3RNLA

Crystal structure of sulfotransferase from alicyclobacillus acidocaldarius
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
298
structure length
247
Chain Sequence
VARPNFFIVGAAKCGTSSLDRYLSQHPDIYIPPKKEAHFFSIPDFPERFTGPGDEGMNLYTIRDEDAYMRLFDGVRGERAVGEASVFYLFYPGTAQRMYDAYPDAKILIMLRNPVDRAFSAYMHLVRDERETLSFRESLAKEEERIRQHYEPLWYYRAVGLYAAQVKRYLDVFGREQVKVILFEEFARDPVQVVRDCCAFLGVSTDFVPDTSMEMEPDLREELTAFFAPDVARLEALIHRDLSAWRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Sulfotransferase
publication title Crystal Structure of Sulfotransferase from Alicyclobacillus acidocaldarius
rcsb
source organism Alicyclobacillus acidocaldarius subsp. acidocaldarius
total genus 90
structure length 247
sequence length 298
ec nomenclature
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13469 Sulfotransfer_3 Sulfotransferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3rnlA00
4JLKA 1W4BA 3GPLA 4Q1DA 3PITA 2JJ2A 4L9SA 3DM5A 2O0JA 2XJ9A 4QL3A 2NO7A 3DZDA 2OXRA 3M1IA 1GTVA 1MV5A 1W36C 4AI6A 5JS8A 4TMWA 2CVFA 4PFSA 1GILA 2REBA 3OIYA 4NPHA 1LNZA 1XPRA 2A2ZA 1Q3HA 3RS2A 2ZUBA 2C9YA 4W5WA 4A92A 4ZDIA 2BKUA 2D4HA 3C41J 4CW7A 3GD7A 2UZ3A 2OUKA 2AK2A 1Z6AA 4DCNA 4TYNA 3C15C 3WNDA 3T06B 2H18A 3G0HA 2IS1A 3SFZA 4M9QA 1E2GA 5CDFA 1SKYE 5EQTA 4C9BA 1DBSA 2BMEA 2BVNA 4NYMR 1KO7A 1JJ7A 1UF9A 2FSFA 1J8MF 1TU3A 3GJ7A 2I4IA 2WWHA 2PEZA 4QNMA 1AJEA 1XU4A 1GNPA 2NO0A 3PEUA 4R98A 4URXR 1E9RA 3HU3A 4NCNA 2GDJA 5J40A 4BFUA 3TKLA 5BN5A 1Q22A 2GBLC 4L15A 1W46A 3AVVA 2QE7D 3KTAB 2ZITA 3MD0A 4HB4A 2ERXA 4KVAA 2WWIA 1VHLA 3Q8XB 3QIAA 4BLQA 4V0MA 4G5SA 3U3OA 2QE7A 4TLEA 3CBQA 3QXXA 1R5NA 1WXQA 2J0UA 2GESA 4PZZA 1E79D 2BBTA 2J9RA 2VHTA 3H2YA 4IDHA 4KBGA 4MUBA 3T61A 1AGPA 4E09A 5CYPA 2O52A 1QVAA 2WAXA 3AVOA 1G3UA 1KAOA 1ZRHA 5FFMA 1E79A 1OHHA 3TIFA 4EJSC 2PX0A 5FBVB 5L3QB 2HCJB 2VSXA 2FWRA 4DDVA 2WOJA 3H0KA 3H84A 4NBSA 4TYQA 1JI0A 3FKSD 1P5ZB 4LWZA 1ZAKA 4HUQA 3KUDA 1JAHA 1KK3A 1XPOA 3L0OA 4OK3A 5H1YA 3SJBA 3GEHA 3FKSA 1OXXK 3C8UA 4AG5A 2CE7A 4LPKA 3SR0A 2C78A 2QGZA 4DRZA 1YZTA 2VSOA 4TLCA 1HQCA 4RCYA 2HUPA 2ZRHA 3OIVA 1BS1A 2J1LA 1YE8A 4M1OA 3RABA 4CYMA 3OEHA 4Z8XA 3BH0A 1OFUX 4ESHA 1S0UA 2ZXUA 1BOFA 1XD2B 2REOA 1HH4A 3QPUA 4PTLA 3THWB 3BH7A 1WCV1 2XTMA 1IM2A 4D82A 1ONBA 4MUAA 4Q4HB 2J59A 2JEOA 4TTRA 3TK1A 4EPXA 5TB5A 4LDJA 5TARA 1G1MA 4O2LA 821PA 4QJ3A 2CNWD 4DLTA 1K5GA 4DIEA 2LCFA 2CE2X 3QUSA 4LRWA 4F93B 1IHUA 2X19A 1UBEA 4JLMA 3QPVA 3P1JA 1M1YE 3EC1A 5LDDC 1JPNA 1PUJA 2CNWA 4M9SA 1ZM4A 4KLNA 1EG7A 2FU5C 3QF4A 3BB1A 3CX8A 4L4UA 2GJKA 2QTHA 4LJ6A 1XP8A 4KBFA 1U8AA 5KPDA 2VF7A 1E4VA 2ZJAA 3KB1A 3QKRB 1Z07A 3LX5A 4NYJQ 4HZIA 2AWOA 3AVWA 2QAGC 4DSUA 3QXJA 3W90A 1G8HA 1VG9B 2Y8EA 3AGQA 2ZI3A 1E2IA 1QHGA 1YRBA 3GJXC 2J87A 4CF7A 1AQUA 1W1WA 1Z0JA 4Q03A 1P3JA 2EFHB 4EKDA 2B8TA 3BGWA 1PZNA 4Q02A 3BE4A 2BBOA 2EVWX 221PA 5EE5B 4LSGA 3UK6A 4A9AA 1DAFA 1UDWA 1X6VA 4DIDA 1UPTA 2FDCA 1VCMA 2FSIA 2VP5A 1W36D 1N3BA 3UPUA 1E0KA 2P3SA 1TX4B 3X1WA 2FJUA 1AGRA 4ZDKA 3DZ8A 4XJXA 3EZ2A 1QHYA 1QRAA 4R2IA 2G6BA 4BLTA 4BFXA 3HPQA 2GCNA 3TLXA 1G64A 4DT1B 2ORIA 4M9ZA 4BLOA 5BN3A 4TMVA 4GL2A 4Q9IA 2J0SA 1N0WA 3Q9LA 1RRGA 5KHOC 2D2FA 1TQ6A 2OILA 4GZLA 4KODA 3EIHA 1XF9A 4WIAA 4B2PA 2J46A 2ZETA 4PC3A 5FL3A 1CRQA 4AIIA 5JS7A 2WKPA 3KQUA 4C7OA 1ZUNB 4PQFA 4M1YA 5EP3A 1C1YA 2BC9A 3K09A 5FTKA 3V9PA 3LLUA 3FHOA 3S1AB 5HPYB 2HT6A 5CB8A 1IY2A 1XRJA 2ZIAA 2QUZA 4YLGA 3NIBA 3FHTA 4LBVA 3JZAA 3FHCB 1KI4A 4OQXA 1G291 1S1CA 4WVFA 2Q21A 3BK7A 3AKDA 1CXZA 1TADA 3BIFA 3EW9A 3P26A 1Q21A 1B0UA 1L8QA 1NMZA 2N46A 2Q9AA 3TVTA 3WY9A 1E96A 1JNYA 4DBLC 1CJTC 1KI7A 2O8DB 1JQJC 5FI1B 4LPSA 2OCBA 1CR1A 3AM1A 4IHQA 3IQXA 4L5BA 3NVAA 2R8RA 3B8HA 5DISB 1E2FA 1NSFA 1AS2A 1NP6A 1TUIA 4BRWA 2QGNA 2V1UA 1E2EA 2R6FA 4EJSA 1AKYA 3ZJYA 1JAIA 3ZZTA 1W7AA 3ZD7A 5CJPA 3QENA 3SFVA 4BECA 2JGNA 3ND8A 2DBYA 4DCSA 1FP7A 3VAAA 2QAJA 1WRBA 4LJAA 1OE0A 2WWGA 4RZ2A 4DEYA 2VHQA 4DLXA 1S3SA 4Q9HA 2JATA 3DDCA 4BZPA 4WW0A 4FCWA 2ZRGA 1NLZA 4QXAA 1YZUA 3DKVA 4K81B 3U7GA 3SQWA 2VF8A 1MOZA 5EP1A 3IO3A 4II7A 2HDNB 4RZ3A 4JBYA 1CS4C 1XEWY 5TVKA 1JR6A 1KO8A 4YDHB 2IX3A 3EWAA 1ZIOA 4IRUB 2BCJQ 4Q66C 5DE3A 4D2IA 2XSZD 4GOKA 4XD7D 2O8BB 1M6NA 1F60A 3IKJA 4QNRA 4PC7A 4DDTA 1U8YA 2C9CA 5JRZA 1S8FA 2A5YB 4C0AC 2XSZA 1ZM2A 3QG5A 4XD7A 4MRRA 5FTNA 4QGHA 2QAGB 1G3MA 3K0FB 5AUPB 4TTQA 4URWR 4HYYA 1R8SA 2VEDA 4N0DA 2IWHA 1SZPA 1J8YF 3AP3A 5KSZA 4R9UC 3THXB 4B3GA 2WWXA 5FH9A 1PVOA 4LGMA 4PAQA 1F2UB 2ZUDA 5DYIA 3OE7D 1F2TA 2ERYA 1FPMA 5SZIA 1G5PA 2W0SA 2QG6A 2G1KA 1CRPA 1EK0A 3PCRB 3OE7A 1XBTA 3SYLA 1NRJB 1VMAA 2PT7A 4LV5B 4MDFA 3LA6A 3ZVLA 3RWOA 3WMGA 2FFAA 5FUWA 5J4KA 1P7CA 4QJ5A 2EFCB 1LFDB 2JLWA 3ICEA 4D80A 4AKGA 4GMXA 4IDOA 3B1ZA 3D8BA 3VR2A 2YNMA 4BFSA 1ZUIA 5AK0A 2AXPA 2RGCA 2GJAA 4PO8A 3KJIA 4CZ2A 3W6PA 4EUNA 1OH7A 1Q44A 3R9XA 5L3SB 3I8SA 2IYYA 5FUYA 3VU9B 1M2OB 3FFAA 2WOOA 3ONWA 5D3MB 1T3LA 4DZZA 2QENA 2QT0A 4NH0A 3LFUA 3VR4A 1XTKA 3ICQB 4YC7A 4AYXA 4RZUA 2XZPA 3B5JA 3RSOA 3L0SA 3MSXA 2QP9X 2XNDD 4B73A 3CWZA 2NZJA 4P3YA 1D5CA 3EA0A 1UKYA 3T1QA 2YOHA 2DFNA 2VTKA 1E94E 1JECA 2XNDA 3IILA 3D31A 4GBMA 5FTLA 