA 5KU1A 3AB3A 2VF7A 4EPVA 1E2GA 2ODBA 1S2MA 1X1RA 1WE2A 2WVJA 1KNQA 3P27A 1CJTC 4NH0A 2RHDA 2X2FA 4PC2A 1G41A 1RRGA 2WPDD 4S2EA 2WJHA 1QVRA 2J7PA 4Q9JA 2VP2A 1XD2A 1NVXQ 2MSDB 1KDTA 3HPQA 3FB4A 4FCWA 5LBIA 1NSFA 1YJ5A 1ZU5A 3MFYA 4Q9HA 1GILA 1EFRA 2QMUA 2J1LA 2XAUA 2VQSA 2VHTA 4II7A 3U3RA 2C9OA 5JCZA 4D26A 1DBSA 4OQFA 5IT5A 5IDVA 3T5DA 4PHTA 3BAFA 3QKRA 3W5JA 4CEHA 1GWNA 2ZI9A 1CP2A 1SVWA 3PUZA 4NKRA 2V55B 5FBQB 2QEQA 4XJXA 1XMVA 1KY3A 3SJCA 3VKWA 3OEEA 1KY2A 2IUUA 1GITA 5EQTA 3U3MA 4NCHA 3M0EA 4HYYA 2QMOA 3AQ4A 1F48A 2HT6A 2PMKA 3MCAA 2ZI3A 2ZRAA 1OV4A 2CXXA 4TLBA 3W3AA 1KI1A 5IHPA 4Q21A 2OILA 4ARZB 1RRFA 3UG7A 1WXQA 4E22A 1XXHE 3EAQA 3ZS9A 1GTVA 5EXTA 1P73A 2D2EA 3QXXA 3ZVNA 2WIBA 2DFTA 5ANRB 3U7GA 4B3DA 3I1FA 1D2NA 1MO4A 2GXQA 4Q1FA 3OEHD 3V4RA 1J70A 1SKYE 3X1WA 3FKSD 3QXJA 3WYFA 2FOLA 5A0FA 4KFTA 3QF4A 1NJGA 4GDFA 4YXWA 1XJ0A 1HYQA 4PSVA 1NJFA 1I2MA 4B33A 1G5RA 1AKEA 1E99A 3L0IB 4LBWA 2V1UA 5SZJA 1CEEA 4URVR 1G3RA 1VG9B 2GK7A 4HB2A 1YHNA 2FX3A 1ONBA 3WBJA 3F8TA 4M53A 4RCYA 3J81k 1P60A 1Z0AA 3RAPR 3EA5A 1PLLA 4FIDA 3LBIA 1ZUIA 1TEVA 1GKIA 1SXJC 1HTWA 1ZMXA 3HDTA 4XTCS 4AYTA 3AM1A 1CULC 4LJ6A 2PX0A 3LVRE 1Z0KA 3AVTA 3TQFA 4IXMA 4BEJA 4CYMA 1KK1A 1KI7A 4LRWA 4V02A 4HLQB 3BB4A 4DSOA 4MDFA 2ZE8A 4EPRA 5DE3A 1HY3A 3QG5A 1U8AA 4V0MA 2OSBA 1DADA 3EWSA 4JLJA 4MYCA 1HT1E 4LSGA 4XOIA 4A0RA 4NCJA 2EQBA 3AV0B 4B44A 3GJ7A 3LX8A 4OBEA 2BBOA 2FPLA 2W2VA 4KBGA 4AWXA 3QG1A 1YRBA 4EQ6A 1T8UA 3ZVMA 4BFZA 1SVIA 5SZKB 2J3EA 1RIFA 3BJIC 3RWMB 2OFXA 2O52A 4NBSA 1J8MF 2GBLA 2OAP1 2ZI6A 1V5WA 1RVDA 2IWHA 1NMYA 2OV2A 4IFBA 3EC1A 4IOKA 4EJSB 2B8TA 1N6PA 4PX9A 3VU9A 4QGGA 2JLYA 3PEYA 2W0MA 3NVAA 3T12A 4KLNA 1M7BA 3LQRA 1CJKC 3T15A 4M1KA 2GBLC 3PQCA 4DDVA 1YR6A 1ZNWA 2CVHA 3QQ5A 4NYMQ 4Q9KA 2ZITA 1P5ZB 4F93B 2OBNA 4M1TA 2C9YA 3T34A 1MKYA 3QNUA 2W6IA 1XJCA 5GJBA 3R9WA 4EKDA 2YNMA 2ZR0A 4FINA 1MO5A 3QY0A 3KX2A 4RZUA 2PJRA 4TMZA 4QM7A 1G19A 4DXAA 1RRCA 2AFIE 4RD1A 2YWFA 2PL3A 5AJVB 5B64A 1GL6A 4A0HA 3P26A 3Q5DA 4LJ8A 1E2FA 1QHGA 2JA1A 1U90A 4FCTA 1NMZA 5HCNA 2E9SA 5FL7A 5GVRA 2V6IA 1NY6A 2HCBA 4F4CA 5KNDA 2OM2A 3AP2A 2H57A 4GT1A 3U2QA 3B5JA 2G9NA 2FSGA 4C30A 2FSHA 4ZKEA 1G21E 1TF5A 4YMSA 1VHTA 4M1SA 1MO6A 4EFNA 1E2DA 4M9ZA 4W5JA 4ZPXA 2C9CA 1JQJC 4PSAA 4QG7A 1UKZA 2AX4A 4L5BA 3OIUA 4V03A 1G64A 1U9IA 3TR0A 1OIXA 5F3WB 3TSWA 2G0TA 5TARA 4DUGA 4B3FX 1HQCA 2G3YA 3NBFA 5EP2A 2RHMA 1P9RA 4LHVA 3RVBA 3OF5A 2EWWA 2GEDA 4H9GA 1P2VA 4G1UC 4DLZA 2IYXA 4AK9A 1JEEA 1XU4A 4TTQA 4Q4JB 1A2BA 1ZUNB 4HDCA 5BYJA 3GLGB 1OHHA 2TMKA 1ZBDA 1U9IC 5JI2E 3MAAC 2B21A 2RCNA 2FWRA 3G5UA 1M2OB 5JJKA 3WMEA 3LRPA 1ZYUA 4F92B 2ZR9A 3CLVA 4YONB 2WMOB 4Q4AA 5E4FA 2AN9A 4OQXA 5TMPA 3G0HA 5P21A 3AVXA 1COWA 2OAQ1 1LV7A 1F2TB 3B13B 2WHXA 1WQ1R 3ZVRA 3I32A 4CZ2A 1YZNA 1E2HA 3Q7PA 1DG3A 4ZIRA 5FUVA 1GAJA 3NH6A 4U7DA 3QI2A 2OLJA 4I1UA 4M1OA 3G82C 1KJYA 4J0QA 2PLFA 1MV5A 4QHTA 4KSCA 5CJ2A 1VIYA 2F9LA 2GWHA 1K5GA 1H8EA 1E1RA 4PC7A 2IYWA 1MABA 3RWOA 3VTKA 1TL7C 5FPTA 3ASYA 2QENA 4ZDKA 2DWPA 3WRYC 1NBMA 1Q1EA 5EP1A 4URWR 4TT3A 5K8TA 4ASUD 4US2R 1G6HA 4RD6A 4AC9A 2WJVA 2FH5B 4LCBA 2JGNA 4MYHA 3K70C 1GOTA 3F0TA 4PHGA 2CL6X 3TIFA 3QKTA 3NHBA 4H1UA 3H84A 4LX0A 5CB6A 1I4LD 4QGFA 3VR6A 2DBYA 3QIAA 4KHZA 2FZ4A 4OQLA 1Z8FA 3VR2A 3WHLA 1XEWY 2QNRA 4Z8XA 1KO7A 2ZRFA 2XGJA 4PTLA 2FE4A 2W6JA 4JSYA 4QKQA 2XZLA 3IHLA 2AFHE 2J0QA 1OKKD 4FWIB 3LY5A 3EA0A 3I5YA 4PANA 5JSZB 1S96A 4IDNA 1R7RA 1OH6A 4F4JA 1R6BX 3BIFA 3Q85A 1Q1QA 3TUIC 3A6PC 4X8OA 1SXJD 1KI6A 2A9KA 