3RNLA

Crystal structure of sulfotransferase from alicyclobacillus acidocaldarius
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
298
structure length
247
Chain Sequence
VARPNFFIVGAAKCGTSSLDRYLSQHPDIYIPPKKEAHFFSIPDFPERFTGPGDEGMNLYTIRDEDAYMRLFDGVRGERAVGEASVFYLFYPGTAQRMYDAYPDAKILIMLRNPVDRAFSAYMHLVRDERETLSFRESLAKEEERIRQHYEPLWYYRAVGLYAAQVKRYLDVFGREQVKVILFEEFARDPVQVVRDCCAFLGVSTDFVPDTSMEMEPDLREELTAFFAPDVARLEALIHRDLSAWRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Sulfotransferase from Alicyclobacillus acidocaldarius
rcsb
source organism Alicyclobacillus acidocaldarius subsp. acidocaldarius
molecule tags Transferase
molecule keywords Sulfotransferase
total genus 90
structure length 247
sequence length 298
ec nomenclature
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13469 Sulfotransfer_3 Sulfotransferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3rnlA00
4G01B 4Q1CA 3L0PA 4OHZA 4NONA 1NVWQ 3TGPA 4FINA 1ZNZA 1FTSA 4PC7A 1R2QA 1BH2A 1A4RA 4DLWA 3LV8A 5JJIA 3IBYA 3LH5A 2JDIA 3I4LA 1OH6A 2IBMA 4Z1MD 2REOA 3C41J 3EZ9A 3BH7A 4GP7A 1GILA 1S2MA 2B7BA 1NL3A 4JJKA 1U2RA 5GJBA 1SXJD 1OPXA 1T91A 3ONWA 3I92A 4M22A 1UAAA 1P2SA 1ZD1A 1NKTA 4TMKA 1BS1A 4PHHA 1Z0KA 8OHMA 4B32A 2B8TA 3MSXA 1MV5A 3SU8A 4PR0A 2J7KA 1HTWA 4OQMA 3WRYC 3AV0B 4LJ7A 4DLYA 3B8HA 1NN1A 1M6NA 2CL7X 2WOJA 5FI1B 1WE2A 1GNPA 3A4LA 1H8EA 1TQDA 2DFLA 1FPMA 3GJ3A 4PPQA 2PCJA 4TLCA 4EJSB 4AIIA 5HZKA 3HP1A 3C4JA 2QNRA 3AVVA 3SOPA 3R9IA 3V4RA 3IPYA 4DSNA 2LWIA 2ZYTX 3AVUA 1KO4A 3UPUA 2FFQA 4OQLA 4OI0A 3KJEA 5FUXA 2CK3D 5HPYB 5JMTA 2ANBA 2ZS8A 3VFDA 4YMSA 3KQUA 4AYWA 2QMUA 2F3RA 2FN4A 3ZJYA 4GI7A 4ZCMA 1ZNXA 4TMVA 3THYB 4V0LA 1EFHA 1GWNA 3VR4A 1U0HC 5D3MB 2V1UA 3HYTA 5GVRA 2JAQA 5ELXA 1IY0A 1KNQA 2FZLA 4CEIB 2WJHA 4AD8A 5FBQB 1VHLA 4HAXA 1P62B 2QE7A 1QHSA 1RRFA 2EFCB 2ZRLA 3FVQA 2NIPA 5FPHA 4CIDA 5AJWA 4EPTA 3R8FA 1SVMA 2QT1A 3MCAA 4JLNA 1CJMA 4MUAA 5B57C 2X8AA 4YDHB 3U7GA 2Q6TA 5KNCA 2GAOA 4NCHA 2WMOB 4DRZA 4UNQA 3H84A 4IOKA 4K81B 2VQSA 5ANRB 3OF5A 1M7BA 1TUIA 2VL7A 4IVRA 1NIJA 5H70A 1QZXA 3DMNA 1ZM9A 3AB3A 3D31A 5HZHA 2QAGA 1F5NA 4V0MA 4DZZA 2XOKD 2IW3A 1EFCA 3Q5EA 5C1BA 1U0JA 3HU1A 2JLRA 4NE2A 5E3HA 4QNMA 4B6EA 2N1BA 2VA8A 2WWWA 2XX3A 1MH1A 1G17A 3NBZC 1SVSA 4TL8A 2JEOA 1LW7A 2C9OA 4GSYA 4ACAA 5DIFA 4KXFB 1EFTA 3JVUA 5CLQA 1YZNA 4AG6A 1E1QA 2KBEA 2ZJ5A 3MJHA 5TV2A 1QHXA 5FOSA 1IXZA 1IM2A 3AVQA 2XOKA 1TF5A 4R2HA 2GTPA 2QGNA 4JVSB 1W0JD 4TMWA 4P31A 1JBKA 3NH6A 1G16A 4YDSA 4LV6A 4HAWA 4OHXA 2G1KA 2GK7A 4QGHA 4OHYA 4NCNA 1WF3A 1Z0FA 4FMDF 3K9LA 2ZJAA 3KXIA 1AQUA 4TQUS 3VNVA 1M7GA 1NLYA 3MUFA 2RCNA 4ABYA 4ARZA 4C3ZA 2JIZD 2WKPA 1UDXA 2OHFA 1TF7A 1Z8FA 1ZC4A 5EQTA 3RS4A 3NTUA 1X8LA 4MUBA 3KQHA 4US1R 1VIAA 3VR6A 2ZQ5A 5FL7D 5G40A 2VP6A 1VECA 1DARA 1SXJC 3TRFA 1YR7A 3IKJA 5J4LA 5AJYA 1IN6A 1AKYA 2QTHA 3FKSD 4DCNA 4RJLA 1DADA 1NSTA 4ZCLA 4HUQB 1N3BA 4K8OA 3REGA 2QP3A 2NZJA 3ZVLA 2IYZA 2JATA 4D0NA 3CRRA 3TR5A 4A0HA 1CR0A 2IUTA 4LOAA 1Z6YA 2WWGA 2WPDA 2MSCB 1I4DD 2O8EA 3QY0A 3ICEA 5KNDA 1GRRA 3BERA 1YZLA 4NYMR 3NC1C 3OAAA 5F3WB 3BAFA 2ZITA 1PLJA 4LPKA 4Q4HA 2HT6A 3GLIB 2V54A 1N5LA 4HZIA 4TQ9A 1VCIA 1Q12A 4NMMA 4U00A 4GPTA 1QVRA 1XEXB 2R6FA 5B58C 3KUCA 3AKEA 3FTQA 2C03A 4LJ9A 1NY5A 1XEFA 3KQLA 4L9SA 2VSXA 2OBLA 2I1VB 2ERYA 4KU4A 1NG9A 2RB4A 2BVNA 3AF0A 4ASUD 1Z3IX 2KB0A 1XD2A 4JBXA 2KBFA 2QMOA 1UEJA 2PX3A 2QA5A 4LV5B 3WNBA 4TLDA 1RRGA 3WY9A 3F5FA 3E1SA 2GZHA 2VEDA 5CIQA 2FMXA 3NXSA 1X6VA 4FMBB 3B5JA 3THWA 4Q66C 621PA 3VKHA 1UKEA 2CLSA 1MR3F 3LVQE 3FE2A 4X8OA 3UMFA 4A15A 2X2FA 2G0NA 3MG9A 4V0NA 3TE6A 5GVSA 1UKZA 4HDOB 1DE0A 1P9NA 5KSYA 1VMAA 5JHHB 1XMIA 5CK4A 2YWGA 1YVDA 5TY0A 1FW6A 2RMKA 2Q3FA 2EU8A 3K1JA 5G53C 1YR9A 1FMLA 1RKBA 2V9PA 2V6IA 2F1RA 4A2QA 2DFNA 2ZRCA 3K70D 5AJVB 3CNNA 1JECA 4LC1A 4WBSA 3NG1A 3C16C 3SFVA 3CRVA 3W3ZB 4BFSA 1DAIA 1I2MA 5L3QA 4LYHA 3QF4A 5SZIA 2ZI5A 3A37A 3BOSA 2RAPA 1V5WA 4E03A 5K8UA 5FOUA 5KSZA 2G3YA 4CDGA 1HEIA 5HCIA 3UWOA 3TJZA 1AM4D 3HPRA 1U0LA 5KDLA 2R9VA 4EFLA 1KO1A 2VRWA 1SVLA 4TT3A 1AKEA 4ESVA 2GK6A 3GLGE 4C2UA 4CF7A 3HYRA 3DPUA 2AXNA 2NO7A 4QBFA 4EQ6B 4KYUA 4NCIA 3B6EA 3ZVRA 1GKUB 3IQWA 3KJGA 3GPLA 3W9YA 4ASUA 2O5VA 3IQXA 4D2IA 3SEAA 1BKDR 1CS4C 3A4NA 4AKGA 1GRNA 2IEYA 2OFXA 4U7DA 1E0AA 4A6PA 2GZDA 3KXLA 2H5EA 1NBMD 4FWTA 2V7QD 2IEZA 4U02A 1Q1BA 2W2TA 4B47A 2NG1A 4RD1A 3RWOA 4W5WA 3CUEF 4A82A 5FUVA 2ZU6A 4BZPA 4KLZA 1Z0JA 4PZLA 2WJGA 5DYIA 1NSFA 4B2IA 2CVHA 4RSGA 1OFIA 1GVNB 1N6IA 4HYYA 5K8TA 3U4QA 3BS4A 2ZSAA 3VTKA 3L43A 4DEYA 4TL6A 1NN0A 1IXRC 2FSIA 5CDFA 4XVRA 1F60A 1J7KA 1W47A 1Z29A 1KHTA 3FDIA 2J0VA 4PZZA 1Z28A 1G1MA 3L8ZA 1XB2A 1CLUA 4P3YA 2ZRGA 2A2ZA 1GL6A 2CNWA 2ZEJA 2IF2A 1P2VA 3SJCA 2BWJA 3LO5A 2FPKA 4EQ6A 2WSSA 2YVUA 4JJZA 5KDDA 3O8CA 2J0UB 2CHQA 3FGNA 1K5GA 2XSZA 2A7QA 5FOXA 2XTZA 2XXAB 1XEWY 4Q1BA 3OEEA 4Z8YA 5FL7A 5IK2D 3QKRB 4L4UA 2C78A 1Z6GA 2PLRA 1P9RA 1E0SA 1E96A 3SYKA 4C0SA 3CW2A 2FV8A 5L3QB 3RRYA 2IS1A 2OZEA 4B3BA 5E7MA 2GEVA 4EPYA 1NLFA 1KKLA 3W6NA 1YZTA 3FB4A 4LC0A 3NDPA 3ZH9B 