3TUZC 1JEDA 1OW3B 1KI6A 2W2TA 4PHFA 5EE0A 3MLEA 2H16A 4JLBA 4UJ5A 1NBME 4QFMA 1T5LA 1ZW6A 4D6PA 2VP4A 5UKDA 3K9HA 1TAGA 3BAFA 1A4RA 3FOZA 3GLFE 4HLUA 4AD8A 2WWYA 2XX3A 1C4OA 2CLCX 1MKYA 4MYCA 3WYGA 4ZDJA 3LBHA 3R7WA 2ZREA 1UKVY 4YQFA 3CM0A 3I32A 3KXIA 5AUNB 3QI2A 5HZHA 1GNRA 2C5LA 3FB4A 2B7BA 1VPLA 3EIQA 3A37A 4FMDB 2OXCA 3IDQA 3PUVA 2OG2A 3IPYA 5DI9A 5DSZA 3K9LA 4QG7A 1W4AA 2FA9A 2QMEA 2Z4RA 4IVRA 4OQLA 3F0TA 4MITA 2V8OA 4CDGA 2F1IA 1ELOA 2IK8A 2R2AA 2D74A 4MRPA 1TL7C 3C16C 2IYSA 3W34A 2A78A 3T35A 2CVHA 3B2EA 4W5JA 5DN6D 3U60B 421PA 1J70A 4FIDA 3QKUA 1N6OA 2ZS7A 1F5NA 5BQ5A 3EX7C 1CF4A 4JLNA 4PANA 3KQLA 1TF7A 4ZCLA 3IEUA 1RJ9B 4QBGB 2AKYA 1A2BA 4AKEA 1BMFA 1S4QA 2W2XA 1WP9A 4ZV4A 2H1LA 3ZZUA 1EWQA 1WA5A 3QVUA 1XFAA 1G3QA 1ZC3A 4P4SA 5HZKA 3B60A 3LVQE 1NKSA 2F7SA 3EZ9A 5JCZA 3QY0A 2WIBA 5FOVA 2O0KA 3SE0A 4ACBA 4IOKA 2G1JA 3FMOB 3VX4A 1GP2A 1XTSA 1SHZA 1RVDA 2A3RA 2LKCA 1QG2A 2G77B 1KK2A 4X8MA 2IYWA 1MH1A 4IXMA 5KTYA 2WJVA 3TH5A 2RGAA 2FPLA 3DMNA 3QNUA 2JLYA 3PIRA 5F9FA 3GLHE 4HAXA 5DHAA 2GILA 3Q7PA 3SYNA 2ZRFA 1VCNA 4LC1A 1VG1A 3NWJA 2ZRKA 3TUJC 2IBMA 5H8WA 3OAAD 4LV8B 1H65A 3DKPA 4JVSB 1NBMD 1E1QD 5LD2C 5AJYA 4A0HA 5EXSA 1FX0A 1Q12A 3AQ4A 3SN6A 5JHHB 4RSGA 3OAAA 3MWJA 4EFMA 1UM8A 2V6IA 4AY2A 3K9GA 1NBMA 1IXSB 1E1QA 3MMPA 4FMCB 1DAEA 2AXNA 4WZ6A 5L3RA 4TZ6A 5B57C 1P75A 4WZBE 3GLFA 1ZCBA 4JMPA 1FTSA 2R65A 1KK0A 4V0KA 4U5XA 5JEEA 4K46A 3LDAA 1II8A 4LYJA 3TSZA 3NH9A 1UJ2A 3EWSA 3LXXA 4HEJA 2WWWA 3KJHA 1OXSC 3CLVA 2NPFA 2O8EB 4YMWA 5HR5A 2PLRA 4B48A 4P4UA 3IIKA 1M7GA 1GKYA 2GF0A 4QM6A 3ZQJA 4KI0A 1CBUA 4DVGA 1HT2E 3FWYA 5HE8A 1TTTA 4OHWA 3QBTA 5E7IA 2RGBA 2ANBA 5GJVC 4B47A 3C5CA 3CR7A 4HZUB 4IOLA 3RNLA 4Q9JA 2F55A 4BPBA 3O47A 3RC3A 1ZUHA 1OFHA 1IN5A 4BRUA 4B3CA 3N70A 1E2NA 4WOPA 1Q1QA 3IEVA 3X1XA 5JWRA 1VECA 2NOAA 1Z0FA 3VNUA 1U94A 3G82C 4JLPA 3B1YA 2Z4SA 5G41A 1JB1A 4IXNA 4LHWA 1KJWA 1GRNA 1TQ2A 3WHKA 1G4AE 3KJGA 4F92B 3NDPA 2ZJBA 3I61A 5CB6A 4C0HA 4X8HA 2FV8A 3L8YA 2YC2C 4MDEA 4S2EA 4Q21A 4DJTA 4DKXA 2OSBA 3EA5A 1P4SA 4FMDF 2JJ8A 1ZD8A 3OEED 5GADl 4L9WA 1ZU5A 1SVSA 4MYTA 2ODNA 3QKSA 2PJZA 5FUXA 5L3VA 3FDIA 1G41A 4YDSA 3GLHA 1AQYA 5GJCA 3CRQA 1G8FA 3J81k 1UKZA 1R8QA 4FINA 4Q4LA 1DVRA 4MA4A 3RWMB 2R6AA 1V43A 2ZRBA 3RYTC 1KI3A 1P2VA 3AP2A 2FFBA 2GCOB 2OCAA 2X1VA 5AJXA 2J7KA 2XTNA 1TF5A 3P27A 1U0JA 5IHPA 4Q01A 2QU8A 4LC0A 4QC2A 1LB1B 4RY2A 3I92A 2GNOA 2V7QA 3REGA 2F43A 2MMGA 5H68A 5G3ZA 1RKBA 5AWFC 3K70B 2I3BA 2ZJ5A 4NMMA 4PAMA 1N25A 2DHRA 2ONJA 3THYA 3PENA 4GPTA 5FBLB 4D4MA 1XJQA 1VDZA 4V0ME 2FZ4A 4EIWA 3CX6A 1W2HA 4B35A 3AH8A 1I2MA 4OHZA 3UKDA 3AVYA 2BV3A 2IYZA 3I73A 5G53C 2JLUA 1BO6A 1TU4A 5TV2A 1SVOA 4JVLA 2VP6A 2ZJ8A 3HU2A 1T91A 4P32A 4UKDA 3PEYA 1E2KA 1NNEA 3SYKA 1S1MA 1PLJA 5EXXA 1Q1ZA 3GQBA 1NI3A 1T9HA 3AKCA 1FUKA 4YONB 3KL4A 1X8JA 5J4YA 4LBWA 2XXAB 1VG8A 2FX3A 3NHBA 2C04A 1XTJA 2G9NA 3PXGA 4BFVA 3KX2A 2P6NA 5DNYB 4LI0A 5CLQA 1OB5A 4Q7KA 2VL7A 3MUFA 2BBSA 4FMCF 5AR1A 5E95A 3LH5A 1AZSC 2JDIA 5CIWA 4RD0A 1HEIA 3VKWA 2O8FA 5JSZA 1MT0A 3GLGA 4M0LA 2IYRA 4IKEA 3BFXA 4A8JA 1XEXB 1NN5A 2MSEB 1AS0A 4RFSA 4Q1AA 1M34E 5C4GB 1U81A 3K0EA 2GJ8A 5KOYA 1KMHB 1E4YA 1S96A 4N0EA 5EP4A 3LW8A 4CEJA 1DG3A 3MWKA 1CR4A 4TN1A 1NIPA 4V0OA 5J5CA 1BH2A 2ZVQX 5DIFA 1FTNA 3BBPA 4QHTA 4LX0A 1NVWQ 1KJYA 3WXMA 2QMUA 2QPAA 2HYDA 3VR3A 4IW3B 3BFKA 2MSCB 4AK9A 1DAIA 3QPWA 3KKNA 2R6DA 2FOLA 4Q9KA 2VHCA 4OI2A 1FW6A 1P9NA 3ZVNA 3TJZA 2GVDC 4MKHA 3Q7QA 1XX6A 1E2LA 3N2EA 1GOTA 2Z6VA 3WRYC 1E1RD 4DEXA 3R20A 1EGAA 2Q9BA 1RE0A 1JQLB 4ABYA 5AJWA 5JCPA 4H9GA 2IA5A 3SDZA 5JLJA 3U7HB 3IIJA 5FBWB 3RS3A 1U90A 1T8TA 5BYKA 1E1RA 2CXXA 4NP6A 1O87A 4CEIA 1YR7A 1DEKA 3QOFA 2PJRA 1GL6A 1NVVQ 2KWIA 5C2JB 2DCUA 1GKUB 3IHLA 1KO5A 3E2IA 2JASA 1LF5A 4GOXA 4NCHA 5P21A 5JHGB 2QRNA 2ORWA 2IYVA 2IXEA 2W2VA 4LHZA 3AF0A 1XZQA 2XB4A 2BKEA 3P20A 2FH5B 5KNCA 1G7CA 2WBLC 5JWHA 3NXSA 1UDXA 4KXFB 1E99A 2ZRMA 3CB4A 3D3QA 2CHVA 2RHMA 2FPMA 2D06A 4XWOA 1UADA 4JLVA 2JLVA 4U7DA 1BYUA 3I4LA 4NCIA 2WWFA 4G1UC 1X3SA 4PQYA 1SXJC 2A5FA 3CKLA 2HLDD 4Q4JB 2ZE5A 4B3DA 4FMBB 3O8CA 2K5UA 5L3QA 2ORVA 2JLRA 1R7RA 2B92A 3L82B 1E9EA 4BLPA 1KDRA 2G0NA 2HLDA 2WTUA 4E22A 3B13B 1OB2A 3LVRE 1AS3A 3TUIC 2OEPA 3FFBA 3FTQA 1OYWA 2C8VA 3LD9A 1E9AA 1XZPA 3HPRA 5SZJA 3BH6A 2QSYA 4KSCA 4M9XA 3A36A 4KSBA 4JLOA 2ZVPX 2I1QA 3RS4A 2P5SA 1P2TA 1OIVA 4KAXA 3SS8A 2W6JD 2V1XA 1EESA 3MCAA 4LOAA 2JAQA 3Q5DA 1EWRA 3U7EB 4UXIA 2HF8A 1T8UA 2BOVA 1SKYB 1XD2A 1S9DA 1G5TA 1XD9A 1YZNA 3X2SA 3THWA 1I2DA 1ZNZA 4PZLA 4UQOA 2RB4A 4GSYA 4UNNA 3UMFA 2MMCA 4EPYA 4F4CA 1KSJA 2ZR0A 1RRFA 3E5HA 1E9BA 5IRCD 4LJ8A 1DO2A 1XWIA 1NIJA 5KSPA 4BZQA 2D2EA 3AP1A 3RC8A 2TMKA 1S2MA 4NYIQ 2ZYWX 1KY3A 1NL3A 3AF3A 2WZQA 1XMJA 1Q0UA 2IHYA 5KDLA 2E9SA 1NVVR 3KB2A 4O25A 4URZR 4XWKA 1YVDA 2RGNC 1R0XA 4ZKEA 2VHJA 1KO4A 1OT3A 4L8GA 2QM8A 3EZFA 3DOEA 2Z83A 2WKQA 4IJMA 2E87A 1D2NA 1XEWX 3MWLA 5EXTA 4OYHA 1GNQA 3C5HA 3QKRA 2RKOA 4A6XA 2BBWA 4HDQB 2IXGA 1U99A 1KO1A 4V0LA 1LS6A 2F1JA 1DOAA 2KBEA 1FFHA 3BD9A 3AUYA 5JBQA 4IOJA 2J0QA 4URVR 4JSTA 4GOJA 3CIOA 1WQ1R 1KHTA 3EPLA 4URUR 4LJ7A 2AX4A 2OAP1 1Z0AA 4Q1CA 4MQBA 1QHXA 