4JVSB

Crystal structure of lepb gap domain from legionella drancourtii in complex with rab1-gdp and alf3
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
170
structure length
170
Chain Sequence
b'EYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structural analyses of Legionella LepB reveal a new GAP fold that catalytically mimics eukaryotic RasGAP
pubmed doi rcsb
source organism Legionella drancourtii
molecule tags Hydrolase activator/protein transport
total genus 59
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2013-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jvsB00
2ATXA 1K5DA 3CPJB 1JJVA 5GVRA 3KTAB 5K8LA 4BLSA 1VYVA 2IF2A 5JHHB 1FP6A 1E2DA 2EYQA 2YHSA 3R8CA 5JJIA 2C5LA 3QPVA 2ORVA 4IVRA 1YZKA 3LO5A 2IYRA 1J99A 2WJGA 2A78A 4TYPA 2R62A 2IXFA 2OZEA 2GETA 3W6NA 2IS4A 4CEJA 4KBFA 2IHBA 1MRSA 4PC6A 3QJYA 1XXHE 1F6BA 4EFNA 1XEXA 3QVVA 1GG2A 4JKIA 1G64A 1Z08A 4LCBA 3PIRA 4LYFA 2DHRA 3QG1A 3BIFA 4BZPA 1J90A 1G1MA 1BMFD 4JMPA 3K53A 3VFDA 1LTQA 2EFCB 2H5EA 2JJ1D 2I1VB 3GLFE 3I5YA 4QGGA 1W47A 4RZUA 1E79D 2ZJZA 2XZOA 1E2LA 2BBTA 1AQYA 1XFAA 4LYAA 3AF1A 3BC1A 3MUFA 3MWKA 3CNNA 4XOIA 3GP8A 3B60A 2GJ8A 4Q1FA 2HF9A 1II0A 2XNDA 3TMKA 3I1FA 4OI4A 2WJYA 4DDUA 3FWYA 3AKDA 2CCGA 1VTKA 2CCKA 4QG7A 3BXZA 3QKTA 4WA7A 3QXSA 2ANBA 4FWTA 3RC8A 2YV5A 1Z3IX 4HDQB 3CW2A 2HCJB 2BVNA 4XJXA 3AUXA 4OHZA 2MMCA 4W5JA 4GOKA 4ZCMA 2ZEJA 1JQJC 1KDRA 1ZD8A 2VO1A 1J8YF 2QGZA 4M21A 1QF9A 1UBEA 1MKYA 3GLGA 4S2EA 2FZLA 4G3XA 4HLDA 1MRNA 3SNHA 2GRJA 4TYQA 1SXJE 3EZ2A 4IEIA 2ZJ8A 3P4XA 4EQ6B 3U6BA 1N5KA 3ZLJA 3SBEA 3EIEA 1AN0A 4A4DA 1ZD9A 5CDFA 1WE2A 3IUYA 2ORIA 1KI8A 4QNMA 5A4JA 3K9HA 1G3QA 1U9IC 4C0LA 1F2TA 3HU2A 1P9RA 1FZQA 2O8CA 1W49A 4Q9HA 4RCZA 3CX6A 1E9FA 4G5GA 1KSGA 4ZDJA 1CF4A 2ZREA 4MRNA 2K5UA 4EJSB 4HB2A 4Q7MB 4I4LA 2O0JA 4IDOA 4FMDF 4BLTA 2GBLA 3DO6A 5F9FA 3LDAA 2ZVPX 1P6XA 1U0LA 4ZDWA 1E6CA 5HR5A 4IRUB 4HZUA 4YMUA 1L8QA 1ZD1A 3IPXA 2GK6A 1NN0A 1SKYE 3BFVA 1X1RA 1XJQA 4LWZA 3W9YA 3E2IA 1AA9A 2OLJA 4M4SA 4EAQA 2O8FA 3ICQB 3IGFA 1KSFX 4PZYA 1A2BA 4DZZA 4A8JC 1WA5A 4Z8YA 5ANRB 1F48A 4Q5IA 1YR7A 2YYZA 1G17A 1KMHB 3RC3A 3EX7C 1OXVA 1H65A 4TMXA 4AD8A 4MKGA 4P4UA 2ZAOA 1G7CA 3LW7A 1IJFA 1UKVY 2WWYA 2ZI6A 2B8TA 2OAQ1 4JLKA 1EFUA 4LK2A 3AM1A 3RHFA 3EIHA 3EPJA 1N6OA 1OV4A 4A6PA 4PAMA 1FTNA 2WJHA 4JL5A 2J7PD 5FBRB 1S0UA 1DBSA 5LPNA 1SHZA 3HYRA 2VPPA 1UKEA 1T8TA 3FDIA 4X8LA 4DSTA 1ZRHA 2ZRDA 3DZDA 5LB4A 1DARA 3EPKA 2GF0A 1JEDA 3Q5EA 4I81A 1OFTA 5SZJA 3NTUA 1NN3A 4JBXA 4AK9A 4CIDA 1BMFA 3SJBA 2JJ1A 1T3LA 1KZ7B 2GCPA 1W44A 4MRVA 3TK1A 1AJEA 4TMKA 1E79A 1EWQA 4WZBE 1MO3A 4JVNA 2VF7A 3TUIC 4C0AC 4DLTA 1G7RA 1LS6A 3DZ8A 2QA5A 2VA8A 2W6IA 1Q1EA 1US8B 3C8UA 3K0SA 4Q18A 4ZIRA 5DE3A 2HYIC 3NDBB 1PVOA 2FV8A 3THWA 4XWKA 5E95A 6Q21A 3EWSA 3W5JA 1OF1A 2HT6A 2ZRPA 3MG9A 4TMVA 3LA6A 4A6XA 1QVRA 1DG1G 3CPEA 2QE7D 3AVTA 1NLYA 5IHPA 3TUJC 1N6RA 1ONBA 4BEBA 2KBFA 4TL8A 3CF2A 4JL6A 2MSCB 3QF4B 4F93B 4XSGA 5FPYA 1WQ1R 2QEQA 3QSYA 4I1OA 1QHHA 1KI2A 2JA1A 1R8SA 4WXPA 2QPTA 4AYTA 2JLUA 1XCPA 4M1WA 2WMOB 4PHTA 3ZS9A 1JAIA 1LVGA 2WZQA 2FSGA 4FMDB 2CHVA 4YC7A 1W36B 2DFTA 2C98A 4RZ3A 5FPTA 1N5LA 4OHXA 4RCYA 1E9EA 2RH5A 1XJCA 2EFDB 4KBGA 2ATVA 2OAP1 2ODWA 3AVQA 1FUKA 4QXAA 3RWOA 1CJKC 3PUVA 4A9AA 3BORA 1W2HA 5AR1A 2DWQA 1RRFA 2BCGY 2QT1A 2OUKA 1VKJA 5EE1A 1OIXA 5JWHA 2J3EA 2F3RA 2ZE7A 1E9CA 4CVNA 1NBMD 4KHZA 1XU4A 4QGAA 1G6OA 1KO7A 4LJ7A 3D31A 2BIFA 2P6NA 4C0BA 4HAUA 2PT5A 4LX0A 4Q9IA 3RS3A 2BWJA 2EQBA 1U9IA 2WWHA 1XTSA 4I99A 1YZUA 1TL7C 1JR3D 3TBKA 3OEED 2ZI7A 1XDBA 4M53A 5EE5B 2FZ4A 5CLLA 3RANA 1U98A 5G3YA 1AS3A 1NMZA 5DI3A 3OIYA 5JZVA 2ZYTX 3V4FA 3AF4A 3RSOA 1KJYA 3GCGA 3C15C 3JVVA 5FTMA 2ZYUX 1KO5A 3LBHA 2GEDA 1Q3HA 4NTZA 1HT2E 3NXSA 2PT7A 2H1LA 4S35A 3GLIA 2C9YA 3A1WA 1ZNYA 1HT1E 4KU4A 5JLJA 3UG6A 2GCOA 1XPRA 2J7PA 1Z83A 4JS0A 4PHGA 4HAVA 2IYTA 4B32A 5UKDA 5FR1A 4OK3A 2VH5R 5JSZA 1P5ZB 1SZPA 2Q3MA 2P5SA 2B92A 1TQ6A 2KWIA 3GQBA 4ZI3A 4A8JA 3AVWA 4V0MA 1XTQA 4CEJB 4PHFA 2IS1A 4LV8B 2P6UA 1XEXB 1HH4A 3QBTA 2AK3A 1ZUNB 2WMNB 2VP9A 2QRNA 4CYMA 2RGEA 1IXRC 2ZR0A 2QROA 1U2RA 3RNLA 3WYGA 3FB4A 1VHTA 2JEOA 1X8JA 1Q1ZA 2LKCA 3I8SA 2JIZD 2C78A 3U3OA 1HYQA 2BMEA 4DEYA 3B6EA 4D81A 2QE7A 1N25A 1M6NA 2WPDD 3RS0A 1G8PA 2A3RA 4NYMQ 1GRNA 3X1DA 1KOFA 3UG7A 3FHTA 3HJNA 1OW3B 5EQTA 4OL0A 1AGRA 1CR1A 5L8VA 4Q1AA 2ZI4A 1MV5A 2P5TB 3BJIC 4W5WA 3GLGB 4LBWA 4P4SA 2R6DA 4D4JA 2OCYC 1TUEA 2FNAA 4KYUA 4DKXA 5JJKA 3P1JA 2O0KA 4CEHA 2AXNA 5JS8A 1SXJC 2WVJA 1R2QA 3ZYCA 4HZIA 2ZM5A 4Y0AA 4DCSA 2A5GA 1Z0AA 3I61A 4YONB 3ZH9B 2HLDA 4MDEA 2ZRBA 4OQNA 4JYBA 1GL6A 1F2TB 3HPRA 1KSHA 2YWGA 3AH8A 3HWSA 4LJYA 2O8CB 2DYKA 4UNNA 4GSYA 4OHYA 1IY2A 1A2KC 3VTKA 1T91A 4TTRA 5H8WA 2J45A 3A4MA 3U60B 3ZVMA 1NBMA 3GPLA 3IEVA 3K9LA 5KDLA 4AIIA 5B58C 1VHLA 4PSVA 1YKSA 2CXXA 5FR2A 1AKYA 4GRAA 1XTIA 2F7SA 1Z6TA 3TW4A 1N0VC 4JVLA 4DBLC 5AK0A 4DUGD 4BASA 1SXJD 2YZ2A 3AEZA 5EE3A 4P33A 1N6LA 3REFA 4NU0A 5DYIA 1OT3A 1JR3A 4KI0A 2ZRKA 2LWIA 1WCV1 3QKUA 4QOSA 4E09A 1EFTA 2C9CA 3OEEA 4TZ6A 4HZUB 1R5OA 2B7CA 1K8RA 2X8AA 1QBKC 1R0WA 2ZRGA 