3P26A 5DO9A 1QHHB 2RH5A 2V4ZA 3K70B 3DM5A 2IYSA 1XTRA 2AFHE 4M1KA 4F4JA 4D80A 2JLWA 1Z0AA 4QJ5A 2ZRJA 1EX6A 4DXAA 4QBHA 3WBKA 4JS0A 5JWHA 2OLKA 3CB4A 1KSFX 3Q8XB 1E9SA 2GJAA 1U9IA 3SHWA 3OIVA 1ZP6A 2JLVA 3UKDA 3K8YA 3EASA 1S8FA 3THWB 3M4YA 3DO6A 2YOGA 2HYDA 2JJ1D 5FTJA 3GFOA 4PANA 1Z5ZA 2FWRA 3Q72A 2H7VA 3U3KA 1Y63A 2QORA 1Z6XA 4EPWA 3TVTA 1GSIA 1IY2A 1R8SA 3AF4A 4MRNA 2YYZA 3VR1A 1DAKA 1XD2B 3OIYA 1M74A 3OESA 2JJ2A 3ECCA 1TAGA 1T9HA 1DAMA 3SDZA 2W6JD 1QBKC 3O47A 4TYWA 3H86A 1NMZA 1SVKA 2FPLA 5J4VA 2P5SA 3FMFA 4DLRA 1E4VA 4B33A 4Q48A 2HCJB 2YNMA 4MYHA 1XRJA 3NHBA 2XZPA 2QRNA 2WJYA 3CIOA 1Q3TA 2CDNA 3L8YA 3WHKA 4LJ4A 4BFVA 4E09A 3LX8A 1ONBA 1U8AA 4C0KA 3IIMA 4OQNA 4QGAA 4AURA 3S1AB 4MKFA 1CJUC 5J4HA 2JLXA 2PJRA 2O8EB 2PT5A 1N0VC 3EIEA 2IC5A 3KKPA 3RVBA 4B6FA 4DCUA 3BFXA 1XNJA 2RGGA 2FFHA 2GBLA 5EP3A 2C9YA 2FOLA 4DCSA 4JVLA 1ZJ6A 4HUQA 1KOFA 3QNUA 2BBOA 3W8RA 2CBZA 2ORIA 2V55B 3T15A 4V0KA 3W8NA 1W36B 4WXRA 3AVTA 2GXUA 2DPXA 2IS2A 2H17A 4PXAA 5J4KA 3TUIC 3PVSA 3B2EA 4MQBA 5JRJA 4ON9A 5CYPA 2A5JA 2GILA 2C2HA 1QDEA 4PQFA 3OIUA 5JS7A 2XTNA 3PENA 5A0FA 3K0AA 4JLMA 2IYXA 2JLYA 2IYTA 2ZI6A 4HZUB 1E79D 1EX7A 4DB4A 2ZE8A 3VKWA 2F55A 1UPTA 2WVJA 4ILEA 1JR3E 2O0JA 1XZQA 5EXPA 3WMFA 4BPBA 4URZR 3P1JA 2P3SA 3FKQA 1O3YA 3BBPA 2RGEA 2X1VA 5TB5A 1GP2A 3OHMA 4Q1DA 2ZUBA 2JDID 2PZEA 2VHTA 1P4SA 5FPTA 3UXMA 4TZ6A 3NBFA 4EFMA 3ICQB 4H1UA 1W4CA 1T3LA 3KKMA 4RZUA 2LCFA 2ZRDA 2ONJA 1XXHE 1X86B 2J45A 3CX8A 1N6LA 3U6KA 1KY2A 4OQXA 4TWZA 4XWAA 1FTNA 1IN5A 1GKYA 2WJJA 2FZ4A 1OIVA 2WOOA 4GL2A 3W6PA 1HA3A 4HDCA 3VNUA 3MWYW 5SZJA 1UBCA 2Y8EA 1L2TA 2GJKA 4LJ6A 4QL3A 5HR5A 3FOZA 2B8WA 4I1OA 1VPLA 1HH4A 4LBYA 5E95A 3EZ6A 1P6XA 1YR8A 2CVFA 1KI7A 4LCBA 4B43A 4GZLA 3K0CC 5TVKA 1OV4A 1JPJA 2ZRBA 5FFMA 4QRHA 1E0KA 2CCGA 1FUUA 3ZZTA 1PLLA 2ZJ2A 4ZDIA 4IEIA 4F7WA 1HT2E 2EFGA 3V00A 4M1OA 4XD7A 4JYCA 4URXR 1DTSA 2ZS7A 4CW7A 3QE0A 1DELA 1E0JA 3WBJA 2DCUA 4ZPXA 4QG7A 1G8FA 4IOLA 1G3UA 4CEIA 4FIDA 5D3MA 1YU9A 5FOVA 4BLSA 4BFTA 2XNDA 4DB2A 3ZS9A 1KO7A 3QOFA 5TARA 1COWD 3QG5A 1XXHB 4F93B 1Z6AA 4TN1A 5BN5A 1KNXA 4JLDA 3CZQA 3JZAA 3PUXA 2PMDA 1ZCAA 2PBRA 2ZU0C 4CEJB 4P0TA 2FFBA 3K9HA 4RKFA 3AKYA 1RYHA 4ERNA 2PL3A 3TW8B 4YLGA 1W44A 3ZLJA 2MSEB 4I1UA 1G291 1CEEA 3FHTA 1CTQA 4DLUA 2R2AA 3K70C 4QFMA 2QROA 1P5ZB 1UKYA 4RZ3A 4Q4JA 1ZVQA 1LTQA 2CCKA 1H65A 3BFVA 5C2JB 1Z63A 2P0EA 4DUGA 4BECA 5SZKB 2C9CA 4CEHB 3W5JA 1KDPA 1KI6B 5C46F 3CF0A 4Q9IA 4Q1FA 2CK3A 2O52A 3VHXA 3T34A 1TEXA 4JBWA 4ZI3A 1KI3A 2BMEA 4NYJR 4WIAA 2RGCA 3I73A 3OFNA 4HB4A 5JI3E 5JEEA 4D0GA 4L16A 4W5HA 1BO6A 5KPDA 1NG1A 4XVUA 2ZUCA 3BD9A 1VCMA 1SHZA 2A9KA 1Z07A 1MO4A 2OV2A 2W2VA 221PA 1OT3A 4MYCA 1OKKA 4Z51A 1CF4A 4IOJA 3CH5A 2YJTD 3GJ0A 2GNOA 4M1TA 3DL0A 1LY1A 2EFDB 2G77B 2JCSA 2QQ0A 4D4JA 1W2HA 3QKUA 1MT0A 1C1YA 4AYTA 4D4LA 4HLUA 5LDDC 1GNQA 1II8A 1OIXA 2HDNB 2OAQ1 3TAUA 3U61B 5AWFC 1S9HA 2YZ2A 3DHWC 4RVCA 1N0WA 5BYJA 4C0QC 5F9FA 1Q44A 4IOMA 3NDBB 1SKYB 4MRSA 3K0FB 3JZMA 1KK3A 3W3AA 3QSYA 2PZGA 2QUZA 4FD2A 1GNRA 3QXSA 4Q00A 1KO8A 4Q4AA 4GOXA 5BN4A 3KJHA 2WWIA 2HJVA 4BLOA 2W6IA 3MLEA 2O8DA 5JECA 3CR7A 3EZ7A 4GOKA 4MH0R 4Q5IA 3SZRA 2RGDA 2VP2A 4B75A 2J5XA 2FE4A 1X8JA 1JQLB 4TYQA 1RJ9A 4IVPA 3KDSE 2C5LA 1VIYA 2FNAA 3BWDD 3GEEA 3P32A 2WV9A 2BEJA 1G7SA 2PMKA 3X1XA 1RZ3A 1Q57A 1KY3A 3EW9A 3TKLA 3A36A 2G6BA 2ZJYA 4JSYA 1KDRA 3FYHA 3THXA 2ZI9A 4FCVA 3MWKA 2Z43A 1N5KA 1RRCA 1D9ZA 1WP9A 3HWSA 2JGNA 1ZM4A 1OXTA 1T5IA 1PZNA 2VP0A 3OE7D 4LYAA 5EP4A 2H57A 5EE1A 1E2GA 2G9NA 5J5CA 4LJ5A 1ZM3A 3CNLA 5J40A 4DSTA 1E2MA 1QG2A 1PUJA 2PEZA 1OSNA 4HAVA 3UG7A 4KSBA 3TBKA 3BORA 4HDQB 2O8FA 1ZIPA 3IHWA 2OE2A 3O8BA 4BLTA 2F3TA 1XFAA 2X2EA 3LQQA 4AK9A 2O0KA 4WVFA 3U60B 1KAGA 1OXSC 4LY6A 1OHHA 3SBEA 4F92B 1P61B 2OLJA 2GF0A 5IT5A 3FMIA 4DDUA 4US2R 1Z0IA 1CU1A 4TTQA 3RABA 4JLKA 5JZVA 4Q7LA 2BBWA 2O8CA 1CR4A 2H1LA 1FX0A 2ZJZA 2HF8A 4YMWA 1JR3A 4B74A 4FWIB 3CX6A 2PLFA 2D2FA 3CR8A 5JSZB 1SGWA 4GRAA 1OE0A 2GCOA 3F3YA 3OZXA 3CRQA 3T12A 4I1VA 2REXB 2OEPA 1G6OA 3VMFA 1AGRA 2WMNB 4B35A 4JLVA 1GRQA 4Q47A 2Z5FA 1YRBA 4IXNA 4LHXA 3U7FB 1EWRA 5TDHA 1J70A 5IRCD 4RCYA 1E4YA 1SVIA 5KDOA 5GADl 2P6RA 3IO5A 4LV8B 3C5CA 2J46A 5DN6A 4GNKA 2ORWA 3AP1A 1Z22A 2QZ4A 2J3EA 3PFIA 1IN4A 4HB3A 2VTKA 3VU9A 3AVYA 1ZMXA 2VF8A 3KTAB 3ASYA 1KYIA 2FF7A 2IS6A 3SE0A 2UKDA 1FMJA 1W1WA 3C15C 1OF1A 2WTUA 1JR6A 1YQTA 3ZYCA 5FBLB 3NHAA 4R7ZA 2R6AA 3CONA 2EYQA 3CZPA 4IW3B 4B3GA 2F1HA 1E2HA 2ORVA 1XU4A 1NVXQ 2ZANA 4QJ3A 1XX6A 3N2EA 4FN5A 5KU1A 5EZ6B 2IUSA 2W58A 1RYFA 4OYHA 4E22A 1WQ1R 1OKKD 3CRMA 4DUGD 4KFUA 2CXXA 1NN3A 3T1QA 3SYLA 1CXZA 4BRWA 4OQFA 2VIIA 4GZMA 2CEAA 2WWXA 3RRMA 1AS3A 3A8TA 4DLVA 2QTVB 1EGAA 1S0UA 1RFLA 4C7OB 1KZGB 2CL6X 3B9QA 4L8GA 1HYQA 2FSFA 4Q21A 1JEEA 4BLRA 2VP9A 1EFUA 2Z4RA 1M34E 2PX0A 1G18A 3QUSA 2FSGA 4GOJA 5EE3A 5GJCA 2LKDA 2X19A 1XDBA 4D4KA 4TL7A 1DVRA 2K5UA 1S3SA 4UJ5A 5KNBA 3CWQA 3GLHB 4ZDKA 2W6JA 2ANCA 2Q0HA 2R6CA 4Q7KA 5E7JA 1DAGA 1DPFA 3B1WA 2EVWX 2QU8A 2PH1A 2BIFA 2NTYC 5J47A 5BYKA 1G19A 1N0UA 4WZ6A 1MRNA 4DSUA 1E2LA 2ZVPX 