2J41A 1R4AA 4LJ9A 4NCNA 4OQNA 1S1MA 1LW7A 4GZLA 5HPYB 4L16A 2X77A 4NU0A 4WBSA 1TQ2A 1IY1A 1II0A 2QP3A 3GLHE 2JEOA 2VHQA 1XEWX 2QL6A 4Q1DA 1II8A 1G6OA 1CKEA 1OLOA 2QG6A 4M1MA 1R5OA 1AQYA 2ZRGA 4HAUA 1W0KA 1XD2B 5EZ6B 2ZUCA 1G16A 1HT2E 2D62A 2NQ2C 1XP8A 2YYZA 4DCSA 2IYSA 1KTVA 3ZVLA 5C4MA 3GEIA 2ZXUA 2HJVA 2W00A 4V0NA 1FMJA 3QKRB 4A2PA 4CEHB 3I92A 5DNYB 2NG1A 4C0LA 4B3BA 5DGXA 1ZM2A 1T3HA 5LD2C 2ZTSA 3IDQA 3K0EA 1GNRA 3HP1A 3CWZA 5KOYA 2QSYA 1VG0B 2ANBA 4GP7A 2AK2A 4Q1CA 2PZGA 1NKTA 3IEVA 4QBIA 3EIEA 1GZSA 1K5DA 1KAGA 4HAWA 4PSKA 5KNBA 1XD8A 3CB4A 1UBGA 3MUFA 3QOFA 4AIIA 1R0ZA 2X2EA 4MGZR 1U0HC 1VIAA 2HLDD 2A5FA 1LF5A 2VP5A 2BCJQ 2KB0A 4PAMA 5TVKA 4EPWA 4NYJQ 721PA 2AK3A 1E0SA 4L8GA 4Q7MB 4DDTA 1N6LA 2REBA 5JEEA 5KO2A 1RW4A 1TQDA 2ORVA 1XPUA 3N2EA 4C9BA 2P0EA 2ATXA 4PO9A 5KSYA 2O8FA 3GLFB 1L4YA 4MDEA 4KLZA 3QF4B 4XSGA 3T1OA 4KFRA 3T61A 1GUAA 1W48A 5DO9A 3ONWA 2WBLC 1RYHA 2ODNA 2BVNA 1GVNB 2EYUA 2WKQA 1CJUC 4UKDA 5FR1A 4D25A 3WP0A 3NEYA 3CPEA 4Q1AA 4DCUA 1KYIA 2RB4A 2CE2X 2VO1A 3H2YA 4LY6A 3T06B 2JATA 3KJIA 3BXZA 1E2KA 3NWJA 4O25A 4TLCA 3SOPA 2IW3A 121PA 4LK2A 2GF9A 4M1WA 3VR4A 1OH5A 2ATVA 2CMKA 4GMXA 3LAWA 5FI1B 1I4TD 1QHYA 1M7GA 4AYXA 4ACAA 2QRNA 5G40A 4PHHA 1ZNYA 2ZRDA 1US8B 4OHWA 2QTVB 5KDLA 4IKEA 1Q20A 1JEDA 2BBSA 1ZJ6A 1AM4D 1MR3F 2F6RA 1M34E 1DAEA 1Z6TA 5FPYA 3LH5A 2XTZA 3WHKA 4C0QC 2REOA 5C4GB 4M9QA 3CRW1 3W6OA 3DZ8A 1G3MA 3K0CA 4EQ6B 2BBTA 1U8YA 1NVWQ 3B9QA 4QRHA 2QBYA 4OI0A 4MGYR 4QGHA 1Z06A 1GP2A 1E9SA 4DDWA 4L9SA 1W5TA 4M8NE 5B30A 3UWKA 1DG1G 1HURA 1KDRA 3K9GA 2GJ8A 3HU1A 1ZP6A 5JWHA 1CU1A 2WSMA 1UM8A 5CIQA 5C46F 5L3SA 3I3SR 2H8KA 3W9YA 1TX4B 2YWEA 1FFHA 2JJ1A 4RVCA 1GFIA 1ELOA 4DSTA 4EUNA 1WA5A 4JS0A 4LDJA 1DE0A 4PZYA 4EPTA 2NO9A 2YJTD 1J8YF 2A7QA 2IUSA 3O8DA 4QNRA 1OHHD 1E9AA 1HV8A 1VECA 2GJAA 1G7SA 1P2TA 1XMJA 2IEYA 4ON9A 2WTUA 5FPSA 3T5GA 2IXEA 4PAOA 2ZI5A 4CF7A 2ZSBA 1CR4A 3NC1C 4EJSA 1Z0JA 2NZ8A 2IHYA 4YLGA 5TDHA 2VPPA 4PQYA 4Z8YA 3ZJYA 4TQ9A 3EXAA 1KSGA 1O3YA 4WZBE 2CL0X 1T5LA 1QF9A 4TL7A 3DMNA 1GRRA 2ZE7A 1O87A 3L43A 1NI3A 2FMXA 2CK3A 3UG6A 3WNDA 3FDIA 4Q47A 1KK2A 2D4HA 4EJSC 5A4JA 1ZC4A 1EGAA 1OSNA 5GJVC 1DAKA 2FSFA 3LA6A 4DKXA 1R5BA 3K1JA 3CW2A 3NBZC 1ZAKA 1E1RD 1G9XA 4PXAA 3O8RA 1RKBA 4MQBA 2F9MA 2OG2A 3KKMA 4XVQA 4YDHB 1IOZA 521PA 4C0HA 1NBMD 2KSQA 3NKVA 1XCPA 5CDFA 3THOA 2Z5FA 2CDNA 3X1XA 3W6PA 3U5ZB 4AY2A 4LPSA 3ZYCA 4FMBB 4XD7D 2J46A 1E98A 2IYTA 4UNRA 3IUYA 4HLCA 1A1VA 1MRSA 1Y63A 4TL9A 2GZAA 2XZPA 2VP9A 1C9KA 1A82A 1FMLA 4IEIA 1GRNA 4Q03A 4QBGB 4QJ5A 2XOKD 5DHAA 5HCIA 1WBBA 2OBMA 1ZD9A 5DYGA 5FR2A 4EFLA 1SXJE 1GL7A 2GJSA 4B2LA 1YZQA 4RJLA 2E87A 1D9ZA 4LJYA 1E79A 4HDOB 2ZSFA 2V9PA 3QSYA 2O8DA 1KSJA 5BWMA 5JWOA 5K8IA 1JJVA 4RKEA 2GEVA 2KE5A 2KWIA 4LJAA 4Q4AB 3KQLA 1KI4A 2OUKA 2XSZA 3CZPA 1JR3D 1W49A 5HKKA 1CR1A 3IGFA 3NBXX 3ZS8A 1IN8A 1XJQA 2NIPA 1P61B 4B2PA 1W0JA 2ONJA 4ZIRB 4UXJA 2UZ3A 2YOGA 2J87A 1KDOA 3VNVA 3FMOB 3LVQE 4DLXA 4DCTA 1P62B 4JLKA 2PEZA 2WJJA 3REGA 3BH0A 3C5HA 4A92A 1OFIA 5JBQA 3K70B 5FOSA 3KXKA 1JJ7A 2GXSA 1R8SA 3GFTA 2DFKB 1LF0A 2FGJA 2GA8A 2HDNB 3PEWA 3HR7A 1BIFA 5DISB 2IYQA 1X8LA 2IWRA 1R0XA 1CR2A 4A0GA 1T4GA 1IJEA 1XRJA 3U7EB 1QVAA 2NGRA 4TTRA 4XVUA 2DR3A 4OHZA 1E4YA 2QP4A 1GM5A 1RZ3A 4LHZA 1N2CE 4NP6A 2XITA 1NVVR 2YWHA 1G7RA 4LJ5A 4Y0AA 4N0DA 1GKYA 1ODFA 4QC2A 5AJYA 1Q44A 2BWJA 1QHIA 2GEUA 2RGNA 1NKSA 1PUJA 2OCYC 1UKVY 3L2OB 3AH8A 1N5KA 2W83A 4FMDB 5DI3A 3RS0A 3ICQB 1IY0A 5IF9A 2D7CA 4B73A 1XWIA 2QA5A 4YMVA 2CNWD 4B6EA 5B57C 