5DN6D 1RE0A 2QTFA 5TMPA 2NMVA 5C2JB 3QG5A 3W6PA 3FKSA 3MWLA 5JBQA 1CJMA 3AGQA 2YWHA 4A1FA 1N2CE 4E03A 4FMBB 3U7GA 1NY6A 4MH0R 3T1QA 1E96A 1M34E 4GL2A 2O8FB 3SR0A 3DVLA 1XB2A 3SJZA 4G5QA 1JPNA 3ADKA 2H17A 2IYWA 2JAQA 2WSMA 2CL0X 4M1KA 1E99A 4NMMA 3SYLA 3NEYA 4D6PA 4DEXA 2X19A 4B75A 1W4CA 2GVZC 3B8HA 3G82C 2QTVB 4F91B 2JJ8A 2EVWX 3TR0A 3EAQA 1XBTA 2Q21A 3LQQA 4GI7A 1DVRA 1YZLA 4C0QC 1ZCBA 2A5YB 2RGDA 2V7QD 4FWIB 1VG1A 1GFIA 3FE2A 2QAJA 3KZ1E 4HI0E 1TQ2A 1X8KA 2H16A 3NH6A 3T1TA 3H2YA 2AFIE 3CF6R 2ZRHA 2BMDA 3ND9A 4FW9A 4PQFA 1E9AA 1DO2A 4PO1A 5JCPA 3VR2A 4LBZA 3GJ3A 4QGFA 3CRMA 4JLMA 4W9MC 5JJLA 4OHWA 5KSZA 1G7TA 5GJCA 1CJVC 1H8ED 4E07A 5BXQC 2PLFA 3W34A 1KK0A 4GT1A 1VYUA 1Z06A 3K9NA 4G1UC 1KNQA 2AL7A 4PO8A 1QHXA 3T34A 1PLKA 2J87A 1CJTC 3CRW1 3M6AA 3MMPA 1VIAA 4HSEA 4KSCA 4HAXA 4UNPA 1E0SA 1CRQA 2FSIA 2JIZA 2ZU6A 3EW9A 3QI2A 3WRYC 4EPWA 2Z43A 3I3SR 4OQFA 3H0KA 4FI3C 4ZIRB 3GJ5A 1S4QA 4Q21A 4U00A 1XTKA 3TKLA 3THWB 3MFYA 4L5BA 2WPDA 3RRMA 3B1YA 4LHYA 4MGIR 2AD5A 1GILA 1G7SA 2AWNA 1JPJA 1TPZA 1XZQA 4Q9KA 1XXHA 1NL3A 1ZU5A 3B13B 4YDSA 1KI6A 1PJRA 1S3SA 1SGWA 4O2RA 4ERNA 4BLQA 1XTJA 2F9LA 4QM6A 1E1RD 1R0YA 4QGHA 4QL3A 1OXTA 2JASA 4P31A 4K8OA 3GLFA 1XCGB 3FMPB 1BYIA 1QHHB 1XP8A 2RGXA 3QNUA 3Q7QA 1OKKA 2V6IA 4LC1A 2EFEB 2YOGA 2GZHA 2F1HA 1NLZA 3DHWC 3SYNA 3DDCA 4B3DA 1U8ZA 1YJ5A 3GLHE 1OYYA 3TSZA 2QM7A 3S1AA 3X2SA 4RD2A 2R6GA 4OQXA 4RFVA 1S2MA 1ZNWA 1UF9A 1G9XA 1U8AA 2I4IA 2RHMA 3HYTA 4KSBA 4EPYA 1AZTA 3B9PA 3QE0A 1Q22A 1QHIA 4Z51A 2CLDX 4LHVA 2WKQA 1JR6A 1YR6A 5FPSA 1U0HC 1AS2A 2OBNA 3EPHA 1IN7A 4GMDA 2VQSA 2H18A 4G0NA 4B48A 1NVVR 1QG4A 4KFTA 2IUTA 3QPWA 4OKSA 5K8IA 3KQKA 2OE2A 4DUGA 1SXJA 4DLZA 3T5GA 3ZD7A 2ZRAA 2IYSA 4AKHA 2F9MA 3GMTA 4NYIQ 2BKUA 5FBVB 4MUAA 5M04A 3W3AA 4RVCA 4UNQA 2ZJBA 4JLJA 5DO9A 5DN6A 2G0NA 4JT2A 4TLBA 5IK2A 2XGJA 3DEFA 4KFSA 4NP6A 3AP1A 4JSYA 5JEDA 5E7IA 4ZKEA 1ZIPA 2WWIA 3B9QA 2X2FA 1DAHA 4KVGA 5JMTA 3WNBA 5L3SA 5JFGA 2ODNA 3PITA 5FL7D 2JGNA 1VIYA 5DI3B 5H68A 4BQSA 2QUZA 4PC2A 4GMXA 3SC3A 1R7RA 4Q00A 4KLZA 1RFLA 1TX4B 1T0HB 2ZYWX 3SHFA 4U02A 2ZVQX 1JECA 1KDTA 2QT0A 2V7QA 3FMIA 3VR3A 1E94E 3FVQA 2RKOA 3GLIB 1TTTA 3V4RA 1M8PA 5DLQC 1G4UR 4LV5B 2GCOB 1WXQA 5DIFA 1FW6A 4URYR 1TMKA 3NG1A 4TL6A 2ZSEA 1K6MA 5JSZB 2SHKA 2WJVA 3HDTA 3QPUA 4N0EA 1ZU4A 3KXLA 1HUQA 2AR7A 3Q9LA 2GZDA 1JNYA 1H8EA 1XD2A 2FN4A 3LRPA 3K0FA 4A8JB 1W46A 5G41A 4PZZA 3TVDA 3SE0A 1CKEA 4X8MA 3AQ4A 3RRZA 1KIMA 3CIOA 1D6JA 2REOA 3X1YA 3KJEA 2WOOA 1W4BA 2CLCX 1XNJA 2WWGA 4B3CA 1AQUA 3BWDD 4DIDA 5AUQA 1X3SA 3GEHA 4MGKR 1IY1A 4XTRA 4C7OA 4LV6A 2G6BA 2C96A 1DOAA 2XNSA 4PQYA 2GTPA 2Q6TA 3BB3A 4LJ5A 3TQCA 1GRQA 1RW4A 1S1MA 1GOTA 2BM1A 4B74A 1KMQA 3A4NA 2BBOA 3RRNA 3TJZA 1Q12A 2R6FA 1NMYA 1Z29A 1DAKA 1K5GA 2RGNC 4M9QA 4WZAE 1CU1A 1E1RA 4DWJA 2XXAA 1DELA 2G9NA 2EFHB 1NP6A 2FFHA 4KVAA 1JEEA 3B1ZA 3FTQA 4DDTA 1TU4A 2P65A 1DO0A 1N6NA 2ZE8A 4P4SB 4IJMA 5E7MA 3L2OB 1EFRA 1KHTA 2QNRA 4ZPXA 1KY2A 3VNVA 5EZ5A 3SDZA 4DT1A 5KYKA 2WIAA 3MRSA 2FSHA 4PX9A 4CEHB 3AVVA 2D7DA 5L3RA 3UKDA 2IT1A 4JLDA 4QHYA 3VKHA 3OF5A 2DCUA 2QTHA 3C4JA 2NIPA 1E4VA 5JI3E 3MWJA 5EXPA 3SOPA 4IDHA 1MOZA 3UMRA 2C2HA 1EG7A 1ZNXA 2PEZA 2QN6A 4FIDA 4PPNA 4B6EA 5TVKA 1FNMA 5E4FA 2B21A 3TH5A 4DLSA 1HY3A 3IDQA 3H1TA 1G5RA 1EX7A 5FTLA 1II8A 4ON9A 5AUNB 1P2VA 3QEJA 4G5SA 2F43A 4TWZA 1A1VA 3AB3A 5FBLB 2GKSA 1FQJA 5EJEA 4TMWA 3C5HA 3MCAA 2F1IA 1LW7A 1BS1A 4LI0A 2AN9A 1FP7A 3PXGA 1RJ9A 3KQNA 5FL7A 5HKKD 4DLRA 1M1YE 1HTWA 1IXSB 4W5HA 5EXSA 1N0UA 2NZJA 3L8ZA 4A36A 2WTUA 4M1OA 4Q1CA 2O8BA 3BERA 1PUIA 3N5CA 4Q7LA 5GADl 1LF0A 4PO9A 2R9VA 5FOSA 1RVDA 4Z1MD 1KJZA 4EKDA 3WNCA 3ZZ0A 3R8FA 5HTKA 2B6HA 3SN6A 1VMAA 1GNQA 4OHVA 2IF0A 2IA5A 1RIFA 1MO6A 3PUXA 2OCAA 3CR7A 4EUNA 3AVYA 1PLLA 1HQCA 1Z22A 3LLMA 3NC0C 4X8HA 3ZZUA 4BFZA 2MMGA 1LF5A 1KDPA 3SHWA 2WJIA 5ELXA 3Q3JB 2QENA 5C4GB 1RRCA 4O2LA 5GJVC 1XEWX 3QY0A 3U3RA 2ZI5A 4LYJA 3U3KA 3FFAA 2ZYVX 2QBYA 3IQWA 4MA4A 2VP2A 5EXXA 2AX4A 1EK0A 2D3WA 1KAGA 1Q20A 3TR5A 3WYAA 4LYHA 1X1SA 4CZ2A 4B2IA 4N1AA 1KNXA 4PZLA 4HDCA 4DXAA 2QGNA 2ZR9A 1W4RA 4QBIA 1Z2AA 3TLXA 1FL9A 1V5WA 3KL4A 5D3QA 3R9WA 3B2EA 4LUCA 2RCNA 5KSYA 3ICEA 2GXSA 3I62A 3AVOA 1G3RA 3NH9A 1FUUA 2V1XA 3HU1A 1P2SA 1DS6A 2PMKA 1MR3F 3E5HA 4TQ9A 2GXAA 2PEYA 1NSFA 3CONA 1W0KD 2A30A 4MRRA 3UMSA 4D4LA 5J4LA 4BLOA 3ZDQA 2J0UA 1ZM4A 2R6CA 4PTLA 1KI4A 3EARA 1XXHB 5KDDA 1AGPA 5EXTA 1I2DA 3ETLA 1GDDA 1KI6B 1WDTA 3WXMA 2D62A 1HURA 2ZJYA 2FG5A 3B78A 1GKYA 4DRZA 3J81k 3MSXA 4EFMA 3GLFB 1JB1A 3HP1A 2IXGA 2PL3A 1N5IA 5CM8B 3CH5A 1F2UA 3PR1A 1HQYE 1ZW6A 4GZLA 4C30A 4NYJQ 2JLXA 3C41J 1ZUIA 1TQDA 3QENA 3S1AB 3R9IA 3VNUA 2J9RA 4TLEA 2BDTA 2Y8EA 5CIWA 1G3IA 1LB1B 1OIVA 4FXPA 3EC1A 4JVSB 2RGNA 3SYKA 2WHXA 2QMOA 4ZCLA 1KI3A 1OSNA 2NO0A 3A36A 1R10A 2VTKA 1NG1A 3HPQA 1F3OA 4O0MA 4A2QA 4LHZA 3ZVRA 2OBMA 2HUPA 1L4UA 4B34A 2XOKD 4TYNA 1HEIA 4BLPA 2GCNA 4PAOA 4KV9A 2VEDA 1CR2A 4G01B 1NF3A 1SXJB 3LWNA 5DGXA 4PC1A 3CR8A 3AKEA 2NPFA 2C03A 1S9DA 3OIWA 1KO8A 1OB2A 4Q4HA 2VRWA 5EUMA 4Q7JB 2GHIA 1XEFA 2VYFA 2J59A 2REBA 4CT4B 1EXMA 3HU3A 5LBIA 3IEUA 1X86B 4OYHA 4QFMA 