4MYTA 4P4SA 1CJVC 3GP8A 1P2TA 1EESA 1N6HA 4JIMA 4QOSA 3RS5A 4I99A 2OM2A 1SZPA 2ZRHA 3PUVA 4PX9A 2G0TA 1F2TB 1KSHA 4A4DA 2CCJA 3AVWA 4WXPA 3QQ5A 3QPWA 2CJWB 1G3IA 4XTRA 4POAA 4KBFA 2IS4A 2O8BB 2GHIA 2ZRAA 1TPZA 2XB2A 1HE8B 4YMTA 1IY1A 3T5GA 2NPIA 4DSOA 2RGNA 1K8RA 2HYIC 4PAQA 3RRNA 2QP4A 3LD9A 1Z83A 2OAP1 3OEHD 4DEXA 3QEJA 1MABB 2RHMA 4TT3D 2YWHA 4EFNA 1YR6A 1CJTC 2MSDB 5TXGA 3MAAC 1MOZA 4LPSA 2P2LA 1L4YA 1W4BA 2ZI3A 5GJWC 3TNFA 2GJ9A 4LHWA 5IF9A 2BOVA 4C4PA 4CT4B 5G3YA 1S96A 2P6UA 2W83A 3K9NA 3Q5DA 4JYBA 4AKIA 2D4HA 1AQYA 2IXEA 2UZ3A 2IXGA 4Y0AA 1TX4B 2CMKA 2F6RA 2FJUA 3EXAA 1XPOA 2ONKA 3QXCA 4FCTA 4IJMA 3QIAA 3OEED 4E5UA 4KHZA 2A5GA 2BV3A 3MFYA 4QGFA 1W46A 2IYUA 3AVPA 3WYFA 1QHIA 4LGMA 4PO1A 3X1YA 1G3QA 2ATVA 2SHKA 2WAYA 2ZROA 1NMXA 2QBYA 2BMJA 3G5UA 4IDOA 2ZYWX 4URUR 1AZTA 2WWFA 3IBGA 4TTRA 2ZRMA 1Q3HA 3HJNA 1H8HA 3QI2A 2P6NA 3I8SA 1D8TA 4CRWB 1BIFA 4LJYA 5HE9A 2C98A 1M7HA 4ZO4A 4LHZA 4PO9A 3GJ7A 1G64A 1XJ0A 2JJ2D 3IUYA 5JCZA 1GDDA 2QRZA 1QF9A 5CITA 2XGJA 4LI0A 3I61A 2DY1A 3U7EB 1CR1A 4JMPA 3R9WA 3ADBA 4DCTA 4DDWA 121PA 4PAMA 2GETA 2OG2A 1VG0B 1DO2A 3RRZA 1PV4A 1L8QA 5FBVB 1G41A 2AD5A 3M1IA 3UK6A 1B23P 2XEXA 4OK3A 4FMDB 3V9PA 4A8JB 4MYUA 2IWRA 2NO9A 4QNRA 4BWYA 2RKOA 2IYQA 5G3ZA 1JEDA 1U90A 4D25A 1G6HA 4TLBA 4TQAA 1M1YE 2Z4SA 4JVMA 1DAFA 1FP6A 4FI3C 1UBFA 2YOFA 4W7SA 3B1YA 1D6JA 2BBTA 4ZIRA 1I2DA 1E99A 1XWIA 3EA0A 3U44B 3GLFA 1US8B 2A78A 4LSGA 1W49A 4O0MA 2P5TB 4M9XA 1UBEA 3MJRA 2OILA 4LYJA 2QPAA 4B3XA 5DYGA 1ZM7A 2YKGA 1T6NA 1JAIA 1YE8A 1YHNA 2R62A 1YKSA 2BEKA 2NGRA 1OLOA 1T4GA 1HY3A 1NMYA 1KI1A 2DFTA 3KKOA 3L0SA 1KK2A 3UANA 1OB2A 2OBMA 4DLTA 4B2PA 1ESMA 5FOWA 3ADDA 3R7WB 4JT2A 1MO6A 4MRPA 4P33A 2CE7A 4YXWA 1E2PA 3EWSA 2GF9A 3SN6A 4D82A 2J0SA 3LRPA 2GCPA 2G88A 4ACBA 3IIJA 4YQFA 1IOZA 3L2OB 4LBWA 1KO5A 1TTTA 2WSSD 1I4TD 3O8DA 2WPDD 3LQRA 3RAPR 721PA 1VYTA 2ZRFA 2GA8A 1EWQA 4TMXA 1FNNA 3SJZA 1JJVA 2OBNA 5HCNA 4O2LA 2NO0A 1G8GA 3T5DA 3VHLB 1W5SA 2J87A 4MDEA 1E1RD 4EPRA 5M04A 4O25A 5JHGB 3WYAA 1D2EA 4NTZA 1ZU4A 1TU3A 1I4LD 3VR5A 4B3FX 4EDHA 4A8JC 1NVUQ 1R4AA 3QVVA 4OJKA 5HE8A 3I5YA 4R2IA 4PSVA 3K9GA 3LVRE 3DMDA 4PQRA 2GWHA 4M1WA 2HEIA 4MGYR 3SFZA 3P4XA 3BGWA 1Z6TA 4HLDA 4NDZA 4RD4A 2FSHA 4ZCIA 2JJ8A 4E07A 1NF3A 4Q03A 1CRPA 3SI7A 4ITRC 3FMPB 3ZIAA 4DVGA 1Q22A 3OAAD 1ZU5A 2AR7A 2V6JA 3BB4A 4EJSC 3DVLA 2W2XA 4HB2A 4BE7B 4R9UC 2NZ8A 1XJCA 1S1MA 1ZNYA 4FCWA 2QM7A 2XZOA 5LD2C 4DLSA 4BFYA 1LV7A 4IDNA 1RC8A 4X8MA 3HU2A 2BHRA 1XP8A 1E98A 3LLMA 4M1SA 2R6DA 3NEJA 3LXXA 4UNRA 4EIWA 4A2WA 3AGQA 4AWXA 1KKMA 1E6CA 1IJEA 4X8HA 3UATA 2ZETA 4HLCA 4B34A 2ZS9A 1JQJC 1LB1B 4S35A 4IRUB 2ZUDA 4X8LA 2ECKA 1TL7C 2UVQA 2WKRA 3GJ5A 2QG6A 2ZE6A 3KXKA 3A4MA 2AK3A 1GKIA 3DZDA 2ZPTX 2GXQA 2BJWA 2QPTA 5AUOB 2ZYUX 4KFSA 3T61A 1G3MA 2GVZC 3U44A 2I3BA 2EQBA 3EG5A 4QC2A 4KCGA 4OJQA 1A2BA 4ZIRB 1GTVA 4UXJA 1A82A 1P75A 1Q1EA 3KZ1E 5DSZA 3TAHA 1A5TA 4PPGA 3LW8A 3JVVA 1TQ4A 3A1SA 1P72A 1LF5A 4JL8A 4LBZA 2ZYVX 5H1YA 2BMDA 4WA7A 2IX3A 1R5BA 3BH6A 4N0DA 4KJZA 1YZUA 4HAUA 4DT1A 3FKSA 2ZRNA 4ZDWA 3PV0A 4NYIR 3A1UA 1COWA 4HLUC 2FU5C 1S4QA 5DHAA 4ZI2A 1FP7A 2N42A 4DJTA 3K09A 4PC1A 1C9KA 4JZKA 5CM9C 4K46A 4Z8XA 3PEUA 5C4GB 3KKNA 1R6BX 1R7RA 2FFAA 4PFSA 3AKCA 1QG4A 1R0WA 2BKEA 4G5SA 5DE3A 1ZINA 2HLDA 3Q3JB 1ELOA 4OHWA 1HUQA 2FGKA 4LBVA 4KVAA 1WA5A 3QG1A 1LVGA 2OCPA 1S1CA 1G5RA 2D7CA 1S9DA 4M2LA 4NH0A 4CVNA 4RD3A 4KSCA 4RKEA 2QBYB 3W34A 1UBGA 1R8QA 3OEHA 1E9DA 4A0FA 4PC3A 1G4AE 2BJVA 3CPJB 4N0EA 4Q1EA 1G8YA 2KWIA 4N1AA 5DI3A 3U3RA 2UZIR 2HUPA 4F4CA 1EXMA 5CLLA 4MGKR 1KI9A 2X77A 3H4MA 5FTNA 2GESA 2F43B 3K09C 2J7PA 3IHLA 1ZYUA 1NBME 4TTPA 3TW4A 2ZSFA 5EE0A 5LPNA 3U2QA 5CM8B 1XTKA 3TQCA 3WMGA 5BWMA 2PCLA 3AKDA 3UMSA 1KDOA 2JLQA 1IQPA 3EX7C 3I72A 4OHVA 1MABA 1OW3B 4RCZA 3TUZC 2GJ8A 3L82B 1CR2A 1A1VA 1UDWA 1ZUIA 1NY6A 3X1WA 4WAUA 1N25A 1E2DA 3CPEA 3PR1A 4JT4A 4BLQA 3PG5A 1WMSA 2ZRKA 5KHOC 3QKSA 4I81A 3SC3A 5B30A 2J7PD 2JA1A 2Q9CA 4IDPA 1R0YA 1RIFA 3AP2A 3KJIA 3NVAA 2FA9A 1ZW6A 4YMVA 2O8BA 4NYMQ 2CJWA 2WM9B 4NBSA 1ZNWA 1Z2AA 3GJ8A 5HTKA 4PC2A 3TH5A 1F2TA 2XNSA 1L4UA 3GEIA 3BB3A 3HU3A 1TEVA 2GZAA 4H1VA 4RFSB 4W5JA 1FOEB 4URYR 1HURA 5HKKA 4IEEA 4YXWD 3IO3A 5EUMA 1Z08A 1LS6A 3CF6R 4D4MA 2XZLA 1QVAA 2QL6A 4WZBE 3R8CA 5DLQC 2GVDC 4Q9KA 4HB0A 2VLIA 5JFGA 5CJ2A 2XTMA 1ZC3A 3W6OA 2E87A 4IDHA 1VKJA 1JJ7A 1ZUHA 4O3MA 2ZE7A 1Q1QA 3B7GA 3TSWA 1KMHB 1QHGA 2IUUA 1E9EA 2IA5A 2V1XA 4QXAA 1AIPA 1G9XA 3OIWA 4US0R 3FFAA 3VKGA 3SYNA 2ZR7A 3BE4A 5LB2A 1BYUA 1XTSA 3WP1B 3A1VA 5EUQB 1IHUA 3EZFA 5AJXA 4HUTA 1VG8A 3TK1A 5AUNB 5JS8A 2VO1A 5KOYA 5KO2A 3P20A 1EFRD 4JLBA 4KFRA 2WJIA 2ZRPA 1U81A 2A5DA 2O0HA 3DZ8A 3ZZUA 3BJIC 1R5NA 1XPRA 3GLGA 1N6OA 3T1OA 3C8UA 3KTAA 3Q9LA 4Q1AA 3AQ4A 3FHOA 1CBUA 3VU9B 4AYXA 4ZKDA 1AS0A 3B82A 3T1TA 1XCGB 5L3SA 1OXUA 2FPMA 2G83A 4FMCF 4D0LB 2OXRA 2FH5B 1LFDB 4A2PA 2IF0A 1N6KA 1XMVA 1F6BA 1E1QD 3NBXX 4V03A 3CKLA 3I5XA 2F9LA 1F2UB 5IDVA 1SXJB 4PPFA 2IWHA 2V7QA 5CJPA 4G5OA 5EZ5A 2BM1A 1GL7A 3T06B 1EG7A 2P67A 2OXCA 5JSZA 1Z2CA 2AWNA 1XCPA 3HDTA 2AFIE 