2ZPTX 1OH5A 2YOFA 5K8IA 1LF0A 3EIEA 2BM1A 4XOIA 2QORA 3TAUA 2O8CB 1P73A 2ZI4A 1YZLA 3UWKA 5FTJA 2YV5A 2XEXA 2Q6TA 4IDPA 2YYZA 3DHWC 4DT1A 3UG6A 4D0NA 4TL6A 1U2RA 3CH4B 4V03A 1DELA 2IS6A 2A30A 3R8CA 2QP4A 1DADA 2W58A 4B3XA 2RMKA 4XVQA 1OH8A 4EFNA 4FXPA 3R8FA 1E2JA 2GBLA 4RZXA 4TMXA 4EQ6B 3A4NA 4Q00A 2V4ZA 2QMOA 1G19A 1R0ZA 2YINC 2ZRAA 2GJ9A 3OZXA 1R2QA 4M1MA 4M1KA 4QM7A 4O0MA 2V54A 2OO7A 2ZRPA 1GAJA 1NN0A 4F4IA 3W5JA 3S1AA 2ODWA 2GZHA 4DSTA 1QZXA 4DLWA 2IF2A 4HB2A 1EFTA 3AGPA 4NYJR 2CJWB 2FGKA 2A5GA 2WJHA 3U2QA 2W6ID 3VHLB 1OV4A 3TBKA 3THOA 1N6NA 3SU8A 2H8KA 3U3MA 1SXJB 4KO8A 5JJLA 1PLKA 5IT5A 2O0HA 3SEAA 3GJ6A 5KNDA 3G5UA 3NDBB 3EARA 5GVSA 4L16A 3A58B 3O8DA 4G01B 4CGZA 2O8DA 4D26A 3I5YA 1RRPA 3GFPA 4LBZA 1FUUA 2ZQ5A 3CRVA 3NC1C 1CJUC 3A1WA 3AF4A 1YR9A 4JZKA 4HLDA 3SOPA 1PJRA 3GJ4A 1AM4D 3GJ8A 3UIEA 3NC0C 2EWWA 1KJZA 3OFND 4JYBA 1W49A 2KJQA 4R2HA 3Q85A 1W47A 4LHXA 4ESVA 1XTIA 1S3GA 2GAAA 3L0IB 2G0TA 3BC1A 1P9RA 2PCJA 1W5TA 4TTPA 4KHZA 3AVQA 3CR8A 3GCGA 5A4JA 2FMXA 2GKSA 4RD4A 2P6UA 2FE4A 2VLIA 5JECA 1UAAA 3H86A 5KU1A 3OF5A 2QZ4A 1ZNWA 1Y63A 4WA7A 4B43A 4BQSA 4C0JA 2ZUCA 4M4SA 1FQKA 4Q9LA 4KYUA 2Q9CA 1NJGA 5HKKD 2QQEA 1NMXA 3A1VA 3HWSA 2R9VA 2CL6X 1L2TA 3MJRA 5J4LA 1G8GA 4H1UA 1H8HD 4ZPXA 5EE3A 2UZIR 4A0RA 1KDPA 1FQJA 1OSNA 3ADBA 3Q5EA 4BFTA 1E0JA 3BWDD 1Z8FA 2WSMA 3U4QB 2GXUA 4K8OA 2YKGA 1H8HA 2PMKA 2O8BA 3VR6A 1LS1A 1NMYA 1BIFA 1SQ5A 1TEXA 4PAOA 1Q1BA 4LUCA 4JJKA 1OXVA 1T0HB 2PL3A 3B1WA 6Q21A 3GLIB 4HB3A 3U44A 1Y3AA 2GEVA 2QAGA 3K0FA 1KZGB 2JLSA 2NZ8A 5J4VA 1N5KA 3CONA 1Z22A 2RGNA 5FTMA 1J90A 4PO1A 3THXA 2KB0A 3QF7A 3KQHA 4TMTA 2NTYC 4YXWD 4OQFA 3RRMA 1CP2A 1BYIA 1OXTA 5C18A 2EYUA 1A7JA 2GAOA 2WHXA 3ZZ0A 5F9HA 2ZYUX 1E9DA 5B30A 4D4LA 1E3MA 1MABB 2YC4C 2ZJOA 5G3YA 2HCBA 3W5IA 1PUIA 2E1RA 1Q57A 3CX7A 4IFBA 3NG1A 4YXWA 3T1OA 3TVDA 4CT5A 1EX6A 1NY5A 1FNNA 1RYHA 2X77A 3HYTA 4ON9A 1AA9A 3FVQA 4HSEA 4ILEA 3EASA 3SBEA 2P0EA 3AB3A 2OBLA 2C99A 1ZCAA 3HJNA 4RD6A 4A2PA 4C0SA 2EFDB 2LWIA 3IGFA 2C9OA 2H17A 3CO5A 5J47A 5IF9A 1TNDA 1N6RA 1NN3A 1UKEA 2A9KA 2XNSA 3LNCA 4ZCMA 5GJBA 3GEIA 5IK2D 3WYAA 4FD2A 1QHHB 1Z29A 3HR7A 1NVXQ 4OQNA 2WJYA 5L3SA 4Q4AB 1QHNA 2ZS8A 2EW1A 2ZR7A 1X86B 2G83A 2PEYA 5IK2A 1RRCA 2QMHA 5D3MA 4EPWA 4WXRA 3JVUA 1WF3A 5FL7D 3WMFA 2J45A 4GDFA 3BERA 3IUYA 2OFOA 2YWEA 2KSQA 1MR3F 1A2KC 2PT5A 1B23P 1W4CA 4BWYA 3BRWD 4DCTA 5FL7A 2WVJA 1AIPA 1XDBA 2OCPA 1GUAA 3KQKA 3PUXA 4QBIA 4WAUA 2ZRDA 3DMDA 1I4LD 4C2TA 4TLBA 1G18A 1HY3A 4NCJA 1US8B 2WKRA 4AWXA 4LY6A 5FOWA 2ODBA 2ZEJA 4LV6A 2ZSBA 4M1TA 2VP2A 3EAQA 1ZIPA 4KFRA 2ZE8A 5E7MA 1RZ3A 1P60A 2BMDA 3OIUA 4ZI3A 1XPUA 3CF2A 3A1UA 2GZAA 3QKTA 3F3YA 1XMIA 1P6XA 3QG1A 2OLJA 3KKPA 4Q1BA 5B58C 1CR2A 4F38A 1UEIA 2PZFA 4KV9A 1YKSA 2W0MA 4W7SA 3MJHA 1TPZA 3AVXA 3LWNA 5DH9A 4PR0A 4UJ3A 2H7VA 3F8TA 3U5ZB 3A6PC 4BUJA 4A36A 4D4KA 3U3RA 2BJVA 4P0TA 1G3RA 4TSFD 5DN6A 3WBJA 2PZEA 4GFDA 4AC9A 4W5HA 1HE8B 4G5GA 2JLXA 3K70C 3I8XA 2F3TA 2VIIA 4Q1EA 4BGDA 1KKLA 1CIPA 4TSFA 2FEOA 5DI3B 4PSVA 1C9KA 4DDUA 4GZMA 5JZVA 2AFIE 1T3HA 3T34A 4KLZA 1I4TD 2R6CA 4EPRA 4M1WA 1G7RA 1E69A 1XXHB 4EPTA 5J4HA 4F4JA 1RJ9A 1YZGA 2FZLA 3CPHA 3PG5A 1ZM7A 1U9IC 2AL7A 2EYQA 2NGRA 1GG2A 4C0KA 2R44A 4LZZA 3IPXA 4UXHA 4PSKA 2ZRJA 1QDEA 5FPSA 3DL0A 3DM9B 3EPHA 3U3KA 3SHFA 1TUEA 4DLVA 2IW3A 4Y0VA 3MG9A 4ZIRB 3VFDA 1WBBA 2OZEA 1ZC4A 2YWHA 1XEFA 4ASUD 3A4LA 1XJ0A 2FN4A 1TMKA 2ZS9A 2ZU0C 3SJCA 1JR3E 1CJMA 1Q3TA 4PPQA 4BLRA 1KI9A 2AD1A 2IL1A 3LLMA 5C46F 4ASUA 3OESA 2ZAMA 3V00A 1IN7A 1HE1C 3L43A 3K9NA 2Z43A 3FGNA 1T5IA 3WP1B 2IS4A 3IO5A 2XITA 2HJGA 2I1VB 3M6AA 5EJEA 1KAGA 1IAQA 2AHOA 1LY1A 2IUSA 4J0QA 3LBNA 4TL7A 4NTZA 1NVUQ 1YHNA 3AKYA 1ZP6A 721PA 2QRZA 2RGEA 1UEJA 4JL5A 3M0EA 4B6EA 4OJQA 4Z54A 1GDDA 3HU1A 3VMFA 1G7SA 1JPJA 4C4PA 1P9WA 5FOSA 1G8YA 2J0VA 4LCBA 2RGXA 1NSTA 2ZROA 2O8EA 3B82A 4YMSA 5K8LA 1MO3A 2FNAA 1N6LA 1ZJ6A 2OBMA 1NJFA 3GLGE 1NLFA 4TLDA 2QA5A 4H1VA 3QE0A 4Q7LA 3IBGA 2ATXA 3A1SA 5FI0B 2F1RA 1VCOA 4CEHA 5FPHA 2FGJA 2QM7A 1P2SA 4FN5A 5M04A 4HZUA 2IYQA 4EAQA 1QHSA 4Q7MB 1VTKA 4JSYA 3CRRA 4HAZA 5BXQC 4KYIB 4HATA 2ZTSA 3T5DA 121PA 3RLFA 1OFIA 2IUTA 2F9MA 5E7JA 5EXPA 1FNMA 3U3JA 4ARZB 1G20E 3QKSB 4E03A 5KPJA 3AVUA 4NU0A 4QOSA 1SULA 1HYQA 3K0SA 3W3AA 3OEEA 1ESNA 1PLLA 4HUTA 2ASEA 4C3ZA 5TDHA 2ZE7A 2YJTD 5AUOB 5C1BA 3WNCA 3AVTA 5CM9C 3REFA 2BWJA 4OL0A 2GETA 4PSAA 4G5QA 1JR3D 5KSOA 3TMKA 2QY9A 3ZQ6A 2AWNA 1D2MA 2BEKA 4CIDA 1MRNA 3P4XA 4C2UA 1F48A 1FMLA 1JR3A 1U98A 5DGXA 4GP6A 4OQMA 2HXSA 2YZ2A 4PO9A 1CKEA 2IT1A 3DPUA 4FCVA 1D9XA 1JALA 3A8TA 3HP1A 4A6PA 2ZSEA 4G3XA 4B71A 2VYFA 1DO0A 3ZDQA 3EPKA 1JXOA 4OHYA 5JEDA 4X8LA 3UXMA 4CT4B 2A7QA 1E2QA 2GCOA 1UFQA 1J7KA 2N1BA 2IEYA 2PLFA 5FOTA 4PPFA 3K70D 2A5JA 4MH0R 4B34A 1DS6A 3VR1A 5BW8A 4KCGA 4PC6A 2JJ1D 5FR1A 1VIYA 2Q3MA 1XNJA 4NL4H 2ZYVX 3W3ZB 4RKFA 4A2WA 1NY6A 1G5RA 621PA 2D62A 1Z5ZA 2QSZA 3B9QA 3CF6R 5LPNA 4JLJA 4WZAE 1D6JA 2JJ1A 2NG1A 4GNKA 2QBYB 1IXZA 3Q3JB 4OK5A 1E2MA 4G5OA 1IJFA 1HA3A 3ADCA 2QP3A 3EC2A 3B1XA 4I4LA 2DWPA 4UNQA 3RANA 1R0YA 5EE1A 4BEJA 2QEQA 1N6PA 3D6TB 1U0LA 4NONA 1KDTA 4LBYA 1WB9A 5FPYA 5IDVA 1AK2A 2YWGA 4PHTA 3K0AB 