3RNLA

Crystal structure of sulfotransferase from alicyclobacillus acidocaldarius
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
298
structure length
247
Chain Sequence
VARPNFFIVGAAKCGTSSLDRYLSQHPDIYIPPKKEAHFFSIPDFPERFTGPGDEGMNLYTIRDEDAYMRLFDGVRGERAVGEASVFYLFYPGTAQRMYDAYPDAKILIMLRNPVDRAFSAYMHLVRDERETLSFRESLAKEEERIRQHYEPLWYYRAVGLYAAQVKRYLDVFGREQVKVILFEEFARDPVQVVRDCCAFLGVSTDFVPDTSMEMEPDLREELTAFFAPDVARLEALIHRDLSAWRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfotransferase
publication title Crystal Structure of Sulfotransferase from Alicyclobacillus acidocaldarius
rcsb
source organism Alicyclobacillus acidocaldarius subsp. acidocaldarius
molecule tags Transferase
total genus 90
structure length 247
sequence length 298
ec nomenclature
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13469 Sulfotransfer_3 Sulfotransferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3rnlA00
1YVDA 3AKCA 5FTNA 1CJUC 3SJBA 1ZD1A 2EW1A 2J46A 3VX4A 1F2TA 2LWIA 1ZCAA 1XJQA 2XSZD 4Q66C 2CVFA 3SR0A 4C0HA 1NJFA 2IF0A 4V0MA 1BO6A 6Q21A 2HXSA 1VCNA 3ECCA 1NL3A 4Q4AA 1E3MA 1G5TA 3THYA 1E0SA 3QPUA 4A0RA 1W47A 3KTAB 3U7FB 1F48A 4N1AA 4HLUC 1YJ5A 1YR6A 2ZAOA 4A0FA 1JBKA 1V43A 2GHIA 1IOZA 1BYIA 2WM9B 4EFNA 2VO1A 2X77A 4JLOA 1QG2A 1XZPA 3U3JA 4JS0A 2ODEA 4GT1A 1MABB 3LQRA 5E95A 1SULA 4JMPA 4PHHA 2DCUA 1FUUA 2SHKA 1U9IC 2ZSEA 4HSEA 4F4IA 4BASA 1RRCA 121PA 5GJVC 2XZLA 5FL7A 2EWWA 4XVUA 3D3QA 1E94E 1DEKA 4OK6A 4B48A 2OUKA 4P33A 1N6NA 4AWXA 4L9SA 1OKKA 5DISB 4V0ME 1G5RA 2YJTD 3LX5A 1SGWA 1QZXA 4C0SA 3MJRA 3GJ4A 3EARA 3AGQA 2CE7A 5BYJA 1KNXA 3QF4A 4IVRA 4KBGA 3KKNA 1Q1QA 2C9CA 1S8FA 4HAXA 2AD5A 2GXSA 1EESA 4UJ3A 4G3XA 1P9NA 2AN9A 2LCFA 4H1UA 1FMJA 4R2IA 1TQ4A 3RSLA 1RYFA 1E9AA 2ZI6A 2Z6VA 3O8RA 2OFXA 3SQWA 1E98A 4FCVA 2QAGC 4AKHA 3HPQA 3X2SA 4DLYA 3FHTA 1S2MA 1IN7A 2AFHE 3LBHA 3A36A 1W0JA 2AXNA 3DO6A 4MUBA 3WNCA 2N46A 2W6ID 2ZM5A 5JCPA 4OKSA 2X2FA 3BIFA 3WHLA 4BE7B 3R7WB 2QT1A 5KDLA 3SOPA 3QKTA 4BLRA 3ZVMA 1Q1BA 3PEVA 4YLGA 2PLRA 4XIGS 1WMSA 2GJSA 2VA8A 3LY5A 1FFHA 4PQYA 5FOWA 4AD8A 1UBFA 3WRXC 1P5ZB 5DI9A 2ZJYA 4Q1DA 5J4KA 4RY2A 4GL2A 4PQFA 4C0JA 2N1BA 1D5CA 1NSTA 1J8YF 3GEHA 2ZI3A 1E1QD 3LFUA 4MYTA 2OCAA 1J90A 4LYAA 2AFIE 4B6FA 2ZYVX 4Q1BA 4B34A 5KNDA 3ZD7A 4RD2A 1X6VA 3PFIA 1J8MF 4B76A 1XMVA 4HB0A 1SVKA 4GMDA 3U7EB 3FVQA 2CDNA 4Q7JB 1NY5A 4DT1A 3V4RA 2R62A 4D4MA 1VIAA 3B6EA 4ITRC 1R0XA 3Q7QA 2QP3A 5EXSA 1EX7A 1GKIA 1N6RA 1U0JA 4GOJA 4B74A 1T3HA 2CL7X 2XNDA 3GFTA 2ANCA 5SZJA 4L15A 4IDOA 2ZIAA 4URZR 4Q9JA 2B7BA 3E70C 4OYHA 2YHSA 5DGXA 3TSOA 2WMOB 4YC7A 4D4LA 4QM6A 2IS6A 1NF3A 1TEXA 3SHWA 1HTWA 2YWFA 4QC2A 4UNPA 4LV8B 5B2ZA 4EAQA 4ZCMA 2D7CA 3FKSA 2OLKA 4OI1A 1FL9A 1OSNA 4NKRA 4E09A 3TVDA 3RS2A 5B30A 4YMSA 4W7SA 1Q44A 3NXSA 5C1BA 3K09C 3BFXA 3THYB 1CR0A 3LAWA 2AWOA 3TE6A 4MDEA 4TL6A 4CEIB 3PEYA 4PSVA 3D6TB 4I99A 5AWFC 4DB2A 4KFUA 1KNQA 1Z6XA 4WZBE 1GRRA 1E2DA 4Z8YA 2O8BA 3G5UA 5HR5A 1NY6A 3A1TA 1JAIA 1Q12A 5AJWA 3KJGA 1Z6AA 3B82A 3HU3A 1W2HA 1N6LA 2BMJA 3C5CA 2ORWA 4PPFA 5KDDA 2GILA 2C9OA 2X2EA 5LPNA 4FMDF 4LRWA 1E1RA 1CR4A 1MT0A 1H65A 4LBWA 3LW8A 1Q57A 5L3RA 4OHZA 3KQKA 2O8CB 2O0JA 4V0KA 5E7IA 5H1YA 2BBTA 1BKDR 4TSFD 4LJAA 2JJ1A 3C16C 3PV0A 4DEXA 2NZJA 2QT0A 1QHHA 1KI4A 4PR0A 4D25A 2W0SA 1FMLA 1H8ED 4PAQA 3F3YA 3X1ZA 4NDZA 2GK6A 3DOFA 1W2GA 1U2RA 3A4LA 4QJ3A 3RC8A 2K5UA 4R71A 1KO1A 4PXAA 1GRNA 4GNKA 1YR7A 4DLZA 1G18A 3B1ZA 1E2LA 1W4RA 1KAGA 3W6NA 3MCAA 5B57C 5LD2C 2QP4A 4KU4A 2RAPA 2BWJA 4RD1A 2JDIA 4ABYA 1KGDA 4KV9A 3CUEF 4TMXA 1KI6A 4D6PA 4UNSA 2Q3MA 4LI0A 1Z63A 3GLIA 3T12A 2CLDX 2O52A 2KBFA 2RGNC 2ZSFA 5BW8A 1XPOA 2DB3A 2CCGA 1LFDB 4OBEA 2ZTSA 3WYGA 2XJ9A 2O0HA 3HYTA 1AS0A 4TYWA 1P61B 5HKKA 3K0FA 1ZIOA 3BXZA 3RWOA 2B21A 3CPHA 1XEWX 2Q6TA 2BVNA 3KJEA 2Q0HA 4JYBA 4BQSA 2BIFA 2YV5A 4A9AA 2ATVA 3PEWA 1Q22A 4QXAA 3KQLA 4A6XA 3FE2A 1G8YA 1I4TD 2JJ2D 2IWHA 2PJRA 2W2XA 2YWEA 4B2IA 4H9GA 1R0ZA 1XP8A 4QNMA 2B92A 5H70A 2Q9BA 4U00A 3A1UA 1ZM7A 3MGCA 1G9XA 5SZIA 3VKWA 4BZQA 5L3VA 1ZD9A 2CL0X 4IDQA 4Q4LA 4Q01A 4QBFA 3GLIE 4PZLA 3SEAA 2XXAB 1YHNA 4MRVA 4Q02A 4B2PA 1ZM9A 5FOXA 2KE5A 2QTHA 2ONKA 1HQCA 1G19A 1TADA 2V6IA 1UKVY 3DHWC 1FNMA 4KJZA 2CNWD 4QM7A 5BXQC 3GJXC 2FPLA 3QVUA 1FW6A 3CB4A 3AVXA 3EC2A 4QNRA 4BPBA 3T34A 4OI0A 5CJPA 1MKYA 4QOSA 1OH8A 2WWWA 2ZU6A 1Z0IA 3CX8A 4KCGA 4RD3A 1K6MA 2IYZA 2WIBA 3PUYA 4B3BA 2P5TB 1OB2A 3QPWA 3C5HA 1TNDA 1GTVA 1XPUA 3P4XA 1E2HA 3ZIAD 4LPSA 4LHWA 5B64A 2PEYA 5EP3A 2W2VA 1UFQA 2GK7A 2ZI7A 4QBGB 3TR0A 4ZCIA 3EZ9A 4KI0A 3CPEA 3AM1A 2NPIA 1OYYA 5C46F 1II8A 5FPKA 3PR1A 1TMKA 1KSGA 4IKEA 4BFYA 5F9FA 5FFMA 2J41A 4KYUA 4FW9A 1BH2A 1E9EA 3IBYA 2DBYA 1NN5A 4PC1A 5LDDC 2FPMA 3BC1A 5SZKB 3CNOA 1ZC4A 3QKRB 1Z5ZA 4EJSC 1KK3A 1W46A 1CULC 3SQXA 4DCNA 2OG2A 2RGGA 1CRPA 4HLCA 3MFYA 2UVQA 5AR1A 1TQ2A 5ANRB 1HT1E 5FOUA 1W4AA 4FI3C 4LY6A 1KYIA 1ZMXA 5H68A 1N0WA 3BH7A 5DHFA 3GJ8A 4C4PA 3IGFA 1X8LA 4L16A 5FTMA 5IDVA 1OFUX 1YRAA 4CIDA 5KHOC 3IIJA 1HE8B 3FGNA 1KJWA 3E5HA 1XRJA 2FGJA 2UZIR 2IYWA 4EPXA 1C4OA 1GNRA 3B85A 1US8B 1AZTA 2GKSA 2JASA 3T61A 3TAHA 1GAJA 3DZDA 2CVHA 5EXPA 2HF8A 3B5JA 3SBDA 