2D06A 4L15A 3D3QA 3VR2A 4ZV4A 3WNCA 2P65A 1DS6A 1E94E 1T0JB 2BC9A 2VP5A 3AF1A 1G7RA 1FX0B 3LBNA 5GJVC 1GM5A 5LBIA 5EE9A 3FPAA 1X1SA 3R20A 2IYWA 2QI9C 3SS8A 3UIEA 2QAJA 3VAAA 4Q9HA 4D6PA 1E9RA 1CKEA 4JBYA 1IN7A 4QHSA 4C0HA 4Q9LA 4MKHA 5DH9A 3LBHA 4LHYA 2XJ9A 5A4JA 4M9ZA 3CRW1 1PUIA 3EWAA 1GG2A 2QE7D 3QVUA 4XWOA 2AHOA 2ZAMA 4TL9A 1SULA 2WIBA 4A1FA 1ETUA 5B64A 1F3OA 3QBVA 4M9SA 5JCPA 1TU4A 1VCOA 1UFQA 2YC4C 1Q20A 4M21A 4TMZA 5AR1A 1SXJE 4TZ0A 2YWEA 1GOTA 1E9AA 3LLUA 3WP0A 1ODFA 3KQKA 2R6GA 3THXB 1ZCBA 5KSOA 2Z83A 5FPYA 5FR1A 3QKTA 4G5QA 1SVWA 2JLSA 1VYVA 3MWJA 5EXSA 3RSLA 1OXVA 1Z0DA 1KMQA 5DGXA 2EFHB 1JI0A 1FQKA 4HSEA 5FTKA 1RJ9B 3ADKA 3QBTA 4CT5A 5KPJA 1E2JA 1FL9A 2KI5A 3PIRA 4EKDA 4KFTA 2NQ2C 2O8DB 2YC2C 4B76A 1WDTA 2BCJQ 4FXPA 1G5TA 421PA 5H68A 3TUJC 1AGPA 1LF0A 4DLZA 4C0JA 1MO5A 1YZGA 4OL0A 4Y0VA 2CHVA 5FPSA 1AA9A 2H16A 2BKUA 2R44A 1OH7A 3L0OA 3ZDQA 3GQBA 4CGZA 1KK1A 1IN8A 1T8TA 1SXJA 1T3SA 1F2UA 2IYRA 2JIZA 1R10A 4A9AA 3B13B 1OFHA 1H8HD 2W0MA 4AKHA 1U94A 5DHFA 2DB3A 2R65A 1CP2A 1II8B 1GITA 1S3GA 2WBLC 2VSFA 4HAYA 5L3SB 1NKSA 1KI2A 2A3RA 2I1QA 2ZIAA 1LNZA 3ZIAD 3GLGB 4BLPA 4L9WA 2EWVA 2Z0MA 2GBLC 1CRQA 1L7VC 3E70C 4PAOA 2ZJBA 2V8OA 3B60A 1XD8A 4QHYA 1NN5A 4P32A 1OFUX 1XD9A 4HEJA 2R8RA 1AN0A 2YV5A 3IPXA 3RSOA 3FWYA 4U5XA 4LRWA 3DOEA 4HATA 4BZXA 4AKEA 3AM1A 1FQJA 1IJFA 1VCNA 3B1VA 3GLIE 1U8ZA 3LAWA 4DDVA 3CO5A 2NOAA 3ZZ0A 2GDJA 3SNHA 1E2KA 1JXMA 1XCMA 2ODEA 1HQCA 1KAOA 1KI6A 1KMHA 3C14C 4IFEA 4RD6A 4UJ3A 2DBYA 2MMCA 1AJEA 4CEHA 1M8PA 1UM8A 1OYWA 2Q3HA 2F9MA 4ZDJA 5F9HA 1DG3A 4NHOA 4QBGB 3W90A 3D8BA 1IAQA 5AJZA 4JLAA 2WAXA 1DG1G 4DIEA 4Q4JB 5E7IA 1EFRA 1Z47A 2Q3MA 1P73A 3CPHA 2VF7A 4BFXA 4RFSA 3PXGA 3NEYA 5JI2E 1H8ED 3EA5A 1KI4A 1U99A 2B7CA 4CEJA 2IHYA 3Q7PA 4NU0A 2D7DA 3ZVNA 3B9PA 3IEVA 1SKQA 1NIPA 1KTVA 1N6PA 4BGDA 1XXHA 4NPHA 1G20E 5EXTA 3TMKA 3KX2A 1W4RA 3PEYA 4HI0E 4QGGA 4TLAA 2J1LA 1OXXK 4JL5A 1U98A 3NWJA 2OCBA 1XPUA 3QKSB 2VPPA 4B73A 4G3XA 3PUZA 3RNLA 3KFXA 1OYYA 4D26A 2ODBA 2OCYC 4FW9A 3CNOA 2B92A 2JASA 3RYTC 1ZRHA 3AH8A 4TLEA 4Z1MA 4JL6A 2EFEB 5HKKD 1J90A 1X3SA 2OESA 3GJXC 2Z6VA 3AGPA 1T8UA 2BMFA 3EPHA 4OBEA 3K0CA 2F7SA 2C77A 3BFKA 2OFWA 3ASZA 2RGXA 3MMPA 3QXJA 2FX3A 5DISB 4C0AC 5FH9A 1R0XA 4UNPA 3TQFA 1VHTA 4PHTA 4A92A 4XWKA 4JLJA 4MITA 4Q9JA 1P9WA 1ZUNB 3X1DA 2AN9A 2F43A 2RGNC 3EIHA 3GMTA 3IGFA 4F91B 5E4FA 2AL7A 2L0XA 3ZVMA 4B3DA 3A1WA 4MDFA 5DI3B 1E79A 4MKGA 5L8VA 4O2RA 3TR0A 1JR3D 1JPNA 2D74A 2OT3B 4C2TA 4Q18A 3ZGXA 1HQYE 5FTMA 4R71A 1YJ5A 3SHFA 2RGAA 1NP6A 1G3RA 4KI0A 1FFHA 2ZAOA 3SQWA 3VR3A 4C30A 4PO8A 4LYFA 3H0KA 4V02A 1PJRA 2E9SA 2MMGA 2J0QA 1BYIA 1ZM2A 3MWLA 3U7HB 2OSBA 4Q4LA 3EARA 3OFND 1SHKA 4RD0A 4S2EA 4BUJA 2PT7A 1XBTA 2ZTSA 4XTCS 4UQOA 2NMVA 5TMPA 4DKXA 1ESNA 1WXQA 4G1UC 4GDFA 4M53A 4QKQA 4W9MC 4HZUA 2B6HA 5EJEA 1KJWA 5AUQA 5BN3A 1Q0UA 4JSTA 3K0AB 2HCBA 4I1SA 3MRSA 4PPNA 1XTQA 4DT1B 1VDZA 4IDQA 2XITA 4FMCB 3O8RA 3LXRA 1YZKA 1E32A 1G21E 3B78A 4JKIA 1R0ZA 4NL4H 4OK5A 3ZQ6A 1QHYA 4PTLA 3H2YA 1W2GA 4B44A 3ND9A 1E2QA 1KZ7B 5JWRA 4EPXA 3EPLA 4LWZA 2A5FA 3ZQJA 3X2SA 2VHCA 5DN6D 4LK2A 2BBSA 1G5PA 5G41A 1M2OB 3V4FA 2KSQA 3ETLA 3I32A 2ZRIA 2DFKB 2ODNA 4IKEA 3IDQA 1ZD8A 3E2IA 2OCAA 1AK2A 1E1RA 4C0BA 3ND8A 2HF9A 4DDTA 3BH0A 4D81A 2DR3A 3S1AA 1WBDA 2D3WA 1XTIA 2GXSA 1UADA 1T5LA 3KB1A 4XVQA 3D6TB 1WCV1 1O87A 3N5CA 1OH5A 3AEZA 3A58B 5B2ZA 2BCGY 1Q1ZA 4P4TA 5JBQA 1LS1A 4Q7MB 4KO8A 4G0NA 4DBLC 1TQ6A 3VX4A 2GXAA 1AS2A 4NCJA 1HV8A 3LNCA 4B71A 1VYUA 2CLCX 2DYKA 2Q21A 1VG1A 2D62A 1W36C 3AUYA 2EWWA 2QY9A 2W0SA 3PQCA 4TYPA 1CJKC 3ZS8A 3KKQA 2XNDD 2CL0X 4M8NE 3VX3A 3KQNA 2QPOA 3PEVA 4KODA 1GFIA 3EPKA 4NYJQ 1OHHD 2JLZA 3CM0A 1IONA 3BB1A 4LZZA 1II0A 4KAXA 4OI1A 1RPZA 4I4LA 3NC0C 2Q9BA 4EUNA 3I62A 1W7AA 1BMFA 1JALA 2VYFA 1E9CA 3X1ZA 3EZ2A 3ZD6A 3T35A 1PVOA 4PSKA 4TYNA 1FUKA 4II7A 2G1JA 2WKQA 2WJVA 1V43A 3NIBA 1E2NA 2AKAB 3AUXA 4M1YA 1TF2A 4PZYA 3GLFE 4KV9A 1KSGA 1XTJA 1Y3AA 3LY5A 1GL9B 1J8MF 4NP6A 1QHHA 2RGBA 4KVGA 3RHFA 1A2KC 2NPFA 2CHGA 1E2FA 2QENA 4XSGA 1G8PA 3LX5A 1W4AA 3MD0A 1D2NA 3DKPA 2C8VA 3GEHA 2CNWD 2ZM5A 5F98A 5FUWA 4TSFA 2QEQA 1N6RA 1WBBA 3M6AA 5JRZA 1XZPA 2KE5A 5EE5B 2GEUA 3LW7A 3NKVA 1FZQA 4GMXA 1FNMA 4UKDA 3SJBA 4ESHA 3WRXC 1OH8A 3RS3A 2W6ID 1JNYA 2OO7A 3QPVA 4J0QA 3U3OA 2C99A 4Z54A 2ZE5A 2QSZA 3QKRA 4XJXA 3QEOA 1NVVR 3R7WA 2VHUA 2JLUA 3PUYA 1KJYA 3CH4B 3VQTA 1E9FA 2F1IA 5FBRB 5JLJA 2XXAA 2PJZA 4IVQA 2VHQA 1NVVQ 2J0UA 4EAQA 3RS7A 3U6BA 4P4UA 4WOPA 1D9XA 4M4SA 4MA4A 2ZJ8A 1NJFA 4URWR 3E5HA 3UWKA 3BIFA 1IBRA 4C0LA 2QN6A 5LB4A 2HJGA 1US8A 3PJRA 1TQ2A 3UG6A 3GLFB 4RY2A 4PHGA 3CLVA 5EP1A 3IEUA 2ZSEA 3ADCA 5BW8A 4H9GA 1U9IC 2VHJA 3BRWD 3REFA 3TVDA 3U4QB 1VG9B 2AD1A 1KDTA 3C5HA 4G5GA 5F2EA 1T3HA 1XMJA 3U3JA 5A5GA 2RHDA 1BMFD 1DEKA 1NJGA 1E69A 3AF2A 4NYIQ 3SR0A 3J81k 2PEYA 5EP2A 2ASEA 2XAUA 2VP4A 1C4OA 3Q7QA 3WNDA 4YONB 3T1VA 5CYOA 4DLXA 4A8JA 1OIWA 5L3VA 1SQ5A 2GKSA 1YRAA 2WSMA 2ZI4A 2AWOA 3EIQA 2ODWA 2Q9AA 4OKSA 5FUYA 4TYYA 2ATXA 3DM9B 3AP3A 2YHSA 3FFBA 5FI0B 1UJ2A 2WWHA 1NLZA 3I8XA 1ANKA 