3QXJA 5HKKA 2Z6VA 3PVSA 1CR0A 1ZC3A 3A58B 2OFXA 3Q5DA 4FCWA 5FPHA 2FSFA 2IK8A 1Z0IA 2IYXA 5L3SB 1Z0KA 4R2IA 3KJIA 3AVUA 3QOFA 1UJ2A 2GJ9A 4DHEA 2QP4A 1VCIA 2BBSA 4YDHB 3KKNA 4Z1MA 421PA 5KSOA 1OH7A 3AKYA 1G5PA 3CRRA 4B2LA 4IOKA 4Q1EA 1R8QA 1SVMA 2W6JD 5AJZA 2NG1A 2YINC 1DE0A 4B33A 4PC7A 4R7ZA 3B1VA 3L0IB 2WM9B 5E3HA 4HLUC 4D82A 4ZV4A 2EW1A 1P2TA 1X6VA 4BEJA 1KGDA 3PJRA 1DAFA 2CNWD 3K8YA 2H7VA 1SKYB 1NIJA 2IYLD 4LZZA 3RWMB 3T12A 4C0SA 1C1YA 1R0ZA 5BYJA 1CXZA 4M0LA 2EWVA 1ZM2A 1TNDA 4RFSA 2HJVA 1XD2B 3K9GA 1IQPA 2GAOA 3ZZTA 2ZIAA 1M7BA 1EGAA 4M22A 3U7FB 3A1SA 3C7KA 5F9HA 2H92A 5CM9C 2OCBA 2V8OA 2DY1A 1W0JD 1W2GA 2WWXA 3GFPA 3KQUA 1EFCA 4BGDA 4XD7D 4DSUA 1XD8A 1RRPA 3MLEA 2FGJA 2ZJOA 2WWFA 4OK5A 1UKZA 4C7OB 1IN5A 4NZYA 4XWAA 1B0UA 4UXIA 4BRUA 1W0KA 2OILA 1AKEA 5KTYA 2IUUA 4GPTA 5G53C 3K70C 4A15A 2R6AA 4E5UA 3T61A 1C9KA 4YXWD 4LRWA 1FMLA 3Q8XB 3LBNA 1KSJA 3F5FA 1R5NA 2Q9CA 2IYYA 2JLYA 2XXAB 4LJ8A 3EZ6A 3C14C 5C1BA 1KDOA 3B1XA 5FTJA 1TADA 4V03A 1G4AE 4N0DA 1OE0A 4GFDA 1Z6AA 1D9XA 2H8KA 4MGYR 1TQ4A 3RLFA 3ASYA 4DT1B 4MYCA 3B82A 2QM8A 4B35A 3NBFA 1CJUC 1WBDA 5KSPA 2IUSA 3CWZA 1FTSA 3BB1A 4NH0A 1BIFA 1P4SA 3V00A 2D2FA 3K70D 5CJPA 5IF9A 2G77B 2XX3A 3KB2A 3ZQ6A 3ADCA 4JLPA 5SZIA 4H1VA 4LJ6A 2XOKA 1E2GA 4MITA 1KKLA 3KUDA 5G40A 3O8BA 3NBXX 4DLXA 1COWD 1XMJA 2FPLA 2J5XA 4AKEA 4RZ2A 2PJZA 1M74A 3W8RA 5F3WB 3TQFA 1XCMA 2WJJA 1II8B 4L8GA 2A5JA 1KZGB 4MDFA 1KJWA 3H86A 4Q9JA 3BD9A 5J4VA 2F43B 1TF5A 3U61B 3FPAA 1W5SA 2OFWA 5E7JA 2ZSFA 3GLHA 3VR5A 4V0KA 2J46A 3LAWA 4BPBA 4UXHA 3DMDA 1MO4A 4XH9B 5TY0A 1IN6A 5KO2A 2C04A 4ESHA 5DHAA 4RJLA 2JLRA 1RJ9B 1SVIA 3B85A 4DLUA 3QUSA 2O5VA 5JWRA 4WOPA 3RVBA 4UJ3A 3TVTA 3B5JA 4ARZA 4GDFA 2AD1A 4UNSA 2ZRMA 3KXIA 2RGBA 1E2KA 2W6JA 4JIMA 3RRYA 2V1UA 2O8BB 4QJ4A 2ZUBA 4V0LA 1IHUA 5FBQB 1XMIA 5AJXA 5SZKB 4U7DA 2AK2A 3U44A 4HB4A 1OLOA 5FOXA 2VP0A 5JRZA 3UANA 2KE5A 3BFXA 1DAGA 3SJAA 4QNRA 2QAGC 3P20A 3UK6A 2CNWA 3IIJA 2ZU0C 1NG9A 4RKFA 2UKDA 2PCJA 1S8FA 3UIEA 3NIBA 5CLQA 2W0MA 3VX3A 1DEKA 2A2ZA 5FFMA 2ZTSA 1GITA 2G88A 4KFUA 1GZSA 4IVQA 2ODEA 1NIPA 4UQOA 2HDNB 4TYWA 2FEMA 2DR3A 1Z6XA 4TN1A 3D6TB 3FYHA 1JALA 2VL7A 3F3YA 5J4HA 2QBYB 2REXB 1W0JA 2GK7A 4EFLA 2GEUA 4NCIA 2FOLA 4HLUA 3WRXC 4XD7A 4NYMR 2W00A 1ETUA 2ZRJA 1XMSA 4IOLA 3GD7A 3CPHA 4US0R 5CB6A 1YE8A 4PSKA 4NL4H 1U81A 4V0OA 4KAXA 4Q9LA 4LC0A 3OIVA 3LVRE 5TXGA 4PPFA 3LVQE 1UDXA 1XF9A 5KNCA 3GJ0A 4OI0A 4LBYA 4YXWA 2QY9A 2L0XA 1NY5A 1GRRA 2LKDA 5J5CA 2FU5C 3IO3A 2CK3D 5JHGB 4K46A 5LB2A 3OIUA 4HLQB 2J0UB 3DPUA 2QPOA 1L7VC 4D0GA 4B6FA 4FD2A 5TARA 3I5XA 3U7HB 1VDZA 3ZIAD 1QRAA 1X8LA 2Z83A 3EZ7A 2X77A 2YC2C 2DFLA 2YOFA 1ZVQA 4IHQA 3UPUA 2F1JA 1KK1A 4NE2A 3U5ZB 1GAJA 2VP5A 3SS8A 4Q4AA 5KPDA 4JLAA 1F2UB 1ZJ6A 4IXNA 1GWNA 1PLJA 2ASEA 3GFOA 4TTPA 1N6HA 4MGZR 4B76A 2D2EA 2BHRA 5HCIA 2PCLA 3K0AA 2ZQ5A 3A4LA 3A1VA 5DH9A 2NQ2C 1OXSC 4BWYA 1Z6GA 4KCGA 2CMKA 5BN5A 4RD3A 4Y0VA 4ZCIA 4UKDA 1CULC 2F1RA 2IS6A 4D4MA 2FE4A 3N70A 1COWA 3TGPA 3MJRA 3K0EA 1P9WA 2D4HA 3Q72A 2BJWA 5P21A 2ZSDA 2E1RA 1O3YA 3H84A 3IIKA 4IOJA 4JBWA 4DCTA 4DDWA 2GILA 1Q1QA 4QBFA 4E22A 2FPKA 2C9OA 4EJSA 1MABA 2BOVA 2CHGA 3T35A 1P72A 5BN4A 1P9NA 1JI0A 2Q0HA 2E9SA 4II7A 4Q4HB 1M7GA 2QMEA 5K8TA 3C16C 2HT1A 3DKPA 3VHLB 4KXFB 4QBHA 4A0RA 1N0WA 3AF0A 2YWEA 4JLOA 1KK2A 3X1WA 1YVDA 4OK6A 1S1CA 4F4IA 2WAXA 3OFND 3QQ5A 3U7EB 2W58A 4PSAA 1RKBA 1Z0DA 3D8BA 4C0HA 4DSOA 3ADDA 1OH6A 1RRGA 4OBEA 3SU8A 2OG2A 2V54A 1XJ0A 4FCVA 3HR8A 1D2MA 1ZCAA 2YC4C 4FMCF 4UXJA 3R7WA 2J0QA 2OLKA 4QHSA 2XJ4A 1T5IA 3QKRA 4BZXA 1RYHA 4GNKA 3DOFA 5B64A 3IPYA 4LJ9A 3M0EA 4M1MA 4NKRA 5B30A 2R65A 2ZR7A 4HLCA 4GP7A 2XITA 3A1TA 3NHBA 5GJWC 2TMKA 1HA3A 2CCJA 1GIAA 1P75A 4XWOA 3WNDA 2KBEA 1D2EA 3RS5A 4CT5A 4BFVA 4ASUD 1OIWA 3K1JA 2V3CC 3ZD6A 1J8MF 1T5LA 4NBSA 2V6JA 4D0LB 4R9UC 4RFSB 1D9ZA 2Q9AA 2C95A 4RD1A 4DB4A 1DAMA 2GJAA 2ZITA 3B1WA 5DSZA 4KODA 3DKVA 4LSGA 2VSOA 2ORWA 2FWRA 1YZTA 4A2WA 2QAGA 1A5TA 1HV8A 3K0CC 2J41A 1R4AA 3PUWA 4YQFA 4LJ4A 1B23P 2ZS8A 4HUQA 3ZQJA 2FJUA 1JJ7A 3CWQA 1SVWA 3AF3A 3OEHD 3T1VA 2NO6A 1M7HA 4F7WA 2CK3A 1JAHA 3BH0A 1MO5A 1YZNA 2UZ3A 3ZS8A 3C5CA 2A5DA 3VX4A 4C0KA 1TEVA 4AY2A 3QBVA 4P4TA 1OPXA 2GJKA 3JZMA 3L82B 3KB1A 2JLZA 1H8HD 2Z4RA 3T15A 5KHOC 1GKUB 3P4YA 2BMFA 3QVUA 4I1UA 4JBYA 1RPZA 4GZMA 1JQLB 2F3TA 3PUZA 2BJVA 1N3BA 3CZQA 3GEIA 4Q4JA 2CLSA 2AXPA 3LX5A 2BCJQ 2GWHA 1QHSA 3EZFA 3MGCA 3SBDA 3VHXA 721PA 2XZPA 4GP6A 3L0PA 4DCVA 3WMGA 1AS0A 3RS4A 3QF7A 4EPXA 1VG8A 2ODBA 1G291 2ONJA 1II9A 2GF9A 1J7KA 2IYZA 1Z2CA 4JLNA 2HF8A 5L3QA 4NYIR 221PA 4ZKDA 3O8RA 5CYPA 4KJZA 5J47A 2IL1A 1HE8B 2XJ9A 1T3HA 1G19A 4GOJA 1Z28A 1L4YA 3VMFA 5BWMA 5FL3A 2CVHA 1A82A 3BE4A 4URWR 3CZPA 3F0TA 2PX0A 5KNDA 3EPLA 4HDOB 3CRQA 2XB2A 3EWAA 2ANCA 3SZRA 1TAGA 1R0XA 3H4MA 1XPUA 2VSXA 3O8CA 1T3SA 5HZKA 2PBRA 1Q0UA 4FMCB 3GLHB 3MWYW 1IONA 3QXHA 3FHOA 1OHHD 2OHFA 2VF8A 3AVPA 3DOEA 4LHXA 4WW0A 2AKYA 4LOAA 4URZR 4JYCA 5F98A 2CVFA 3AP3A 3OFNA 1ANKA 4GBMA 4LPSA 2WOJA 5FUWA 4DLVA 1CRPA 1FOEB 1YRBA 1KO1A 2W0SA 2CL6X 2ZS9A 1CIPA 4M2LA 4ARZB 5H70A 2DPXA 4A0HA 3L43A 4M1TA 4PQRA 1GUAA 