2Q9AA 4IDQA 1KI6B 3A1UA 1W4BA 2A5DA 3DOEA 5EUMA 1W4AA 4MRVA 1E32A 3KB2A 2PT7A 5E95A 3RHFA 1HE1C 1UPTA 4CDGA 4Q66C 1F5NA 3EW9A 4NYIQ 1KMQA 1II8B 1W4RA 3NDBB 4DRZA 5JSZA 2ZJ5A 3DMDA 3Q8XB 2NO1A 5KSPA 4HATA 2JAQA 1WB9A 1UADA 2JLWA 4TMWA 4OI2A 4P33A 4JLDA 4UXHA 2ANCA 5DLQC 1Q1ZA 4K81B 1FUKA 4U00A 5GJCA 5JHHB 2GESA 3P20A 1L4UA 1F6BA 621PA 4MUBA 1E2PA 2GCOA 3AUXA 2JIZD 5G3ZA 1BH2A 1L7VC 4GSYA 1PUIA 2GJKA 1E3MA 4N3NA 2NZJA 4ZDIA 4YMWA 3VR3A 3B1VA 4GOKA 2QM8A 1FL9A 1XF9A 3X2SA 1OFTA 1AS0A 3TR5A 1G8GA 1Q3TA 4RSGA 5IK2A 2PBRA 2ZJYA 4AG6A 2WJIA 1E6CA 1D9XA 1E69A 3EPHA 1N6OA 4A1FA 4Q1BA 1G17A 2JLQA 5TB5A 5BN5A 1E94E 3IIMA 2QSZA 2QT1A 1NG9A 4RZXA 3GLIE 4PPGA 1AQUA 3NTUA 1KI8A 1N0UA 1ZD8A 5CLQA 1RPZA 1XEXA 1ZM7A 3SZRA 4ZI3A 3EPLA 1KMHB 2OE2A 1V43A 2R6GA 2GKSA 1FPMA 3OE7D 4OK6A 4Q19A 5AUPB 5DYIA 4JLBA 3RDPA 4JLNA 3FKQA 4ABYA 2O8FB 1QHSA 5JRJA 1KHTA 2G1KA 1W7AA 1G8PA 1VCNA 5FH9A 1ETUA 1YR7A 4HI0E 1SHKA 4RD2A 1T91A 4RD3A 3R20A 4LV8B 4KITB 1XZQA 3X1YA 4DJTA 4DLVA 3CR8A 4WIAA 1LY1A 2ZRJA 2UVQA 3PFIA 1AS3A 1TADA 4BQSA 3GJ0A 2WMNB 2WAYA 4OK5A 4B6FA 4XWOA 3DOFA 3UMRA 3AKDA 3UXMA 5L3QA 2G0NA 3GLFA 1X1SA 3SJBA 1WRBA 2P6NA 4JT4A 4CGZA 3ZGXA 2AKYA 2X1VA 3ZD7A 1MRNA 2Q3HA 4NDZA 3RS5A 3PR1A 1UEIA 4FMDF 4JBWA 3AVOA 5KTYA 2Z4RA 2VA8A 3CF6R 3KFVA 1JBKA 2YOHA 1DAFA 1LTQA 1EFUA 2IBMA 3C7KA 1H65A 4GPTA 4XWAA 1XTIA 3A8TA 2JLVA 2QBYB 3TSOA 2OBLA 2RGBA 4GNKA 1US8A 1UDXA 4AD8A 2WWGA 4P4UA 2IYYA 1TU3A 1Z5ZA 2F1IA 3BFXA 3LNCA 2WWFA 3KQNA 4FXPA 1ZCBA 3JVUA 3A1WA 1PV4A 5L3SB 4IW3B 4BFXA 3TH5A 5BN4A 3RRMA 1X8JA 1ZUHA 3MWJA 3SS8A 3OIWA 2V6JA 1U98A 1N6IA 4PC6A 2O0KA 4PAQA 3UMFA 1TUIA 1JR3E 2WZQA 3JZAA 5JECA 1JQLB 4LZZA 4PO1A 1I2DA 1N3BA 1E9FA 2UZIR 2CEAA 1TAGA 3A36A 1OFUX 4W5HA 2BMEA 3ND9A 4P4TA 1EXMA 1SVOA 1VHLA 3RS2A 1XX6A 4FN5A 2FSIA 3PG5A 1E9DA 1EWRA 3AF1A 4DLSA 4R7ZA 4G3XA 2R6FA 4RCZA 3U3JA 2QTHA 3E1SA 1Q3HA 3UMSA 1W36B 3SI7A 3OAAA 4URZR 2OLKA 2AWNA 4NONA 2O5VA 1DO0A 1DPFA 3OFNA 1Z6XA 2RGAA 1N6HA 4BFYA 1A2KC 4M0LA 2XTMA 1R0WA 3I72A 1E9EA 4H1VA 5J5CA 3SJAA 1AA9A 2CCKA 3GD7A 4IDPA 4KVGA 4D0GA 4DC9A 4HAXA 1I4DD 1UF9A 5FOWA 2R62A 1II9A 2WSSD 1S3GA 1N0WA 3GJXC 1Q21A 2HF8A 3PITA 4C2TA 3RC3A 4Q7JB 2BJVA 4BE7B 2JLRA 4IOMA 3RLFA 4BZQA 4F91B 2BC9A 3P4YA 5KSZA 1G8HA 5JEDA 2VLIA 4Z1MA 5DN6D 3N2IA 3ZDQA 2FU5C 2C8VA 3RANA 3HYTA 2QE7A 1OF1A 2G6BA 3ZIAA 1L8QA 1XMIA 2QPAA 1CR0A 1VPLA 2ZYVX 3GJ4A 3CH5A 4LHXA 3DVLA 4DEXA 1E2IA 2ZU0C 1SVKA 1H8HD 1U94A 4B3XA 1ZINA 5F2EA 2ZSEA 4FD2A 2IYZA 4BWYA 5BQ5A 2Z4SA 2ZVPX 3AF3A 1E2QA 4DB4A 2GNOA 4CEIB 2IL1A 3EIHA 3ZZ0A 4F7WA 4UQOA 3AP1A 4M9XA 4GP6A 1NP6A 2CVFA 2VYFA 3LQQA 1W5SA 2GETA 4BLRA 5EJEA 1BMFA 2O8DB 3VKGA 1Z29A 4PFSA 1FP7A 4DEYA 4PQRA 3WRXC 2BEJA 2ZRIA 1E1QD 2ZYUX 4JJZA 1RYFA 4LI0A 2ZJAA 5FUXA 5C1BA 4EFMA 1CLUA 3NXSA 2FFBA 2P2LA 3SR0A 3BK7A 4HB4A 1KOFA 1NN0A 4D4KA 2P6RA 5UKDA 1DVRA 2NTYC 1XFAA 5JS7A 4N0EA 2GHIA 2WKRA 1FQKA 2XNSA 1SVSA 2BIFA 3K8YA 1KIMA 4P4SA 4MITA 2FV8A 2QORA 2QI9C 3KQKA 4U02A 1Z63A 2O0HA 4OL0A 1X3SA 3FMFA 1J99A 3IIKA 4DLRA 4Q02A 1IN5A 2VH5R 1OB2A 1XZPA 2J7PD 2OZEA 1OFHA 1GDDA 3VNUA 1YZUA 3CO5A 1E0AA 4D2IA 3C8UA 3GLIA 2B8WA 3L0SA 1EFRD 1FOEB 1DAMA 1N5LA 2C99A 1PLJA 4TWZA 1KK0A 3K9LA 3I73A 4Q7KA 3ECCA 1BKDR 1JECA 3CF2A
chains in the Genus database with same CATH superfamily