1G8HA 4JVNA 5JJKA 2PZFA 3K53A 4QHTA 2QT0A 2QQEA 5JWOA 5D3QA 2IL1A 1X1RA 1MRSA 2ZXUA 2XJ4A 1NI3A 4EPVA 1W48A 1N6NA 3K0EA 1P2UA 4UNNA 1Q21A 2WWYA 3B1XA 4PHFA 3WYGA 1II9A 4BEJA 3K0SA 3RS2A 2WZQA 2ZR9A 1KGDA 2A5YB 1X8KA 3N2IA 2B21A 3QJYA 1N5IA 3QF4B 5SZHB 4OK6A 3EC1A 2DWOA 2V3CC 4JLPA 2KJQA 4MKIA 4MRVA 3SQXA 2AK2A 3QXHA 2HV8A 3DOFA 4XSHA 5DI9A 5FL3A 1GIAA 3CBQA 4JLOA 4OI2A 3I1FA 4DCVA 2FGJA 3DKVA 4MGIR 1G7CA 2E1RA 2AKYA 3RC8A 2I4IA 4WZAE 1RW4A 5UKDA 4TSFD 5CB8A 4BRUA 5FTLA 4YC7A 2EYUA 4IXMA 1PLKA 2FEOA 1DBSA 3CX7A 1G7TA 3UMRA 3AVXA 3W5IA 1OFTA 3WHLA 3AF3A 1SVOA 3LWNA 1OB5A 4M0LA 4IFBA 3P4YA 2NO6A 2ZSDA 4BFUA 1RRPA 1QHNA 3PITA 3HPQA 3OE7A 4QM7A 4ZKEA 2CLDX 3HR7A 4RD2A 2FDCA 1JB1A 2DWQA 3LFUA 3M0EA 5C18A 1XMSA 1G4UR 2WICA 3HR8A 1F48A 3RS0A 5CDFE 2XB4A 2XSZD 1DAHA 4AG5A 1KJZA 5LD2B 1D5CA 1W0KA 2D2EA 4WW0A 1TMKA 1IXSB 1UF9A 3WMEA 2J41A 1CIPA 1UKVY 1YZQA 4KBGA 4B2LA 3RDPA 4BFZA 3QXXA 1MO3A 3R9XA 2C96A 4LHVA 2LKCA 3D7MA 3EC2A 5KSPA 4P4SB 1DAEA 1P60A 4UXIA 5CK5A 2OFOA 4G5RA 2WIAA 5JEDA 2IT1A 1XEXA 1ZBDA 2AX4A 2DHRA 4M1MA 4KLNA 4Q19A 1TADA 5L3RA 3G0HA 2IYYA 3G82C 3GCGA 3RLFA 4R98A 3GLIA 3GLHA 4Q4HB 3QF7A 2OUKA 5P21A 1GZSA 2DWPA 2F1JA 4URVR 2JJ1A 4MGZR 1TUEA 2CE2X 3KUDA 4IHQA 2AXPA 5H8WA 2H92A 5AUPB 1HT1E 4UXHA 4B48A 4C7OA 1J2JA 3N70A 3BC1A 2HXSA 3DEFA 3B1ZA 2FG5A 3IILA 4N3NA 3SBDA 4F4IA 3C7KA 2NO1A 4C9BA 1TNDA 1GUAA 1Z06A 3PCRB 4NZYA 5C4MA 3RANA 4A36A 1BOFA 4GBMA 3B85A 3CWZA 3F0TA 821PA 2IYLD 2BDTA 1P3JA 2A30A 4V0ME 4PSAA 2QTFA 4PC6A 4PQYA 3GLHE 3LA6A 4QJ4A 1W36D 4CZ2A 3AVOA 3NH9A 4XH9B 3BK7A 3GJ4A 1J8YF 4A0GA 3P27A 1W0KD 4ARZB 3H1TA 521PA 1XJQA 4CYMA 4A0RA 4LJAA 4DC9A 2YOHA 1N5JA 2IXFA 3RWMB 5J4YA 1RE0A 3BXZA 5IK2A 2BM0A 5IHPA 1HE1C 1XF9A 2GEDA 5KTYA 4AI6A 3TSOA 1N2CE 3FHCB 4XOIA 4RZXA 3SJAA 5KYKA 1EK0A 2GCNA 2GCOB 5BXQC 2QMEA 3WXMA 2GRJA 3F8TA 3GJ6A 2QAGC 4LX0A 3TSZA 1CULC 4V0OA 1J99A 3GD7A 5EXXA 1SKYE 2H18A 3CF2A 1JXOA 2VH5R 3LDAA 2ZJOA 3KFVA 2O8CB 1P7CA 1UEIA 1K6MA 2FEMA 1K5DA 4HAZA 5FR2A 1B0UA 3IIKA 2ZVQX 2ZI7A 4TMTA 4BEBA 1XEWX 4UNSA 4Q02A 2ZSBA 4AC9A 3U5ZB 3A6PC 2J59A 4BQSA 4QBIA 3RC3A 2QSYA 2QAGB 1KIMA 3PEWA 3L0IB 4LJ8A 2QGZA 3GFPA 1AZSC 1DOAA 2O8FB 3Q85A 4L5BA 2IYVA 2QMHA 4GMDA 4BFWA 2C04A 5BQ5A 5CIWA 2ERXA 1T0HB 3THOA 4YMUA 3TIFA 4JKYA 3LBIA 2REBA 1D2MA 4RZ2A 4KITB 4LDJA 1WB9A 4A6XA 1W5TA 2QP9X 3A1TA 4GFDA 3MGCA 4M9QA 5FBWB 5AK0A 2EW1A 3DDCA 4DHEA 1QRAA 1VTKA 3U3MA 5K8IA 1E3MA 2ZREA 2WHXA 4DIDA 4LUCA 4MRRA 4BASA 2HXYA 1A7JA 4HLQB 1W0JA 2YINC 3KB2A 5FOTA 1KK0A 4KYIB 4DWJA 1JAHA 4Q7JB 5K8LA 4XIGS 1ZIOA 2GAAA 3THYA 1E9BA 3PUWA 4NKRA 4Q01A 1DO0A 2IHBA 1ZAKA 2GJSA 1MKYA 1GAJA 1NBMA 2HLDD 2H8KA 4QM6A 2TMKA 2IK8A 6Q21A 1NNEA 4XD7D 3EAQA 3QENA 1E2IA 3QPUA 1KI8A 5KUTA 1RVDA 1WRBA 1E2EA 4EJSA 1NRJB 2W00A 4NCKA 4Q4AB 3TLXA 4AY2A 1R5OA 4GT1A 2ZR0A 1OJLA 2YWFA 3K0FA 4F38A 2C95A 3I3SR 4RFVA 3FMOB 2QM8A 5JJLA 3GFTA 1U8YA 4B3CA 1ZD9A 4OI4A 3KL4A 2VBCA 1KSJA 3ZD7A 2VSOA 4GP6A 2N46A 5DNYB 5CB6A 3NBYC 5FPKA 3EPJA 2J9RA 2HT1A 4BZQA
chains in the Genus database with same CATH superfamily
4YYZA 1ZH4A 4Q1CA 3JQAB 3FMGA 3L0PA 4FKBA 4JENA 5DOZA 5IZCC 2WYVA 5GZ1A 2NQ8A 4FINA 3WZ2A 1ZNZA 4MAAA 1KIFA 5EKUA 5A7GA 5HILA 4A7PA 1FTSA 1RLIA 1TD9A 5THQA 9ATCA 1MCZA 1MFPA 1KBZA 3OX2A 3VPAA 4DLWA 3CO0S 3VR6D 2IOYA 3L92A 1GVHA 3UMJA 2FJ0A 2TMYA 4E3WA 1GPBA 1LSOA 3C41J 3L01A 4IMPA 4I1PA 2EKZA 1GILA 1S2MA 1NL3A 4UBMA 5IVIA 1G8AA 3D8TA 1DXQA 4F6RA 2UUAB 2IUFA 3SXPA 3SYRA 1OPXA 2VYVD 3PWKA 3VAZA 4ZI7B 1JQ3A 4RPGA 1JVNA 4H1WA 1JIJA 2QUKA 4M22A 1OTYA 1P2SA 1ZD1A 2EJTA 2GJ4A 3D2LA 2E49A 2RG1A 1SZDA 2B8TA 3MSXA 2QNIA 1HTWA 4OQMA 5JNRA 2PSSA 4DV1B 3AI2A 4IDEA 3AV0B 2Y9MB 3KBOA 3N2LA 1TIKA 1T8YA 4NSNA 1FFAA 1F4VA 5A9TA 1ZA2A 5LYYA 2YMQA 2J09A 4JGIA 4K6KA 3AOEA 3DAOA 3EY9A 5FI1B 1E5QA 3E7WA 1H8EA 1FPMA 2XT9A 3V4LA 2NZUG 4O2AF 4E7PA 1BDHA 2ZBEA 2FQ1A 5EZQA 2P9TA 4DMFA 4ABTA 1O89A 2AT1A 3AVVA 1V7CA 3E8SA 4BGEA 4PQGA 3ABIA 3SOPA 3V4VB 3GRZA 2AOTA 3D7LA 3OZ7A 4XAQA 3R9IA 2DUNA 4KXYA 2ZYTX 4IICA 4R8VA 4JDPA 4OQLA 3KJEA 5CLGA 5JATA 4R2JA 3UB2A 5AFSA 3IAEA 2YCBA 3B6ZA 3VPFA 5HQ3B 3F1KA 1BN7A 4W8GA 5MHTA 4N47A 3PLNA 5AXDA 3A3YA 2X14A 4ZCMA 5KOJB 3THYB 4FJ0A 4V0LA 1EFHA 2PZBA 3AF5A 3I2YX 2JI8A 4GMKA 1U0HC 1SB9A 3PDJA 2CXNA 2JAQA 4II3A 4ZWNA 4CEIB 4FX5A 3ZVKA 4F21A 2H59A 3LQ1A 3IMKA 2ZULA 1QHSA 1G21A 3BXEA 3BWCA 3H75A 1RRFA 2NIPA 3I58A 3HVUA 4HDNA 3VSBA 1LW6E 5IVHA 1PNOA 3OO0A 1CJMA 1MXHA 5B57C 3K9WA 2Q6TA 2GAOA 4KPGA 3UT5A 1G4HA 4C4RA 4DRZA 1O0BA 3ZZ1A 2JBHA 3P9YA 3K6JA 2DKOA 2Y0PA 5ANRB 4C2BA 2JB9A 1M7BA 2QWXA 4IVRA 4OLJA 1ZA1A 4LN1A 3GLTA 1P2BA 2HXGA 3WMWA 1YR2A 3CLRD 4PNZA 3AB3A 3THSA 1YFJA 5HZHA 1F5NA 3LP6A 1YC5A 4BNKA 3ZJTA 3ER6A 3HDQA 2ZBUA 3ZV6A 4M7OA 3KAPA 1Q7RA 5A7FA 1HWYA 3BSWA 3UAWA 3HC7A 3PFKA 1VE1A 2WWWA 3JRWA 4TL8A 4UC0A 2C9OA 3LUKA 4BRZA 2GD2A 2W42A 1O4WA 1NVDA 4ERXA 3O8QA 4CL2A 4N76A 4KPFC 3DBHA 4GECA 2KBEA 1U2GA 2QXYA 2IV7A 5TV2A 2OC4A 1QCCA 1IXZA 2Z2XA 4M8IA 2JAPA 1E6EA 3BN3A 5ALDA 4CJXA 1X7XA 3H87A 4FHGA 2GTPA 4XWGA 5LCXA 2E4YA 