1P2UA 2FGKA 3BAFA 4P32A 4Q66C 4ZO4A 5FUYA 4EPTA 4ZDKA 4TYYA 1G8FA 2ZRLA 3AP2A 2OSBA 1XPOA 1FMJA 4TTQA 4PAQA 5G3ZA 4XVQA 2FFQA 4C3ZA 3U44B 3DM9B 3EXAA 1DPFA 4PHHA 4MKHA 5TV2A 2VHTA 1E2IA 4PC3A 1D5CA 1SVSA 2QI9C 4JZKA 2YOHA 1UM8A 1VCOA 1NKTA 5CK4A 4RY2A 5AJYA 4ASUA 2X1VA 1Z0JA 1Q1BA 2XTMA 1EWRA 4JJKA 2GJSA 5C46F 3LNCA 3SQXA 3GJ4A 2CHQA 3KKMA 5B57C 1E2QA 3W3ZB 5EP4A 4M9ZA 4Q1DA 1T9HA 4KFRA 1BOFA 1VYTA 5C18A 1XX6A 4WIAA 4WVFA 4DLWA 1E9BA 3TRFA 1A4RA 2IC5A 1KAOA 2D7CA 3TAHA 521PA 1UBCA 2W2XA 4QC2A 3WYFA 1UBFA 3KJGA 2WSSD 3OEHA 4AKGA 1T6NA 1E1QD 3W6OA 3IBYA 5BN3A 1VCMA 2PZEA 5BW8A 1Q21A 3BOSA 1ZINA 2IEYA 1WBBA 4Q01A 1F5NA 4QJ5A 4LDJA 2VP6A 3R20A 2W6ID 1H8HA 3EA0A 1BO6A 5IDVA 1E69A 1E2JA 4CF7A 2RGAA 3LW8A 1OH8A 1S96A 2VHCA 2ZRNA 1OFUX 1CP2A 3GJ7A 2HYDA 3IKJA 3K0CA 5LD2C 1IY0A 3OAAD 1ZUHA 5FUXA 1QHNA 3CB4A 1GL9B 4IFEA 2ECKA 4Q4AB 3L0SA 2RHDA 5J4YA 5CIQA 2ZJAA 2O8DA 2IWRA 4QKQA 2OFOA 3KUCA 3K0AB 3K70B 3TE6A 4MYHA 1ZMXA 3OZXA 4L9WA 1UAAA 1UADA 2QU8A 3RYTC 1J2JA 4TL9A 2QMHA 2ZUCA 4WBSA 2B8WA 2GXQA 4D26A 1NSTA 3BFKA 4V0NA 3TW8B 4DSNA 4DCUA 2P6RA 2CE7A 2JDID 2QG6A 5AUOB 1DAIA 1QHGA 4BFYA 1GKIA 3WP1B 4MYTA 2FH5B 4Q03A 5BQ5A 3ASZA 1ZP6A 1LY1A 1LNZA 3F8TA 2OT3B 1U8YA 1D2NA 3LD9A 1KY3A 1MABB 2D06A 1OHHA 5LDDC 3G0HA 4KITB 1T0JB 1GVNB 2UZIR 2ZAMA 3LV8A 4DJTA 4BFTA 3E70C 3BK7A 1QDEA 5JS7A 2XB4A 1CLUA 1T8UA 1E9DA 4MKFA 1GTVA 4JT4A 1E98A 3QEOA 4IXMA 5FH9A 5GJBA 2RB4A 2VHUA 3G5UA 4ZDIA 2XSZD 3GJXC 4JSTA 3REGA 4L9SA 1KI7A 3JVUA 3TSOA 1SKQA 1YQTA 3MJHA 3PEUA 5HPYB 1DADA 2KI5A 4BRWA 2G1JA 4C4PA 4QBGB 3R7WB 2O52A 2WV9A 1XTRA 2RMKA 2OM2A 3IHLA 4M1YA 4NHOA 3QKRB 1KI1A 2IYVA 2W2VA 4TSFD 5D3MA 1W4AA 5EP1A 3VAAA 4FINA 5HCNA 2V9PA 1Z63A 4C2UA 3Q7PA 3QKSA 3X1ZA 3ZJYA 4D80A 1R5BA 2YNMA 4AYWA 1NN5A 3IILA 1E2PA 4KYIB 4YLGA 2J1LA 3A8TA 3FMOB 4RZXA 5K8UA 3W8NA 3ZVNA 3IQXA 3PEVA 2ZPTX 4YMSA 3OHMA 3FMFA 2CJWA 4DLYA 1ZYUA 3M1IA 1E9RA 5HE9A 3ZGXA 1KI9A 3VU9A 4QRHA 4QHTA 5AJWA 2J0SA 3TSWA 2G0TA 4N3NA 1Z6YA 4UNRA 2WSSA 1FX0A 4Q7KA 4TZ0A 3I92A 5KOYA 1FNNA 2JLSA 1I4TD 2QAGB 2DFNA 4AKIA 1E1QA 4RD6A 4US1R 2FPMA 3SFVA 821PA 2ERYA 4HUQB 4TL7A 2AHOA 3GJ6A 1GSIA 2ONKA 4YMVA 2JLVA 121PA 3SQWA 4ACBA 3SI7A 2ZRFA 1G8YA 5FOWA 3NC1C 3PENA 4NYJR 3CKLA 1BYUA 4IDPA 4B43A 4YMWA 1E32A 2Q3FA 4H9GA 4D4KA 3O47A 3VKGA 4AURA 1RC8A 4L15A 2EYUA 4HYYA 4MKIA 2AKAB 5CK5A 2ZE6A 4WAUA 1QZXA 2EFGA 1E3MA 1AM4D 4B73A 1BKDR 5EP3A 1LS1A 3N2IA 3V9PA 3OAAA 1UEIA 4HB0A 2XAUA 3IO5A 2DFKB 4AI6A 1U90A 3I72A 3THXA 2XZLA 3OESA 3OE7D 2P3SA 4Q4JB 3K09C 4F92B 1TU3A 2QPAA 2ZJ5A 1YR9A 5EP2A 1OH5A 3TAUA 2OO7A 2YJTD 1NN1A 1XMVA 1OXUA 4BZQA 2GVDC 1ODFA 4OI1A 1CEEA 4IKEA 3BH7A 3KKPA 4IW3B 4B3GA 1P3JA 2VHJA 2C77A 2J0VA 2JJ2D 4W7SA 2P67A 3CM0A 2QZ4A 5KUTA 5KU1A 5L3QB 3WHLA 3K0FB 1N6PA 5HZHA 1LV7A 2JDIA 2ZANA 3JZAA 4NCKA 4TMTA 4A0GA 1Q57A 3WMFA 3GEEA 3W90A 1SQ5A 1G20E 5JI2E 2WBLC 3T1OA 2YKGA 1PV4A 4A2PA 3KXKA 3CBQA 2Q9BA 2HLDD 3KQLA 1ZAKA 3KJHA 4K81B 3IIMA 4R98A 1P7CA 2DBYA 2N42A 2OXRA 3GLGE 4AG5A 2BV3A 2VP4A 2Z0MA 3ZVLA 4EPRA 4PPGA 2ZROA 3NHAA 4IEEA 5EZ6B 3WMEA 3PEYA 1VCNA 4CEIA 3I32A 3SFZA 4POAA 2HXSA 4MRSA 1WF3A 2QP9X 2NPIA 1VECA 3ADBA 4HUTA 1BH2A 1SHKA 4WXRA 4H1UA 4BFWA 4RSGA 2IBMA 3D3QA 4F4CA 5CDFE 1GL7A 2CBZA 1LFDB 4Q02A 4Q48A 1GNRA 3UXMA 2O8EA 4QJ3A 2XSZA 4EDHA 2R2AA 1MT0A 5H1YA 3THYA 1XZPA 2WKRA 2R44A 3P26A 2V4ZA 3KFXA 4B71A 4DDVA 2OV2A 1NI3A 3AVXA 2QMUA 3LQRA 4GOXA 3LH5A 3CLVA 3FKSD 2FFBA 2W2TA 4CGZA 3LXRA 1OJLA 3CRVA 3CH4B 5CITA 1ZM7A 4EJSC 1E0JA 3U4QA 2G1KA 4TSFA 1NVXQ 4HB3A 2HCBA 1E4YA 1G18A 1Z0FA 1Q3TA 2B7BA 3NBYC 4Z8XA 3UATA 1I4LD 5L3VA 2F6RA 4ILEA 1UBGA 4HEJA 3WBKA 1O87A 2CL7X 4Q47A 4YMTA 1E2EA 2KB0A 1F60A 2NO9A 3EC2A 2G83A 1P60A 4URUR 3RAPR 2QRZA 5BYKA 1T4GA 2I3BA 3M4YA 3TIFA 3U3MA 3L8YA 2H57A 3ECCA 4X8OA 1MH1A 1G41A 4R2HA 2GNOA 4HAWA 1DG3A 2NGRA 5SZHB 1EX6A 2BKEA 4Q19A 2BC9A 4PFSA 4F4JA 3R9XA 4B47A 3FFBA 5FOTA 1W48A 3FGNA 2QORA 4DVGA 5CB8A 1ESMA 1YZQA 1UPTA 2QQEA 4BUJA 3P32A 3QXXA 3VR6A 1XD9A 4RD4A 4TLAA 4AG6A 1E2NA 1DTSA 2Z4SA 3FKQA 2DWPA 2QSZA 5HE8A 2IW3A 3QIAA 3VKWA 4C9BA 2IXEA 4ESVA 2IHYA 5JECA 3EASA 1UDWA 3PUYA 4ACAA 3RS2A 4CW7A 2CDNA 5EUQB 4EIWA 3NEJA 4WZ6A 1C4OA 1SVLA 2JCSA 4D0NA 1D8TA 3WBJA 4B2PA 1CR4A 2EU8A 4MUBA 2FMXA 2D74A 3OE7A 2GDJA 1OFIA 5DI9A 2NOAA 1QVAA 2AFHE 2WAYA 1S9HA 2ERXA 5FBWB 4URVR 3X1XA 1SULA 1EFHA 3PV0A 1Y63A 3TNFA 2QP3A 3L0OA 4DCNA 2GXUA 8OHMA 5DYGA 3W5IA 1Y3AA 2NZ8A 4M1SA 4I1VA 3CO5A 3KTAA 2I1QA 3WP0A 1TF2A 1JXMA 4NPHA 1PZNA 1UFQA 3SJCA 1WMSA 2JJ2A 2O8DB 1E0AA 3LY5A 4LHWA 1TF7A 4B3FX 5J40A 4OJKA 4BFSA 4TLCA 1YU9A 1OKKD 1E2FA 2IX3A 1I2MA 1SVKA 1UEJA 4FCTA 4LBVA 4MYUA 4DB2A 4PPQA 4Z54A 2A9KA 2KJQA 3NDPA 3FOZA 2ZSAA 3K09A 4P0TA 1ZBDA 1GM5A 4B3BA 1W7AA 2BEJA 5KPJA 2MSDB 1UKYA 2ZUDA 621PA 4LGMA 1AK2A 3NKVA 1FQKA 1KYIA 4JLBA 4NCHA 3CNOA 1E9SA 1G8GA 1N6IA 3ND8A 5JRJA 2ZRIA 1RYFA 3CX7A 3U3JA 4HAYA 4OQLA 2HJGA 3MAAC 2IEZA 4TQAA 3LBIA 4A92A 4PR0A 4TMZA 1W36C 4AYXA 1TUIA 5AUPB 2PH1A 5A0FA 4IDNA 1DAEA 5FTNA 1E2HA 1E0KA 2NO1A 3Q85A 5IK2D 1ZNZA 3A6PC 2G3YA 3B7GA 1M2OB 2IYUA 4A0FA 5TB5A 1JBKA 4JVMA 2IS2A 2FF7A 