2ZPAA 2ZIGA 2I80A 4F6LA 3DO6A 5KSWB 4FNMA 4YAWA 4JI8B 3FSJX 3S8EA 5F9MA 4N6GA 4RSRA 1MOPA 3H0EA 4DAOA 2XECA 5J58A 4R51A 5JCJD 4LF4B 1R8QA 3ZVKA 2G4LA 4L02A 3P9PA 1RM4A 1D7AA 2QY9A 3I6YA 2Y05A 1NUHA 1FRNA 4MRNA 2RONA 2ZT6A 5FUYA 5B2FA 3PLAE 4ZVTA 2BGUA 3C3BA 4DGSA 5HM6A 4EAQA 3JYOA 1KEWA 1USKA 2PXCA 5B7GA 1V8OA 2F1JA 3DHNA 5BY2A 4RBNA 3RYIB 1ND6A 2TYSB 5AXAA 5AKXA 4B31A 2IUEA 3T7EA 1ZNZA 3AI3A 1R37A 3FY4A 3Q2IA 2OC9A 4MSUA 2WM9B 2ZKLA 4UHHA 5JQGF 4WNIA 4PLHA 1JJIA 2W11A 4YT5A 3WRWA 1WHTA 4B3HA 3RRZA 3E7FA 5G4LA 3RAEC 4BV3A 1RXIA 3EFBA 1I1QB 2JJ2A 5ALQA 1M2NA 3UPTA 4NE7A 2K6GA 3RC7A 3GN1A 2WY2D 4B2YA 3UGJA 3E9CA 1Y8QA 1U2SA 4PR3A 4A82A 1F8FA 4JYCA 4OQEA 3T4EA 3V1KA 2WB2A 2I8CA 3TE6A 2R96A 3CEMA 3SQWA 4O4JF 3UJAA 1BEEA 1PYDA 3DTVD 3LUDA 4RMIA 4MVJE 2GCOB 3UY4A 3SIPA 2E5LB 2OV4A 3GJ5A 2NYAA 1KO5A 2CFIA 4OP3A 2JS7A 2EW1A 3OUTA 3SSAA 3ULKA 4CM3A 1J1UA 4ZANA 1KSFX 3BGWA 4BO0A 1MO2A 1M0EA 2Y71A 3OZRA 4IIGA 5H8WA 4DY6A 2Y27A 4OFZA 5FFNA 2P6MA 5D51S 1MOQA 4IS2A 1WPRA 3QPCA 1TUEA 1Q74A 3M34A 4R40A 4L4SA 1KZ4A 3N70A 4QXQA 4JVNA 4IX1A 4CIWA 1LFAA 1PE0A 2OZVA 2W6MA 1SG9A 4TKZA 2Y68A 2YH2A 3ZY6A 4ZVMA 3WL3A 4EGCB 3FOWA 1FYVA 2GJ4A 3PDWA 2IF0A 2LGJA 3W8EA 4HX9A 2WSIA 3R0XA 4NSNA 4HFJA 4O33A 3C6MA 1T6NA 2J67A 3MYYA 1UZUA 4OUDB 4YHBA 1UK7A 5AJXA 5KREA 4AG5A 3CKMA 4JUIA 3WA7A 3DE6X 2W98A 1ZCFA 2VWGA 4GWKA 3KQOA 4OFWA 4PQFA 4F1WA 1EBFA 2VSFA 1A2QA 2HK8A 4WCFC 5L51A 4Y6OA 2P67A 2Q2QA 4P32A 4DA7A 1GG2A 3EXHA 2Z57A 3DEIA 4ILKA 2WQ6A 3DHVA 2W2NA 2EFHB 2Y4NA 1WMBA 1ULUA 3ZJ5A 3GLGE 1QJ4A 5C81A 1P4AA 1JIUA 4F04A 1WSDA 1UH5A 3I9KA 1YRLA 4RYLA 4NEGA 4R1NA 2CJWA 4JLAA 3PUWA 2ODWA 3OVMA 5I9BA 1PIWA 1JHYA 3TDKA 1MQ8B 2A5JA 1KZ7B 1P8JA 4IBOA 5AI4A 4AJPA 4ND2A 2GAFA 1CE8A 1N5OX 4H4CA 5CEEA 5IAOA 5AWFC 3VZQA 4M83A 7GPBA 2I99A 1OU0A 2PWBA 1NV8A 2Z8XA 1QNLA 2DECA 3AI2A 2E6KA 3R3JA 3CZQA 1OB5A 1QYXA 4GYKA 1TCVA 4WXMA 2FQ1A 2DM6A 2DJIA 3OZSA 1MN6A 2RDMA 3IIJA 2I67A 4KI0A 4ZCSA 3O1HB 3QXCA 3F97A 1H4VB 3U3ZA 3WLKX 4P34A 2J3IA 1X1CA 3LZ6A 3EOAI 5BN1A 3Q3JB 2CYBA 3A14A 3AM4A 4NCXA 3SZGA 1G21A 2IJGX 2XUAA 2P4QA 3DBIA 1XRSB 5EKTA 3TL6A 3WDLA 3KCQA 5CNJA 5J4HA 2JG3A 4CHTA 2FWNA 2QVGA 1DRJA 3OT5A 1FX0A 3VYTB 1UXHA 2QHXA 4G5GA 4D80A 3NUGA 2GA9A 4I6JA 5GZ6A 4RS3A 1RAHA 1IBKB 3EZFA 5I9LA 2I54A 4H60A 4GYYA 2ZWMA 3PUXA 1ORWA 4UEWA 4RNDB 2Z4TA 5JVDA 2AQ8A 3ACBA 3M6FA 4LOAA 3RD5A 4F3YA 2CFRA 2FWAA 2BKVA 5DYNA 3I12A 4BQRA 4H6PA 1AGPA 3P2EA 2B4KA 3D1JA 2I1LA 5E6UA 1WSBA 1FFSA 1Q95A 2QLFA 5DX1A 3U3OA 3PXXA 4H08A 4CTNA 5TV2A 1IM2A 1KH3A 3HJCA 3PHGA 3T4PA 2ZM6B 5HG0A 1DZIA 1QYDA 2HWYA 4JL6A 5EXXA 5TMBA 2B7BA 3ENNA 1AK2A 4V2UA 4N39A 3W5DA 3BGOS 2Q4TA 2WV9A 4JZKA 3G7SA 1Y1RA 2ERXA 2YWCA 2V74B 4BX3A 2P41A 1QUFA 2EVWX 3GQBB 5I9TA 3RW9A 3WKDA 3A37A 2Q2VA 1SVLA 1XYVA 2GAOA 5TQ2A 3R6WA 3VU8A 3ZLJA 4C6RA 4LBYA 5EP3A 4IIVA 1SBIA 3NUQA 5KYXA 5HF6A 1T0IA 2P2YA 2J9RA 2XMQA 3MA0A 4FU0A 4LKRA 4ZO7A 4CV1A 4BAZA 4F60A 3O7MA 2R5FA 3FZEA 4PONA 2XNCA 4GNRA 5CT9A 3GY0A 4TV8A 2C2YA 3MJFA 2RK6A 2NM0A 3QEOA 1VHQA 4PGGA 1R5NA 4MVJH 2B3DA 2Z58A 5H81A 3UB2A 2VBCA 3LKZA 4XXHA 1COWD 3K9BA 3D6AA 3ZTTA 2C7OA 5EHXA 4WERA 1EKXA 1UP6A 1HE4A 2OC4A 1DMSA 3ITNA 5D1HA 3D6JA 1USUA 2DTEA 2OXEA 2PGNA 2QVZX 2PZ8A 3AETA 3VNRA 1K92A 3CT4A 4DC1A 1RJDA 3ZJUA 5CITA 2R6JA 3GC6A 3IVGA 3DT8A 4B3MB 2Q4DA 4ITRC 4PC1A 5EQFA 3DZDA 3MINA 4OYYA 4WE3A 1E3TA 1J49A 3EZ2A 2ZM5A 1H8ED 2ZIFA 1PZGA 1R4MA 2IC5A 3WYEA 4RIFA 4YCMA 4EENA 4D41A 5A0VA 2DCMA 2P2DA 1OXKB 2L0XA 3HKEA 3O8BA 4MVJG 1MW8X 5JQGA 2XMPA 2NV6A 4JVLA 1NFFA 1V2HE 5DSTA 4DOMA 2O2EA 1A9TA 3WWZA 1XTKA 3GRYA 2CJFA 3HADA 4CUZA 1ZS9A 5IUJC 3DE5X 3OLWA 3TLEA 5AM4A 2K4MA 5CAEB 4ZC8A 3DSRA 3F2IA 3GLSA 4FLMA 3PV0A 3OFKA 2Y8EA 4B71A 