1RQXA 2ZIXB 3UUFA 3NH6A 2NUPB 2GN9A 4EG1A 3VU1A 2OGTA 2FHSA 2GK7A 1DTEA 4Q3OA 1QB8A 5GOZA 1Z0FA 1KE1A 2ZJAA 3JWHA 3C74A 4S1NA 3MUFA 4MCJA 1YZ3A 2NU6B 4IXTA 3BFPA 3IBTA 4C3ZA 3LUHA 1M2GA 1CIVA 4LDRA 3ZEAA 5BUZA 5L95A 4MYRA 1K7SN 3COVA 2HX1A 3QOWA 2OPHA 4WFQA 3K2BA 4P0QB 3NRBA 1X8LA 4MUBA 2DT8A 1FP4A 5G0UA 2QE6A 1UM9B 5EWMB 5A2QA 3EXFB 2ZQ5A 3EYWA 4P3KA 2PIAA 1DARA 5J4LA 1WCXA 3PQEA 1IN6A 3OBIA 5D6OA 1LDGA 4ECAA 2JCYA 3TB6A 1YNOA 4HUQB 2BFEB 1HMPA 3HZZA 3REGA 1WLYA 1BE8A 2GDZA 1TZJA 4MVJD 2NYRA 1Y8RB 2IYZA 4D0NA 3GZNA 4AICA 1RQ7A 3MF4A 3SNKA 1CR0A 1B8VA 1DTWB 1BS2A 1OFVA 3AEYA 3I9V6 3IQZA 4X63A 3S28A 5JSQA 1EVKA 1GLNA 2WWGA 3DULA 3DEYX 4HGRA 2WPDA 1T2EA 2MSCB 2O3QA 4L3WA 4YCSA 5KTOA 4OLBA 1ZHHA 1UZUA 4HDAA 4D96A 2KHZA 1GQFA 1GRRA 3BERA 3EN0A 3OQ6A 1YZLA 4NYMR 3AILA 3UZUA 4Q4HA 4AG3A 2V54A 3F3SA 1N5LA 4CLXA 4TQ9A 1I6WA 1JWAB 1V8PA 3N05A 1LPBB 3PP8A 5B58C 1FS5A 3KUCA 2QZ9A 3ZC3A 3DQZA 2A67A 2J4FA 4YT5A 3INRA 3F6BX 3RSFA 3BWYA 5BURA 5I01A 2OAGA 3OU2A 3FW1A 2ZSHA 3OEWA 3OLYA 1Z3IX 1PQWA 1TM2A 2KBFA 2RBKA 2XNHA 5IEBA 1E1MA 1J23A 1UEJA 3M70A 2VNAA 4LV5B 2R7KA 4GI1A 4I3GA 3WNBA 4AECA 1RRGA 3KOMA 1LFAA 4DIKA 1C3XA 3L5OA 4UM9B 5G0TA 1NSYA 2AYYA 5KNDD 3D7NA 3DNMA 1E8NA 5CIQA 3ZJ5A 4FMBB 4U8GA 3OFJA 4P58A 2ALJA 1PR0A 3CZRA 1UBKS 1VLVA 3UMFA 1HDGO 3CB2A 1MU0A 3MG9A 5GVSA 1UKZA 4RE6A 1FTGA 1OA0A 3JQCA 3HB7A 4JB8A 1E7QA 5IG2A 3RU2A 3I3OA 3ORFA 5L4LA 1F8UA 5TY0A 4WOBA 2WU3A 4AN4A 3OZSA 1I7NA 3O1IC 2R5FA 3T3HA 1RXWA 3WJ1A 1NUPA 2W2OA 3ISTA 4BNWA 5CA0F 4UUAA 1GU1A 4DY4A 3EUEA 5JDIA 1KH2A 2QI9F 3SSNA 2BGGA 3C3XA 3D0QA 3FNEA 2Q3BA 1WMDA 4PS1A 4A2QA 5LIPA 1BG6A 4BNDA 4H6PA 3WI7A 3K70D 2NSYA 1TCBA 1XTVA 2WP8J 3B48A 5AJVB 4ITVA 4BFSA 1KS2A 2JZOA 1H93A 2PSEA 3W3ZB 1A27A 5L3QA 4LYHA 5ESXA 3IDOA 2V3VA 4XIFA 1V5WA 1NC3A 4IJ5A 1N1DA 4MUKA 4R3NA 5FOUA 4HVLA 4B09A 2HLHA 5K8UA 1A9SA 4OBXA 3B52X 4CDGA 4I55A 1V4VA 3LT1A 3MEQA 3ANXA 4WNAA 5HCIA 5FBZA 1BDIA 4MP8A 3UNXA 1AM4D 4B5LA 1VBNA 5EXDA 3W4JA 1DCFA 4L8YA 4O4IB 3IOMA 4FYIA 5HWSA 3ZIDA 2CXRA 4C29A 4ESVA 2GK6A 3TEJA 1CS0B 4K9LA 2NZ2A 1MB2A 1EGVB 1CDEA 1ZIXA 2AXNA 2YIDA 1D0VA 3AFMA 1I0LA 4YX9A 4QOHA 1QOPB 3RO7A 4LS3A 1K8XB 4JODA 2E48A 4CV1A 2MIIA 2Q4DA 3KJGA 5JDCA 3W9YA 3GPLA 3H5OA 3K0HA 1BKDR 1I7DA 4RPJA 3K72B 1NBMD 3DOOA 3LCJA 3S2SA 4EGAA 1OXBB 3PRKE 4ZVQA 4YH1A 5A6SA 4Y6SA 1SXQA 3GP5A 3RWOA 5CW1A 2G8NA 5IYZB 3GARA 5FUVA 1V9LA 4BZPA 4FYPA 1Z0JA 4M87A 4PGAA 1T3TA 4PZLA 4RVHA 3HCEA 1T43A 2CVHA 4RSGA 1GVNB 4Z9BA 4Q1VA 1N6IA 3LVBA 3ZBQA 2LRHA 1EUQA 3N39C 4YN3A 2WSLA 1GYQA 4XVRA 2PGOA 1JZTA 1KHTA 2FY8A 4CODB 1Z28A 4OMUA 4TQGA 4W5OA 3GCDA 4PXSA 5JPCA 1FW8A 5EMJA 1XRSB 4HTAA 1WL8A 1H6DA 2VQFB 2R6R1 2ZEJA 4S1TA 1OLUA 1R12A 1YQDA 4K6GA 4B79A 5A62A 5KDDA 2A58A 2CHQA 3F74A 1USUA 3OCJA 5EY5B 3TBFA 2EIXA 2A7QA 3GGPA 4E33A 1YHYA 2QR3A 3E18A 2BGKA 3GBPA 2JIPA 3WYGA 3VO2A 4Z8YA 2OOSA 3QZUA 3QKRB 4AZ0B 4Y2RA 2G36A 1H2ZA 4L4UA 1XZCA 2C78A 3MUNA 1UMBA 2VBGA 2PLRA 3FGPA 3MWFA 3TSAA 2XWQA 1E96A 1R88A 1WVMA 3JZIA 4RV5A 2C2XA 2WDPA 1ORWA 3HJRA 4C0SA 4DILA 3UHAA 1Z18A 2RARA 1P18A 2OCDA 4EKYA 4MS1B 4RKRA 2IS1A 3FIUA 2OZEA 1R8YA 3AEQB 4B3BA 2I3GA 3SVLA 3NU1A 4HHEA 3QSGA 4JXZA 1ZIYA 4EG8A 1DKLA 1OLXA 2P4EA 3DJFA 1N75A 1KKLA 4CCYB 4MA5A 4E5PA 4LC0A 3RG2A 5KHLB 1HNXB 1X8XA 3H3JA 3NDPA 3D6HA 3U4MA 2BI8A 1CEYA 3X1JA 3GFBA 3P26A 1BFKA 2H2FA 2AJBA 4UE6A 3PD1A 5AH0A 2RH5A 2V4ZA 3QTTA 4JNCA 2IYSA 2ZJ3A 5KTTA 4BCBA 1RCTE 4M1KA 4F4JA 4D80A 2AZ4A 1E7MA 3OZWA 4UAUA 4BB0A 4EQZA 3BG5A 2C7OA 2EZ9A 3CLHA 1JIUA 4RESA 4AMUA 1A71A 3CMMA 4OHOA 1IG0A 1UZAA 1MVNA 2OLKA 3CB4A 1KSFX 2BGRA 5BW6B 4ARCA 3SHWA 1U9IA 1XVUA 1ZP6A 2JLVA 3UKDA 4ED9A 3V7NA 3EASA 1S8FA 2LV8A 2QY6A 4MS4B 5I7HA 3IEMA 5K05A 2QB5A 2YOGA 6REQA 2BEUB 3IVCA 4PWYA 4M86A 1FQWA 3KE8A 4HWSA 2OD2A 5MFZA 1V1RA 1X2BA 2H7VA 3CZAA 1SRQA 3VZPA 4PZ0A 5DHTA 3H2BA 4YP0A 1PT7A 2QORA 4MQ5A 4GE0A 1NNSA 3BYZA 1JQDA 2QL5A 1R0SA 1IY2A 4Q15A 1IFXA 2BAGA 3AF4A 1JEAA 1PJAA 1DAKA 4PIVA 4ZV7A 4BMVA 3OESA 3OC6A 3PJGA 4FOSA 4GGOA 4IIUA 1TAGA 4U6QA 1DAMA 3ETHA 3SDZA 2W6JD 1I6LA 2XLBA 5BOSB 5IH7A 4ZT2A 1FE8A 1L7OA 3H86A 5J4VA 2X3FA 4BRSA 5JH7B 4H7HA 4ARAA 4DLRA 2I62A 2I6GA 1XRJA 3GGCA 3VGJA 1A1SA 5ADVA 2QRNA 4TV8F 4YK7A 1MTOA 2VF2A 1QF7A 3CIOA 3V4PB 1T9AA 2QX8A 1Q3TA 3H5NA 3NETA 1KJ9A 3LX8A 1H9BA 1K98A 4OHRA 3CLTD 4QXOA 2XB6A 2IODA 3IIMA 4LECA 2O6LA 3A4TA 2GPSA 3SYTA 2PQ2A 1YR1A 1XA4A 4AURA 3GW8A 1VL6A 4YJGA 1T9GS 3B6MA 2CWDA 2FUKA 4F8EA 2PJRA 2PT5A 2WTBA 4G23A 4KDCA 2XDQA 3FPBA 3JQBC 3W78A 3RVBA 5FULA 1SU8A 5G0VA 2VHZA 4TLMB 3NO4A 1CUFA 4JH0A 2FFHA 4JD5A 1JIIA 3KXPA 2VXCA 4MUMA 4EB3A 1MZPA 3ZX4A 4HSGA 3RU7A 4JVLA 4FSDA 4DCSA 2PX5A 1ZJ6A 2NV2B 4M1QA 3ERCA 5EHZA 3D6MA 1HC7A 2V55B 3ETEA 5I3ZA 3LO8A 3FTNA 2VCHA 1DEXA 3C1TA 4DDMA 5KYXB 3W8NA 4JX9A 4GIBA 1A9OA 3UC5A 4MV0A 1VLMA 1Z62A 3A0RB 4PXAA 5I4IA 3EK2A 1Y48E 3AT1A 1MT3A 3OX4A 1SZCA 5A9SB 4L02A 2DSTA 1WNTA 3WQRA 2SECE 1EGHA 2CVPA 5K3CA 2CNKA 4X1KB 1M8FA 1VJGA 5AW7A 2JGRA 4PQFA 5BUSA 4AJ4A 5D5PA 5KVCA 1IM5A 3WO0A 3CN9A 5BSGA 5KYWB 2AXEA 