2OLKA 4TQUS 2REXB 1G6HA 4ZO4A 4D4JA 1ANKA 4FW9A 1XB2A 4C30A 4A8JB 3E70C 1KDOA 3KFVA 4DWJA 1L7VC 3PEVA 3RRZA 2H5EA 3FYHA 2XXAA 1KKMA 3T1TA 4ITRC 1DAMA 1EX7A 1XD8A 2AFHE 5LB4A 1G16A 3LY5A 4EPVA 4XH9B 2ATVA 1RPZA 4RVCA 4RJLA 2JJ2D 3AF1A 5CK5A 2ZI7A 2BHRA 3KKMA 2IYLD 2QNRA 3UMSA 3B9PA 4Q18A 3DEFA 5EUQB 2JIZD 4A0GA 4D0LB 1XEXA 1NF3A 3W9YA 2V9PA 3SHWA 1OIXA 2G3YA 2PCLA 4O2RA 4I1OA 4M8NE 3SZRA 4TMZA 3U61B 2JIZA 1ZVQA 2CLDX 2PH1A 3DOFA 1KY2A 4JLDA 5EP2A 4CRWB 3C14C 1KIMA 4HLCA 4HAYA 1KMHA 4JS0A 4TYPA 1X1RA 1N2CE 4DUGD 2CCJA 2W00A 1FP6A 2EWVA 5F98A 5ANRB 4G5RA 2QI9C 2OFXA 4PHGA 3P4YA 1M74A 2GXSA 4DUGA 4KVGA 1G21E 3K09C 2QL6A 1L4YA 1J2JA 4CEIB 1HT1E 3W8RA 2J0UB 4LJ9A 3KDSE 3WYFA 1OFTA 2QN6A 4DB4A 3TW8B 1J99A 3GP8A 2Q0HA 4AKIA 1A82A 1VG0B 5FOUA 2GTPA 3DVLA 1QBKC 2P67A 3KTAA 5GVRA 1D8TA 3U6BA 2IEZA 4QHYA 2BEJA 5TXGA 4HDCA 2BMFA 5JJKA 4MGYR 3NTUA 5BWMA 2B21A 4ZI2A 4U00A 3ZVMA 1E2PA 3FE2A 1SVMA 1SVLA 2VP0A 4MRNA 2IWRA 3CNLA 3EZ6A 4B2LA 4XTRA 3QJYA 4JKYA 1OHHD 3MGCA 3SJAA 1E6CA 4HUQB 1KI2A 3GJ5A 5EZ5A 5BN4A 3WP0A 4MKGA 1KYIA 1RFLA 1RW4A 2UVQA 5A5GA 3FMIA 1W0KD 2ZI9A 2DFLA 3W8NA 1ZNXA 2VA8A 1D9ZA 2WJGA 2GEUA 1KI8A 4BFWA 1FZQA 1R5OA 2GK7A 4TL8A 1W0KA 4OHXA 4LJYA 4ERNA 1GZSA 3NKVA 4V02A 1GSIA 4S35A 1E0AA 4E5UA 3ADKA 1HUQA 3EG5A 4JJZA 2D7DA 4JVNA 4JVMA 3OEHD 4Q4JA 4G0NA 2VP9A 5ELXA 3K0CC 1Z0DA 4N1AA 4XSHA 2B6HA 2VO1A 1ODFA 1II0A 1TQDA 2QQ0A 5EUMA 3K1JA 4TT3D 4PQRA 2W6JA 5CIQA 2IXFA 2ANCA 1KZ7B 3GMTA 5AJZA 3TQCA 3QF4B 2ZAOA 1Z47A 3UANA 3LQRA 3EXAA 1ZMXA 4TT3A 4Q4HA 4MKIA 4CVNA 1VKJA 2CMKA 2ZANA 5KNBA 2B8WA 3CZPA 2HYIC 3CUEF 4DB2A 3X1ZA 1XCMA 2FSHA 2ZI5A 3FMFA 3IQWA 4AYWA 2CHGA 1GL9B 2BCGY 4QBHA 2HF9A 4P31A 1EFUA 3WHLA 1Z28A 1YZQA 1Z2CA 2VSFA 3CF0A 3KKQA 3MAAC 4PPGA 4TYYA 1H8ED 1OLOA 1E0SA 3KKOA 1SXJE 3P32A 1ZM3A 4IDNA 1NKTA 4RD1A 2CBZA 1H8EA 1KNQA 4BFZA 4OI0A 2ZJ2A 2GVZC 3RS5A 3PFIA 3VR5A 4B75A 4QGAA 5JWOA 3HYRA 1OIWA 4OJKA 2VQSA 4A0FA 1EXMA 4HLQB 1W36B 2DYKA 1KOFA 1TEVA 3C7KA 1SVIA 2IYTA 2CL0X 4RKEA 2NMVA 1K6MA 2DB3A 5K8TA 2IUUA 2YHSA 2XGJA 5H70A 2NO1A 2IYUA 2C77A 2QTVB 1IONA 1IY1A 1XCGB 5FBRB 4QJ4A 4A82A 3A1TA 3PVSA 4C7OB 2CDNA 4US2R 3CRMA 2AKAB 1GM5A 4JT2A 3T1VA 4Y0AA 2CLSA 3BORA 4OK6A 1G7TA 3TQFA 4XSGA 2GA8A 3C4JA 2HJVA 1L4UA 4EFLA 4WXPA 1AN0A 3T15A 3LXRA 5TY0A 1XCPA 3RAPR 5KDDA 5BYJA 3CRW1 3NBXX 1YZKA 2GF9A 4KFUA 4PZYA 5FPKA 4DLYA 1OPXA 3ND9A 5HCNA 3U6KA 1ZD1A 2F3RA 3B7GA 1X1SA 2C98A 3MFYA 2O8CA 2WV9A 4QBFA 1Z3IX 3LV8A 1Z0KA 1IN4A 5CK4A 5CLLA 1XTRA 1G6OA 3TAHA 5E3HA 3VNVA 1YR8A 4F91B 1COWD 4JL8A 4I99A 4IEIA 4M53A 4V0NA 4C0BA 2ECKA 4HLUC 1FMJA 4NYIR 3F5FA 2AK3A 1YR6A 5K8UA 1DPFA 1COWA 5KSYA 4UXJA 4YMVA 3GLIE 3BB4A 4DXAA 1N6IA 1IXRC 2JCSA 4EQ6A 1EFHA 1QVRA 1X8KA 5EE9A 4EJSB 2W6IA 2ZJYA 2WMNB 4W9MC 3TR0A 4F7WA 3I62A 2WMOB 4MGKR 1M7BA 4DSNA 1A1VA 2QTFA 1IQPA 1SXJD 4Q7JB 3EPJA 1R0WA 1ZBDA 3VKGA 4US0R 2WPDD 4AYTA 2CJWA 4R71A 1E9CA 2L0XA 4U02A 2H57A 5LB2A 2CL7X 1WDTA 2HXYA 2ZE6A 4Z8YA 1SXJA 4LHVA 1CJVC 1W44A 4IOMA 2V6JA 3VQTA 2WPDA 2VH5R 3QQ5A 4PPNA 3K8YA 3M4YA 3OFNA 3NH6A 3OIWA 1IN6A 2FPKA 1E2HA 3L2OB 3QXCA 4D0GA 3PUZA 1F3OA 4LJ5A 3CPJB 4MKFA 4MYHA 4FI3C 3ZD6A 3DO6A 5FR2A 2PMDA 4BLSA 2F1HA 3QXHA 3R9WA 4UNRA 1HV8A 1N5JA 3LQQA 2WICA 1VYUA 2DFTA 2EFGA 1Q1EA 2HV8A 3RS7A 4DC9A 3ZS9A 4PX9A 3W6NA 2ZI6A 2A5DA 5KDOA 3K0CA 3ZH9B 3GFOA 2ZRNA 4M2LA 4JBXA 3I72A 2C03A 1IOZA 2OCYC 2O5VA 2OV2A 3IIMA 4QGGA 5HKKA 1UBCA 1VCIA 5D3QA 3TR5A 1KSHA 4Q47A 2ZSFA 4YMUA 5KUTA 4OI4A 1GRRA 2BJWA 3SQXA 1F2TB 3B85A 1ETUA 2XJ4A 4HB0A 1LTQA 4Q1FA 4NDZA 4D81A 2XZLA 2YWFA 2CCGA 4DCVA 2QROA 1K5DA 3ZIAD 3CH5A 1KSGA 3TSOA 4RCZA 3N5CA 3TSWA 3U44B 4IDQA 1OKKD 3VTKA 1N0UA 1YRAA 2FSGA 4DLSA 4E07A 2NPIA 2GJSA 3BOSA 3ZIAA 2NQ2C 1N6HA 1SVWA 1VYTA 4I81A 4JBWA 3TNFA 3QSYA 3U4QA 1F2UA 4JKIA 2OT3B 1OKKA 4XVUA 1IBRA 2GEDA 1EFRD 2Q3FA 2OE2A 1DG1G 1ZU4A 1CLUA 2XAUA 3AVPA 4BZXA 1JBKA 3N2IA 5GJWC 3PUWA 2FEMA 2GRJA 1LW7A 3GLIA 1JJVA 1EFRA 2DWQA 4AG6A 1Q20A 2RAPA 3A4MA 1P2UA 4NHOA 1IN8A 4B33A 1U8ZA 3B78A 2AR7A 1E98A 1HQYE 3ETLA 1DE0A 1N5IA 4B76A 3PUYA 1GFIA 3NBYC 3KQNA 1GWNA 1GKIA 2GHIA 2V55B 3L8ZA 3O8RA 3BS4A 4I1UA 2F6RA 4ZCIA 2VHUA 4KFTA 4LK2A 1UBFA 2P5TB 3GJ3A 1MABA 2CCKA 3CWQA 2QPOA 3H1TA 3LBIA 3WBKA 1Z0IA 3VU9A 5CITA 1XXHE 3RHFA 3LW7A 1R6BX 2XTZA 4JL6A 3V4FA 4UNSA 3BXZA 1T3SA 1KI6B 4FWTA 1TQ4A 3ZVRA 2D7CA 3VKHA 1NN1A 4DCUA 3SJZA 4OBEA 1SGWA 1BKDR 1OH6A 1IJEA 3I3SR 2FFHA 1RYFA 1XMVA 1T0JB 3BJIC 1O3YA 4MGZR 5HE9A 5AJVB 2Q3HA 3SBDA 3UMRA 1OXUA 3FMPB 2G88A 1QHHA 5HCIA 3R7WB 4AKHA 3IHWA 2IYXA 3SNHA 4Q4AA 1FL9A 1K8RA 2WAYA 1W48A 2GK6A 1E9FA 3KFXA 1R5BA 1W0JD 4Q5IA 3ASZA 5FUVA 5JFGA 2Z5FA 1Z2AA 3VX3A 3TGPA 1EFCA 3RVBA 1Z6XA 3NBZC 4KITB 4DLUA 1R10A 2RCNA 2CEAA 1W0JA 2GXQA 2SHKA 3PJRA 5JJIA 4QRHA 4B6FA 1QHIA 1DARA 2J7PD 1WBDA 1ZD9A 4PXAA 4M22A 3FPAA 4NKRA 4HAUA 5DO9A 4IEEA 1US8A 2J7PA 3W6OA 1GVNB 4P33A 4LYHA 2NO6A 1E32A 1AZTA 1W4RA 3CW2A 2OFWA 1II9A 3X1DA 1PV4A 2BM0A 1JXMA 5DYGA 4WBSA 2GWHA 4P4SB 1IY0A 1QG4A 5F3WB 3KJEA 4ZKDA 3RDPA 5DLQC 4TQAA 1KNXA 3KZ1E 5CM8B 2ONKA 1NG1A 3UATA 4B2IA 1CJKC 3T12A 1BMFD 1NLYA 3L0PA 4DHEA 4QGFA 3CNNA 2OM2A 521PA 5F2EA 4PHHA 