3TKLA 3ZS8A 3FMPB 3PENA 1CJMA 2FEMA 1FX0A 3VAAA 3I5XA 1J70A 2GJ9A 1OYWA 2C8VA 1VYTA 4XWAA 2CHGA 1N0VC 4DKXA 2IEYA 2ZE5A 1CJVC 4LC1A 4A8JC 3NHBA 1G6OA 2QMOA 5DE3A 4OQLA 3U3KA 4MA4A 3NHAA 1R6BX 1GRQA 5DI3A 4DUGD 5FTKA 2IBMA 1WQ1R 3U7GA 2G83A 2IHYA 3B13B 2OFWA 1JQLB 2ZR0A 1DAFA 5EXTA 3I72A 4NYIR 3NIBA 2C5LA 2NMVA 2ZR7A 3SI7A 3I73A 3Q8XB 2GXUA 1LW7A 4CT5A 1AJEA 3KKQA 5KSPA 1LVGA 1X3SA 2V9PA 1R5NA 3OEED 421PA 1KHTA 3ZQJA 2O8EB 2H5EA 3SE0A 3FMIA 5EQTA 4CF7A 1L7VC 2WWYA 2QROA 3TUZC 2RGXA 3AV0B 1GUAA 1L2TA 1YZGA 1B0UA 2WVJA 1AIPA 4G0NA 2XNSA 1AN0A 1XEXB 2C95A 4XD7D 1P4SA 4IOJA 5EE5B 5DN6A 3LBIA 4C0QC 2V55B 4YMTA 3IEUA 4ZIRA 1I2DA 1PZNA 2RH5A 1QVRA 3TSZA 1W48A 3L82B 3P32A 1ZM4A 1P9WA 1RJ9A 4GFDA 4X8MA 4V0NA 3A58B 5FUYA 5KSYA 1GILA 3CF6R 4P4UA 3O8DA 4BEBA 3SJCA 3JVUA 2H18A 3RRYA 4DRZA 1SQ5A 4M21A 1XZQA 1VCMA 1W1WA 2ORVA 4NHOA 3ZZTA 2ZRJA 3SU8A 3Q85A 2CCJA 3BB4A 4RFSB 5KOYA 2PX0A 5GVSA 1QF9A 3TMKA 1NLZA 3C41J 1E9BA 2EVWX 3CRQA 1ZC3A 3HR7A 3WMEA 4CW7A 4AKGA 2ZU0C 2WKQA 3AVTA 2QPOA 1XJCA 5TXGA 4GZLA 3KL4A 3EZ6A 3IUYA 4LDJA 5FOVA 3W8RA 4D82A 5AJYA 3KJHA 2R65A 3VMFA 3EZFA 4RCZA 1Q1ZA 1QHYA 2L0XA 3NC1C 2O5VA 2H1LA 5JFGA 3N2IA 2NO1A 4OHXA 3TAUA 4XTRA 1OH6A 1PVOA 2RCNA 4V03A 1IJEA 4MKGA 4HAYA 4AY2A 3IPXA 3ZVLA 4P3YA 2H92A 3VR5A 4CGZA 4NBSA 2NQ2C 2WWFA 2O8FA 1XCGB 1N5IA 1VECA 1R0WA 2ZE6A 2A5YB 1E2QA 3BB3A 4V02A 4DSNA 3NBYC 4HYYA 1DARA 2OCYC 4AYTA 2QGNA 4BFWA 1WE2A 4I1UA 3LH5A 2VLIA 4IEIA 4UNQA 2VP0A 1C9KA 4DB4A 3JVVA 1XU4A 4IFBA 1E2PA 1ETUA 2IYUA 4B43A 1MRSA 1P2UA 3AUXA 3VHLB 4LX0A 1GWNA 3CNLA 4URUR 1U81A 5L3SA 2OHFA 4Q7KA 2YC2C 3OEHD 1DO0A 1YRBA 4O3MA 2OCBA 3AVWA 2PL3A 2ZPTX 2QA5A 2ZRKA 4UXJA 4E22A 2YWGA 2HCJB 3U6BA 2WAYA 4FINA 1Z6YA 4QGHA 2GBLC 4DZZA 3R8FA 5FUVA 1FX0B 1Z22A 1YZLA 1BS1A 3KTAA 4LCBA 1JB1A 3LXXA 5SZHB 2C99A 1YQTA 3BWDD 2QM8A 1YR8A 3FTQA 3CLVA 2DWOA 3GJ6A 4JLMA 1KO8A 2EYQA 1E79A 5A5GA 2WWIA 5DI3B 1MABA 2GVDC 4IDHA 4QGGA 3K70C 1SVOA 2FSIA 1SVMA 1ZYUA 1HYQA 3CRW1 4CT4B 1XD2B 5CLQA 5FUXA 1E2JA 4JLJA 1CJTC 2VBCA 5DSZA 3L0IB 4O2LA 2PCLA 4IXMA 2KWIA 4KFRA 1Z0KA 2HJGA 2ERXA 1UADA 3K0CC 4F4CA 3DL0A 4RVCA 5G40A 5CDFE 3CRVA 1PLKA 2W0MA 4S35A 4TLEA 3WBKA 5HPYB 3OIWA 2ZUBA 2FGKA 2Z4RA 2PJZA 1VCIA 1ZW6A 1S0UA 2B8TA 2I1QA 4YDHB 3RLFA 1YZTA 1A4RA 4I1SA 3VFDA 3VQTA 3AKEA 1QDEA 3MWJA 1T6NA 3HJNA 5CIQA 1E32A 3UMSA 3AUYA 4MUAA 3ZIAA 1FNNA 2J0QA 1COWD 2B8WA 5LBIA 1VHLA 1W0KA 3F8TA 1WP9A 1BIFA 1WDTA 3DVLA 2BHRA 4PX9A 4BGDA 5TY0A 2LKCA 3NH9A 3UATA 2ZJAA 3TUJC 1GKYA 2GCOB 3KB1A 3R7WA 1TUEA 2ZITA 3PUZA 1SXJC 1XNJA 2H7VA 1RYHA 4MYUA 2REXB 2HDNB 2VRWA 3M0EA 4TT3D 2ZXUA 2JLWA 5EUQB 3FB4A 3ZZ0A 3A6PC 3TGPA 1I4DD 1U9IA 1OW3B 2DPXA 1E2EA 2NG1A 4XOIA 2FZLA 2VTKA 4EIWA 1X1RA 4Q4HA 3LVRE 4Q9HA 2G0NA 4IDPA 4EFMA 3RSOA 1W49A 4LZZA 4D26A 3NTUA 1E9FA 2D3WA 2AXPA 3IDQA 4Q5IA 2ZRFA 4LBVA 4BWYA 4EQ6A 4EPYA 4ZDJA 4RZXA 1RIFA 1W44A 3GP8A 4C2UA 1N6HA 4TTQA 3THWB 2ZRGA 3LDAA 4LJ9A 4JLNA 3ONWA 1G3IA 5G3YA 5DYGA 3L43A 1ESNA 3KKMA 2FFHA 3D7MA 4JLBA 4EKDA 1XFAA 2RGEA 1S9DA 3AP2A 4DCVA 1DADA 3MUFA 2D62A 1LF0A 4R98A 3REGA 821PA 2HT6A 1S96A 2EFDB 4NYMR 4DLVA 1PV4A 3RRZA 4II7A 5L3SB 4NCKA 3B1WA 4LYJA 5EP4A 3I5YA 2GCPA 3AF1A 1HT2E 2JLRA 4DUGA 3FFBA 4E07A 2RMKA 4MRPA 3WP1B 4M9QA 2QUZA 1YZNA 2F1JA 5DYIA 3AEZA 4DHEA 4BLSA 3QI2A 4W9MC 1UEJA 4BZXA 4CEIA 4Q1AA 1U94A 3M6AA 4A2WA 1EG7A 3QKSB 2JLSA 1F6BA 1E4YA 1UJ2A 4M1SA 1T5IA 1Z06A 1RRGA 4XSGA 1MR3F 3GPLA 5BWMA 1ODFA 2PZFA 3OEEA 2FFBA 3KDSE 1U90A 1Q1EA 2BJVA 3RABA 1KAOA 4ZPXA 3G82C 1BMFD 2A5FA 3EG5A 4KLZA 4NE2A 5FTJA 3W5IA 4NYJQ 3RS5A 2FN4A 1FTSA 2C98A 1W5SA 2A5DA 2RHDA 2AHOA 521PA 3OHMA 3PG5A 3AKDA 1SKYB 2HF9A 5KNBA 2O8CA 4G5OA 1KSFX 3BK7A 3CKLA 4RZ3A 4YXWD 4JT2A 3MLEA 2ORIA 2GAOA 1FP7A 4Q03A 621PA 2TMKA 221PA 5FOTA 2QMHA 1XD8A 2CLSA 2GWHA 1GSIA 4DCUA 3KX2A 1XF9A 3PUXA 3TW4A 5KSOA 1XPRA 2BOVA 1ZUNB 4XSHA 4PPGA 1ZNYA 1Z08A 3NBXX 4HDOB 4DLTA 1NVVR 1E2KA 4P0TA 1RRPA 5L8VA 1IBRA 3DKPA 1LB1B 1OXSC 2ZRLA 1BOFA 4OHVA 4Z54A 4PO8A 4A0HA 2QRZA 3SZRA 2OXCA 4NL4H 3AF0A 5EXXA 1D9ZA 1ZAKA 3PIRA 1KZGB 4DDUA 1KTVA 3QQ5A 4NYMQ 5FTLA 2EFGA 2R6CA 2YZ2A 1AZSC 4F7WA 3K09A 4M53A 3R9XA 2FEOA 3CRRA 2VSOA 4M1OA 3U3RA 3K9NA 1R8QA 3NWJA 4WXRA 4BLPA 4TTRA 2REBA 3I62A 2WAXA 1P75A 2OLJA 2IYSA 2QENA 3BH0A 4RZUA 3S1AA 4IOKA 4KVAA 3PXGA 2ATXA 5CYOA 1CEEA 8OHMA 1DPFA 1W7AA 3L0PA 2G1KA 1UBEA 2QY9A 4C2TA 5DHAA 1GIAA 2H17A 2IYYA 2QQ0A 3ICQB 3EA0A 1P2TA 3AVYA 3EZ7A 3QXHA 1KZ7B 2GEDA 5KO2A 4MRNA 3ZYCA 4EPWA 1P72A 2YYZA 3C7KA 4JLDA 2OCPA 2J0VA 4QJ4A 1G7SA 2MSDB 4F38A 4Q4HB 1JAHA 2XTMA 2ZE7A 4QHSA 2WOOA 5DO9A 5JWRA 2OZEA 2VP6A 3O47A 3VKGA 2GJAA 3A37A 1Z29A 1RC8A 2W2TA 3ICEA 1U8ZA 1FOEB 1AK2A 2ODWA 3EIQA 4EQ6B 2V7QD 1R10A 1Z0JA 2F3TA 2FOLA 2ZYWX 2XXAA 2IUTA 3MSXA 5BN3A 2E9SA 1XB2A 2Z4SA 3OEHA 1N25A 1OHHD 4GP6A 2RB4A 3ZH9B 4A92A 4B71A 4S2EA 3GLGB 1MO6A 2NO0A 3FMFA 2BC9A 3CRMA 3ZVRA 5IK2D 4WZAE 4RFVA 3KKPA 1DELA 1M7BA 2QAGB 3TVTA 3VR4A 2J1LA 1OIXA 4EDHA 1WRBA 4L8GA 4JLPA 1ZU5A 4PPNA 2RGNA 4EUNA 2FPKA 1TUIA 3K8YA 2OT3B 2V1UA 4ZDKA 5TB5A 5K8UA 5KYKA 4KHZA 2ZJ5A 1QHNA 2QE7D 2RGAA 1D8TA 1G3UA 1KSHA 1OJLA 2FSFA 3UKDA 5JECA 4YMVA 2ODBA 1DTSA 