4F8JA 3ICWA 4MDYA 5J2TB 2FVYA 2IYXA 5KJCA 4L4SA 2JLYA 1P4JA 4HZUB 3WLIA 1ZH2A 1SA0B 2G07A 1Q0LA 1J24A 2JNWA 3FCUB 3LT4A 4RIGA 5I4KA 5DEIA 2O0JA 2HQSA 2JIRA 2QGFA 1PO7A 1YJAA 1XZQA 5EXPA 4DQXA 4AVYA 3H13A 3ZNNA 3P1JA 2PV0A 3FROA 5E1OA 4BC0A 4G0VA 5J59A 1A77A 3OHMA 2PRIA 1GUBA 3PRYA 1MW9X 4NY1A 5FPTA 3UXMA 2GM5A 1QP7A 2FAXA 3NBFA 3EVTA 3I2GA 4HQNA 4ML3A 4RSMA 3H9EO 5MDHA 4RZUA 2DKFA 4DQVA 3TE7A 2K87A 4G5FA 3WWDA 4BU0A 5JD4A 1X86B 3DUFB 4EVRA 1ZDMA 3ZUGA 1W19A 3SK0A 4I5DA 5C37A 3WLFA 3ILSA 5AOAA 1IVYA 3BKWA 4TWZA 4IIYA 3ZJ4A 2IKQA 3IKLA 4K03A 4P32A 2B2CA 2WJJA 1KQFA 1OIVA 3W6PA 4RMHA 1M10A 1QRUA 3VNUA 1O8BA 2WFLA 3MWYW 4N8DA 5BRNA 5TEVA 4BVEA 1VMKA 1U7DA 2DPHA 4LJ6A 2F48A 4ENQA 4XM2A 2VHXA 2FPPA 1KP2A 4ZYXA 1A50B 1KPIA 1YS9A 2Z2JA 1HLFA 2B8WA 1MJ5A 3MTIA 4NMWA 3ZKWB 4H3KB 4LBYA 3O95A 3FWHA 3PTLA 5CBPB 1VE3A 1TTQB 2OXFA 3KOZA 3A9TA 4B43A 4S0ZA 4GAEA 2D0OB 3W7BA 3ANSA 3M6WA 3RV4A 1QVVA 4ND8A 1YUMA 2Q3CA 2CZQA 2ZRBA 2HQBA 2I34A 3HZOA 5B1IA 5CA0A 1E0KA 4AO7A 2OBXA 2CT8A 3LT5A 2BW0A 4EVIA 5J58A 1LK0A 2L17A 2NUBA 2HZ7A 2Q99A 3IVRA 2WA1A 1VZ2A 4IEIA 1QKKA 4JC8A 5FEUA 3V00A 4M1OA 5ICMA 4JYCA 4NJMB 5CBKA 2ZS7A 1XHFA 3ASVA 3M6LA 3OOYA 1WXHA 1DELA 1C7FA 1E0JA 2D2IA 3VTAA 1JIVA 1JMYA 3HYSA 4OBWA 4Q12A 3WBJA 4E5NA 4J7UA 4KAJA 3TIXB 4YAUA 4WRRA 4AP9A 1T1RA 4O1IA 1G3UA 2FB9A 1TCUA 3UXEA 3KSBC 1XKQA 5HIIA 4L07A 4PCLA 3GG9A 1QRSA 1AUPA 4H18A 3M5PA 3QY9A 5GONA 3ZS9A 3FVWA 3M6XA 1KO7A 1GPWB 3QOFA 4U3JA 3ZV3A 4IKPA 1ZVVA 3U0BA 1YQEA 4PX2A 1BMTA 2QTLA 5BN5A 2RGWA 1C7IA 2P5YA 4XDZA 1RXVA 2MHCA 3JZAA 3PUXA 5LBUA 1OAOC 3G5LA 1XCBA 2C5SA 2AI3A 3A9VA 3OIDA 1N2EA 4NFHA 1N1EA 4E6EA 4L3VA 4N5NA 2FFBA 1XK6A 1PR1A 3I01A 1FXWF 2D2XA 2X8JB 1LDBA 1NVMB 3HABA 3U48A 4CU5A 4OA8A 1BCRA 1VB5A 1GYPA 1TXGA 3V9AA 4GG1A 4HT3B 3FHTA 1M73E 4J1NA 1UKYA 4RZ3A 1ZVQA 1LLCA 4W6QA 2OP1A 1Q84A 5GZ3A 2CCKA 1H65A 3DVSX 1Z63A 5DM2A 3K1TA 2P0EA 2IYOA 3OZRA 2YJ5A 1JDUA 3OICA 4DUGA 1JIQA 5SYNA 2AH5A 1R4MA 1NFRA 1Y1LA 2PUFA 1KI6B 3FVRA 5CYFA 4D74A 4DCGA 1CX9B 3DBOB 2FXVA 3K6SA 4PXYA 5AVRA 4Q1FA 3AUSA 3AXTA 3G8YA 4INJA 2NP7A 3T34A 5LNK6 3KAQA 5TF0A 5CEFA 3UN1A 3A6GA 3KLOA 4HL6A 1PK7A 4YIHA 1KAMA 1YIAA 4WL0A 4FU0A 1SZJG 3ADPA 3IOCA 2RGCA 3NKFA 4HB4A 2SCUB 4PNEA 3JD2A 1GTMA 4W5HA 3JD3A 3RTDA 4GKVA 5IAKA 3UV6A 4D6YA 3P0HA 5KPDA 4RNCA 1IULA 1PUXA 2JS7A 2V7TA 1VRVA 3BD9A 2EERA 1IUKA 4U7FA 2I91A 3EJ6A 4XZ3A 1SXGA 1NYRA 1TYZA 1JEQB 2ZJFA 4QYSA 3N28A 1DHTA 4DV5B 4MYCA 5EYPB 1D2GA 4Z51A 5KTNA 2JGLA 3DZJA 2GLXA 3U49A 2WF9A 2O3JA 2X1MA 3NHFA 4M1TA 4UU1A 5BSUA 5JC8A 2JCSA 3TVYA 3CW9A 4D4JA 4ZEXA 5DGTA 2VJBA 5KWSA 1IBCA 4ZCTA 1RHRA 1OIXA 3RYIA 2ZPUA 1RSZA 1D03A 3U61B 1S9HA 1N0WA 4C0QC 5F9FA 5JNSA 4I5FA 3BJMA 2DT5A 2XRZA 1FDWA 1NJ6A 4R2XA 1OUMA 2OKGA 4IOMA 3NDBB 3VU0A 3ZBTA 4DRYA 3EQ7A 4TXNA 2V0NA 5K3AA 1C1DA 3QXSA 4HGPA 5KYVA 5FUQA 4ZYZA 4KYTA 4GOXA 4YP5A 2IHKA 1I5OA 2WWIA 4FJ1A 2ZR8A 2X0IA 1OXMA 2NWQA 1PNRA 2HJVA 2W6IA 1DAOA 3RPEA 1J8VA 2O8DA 1W9HA 2RKBA 4GOKA 1UIMA 1R9MA 4MH0R 4MI1A 4Q0MA 4Q5IA 2C8KA 4NCAA 3ZXIA 2Y4NA 3M7IA 3AUJB 2IFTA 2YUIA 3KDSE 1VIYA 4RZSA 3BWDD 4RTKA 3A6HA 3QWHA 1DC8A 2XE6A 4U2KA 1RZ3A 1Z4LA 1Q57A 1UBRS 1YXMA 3EW9A 1P33A 1N77A 1JS1X 4U7JA 4UFOA 2G6BA 2ZJYA 2DBVO 3P97A 3FYHA 4GDMA 1G9TA 3THXA 1SB8A 2OK8A 3AMVA 4XASA 2N75A 1KHHA 3HJFA 2G09A 2Z43A 2DZDA 4QUIA 2QM0A 1PFWA 1U0RA 4GXQA 4PGFA 2INGX 1QQ6A 4JKOA 5GGXA 1ENZA 3RU3A 2R5NA 3B6JA 1FLNA 2W4QA 3IJPA 1SBIA 1BVYF 3PRHA 5DLYA 5EE1A 4RDXA 4D8VA 2CYCA 2G9NA 1HNWB 1FDIA 2JFNA 3ROKA 4DSTA 1KZHA 3CVOA 4RY8A 4PLWA 4WKOA 4M36A 2HKIA 5ICEA 3RFXA 4YRFA 4QRIA 2UVDA 3S2IA 4OHKA 4KSBA 1YTLA 5TSDA 1EXNA 4ETWA 5HXAA 3E1GA 3IHWA 2B2NA 2VDWA 1L8XA 1BFUA 4B7CA 2QLBA 2WE8A 3L4BC 4BLTA 1KBOA 4TV9B 5F1PA 3BIWA 2O0KA 1QBGA 4FGKA 3SBEA 3M2TA 1P19A 3N53A 5H7XA 5CPBA 2GF0A 5K0SA 4PPYA 1DPGA 2RG7A 4CF3A 4R5HA 1ZHFA 2CVQA 4EG3A 4TTQA 2PVCA 3DE1X 4JLKA 3WRXA 4DMRA 5JZVA 4HADA 1Z35A 2H1LA 1PT8A 3BTOA 1L1QA 5K0LA 4O5AA 4J16A 3U1VA 3SICE 1V3TA 1XU9A 3H4IA 2PLNA 3Q2IA 4FWIB 4XQGA 3CX6A 2RK4A 3L4EA 3H7AA 4TM7A 4U6SA 2JHFA 3HCRA 4X91A 4CF5A 3GFFA 4CG0A 2BFNA 1SGWA 1Y37A 3K5WA 1OE0A 3FUXA 3F3YA 3OZXA 5AHWA 2VNKA 2REXB 2ACWA 4I1VA 4OLHA 1G6OA 2GEFA 1EDEA 2GFIA 2M6SA 2WMNB 4D3DA 1WU8A 4JLVA 3R5XA 4PO3X 2Z5FA 4LHXA 5CCEA 3EDCA 3AR5A 1H9CA 1L3BA 3GGSA 5IDQA 5TDHA 1J70A 1UXKA 4K88A 3P0JA 4RCYA 5IRCD 1Y1PA 3LL4A 3EGDB 4O2AA 1SVIA 7REQA 5KDOA 5GADl 2D2VA 2P6RA 5GP1A 2GX6A 4LV8B 3K1AA 3C5CA 3TRJA 3FNFA 1CZOA 2J46A 2WT4A 2IIPA 2ORWA 4GNKA 5DN6A 1Z22A 3LPMA 1JHAA 4P53A 2QZ4A 2HR1A 2TMDA 1XVVA 4MPJA 4Y67A 1YS2X 2AVDA 2EKBA 3G85A 3H8JA 3VU9A 3H4VA 3ASYA 3KTAB 4YCBA 1KYIA 3O8OB 4E46A 4KFCA 4WH0A 1Q92A 1CZLA 3R7NA 1O95C 2VJOA 1NPTO 2OHJA 3C15C 3O7MA 1VHWA 5EWLB 2QG9A 1YQTA 4JJ6A 4UMVA 5FBLB 5J1TB 1SAYA 4R7ZA 3ZYCA 2R6AA 1VL1A 3GAZA 4LQ4A 2YY6A 4D9KA 1K27A 1UWVA 3GVCA 3M34A 4FGZA 2F1HA 3UWPA 2XCTB 4B3GA 2Y67A 3R4VA 4MLPA 5KU1A 1HYHA 4FN5A 4JBHA 3IE2A 5EZ6B 2IUSA 5DBGA 2W58A 1I32A 4R4JA 4RJ2A 4CNQA 2JLUA 2ZDGA 2B0CA 2YN0A 3RYHA 1KEZA 2CXXA 4HQOA 