5IT5A 2WWWA 1XEWY 2ZI9A 3P27A 4R71A 4OQMA 2PJRA 4NDZA 1ZIOA 2UVQA 4RD0A 1IN8A 1CS4C 1P62B 5C4MA 4AWXA 5D3MB 5FTKA 4EQ6A 1R6BX 1G16A 3PG5A 3SEAA 1Z07A 2JLWA 4HATA 1IN4A 3EIQA 1IAQA 3BBPA 3PFIA 3QKSB 1FPMA 2FFAA 4TQUS 1W36D 2ZSBA 4DC9A 3U6KA 2Z5FA 1HE1C 5JWOA 2DB3A 4L4UA 5A5GA 1AZSC 5DNYB 3PEWA 4L16A 3A37A 1CTQA 4AC9A 2RAPA 3EG5A 3I73A 5JEEA 1NRJB 2F55A 4G5OA 5EE0A 1IBRA 2CJWB 3CNLA 2C8VA 2VBCA 4U5XA 4J0QA 4URXR 2N46A 3VU9B 4C0JA 1J70A 3CF0A 1W5TA 2Q3HA 2W83A 2XEXA 3HR7A 4IOMA 1FX0B 1Z5ZA 3T5DA 3MD0A 2VSFA 3WHKA 1KTVA 3BB4A 3CX8A 2BBWA 3GLIE 2BM0A 2VHQA 3NVAA 4XVRA 2JATA 1NNEA 2FX3A 5AWFC 4A82A 2A7QA 4LPKA 1ZM3A 4TT3D 4XTCS 2CE2X 3AF2A 1S3GA 1XWIA 3BH6A 3LFUA 4KO8A 4M9SA 4M9XA 1NVVQ 4BFUA 2OEPA 4NONA 4CRWB 2NO7A 4CDGA 2QL6A 4JJZA 2QSYA 1G3UA 1WP9A 3KKQA 1PUJA 4V0ME 2LCFA 3PQCA 1ZM9A 2DWOA 4M8NE 2AWOA 5DISB 3A1UA 5B2ZA 2GEVA 1AIPA 4XSHA 2OXCA 5CJ2A 1KMHA 4D25A 3THXB 3VR4A 1NJFA 1A7JA 1IJEA 2IYQA 4TLDA 1NMXA 1EESA 4MRPA 3VR1A 2A5FA 2HXYA 4BE7B 1Z47A 4O25A 1IOZA 4IVPA 4B3XA 4BFXA 1OYWA 3CUEF 1EFRD 1U94A 1VPLA 1RZ3A 1Z8FA 2EWWA 2O0HA 3BGWA 3N2EA 2OBLA 2WICA 3THOA 2ZXUA 1I4DD 4JL8A 1YHNA 2WIBA 3RABA 3KFVA 3KKOA 3RS7A 2BEKA 3TUZC 4KLNA 3RSLA 3AKCA 2KSQA 3PCRB 1G8HA 2HEIA 2WKPA 3AV0B 3I8XA 5IRCD 1NKSA 3FHCB 2VLIA 4G5RA 5LD2B 1WB9A 1VG9B 4PXAA 4MQBA 2JLQA 2YVUA 2IWHA 2ZJ2A 2XTZA 1TEXA 1WRBA 1P61B 3KDSE 4XIGS 2HV8A 5JCZA 3UWKA 4LY6A 3LXXA 3EA5A 1ELOA 1IM2A 1N6KA 1US8A 3I4LA 4PANA 3UWOA 3LLUA 4CEIB 1N5JA 1G3MA 1OB5A 3DM5A 4IFBA 2FDCA 3DL0A 2R8RA 3D7MA 2OCPA 2RGGA 2MSEB 3T06B 1G6HA 2ZRCA 4OI2A 3ZIAA 2XNDD 5KNBA 1KKMA 3DMNA 3U2QA 2O8EB 4LJAA 1W1WA 2PZFA 1QG2A 4US2R 4BECA 1JXOA 5KDOA 4P3YA 3THYB 5GVSA 1GP2A 2GZAA 4F38A 1YRAA 1OFHA 3EZ9A 3QF4A 4EPVA 3GFTA 4Q4LA 1NBME 3VQTA 5F2EA 1G5TA 3U4QB 4JKYA 4V02A 2CEAA 4XVUA 1ESNA 2VIIA 2P0EA 2GBLC 3BRWD 4HAZA 1ZC4A 5FOUA 2YWFA 2C99A 1JR3E 5CYOA 3O8DA 1G21E 4C2TA 5DHFA 3E1SA 5EE9A 3UMFA 1KO4A 2PZGA 5TDHA 3BS4A 1YR8A 1P73A 1NJGA 2BMJA 2J7KA 2ZETA 2XTNA 4I1SA 2GA8A 2P2LA 2V55B 3NWJA 1E2MA 2ZI3A 4NCJA 4ABYA 1SVOA 3KX2A 1XRJA 4BLRA 2E87A 2ZE5A 4IDQA 1NVWQ 4ZI2A 4QM7A 2NTYC 5FI0B 1U99A 1YZGA 2GESA 1IXZA 4RKEA 5FI1B 1OXXK 2X2EA 2ZS7A 5FUVA 2OESA 1Q44A 3QXCA 3LX8A 1NVUQ 4TT3A 4FN5A 1U0JA 2PLRA 1KK3A 1NLFA 4NCNA 4OJQA 3RDPA 3WY9A 4DIEA 4JLVA 5J4KA 3AGPA 3AUYA 3IBGA 2FA9A 1GNPA 2FEOA 2GAAA 2PMDA 2PX3A 3NBZC 4UJ5A 4B44A 5FPKA 3IHWA 4Q1BA 4O3MA 1CBUA 1V43A 1QHYA 5FOVA 2RGCA 2QQ0A 5AJVB 2N1BA 1L2TA 3ONWA 3KQHA 4D2IA 4ITRC 1VG0B 3GJ8A 1FFHA
chains in the Genus database with same CATH superfamily
1SBCA 4U1RA 1QYXA 1K5DA 1I7QB 1JJVA 3KTAB 5K8LA 2JCXA 3ITNA 3MS2A 4I50F 4RTLA 2ST1A 2YHSA 2XD4A 1O4WA 3KM0A 4EH1A 4MR9B 3RJZA 1FSGA 2C5LA 1OX4A 2ORVA 4IVRA 3LO5A 1RYMA 1I6MA 2PG3A 3ODGA 1K7CA 3QHQA 4PBRA 2YW2A 3L84A 1J99A 1RAGA 3H5IA 5A4AA 4AY5A 2WJGA 2A78A 3GZTB 4FIZA 1SAYA 4TYPA 2IXFA 1FRNA 4B45A 1NW3A 3DE7X 4YRTA 2X58A 3HBFA 3WI7A 4BC1A 3D3WA 4L4YA 1QYWA 1E3MA 1OZFA 3QJYA 4B84A 5AVXA 1XALA 3FRHA 3HY3A 3CYFA 1JBEA 4DIKA 5BV8A 4M1EA 1Z08A 2VWGA 5IBQA 1L5GB 2DHRA 3ILHA 2VS1A 3L1HA 1ZK2A 5IN4A 3BIFA 1C7ZA 1RKVA 2PUDA 5IXYA 1L5YA 5K5EA 3K32A 3VFDA 1A9XB 2EFCB 1P4JA 1AUQA 1BC5A 2JJ1D 1MMFB 2O20A 3HNRA 2DSNA 4L28A 3DV0A 2DOKA 2NYUA 1I9GA 2AV6A 4PW0A 3KSBC 4FC6A 5E8RA 3I9V1 3F71A 3GG9A 3H1FA 4MKXA 2GPYA 4NS4A 3KQHA 4R05A 2GJ8A 3O8LA 3KJQA 3DDZX 2WP8J 1PP4A 2J6CA 4FFLA 1II0A 1L4MA 2XNDA 4NZPA 4OI4A 5IVIA 4AF8A 4AP6A 4C3VA 1T4BA 2CCGA 2CCKA 3PC2A 5TT0A 1ORRA 1PZHA 1RZUA 3QXSA 2ANBA 2IZOA 3RC8A 1Z3IX 2EERA 3C3BA 1G20A 3PFKA 4HDQB 3VDXA 5EYPA 4XJXA 4ZYXA 3ZIDA 3AUXA 2HMVA 3F6YA 4UAJA 5EVJA 1DKNA 2X7HA 2X9VA 3D02A 4RIIA 5JYBA 5LQDA 1JQJC 5JTUA 1QMPA 1GL3A 1ZD8A 2QMYA 2H63A 4JD5A 5DM2A 2I3DA 4YHBA 4M21A 1QF9A 2V7TA 2VEOA 3EXG1 3ABIA 4KWIA 3GAZA 4BO5A 3UTDA 2UYGA 1U2PA 4CLXA 4P7KA 2UYYA 4NHEA 2QUIA 3BRWA 1A1SA 2ZDHA 3ES9A 3EZ2A 3HCRA 3O3MB 4DXHA 3M6IA 4EQZA 1RBYA 2IKSA 4R9SA 3U6BA 1G9SA 7AT1A 1A76A 4FYIA 3TXXA 2ONCA 3JZDA 4JQYA 4XARA 4BZWA 2AEJA 1IUKA 2DHQA 2EBHX 2K4MA 1DP4A 2ORIA 4FEYA 3KZOA 4QNMA 2CUTA 1G3QA 3D5QA 1KEEA 5K0LA 5FQNA 2XCSB 2H1WA 3HU2A 1P9RA 3LLCA 3PIIA 5A9SB 2I54A 1FZQA 4KO1S 4ZAGA 3P2JA 5ITZA 2Q99A 4NE9A 1W49A 4Q9HA 4EW1A 2ZYHA 2F8LA 1E9FA 3BMCA 4YT2A 2K5UA 5HZMA 2IELA 4UOZA 1C0KA 4X93A 4DMUB 3KV1A 3SS7X 2O0JA 1PDOA 4ND1A 2QL9A 4UBLA 4URFA 4Y1RB 3TI7A 4NVRA 3ZI4A 4BNIA 5HSGA 3L4JA 1QNLA 4QO8A 3DF7A 2ZVPX 3IR6A 3NX4A 1E6CA 4ZDWA 4F60A 3EDQA 3CLSC 3PICA 1GVHA 1V3TA 4AU1A 4CIWA 3NKFA 1YB5A 2NXNA 2PXXA 2R6HA 5DWQA 4ZOLF 3CE9A 2FWJA 5KOJA 1Z4LA 5D8DA 1NN0A 2C20A 4KI7A 1X1RA 1G55A 2M9MA 3H2SA 1JDZA 2QD5A 1K97A 2FWBA 2OLJA 1CQXA 4B31A 3D3JA 3ICQB 2PHZA 1QTRA 1KSFX 3IGFA 3G23A 4DIOA 1BU8A 1K7YA 4BL5A 1A2BA 3L41A 4DZZA 4A8JC 5ANRB 1F48A 4Q5IA 1YR7A 2I7CA 4CCYA 5LQRA 3H5OA 4F2HA 4UZSA 1F6WA 5BW6B 1RWBA 3LW7A 4OG2A 1IJFA 1XZDA 3F1LA 3TZKA 4DCCA 2FW6A 5DRYA 1YE3A 1OFGA 2B8TA 2ZI6A 1JDPA 4LK2A 3HG7A 3AM1A 1FDIA 2HV9A 3EIHA 5LWQA 1OXMA 5EQDA 1OV4A 1IMJA 4QPCA 3O2SB 4RESA 4A6PA 3GLSA 4PAMA 9LDBA 5JDIC 1TIKA 4O8CA 1TJ4A 1HDYA 3BE8A 5FBRB 1IZ0A 