1OXMA 2ID4A 3DGEC 4TKUB 5G02A 1ANKA 2HO5A 1MLDA 2O2JA 3BMCB 1HNNA 4GUAA 5DGCA 3O82A 5C37A 3VR6D 4HADA 3L4BA 4O4JA 5B3JC 4Q3AA 2XMBA 3K0FB 5JXGA 4S05A 4XWYA 6Q21A 2C7PA 1GNSA 2B7CA 2EP5A 3NHSA 1O94A 3UJ7A 4RHUA 4YDQA 1IXYA 4QOHA 2IK8A 2P40A 4BGEA 3DB1A 1IWBB 4EG4A 2Y6VA 3IYLW 5KOJB 5JV5A 1KC1A 2JGEA 3CG4A 3ELDA 3M6AA 3WY9A 1Z8DA 5CFMA 1M83A 2RD2A 4PLFA 4REOA 2UYOA 3OLXA 2KS6A 5CW2A 1EK1A 2Z5GA 2C1XA 3VI3B 3Q7IA 2APJA 4R98A 4Z53A 1NVMB 4XWKA 1GNTA 3W04A 5EIAA 2VHUA 2H7VA 4YVFA 4R71A 1ZI6A 1J2JA 3IV9A 4KJXA 3CH4B 1EGQA 1P5RA 4Q12A 1E2EA 4K26A 1JZQA 1DS6A 3DWGA 3THYA 4CW7A 3W7VA 4NHOA 5JCOC 1RBMA 4WOPA 2A9OA 3P71T 2XXAA 1FP4A 1B93A 1W0KD 5A1TA 4IWNA 4ZALA 1DAGA 1EWYA 1DTSA 3MEQA 1P7CA 3ZV7A 2F7SA 1SHJA 4CG2A 1AHNA 3LF2A 4Q37A 2QRUA 3WSVA 2PUGA 3PQFA 1ORDA 3ZGNA 3OECA 3CUKA 4E7OA 2X1MA 2VTKA 3K05A 4GFDA 2QQGA 2ZI4A 3DPIA 3L7YA 1LNQA 3H1TA 4HB3A 4HR7A 2I65A 3ASVA 4K28A 2Y1KA 4W9NC 2AX3A 5J9FA 1W4LA 2CNDA 2ZJ2A 3VYWA 1LK5A 5AMXA 1YE8A 1K6MA 3WR5A 2GARA 3IESA 4JJ6A 2XYHA 3FCOA 4NICA 4GKKB 5JAPA 4X3PA 1U8TA 3I1JA 3RRFA 1KY5A 1ZITA 1YR3A 4EW6A 3CHYA 3AF2A 1GG5A 4M46A 3ZD9A 4R1UA 3FOZA 4RE6A 3PYLA 4XQEA 4B8ZA 5CNMA 5JSKA 4CU2A 3CVXA 4DG5A 1DC8A 5SZIA 2X8BA 4PQGA 2EP7A 2Q3MA 3MOSA 3B3GA 4RL6A 4NNPA 2HY7A 5D7BA 5JC1A 3O2JA 1BA2A 3PK0A 4ZHQF 4GD3Q 4FEEA 1XCJA 3P9ZA 1S1CA 3A25A 2X4GA 1HEYA 4EATA 4HB0A 4YX9A 2EAUA 1OZFA 5F7OA 1AURA 1RPNA 1RQGA 1QHNA 2P1ZA 2P6UA 4WW0A 2GX6A 1GDTA 2VHYA 3V2HA 3THXB 1J1ZA 3KJGA 3ETHA 4CFZA 1ONOA 3FWYA 4UU0A 2DMRA 4GPD1 5DHRA 1MQSA 1T9HA 1ILWA 1JB1A 2AH5A 2Q2OA 2DKNA 1PWHA 1E3WA 3K5PA 1BE1A 1KGSA 1RJ9A 1WCYA 1PR4A 1P9LA 3A1EA 3QEJA 5DF1A 2LCQA 3PIRA 4KSBA 2YIDA 1TRKA 2WNIA 3O93A 1TO6A 3EQ2A 3I5MA 3LPNA 4IP0A 4LRXA 1NLYA 3U44B 2A7XA 3PEVA 1CJVC 3D7RA 4A6EA 1ZRHA 2WOOA 1U9CA 4EITA 5AUQA 3AONB 4L5YA 3ZU3A 2D1FA 3DBVO 3FMPB 1OA1A 5CURA 4N5NA 5J5VA 1O5OA 2C2MA 1GDHA 1YNOA 2HNAA 2ZAOA 3B36A 3ITKA 2G77B 4K9DA 4LJ7A 5EKDA 4HVLA 4JYMA 2JCSA 4RNCA 2CFSA 5HGXA 2XD9A 2YUIA 3U7HB 1UQUA 3UOWA 2K2QB 3MELA 3WLJA 4RV5A 3BD8A 1XZDA 1W35A 3DUFA 2DHDA 4GSLA 1YBHA 5B58T 1FDVA 1K6JA 5J2UB 3TE7A 3GZJA 5FL3A 1O9BA 4TYPA 1I3CA 1TT7A 3HJNA 2Q4BA 3OWHA 2CXPA 1XDUA 2VI5A 2BGTA 2X0DA 4I0WB 4OG2A 4N5DA 2AS0A 2CXQA 1PFQA 3KT0A 4FFWA 2Y9MB 4MARA 1ND5A 1QS0A 2E89A 2WOJA 4MAMA 1F51E 3PI6A 4TKMA 2FPWA 4JQCA 4JI5B 4AKIA 3DFIA 3NLLA 1K66A 3F8SA 5FUBA 5DCLA 3SYRA 2DQKA 4G4GA 3DDWA 3JQAD 5HFAA 4DNFA 2H4WA 3F74A 4F4IA 4ESHA 4L8LA 3DE0X 1XVTA 3BHNA 4OBXA 5T6MA 1KE1A 3CKLA 5CK5A 1KYTA 4KWHA 1HLPA 3WIOA 1A4XA 2QD5A 3COVA 4GF5A 3TTTA 1W0CA 1WUTA 2V97A 4OQDA 4PCUA 4WCDA 5JW6A 2PSJA 5EWLA 3SHTA 3AVQA 1GQ2A 1KQGA 3MJEA 2P1DA 2ZREA 4A5OA 3RUDA 5EQJB 1W52X 1M2WA 4DDUA 3NVMB 1Z4MA 4BX2A 5CG1A 3HJAA 4PY2A 5JO0A 1J0DA 3ZWOA 4ZEOA 4AROA 1RJGA 3NGXA 3LIIA 4IOLA 2FI1A 1FU4A 1L7OA 3RR2A 2B61A 3DOJA 3M4ZA 5GZ1A 5FOQA 3TW8A 1GRVA 1YDGA 1YMUA 2Q21A 3G8AA 4MKIA 2X14A 3SG0A 3O4FA 1YDHA 1OPRA 1P45A 1PEDA 4D79A 4DIEA 4X1YA 2V0NA 3I6MA 1NF8A 1ZM9A 2CLOB 4OXXA 5TPWA 1E9BA 5F2NA 3EIXA 3QFRA 3ENKA 5B1DA 3MC1A 4HYEA 4MA0A 1I80A 2BDUA 2I1VB 1OBCA 4WKPA 2CK3D 2R8EA 3M7IA 1MC5A 2BFDA 4H31A 3ZV6A 3EPJA 1SUWA 5C52B 4S0ZA 3UHAA 3VH2A 4YYEA 3G88A 1MB4A 3A7EA 3RKUA 5LWHA 2ZSHA 2OZPA 3FWZA 4DANA 1IJFA 3OFVA 2B78A 3OFSA 2YBEA 3AP3A 4OFBA 4WZAE 3D64A 4PN3A 3QVTA 3L6UA 3OH8A 2QGZA 5G1NA 3HA5A 2PPLA 1NXOA 4PZLA 2CLDX 2Q29A 4RXMA 4DQVA 1W5AA 1D7OA 2WD7B 1VYUA 3KJQA 1QP4A 3K15A 2YN2A 1U81A 5LMCA 1EJ0A 2W48A 3PX7A 2H2AA 1SXJA 2P35A 3KOMA 