3IO3A 1YU9A 3EZ2A 4QJ5A 3SJZA 4F91B 5F9HA 3ASZA 3BD9A 4LK2A 4A36A 2B6HA 2XITA 2ZSAA 3SJAA 3MJHA 3I3SR 3KZ1E 4QL3A 4TLCA 4E03A 1JJ7A 5HCNA 4K46A 1D6JA 4HB2A 3K70D 5EE9A 2VHQA 1ELOA 2QM7A 1OFHA 4G5SA 4XVRA 3NEYA 4UXIA 4B73A 3PJRA 3VHXA 3QKRA 3THXB 2Q3HA 3OAAA 2FDCA 2HLDD 4QGFA 4BFVA 2OFOA 4M8NE 4GBMA 2VP5A 2IXFA 3AF3A 4LC0A 1J7KA 2UKDA 3UMFA 1E2NA 1VKJA 4ZI3A 1OFTA 2X1VA 4EPTA 1P60A 1YZUA 4MDFA 3GLFB 2JLYA 2F1RA 2E87A 1VG1A 3IHWA 1COWA 2P65A 4JL5A 1OT3A 4BFZA 1UM8A 4HATA 4B75A 1KO5A 1Z0FA 5A0FA 2VQSA 2BBOA 2IXGA 3QY0A 4Y0AA 3Q72A 1A1VA 2H16A 4CDGA 4BRUA 1US8A 4L4UA 2BDTA 4TLBA 3NG1A 4AI6A 4KSCA 3FOZA 4DSOA 1M6NA 2BMDA 3QE0A 1NN0A 3EXAA 4PO1A 4OHYA 3DDCA 4PPQA 3IPYA 1CLUA 1LS6A 2VF7A 4JJZA 5FPHA 1N6PA 2F1IA 4JVSB 3B2EA 2IS4A 1HE1C 1K8RA 3CM0A 3IQWA 4PC2A 1VIYA 3LV8A 4IEEA 1KI9A 4YQFA 5KU1A 1R5BA 4HLDA 4M2LA 1JEEA 5DIFA 3S1AB 4CEJB 2G1JA 3U44B 1OV4A 1RW4A 1BYUA 2WTUA 3X1YA 4DWJA 1SXJD 2GJ8A 2JLZA 3HR8A 4PTLA 2GDJA 2IL1A 4WBSA 5JWOA 2CBZA 1T3SA 1TPZA 1XCPA 2IHBA 3QBVA 4LJ6A 2VSFA 3LO5A 1DE0A 2D2FA 4C30A 1CS4C 4BUJA 3MRSA 2QU8A 3VNUA 2O8EA 4DIEA 4LBZA 4UNNA 1XTSA 1R4AA 1UKZA 4TL8A 4B3XA 1UAAA 3CZPA 2JIZD 1NMXA 4EPRA 4HI0E 2DYKA 1H8HD 2Q3FA 4XTCS 1XEXA 3C8UA 4KITB 4ZKDA 1IY1A 2XAUA 1YR9A 4QG7A 3W3ZB 4HZIA 2XSZA 2MMCA 4W5JA 1R5OA 1QHSA 4ACAA 3TRFA 1D2NA 4TLAA 1G41A 1K5DA 1XX6A 5LD2B 1UF9A 4TZ0A 4O25A 1EWQA 4IDNA 2GAAA 3U60B 4QHYA 2D4HA 1G16A 4JKIA 5J4VA 4A6PA 4A8JA 1W36C 1T8UA 2KJQA 3P27A 1Q0UA 1U98A 5J47A 2J3EA 4RFSA 4YONB 1Z47A 1BMFA 1Q20A 1NRJB 2R6FA 1P9RA 4BLOA 1A82A 3EC1A 4A4DA 1X1SA 1DAGA 4WIAA 3OIUA 4MKHA 3QJYA 4OK3A 5BN4A 1TTTA 3QNUA 3EPJA 3ZDQA 5GJBA 1G7CA 3KJIA 3V9PA 3A4NA 2NPFA 2ZETA 1CXZA 3LXRA 5CM9C 5D3MB 4ZO4A 2ZRIA 4TYNA 2QNRA 1RVDA 2RGCA 1G4AE 4NU0A 2P2LA 3RS3A 3SBEA 3DM5A 5BYKA 1NBMD 3KXIA 3CW2A 2ZREA 2RGDA 2IS1A 2V8OA 3WP0A 2ZJBA 2YVUA 2C77A 1DAMA 4AG6A 3P4YA 4ESVA 3GEIA 4TMVA 2ZRCA 3ND9A 3RVBA 1SVWA 2YKGA 4M1WA 1JQJC 1KO4A 2QPAA 4EPVA 2V3CC 1JALA 4BECA 4GOKA 3QSYA 1HUQA 1TU3A 4LYFA 3CR8A 3HP1A 4PANA 4UJ5A 5K8LA 3WRYC 4TYYA 5KPJA 3CH4B 5BN5A 1OXXK 1NI3A 2NOAA 3JZAA 4E5UA 5JJKA 2HEIA 1NNEA 1MV5A 3D8BA 1FZQA 2W6IA 4PSKA 3W6OA 1AGPA 2P67A 2ZYTX 1Z6TA 2DWPA 1PUIA 3H0KA 3H86A 3TIFA 2PMKA 2JATA 2OE2A 4D80A 4GDFA 4PAOA 5K8IA 1KK0A 3AVUA 1FPMA 3CF2A 5KSZA 2CJWB 3VR6A 3KKOA 2VH5R 2VP4A 1ZNWA 3RC3A 1JEDA 4UNRA 3AKYA 4LOAA 1LS1A 1U0HC 1GFIA 3A4MA 1ZP6A 4ZCLA 1NKTA 2XX3A 3EWSA 4JYCA 4O2RA 5FPYA 1KO7A 4DLSA 1FTNA 2QQEA 5F3WB 4PAMA 1CR2A 4C0KA 2ZS9A 2BCJQ 3EIHA 2BJWA 2FV8A 1HQYE 2NIPA 1XD2A 1XXHB 4GI7A 1E1QA 1JR3D 4O0MA 4B3CA 2V7QA 3R8CA 4KODA 3UMRA 4ASUD 1KI1A 3I8SA 2GJKA 1X8KA 3QUSA 5K8TA 4EJSB 4QKQA 3LLUA 1Z8FA 3MMPA 1CU1A 1G21E 1EWRA 2MMGA 4TMZA 1KMHB 4I1VA 2GEUA 3LNCA 2QMEA 3QEJA 1DAEA 2Y8EA 1CBUA 4QBIA 1XD9A 3NH6A 3ADDA 4N0EA 1SVIA 1KKLA 2IYVA 1TQ6A 1YKSA 5TARA 1N3BA 3BAFA 1Y63A 4XH9B 3REFA 2FH5B 1SVSA 5G53C 2EQBA 2FFAA 4IJMA 5JI2E 1KY2A 3W3AA 3TK1A 4LPKA 5HTKA 3BFKA 4Q1FA 5KPDA 1HA3A 1M34E 3SHFA 2QE7A 5FR2A 2QGZA 1PUJA 3R9WA 1X86B 2GF9A 2HCBA 2GBLA 2VYFA 4LV6A 5CB6A 2A7QA 4G5RA 1DS6A 1NN3A 5FPTA 1HH4A 3H84A 2A5GA 3GQBA 3I92A 4A8JB 4CYMA 4ARZA 4PZYA 2GCOA 5FL7D 2ZVQX 3SN6A 1NLYA 1J2JA 4US2R 3QXSA 1JPNA 2QRNA 4G1UC 2IYXA 1OKKD 2F1HA 3O8CA 2WWXA 3T35A 2ZRAA 4FMCF 4PO9A 2MSCB 3NDPA 4Q9LA 1FQKA 1G5PA 2IT1A 4MYCA 4TSFA 2P6UA 1QVAA 4NYIQ 3EX7C 4NCIA 2QL6A 3IQXA 4D0LB 3C4JA 3ZLJA 5CB8A 1H8EA 4PHGA 4KVGA 3K0CA 1QHXA 2ZR9A 1YZKA 4HZUB 3RRNA 3U3OA 3GJ7A 4JVMA 2OV2A 4MKFA 4GPTA 5CK5A 1Z0AA 1OE0A 5EUMA 2PZGA 1TU4A 2FSHA 5FOSA 3THWA 1G17A 3U6KA 1N6KA 4DVGA 2IYTA 1XDBA 2ZQ5A 4LJ5A 5H8WA 2OBMA 3BE4A 4KYIB 4LYHA 4OHWA 4QHTA 3SNHA 3BGWA 4D4JA 5J4LA 5D3QA 2PBRA 1P6XA 4TQAA 3U4QA 3GCGA 3WY9A 1KMQA 1E96A 2QP9X 1A7JA 1EFRD 3U61B 4MGIR 1E9CA 3T06B 4Q21A 2VHTA 2C03A 4FIDA 2IWRA 3VNVA 1LF5A 1Z2AA 3LA6A 5FBQB 3VU9A 2CLCX 3CX6A 1EFHA 2F9MA 4FMDB 1E2MA 3L0SA 1IXZA 1J99A 1I2MA 4M1MA 4TYPA 3QKSA 2DFTA 1M7GA 3O8BA 1R7RA 1KI3A 3CR7A 3P20A 2XGJA 2NO6A 4DSTA 1ZRHA 2JJ2A 4QGAA 4KXFB 4TMKA 3GJ0A 1IQPA 2IK8A 3C15C 4JKYA 4AK9A 2F43A 3OE7D 4AIIA 4XWKA 4OJQA 1D2EA 2GCNA 1XTIA 2GZHA 3PQCA 2CMKA 2JIZA 2VHJA 1YZQA 2FZ4A 3QBTA 2XTNA 3I4LA 4HB4A 4PHFA 5L3QB 4DLXA 4MKIA 3BRWD 2WKPA 2C04A 3PVSA 1ZNZA 1V5WA 4TZ6A 4PQRA 2WWHA 2EU8A 3IHLA 2YNMA 3JZMA 2YOFA 2BMEA 1D2MA 2FU5C 4JVNA 1ZNXA 3RRMA 2CNWA 1JXMA 1Z83A 3HU2A 5CIWA 1KI7A 4C0LA 3EA5A 2ZRPA 3KFVA 4XVQA 2PH1A 4K8OA 3DPUA 5AJXA 3MD0A 2KBEA 3RAPR 1XCMA 2QSZA 4WOPA 1KDOA 2ERYA 3GLHB 1Z28A 2IS2A 4D2IA 4A82A 1F60A 3OFND 4GSYA 3DMNA 3WMGA 5JEDA 2OBNA 2OESA 1MO4A 3Q3JB 1IXRC 4R2HA 4B35A 3MG9A 1OLOA 1E2GA 4JVLA 1SKYE 3GFOA 2JAQA 2PX3A 5F2EA 1UEIA 4C7OB 4HLUA 1UKYA 3RS7A 2BCGY 1F3OA 3EW9A 4K81B 1JI0A 5E4FA 3TJZA 5LB2A 4ARZB 1W36D 1XTJA 2IA5A 4NONA 2CK3D 5DLQC 2C9YA 4W5WA 1AKEA 2R9VA 3PITA 4LV5B 4LSGA 4POAA 5J5CA 2GTPA 4JBXA 4JJKA 2IYRA 4BZPA 3CF0A 3K70B 4V0OA 4PC6A 3HDTA 1VTKA 2XOKD 4L5BA 1N6IA 1VCOA 4CZ2A 2A5JA 3BS4A 1DO2A 3N2EA 3P26A 4DC9A 2DFNA 5EZ5A 3ADBA 4CEHA 1E69A 2DFKB 4ILEA 2ZYUX 3HU1A 1ONBA 4MGKR 2KB0A 1IN4A 1ZVQA 4C0AC 4Q4JB 2EFEB 4HAVA 2J7PD 4HEJA 3RNLA 3MWLA 2G77B 