1LBTA 2NXWA 2R11A 2XXJA 2ZSKA 4ZQBA 3KUUA 3LUJA 3OETA 4GXQA 2X40A 3HVHA 1SHZA 4JK3A 2VPPA 1P7WA 1GT91 5FWAA 4BNZA 3T1YB 3BIOA 4KRGA 3DE1X 1AZWA 2PKWA 1OFTA 4PYQA 5SZJA 2F8TA 2AFHA 2ZWVA 4CIDA 4RF5A 1Y1RA 3SJBA 4RQTA 1T3LA 2RE8A 1KZ7B 2Y1KA 2GCPA 1XA0A 3FPHA 4I5IA 4DMMA 5CFLA 1E79A 2AG5A 4G5YA 4WZBE 10MHA 1ORTA 4JVNA 4MWTA 4Q7EA 4RJKA 5DFAA 3EOBI 4RLQA 4UUNA 2C94A 3TUIC 4C0AC 5CDUA 4EVRA 2QA5A 4ZVUA 5BR4A 1CY4A 4IZ6A 5HK8A 5B4VA 3K0SA 1T9DA 2RSLA 3K3PA 3LKDA 3MJEA 2F8SA 1A2QA 2G80A 4NZOA 5DE3A 3Q5GA 3NDBB 2VQ6A 2FV8A 2XWQA 4RBNA 3THWA 1SUDA 1X7YA 2EIHA 1TPYA 4GUDA 1FY2A 5AKKA 3W5JA 3HYNA 1OF1A 4A6XA 3MT9A 6Q21A 1I1OA 3LA6A 1QIJA 1DG1G 2Y76A 3CPEA 1XZKA 3K73O 1IJKA 5AUOB 3AVTA 3P2OA 4D9IA 1ZJWA 2Z6UA 4V24A 2IP1A 3GNLA 2XKJE 4FC7A 3QF4B 1IXYA 3L0DA 1WQ1R 4I1OA 2AQKA 3ROQA 3CUKA 4IYJA 4N01A 5C7IO 4HMQA 1MJFA 2AJ8A 2JA1A 4IUBS 4UM5A 1MVNA 1GY8A 1PV2A 1XCPA 5JCOC 4OLJA 1H22A 3F97A 3U1TA 1LVGA 3LQ1A 1PBNA 2FSGA 3LX6A 3VJRA 1KZ6A 2LE0A 2GD1O 2O50A 1W36B 3A3PA 3BICA 3O4JA 4DZRA 3BYZA 4JENA 1ZI9A 3TWOA 4W99A 3JRWA 4EHJA 5AI0A 1BEEA 2VK4A 3GP5A 3IR5A 3ELYA 1U9YA 3HDJA 1LDGA 2A6PA 2G08A 1KAHA 1M2GA 3BXPA 3OQMA 1IBLB 1LH0A 2JW5A 3PUVA 5AVUA 4NE7A 1CDDA 1W2HA 4IIDA 4KDFA 2IH4A 1FS4A 3L8HA 4OF4A 5AR1A 4H4CA 1KY5A 1CE8A 2C9ZA 3PPVA 1RRFA 1ZHFA 2QT1A 3EF1A 4LHEA 3NJRA 4R2WA 3VTZA 4D98A 2FYTA 1ZJYA 5JWHA 1TO6A 3LS2A 5D1NA 2A59A 3N6VA 3EIXA 1XU4A 3TSYA 2HU8A 4EHLA 3GN1A 4YQEA 2PKQP 4LJ7A 1VIVA 3L4SO 3KSDO 4CTMA 1QIMA 1VBFA 3UY4A 2PT5A 1WZNA 4JR2A 1HK7A 3PXBA 4N5NA 1Q14A 4LOJA 2E4WA 3KT8A 1ABFA 3U39A 4PN7A 3OFJA 2I3AA 4IZHA 3GEDA 5CA1A 1WUIS 3GJYA 4I99A 1TL7C 1JR3D 3MLAA 4BNHA 3PC3A 1YOBA 3UMGA 1FP4A 3GVHA 4EKNB 1YR1A 2FZ4A 4EECA 4UQLA 1NMEA 1C41A 5DI3A 4LWQA 2B2NA 5GGYA 3V1YA 4YJ2B 3CA8A 3RE1A 1JFFA 2ZYTX 5B6IA 3WK5A 3TOCA 1KP9A 3DWEX 1OLUA 4NZMA 5DOVA 2W43A 4OXXA 3HWWA 1EM8A 2RHRA 3PGVA 1I33A 4DLPA 4ZZ3A 1DOZA 3K8ZA 3JAWA 3LBHA 4C6TA 5BUQA 3LXMA 4GXRA 4NTZA 1KYWA 1AA6A 1EK2A 3GEMA 5C31A 3GLIA 1DMSA 3PX3A 2R1TA 4NK5A 4J0GA 1OLXA 1HT1E 1ZNYA 2MOKA 4G1MB 4D5GA 1XPRA 1VLQA 2I71A 1JEYA 2ZWAA 2J48A 1L4BA 4ZC8A 1HXHA 3CUTA 3G6WA 1OX4B 1IRIA 1A9RA 2Z9DA 2IYTA 2GPBA 2Y1OA 3HKDA 3OCWA 4MQLA 1GNTA 1I10A 4JJ8A 4OK3A 5LP6C 2P62A 1P5ZB 1WVMA 3C5EA 4XUGB 2P5SA 4ARCA 3CJTA 2KW5A 2KWIA 4LYYA 1QIHA 4YRDA 1JG1A 1SBHA 2VYNA 1NVKA 1XTQA 1HOTA 3WIBA 3D3WB 5HNKA 2JFPA 2O0LA 3MQFA 3VYVA 1HH4A 2BZSA 3FZGA 4J9VA 5KVSA 5DHQA 1QQ6A 4DV2B 1BXRA 3K15A 4L3WA 2QRNA 3FWHA 4F1WA 1BVRA 4F8YA 1T9GR 2RGEA 4IX1A 3AMVA 2QIPA 3RVJA 3ZCSA 1AGNA 5C0OE 3NTQA 2FCAA 3ZWYA 3NUZA 2X5XA 4E2ZA 5MF6A 3DC2A 3DV0B 4NJMA 3C7DB 5EJ8A 3GLTA 1VRCA 2P2NA 3EGWA 4AJPA 5EXDA 3LUDA 3KCNA 2Q3JA 4YT5A 1R88A 2LKCA 5FKJA 2TMYA 3U3OA 1HYQA 1EGHA 2CXQA 5A7HA 1XLTC 2QE7A 3L6UA 3E58A 4F71A 1G20B 2Z08A 3CJRA 4NYMQ 4WWHA 5EYPB 2A0YA 4PXSA 1KOFA 4AIRA 5T7BA 3FHTA 5CXUA 3R6DA 1IU9A 5LLTA 1CR1A 1MB4A 2OD2A 4Q1AA 5IASA 5BPFA 1E7RA 2P27A 2HKIA 4RIHA 5F1YA 3BJIC 1UXHA 3W2HA 2DHEA 3ESZA 1PGOA 2MR5A 5JJKA 4DKXA 2O7VA 4ZAWA 1PT5A 2O0KA 2X5NA 2CFIA 4B3SB 2FHSA 1K08A 4CEHA 1FFXA 4G9BA 1DI0A 1SXJC 3F7OA 2G4LA 2WVJA 1R2QA 4UTRA 2YJ5A 4PZAA 4RVGA 4F5DA 2ZM5A 2W5UA 3MCWA 4DR6B 1BG6A 4HD8A 5L6MB 4CGYA 4E46A 4LECA 4Y9UA 4PFKA 4ZT7A 4BVGA 2O05A 4YONB 1EZ4A 2HQOA 3L93A 1BN6A 1E64A 1KEEB 4PGFA 3S8YA 4I9FA 3GWGA 2HK8A 5DGCA 3V8PA 1GNSA 4E3WA 5ITZB 4LJYA 1IZ7A 4IV5A 2Q8QA 1TO1E 4GSYA 3HLYA 2OOKA 1IY2A 3BMCB 1A2KC 4WXHA 4OJNA 5G2OA 4BNYA 5J2UF 2R7AA 1TRKA 1V8ZA 2GBIA 2IYNA 2H0AA 2Q1SA 2P9EA 1Z3CA 3P45A 4KE8A 1Y3IA 3I9JA 3SAJA 3WB9A 4BB6A 1U63A 2C4NA 4CLEA 1CUVA 2PMFA 3AM5A 5FR2A 4GRAA 1Z4JA 3EB9A 3DOIA 3M5DA 4JVLA 1GFWA 3PGA1 4HK4A 1XYGA 2JHGA 3AEZA 4HH1A 3NBUA 5EE3A 3RUEA 3S4YA 4GWLA 5IFKA 5FPSA 2IQIA 3O3NB 4QYWA 4JDPA 4COOA 1JHXA 1ENPA 4ZCTA 1K8RA 3T5PA 2X8AA 5TMPA 1R0WA 1Y42X 2ZRGA 2NMVA 2QTFA 2CLHB 3P8ZA 5KOJB 3QG5A 2KYRA 4TLMB 5I9IA 1A5BB 2ZB4A 5COBA 5JCJD 3FZEA 1TCUA 5JBQA 4A1FA 4E03A 3FLBA 2CZQA 3OHSX 1NY6A 3B38A 3IUPA 4LE1A 4HNUA 2NNWB 3GGPA 5DYYA 1E96A 1M34E 4PXYA 4X45A 4WBNF 4GL2A 5DEIA 3OQIA 3HB7A 2VPZA 3MTAA 1LEHA 1E60A 1JPNA 1K68A 1V7ZA 2OOSA 3OZAA 5ILQA 3T52A 1WM1A 2QMZA 2SBTA 2H17A 2JAQA 3CX4A 2X2OA 4MUNA 2XQFA 2J3QA 4BAUA 3HM9A 2J6HA 1PRYA 1XQXA 5J9FA 2X1HA 2X19A 4B75A 4C1BA 4PHCA 1Z18A 4D5EA 3KUKA 3OKPA 2IZZA 2RHOA 2WK1A 4Z86A 4C7BA 5FUQA 1SG0A 4H08A 1JDTA 1R16A 5MN4A 4KE6A 3U09A 5JNSA 4C0QC 3MZ0A 4ZCQA 2RGDA 2V7QD 1JU3A 4FWIB 3FE2A 3KZ1E 5CEEA 3FX2A 2G5TA 2VYCA 2Y71A 4QOFA 4BKQA 1DB3A 2FRDA 3FRIA 3RBZA 3KCQA 1SEVA 3I01M 3ND9A 4FW9A 1E9AA 1DO2A 3NWBA 4HWTA 5CHYA 4YNBA 4DSAA 1D3AA 1KZ4A 4O5OA 1X87A 4RV5A 3KSAC 1UEXC 2VRNA 4GXNA 4W8HA 5K3CA 3FUXA 5JJLA 2QB5A 2BP7A 4G89A 2ACEA 3LT5A 1G59A 1H8ED 5AJUA 4ALKA 3HJHA 2AFHB 1KK0A 3FIJA 5C5CA 4GT1A 3T7AA 1C3EA 4P3KA 4YRCA 1RKXA 1QV6A 3PFBA 3A9SA 4ZC1A 3M6AA 2J87A 1CJTC 5EUBA 3CW8X 4HAXA 4UNPA 2JG3A 2QTRA 1DCTA 2VN8A 2JIZA 5JU6A 3QI2A 3ZDYB 2Z43A 3THSA 2Q4EA 4CF3A 3KWMA 1UPXA 2PBLA 3THWB 4CDMA 4C4RA 1X7YB 2WPDA 4L5BA 5C4IA 2LDXA 4BWFB 2AD5A 1NXSA 1GILA 1G7SA 2QM3A 3IOYA 1SUFA 4M0UA 4PN3A 3K1YA 