5EIWA 1KDPA 1YKFA 2IFTA 4OJKA 2D06A 1SC3A 2RG7A 2YR0A 3OCJA 4IUYA 2MYPA 3V4FA 3CRQA 1ZCJA 4KO4S 1LRLA 4LK3A 1FDRA 3LO5A 4PYNA 2TMYA 4AP9A 4DQXA 3N59A 3RRNA 3OD5A 4RY0A 3KHKA 3T3IA 4OD0A 3H2SA 2OORA 4DQDA 3NYRA 2C4MA 3WQBA 4EG7A 5JRZA 2QTMA 2H9AA 4MULA 4DEVA 1P4RA 4HQFA 5CA1B 4K9RA 2CHGA 4GH5A 4M9CA 1C5KA 1QX3A 3N8KA 5LJIA 3D9QX 5CH8A 4TTPA 1FCJA 1MZVA 1TQ6A 2ZDQA 4MVJP 3RHSA 1YB7A 2O8BA 1BC5A 1XHLA 1W85B 1PNRA 1CZRA 1JX6A 2EFYA 2PMDA 1TMOA 3OM8A 1RM5A 3IUBA 3SEAA 1O95A 3AEYA 4KFSA 2ZU6A 3TLGA 4ALNA 2R2AA 1JNXX 1Z2AA 3IAHA 1JKXA 4Q5IA 2CJXA 3DLPX 4Q1VA 3NGMA 2HWXA 4RVGA 4U7GA 1BOFA 1NA5A 3ML1A 2Z1DA 4JU9A 3FHCB 1WBDA 2CV0A 1JAYA 3SMVA 5DBFA 2ZYTX 3EZ9A 2I55A 1KYZA 2PN1A 3DCNA 3USZA 3V9AA 3ZE6A 2JFUA 3IULA 1KZ9A 2R8ZA 3C7TA 2V0CA 1NR5A 4FR5A 3ADOA 4N0PA 1XB2A 1Z38A 3Q6MA 4N6NA 5JDIA 1RJEA 2Q3DA 2PWAA 5EAIA 4BQFA 3VSBA 2HNBA 4ZT4A 3TI7A 4E5NA 3AHEA 4Z4FA 2QP9X 3DCYA 2EBHX 2WFLA 1P75A 2NO6A 5EE3A 1N5IA 4FQ5A 4UTPA 4BKPA 1J2RA 3I01A 1T24A 3L4SO 4QFCA 3U1VA 3MD9A 1KVSA 2ZB8A 3R8FA 1RI1A 3IS3A 3FOAA 1QZ3A 2V3VA 3EXFA 3PGXA 1N7HA 4ZHQA 1ZMRA 5B6IA 2WQ7A 3KEQA 5LMZA 3GEDA 2IH2A 4KUEA 4LHYA 4I4TB 4U2GA 4XRRA 3LA8A 4A6XA 4UFOA 5ADHA 3N0WA 2AW5A 2NZVG 3CKYA 4NJEA 1XTSA 3KVYA 4XB1A 1GUFA 3REQB 4PTYA 3FHLA 1GSIA 3LC1O 2Q3LA 3ZE8A 2QN2A 1GQYA 1U3TA 5KYWB 2O8EB 3EFHA 2G5CA 1MP0A 4IX9A 2AYYA 1EK2A 1CX9B 3CLUC 3Q9LA 4Q4HA 4PG6A 1E60A 3WZLA 1JEYA 1GADO 3KJFA 4RSMA 4PYKA 2RC5A 3C6QA 3NS7A 3TXAA 3U9LA 3R1IA 4DWOA 4FCVA 4GKAA 4YMUA 1D07A 4GBGA 4RKFA 4X7MA 1T5SA 3WQRA 1QFZA 2AUNA 4FKMA 2W6CX 4EHIA 4YMTA 2OHIA 2A94A 2NSJA 1W44A 2JFNA 3BGIA 5EPUA 1T4CA 2WNHA 3CX8A 2W58A 4OHVA 4J6EA 3IX7A 4XYGA 4NZZA 1MGPA 2EWVA 1X74A 4MMXB 2VP6A 5J5AA 2ORWA 4S2UA 3AI1A 3VR1A 3W5HA 3ANMA 4EH1A 3HFRA 4QUKA 3F6PA 3CCBA 5A05A 4HZIA 4NJOA 2G88A 1DJNA 4H4DA 3GXBA 4KK3A 3AXSA 4ZT3A 2IBSA 4K9PA 3WOHA 1L7DA 3TM4A 2PR2A 4ZQFA 1NJ8A 4FMCB 5CGZA 3ZQKA 1Z2EA 3FRJA 3OTGA 5CM8B 2EKPA 4TN1A 1JU4A 5E7JA 1EE1A 2DOKA 1QKJA 2ECOA 3E84A 4HC4A 2OP1A 1ZCZA 3QU7A 4E6EA 5LDHA 3U0VA 3HKDB 2B6HA 3DPUA 3OQ1A 3I58A 5CU7A 2J0QA 1OYWA 2Z6VA 3FI0A 2JGMA 5H7XA 3ZQ6A 1V8ZA 4B1FA 4RJTA 3ZHQA 3EQ9A 2YMLA 1G60A 1H2YA 2D0DA 2ZYWX 3ADKA 5D85A 4MVCA 5K0FA 1EUYA 1R9NA 2P91A 3JW8A 3V1MA 3QXGA 4EKIA 4NF2A 3WGLA 2ZUFA 3N0VA 1PP4A 3ZNPA 2H0AA 1ID1A 4UZEA 5HIMA 3VYVA 1SQFA 3H7IA 1I7QB 1L9XA 1OY1A 1A4RA 1EVLA 3H2GA 3HGMA 4CCAA 1NLFA 3DBOB 5A6VA 5HZMA 3Q5EA 6NULA 4Q3CA 2VDNB 2VQ6A 3ZOKA 4CIBA 1LZKA 5A6SB 3P8ZA 5DULA 2DU8A 3LFTA 1YZGA 1XPOA 2F3TA 3R7WA 4D3FA 4M4SA 4FILA 1V41E 3G68A 4HMOA 1N78A 2LIPA 3COJA 1JQ3A 1TE2A 3ZUPA 1WDTA 4TSKA 3EB9A 2Q49A 4RH0A 3IHKA 1JAZA 2QAGB 2R4UA 2VF8A 5HF9A 4B2IA 4DNOA 2BFOA 3T99A 5KMGA 1ZL0A 1NQOA 2VZ9A 3R41A 5SICE 3THWA 1UMKA 3KWLA 5CLGA 2KMLA 3EDQA 2D6FA 3HKBA 4GOLD 3WXMA 1GGKA 3JQ8A 4HUQB 4KACA 3DS8A 4MK4A 4MUIA 3AF6A 2HIMA 4HXGA 1BS9A 4QTTB 5KTKA 1VCHA 3QF7A 1QZXA 3MJRA 4L3OA 3S1AA 4XX0B 2O20A 1HEIA 2H2GA 2GBFA 1JT9A 4ICIA 5FQOA 3WDSA 3EFEA 4BWVA 1UBUS 1VG1A 2YV5A 5DH9A 4YIKA 3A9TA 3U3XA 4EHLA 4ZCIA 2ZS8A 3AJEA 2NU9A 2VPWA 4Z4HA 3BFJA 3DBHB 3NEJA 4R1LA 3RAGA 1ZH0A 4BNZA 4OAQA 4Q93A 2DQ4A 2XNJA 3WMFA 1QM5A 4JBXA 2ZBRA 2AXNA 2Z83A 1E9CA 2REQA 3MGAA 4U1RA 3K1YA 4DE5A 4XVCA 4AI6A 3BE6A 2BR5A 3PIDA 2CFTA 5JS8A 1KS9A 4EAAA 3GARA 2AN3A 1FPQA 2WWIA 4ND6A 2Q41A 4Q24A 3NPAA 1DOAA 3LHDA 3PXDA 4FFRA 4RXUA 4C0BA 1GUBA 3REFA 2D5CA 1P1CA 3QKSA 4ANFA 2X7JA 3BN3A 5CDFE 4PEVA 3CUWA 2GR9A 4DV3B 4NOLA 3MWEB 2FPMA 4IVPA 1XKQA 2ZDHA 1AC5A 3PRKE 