1ZINA 4A2PA 1E6CA 1KI2A 4IOMA 4LGMA 2YOHA 3ND8A 5C18A 1IJFA 2QMUA 3R20A 2JLUA 4FWIB 4MRSA 1R8SA 2GF0A 5GJWC 2AKAB 3B7GA 4NCJA 3GLGA 3NVAA 2KSQA 4FD2A 2ZEJA 1D9XA 3U4QB 3V4FA 3QENA 2W00A 4LHZA 2QAGA 5AJZA 4OI4A 2GESA 2Z5FA 3QF7A 4LJYA 1B23P 4PZZA 2W6JD 3LW7A 1QRAA 1ZM2A 1KKMA 4YDSA 3A1WA 5JS8A 4PHTA 1LV7A 1VG8A 2WJHA 3EPKA 2CCKA 3VU9B 2MSEB 1OIVA 2QORA 3Q5DA 1XMSA 4DLUA 4ZV4A 5CJ2A 3UG7A 4HUQB 2F9LA 4FMBB 3ZJYA 5JSZB 1SXJB 1DAIA 4MRRA 1JR3A 4D0GA 1O87A 1TF2A 3KXKA 3K53A 3BOSA 1GKUB 1P2VA 2J45A 1PJRA 5TV2A 3W8NA 1N5KA 2WZQA 1S1CA 2A3RA 2J0UA 2PT5A 4RZ2A 3GLGE 3WHKA 2VEDA 3CH5A 5JJIA 4JZKA 4OQFA 1L4YA 2F43B 1XJ0A 5CK4A 4B47A 5JHGB 1JXOA 3PEUA 5A4JA 2ZS7A 2KI5A 5GVRA 4F4JA 4B3FX 3THXA 1KY3A 2OBLA 2CHVA 4XD7A 3W6PA 1AGRA 1ZD8A 2ZRHA 1AA9A 3U3MA 3VR3A 5JBQA 1DAKA 1IN8A 1QBKC 2IYLD 4M0LA 3THOA 5HE8A 1CKEA 2P3SA 2G9NA 3GLFA 2D2EA 4IFEA 2WJJA 2VHCA 4C9BA 4YMUA 3BERA 4WA7A 4Z1MD 2AWNA 2G0TA 4OK5A 2ONJA 1JR3E 1UBCA 3W9YA 1RKBA 4HAUA 3IO5A 1G8HA 2WJIA 2YOGA 1TF7A 2OAQ1 1VG9B 3PCRB 4HB3A 3T1VA 1GNQA 2C2HA 2GA8A 4Q48A 2CEAA 1VYUA 1KK1A 3H2YA 3VKHA 1IN5A 2RKOA 3GD7A 5E3HA 2BEKA 4QBHA 4XWOA 1VDZA 4D4KA 1Z6GA 5AUQA 1OB5A 4Q7LA 4DLWA 4LWZA 1KI8A 2AD1A 1NVWQ 3CONA 3N5CA 4DJTA 3LWNA 5CM8B 4BFXA 3KFXA 4KBFA 4ZDIA 3KXLA 1LTQA 3DM9B 4DDWA 3FWYA 4TQ9A 1YE8A 3M4YA 1RPZA 1T8TA 4ESHA 1RZ3A 3Q9LA 1IHUA 1UDWA 2PT7A 4CEJA 3U44A 3MAAC 2DWQA 2J7KA 4BFUA 2ZROA 2GXQA 3LD9A 3MWYW 3SC3A 1RE0A 1UBGA 3GLFE 3K9LA 3TBKA 2YC4C 1NLFA 1E2FA 1GNPA 1WB9A 1TQDA 4HUTA 4KLNA 4A1FA 2GXAA 2OXRA 4RKFA 2J5XA 3CWZA 4AYXA 3AVOA 1ZCBA 1M74A 2NO7A 1WBBA 5JWHA 1QG4A 4G01B 4CEHB 5FBWB 3KB2A 1ZJ6A 3AGPA 3RHFA 1P62B 4MITA 3AP3A 2XB4A 3CZQA 2QZ4A 2I3BA 3B1VA 4MH0R 1E0KA 1EXMA 2QN6A 1EFRA 2ZANA 3L2OB 1IY0A 1XTQA 3K0AB 3IIKA 3CBQA 3DOEA 3QOFA 1E0AA 1G8FA 5J40A 4LHXA 4M22A 4NTZA 3ETLA 1CP2A 1XMJA 3B78A 3CIOA 4FMCB 1VMAA 1WA5A 2IX3A 2ZRMA 4WW0A 4FXPA 3K9HA 1ZIPA 2Q21A 3L8ZA 4M9SA 4PFSA 2ODNA 1GITA 1NVVQ 2A2ZA 1LNZA 2VPPA 5IF9A 3WNBA 3ZVNA 1IONA 4RKEA 2VIIA 5GJCA 2GETA 3VR1A 5C4MA 5F98A 3B60A 4URXR 1OPXA 1Q21A 3U5ZB 4G5QA 3NEJA 4X8LA 5J4YA 1AS3A 1G7TA 4RD0A 3L8YA 3OE7A 5J4HA 1XEFA 3FKQA 5FI1B 2F3RA 5ELXA 2CHQA 2OSBA 1SHKA 2P6NA 1T4GA 3W5JA 1F2UB 3UPUA 3T15A 1NMYA 5D3MA 1OXUA 2P6RA 4KFSA 1L4UA 5JS7A 2QEQA 5BQ5A 4IOLA 5DN6D 1F2TB 1OF1A 2J0UB 3FYHA 3EPLA 4NCNA 4WXPA 2WSSD 3I61A 3EWAA 5JEEA 1OFIA 1SHZA 4TL7A 2RGBA 4R9UC 3SFVA 4Q4AB 3CWQA 3AH8A 3AB3A 2AKYA 5E7JA 3AQ4A 4RD6A 5UKDA 2BBSA 4UKDA 3QPVA 4AKEA 3VX3A 2HUPA 3EAQA 3QXJA 4OQXA 1WBDA 3OFNA 3P1JA 4DBLC 3K0SA 3QG1A 1N0UA 3QXCA 1ZU4A 4P4TA 2C96A 1O3YA 3QXXA 3X1DA 2OM2A 4HAZA 2IYQA 5JZVA 2XJ4A 1G291 3NC0C 1FUKA 3K1JA 2BKUA 3GJ5A 3T5GA 4CRWB 2WICA 5HE9A 5FBLB 1ANKA 1AQYA 4RJLA 5E7MA 4ON9A 2CK3A 1FQJA 1S1MA 4M4SA 4Q18A 4DCTA 2D7DA 4IXNA 1G8PA 1LY1A 1TX4B 2I1VB 4TT3A 1U8YA 2CJWA 4Q9KA 3K0EA 4JIMA 3IEVA 3UANA 3KQHA 2IUUA 4JSYA 2NGRA 1GDDA 1NVUQ 1T91A 1TF5A 2XOKA 3UWKA 3WBJA 4BFTA 2YWHA 2EFHB 3QF4B 2F7SA 1GL9B 2WPDD 2F6RA 2HXYA 4MGYR 2QPTA 4JSTA 4BEJA 1N5JA 1KSJA 1T5LA 3UXMA 2UZ3A 2VF8A 3OF5A 1XXHA 2D74A 2BBWA 2J7PA 3IKJA 1P2SA 5TVKA 4JLVA 3A8TA 4TMWA 1DAHA 3NBFA 1E99A 3TW8B 4D0NA 2WIAA 1G3RA 5JLJA 3LRPA 3T1OA 4V0LA 2P0EA 4EJSA 2FMXA 5EE3A 1T3LA 1P73A 2W83A 1E9SA 3D31A 3ZGXA 2ZI5A 1ZUHA 4LBYA 1XWIA 4B32A 1KMHA 4GOXA 3FDIA 4KAXA 3L0OA 5P21A 5TDHA 2A78A 2Z83A 3EIEA 3NKVA 2ZUCA 3HWSA 1G3MA 4N0DA 1E9RA 2A9KA 1U8AA 2W6JA 3GJ3A 1K5GA 3H4MA 1IXSB 3WMFA 2HYIC 4MYHA 4RSGA 1CIPA 1CRQA 1E2IA 1MO5A 1GL6A 1KDRA 2XZOA 1FP6A 4M9XA 2WKRA 3GMTA 5C2JB 4QRHA 5EP1A 5IRCD 1JNYA 1GM5A 1E79D 4OL0A 5C4GB 4XJXA 3SS8A 4I81A 1XXHE 3TH5A 3V00A 4P31A 4ERNA 2J0SA 4AYWA 1HURA 2Q9AA 2V1XA 1NJGA 5AK0A 1NVXQ 1E9DA 4I1OA 3TQCA 5JRZA 2ZE8A 4DT1B 4FCWA 3SFZA 2WSMA 4TMTA 1WCV1 2V6JA 3RS4A 2X19A 3TSWA 2ZJZA 1KIMA 4B6EA 1NG9A 1Y3AA 2F55A 2J59A 3W34A 2ZJ8A 2CL6X 4M1TA 1P7CA 4YXWA 3RANA 1IM2A 1IN6A 2ANBA 4Z8XA 3Q7PA 2R8RA 1G20E 5AJVB 2O8DA 5FPSA 1DVRA 2AL7A 3WYAA 3CNNA 4KO8A 5AUNB 1KJYA 1NP6A 3WNDA 4IHQA 4HZUA 3FHOA 4CVNA 1MOZA 4Z1MA 1NMZA 1SKQA 4NPHA 3DEFA 1P3JA 1VHTA 4AG5A 1NKSA 4DIDA 2AK2A 1X8JA 1W0KD 1RFLA 3LBNA 3AVPA 2B7CA 2LKDA 1EK0A 4Z51A 4GMXA 1DG3A 3UIEA 3UWOA 4IRUB 2O8BB 2NZ8A 1OXTA 1Z3IX 2R6AA 3GEEA 5IHPA 3K9GA 2Z0MA 3F0TA 1VPLA 1S9HA 3OESA 1OH7A 4DSUA 1KJZA 3QIAA 4C0BA 4AC9A 2HJVA 1GOTA 2PMDA 4GP7A 4WZ6A 1CR1A 3NDBB 1E4VA 2QG6A 3ZZUA 1T0JB 2DR3A 3W90A 4GRAA 2FG5A 5CLLA 1W36B 2P5SA 4TWZA 3KQUA 5JRJA 2G3YA 3ADCA 1ESMA 5CITA 4U02A 2VP9A 5FBRB 1QHHB 4Q9IA 5FR1A 3DZ8A 1II9A 2XEXA 2VL7A 4P32A 4JBYA 2FX3A 1DOAA 3KUDA 4IW3B 5AUPB 1EFCA 3B1YA 1EFTA 4RD4A 4TL9A 1GL7A 1E0JA 4ZKEA 3BJIC 4US1R 1QHIA 2GEVA 4C3ZA 4LJ7A 4M1KA 2V4ZA 3OIYA 1DG1G 2BM0A 5M04A 2PLFA 5EE1A 4LUCA 4DLRA 2GVZC 5L3QA 1A2BA 1JJVA 1ZM3A 2JJ8A 1KI6B 1Z2CA 2HYDA 1Q3HA 3PUVA 4U7DA 2IUSA 5DH9A 3GLIB 1S3GA 1OHHA 2G6BA 4P4SA 2WHXA 2ZJ2A 3BB1A 4ACBA 3FHCB 1MO3A 2J87A 3QEOA 4PSAA 5IK2A 4PC7A 4ZI2A 2JLVA 4U5XA 4HLQB 3B1XA 2FE4A 5G3ZA 3WYFA 2BV3A 3K0FB 4Q1CA 4LHVA 1JR6A 3C14C 3LLMA 2OO7A 2C78A 3ZD6A 1VYVA 3AVQA 2ZUDA 3GLHA 1S3SA 2EYUA 2OILA 4HDCA 1RRFA 1JECA 2CE2X 2WMNB 3I32A 2N42A 