2ZU6A 2ZRCA 3VHXA 1MO5A 4I1VA 1DAGA 4NE2A 1VYVA 3ECCA 2ZJZA 4OHVA 4TQ9A 2YVUA 2BMJA 2DY1A 5LBIA 2KE5A 1KGDA 3O8BA 2CHQA 1KMQA 1X8LA 1ESMA 3AUXA 3MRSA 4I1SA 5DI3A 1I4DD 4DSOA 2VBCA 5JRJA 5C4MA 3K53A 1P61B 2NO9A 5G40A 2FF7A 1F6BA 1AKEA 1D2EA 1CTQA 2DPXA 3OHMA 2XB2A 2OAQ1 2Z0MA 4MGIR 4Q19A 3WMEA 2ZRLA 2WM9B 3FKQA 1XXHA 2DWOA 2ODEA 4ACAA 1FX0B 3RSLA 1GITA 3HR8A 3IBYA 1DTSA 4TMKA 5JMTA 4XWAA 2P6RA 4O3MA 3X1YA 4A15A 1W5SA 1Z6GA 4KU4A 1G3IA 4JYCA 1G8PA 2IF0A 3R9IA 3GLFB 4A8JC 1G17A 5FBQB 3UG7A 4B44A 2NIPA 3MWYW 2UKDA 2PZGA 4BFYA 4A2QA 1II8B 1LV7A 3CZQA 1LVGA 1SHKA 1YJ5A 1CEEA 4ZIRA 2RGGA 3CPEA 4EDHA 2ZSAA 2X2FA 4QKQA 1E2DA 4OI1A 1GIAA 3NEYA 4JT4A 2QT1A 3CNOA 3TW4A 4FWIB 3D7MA 4BE7B 1XJCA 2GCPA 2IC5A 3RRYA 4KJZA 4LYAA 3RS0A 1E9SA 5JI3E 3ADDA 2J3EA 4TWZA 2PBRA 3QEOA 2AN9A 1JEEA 4B74A 4HI0E 2B7CA 1OF1A 3H4MA 4GRAA 1Z63A 1GL7A 4M1SA 3AV0B 1M8PA 3PV0A 3NHAA 3TE6A 1CU1A 4PC1A 1CULC 2C95A 3V4RA 3HDTA 3UWOA 2JA1A 4XIGS 4A1FA 5L8VA 1G4UR 3PR1A 2DR3A 4N3NA 4NZYA 1DAHA 3AKEA 3LO5A 3SC3A 2YOGA 4POAA 4B3FX 2EFEB 1WE2A 3NEJA 3KXKA 4CEHB 1YU9A 1NG9A 1SVKA 2VRWA 3T5GA 2ZM5A 5AUQA 1ZYUA 2R6GA 3ZGXA 4HAWA 1ZNYA 3KXLA 5CJ2A 1CR0A 3E1SA 5KYKA 2BDTA 2FFQA 4LYFA 4A4DA 3B6EA 4TLAA 2X8AA 5FPTA 2FG5A 2WIAA 3ZYCA 3QVVA 1W2GA 3GLHB 4US1R 3WRXC 3LAWA 3LRPA 4P4TA 4Q48A 4X8OA 5HTKA 3SI7A 3PEWA 1GRQA 2H92A 1P72A 5TMPA 4Z51A 4GMDA 5DHFA 2D3WA 5EZ6B 2C2HA 1T4GA 2KBFA 1DAKA 1M7HA 2RGDA 4OKSA 3ZLJA 1Z08A 4LJ4A 2MSDB 4RFVA 1OYYA 2CK3D 2XZOA 2W83A 2ZYTX 3GJ0A 5A0FA 1V5WA 1ZINA 3WNBA 4ARZA 5E4FA 4AURA 2DFKB 4D25A 2HEIA 4IVPA 4MRSA 1KSFX 5B2ZA 2V3CC 2HT1A 3BB3A 1Z6YA 1VHTA 2CK3A 2JLZA 1KK1A 3JVVA 2F43B 1N6KA 2WJJA 1WMSA 2JLQA 3JZMA 4RD2A 2VPPA 5SZHB 4UNPA 3I5XA 3ZS8A 4GI7A 3THYB 5SZKB 4C0LA 3B1VA 1Z83A 2OESA 3U7FB 5CDFE 1MRSA 4RD3A 5JI2E 2P2LA 2BIFA 3ASYA 1MO4A 1MO6A 3AF2A 2P65A 2V7QD 1RC8A 1SKQA 2RHDA 4GT1A 2N42A 4BASA 1U0HC 4JLAA 2F9LA 4FCTA 1S9HA 1G9XA 4NYMQ 4TL9A 4URYR 4DDWA 1KTVA 2J41A 4IVQA 4PC2A 4KFSA 2ZRIA 4XVRA 2EQBA 2KI5A 4QHSA 1HTWA 4MYUA 4DLZA 3GEEA 5CYOA 1XTQA 3QBVA 2X2EA 1KI1A 3EZ7A 4M21A 3TRFA 2GXAA 1OJLA 1R4AA 1T6NA 1TF2A 4XTCS 4DLRA 4C0QC 4R7ZA 5B64A 4TZ0A 1UBGA 1VIAA 2PX3A 2AD5A 4YMTA 2IS2A 4B3BA 4TYWA 2OBNA 2OHFA 3PQCA 4B32A 3RRNA 1N5LA 1RIFA 1ZM9A 1N0VC 4Z1MD 1Z6TA 4ZDWA 1U9IA 4HDOB 1P62B 4IFEA 2O8FB 1FOEB 5JSZB 2RH5A 3NBFA 4GP7A 4NCKA 3GLGB 5KO2A 3QXSA 8OHMA 2WJIA 4Z1MA 3LX8A 2QBYA 3GFTA 2QPTA 2J5XA 3AEZA 3Q72A 4BEBA 3I1FA 2XOKD 2WSSD 2ZSDA 1A5TA 2JDID 3QEJA 4RFSB 4MRVA 5LD2B 3BFVA 2EU8A 2R62A 2XOKA 2WSSA 2IHBA 4LHYA 1XMSA 1Z06A 2GZDA 2C96A 4HAVA 2LKDA 3K0AA 1HURA 5FOXA 4CEJB 1YQTA 1QF9A 4JIMA 3KUCA 2ZR9A
chains in the Genus database with same CATH superfamily
4UM9D 3K71B 5SYAA 4Q1DA 1GVHA 2WNHA 4FZ5A 4TXNA 1YS2X 2GN0A 1U80A 2O0JA 1P8JA 4HNUA 5EIFA 1ILEA 1LBQA 3SGLA 2AMVA 1BC5A 1VMIA 4IMPA 1RWPA 5JH7A 1FDSA 2LXNA 3CU5A 4V0QA 1V5EA 1PR9A 3OIYA 1CQIB 1BH6A 2X8JB 1YJXA 1UJ6A 3CHYA 2OO5A 2ZUBA 2C9YA 1Z4JA 1T5OA 2BFBA 5C5IA 3PEEA 2XQJA 1WXGA 2UZ3A 2AK2A 5F23A 4TYNA 1YB4A 4IJ6A 4HWTA 1PVVA 3G79A 2H4ZA 3RI3A 3WNDA 3PKZA 4J8PA 1W5FA 4RY8A 5AK6A 3G0HA 5BSFA 2A1IA 2Y1DA 3A6LA 4M9QA 2YJZA 2W6MA 2PX5A 1QH0A 5CDFA 3RYIA 2O2JA 1CT9A 2H1WA 1NKVA 5IKXA 1XNQB 4ETWA 5LQSA 3WGLA 2FSFA 5I8ZA 1YVUA 4EEZA 1G55A 1Z5UA 1B6GA 2I4IA 2JGJA 3MCWA 1MX5A 1EVJA 3K6KA 4WOCA 4KGXA 1AJEA 4OB6A 1BGVA 1ISSA 3HU3A 4NCNA 5A06A 7REQA 1WDKA 2BI7A 5BN5A 2FSUA 3DB1A 3MS4A 4YYEA 1ADGA 3CZ5A 2CKMA 2B25A 4HB4A 4KWCA 3F98A 4A03A 4MS4B 1A8QA 3EY9A 4NECA 4DQDA 3Q8XB 3QIAA 4HTAA 4YRZA 4Z6KA 3I2HA 2VUHB 1EJ0A 2QE7A 4TLEA 3CBQA 3TBHA 1GN8A 1Z2PX 1NJ6A 2ZIXA 3AYXB 1GR1A 4N9QA 2GESA 4P5PA 6CHYA 3UO8B 3TW8A 1X8XA 5ALWA 1XGKA 2J9RA 3H2YA 2BUAA 4IDHA 4CTOA 2G40A 2XMZA 5M2QA 1KJIA 1HE4A 2C8JA 3ER8A 2O52A 3QW2A 3LC0A 3R3YA 2HMTA 1QVAA 2ADOA 4MIYA 3JYHA 1JHMA 2N0SA 2WAXA 3AM5A 1G3UA 3MTJA 5E1BA 2DQ4A 3TIFA 2FPPB 4ESEA 3PPWA 3HNOA 1R4ZA 5FBVB 3UB2A 4OGLA 2FWRA 4M8KA 2EX0A 3U40A 1TQHA 2WY2D 3H84A 2OC9A 5DHPA 1TMYA 4NBSA 1MOQA 1M34B 3AL0C 1OX6A 1JI0A 3FKSD 1OA0A 1WCIB 2VSNA 3V7YA 1E6KA 4KHPB 2BMVA 4WUVA 5DX0A 2TMDA 1TTPB 1GTZA 3KUDA 4ND7A 1XPOA 3I09A 2FYTA 5H1YA 5BNFA 2FHPA 3GEHA 1PQPA 2RHGB 3C8UA 1ZJYA 2CE7A 4LPKA 4DRZA 1AV7A 3GZTB 1YT5A 1YZTA 3IMCA 4IF4A 1HQCA 2BEUB 2ZT6A 4RCYA 2FETA 3Q5GA 3DTNA 5LIPA 1YE8A 3E6AA 3WB2A 13PKA 4E30A 1QK5A 1BOFA 2CN1A 4MI9A 3RF7A 2YWDA 3QPUA 3BH7A 7GPBA 3F4LA 1U3WA 3UOGA 2FWJA 5IEJA 4IGIA 3RVKA 4B1FA 4JN6B 4Q4HB 2JFGA 4TTTS 4D8XA 1IBCA 3O1IC 4LDJA 4MJXA 1G2OA 2DBRA 1BFDA 2Q1SA 2VDVE 2X58A 2XYRA 3KE9A 4LXQA 3G2OA 4O2LA 4ZHSA 1C2YA 3T3DA 1RAAA 2I6GA 3N86A 4ME6A 2CE2X 4MP8A 2XT9A 1VE1A 1IHUA 2X19A 4IHAA 3VZSA 3FDZB 1FDRA 3MBIA 3QHAA 1M1YE 3WKAA 3RAFC 5JO9A 3PQ2A 1H6CA 1JDPA 1P45A 5EGSA 2CNWA 1M0EA 5JMPA 4LTDA 4TV9A 5CA0F 4CUZA 3QEKA 1M2JA 2QTHA 4LJ6A 3WK9A 3ZCXA 4KBFA 4RHEA 1M1ZA 4AZSA 5ITZB 1TIBA 5DRTA 1E4VA 4DNQA 1YTLA 3LECA 4R2KA 4MV3A 4HZIA 3TLAA 5EIAA 2YN0A 3RRXA 3UHJA 2QAGC 4DSUA 5LYJA 3TSAA 1G8HA 1H66A 1VG9B 3AGQA 1T8RA 2O2HA 2NTVA 4UW9A 1YRBA 4CQNA 4HMQA 2PGIA 4EHDA 1U5AA 5CBPB 2X41A 1Z0JA 3ZY5A 4Z7OB 3TIVA 2TSYB 3AESA 