1PQ4A 1U04A 5IDXA 5KWSA 2E5FA 4PSUA 2JHGA 3DZGA 5ICMA 1C14A 1MJGA 1YKSA 2BHLA 2CB0A 3CFYA 4OGLA 3EGOA 2ZSAA 3H9BA 2H18A 3MRSA 4HN2A 1TJ4A 2FNAA 3VVCA 2BMDA 4C4PA 5CNIA 5J1TB 2QQFA 1Q84A 3DE4X 3BDIA 4S1WA 5EWMA 2JGRA 3ZOZA 2RBEA 2VF4X 4UNPA 1M2VA 2YHBA 1R88A 3ZLBA 4DY4A 4Z0PA 4FYIA 3KT6A 4NBKA 1X0VA 3R7SA 5DWDA 5KAMA 5FPKA 2JZNA 5ER6A 4LGYA 5TY0A 3CSDA 4HDAA 4ZVUA 4BHTA 1OXSC 3RFXA 4CQJA 1VMKA 4XWWA 3HLKA 1A8PA 3A4NA 1IH8A 5MDHA 3L79A 1T0BA 4BRSA 2UVDA 4F85A 3TNDA 3A26A 4FB4A 3RC1A 1ZJZA 3W1WA 1T9ZA 3FCEA 2QT0A 5EKXA 1M1UA 2AJ8A 4R16A 3O74A 3WAKA 2WKWA 2WE8A 1HYHA 4HXEB 2OVBA 2ODPA 2IXFA 4ND1A 2BCGY 4HYTA 3CYFA 1JUDA 5ESWA 1BGXT 1ORIA 5IARA 1P2FA 4WVFA 1T6YA 2BGLA 2R47A 2AHOA 2B25A 2H1LA 1LVUA 1FDTA 5FBWB 1YJQA 4C6TA 4XAQA 2BM8A 4RD0A 2HBQA 3BRWD 4Z86A 4UUPA 3VVLA 1XRNA 4NIMA 1BJRE 4F45A 1W9MA 3A11A 4A8JA 2Z1MA 2ZJ4A 2FSUA 3BIOA 4UOZA 1UKEA 1I14A 2H4XA 3QENA 5CH3A 3DLTA 2QGNA 1E62A 5MHTA 6GPBA 3W5AA 2FJUA 1E9RA 1T3SA 1ZKMA 3W3ZB 4YCBA 3CJRA 3KE9A 5SY9A 2OFFA 4LGCA 1J7KA 4KXFB 1N1EA 2LUOA 2W6ZA 4ZXFA 3OFND 4BLPA 1DL5A 2X0NA 1N6KA 3T54A 1FS6A 1GYPA 1K8ZB 2Q2WA 1OTHA 3H87A 3NR2A 4MPTA 4HUTA 5HK9A 1BSVA 3G59A 3BH6A 3HYNA 2OWDA 4YAGA 2R1TB 2ENUA 3OT1B 4W9RA 2FR0A 3FAKA 1WF3A 3FUWA 3B12A 1C9MA 4LVOA 2PH1A 5AK0A 5CIYA 5CX1A 4JDPA 1SH7A 1XQVA 3ZDAA 2CNWA 1YZLA 2FY8A 3AUTA 1K63A 3FRHA 3VPSA 4D4MA 3G8YA 4LBVA 5TNXA 3KE8A 4LNHA 4P58A 4ZKDA 3M5WA 1CRPA 3VOAA 1QB7A 1ODCA 3OIDA 1F2DA 1QPZA 3BE5A 4XJTA 2QG4A 4BVAA 3HHEA 1KQNA 4IGKA 1KH1A 3O3CA 4QBFA 2CVOA 3ZIAD 2WUDA 4MGIR 3O90A 2OO7A 5I9SA 1RE0A 3E9NA 4OU5A 1QAMA 5K6AC 3FVTA 4KLCA 3SEZA 2FPGA 1GIAA 4E51A 1W9HA 3GUCA 1XQXA 1H2EA 1WXHA 3KUCA 1PFKA 2J5XA 4YRSA 3QW4B 2RARA 4BNUA 4OLAA 3M1YA 3CPJB 4Y0VA 2VDKB 1TIBA 4XARA 2XE6A 2C8LA 1P6XA 2WIDA 2BGGA 1BMFD 1YA8A 1G6KA 3K4PA 3SBEA 3D02A 2W2TA 3WYAA 2OXRA 1OPXA 2WPNA 5FORA 1G5IA 1GSAA 1PUXA 1Q0PA 3E05A 1C30A 3O83A 1T4MA 1IN7A 2ZRLA 3GFBA 4LVNA 1Y5RA 2HFKA 1CZHA 3QUSA 1JSCA 3HVIA 1P3JA 4R9NA 3M3DA 2H1VA 4DMKA 3SBXA 2JF0A 3IUNA 4OM8A 1K3UB 3MMZA 2GDJA 3N75A 1ZK4A 1UBSB 4L5AA 1GT91 5MN6A 3ASZA 5IEJA 1C7IA 4TLEA 1IZ0A 5HR5A 4IS3A 3CUSA 5HJ2A 2VNIA 1UT5A 2QAJA 5E1OA 1ZMBA 2GRJA 5F1KA 1IVYA 3L7OA 3L0ZA 2O3RA 4BNNA 1JWLA 2BI4A 1Z33A 1P1JA 1ZJ5A 4N54A 4MWBA 1DX4A 3VU9B 1G55A 1GT6A 1U0SY 5F12A 4XPZA 3K0SA 2GZ1A 3PSHA 5J3JA 4CMBA 4AT1A 4IUBS 5M29A 5FUQA 3CLTC 1NHWA 4K87A 2PMWB 3W2IA 4A4DA 1EFCA 4MEBA 1U2PA 5K4GA 1Z5VA 4PO8A 2L82A 2OD9A 1FRZA 16PKA 8MHTA 4LYAA 1XMPA 1GLVA 2FYTA 2PEYA 2YJGA 3LK7A 5CD9A 2QIPA 3JWIA 3ZY2A 1PJ3A 1ZD2P 3X1ZA 2EQ5A 4M86A 5SY6A 1TJPB 1GSOA 4HGYA 3ELYA 3SX4A 2RGYA 3W77A 4EHNA 2JRLA 5GTDA 4QUGA 3F67A 5CHEA 1RQXA 2ZYAA 3GU3A 5E38A 2V45A 5AOCA 3IKTA 2PFSA 1Y5LA 5JNRA 1NXQA 2J8ZA 3AYXB 3NNNA 3VRHA 4ZCLA 4XLZA 4KR9A 1VGQA 1QFMA 3R2JA 4EHJA 2LWIA 3LVBA 3DE2X 1WG8A 1ZIOA 2AVNA 2PG3A 2V9CA 4ZHSA 1V4BA 4S24A 1OE0A 4TVBA 3EIUA 1X1TA 4Y2SA 3ABSB 4AUKA 3OD1A 2NUAB 1FNSA 1HNXB 4EKNB 4AW9A 1XL1A 3LXRA 2ZWOA 5FI5A 5C1IA 1R27A 1BNCA 4ESOA 1RABA 4HDQB 3V00A 3PFBA 4IVNA 3WJ1A 1Y8RA 4KWCA 4OAOA 4Q16A 4DPKA 1BEUB 5B7PA 4HDRA 4TYYA 3HCAA 1SEPA 3H11B 4IV8A 1XLVA 4J43A 3TLZA 4G9EA 1VP9A 4RZHA 4UBMA 1NMQA 1U4OA 4Y2TA 2P4UA 4B47A 1Y8ZA 2JGDB 4C0KA 2ZBEA 3MCWA 3ER8A 1YGYA 1NXTA 2XRMA 1SIBE 1DBVO 2QX9A 3O1IC 4TMXA 3RIMA 1WETA 1OIVA 3U4MA 1DO2A 1TMKA 3RC2A 1Q3KA 1R74A 4OU4A 3D8NA 1JILA 2BZGA 3A2MA 4LXGA 2NZUG 3HB0A 2CYAA 3FMIA 3NFRA 2IXDA 1G4UR 2NZYA 3F4KA 3PNKA 3AL3A 3F8WA 3BK2A 4UM9D 5A5GA 1GTL1 3MHTA 3R3HA 