3OIVA 3N70A 1GP2A 1IY2A 1T9HA 4NH0A 3LX8A 2EWVA 4B3GA 2JLQA 4C7OA 1TL7C 5JI3E 4Q00A 1Z0DA 4GZMA 3SYLA 4JBWA 5AUOB 4TQUS 1NIJA 3AF2A 4JT4A 2V54A 1F5NA 3TR5A 4M9ZA 2WSSA 2BEJA 4WVFA 2FFQA 3VR2A 1KOFA 5FH9A 1Z07A 1S4QA 1W5TA 1VG0B 3A1SA 1G6HA 1PLJA 5HZKA 1OXVA 1XTKA 2XTZA 3I8XA 1AKYA 4MQBA 2NTYC 3TNFA 4B44A 2ECKA 2HLDA 4X8OA 3FMOB 4NP6A 3BFVA 3DMDA 2ZS8A 3T1TA 3U7HB 1UDXA 4JL6A 3GLHE 4TTPA 2O8DB 3AF4A 2R44A 4Q4JA 4B2LA 3HYRA 4US0R 1NN1A 4OI2A 3QVVA 1QHGA 4URWR 2FF7A 3FPAA 4HDQB 3EASA 5JCZA 1CTQA 4QFMA 2FWRA 5KUTA 4LHYA 4DDVA 1G4UR 2JGNA 5DNYB 1UKEA 2ZRNA 3MWKA 1NSFA 3IBGA 4MGZR 5EP2A 3RDPA 1W0JD 5EE0A 2HT1A 2JA1A 5CYPA 4B3DA 1II8B 2ZAMA 3TQFA 4A0GA 2IXEA 2WJVA 1GVNB 1Q3TA 3VTKA 1XMIA 1XEWY 2ZI4A 1ZBDA 3BBPA 4A2QA 2D06A 2FA9A 3RS0A 2DY1A 3SDZA 4LJ4A 1M7HA 4AURA 1R0YA 4W5HA 1IAQA 2DHRA 3TLXA 2IF2A 4URVR 1R2QA 2OEPA 4EFLA 1EFUA 1CF4A 2QSYA 3E1SA 3IILA 2DFLA 3J81k 3NBZC 1A2KC 1N5LA 2R2AA 2WPDA 2R6GA 3EPHA 2Q9CA 4WAUA 1XTRA 3IIMA 3TUIC 4PC3A 1I4LD 2FSGA 1UPTA 4R7ZA 4HUQA 4RCYA 3PUWA 3M1IA 5JSZA 1SXJA 4F93B 3DKVA 2WJYA 4DXAA 4JLAA 2QBYA 1NIPA 3UK6A 1SVLA 3I1FA 2H8KA 3KQNA 2QI9C 2WV9A 4BLTA 3X1XA 2Z43A 2ZRBA 1A5TA 3E2IA 1G8GA 4X8HA 4OQNA 2QTFA 3OZXA 3CPJB 1T0HB 2BMFA 2OAP1 5EZ6B 3T1QA 5FL3A 3LVQE 4TLDA 3U2QA 3F5FA 1N6OA 3CX7A 1HY3A 1NG1A 4IVQA 5CDFA 1M1YE 1H8HA 3B8HA 2XNDD 2IW3A 5JJLA 2GZAA 1L8QA 2WWGA 2XZPA 1HEIA 1DBSA 1GG2A 2J9RA 3BH6A 2WBLC 4P4SB 2ZSDA 4FN5A 4B33A 3FKSD 5TMPA 2WJGA 2W58A 3R9IA 1AS2A 1N2CE 4FWTA 2FJUA 2JCSA 2NO9A 1SXJE 3CO5A 2PCJA 2BKEA 1OH5A 2REOA 4NMMA 4D81A 3ZS9A 4G5GA 2GZDA 3LQQA 4BRWA 4UQOA 3FFAA 4DDTA 5KDOA 4NZYA 2ASEA 1M2OB 3QKUA 2X8AA 1TAGA 2O0KA 5HZHA 3BORA 2GRJA 1U0LA 4ZDWA 3T5DA 4TYQA 4M1YA 1U99A 2EFCB 1AQUA 4TN1A 2PEZA 5LB4A 5FUWA 3KUCA 4DEYA 1TEVA 4KFTA 1E1RD 2G88A 2PZEA 3HPRA 4OJKA 3OAAD 2VHUA 1WXQA 2AR7A 4URYR 1XBTA 2XB2A 1G3QA 4JLKA 2BM1A 1MH1A 1EX6A 4FCTA 4JL8A 2ZRDA 4ZIRB 5EJEA 2JJ1D 1CJKC 1NBMA 4Q7MB 3WXMA 4OQMA 3G0HA 1GZSA 3AP1A 1RJ9B 1W4BA 2ZVPX 3GFPA 4Q19A 4YMWA 4L9WA 4N3NA 3RWMB 4BFSA 1KDTA 2H57A 1WF3A 3UG6A 721PA 1EGAA 3QG5A 2JLXA 4LJ8A 5JHHB 1G7RA 1AM4D 2HV8A 3ADKA 4Y0VA 4F92B 2IC5A 4IVPA 2E1RA 2JDID 1C1YA 1KK2A 4H1VA 3ZQ6A 3X1WA 3B9PA 3B9QA 3K0AA 5KNCA 4UXHA 1M8PA 2AX4A 4NYJR 3SYNA 4DCSA 2I4IA 2ZI9A 3A1VA 2AK3A 2WOJA 2ZSBA 5HCIA 5FBVB 4I4LA 3RYTC 4BLQA 2VSXA 4Q47A 5IT5A 2IEZA 2ZJOA 4HAWA 1NBME 1G64A 5HKKD 5GADl 2VP2A 1KDPA 1W4CA 3ASYA 4A15A 2GNOA 2RHMA 4KSBA 5G41A 2QTVB 1SZPA 5FI0B 1II0A 1ZUIA 2R6DA 3AVVA 2FNAA 4AKIA 4NCHA 2O8FB 2CXXA 1PLLA 1JPJA 1HV8A 2JEOA 4Q1EA 3SYKA 3Q5EA 1G1MA 2YINC 1MRNA 5KTYA 2QBYB 1F2UA 2QAJA 5JMTA 1OIWA 4J0QA 4ASUA 3H1TA 5B58C 2A30A
chains in the Genus database with same CATH superfamily
1H4VB 1Q74A 1YVDA 3BXEA 2EFJA 1EJ6A 2I7CA 4TTJA 3BXGA 3SJBA 1ZD1A 4RTQA 4BMVA 2J46A 3VX4A 1PSDA 2IP4A 2LWIA 2J4DA 2X9LA 1KEEA 4OMFG 1QU3A 2A9RA 3GJYA 2WTBA 3N8GA 1QYWA 3PPVA 2I33A 3A4YA 2ZIXB 3O3OB 4V0MA 4C0HA 1BO6A 4JLWA 3HYLA 4QXRA 1JIXA 4A7PA 1PD0A 3Q7SA 1VE3A 4NECA 1Y81A 2AOWA 1JDBB 1BQ4A 3ID6C 3A3KA 4UBMA 3V1LA 2RIPA 3U7FB 2YZ7A 4O29A 3DQQA 4HLUC 1VL5A 1W93A 3WQRA 5AVQA 1YR6A 3DTYA 2R3SA 1JBKA 2HNKA 1BYIA 2WM9B 3P9PA 2VO1A 4PSUA 3UMYA 3OZVA 1Q7RA 4JLOA 1O9BA 2G5TA 3PE4A 1KH3A 5AM4A 3U3JA 4NICA 1HKUA 3NFRA 1A5AB 2I91A 5T8KA 3MS4A 1IBKB 4TS1A 4CUZA 1PR2A 1GY8A 3ETGA 5J2UF 1SULA 4JMPA 1FUUA 3T8YA 2I2DA 3UJAA 3ZV5A 1OGIA 4BASA 3QVTA 121PA 5GJVC 2PZMA 4N3GA 4KMRA 6PFKA 3OCZA 5HWSA 5KC8A 3HTXA 1YVEI 2XF2A 3OJEA 5K4HA 3V3TA 1QS0B 3R0IA 4JROA 5IAJA 4K1XA 5DNCA 3WRWA 1R64A 1T1IA 1U2SA 2YJTD 2RBKA 3D1VA 3LX5A 4DJAA 4DC1A 3FUUA 1QZXA 4C0SA 3TRJA 3MJRA 3GJ4A 5COAA 1GN8A 3A2KA 4KE8A 2BRUC 3D54D 3F8SA 2CE7A 3JQQA 1MFPA 1XJ5A 3N0TA 3M6IA 4CR6A 1KNXA 3JRNA 4IVRA 4KBGA 4HZGA 1C8BA 5D00A 4HAXA 2OFFA 4B4KA 5F3DA 3KJNA 3R41A 1QMPA 4DDHA 1EDEA 5BMVA 2NV6A 4MV9A 4OQPA 4OSEA 1UIRA 4YJFA 5DLDA 5F21A 1X38A 2Z6VA 4IMRA 2AGVA 4K8RB 3G9TA 1EAMA 2ZXFA 4NF2A 4UUNA 1KPGA 3X2SA 5ESWA 1A8SA 4DLYA 5KJFA 4EYEA 3HRIA 5B4UA 3LBHA 2Z04A 3A36A 4MUBA 2DERA 2ORYA 2W6ID 5TX7A 2BP7A 5I7AA 4BJHB 5MDHA 2B36A 1OC2A 4CF4A 2V7BA 2X2FA 3BIFA 3I04M 6LDHA 1ORHA 2D5CA 2QT1A 1WOYA 1NHWA 4U6SA 2M6LA 3I1YA 3R40A 5KDLA 1NDQA 3WO0A 3ZCUA 1B7GO 4BLRA 3ZVMA 5FUBA 2DETA 4CM8A 4JBNA 2PLRA 1VBNA 2ZWVA 3MS2A 3R5FA 4R4JA 3W2EA 1WMSA 5TS2A 3VR6D 1JBQA 1E3TA 1YA8A 2O1EA 3LY5A 4PQYA 4WEOA 5FOWA 3UV3A 4AD8A 4BVGA 1UBFA 1NXWA 4BATA 3WRXC 2XMBA 5KSWB 1FSGA 4P1ZA 3Q12A 1MU0A 2YR0A 2LV8A 1UODA 9LDBA 3WKDA 4YO8A 3X43A 3W7VA 1QM5A 3T7SA 3DP9A 1VCHA 4FR5A 2L17A 3PR2B 1C50A 4DA9A 4EHNA 5IJWA 4E12A 3C3PA 3W8EA 2H9YA 3J81A 5ILGA 3U9TA 3LFUA 3G9ZA 1J90A 3P0EA 2AFIE 1R88A 4LYAA 3ZD7A 5I9MA 4WFIA 1X6VA 3GLRA 3C8DA 3PFIA 1FJXA 1J8MF 2BI7A 5DHSA 2VG8A 4O2BF 3NTVA 5JDCC 3DVRX 1WDLA 3HHEA 4JI6B 3U7EB 3FDZB 4ZI7F 2R62A 3GOHA 1C3OA 3HJBA 3OVMA 2NUTB 2UZ4A 1UFOA 5EXSA 3UPDA 2QR5A 3G02A 3O94A 3LMKA 2AB0A 3HSYA 2OOKA 2Q5HA 5JR3A 1FTQA 5LMNB 2FI1A 2IHTA 2ANCA 2X0JA 4XX0B 5SZJA 2KPOA 4PINA 4Q0MA 2Q6KA 4URZR 4WK0B 1M73E 4OYHA 5J63A 1ZGGA 2C4TA 2ZVDA 4YR9A 3GG2A 4KPUB 1WWKA 1S2NA 2YWFA 5I8PA 2HSWA 1A7KA 2D7CA 4PZ0A 2NZUG 