3U1BA 4YAGA 3I6BA 1QV7A 1JVNA 4FOSA 4QD3A 1GQ2A 1LI5A 4UU8A 3HUUA 1JZQA 1TIPA 3BE4A 4G23A 2BBOA 5K6AC 4ENTA 221PA 1PF7E 1L5FA 1A72A 3D7RA 3E3LA 2CD7A 2HW8A 1DAFA 3RC2A 3RJTA 3S6JA 1UPTA 3C4QA 5JCXA 2FSIA 2FEKA 1T26A 2M1ZA 3BA6A 3O7MA 3PICA 4Z9FA 3ZKWA 1E0KA 3WDKA 5IZCC 4O63O 1AGRA 4RSMA 3AETA 1RQ2A 2YX1A 4Z7QB 4ZDKA 1UZLA 2E4YA 3MJFA 3S2ZA 1QRAA 4R2IA 5LMCA 2G6BA 3O21A 2ZIUB 3BE6A 1Z5GA 4E33A 1Z4QA 2XPCA 5I7HA 3FNBA 4DT1B 4EW2A 4M9ZA 3K2BA 3L7JA 4UU0A 3A05A 4IIYA 1HYEA 5D7BA 5B4UA 1TYEB 2W71A 1PR1A 3Q9LA 2HCFA 1TTQB 1P5RA 2D2FA 3BGSA 4EA8A 5KHOC 3VVBA 3QVSA 3EIHA 4KODA 4XLZA 4WIAA 4UCWA 3FSGA 3WGQA 1M66A 3TRHA 3JWJA 5FL3A 1JLMA 4LVNA 4AIIA 3ZNOA 5AH0A 2WKPA 6PFKA 4PQFA 1PR6A 4UQPA 2R00C 4ZOBA 4ZK2A 3M4NA 5K4HA 4OX9B 1GXSA 3LQFA 4JI1B 3Q9NA 5J1SB 3FAZA 1KYXA 1C1YA 1V1JA 4Y2UA 1CUEA 1T2DA 5FTKA 4Y9UA 3S1AB 3VJRA 1JRLA 1PZMA 1XRJA 1QVVA 1RZVA 2QUZA 4DWWA 2AMLA 4LBVA 3W2FA 3EQZA 3D8TA 4FB5A 5CVUA 1BCRA 1F1JA 1FFBA 4BAZA 4H7DA 4MRMA 4N65A 1M8JA 5K0FA 2W2KB 1Z73A 1ZGCA 4K2HA 3R9KA 3SLKA 2NX2A 3A7EA 1W59A 2IUYA 2Y67A 4J1TA 2XQIA 4Z0HO 3HP7A 1B0UA 5IHXA 3W5BA 3RT1A 3EVNA 4M8LA 1E96A 4DBLC 1CJTC 2O8DB 2I0FA 3VYRB 1JHDA 5FI1B 2RI1A 2OCBA 5JXWA 4BNVA 5B53A 1H9AA 1XFDA 3JQGA 2B1RA 3NHRA 4IHQA 2H5LA 2IE0A 3B8EA 3ZXYA 1AB6A 1XDWA 1P1CA 1NSFA 2DTEA 1Q7GA 3CZCA 4EYEA 3FJ1A 3IP7A 5LCXA 3RU9A 4DMMA 2EZTA 4BRWA 2QGNA 3DH0A 4EF4A 1W581 3FCYA 4G81A 1XLWA 1EUZA 4BBPA 2DKOA 3ZJYA 4FOLA 1KOGA 1W7AA 1IL0A 3ZD7A 2C9MA 1XCBA 4K6CA 3ULKA 1S7GA 2IOQA 4BECA 3FUWA 3KG2A 7ADHA 3WRVA 1GDTA 1FP7A 3L4BC 3VAAA 4MVCA 1AQLA 4FNAA 2PJDA 2WJAA 3OCXA 2UVPB 4LJAA 2ZT5A 2ZTVA 4WERA 2GO1A 3WFZA 3P0HA 3V1TC 3KZOA 4CV1A 2QG9A 1NXQA 2GYWA 3EE6A 5I9SA 4DEYA 4UDXX 4Q9HA 2XXBA 4JJEA 1PRYA 3DDCA 2LR0A 4RK0A 4TZTA 3TB4A 3T3PB 3QU9A 5DTIA 1NPTO 1N75A 2BFOA 2WTMA 3U39A 2CB0A 3NXKA 2QN8A 5EP1A 4BVBA 1ZOSA 5F5LA 1T10A 4II7A 2LZ0A 2UYQA 1EVZA 2ENUA 2UZ1A 3KNZA 4JBYA 4RZ3A 5G02A 5TVKA 4YDHB 1MB2A 1K92A 4U3JB 4ZT6A 4ENSA 3PB3A 4BJHB 3HB1A 2R8OA 4IRUB 4Q66C 3W78A 4D9EA 4XD7D 3ZGZA 2O8BB 4QNRA 1P2DA 4DDTA 5I47A 1OI3A 1QJCA 4CM8A 1TCCA 3OU6A 5C1DA 2ZOSA 5JRZA 1S8FA 4C0AC 2PKXA 5BQOA 1UWVA 1JHOA 1Y37A 4KMMA 4YT5A 4F5ZA 4HVLA 2XUJA 4HNHA 1C7QA 1EVKA 3CW8X 1G3MA 4O1HA 3W4KA 2UYHA 1Y4SA 4ZMSA 4IQGA 4TTQA 2QJWA 3P0RA 4G6ZA 2ZJ0A 4B3GA 2P69A 1B0AA 1SZPA 1ZI8A 3LXUX 4UEWA 3THXB 1NX9A 3KQYA 2XXJA 3IEMA 1SBYA 2VF5X 5LDHA 3Q98A 1ULBA 5L6MB 2MYNA 3GLRA 2DKNA 1E1MA 1G5PA 1UWLA 4A1OA 5E6SB 2HBQA 2QG6A 3ASVA 3T3IA 3S44A 1NAIA 1PR0A 1CRPA 1XZCA 4ZOLF 3VV3A 1LPSA 1U7HA 2A5LA 3BWXA 3ELBA 3LBAA 2XA9A 1L4EA 1B6SA 3KVNA 2HMSA 3DFFA 1USIA 1WZNA 2PT7A 3EUEA 1JN0A 1UC8A 3DE0X 4LV5B 5LQNA 4MDFA 3LA6A 3RVQA 3ZVLA 3RWOA 4R8SA 1JILA 3WMGA 1YS4A 4MSUA 2YNMD 3INTA 3VH1A 2BTOA 2JFBA 2P90A 2QRMA 2QRPA 2VJDA 3AFIA 3EHEA 4W8GA 2PV7A 5AK3A 4TTSA 4X60A 4R0MA 3D8BA 1ECBA 5K6AA 3WS7A 3FPKA 3MT0A 2A86A 3RVRA 2BLNA 5AK0A 2Q07A 2XCQA 3BD8A 1ILWA 4KRYA 4ZVNA 2GJAA 4OGGA 2E82A 2I7DA 3PWSA 1Q44A 5IC4A 1P33A 2OVBA 4S24A 3TXXA 3DWFA 4MPJA 5CFRA 2QN7A 3FFAA 2WOOA 4UPVA 3A0UA 4ER0A 2JL1A 3UCXA 3BDVA 3OM0A 5C5EA 2G8NA 2CXPA 3OCVA 5TEVA 3RFVA 2QT0A 3AIMA 4YAKA 4X1OA 3LFUA 1KARA 1Y9DA 4YT4A 2H7XA 4KIUA 5ELLA 1RM5A 2I7XA 4RS3A 1JT2A 2BHLA 2DSNA 3B5JA 1Y8RA 3ONVA 2VBIA 3RSOA 1PFWA 1RMQA 4B73A 2NZJA 2H07A 3NP9A 1D5CA 3EA0A 4G0QA 4UATA 1KQFA 3P2IA 4YRPA 3T1QA 2B1JA 1FJ2A 2YOHA 5KTTA 4WLUA 1VJGA 2VTKA 1JECA 3KOMA 4NG5A 5AP9A 3IILA 5JCJD 1QO0A 1IPHA 3EG9B 2A9FA 3TUZC 2GR9A 2W2TA 4JI8B 1KPGA 3IQDB 3OT4A 4AS3A 1SRRA 2FCRA 5FFFA 3AR6A 1L5VA 4HQ6A 2AR9A 2RHBA 3WDSA 4D9NA 2VP4A 5UKDA 2AJ8A 2PUVA 3EVZA 4F84A 3BAFA 3FOZA 2V6FA 1FXUA 1O54A 3LWDA 4HLUA 5CA1F 1X0XA 4D6XA 4MYCA 2CLCX 3O26A 3WYGA 2VATA 1ZR4A 3UW1A 4RYDA 3IBSA 3T5AA 1VE6A 4YO8A 3JZFA 4DCJA 4GOMD 1H5QA 2J3IA 4AJEA 1V6CA 1ESZA 3EIQA 1AGXA 3WVNA 4CV3A 1R5JA 1NBIA 2OXCA 4RHFA 3PUVA 3W2TA 4BWVA 1MNAA 1YL5A 2A88A 3IPYA 1UBKS 2QJTA 3MGBA 5TPWA 4QG7A 2QMEA 2RKWA 1EG2A 3VGPA 1AKVA 3H99A 2WHRA 4RM3A 2BFDB 1ODKA 4ZVVA 4YRQA 2ZBRA 1CC1S 2GQ0A 1G8SA 3UMBA 1SQ6A 5HM6A 1PG5A 2IYSA 4LCJA 1XMOB 2C83A 5CMLA 3B2EA 5BSMA 2GSWA 4KXWA 3C6YA 3SF8B 3D4PA 1J70A 2ZKIA 2ZS7A 1F5NA 4LF7B 4PANA 4W9NA 4D44A 2GYUA 2EIXA 4HWOA 3SICE 4YRTA 5K0JA 1A2BA 1QUFA 1BMFA 1QXSA 4RJTA 2W2XA 1WP9A 3WA7A 1Q2UA 3HM9A 1EWQA 4K9NA 5DHRA 3EFHA 2FWIA 3CEMA 3R7BA 2E5LB 1MAAA 1ZGAA 3K2IA 4J0CA 4E13A 4DY4A 3HJGA 3D5TA 4WNIA 3V6LA 2ZYDA 2HK9A 3KEFA 4UEJA 1JIJA 2O0KA 1CUIA 1QKJA 3E1KA 4ACBA 2Q1WA 2LKCA 3K6RA 4W7HA 3EIXA 1QG2A 2PBZA 3AEQB 3TYXA 1CUHA 1QCDA 3KHTA 1N1MA 2YVAA 2YFQA 3NYQA 4K9DA 4X8MA 1EXVA 3JU3A 2WJVA 4FEGA 4M89A 2RGAA 3TH5A 5I9BA 1Z5WA 2JLYA 3PIRA 3GLHE 4PF1A 4U9UA 1DJLA 3QPBA 1DC3A 1YAJA 3I6IA 1U9YA 1X74A 1NE2A 3FUCA 4MR9A 5G4LA 5AW8A 2VXYA 3EDQA 4COOA 2ZRKA 5AVWA 1A4UA 3FW1A 1OBCA 2GKOA 4MVYA 4LV8B 1CY0A 1OAAA 1N8SA 2WKSA 4GGMX 4RF2A 5DHSA 2QXUA 1VIMA 4JVSB 5EKXA 2SKDA 4RKWA 4L78A 5LD2C 1Q17A 4A0HA 4CF4A 1Q12A 3ZCTA 2QL5A 4EYQA 3DEYX 5B7GA 5JHHB 3CISA 3OAAA 1GPYA 4HDRB 1UM8A 2V6IA 4KLCA 4S2UA 3NKLA 4DZRA 1LPOA 2H8GA 2AZMA 1QS0A 2OZLA 2BFMA 4YAJA 5J1TB 2CMFA 3JRNA 4MV5A 4RL4A 