2J32A 3Q72A 1UK6A 3R0IA 4I50B 4Q05A 1HA3A 3AF0A 1XKTA 1L5HB 4BFTA 1PDOA 2Y67A 4I2NA 4NJMA 3SDZA 2E18A 4CL3A 2BJHA 2JFZA 4BCBA 4YV0A 2P3SA 5A7HA 5E1MA 2BFWA 3LHSA 3PXAA 4M9UA 1JL3A 1L3IA 4Q4JA 5REQB 4YDSA 4LFAB 3TDNA 1CJMA 2IHTA 2NMVA 3NUZA 1Q0ZA 1JH8A 1T2CA 1X1AA 3EWAA 3GEPA 3KEMA 3KLNA 1U2DA 5JH7B 1P7YA 4PQEA 1K8YB 1QV7A 2NV2B 1KMMA 3GQVA 4DCMA 2XR1A 4A27A 1A76A 4I99A 4L15A 4RTKA 4NCAA 1I2AA 2O9JA 1M2OA 2A8YA 1NPDA 1D2AA 1NYQA 2PAAA 3CIFA 3LCMA 3OZDA 3QWAA 1CY4A 3KYJB 4Y0NA 1L5OA 2WU1A 3QJYA 3S2IA 1NLMA 3GDWA 4I9GA 1H0KA 4KSYA 3B53X 1Z2CA 3QLEA 3HL0A 5GOZA 3GUVA 4QWMA 2XNDD 2E37A 2PV0A 2Q0HA 4G6ZA 4PFQA 2DJ5A 6AT1A 1F2TA 1BJTA 4DKJA 3QXHA 2WSSA 2H5IA 5WRFA 4KNWA 3LLCA 5CA0F 3ESXA 2JJMA 5CFPA 1CUBA 4DIKA 5ENZA 3I76A 1R6XA 2BDTA 2R48A 4MJ7A 4EVRA 2P9TA 3DTYA 1SCQA 3T0FA 2PO5A 1KAOA 2YX1A 3HEAA 1AKYA 3DKPA 3ANYB 1Z6AA 2VWPA 4P9NA 5FO1A 1G291 3U4QB 2DBQA 1ZH4A 3BL8A 3I9JA 5DN6A 3ZW8A 3RADC 1OOEA 2ZSDA 4DYHA 3G6KA 1E1NA 3KS9A 4EG6A 2UVPB 1BWSA 1Y9ZA 2HDHA 2ZE6A 1U1EA 2DFNA 2QY6A 2Q9CA 3O3MB 4FCCA 3D8SA 1TGYA 5LMNB 2AKAB 3HNOA 4LYHA 4UHDA 4UEKA 4EARA 5HKOA 1H8HA 3KOWA 3N74A 1PN3A 5BVHB 2D8MA 2J6IA 4IKOA 3T94A 4ZGGA 4H7PA 4LZPA 3QJ5A 2MR6A 3U19A 5ISMA 1DC3A 2KBEA 1V8DA 1XTPA 3O1LA 2EJUA 4IGIA 1GGJA 4Q3EA 4QHSA 4REQB 3UQYS 4AJJA 4LCEA 5HTOA 2CFOA 1RTKA 3C70A 1AXGA 1CTQA 2RAPA 1U5AA 1OI3A 2IE0A 4Q9DA 3DVRX 2BH2A 3QV2A 1IXRC 4TM7A 3WA6A 1RHMA 2QV0A 2XOEA 3H5OA 3LQYA 3OPNA 4D43A 1OASA 2B99A 4ZTUB 1SCUA 1DAIA 2AMLA 2OFWA 2VK1A 3S2UA 1C8BA 3JQGB 3T6KA 5CFLA 4HO1X 1HMYA 1PNQA 1F8XA 2GPNA 5H0IA 2VDJA 4KIUA 4RDXA 1EQ2A 2J3MA 2WP8J 3M3HA 3PFFA 3PJFA 2OGSA 3DTTA 4OTZA 4JEUA 4WXHA 4GZ5A 5EJMA 4F46A 4HNUA 4Y9TA 3E9YA 1JZSA 3UJ6A 1JZTA 1JHOA 3T8YA 2O2IA 4KOAA 2AIRA 4HHEA 2OK7A 4PLPA 5EZYB 2QN6A 1JVBA 3MQ2A 4BFLA 2X76A 3CF4A 4ARSA 2IXAA 3IBTA 3PC2A 1IB0A 2PH5A 5DLPA 4LQDA 1SULA 2AOTB 3KJHA 2V3CC 1QYVA 2VRWA 3BCUA 4A1FA 5KU1A 1PL6A 1SRRA 2X3FA 3C97A 5MFPA 1HE3A 5FD8A 4CDNA 2CNKA 2WVJA 2HMTA 2VJPA 1KNQA 3VYSB 3BF8A 1X7XA 1K5PA 1JSRA 3IR7A 3WLQA 2X2FA 2VTBB 1G41A 4I4IA 4CIAA 1A3CA 2WPDD 2YIMA 2ID8A 4S2EA 3KETA 2VP2A 3D59A 4FCWA 3FB4A 3F90A 4R54A 1YB6A 3L1JA 4MWTA 1EFRA 1KMCA 4II7A 2H11A 3K5HA 4WGFA 3H2HA 4D81A 2GUWA 4V3BA 4PHTA 4II2A 1JQKA 5BNZA 2B1IA 3FPFA 4CEHA 1EIWA 2WNSA 3E4CA 5FBQB 2XMSA 2ZBQA 1I1HA 4KH0A 4NAUA 4B6SA 2QEQA 5CFZA 3VKWA 3GEGA 3QVGB 5A3JA 4RA6B 4IJKA 1ZGBA 1PL0A 5LOVB 2ZBGA 1NDHA 2C4HA 4NCHA 3S7TA 1RMQA 4XASA 3AQ4A 4I5FA 1AGNA 2B37A 4NFHA 3WGYA 1VHDA 3W3AA 3TLMA 2X86A 3C3AA 3ETGA 4HWPA 4WUVA 4J9UE 5KQLA 1OLUB 3WMRA 2I66A 4FDLA 2OILA 1TVMA 3QMPA 1RRFA 3UG7A 2NADA 1WXQA 1C1DA 1Y4SA 5BVGA 1L4NA 3ZS9A 1U9JA 5EXTA 1V16A 2XUKA 2MYNA 1P73A 4NK5A 3TCNA 4Z4EA 2D2EA 3QXXA 2NUTB 1ZG3A 2ZWAA 3C6KA 3A28A 4H35A 4E1AA 1D2NA 2E4VA 4XIYA 1ZO8A 2C9DA 3OEHD 3V4RA 1TO1E 1SKYE 1QOZA 3X1WA 4J9VA 4HMQA 2DC1A 3QXJA 2O19A 2IEBA 5K4HA 3HBLA 2FOLA 3WYFA 4HQLA 4D3YA 3U4AA 4CCYB 4KFTA 3WHPA 3QF4A 1BKSB 4COOA 4YXWA 4GDFA 3D6UA 3EOBI 3N2KB 3Q8KA 1ZEMA 3L0IB 1CEEA 1J21A 2BEUA 2WEKA 2JA2A 3I9LA 1G3RA 4HB2A 4MIOA 4O5AA 3WBJA 1TT5B 1ONBA 4B74A 3F8TA 4RCYA 3J81k 3QU4A 3TJRA 3BEDA 1RCUA 3EA5A 1PLLA 4FIDA 4XCQA 3NAZA 1S8AA 1E6MA 1GKIA 1HTWA 5J2TB 1TK9A 4KQ1A 2BFPA 1SHTX 5E0OA 2I7DA 4LJ6A 3ZHXA 4AJ1A 3LVRE 1G8AA 2X3YA 4MYRA 3RYFB 4W5RA 1FYXA 1KK1A 3CW8X 1I6KA 2I2BA 4HLQB 3K9FC 2FR8C 1SQGA 4CM5A 4DSOA 3UT0A 1RI2A 5DMXA 4MDFA 1KORA 5DE3A 2XUOA 3I0MA 4TROA 3JQAB 3ZPXA 2OSBA 1GV1A 3EWSA 2JH9A 4MYCA 2YHIB 4LMPA 3SXUA