1WW3A 3U09A 5EZSA 1ENYA 1FL9A 1OSNA 4NKRA 1ABBA 3TVDA 5B30A 3NPAA 4M0MA 4YMSA 4CLHA 1SRRA 4RH1A 3GG9A 5TJ9A 5LXTA 4O6VA 2RHCA 3H8JA 4ROTA 3NXSA 2IP1A 1Z8NA 1NATA 1GJRA 1GPWB 4ZC1A 1CR0A 1PJAA 3TE6A 2HA7A 1U9JA 1ECJA 3JYHA 3PDIA 3P4UA 4KL8S 4GZ5A 4DB2A 1TVEA 1DX9A 4S1TA 4W9RA 5C5DA 1E2DA 4P7GA 2O3TA 2X4LA 1AMOA 5CGZA 3NGXA 4BZZA 3A31A 3T7TA 1Q12A 2PX5A 2JFWA 3BCRA 3HB5X 5EIHA 1GNTA 2A59A 3HEBA 4LVOA 5AJWA 4FTWA 5ES3A 3VSCA 1XVTA 3DOOA 2JL1A 3DTVA 3KJGA 3WWEA 3B82A 3ETJA 3BHMA 1O8CA 1HL3A 3BWYA 1N6LA 3C5CA 3EGEA 3DLIA 4CFZA 2X2EA 5LPNA 3KKEA 5K09A 3O5AA 4OHZA 3LW8A 5DNAA 3KQKA 3K5PA 1B16A 4V0KA 3ZKWA 5D7BA 5AM2A 3C16C 3PV0A 5H0IA 3FNEA 2I03A 3C39A 4Y2JA 2B1GA 2QX9A 2PO7A 2V59A 1KI4A 3HXTA 5YASA 4GDMA 3IVMA 5JQGF 4NDZA 2VDWB 3WYEA 3FUXA 4R3NA 4UDXX 5ELLA 5HG0A 2B35A 3BF8A 4KR2A 2WIFA 4R71A 1GSHA 4DNXA 1KO1A 2OCKA 4PXAA 1GRNA 1UAGA 3I8OA 4GNKA 4YJFB 1E2LA 1VDMA 1R00A 2CT8A 2R4QA 4PG4A 4M99A 3W6NA 3MCAA 5LD2C 2XUIA 2PS9A 1U3DA 3CSSA 2RAPA 1SBNE 3PNOA 2BWJA 3GJRA 3C1UA 4HDNB 5ALZA 1I80A 3A9WA 3NDJA 4RGYA 4NR0A 4TV9A 5BOSA 2QSUA 1JVBA 2EKDA 4CQNA 1Y1PA 3LVFO 1AKRA 3H9BA 1ARZA 3K4QA 2CLDX 3VGJA 4BO2A 1Z63A 4RMGA 4LRUA 3H9JA 5JZSA 5BW8A 2DB3A 3GYGA 4Y1EA 1LFDB 2BTOA 4OFWA 5AK6A 5FPQA 3SVTA 3WYGA 3GFGA 2O0HA 4FWBA 3JU3A 1FDVA 4DNOA 1N9ZA 5FO0A 4YJ2F 1SG6A 5A4FS 3F9RA 5K8VA 4IGEA 3RWOA 1W8IA 4CM8B 1A8UA 4QLAA 5G2OA 4GOMD 4L95C 4O4HA 4AU1A 4BQSA 2ATEA 2BIFA 2YV5A 4YCSA 3UHJA 2WSLA 5T57A 4HPWA 3D6JA 4CM4A 1Q22A 3VTFA 1I4TD 1T1SA 2D8MA 2I4MA 2JJ2D 2RJNA 1EWTA 3IMGA 4TS9A 5CXXA 3PNKA 3JQGB 4G2NA 3NHKA 1Z88A 4G86A 2FP4A 5DBFA 4JB0A 5H70A 2F3SA 1Y37A 1G38A 4EY7A 2GYYA 3OT1A 2Q9BA 2C58A 3BTSA 3A1UA 3DP7A 3MGCA 1L5ZA 4P84A 4ZVTA 1O6GA 3VKWA 1J8VA 2HSZA 2QM3A 3H5TA 1L7DA 4YRTA 1GTSA 2HMWA 3AM3A 4QBFA 2A0KA 3SEAA 5ENZA 5CVDA 3OPXA 3OT4A 3A1NA 1YHNA 2JJYA 1WHTA 1R1DA 1Z37A 2AOTA 3EGDA 4PLCA 1CY7A 3FWZA 3NIGB 4JK3A 1P33A 5KVQA 2O2DA 2OCXA 3WL3A 3L0YA 4L2IA 1G19A 3QLJA 2GX6A 2V6IA 3QVJA 1L3IA 3DHWC 2HMUA 3QE2A 4GSLA 4NCBA 3JALB 2PSDA 1L4NA 1V39A 4R8KA 2VNIA 3DMRA 3QVUA 4QU8A 1ZMRA 4JD5A 1Z2NX 2FMUA 4JHLA 1AGYA 2IHVA 4R1NA 4HH3C 4M7WA 3T34A 1RZRA 1OZGA 2ZU6A 3DMPA 1LDEA 2B2NA 4KRFA 2WIBA 1NA5A 3TOCA 2FUG6 4B3BA 1N2GA 1MCZA 4U63A 1OB2A 4GLOA 3JYPA 1D4ZA 4FLFA 3IE2A 5ETJA 1VBFA 3ZXSA 4D8UA 1W30A 3P4XA 4GNRA 5K9ZA 2NNLD 3RU7A 1XPUA 2OD2A 4Q3EA 3N2NA 1FLAA 2WF5A 2W2VA 5EP3A 3ZJTA 5EKTA 4IIUA 2PSEA 4KMMA 1M8GA 2CDAA 3EZ9A 3WTCA 3ZY2A 5G4KA 1VLZA 4C5AA 1OYYA 1PNVA 3INNA 3SKYA 5FPKA 4I5FA 4WL0A 5BSFA 3LC1O 5EC8A 2WPNA 1JE1A 4O5OA 2L19A 1KSGA 5F9FA 4F5WA 4D6XA 1OZFA 4NBTA 1QF7A 3CCCA 2YIVX 3I2KA 3KOUA 4FW9A 3SM3A 4K6HA 4D0SA 3DTVB 4O1HA 4ZVMA 1NN5A 4G56A 3AYZB 5CVEA 1B0AA 2M32A 1YU6A 1YNOA 4J3NA 2H1IA 3QFHA 4HGOA 3NGMA 1QGUB 2K2WA 4L75A 1Z5ZA 3KQOA 2YMLA 3RBXA 1KK3A 4UHHA 3HWX1 3ZKWB 3VZQA 3ENVA 2RGGA 1CRPA 3UJ3X 5AR1A 4JZYA 4R81A 1K6JA 4DIUA 1K4KA 1ZVMA 1TQ2A 3BQNB 5ANRB 3ZOKA 1HT1E 3R4VA 1B8OA 4RBNA 2QOEA 5CXSA 2C82A 2PUWA 3A6ZA 3CNEA 3DMFA 1EDZA 1ZMXA 1JTFA 4RKWA 4FYJA 5DHFA 3T7KA 4L16A 4CIDA 3JAWA 3R7SA 1OFUX 2ENUA 2QN1A 3DZFA 3JQBA 1CFZA 3O3CA 1OI2A 3M6LA 1KJWA 1YRWA 3D8TA 4YDQA 4FZVA 1YQGA 3B85A 3WGHA 2CVHA 5EXPA 2HF8A 3RRXA 3W5BA 2C4NA 2UXDB 4EI8A 4UHEA 1CJMA 4X7MA 2FEMA 2OQ2A 1FX0A 3LPNA 2GJ9A 2OQIA 4RVDA 4LKRA 3L41A 3W1WA 4LZNA 1VYTA 2FLVA 2VA9A 3G5MA 3LZCA 4MVXA 2QVLA 2ZE5A 1BDHA 1GCUA 2QLBA 5CEJA 1QRUA 1G6OA 3SD7A 1JA1A 3EVBA 2QMOA 3CUTA 4GPD1 4W7HA 4HC4A 4MA4A 5E1DA 4ZYLA 3KZVA 4N18A 5DI3A 4IJWA 4C5BA 4AQ7A 1E2BA 4LTMA 4B0PA 2EKQA 2G83A 2IHYA 1F2VA 1H2FA 4ZD6A 5I3ZA 2GVNA 5FX2A 1K8XB 2F67A 3I72A 1M6VB 4RPKA 2FHSA 3G7UA 3VNQA 3UOAB 3WYBA 4S1NA 1V47A 4HF7A 1M3SA 3IJEB 3I73A 5DCWA 5EYPA 4C1BA 1HF3A 5IAEA 3AHHA 3OJCA 4V3BA 2YICA 3OM9A 5KSPA 1LVGA 3IP6A 1J8DA 4F1JA 2K87A 421PA 3BD8A 1E7QA 1KHTA 2JRCA 3AUFA 4CKXA 2FQWA 4XASA 5NLLA 2ODPA 1SH7A 4CF7A 2FP4B 3FCUB 4F5YA 1OT5A 1DFHA 2PH3A 3OT1B 2J32A 2BHLA 4TGLA 5KNBD 1LNSA 4GL4A 1L8XA 2QNBA 1L4MA 1E6KA 1P4SA 3PNBA 5DN6A 2GD1O 2RDMA 1OYVA 1WHTB 2CZGA 4UAVA 4LQ4A 5EVCA 4IGAA 2RH5A 4EL0A 4N8EA 5BP7A 2OOSA 2SICE 2XMQA 1QVRA 1XRQA 2C3OA 3A10A 3L82B 4MI6A 4ZEWA 4C06A 4N5MA 3PDJA 2VQFB 1AKWA 2A9JA 3ROZA 3ZQUA 3G59A 2Z2ZA 4MWZA 3AZQA 4JN6B 2BEWA 3HXQA 5LJIA 2XE8A 3CF6R 4KIUA 1TYEB 3D4LA 4PZCA 2H18A 3RRYA 1LLFA 3FDXA 4DRZA 1QP0A 2ECOA 1XVIA 1VCMA 4PLYA 5DNVA 1EVZA 3FTNA 3G13A 3GZ4A 16PKA 2CXPA 2CCJA 4FHFA 5KOYA 1NFRA 2PX0A 5FD8A 3V8VA 5GVSA 2SCUA 4I8IA 4P08A 4L8VA 1YB5A 3F6PA 4LVCA 3E2MA 4Y1RB 3C41J 4Q6WA 2EVWX 3O93A 2J9XB 3A9VA 1FLNA 1UQRA 2GARA 3HR7A 4GYKA 3WMEA 5GZ6A 2ZU0C 2XVAA 3TI9A 1DCMA 1XQXA 5LWQA 2P90A 2X1MA 4HLNA 5DTRA 3GPDG 3KJHA 5C8YA 1H6AA 4QDJA 4CJXA 3UOGA 2QTGA 3R7BA 4IV0A 4QQFA 2W2NA 1TVKA 1QHYA 2A9OA 2BMWA 4TUYB 2H1LA 1T5HX 3LY8A 3D7NA 1UL1X 4UD6A 3TAUA 4NI5A 3L04A 2QTVA 4G8CA 1HBJA 4MKGA 2HOQA 3KEFA 3ZVLA 1ZVKA 2QRLA 2WP0A 4GM1A 2JCBA 3AC0A 4P3YA 4RQAA 4YI5A 3GZTB 1A96A 4DIMA 1LRLA 4LF5B 3FJ1A 3N58A 1VECA 4QYTA 4Q3DA 5IHXA 4PY2A 2ZE6A 3H05A 3RGWS 1E2QA 1Y1SA 4C4SA 2I3DA 3NBYC 2QGNA 2O2CA 1WE2A 2QW0X 2WP8J 1HO3A 2VLIA 4UNQA 2VP0A 2V8BA 3ZZMA 4N01A 