1ZCBA 1YR2A 1KK0A 3DMRA 3LDAA 2R4TA 3UJ3X 3NH9A 4XE5A 3UWDA 4OJNA 4G0UA 1DWPA 2IE8A 2WF6A 3EWSA 4HNRA 2HSJA 5INTA 3KJHA 3LC1O 1CVRA 1LNSA 5JSKA 3L77A 4IQ0A 3K1TA 3FYUB 4EGQA 3NNDA 1O9BA 3G9ZA 1WL8A 4Y1GA 3SYTA 2JFQA 5IASA 4DKJA 2QS9A 1HT2E 3UENA 3EPRA 2XNCA 3FWYA 2G9QA 2CFCA 2F3SA 3ILXA 3D2LA 2REQB 1FNSA 3ZGNA 3MJSA 4EVIA 4AJIA 4TVSA 1WPGA 4X94A 1TTTA 1J0CA 3VNRA 1HL7A 2SNIE 2VYCA 1D7OA 2X9QA 5E7IA 1A98A 1RLUA 5GJVC 4HZUB 5EJ7A 1DKMA 2F55A 2AFIB 3RC3A 1ZUHA 1SCUA 2OPBA 1WABA 1IN5A 4B3CA 1SVNA 3IEVA 1ZA2A 3G0CA 4NOKA 4M1ZA 3W4IA 2EL7A 3OHSX 4YI5A 2NOAA 4CLRB 1SEVA 2Y0BA 4GICA 4XRRA 3RODA 1SU6A 2FZVA 3I6ZA 3ZWMA 4BKPA 4YAUA 5BUZA 3HV0A 5J23A 2QN1A 3B1YA 1Z35A 4B3RB 3WHKA 3M6XA 1KBOA 3SC2B 3I61A 4LWPA 3HV2A 1AKWA 3HSYA 3ON5A 4YJ2F 3WB9A 4X8HA 4OMFG 7AT1A 3ZTYA 5KWVA 5ED4A 2RJ3A 2P68A 5HFAA 4DKXA 4ZZIA 1WAMA 1DU4A 2R8PA 3GNQA 4FMDF 1W2WB 2IPNA 4P98A 1BDIA 5GADl 4L9WA 1U5BA 1ZU5A 4BMXA 4MYTA 5FUXA 1M1NB 3FDIA 1DRKA 3CA8A 5HS6A 2QV0A 2W6CX 1IMJA 1K5HA 1AQYA 5BSKA 4KGZA 5E1MA 5G4KB 4MI1A 3SJUA 5ERXA 1E61A 3AW9A 5F9MA 4CLHA 2GUGA 4MQEB 1H2FA 4BVFA 1P2FA 4UBJA 4RJKA 5IAAA 2ZRBA 5A3QA 1KI3A 1F2VA 1USKA 1QRUA 3AP2A 2OCAA 3EYAA 1C8VB 5AJXA 3O95A 5IW8A 1Y4ZA 4NZOA 5E2BA 1K7YA 1FVFA 2MINB 3I92A 3QU4A 5DVZA 2OHXA 4EHHA 2R1TA 2F43A 2MMGA 4IIJF 4MYSA 3WKBA 1RXEA 2XTJA 2XYPA 1QJ4A 3ACDA 1N25A 3NOOA 3THYA 3NCHA 4UZSA 2I4LA 3UHPA 4D4MA 4G1CA 2YBDA 1DNPA 4KPGA 4WXHA 5T8KC 1Z37A 2FZ4A 3N75A 3RIHA 1W2HA 1GA1A 3HVIA 1A9OA 2PMFA 3NVKI 2BV3A 4P9NA 4W8OA 5G53C 1Y9JA 4ETNA 3LDHA 1QC5A 4BE4A 2OL4A 2PANA 4I4TA 5TV2A 4YIHA 1DIOB 2CJPA 3E05A 4JUFA 3GGOA 4OLHA 5CM2Z 3KJQA 4G41A 5H7XA 3RV4A 2EARA 4B4KA 5BVHA 2PS1A 3TMYA 3A1EA 4YCAA 4TKMA 4ZA2A 3DCIA 4YRKA 1S1MA 1PK9A 4RTKA 2QTAA 5FI3A 5CCDA 2QJOA 2WC1A 3AKCA 1FUKA 3DCYA 3ND7A 3NOQA 1XL0A 3KL4A 1CP3A 1RWQA 4YONB 5NLLA 5BW4A 5T7BA 3DE7X 5TMBA 2FWBA 4LBWA 3MBKA 2XXAB 2ZBGA 1RP7A 2FPGA 1EHCA 5KAPA 2Z30A 1XTJA 2G9NA 1NXWA 3NLLA 3PXGA 2HJWA 3TR6A 5CLQA 2FVYA 5CT5A 3IUJA 2VL7A 5CDHA 3I6MA 3MUFA 1ZJ4A 3MOGA 4KXNA 5AR1A 1I6WA 1QZZA 1CQWA 4REMA 3LH5A 1SG9A 5CIWA 3W9UA 1HEIA 1W94A 2Q8NA 5JSZA 3V9AA 5FLXA 1MT0A 2AN3A 4MO9A 3TQQA 3GFBA 4ATNA 3O3NB 4GQBA 3LFHA 4KAAA 3A6PC 1ZXLA 4JR0A 1I24A 1K8YB 1AS0A 1TZKA 1P0IA 1PR5A 3TF5A 3BJMA 2BPOA 2B4KA 1HYBA 4Q1AA 3MF4A 4YJGB 3WLNA 1BXZA 4Q3BA 5LC1A 2D4AA 4RABA 1ZMTA 4TKUA 2P4SA 4AX8A 5FA8A 1CERA 4N0EA 1PNRA 3LW8A 3ENWA 2BFBB 4IV8A 4CEJA 1T5BA 4CIVA 3M33A 1CR4A 4TN1A 1GU7A 1NW3A 4ZCQA 4GEGA 4YAFA 3FVTA 2AJCA 1QTQA 1XKTA 4DLAA 3P9RA 4LKOA 3OP1A 1KJYA 3QKWA 4J0EA 1H0SA 1PZXA 2QMUA 3B3QA 4MKZA 3VR3A 1A27A 2H1RA 4TRJA 4D92A 5EY5B 1YDFA 3PYLA 4AK9A 2AOXA 2OB1A 4KJXA 4BWGA 4EUHA 4Q9KA 1C0LA 1TGYA 3ICWA 4OI2A 5GY7A 4EEXA 1P9NA 3ZVNA 1H42A 1EB8A 1XX6A 3NDIA 3N2EA 1EAMA 2YL2A 4EMBA 1TK9A 4EG3A 4GPZA 4IGEA 2O7RA 5EVCA 1PS8A 3IC5A 2Q9BA 3T7RA 4DXDA 2GPAA 1JQLB 3BWCA 5AJWA 4ENWA 2IA5A 1GTSA 3WX0A 4OKIA 4WZAB 4MV1A 3M6UA 2H5JA 1OWLA 1T8TA 1UDRA 2CXXA 2NPOA 1CUSA 3QYFA 1KZ4A 3WIUA 5ICCA 4FR5A 1RP1A 1DXQA 4RTJA 2PJRA 3COZA 1GL6A 2ZIXB 4OH7A 3VI3B 4BB9A 3L8HA 4DL9A 3H3FA 2Q8PA 1Y6RA 2X0FA 4BS9A 4YN3A 1T6BY 1I2AA 3F96A 3L8EA 2JASA 5JHGB 2V0NA 1C3EA 2IYVA 4UREA 1ZVJA 1R8XA 2XMGA 1Y34E 3E8SA 2EL9A 3II6X 3RWBA 4E5KA 1X0VA 1ZRSA 2PUAA 3AF0A 4H2DA 1L3BA 4F6CA 5KNCA 1G7CA 1XIVA 5JWHA 3K3PA 4YPOA 4ZHQF 1J33A 4BJ3A 1E99A 2WSBA 1JQDA 5AXCA 4YGXB 2D06A 3OSZA 2OYCA 4XWOA 1NQAO 2PJUA 4ETIA 1UADA 3TN7A 1FS4A 3ZXUB 1I6LA 1Y3HA 3C39A 4W6QA 2AZTA 2GHRA 2WWFA 3A27A 2NAFA 2XLBA 4PQYA 2QZ9A 1QONA 4U6NA 4Z3OA 4FYVA 4RF4A 3CKLA 4XQ0A 1Z56C 2HLDD 4R2WA 3OVMA 1RAEA 2Q5JA 1NXXA 4O8CA 5EJ6A 4B7AA 5IFKA 4U9HS 1U1DA 5EMNA 4FMBB 4O4JA 3BD7A 5L3QA 1YC5A 3L6EA 2JIOA 3BKXA 2CNDA 2WD7B 5K0ZA 1PKEA 5C8YF 4BLPA 3LCVB 1PP4A 2HAEA 3LVRE 4G5YA 4DDHA 2ZUUA 4RA9B 4JP2A 5FWNA 3V8BA 1USGA 4X97A 2QW0X 2C8VA 4HN2A 1E9AA 4PXSA 3ROXA 2QSYA 4JC0A 5GGXA 4GE3A 1KY5A 1ID1A 5BR8B 1M72A 1N2CB 2RI6A 4JB8A 4YP6A 5A0VA 1GG9A 2HA4A 4AU1A 1MF7A 4U2DA 3SS8A 3RROA 3D7KA 4NSNA 1O8CA 2P4EA 3E9YA 1VA5A 1LC3A 1EESA 3N8HA 3DHVA 4N6NA 1M10A 1EDOA 3BMCA 1P18A 2HF8A 4UXIA 4AZTA 2XODA 1ZUD1 1VJ0A 1G21B 1NFRA 4PBRA 1SKYB 1G5TA 3THWA 1XZNA 2QL7A 3DNMA 4UUOA 4EPYA 5IU6A 4J6FA 2E37A 4RPCA 4UAUA 4BTVA 4BP3A 5IRCD 3GHHA 1ATIA 4NV3A 2X5OA 2FZ5A 4BZQA 2D2EA 3QWFA 2TMKA 2XVMA 3HYCA 3QLTA 4NYIQ 4HY3A 4PN3A 3M6FA 1NL3A 4DAEA 1K8ZB 5LYJB 1Q0UA 2G5CA 3B20A 3H5WA 1GKLA 3PQ4A 3QBDA 3AEXA 3SQNA 3ZNPA 4O25A 1M9NA 1KVSA 4D9BA 4DTCA 1H1LB 2RGNC 2W7TA 3H1GA 3LHIA 1S7CA 3L84A 1OT3A 1RHQA 1UBOS 4ZKEA 1SIOA 5BV1A 3DOEA 4U2FA 2X9VA 2QYTA 2C9DA 1GT91 4QIHA 4CLDA 5CPBA 3HZRA 1XEWX 5EWJA 1VLLA 2W2MA 4CHGA 4EP1A 4LYGA 4WOKA 3KR1A 3WGUA 4JYMA 2RKOA 4A6XA 3PTLA 3CTMA 4QOGA 1KO1A 3AUJB 4F12A 1E3QA 4WADA 1S5PA 1DOAA 1FFGA 1UOQA 3AERA 3Q0TA 1E0DA 1UQRA 3VI4B 3BSFA 3DXFA 3CXRA 3BMNB 2JI9A 2ICAA 3AU9A 4KR0A 4UAJA 4LECA 4IOJA 2OCDA 4Z4GA 3LQ4A 5A2QA 4NFSA 4URVR 2YIVX 5EQFA 1XROA 2HDWA 3AUFA 4JSTA 4QU5A 1JDTA 1H5UA 3CIOA 4UBMA 1YZFA 3CCFA 5L3ZA 2YICA 3LCRA 2ZUSA 4BXOA 3GVPA 3SBXA 3A3YA 3EF1A 4P3NA 1ZR2A 1G4HA 4MQBA 2ZPTX 3E8XA 4U0KA 2YRFA 1FNCA 