5GTDA 4Q9KA 3D7SA 2R6JA 1XXHA 2ARKA 3B13B 4PTYA 4DYHA 3QYFA 1DC8A 1KI6A 1W5BA 1PJRA 1TVEA 5HX7A 4D96A 4E7OA 1VHWA 3A7EA 1B1AA 3TLJA 4BLQA 4C87A 1XTJA 1Q5PA 1LX7A 4QGHA 1V16A 4QL3A 1OXTA 2JASA 4H18A 1U0RA 2O14A 3GLFA 5GINE 1BYIA 1YI1A 3ENZA 2L2QA 1UKAA 2B82A 2R6R1 4LC1A 1O9BA 1FNCA 3SYNA 1NLZA 4EG6A 1H4VB 3V7UA 3HUFA 2HA0A 3GRPA 1U8ZA 1YJ5A 4B3DA 4E5YA 1OYYA 3TSZA 5BQFA 3GEGA 4LQDA 3X2SA 2W37A 1HQDA 4NOKA 4RK4A 3DCNA 1YXMA 1AKVA 4E1BA 2C2WA 4B4WA 1CZHA 4KSBA 1U7OA 4EPYA 3B9PA 3L6CA 4B0PA 1Q22A 2I9PA 5FUBA 3WGMA 1Z88A 2CLDX 2V4UA 5ALPA 5TPZA 2B9VA 2G17A 1ULBA 1O0BA 1JR6A 3MD9A 1MX5A 1ZD4A 2POCA 2OBNA 1WCYA 1X7WA 2HTEA 3PI6A 1RFGE 4GMKA 4ZI5A 2EGHA 1SXQA 1CE8B 3G9XA 3RKSA 4RF3A 4V38A 5U1PA 5FIUA 4BJ5A 5FAKA 4FPXA 1PSDA 4OKSA 1X74A 1DU4A 4QPZA 5K8IA 2OE2A 2QZZA 1TCAA 1G66A 3QHAA 1ACLA 1C7FA 4TXHA 2IYSA 4AKHA 3IA7A 4NPAA 4I14A 4NYIQ 4KAAA 1KQNA 2APJA 1U3VA 1R6TA 4G1BA 4RVCA 1Y5NA 2ZJBA 4DMRA 3LC1O 4TLBA 2NT4A 9LDTA 3P0FA 1GYPA 2J31A 2XGJA 3FHLA 4FBLA 4KFSA 5CNKA 3EXFB 4EI2A 5CA1B 1GSOA 2VATA 2ZIVB 3AETA 4OMDA 2OECA 4RMIA 5J2TF 3UEOA 5JEDA 1SPBS 2WZBA 1FP4B 1AKNA 2X2FA 3UICA 3I2HA 4KVGA 4M1QA 5D86A 4P4LA 5BV1A 2IOFA 1K5HA 5DI3B 2GAIA 5H68A 4ZEMA 1Z5PA 3MBOA 1KL7A 1LSOA 1JFFB 1LGYA 4Z49A 2G1AA 1Z7YA 1OLUB 3EDCA 4JMLA 1NF2A 5EL0A 3STVA 4RM3A 1RFLA 1SIUA 1ZH4A 1EM8B 5JQGF 2BGWA 2Y1CA 3SHFA 1XDGA 4U02A 3JAWB 4C6TB 4BV9A 1GT6A 1YDEA 4RPGA 4JU8A 2AZMA 4HQLA 1UDCA 2NAFA 1DXOA 4K26A 1E2UA 1RQRA 3WLJA 5KYTA 1E6EA 2R1TB 3FY4A 3GLIB 3DW3X 4EG3A 1OLXB 3N05A 1O95D 4I46A 3PUJA 1TMKA 1JEYB 4KXWA 4TL6A 3AF6A 1L1QA 1TLLA 3PHLA 4FR0A 1A27A 2XVMA 2ZSJA 3HKDB 3UJ7A 4EA6A 3E9YA 1U1GA 3ME5A 2J3JA 3Q12A 4HHEA 1VGQA 2SHKA 3D5TA 1GN9A 2WJVA 3N86A 4GZ6A 1ZU4A 4N0EA 4QPPA 4QQRA 3DB1A 1ZN9A 3AT1A 1JNYA 2GZDA 1QQBA 2LTAA 1PR0A 1RYZA 2FZGA 3DDUA 1W46A 3K0FA 1GCAA 2W8BA 2XIJA 1C81A 1MFZA 2EBFX 3PL5A 1JYFA 3W2FA 1SK9A 4YP5A 4X8MA 1VMIA 4YECA 4ZRDA 1BXRB 2Q45A 4LJLA 1N92A 3AQ4A 4Y3UA 3LC2O 1JIJA 1UOPA 3RRZA 4MJXA 4MOWA 1WKCA 4WXYB 2I6QA 3GELA 5DX8A 2I2CA 3LP8A 1PKXA 3BWDD 4NZNA 1CY0A 3HXMA 1YS1X 4DZTA 5TR9A 1P77A 1X3SA 4RKRA 3AB7A 1IY1A 4NJMB 4UUQA 4CU2A 4F85A 4KHPB 3OA2A 1M8JA 1DOAA 3JTEA 2XYQA 3TQRA 3ZE1B 2KX7A 2E55A 4LJ5A 1Y9ZA 1GRQA 3OE4A 3I9OA 4B74A 1S1MA 1GOTA 3KD2A 3ZG6A 4OUDA 3IT2A 4D79A 3TEMA 2VF4X 1HYGA 1JE1A 1U2EA 2M6KA 4ZN6A 3TZ6A 1GU0A 2VDOB 4PAWA 2D8MA 1N2XA 2FJPA 5CTJA 4G0VA 1GA6A 2XQVA 4PWYA 2SICE 4WZAE 2XTJA 4X6YA 1KP2A 1A8HA 4BX2A 3ZPXA 1OA0A 4DDTA 3ESYA 4CR7A 1IDOA 1NOJA 1N6NA 2QD4A 3WK8A 3OMLA 3EVFA 1EFRA 1TQ8A 3G0BA 3WGKA 3H83A 5LP6F 5C81A 3GNSA 4CEHB 3U4GA 1LJUA 2FSHA 2R7LA 4FTWA 1FFXB 2G7ZA 1M0WA 3GVPA 3NRJA 3WV5A 2I91A 2EBUA 1I51A 2LDBA 2Z09A 3KE8A 4P8RA 4ZXPA 3JRNA 4G09A 2COEA 4DRXA 3VKHA 2DCUA 1MJGM 1E4VA 1BXZA 4GRDA 4IDHA 4OGGA 5FHRA 2NSHA 1MOZA 2VDJA 2PEZA 3RUIA 2QN6A 4O4IA 1FNMA 3FSEA 3TYXA 1DC7A 3PNOA 2OK8A 4L1KA 3TH5A 1MPTA 1HY3A 1R00A 1OY1A 4FSDA 4IILA 3VZBA 1AURA 2G1UA 4IH9A 2BGJA 5FTLA 4K9QA 2C00A 1ENZA 5AUNB 1UKBA 1P2VA 3QW4B 3VZCA 2F43A 1V37A 5K4GA 5GWXA 4TWZA 4HDRA 5I7FA 1SUEA 3ORQA 1BFKA 2GKSA 3UAZA 2Q5HA 3CIFA 2F3SA 4JODA 2W6PA 3R7NA 3EGCA 3ZCPA 3DDWA 5M29A 1KVSA 3QU4A 5TQ2A 1LW7A 4ZA2A 1OMOA 1BS1A 3OFVA 4LI0A 5HIIA 1HLPA 4U7GA 2E0IA 4QOGA 1FP7A 1SB8A 2GEFA 4AT1A 1RJ9A 4AMYA 5K3OA 1EUCA 4FYMA 3W3AH 2RAVA 3EVCA 3PFGA 1ZOSA 1CERA 2IFTA 4G8BA 4BJHB 5LU9A 1YI0A 4G5XA 1XVLA 1IY8A 4GMGA 3FUCA 4W5HA 1PDVA 1N0UA 2NZJA 5EXSA 3A6LA 3R7LA 2COUA 2XF2A 1SO8A 1NW8A 4Q1CA 2O8BA 3OQIB 4Q7LA 4K9PA 1FMFA 5BSKA 1D03A 1SHUX 3GDFA 3ZKWB 4KRXA 1EB9A 3KKLA 4Z1MD 2FPPA 2WUWE 1N9KA 3ZZ0A 2EKQA 3R8FA 3VNQA 3CNBA 3JD2A 3RUHA 1N2JA 4EHKA 2B69A 2BZ0A 4OHVA 5KJEA 2IF0A 2IA5A 2V97A 1MPXA 5ERXA 3FSGA 3LQ4A 4TROA 4HXGA 4WKBA 3LLMA 2JAUA 2J09A 4X8HA 1GPUA 3ZZUA 3LXUX 2MMGA 1DDIA 3GLRA 5ALGA 5ELXA 3ZDDA 1UFRA 3QWBA 1Z4IA 2ZYAA 3NAQA 1RRCA 4DR7B 3KR0A 5GJVC 1AE1A 3ZU5A 3BJEA 3L1IA 3NTOA 1SQ0A 4RHCA 3MSCA 4FFRA 5JXGA 2BP7B 5KJ1A 1A5ZA 2ZYVX 3X1JA 2O2SA 2C1EA 5KJFA 1XL1A 2A0WA 1T9GS 1DEXA 1KAGA 1Q20A 2D3WA 2JGJA 3AB8A 4CZ2A 2YV2A 1DDGA 4B2IA 1QCDA 4PZLA 1SIBE 4MMZB 5DNWA 5EPUA 4TT8A 1Z2AA 3TLXA 2X2PA 1V5WA 2DU8A 3KL4A 3VTFA 4WNAA 4EHAA 5AW3A 3QUAA 3R9WA 1T35A 3V2UA 5KSYA 4MVJP 3AVOA 4RVOA 2KM1A 4G5HA 2YTZA 3QMVA 5HIJA 5J59A 2PMKA 1P4HA 2Y4OA 5K45A 2GARA 1D6MA 1M72A 4RDCA 3ZU2A 1CHDA 2O7QA 4CXMA 1RQ7A 4JITA 1W0KD 3WQRA 3UMSA 3KR1A 1VBKA 3QVGA 4LRQA 2NU7A 2J0UA 1ZM4A 1XXHB 4IDGA 3WTCA 4BMSA 3BG5A 1H85A 1KI6B 2JCVA 1KWGA 2D62A 1UODA 2FG5A 3FPBA 1QF7A 4N3CA 3LRXA 3H2IA 4RMGA 4BU1A 1V16B 2QVCA 4TKUA 4LZAA 1WXEA 3GLFB 1JB1A 1FFEA 2WW8A 2MWMA 3F3SA 3HP1A 3VVLA 4BNKA 1J56A 4BYGA 3CH5A 3G59A 1GGJA 4ZQGA 5JDCC 4A16A 4D57A 4OLAA 4U6NA 2V6FA 3PC7A 2WF7A 5TQJA 3OCZA 1O6ZA 4NYJQ 3CVVA 3HJAA 1TQDA 1J39A 2YRWA 1U7XA 3R9IA 3VNUA 4TLEA 1O6CA 2Y8EA 3ND5A 5HIMA 3RT7A 4S1OA 3W0LB 3D9QX 1QO0A 3DXZA 5K03A 4JVSB 1KQ3A 2CHFA 1YCHA 1N5MA 1ETHA 2QMOA 2FFJA 3ANNA 3ISVA 2C9BA 4JFRA 3DLIA 3H1AA 3HPQA 3SC4A 3HTXA 2A57A 1X7WB 2IZ7A 4J49A 4B34A 4XB6B 5JCXA 4G07A 2P4HX 5C1PA 1M2NA 2XOKD 1HEIA 4JB0A 4P5DA 