5ALMA 2QX6A 3WWZA 2VQDA 3PDWA 4B43A 1Q0RA 4J8PA 3PFHA 3GZJA 3JAWB 1E60A 4QUEA 3V7FA 1TTHA 3ZOZA 3ZCQA 1G2QA 2OHFA 4R7GA 3FYCA 3WK8A 1Z5NA 1YVUA 1JIVA 2UZ0A 3OEHD 4RNCA 5JNRA 2YW9A 4YIKA 5IUJC 2ZPTX 1NQAO 3LTEA 4RIHA 3ZCTA 1G21B 4UXJA 4D41A 1IUKA 3GX1A 2UUAB 4LSMA 5DWVA 4FINA 1T0PA 4QGHA 4DZZA 1AX9A 5FUVA 1FX0B 1FA9A 1E3LA 1Z56C 4XYEA 4BMSA 1EUQA 4J75A 1KS9A 1YQTA 4Y9TA 4GX5A 3EZNA 1S3FA 3L1IA 4GYJA 4LIPD 1VKNA 3CBGA 5IC5A 5EJ9A 2QTBA 1BKSB 4NAHA 2DWOA 4JLMA 1E79A 1IBCA 4BVFA 5DI3B 3K8ZA 1C29B 2WDPA 4DDMA 2Q7XA 5ICSA 2O3SA 4P0QB 2IE0A 1TMGE 3QH4A 1U2DA 4IDHA 1SVOA 4HQOA 4HS4A 4JVOA 4WK6A 1D4OA 3GCZA 4CT4B 3CRW1 1R3DA 1FS6A 3SHOA 5CLQA 3SQMA 1H4QA 1SD1A 2NXCA 3U3XA 1CJTC 3BGSA 5DSZA 2RD2A 2C84A 3IVXA 1ZGBA 3IEIA 2PCLA 2QKYA 4DQKA 1RI2A 5EYPB 3E5MA 1VHQA 4I3FA 1WTCA 4MLPA 2KWIA 2ZTUA 4KFRA 4QU5A 4UEKA 4HXEB 2DUMA 1EXNA 5C0OE 3DT6A 3WL6A 4F4CA 2O2IA 1E59A 4MKRA 5HILA 2V6GA 1XV5A 3FCCA 1PLKA 4TLLB 3GFBA 4R69A 4U2KA 1PS8A 3OIWA 1WJGA 2Z4RA 1M1NA 5I5EA 5BNTA 5NULA 2PJZA 5DXFA 3PDCA 3FLMA 4CKEB 4AF7A 2GR9A 4UUOA 2HHCA 2XUAA 3F6EX 1G6Q1 2NU8A 3RLFA 2H4YA 2Q4TA 1I3MA 3NHPA 1IWBB 1X1TA 1P0CA 3VFDA 3VQTA 2EF0A 3NHMA 1T6NA 2R7NA 3HJNA 4DF3A 4ETNA 4JJ7A 3R3HA 3BJMA 2H4HA 2MYTA 5JOQA 3I9V6 4D3XA 1ESEA 2ON6A 2B8WA 2ZYSA 1IOVA 3MD9A 1NUHA 1WP9A 2F4NA 3BZUA 1SXIA 1TLTA 1ZJ5A 3DVLA 3OA2A 2FPPA 1MPTA 1YR1A 2HRCA 4PX9A 1OI3A 1EE9A 2L82A 2SKEA 1ZOIA 5JIBA 2ZJAA 4Q3OA 5AW1A 2C7VA 3KB1A 1BE0A 2BFOA 3IPLA 3OT5A 3W0LB 3KV1A 4E21A 2BN4A 1SXJC 1KU6A 2YQ5A 3MN1A 4MYUA 2REXB 2HDNB 2JLWA 2FJPA 1ZHHA 1XALA 4QGBA 5EUQB 1IATA 3FB4A 2ASVA 4QGSA 4J16A 3G2KA 3AJAA 1RLTA 1I4DD 2DPXA 3ND6A 1B4DA 4U3JB 3WYCA 4A03A 4XOIA 1V7QA 2FZLA 3X1KA 2WD7B 1G9SA 5JPIA 5C7IO 1N1MA 1Y7IA 3GT7A 4EIWA 3F4KA 2IVFA 2D0DA 2QQ5A 5ITVA 3U9LA 4G9BA 3QPBA 2YV1A 1U0SY 4LI3X 2QRQA 4DYDA 3H0CA 8AT1A 2WMDA 5JAZA 4KUHA 4BC0A 5K01A 1Y5NA 4D26A 4ARVA 3BTOA 4WBNA 5AXBA 4EQ6A 4LBVA 1N7GA 4GOND 1TCAA 2FX2A 1E64A 5EMHA 4RZXA 2OPBA 4C2UA 4BNGA 2AV6A 4F9GA 4KFCA 3OP4A 4AP6A 1JFFA 2B83A 1BVRA 1BXKA 4BLUA 4NS4A 1PVVA 1WP4A 3KKMA 4EHLA 1CVLA 2B4RO 3ZDAA 4Q7QA 3OLWA 3ESRA 4YRJA 3PVZA 1VMKA 3OH8A 3OU2A 4CKCA 4EKDA 1U4SA 3RROA 4DCVA 3MUFA 5KSZA 4R98A 4RO0A 2XQJA 1SIUA 4H77A 1JSLA 2VDLB 3QI7A 4EI9A 1WUHS 4NYMR 1B76A 1PV4A 3EBOA 4II7A 1DX4A 3N8KA 3ZJ5A 3I5YA 1HT2E 2JLRA 4C2BA 2ZB3A 3A11A 1UOQA 1TJNA 2RMKA 2AI1A 4OL9A 3WIEA 2H51A 1EFLA 4DHEA 3BUSA 2X0DA 4BLSA 4OAQA 4UDNA 5CAEA 5KYWA 3QI2A 3DQZA 2GD2A 1UEJA 4JEIA 1I14A 2B9VA 3PQ5A 4Z0NA 3QKSB 1F6BA 3ZU2A 3CJTA 2Z8ZA 3HDGA 1VL6A 5HF5A 3Q8KA 4FNGA 5SICE 3ADOA 4E4TA 2OHJA 3L3BA 2CVOA 3GPLA 4R1UA 5LU9A 1JIJA 1Q1EA 2HSDA 2AJDA 4ZPXA 5AM1A 3NVDA 3PPXA 1B3BA 1UOEA 3RS5A 3C97A 1FRQA 2NO5A 3RUAA 3I0MA 2H2HA 3TLEA 1JFRA 2OD9A 4RDIA 3UJ6A 5DBHX 4B3TB 2NU9A 5KNBA 4GI1A 3PG5A 1SKYB 3W77A 5ALJA 1M2GA 2J5QA 3GD5A 3UB3A 5MGNA 1LDYA 3CKLA 2FEPA 4YXWD 1LZLA 5BSHA 3H1FA 3OOSA 4C7KA 4P38A 2HFKA 3ML1A 1RM4A 1T5TA 2R79A 3GJTA 2QGFA 2HCFA 5EL0A 2TMKA 1V8DA 221PA 5EXEA 5FOTA 5ECYA 5JCJD 2CLSA 3E22A 4P5PA 4A26A 3AY7A 1QIIA 5L7WA 1IVSA 3R09A 3SYMA 3TW4A 1XPRA 3U37A 5JUWA 2QJTA 1QCDA 1M1NB 1NP7A 1E20A 3DCYA 3N8IA 1GUDA 4HDOB 4XSHA 1E2KA 4FUQA 2C29D 3H8SA 5TPZD 3RK1A 3RUPA 2NU8B 1KS2A 1BOFA 2A9PA 3GRVA 2BW0A 4A0HA 3QYPA 3AHGA 3SZRA 2GN8A 4NL4H 5EXXA 7ABPA 1D9ZA 1ZAKA 5CBKA 1TKBA 2CFRA 5H80A 2YW2A 1DAOA 4FFMA 1KTVA 4EEKA 4NYMQ 1E7WA 1MB3A 2O8NA 2R6CA 1AZSC 2X5NA 2YZ2A 1U0GA 2ZAGA 4M53A 4UDYX 4YECA 5IFKA 3R9XA 3FPCA 4M1OA 4J0CA 4L3WA 3ESQA 2X0FA 2J9ZB 3I62A 4WI1A 1P75A 2FMIA 3OTWA 4A23A 3J7AC 3O03A 3AYXB 4IOKA 4Y9RA 3T9AA 1SHJA 4LFBB 2G80A 1T36B 4FYMA 4L08A 3N7AA 1S6YA 4UC0A 3L0PA 2G1KA 4EL5A 3SS9X 4C2TA 2H17A 1EP1B 2BSQA 1GG5A 4HWPA 4YQEA 5A7GA 1QQ7A 2P1ZA 2VKQA 2YDXA 2O2EA 3BA1A 4PRZA 5GONB 2XD4A 3CUWA 1IB0A 2ZDQA 4FX2A 2RI1A 4PNEA 5AOVA 5HK9A 1L5QA 3AJDA 2J0VA 3IHTA 4MPPA 3VVLA 1JAHA 1PFUA 2XTMA 2C4HA 3FCYA 3NKLA 4K2AA 5DO9A 2FFRA 4CE6A 5C1DA 3UWPA 2L18A 2OZEA 3L6DA 1UANA 3ESAA 1RC8A 4MOWA 2FN3A 2GF2A 3ZNNA 4OATA 2W2TA 3NPMA 3UOWA 4EQ6B 4ALIA 1Q84A 1BHQ1 1JJBA 2BGUA 1T9KA 2FOLA 2HIHA 1F38A 2ZYWX 3ZWYA 4XDHA 5A9TA 3DHNA 4ND6A 1D2CA 3EXHB 3UBMA 1AB5A 3OEHA 3W5UA 2RB4A 1JFFB 5AXAA 2GT1A 1Y3FE 1L7BA 1X7YB 2FKAA 2CD9A 2RHBA 3O1JC 5E2AA 3KYBA 3GLGB 2NO0A 4DV0B 1K9SA 3BKXA 2PTHA 2ZJ6A 3W6UA 1TJ3A 3ZVRA 3O4HA 1JKJB 4RFVA 2IKQA 3KKPA 4B31A 2XUGA 1UBSB 2ES4A 2QAGB 2WJWA 2J1LA 3MS7A 1OWMA 5F77A 1DRVA 3VSBA 4L8GA 2OFPA 4S2UA 4JJ6A 1ZU5A 3CUKA 2Q0XA 2EZ9A 4I2VA 3WGKA 2HMSA 1TUIA 3K8YA 1SOMA 3W3AD 1R8JA 4XWWA 1DWQA 2BEUA 2BH9A 3M7IA 4HFNA 1A9XA 1PFYA 3L7KA 2YHBA 4Q9DA 1RYZA 2CBXA 2ZJ5A 2QE7D 3ESBA 4ZT6A 2FRDA 2JFGA 2BTQA 4TZKA 5CAEB 4YMVA 3GQVA 4J03A 3G9XA 3OPNA 1N5DA 2FSUA 4ZOBA 3TGWA 3HNPA 3ZDBA 2A33A 1AQJA 4LK2A 3SX2A 1Z8HA 5DW3A 5AHOA 4E2FA 2XITA 2ZSAA 4XARA 3H4TA 4KVZA 3KZ1E 1Y4AE 1HC7A 1JJ7A 5HX7A 2X76A 3OLXA 2VPQA 1KDVA 3CX3A 2XBUA 4ZO8A 1C8VB 3FOCA 1O9HA 1VJDA 4RAOA 3QTBA 1A4XA 4ZVQA 3BE6A 1OFHA 3GBPA 4XVRA 4AZWA 3NEYA 3AMVA 3RK4A 3SXPA 3QKRA 3VHXA 4BP9A 5JW6A 2A1IA 1SXGA 2VHVA 2IE8A 2JRLA 2LRHA 1EGVB 1LCIA 1J7KA 4N5IX 4X6UA 4ZU1X 4E08A 1E2NA 