1YS7A 2HA5A 3SLGA 4JA2A 4ZWNA 2R8EA 3E1GA 2OQVA 2BRUA 3VO9A 4CLOB 2CUKA 4XOIA 2QORA 1M6YA 4IUDS 5CAEA 2VYQA 2VSYA 3UWKA 1XAJA 5KOHA 1R9JA 4RY9A 4TYMA 3CLRD 3TXYA 3VPHA 3ZTWA 2PFKA 3WGJA 3NFYA 4I1PA 3A9TA 1Z3CA 4MHOA 1SO8A 1XC7A 3KPVA 4BP1A 1YWGO 4GLBA 4X45A 3JQ8A 4X1YB 3R8CA 3E03A 4BX0A 5CFNA 1D0VA 1FW8A 2W58A 1IVNA 4B45A 1MIHA 3PFCA 4RTPA 1FXWF 3LZ6A 3QPDA 3WK7A 1PEYA 5DYYA 3TL6A 3LLCA 3QK7A 4MZDA 2GBLA 4ZXFA 5TGTA 4ARSA 5CB4F 4JODA 3UAWA 1JB9A 3VC7A 3WTBA 4NENA 2H29A 4P53A 4EQ6B 3E18A 2V4ZA 3H2BA 1GQOA 1G19A 3KB6A 3SS9X 3H17A 2YINC 2ZRAA 2W6QA 4CKBA 1MW8X 4BO3A 4KR2A 2ZRPA 2OO7A 1GAJA 3IIEA 3RYFA 3W5JA 1V1MA 1J4AA 1WS6A 2NP7A 5IT4A 2WDPA 5C1PA 3JY6A 4QU0A 4FDLA 3FZQA 1T2NA 4WKGA 3MUEA 1GN9A 2LTAA 2FGKA 2A5GA 1T9AA 4JROA 3U2QA 3TBKA 3RVLA 1RI5A 3A6ZA 1EWYA 1NW4A 2DBZA 3B3GA 4DDKA 4OB8A 3T1YB 2F67A 1DBVO 2BGTA 1Z8NA 3UV3A 1S2NA 4MWTA 3VSAA 5ERYA 4GH5A 2R7LA 4MUKA 4QLOA 2CJFA 4QPPA 4MJ3A 1UKAA 2OAGA 1ONPA 1TRKA 2RJOA 3GA7A 5K0CA 2W2NA 1UMDA 3KS9A 4D26A 1QRRA 2WR8A 2Y1FA 4J16C 3KU4A 1CJUC 3AF4A 1O7JA 3Q0IA 1PNVA 1G59A 4HLDA 1DHRA 1EFVA 1PJRA 1UQUA 4AF7A 3UIEA 3M34A 3ZC3A 1YRHA 2D5IA 2GN8A 2G9UA 5DTEA 3GMIA 2OV4A 4WXMA 4N5NA 4A91A 1TA0A 3WQRA 2B98A 1CUXA 2C9ZA 3UK0A 2I87A 3KTOA 4KRXA 3AU8A 1DRVA 3RSGA 2V6BA 1ZXBA 1KJJA 1SK8A 2VPZA 2GKSA 3C6QA 4G37A 4JELA 4RD4A 2XMCA 4EDFA 3H86A 3SQMA 3JAMA 2NU7A 3OF5A 4G89A 3GFVA 4WA7A 1OLUB 2II6A 2XGOA 4B43A 4C0JA 3I01A 5IX8A 4Q9LA 5U4XA 5D1NA 1ORDA 2DH6A 5HKKD 1JFLA 3J7AC 4WFQA 1NMXA 3EGXB 4FPXA 2R9VA 1BWSA 2D0OB 4I50B 3MJRA 4TVOA 5J4LA 3HI6A 1AVTA 1OJ7A 1UBRS 3KDAA 1UBLS 1JDUA 3D2CA 3W5UA 2UZIR 4ZAVA 5A4AA 4QECA 2J3QA 2B5OA 3L40A 1HC7A 3ZWPA 3FKJA 3CLTD 3OC6A 4ZD6A 1GUDA 2GXUA 2I3ZA 4U63A 1H8HA 2PMKA 3W5SA 1R0RE 3G6WA 1W5BA 4I5EA 1KJ9A 3F4KA 1IULA 1VE5A 2BHTA 1CE8A 2PMCA 3P2OA 1BIFA 1SQ5A 2YFYA 4HEA6 4BIIA 5HQJA 3ECAA 1AMOA 3E84A 2Z2JA 1OXVA 1T0HB 2RHTA 4Z7JA 1T3ZA 1KJQA 3B1WA 3GLIB 1ZVKA 4HB3A 3W6UA 1WHTB 3U44A 1RAGA 3B48A 3Q2KA 2XCTB 2EGUA 2H2GA 2VP3A 1PWHA 2JLSA 1A96A 4HDNA 4J2OA 1H2HA 2B9EA 1N5KA 3CONA 4M37A 2JCYA 1NBWB 2IUEA 2RGNA 2RG7A 3KLPX 5FTMA 4POOA 5EJ5A 3LBYA 2KB0A 1ZX1A 2OHIA 2JFWA 3KQHA 3RW9A 1PNOA 2UYYA 3HY4A 4OQFA 4QO8A 3RRMA 4PFJA 4GRIA 3UKOA 5C18A 2MTBA 1A7JA 5CLJA 3OO0A 1PJTA 1CEXA 1TJ3A 2GAOA 3GFRA 4URFA 2FQXA 2ZAIA 5CH8A 1KFBB 3SG0A 4XIFA 3AJ8A 4GLLA 1Q57A 3CX7A 4IFBA 4YXWA 4CT5A 3T1OA 1FNNA 4ZVKA 3FH0A 1RSZA 1U28C 1WCWA 3G7UA 2H00A 3FVQA 2RHOA 3Q4GA 5AI4A 1NUAA 4G84A 2P0EA 1MORA 4Z4QA 2R8ZA 3JXEA 4DV7B 4EI9A 2ECQA 4ZMRA 1U6IA 2EFDB 3HDQA 4DLLA 1H2RS 4IDFA 2Z04A 2QDXA 1CX9B 2GX6A 3VMMA 3PTAA 3HWRA 3KTFA 1UPBA 1YQXA 4RV5A 5A0TA 2ECPA 4FNOA 4AZ0A 2BTQA 1E58A 2GB4A 1QHHB 3KLMX 3O9MA 3MD9A 4FD2A 1ULSA 4WK6A 4CMHA 1NVXQ 5ETJA 5I3ZA 3QLUA 1PSDA 3C70A 3QX9A 4Q4AB 1QHNA 2Q8QA 4XM1A 2PMWB 3QIVA 3UXHA 1X86B 4KQHA 4NFYA 3IEKA 4P36A 4LGVA 4U39A 2G7ZA 1ADJA 3ONNA 1GCUA 3PIDA 1WMFA 3RKUA 5JYBA 3DD5A 5FL7D 2HZ7A 4RETA 2WU3A 3G8DA 3VC3A 4GDFA 2YN2A 3IUYA 3JZDA 4IS2A 3V34A 5AIBA 1B23P 4L8FA 1T1EA 3EXFB 3FCUB 2BI8A 2H3EA 1E60A 1FBNA 4J1SA 4J1NA 3UW3A 4ZO9A 3S40A 3IE0A 3RSHA 3L5OA 5BPHA 1MB0A 3F1LA 1E6EA 3PUXA 4WAUA 3HKBA 2ZRDA 4P7KA 4DA8A 2WFAA 1BG6A 1I4LD 3WFIA 3AB8A 3L8CA 1N1EA 5DNWA 1UMCB 3DD1A 3FUTA 4P3KA 1T0BA 2ZEJA 1OTYA 1Z38A 2I99A 1H2EA 3EAQA 1CQZA 1GPKA 1RZ3A 3L18A 5BURA 1JJFA 2BI4A 3IVXA 4B6SA 2BMDA 4ZI3A 2C2KA 4CKWA 4B3MB 3HVRA 3QKTA 2YY5A 2BSXA 5K99A 5AT1A 4M7RA 1D1TA 2G1AA 2VNJA 5CNIA 1P6XA 1YUNA 1TT7A 4K28A 5B1EA 5JNUA 3KKPA 1NT2A 3MWGA 1FFWA 4Q1BA 3E5MA 4K9RA 4KV9A 4W7SA 3OOSA 1AA6A 1RJDA 5DH9A 4PR0A 1F4LA 4TTIA 2ENWA 3UT6A 1V3VA 4RV4A 1XQ6A 5B6JA 1U2GA 4P0TA 1TJYA 1L5QA 2VWGA 3BUSA 3JYLA 4G4GA 5DN6A 5K3FA 3UJPA 5EOVA 2PXHA 5DT9A 4J16A 4ND8B 1HE8B 1ST2A 2F3TA 4FR2A 1EIZA 2GERA 1D6MA 4XIIA 5A1TA 1LXCA 3ER6A 4GZMA 5A6SB 1Q19A 1V26A 2RG1A 4LHSA 4JJ4A 3NASA 3ZPXA 1GTL1 1I4TD 1JIQA 2WZBA 1XJ5A 3WGMA 4EPRA 5AVVA 1SHJA 1JQ3A 3H87A 2VYVA 3KR9A 4KBYA 1L5MA 2A0FA 3EGDA 4GMKA 4FJ2A 4BO5A 1YZGA 3E2PA 3BHJA 4FFBB 2RH8A 1C29B 1P91A 1K4MA 1OU4A 2X0DA 4FFSA 4RJJA 1Y8QA 4MB2A 4C03A 3CBGA 4C07A 3U3DA 1ZRMA 1BNCA 1Z5NA 1QTIA 2Q4DA 2R44A 1EM8A 4TSRA 4DSAA 1NASA 1ZD4A 1RWXA 1Z7BA 4FYJA 4KUGA 4DYVA 3EPHA 4EBFA 3SHFA 1FSGA 1R0BA 5CTAA 2BDEA 1QQ7A 2IU3A 3MG9A 3VFDA 1SCAA 1QFZA 2OZEA 1ZC4A 5JNTA 3CZAA 1YS6A 2ODPA 1XKLA 2FN4A 1TMKA 4UOEA 5AHOA 4EMTA 1CJMA 1Q3TA 1VIVA 2R6JA 4A7PA 3RFCA 3ELUA 4F2GA 2D1SA 4FHFA 5IAGA 2HQBA 3VYUB 2IW1A 2VJCA 2PKEA 1ZN9A 2ZWPA 3ZE6A 4ASUA 2CYBA 4MV8A 5KJCA 3FCAA 5LZ9A 3WB1A 3OPYA 1IN7A 1IUNA 3L43A 5EYPA 3K9NA 5DGTA 4QOIA 3FGNA 1YVPA 1X80A 4IFIA 3IO5A 1BWQA 2I1VB 2FTKE 3I9OA 4WN9B 1JSCA 2H59A 3KZVA 3UWMA 4OP2A 3B5EA 4EG4A 1FSPA 2BKXA 3MIZA 3WWEA 2CLKB 3N2KA 1DEOA 3IR7A 1ODSA 4ARAA 3SQDA 1CG6A 4CI0B 2P9ZA 2ZJFA 4UQLA 2GD6A 3OPQA 4KQJA 3P9XA 4IWNA 4JD5A 2AUNA 1F9AA 2EF1A 2QTTA 3LP6A 3MGGA 3ZUGA 4AP9A 4Z54A 2V6MA 3H19A 1G7SA 2PR2A 2EKDA 3B53X 4DEVA 4PG4A 1PBTA 4F9TA 5JMOA 3NJ4A 3OZIA 3DTVD 1U28A 1SCUB 5FOSA 1L7AA 4AF8A 5FUQA 2XT0A 4GKJB 2ZROA 1BA2A 2Z5VA 4EO9A 2OY0A 2KPOA 1AGNA 2DHDA 1RQRA 4IJ5A 3P9PA 4ALMA 2OBMA 1U3VA 2ZPUA