4KV9A 1E5LA 2QK4A 1CR2A 2P7HA 1IAVA 1EFLA 1F8UA 2Q3BA 3OKCA 1FNSA 1VZ2A 4MWOA 4A26A 5B2FA 5BR1A 2FW9A 3QLVC 4C4OA 4PC1A 2NPFA 3AKEA 4CU5A 4ND7A 1CY2A 2C03A 2HPAA 4UEQA 4COKA 5ECDA 3W5VA 3NPAA 4ZCSA 3AFMA 4L75A 4UFNA 1T9AA 3I05A 1U4SA 1YUNA 1Z0UA 4FYXA 1U0NA 3RRJA 5IC6A 2CMHA 1UJBA 2VYFA 4KOEC 5LBIA 3WKEA 1OWLA 2G7MC 3AETB 1NWHA 1AK1A 4KQKA 2IHZA 2VHVA 3PVSA 5LZ5A 3DOUA 1IH8A 3JQQA 4N18A 4OQZA 1WG8A 3PQ5A 5AOBA 4C4AA 3N87A 1ZISA 3TEFA 1G5IA 5KQPA 2QP4A 5TF0A 3KKNA 3Q3GE 3D4NA 4M0EA 3ZI7A 5KSOA 2A5LA 4NATA 5BWLA 4Y2RA 1H4TA 4Q1EA 5BUZA 1YMUA 2GBCA 3DE6X 5CHEA 5HJEA 2YINC 2PQMA 1J9ZA 3IA2A 4B33A 2P9TA 3H1EA 3B1VA 1R0KA 4IQFA 2WM9B 2XE4A 4BNUA 3AEXA 4HLUC 2Y9MB 4D82A 4ZV4A 2EW1A 1LDYA 1P2TA 5ENZA 1W1UA 1DKOA 4BGIA 4LK3A 3PJRA 1H5NA 2NLOA 3IERA 3A2KA 2HRBA 4JYZA 2CNWD 2JJYA 4R5MA 1B2RA 1SKYB 1P7PA 2WD7A 3DFUA 1C8LA 1K4YA 4IRXA 3V3KA 5C8YF 2L18A 1HZZA 2J9XB 3RQSA 3T12A 4EJ6A 1JV2B 2C92A 2IXBA 3UKOA 1MG5A 4M0LA 2WTXA 1NXWA 3NETA 3T7DA 2EWVA 2I2WA 1TNDA 4DLAA 13PKA 2HJVA 3K9GA 1IQPA 4RS3A 1P1BA 3PHIA 4YCJA 1UDBA 2ZIAA 2W8BB 1QP8A 5C8VA 5BPHA 2O3JA 3S27A 5AMXA 2HRDA 1C0EA 3T3EA 4NZ9A 3ECAA 1NP7A 1JAXA 2FSUA 4HJRA 1QTQA 3LLSA 2DY1A 4CV1A 1W2GA 2H4HA 1V5FA 2WWXA 2XVYA 2IGTA 1EFCA 2BR5A 3GFPA 3ND7A 1T5HX 2GN8A 4RACA 4RYDA 3IEIA 3IP9A 4MMYB 2ZJOA 3FNBA 4OK5A 5BQPA 2BF4A 1H2HA 3RFCA 1G2OA 3W5SA 1GZ4A 4XWAA 2A14A 1HYEA 2FWIA 3L4BA 3FVTA 4XGNA 5E0OA 1A50B 3W4JA 5KTYA 5DTMA 2DECA 4D8WA 5AVKA 3BMNA 4OUDB 4MJ3A 4XYMA 3NEAA 2C82A 4D74A 4E5UA 4A15A 4OHFA 1ZA2A 4LRWA 5ALIA 1FMLA 1P0IA 2R5WA 3OD5A 4LSMA 3NOVA 3HBMA 3Q8XB 3JY6A 3LBNA 1A9PA 4KDRA 4MS3A 1M67A 3SYTA 1M54A 1B74A 2IY9A 2JVJA 2VK1A 4IMRA 4AMUA 2PZKA 4PX2A 3SD7A 1W4ZA 1WD7A 1EVQA 2C2MA 2CMGA 3C14C 3EZ6A 4PX5A 3W78A 3WMXA 3AJEA 3QX3A 3AL0C 4GR5A 2D1RA 4IBOA 2QLMA 4MW1A 1TADA 1UJ5A 1X7XA 2BHLA 3FOAA 2R751 5KOIA 1OE0A 3D59A 4J6EA 1Z6AA 2JFFA 1PYDA 5LUAA 4TWIA 2OORC 3GFGA 3I0ZA 4ZOBA 2DPLA 4J0KA 3OHPA 1T29A 1VKHA 3B82A 2QM8A 1R1DA 4B35A 2XH8A 1V6AA 5KSPA 4DRXB 1XTZA 3BF7A 4HWKA 3CWZA 4NH0A 5CG2A 1RD4A 1FSZA 5KOHA 2H5LA 1NURA 1DBWA 1RHKA 2D2FA 4G1VA 4GG1A 4L5AA 5CJPA 5GONF 1YBHA 2BGLA 2UVDA 3QP9A 5IJWA 5EKDA 3FPFA 1TAHA 3PDJA 2V0GA 1VPTA 3I5UA 4H1VA 3PQ2A 4O4IB 3I45A 4RH1A 3UMCA 1KYVA 3VPHA 4DLXA 2NT3A 3DKIA 4FR2A 1U28C 1XMJA 2FPLA 2C8JA 1B7GO 2J5XA 3LHKA 4RZ2A 3Q9UA 3BQ9A 3TQFA 1XCMA 2WJJA 5IAJA 4L8GA 4M8KA 3D2CA 2CV0A 3CEPB 5CTAA 3H86A 2ONZA 3BD9A 1ISGA 2F43B 4J7AA 5J4VA 1I9CA 3PJFA 3M9WA 1QH8A 2AZTA 2EQAA 1ZK3A 2GX6A 2OFWA 2WVAA 3CGGA 3FPAA 3FPLA 5CBPA 4R1MA 1L5KA 5FWYA 3O4GA 2FB9A 2HD4A 3AU8A 3VR5A 4QATA 4R6WA 4V0KA 1ZHOA 3E2PA 4BPBA 1T4DA 3WIVA 1MO4A 1RQNA 2F64A 4IQ0A 3RF6A 1TKCA 3DXXA 1GKLA 3WOHA 1BDJA 2B20A 4Q3LA 4RK0A 4NXNB 4ZTBA 5EZQA 2ZB8A 1RJ9B 3PRYA 2ROQA 1T1SA 1XTUA 3B85A 4DLUA 5DWDA 3VC1A 16PKA 1EUCB 3X2EA 4AN1A 3UFBA 3GX1A 3AUJB 3UJ6A 1Q6YA 2Z57A 3TVTA 2Q4OA 3FM9A 4GDFA 2ZRMA 2VTBA 1EI9A 1D2CA 4HKTA 4BN5A 2W6JA 3CWCA 3RRYA 2O8BB 3SX0A 1GG9A 2PRYA 1L4EA 3CR3C 3FTNA 3CG0A 2IV3A 4CCWA 3O0DA 4V0LA 3G89A 1IHUA 4BBZA 5DW0A 4CTJA 1RYNA 5H9VA 4UMEA 2DM6A 1FFWA 5JTTA 2E49A 2FPPB 4YCBA 4NJEA 4J2TA 5FPPA 3RIEA 1NYQA 3N5KA 2VP0A 5JAIA 5JRZA 4RK5A 3UANA 1OVGA 2PA0A 1L5QA 1KRWA 2J33A 1Z12A 2VTEA 4DNPA 2QAGC 4RKFA 1A04A 1X9IA 4D3SA 3NIBA 5CLQA 3PPWA 2K2QB 4YRJA 2A2ZA 1YL6A 3TJRA 3O1IC 1E89A 2G88A 1GZSA 3QE9Y 2X5KO 3EXIA 4NBTA 4UQOA 3HXTA 1WSAA 4OFXA 4WH0A 2ZWPA 4TVBA 5LCXA 4BB9A 2NUAA 5L45A 4TYWA 2PO5A 5B6PA 4PIPA 1LK7A 2BFAA 3USES 2ZJ0A 1Z6XA 1PTJA 2I4MA 2VWPA 4TN1A 1NUSA 3F3YA 4JJFA 2W2OA 3FPCA 1CV2A 3BN3A 1L4KA 4OQYA 4MV5A 5CA0F 4G63A 1N2SA 3RUCA 1GV0A 4JOBA 5BYBA 2BTQA 2HBRA 2R85A 4NYMR 1ONSA 3WWOA 1SUBA 1H2WA 2Q7DA 1L6RA 1UK7A 4MDHA 3VPSA 1RI1A 4IPTA 4IOLA 4G4SP 3VHRA 3UUGA 4P58A 1V9SA 4WNAB 5ALYA 3LLVA 1QGED 3KR2A 1YE8A 3HCOA 1U81A 2IUYA 1C4WA 1E8DA 4LC0A 5LQSA 3LVRE 4K6OA 5EQFA 5TXGA 1VHQA 4LZLA 5KNCA 2JK0A 1YNSA 1K89A 2QJWA 5GIOE 2ZBQA 2M2IA 5G0WA 3A3YA 3GHHA 3BD6A 3IUEA 3NNDA 4HNQA 1DFHA 1T1IA 2WIKA 2F59A 4K46A 4JUAA 3QVGB 3OIUA 3AR9A 2NU7B 2J0UB 4HLQB 4Q12A 1WUYA 2DUJA 3LCVB 4U2BA 1NVFA 5D3ZA 5J5VA 4D0GA 3E9CA 1XN4A 1AKMA 2VNHA 3OBIA 4MEJA 1ULZA 1VDZA 1RZRD 2X77A 1L1EA 2DFLA 2YOFA 4IHQA 2JGLA 4P7JA 3PI7A 5F7ZA 3L92A 3TLBA 2GLUA 4DNQA 1L5SA 1GAJA 4TKUB 2VP5A 3JALA 5FAXA 4BY9E 4H3SA 5IJZA 1SD5A 5BNZA 4IXNA 1GWNA 1PLJA 2OXEA 3GFOA 3HB4X 2DUWA 2W4QA 3I58A 2CXUA 3QXGA 4PZDA 3RD5A 1Q50A 3AHHA 4XWWA 1E59A 4GKVA 3A4LA 4MI6A 1FXWA 4CCSA 5F76A 2NQ2C 4ITUA 1GSAA 2R47A 4I5EA 4UQPA 5HQJA 4BVBA 1Z6GA 4KCGA 4KXLA 1Y6GA 5BN5A 4Y0VA 2GD6A 1G4HA 2CNDA 4F0JA 3V8BA 4EW2A 1PWZA 3TW8A 1COWA 2LRHA 2NV2B 2Z9BA 3AI2A 4UAVA 1SEPA 2CMFA 5U4XA 3Q72A 2HHCA 3SEZA 4MVCA 2ZSDA 3AIKA 3H84A 1LFAA 4DCTA 3RYFA 4DDWA 2GILA 4QBFA 5IKEA 4E22A 2C9OA 9GPBA 1PZFA 3P96A 4BJ1A 1ZIXA 2CHGA 2FFRA 1FVXA 1IQRA 5BN4A 1SR8A 1XLVA 3A26A 1PZXA 3TR6A 1DOHA 2HT1A 4JN6B 1QPGA 4Z99A 2ZTLA 3L79A 4KXFB 4RGVA 5JH7A 3DTVA 1WU8A 4WACA 1PL8A 1JL3A 3KB8A 1CNEA 2YWEA 1QYVA 2ZJ3A 3E3LA 3ROPA 1XZ8A 3UKJA 3W7AA 3PPYA 3CW9A 2V7XA 2WAXA 1A8SA 3DUWA 1N3IA 5T4EA 3QVMA