2OB2A 4MPTA 2X1VA 4EO7A 3D81A 5K4GA 1KBOA 2VS1A 4KR9A 1H0KA 2JLYA 2F1RA 1W8DA 1H05A 4J4HA 4DJDC 1VG1A 4UU0A 2AN1A 2BGMA 2VXBA 3KOMA 1K3TA 2PBLA 2Q4EA 4CV1A 2ECFA 4B75A 1R5JA 2EQ5A 3PX7A 2Z2KA 4K6MA 5F1PA 3PKZA 3BTUA 2OAGA 4FYXA 3QY0A 4HBGA 3FSJX 3BIWA 3Q72A 4Z9AA 1TAQA 5AQ1A 4KQHA 1A1VA 4BRUA 2G72A 1T2NA 1U1CA 2C0QA 1IK6A 3BMOA 4N9WA 3HUUA 4WOJA 1YQQA 2P75A 3H19A 3NG1A 2QMQA 3HLKA 4C88A 1AO0A 1F9EA 3FOZA 1GFSA 1ZD4A 2ZULA 5ICGA 3DDCA 4PPQA 5ALIA 2JGIA 4YP5A 1DBWA 1BGXT 1A0OA 1TZ2A 2NTJA 3BGIA 5FWNA 4MVJG 3ZCXA 3O91A 3G3EA 5WRFA 3AW9A 3T6KA 2JJMA 3HADA 3LV8A 4IEEA 1Z0UA 4E5DA 2R47A 2C00A 1X74A 3O7WA 1FXWA 5DIFA 3UK1A 4OH7A 1QONA 4KGXA 1QTNA 1U5CA 3ZD9A 4X6YA 2DAPA 3MW8A 4NG4A 4QD3A 1Y9JA 1YC2A 1XRPA 5I7SA 1NQTA 1KMMA 1GGFA 2IL1A 4WBSA 1WMBA 5B55A 3TOXA 5JWOA 1YGYA 4PYMA 3EIOA 3QEMA 2VSFA 4JGGA 3G8DA 4J3FA 4C30A 4BUJA 2FMTA 4D3SA 5JY6A 3TF5A 3KOYA 3UV6A 1XG5A 2E5FA 2G8NA 3OQBA 4LBZA 1PR5A 1UJCA 4TROA 1RC0A 3WRVA 3R23A 3Q0TA 4IJKA 4TL8A 1PNOA 2CHEA 4AICA 1DIAA 1V11A 1JZQA 4ND4A 3VPSA 1VLVA 4EPRA 4GGOA 5IX8A 1GTRA 2ZGVA 2HQOA 4GXNA 4HDKA 5BSMA 5FXMA 1G8JA 4ZKDA 1WKVA 2BZ0A 3KB6A 1YR9A 4QG7A 3W3ZB 5CXQA 2MMCA 4XQ9A 4OGWA 4FEGA 1PR9A 1C3JA 4DE5A 4UTNA 4RF3A 2PUTA 1B6RA 1LDNA 2KLBA 3OO0A 5FNVA 2JI7A 1T4BA 4TLAA 1J1ZA 1EEXB 3JW8A 4WNIA 5AM3A 2PL9A 3ILYA 2HHJA 1BCRA 1UF9A 1CUJA 3ORSA 4I6EA 1RCUA 1TKAA 1EXVA 2GAAA 3U60B 4TZ0A 3ZI0A 1EWQA 3F6SA 3ZGLA 1I5RA 4R1MA 1CWUA 2H1WA 2Q1WA 1QGZA 1TRHA 3DTTA 4A8JA 1W36C 1ODCA 3ZCPA 2G4CA 2DUNA 1FVXA 1U98A 3V1YA 1KEZA 3AIOA 3DEAA 4YONB 1G5QA 1A9XB 4IM7A 4A4DA 5T5QA 4BUCA 1X1SA 3K72B 4M1ZA 2YJNA 3WV5A 4XM0A 1MHTA 5FRDA 2O3RA 3BULA 3OIUA 1MAHA 2PSSA 3TYXA 3VC2A 5CFQA 5IN4A 3BEDA 4OK3A 4ISCA 3UW1A 5IT4A 5A7FA 3PC3A 2I5PO 3KJIA 4IMJB 4UHJA 2O5EA 5IYZF 2VNAA 4CTJA 2GSWA 4NCXA 5CM9C 1NQ5A 2W6ZA 3L7IA 1QIKA 4KLCA 2ZRIA 3H6HA 5AVUA 1SU6A 2NTEA 1PS0A 2O1SA 5DTQA 2PM8A 4EA6A 3IEMA 1G8AA 2A58A 5IEJA 2WWTA 5JCJA 5TQJA 4UD2A 4ZC8A 3UMJA 4DRYA 1QFYA 2C77A 2Z9BA 3OJFA 4KACA 4YX9A 3N07A 1QU2A 1XDSA 3GI1A 1H6DA 3KLOA 3EH2A 5TGDA 3VHXB 5K45A 1P29A 3RSHA 3ZHTA 2XQIA 1FYEA 2G04A 1QIGA 4REQB 4JBIA 5TPZA 3HKCB 1VPWA 3RVBA 2YKGA 1J5PA 1FRFS 4M1WA 1B6GA 2WI8A 4TLMB 1I1OA 3OQPA 1TU3A 3HP1A 4UJ5A 5K8LA 4UUAA 3GNLA 2XUPA 5JD3A 3JZAA 3KSMA 3PCXA 3JQ7B 3HKDA 2HEIA 2RK4A 3T4PA 1WM1A 4E5SA 4EW1A 2V65A 1N77A 3JQRA 3PI6A 1CB0A 3VNSA 1PBTA 1AGPA 4IMIB 4CQLB 2Z6QA 5KJ1A 1PZHA 4XWGA 3DAGA 3MMXA 2E2WA 4DMKA 4F11A 2ZIVB 3BMOB 1R4MA 4QPJC 1WPGA 1PW7A 1KK0A 2Q4DA 2P9HA 3K4PA 3LUCA 4EMUA 3CN7A 2XMZA 1FPMA 4JEUA 3AVUA 5CB4A 3AW8A 3QBDA 1WUTA 4G1CA 5EG5A 4PG8A 3HP7A 2VH5R 3RRBA 1ZNWA 3RC3A 3WLJA 4CL0A 1Y6JA 4BL5A 2HPVA 4OGFA 3G0BA 4LOAA 1SA0A 3HVKA 4GKBA 4FR0A 5D51S 3O6VA 4ZHQB 2A4KA 4ZCLA 3EWSA 4YMIA 4EY8A 4O2RA 1BXGA 3OP1A 5DCYA 2OGUA 3H18A 1QO0D 3GB9A 3I9JA 4HH4A 4C0KA 1KFBB 1CY4A 2ZS9A 5ICCA 3JAKA 2NAPA 4R41A 4WY5A 3WYNA 2D5IA 2HAEA 2E6UX 2WKWA 3ONDA 4LFCB 3OCWA 4GI7A 1E1QA 2QJOA 3KV3O 1DRUA 3K6JA 3ESCA 1G5HA 3E84A 2JG3A 1JQBA 4MWEA 1KI1A 4H3SA 3R7AA 4CCYB 2FTKE 4CU5A 1DCTA 2FXVA 1H3NA 1X8KA 2HU7A 1OFGA 2GM3A 2ODAA 2P9FA 4EJSB 3JWPA 1X3LA 3FRIA 3GGSA 3LLUA 1Z8FA 1ZK3A 3MMPA 2HQ1A 4GAEA 1G21E 4PHCA 2XCQA 3LKVA 4XUEA 3J80A 3HJFA 2D8AA 2M9MA 4KDFA 1XI2A 1V11B 1SUAA 4WE3A 3P2IA 2PD4A 2C0PA 1MENA 2K7FA 3N3BC 1O94D 3BFPA 1EVLA 1XHFA 4N0EA 4N5DA 1C3VA 3C3MA 3T9CA 3V8BA 3VR5H 1KKLA 4HDKB 1Y63A 3QLVC 4JI8B 1SVSA 4ODIA 4WKBA 4V0SA 5HA5A 2EQBA 2QRKA 4ENVA 2X5XA 2XDQB 3VR3D 3W3AA 3FYUA 3TK1A 2VC2B 4LPKA 3B3AA 1M33A 4YRFA 4CLRB 4B82A 2OORC 4KQCA 2Q7DA 2PX8A 5CURA 1HA3A 3WGZA 2QE7A 3K5HA 1PUJA 1SXPA 1X86B 2GF9A 1Z5PA 2JCYA 1RYYA 2WF6A 3GEGA 4HVAA 4LV6A 3TPCA 3ZHVA 2VRBA 2DHQA 4MW5A 4G5RA 2B1IA 4N3AA 1I1QB 1NN3A 4LYGA 1DBPA 3G2NA 2CFOA 2Q3BA 3KTDA 1LDGA 4F6CA 4LYDA 2A5GA 4A8JB 4EW3A 5C3UA 2Z1MA 1FP1D 1RQNA 1X15A 1XVVA 4IHJF 5FL7D 4NZPA 1NLYA 1Q7EA 3M3DA 1F4LA 1SWWA 1ZISA 1TQHA 2BDEA 3QXSA 3CEMA 2I2XB 5HDBB 4ZTZB 1V4NA 2FW1A 2V45A 3DEZA 3R6WA 1S2OA 2JGRA 4I66A 3VKUA 2F1HA 3CEHA 3I9OA 2RHHA 1E8NA 4IZ6A 3PKJA 2MSCB 1A4IA 3VI4B 1G5PA 4EVIA 2AN4A 4I9UA 3WGGA 4D8XA 4H0NA 3AHIA 4DG8A 1QBGA 3JQAD 4NCIA 2QL6A 3KJQA 4D0LB 4TKVA 1UBJS 1GU0A 3I4FA 3ZLJA 3G0DA 2YXLA 1QHXA 1G2OA 4RHYA 4E6EA 2VYQA 1T35A 4OYLA 4DDKA 3QE9Y 3L7YA 5K3BA 4XJVA 1E89A 5CK5A 1OE0A 1TU4A 1JF8A 1VFNA 2FSHA 2NSLA 1IQUA 1GG9A 2YVAA 3O1IC 1N6KA 4KUEA 4PG7A 4WRRA 4LJ5A 3G68A 5JPCA 4OHWA 4NE9A 4EUSA 3P52A 4L3OA 1IHDA 4EB3A 2BFDA 1P6XA 2VAXA 2IPXA 4UFNA 2GPBA 3F6RA 3IPCA 2H9IA 3WY9A 3SSMA 4S1PA 3BE5A 1E96A 2ZUTA 1JLLB 3DZKA 1W73A 3HKDB 3LFTA 3SCZA 4BB0A 5LQMA 4CM6A 3D2BA 4JH0A 2HDHA 5IJAA 4D5GA 3QVOA 4CTOA 2GTHA 3HRHA 2IWRA 3R75A 3UA3A 4CLDA 2NLOA 4ZZ1A 1DIOB 1U1IA 3LA6A 3EY4A 1I6LA 3VU9A 1NUPA 2GLXA 4NK5A 4XQGA 3RVNA 3U80A 3L0SA 4PYLA 3AY3A 4UBOA 2WAMA 4Q15A 1SCIA 4XDZA 2ADOA 3TZCA 5CB4B 1I2MA 3L6EA 1J8FA 1C0KA 5DF1A 3U7QA 1B6SA 4ZAYA 2DFTA 4RWZA 1LDMA 5ENDA 4B6OA 5DM70 3DAFA 4G1EB 1TCUA 1W1IA 3OQJA 3OMLA 1KI3A 3CR7A 2YHIB 2NO6A 5EJGA 2G7MC 3SDBA 4F3KA 4KXFB 3HCAA 2XYHA 5DSTA 2YJZA 3GJ0A 1QYXA 3E1GA 4ZYYA 1MXHA 2EKPA 1CIJA 3OE7D 3JAKB 4OJQA 3KLBA