4IDCA 1CXZA 3ESBA 2HWUA 4GZMA 3VTFA 2CEAA 3PGMA 4B7UA 4KO4S 3B9QA 3I01M 1J22A 1QH8A 1Z39A 2VQDA 2VP3A 2BFDA 4Q21A 4R3WA 1SUEA 4E6PA 2IQ5A 1X7YA 4AT1A 2FSGA 2P9FA 5DHUA 3SQLA 1E7RA 2J85A 2MOKA 4TL7A 1Y6FA 4UJ5A 2H2AA 1PYOA 2QR5A 1GQOA 3CWQA 3DS8A 4TV8A 4W8HA 1TKCA 2W6JA 5E7JA 4Q7KA 4YRPA 3V1NA 2G5CA 3MQFA 4UFPA 4AUNA 1L7MA 2Z1NA 2EVWX 2QN1A 2GYYA 3PDWA 2X41A 2IOFK 5J47A 2HSWA 1GPH1 1OT5A 2C2KA 4H7DA 2Y2UA 4M8LA 2C4TA 3N87A 1CJVC 2W93A 4P4SA 4UHDA 5B37A 3GP8A 3PPYA 4E1BA 2Q28A 4DCOA 2VN8A 4QOSA 1WEHA 5BORA 2YN4A 1SZPA 5EWJB 2QRGA 3PUVA 1RDFA 1HDCA 3OI7A 2XYQA 1RQLA 3KT3A 4FYKA 3CCCA 4ZZ3A 3BWXA 3AVWA 1GQYA 2FG6C 3IE1A 1N3LA 1TVKA 3K9FC 1DC5A 2K7FA 1JLRA 1GZ4A 2ZRAA 1TPZA 4GMHA 4RAQA 3ROPA 1RJFA 4N65A 1MEOA 1IY1A 4C78A 1VRWA 2QX6A 1F4PA 3A2NA 3VH4A 4DSOA 1KIAA 4E70A 3DFIA 1K8RA 4OGKA 1DQSA 2XVZA 1CRWG 5I47A 3H3FA 3M9WA 4GI3A 1AC5A 5KJ6A 1CY4A 1M6HA 3PHLA 4X7PA 3OEHD 5KYUA 2RCYA 4DEXA 2P4UA 2YWBA 2VRCD 2YWHA 4REQB 3TS1A 2EC5A 2MSDB 4G85A 4FDTA 1MOZA 5ICCA 3DFFA 3SZ3A 2XA9A 2VT6A 2L42A 4C0XA 1W4BA 5I6DA 3A3NA 1DWOA 3KDAA 2R7AA 5G4KA 5IF9A 4C4PA 3EGVA 2RHWA 2P6UA 4JYBA 1YWGO 2E5LB 4WJKB 3A1CA 5EQJB 1I3NA 5K0NA 2DBZA 1TX4B 2F6RA 1KAHA 4RGVA 1C3OA 3NTXA 2ZUFA 2VT3A 5A3SA 1R6XA 2WD8A 4IJMA 3QIAA 3INNA 4E5UA 2BV3A 4XCQA 2VF5X 5GGYA 1QQ7A 2IYUA 3L6CA 5P8WA 2Q27A 4YRZA 4NOMA 5A4MS 4EB8A 2JEZA 1G3QA 1Y6ZA 2CXPA 3OOSA 4IG9A 2ATVA 1RI5A 4QOEA 3PNVA 2SHKA 1Z38A 2WAYA 5T64A 1AZLA 4D3YA 5AHKA 2QBYA 1W88A 5FLEX 2JF0A 1NT2A 4BIMA 4W7IA 4EF6A 3NYIA 1A7AA 3DUWA 1Q3HA 3HJNA 2BDEA 2BGTA 2WU4A 3SX4A 4FZRA 3QI2A 3EQ9A 5AKEA 3F97A 3KPYA 1R64A 1CUJA 16PKA 3HB5X 1SKAA 2WTAA 3I8SA 4HEHA 5CJJA 1NQWA 3LRTA 4CUJA 2WF5A 3PLAE 3FNBA 4IJWA 2P77A 1BJTA 1C3VA 3GJ7A 2OCXA 1XJ0A 1PEAA 2OTCA 3RYCB 1QIIA 1GPDG 1EM8B 4LI0A 3I61A 3U7EB 1FUEA 2J9YB 1QGED 1TECE 2P40A 2IXDA 2QN7A 3LDFA 3PDCA 4DCTA 3R9WA 4DDWA 3HY4A 3M1AA 2GETA 2QQGA 4CHTA 1DO2A 4JZYA 3V7WA 2BRUA 4OHUA 4F3RA 1G41A 2TRSB 1MEJA 1W581 1TUBB 3PYLA 1M8JA 4OK3A 2H4YA 4IIJF 4DLLA 1BU5A 4X6YA 2FKAA 1NNUA 2JC3A 3ZI7A 4PRZA 1DJMA 4EG0A 3JCZA 2IYQA 1Q0SA 1JEDA 1T4CB 3DP7A 4CUKA 3T3PB 4C4SA 1JAXA 4ZQBA 1Q2XA 4H16A 2Z4SA 4UBIA 4JVMA 1Q7TA 4AJKA 2R6HA 2ATCA 1TZBA 1SWWA 2IPAB 1O96A 4W7SA 1D6JA 1J2UA 5L9AA 1DWPA 1VL0A 1XWIA 4TSRA 4XGIA 1N2CB 3SFTA 4JNKA 3HCWA 2IEIA 4LSGA 4JDUA 4O0MA 4HJXA 2PS0A 5F5NA 4CF6A 2I87A 2ZQZA 4CM1A 3HXMA 3CE6A 3AHCA 1UBEA 2GPTA 4R01A 1W6RA 3A2MA 4KDRA 4HCJA 4B3XA 4CKYA 5AT1A 3WADA 1TA4A 1QU2A 1USWA 1NU6A 5AKLA 2ERCA 1YHNA 2BEKA 1TAUA 3KKOA 4EG7A 1NQTA 2NGRA 2WSIA 1HI9A 1KI1A 4E1VA 5G1NA 3H2GA 2P2CA 4DLTA 1XT6A 4MB6A 2AOVA 1GPYA 2JHPA 3HVKA 1O7JA 1SUPA 4MCAA 3GX1A 1MO6A 4KR0A 2CE7A 4CMIA 2B98A 3WKCA 1MJGA 4Y9RA 5CEJA 3L1IA 3JR3A 3NTLA 4QLAA 2YZNA 1PTKA 4NMXB 1U3VA 4Z99A 4D82A 4OSPA 3RAGA 1T0UA 2GPBA 4O1MA 1EZ4A 3GXOA 4DSZA 1UK7A 2WSYB 2G88A 2FZWA 2CEKA 1UMCB 1UKAA 2WIGA 5AW0A 3ESZA 3VZQA 1I4TD 1RYEA 2ODTX 3RAPR 1G38A 1F6WA 4J4TA 4OTZA 1R74A 2HADA 2QD4A 2GA8A 1EWQA 2R87A 3AO0B 2AFIA 1XQVA 4KH1A 3IT1A 3OY7A 3GA0A 2JJMA 4HG2A 3U7JA 4O2LA 2NO0A 1K68A 2AJCA 4LYYA 4R05A 5FWXB 4QEKA 1UK8A 4N54A 4LF7B 4RFLA 4ILKA 4LZLA 1W0CA 1DKUA 3T41A 4NTZA 1CF9A 3OUTA 1YO6A 3Q2KA 1TU3A 4RK5A 4EF5A 4YUAA 4GOND 1H4QA 3IP7A 3O3OB 3U4DA 1KRWA 3QVVA 2HPVA 4UM9D 3PQ5A 4CWAA 4R2IA 2GSDA 4OGGA 1P77A 4PSVA 3TX2A 2P78A 3ENNA 3K9GA 3M9LA 2YZ7A 4X97A 4X7MA 4YJ2F 1OCEA 5JVDA 3NOQA 3RADC 1ZN2A 3EXEB 4PFJA 5FWXA 4MGYR 1SG0A 3P4XA 5ALWA 3HY6A 4RD4A 1XZHA 1Z6TA 2RHLA 3UMBA 1IK6A 2B4RO 3PNOA 1I7PA 3T99A 2QVBA 3VO9A 1FDRA 1YGYA 2MJLA 4P08A 1JG3A 2FSVA 2IDMA 4C0JA 3QU4A 1KMIY 4DW8A 5FWNA 1Z4IA 3UC9A 4I8IA 1ZL2A 3V4ZA 2IHUA 5BV2P 3ZIAA 2VEOA 1P1CA 4DVGA 3OKAA 5F7JA 2QRLA 1WUKS 5H80A 4EJSC 3SS9X 4PQEA 4B40A 1Y1RA 4HB2A 3HV2A 1K4YA 2NZ8A 1XJCA 1S1MA 1ZNYA 2XYVA 3PNLA 3QJGA 4BMZA 4HMOA 1DKQA 4X8MA 5AI0A 1XP8A 3Q8WA 4KWCA 1I2ZA 5M34A 3LXXA 5FNVB 5HF9A 3TNJA 4CMIB 1GPMA 3AGQA 4P0PB 1HYEA 1KKMA 1K5PA 1Y4DE 1P4RA 1DUVG 2QSJA 3G2NA 3NDIA 1J5XA 1K7EB 3JY6A 4HLCA 1LB1B 3NUGA 4S35A 4IRUB 3FBGA 1TTHA 4QFBA 1SC1A 1CZNA 1F12A 1Q91A 2EGUA 2I7TA 3DE4X 3DB1A 3DBLA 3Q6IA 2QG6A 4ARVA 3EC7A 2D6FA 3A4MA 4LVUA 1GKIA 4FEEA 3DE5X 2BJWA 3D0RA 4BTLA 5AUOB 2ZYUX 5ARBA 2H0RA 1G3MA 2GVZC 3GELA 5JYBA 5L53A 3U44A 2I3BA 1CQWA 2AW5A 3UAYA 4B3HA 4JU8A 4ZHSA 4DNFA 3EG5A 4ZXPA 3O3CA 1A2BA 1FK8A 1Z4OA 4ZIRB 1A82A 1XDDA 3P0RA 3BEOA 4BNUA 3RH0A 2Q4RA 2X5KO 1VL8A 4RV9A 1IOWA 1IZ8A 1WABA 3HFJA 5AI5A 4JVOA 2JVIA 2N0SA 3KUXA 1TJ4A 2ZYVX 4H7FA 2BMDA 5LU8A 2IZ1A 3BXFA 1CK4A 4Q7EA 3RD5A 4HAUA 1RXEA 1U0TA 3LI2A 1TUBA 3OSZA 3UHOA 4L7VA 5HKLA 4ZDWA 4BYMA 3FA2A 3FVVA 1KWGA 1W5FA 4HLUC 1R5JA 3H2IA 4ZI2A 5DTEA 2PKXA 4DJTA 4W1PA 4LOHA 1FVHA 3JVIA 1L7RA 3MM4A 1P8AA 4WY2A 2A0FA 2VJYA 4JZKA 5CM9C 3QBEA 5BVHA 3KKNA 4DZRA 1HLDA 1RWPA 2DHDA 1J2YA 2YJ4A 1R6BX 3HMQA 4XFDA 2VJAA 1EGMB 4KQ2A 4PFSA 2AEEA 1L4EA 2BGMA 3GFGA 2QZJA 4KQEA 4OSOA 3ZE9A 6ABPA 2HLDA 2B4QA 1HDXA 1XPJA 3QLVC 1ELOA 4XGKA 1UP4A 2FRDA 2FGKA 3EQ2A 4KVAA 2QN2A 4J03A 5AM5A 2I8LA 5LDGA 5THKA 1KOGA 3PXCX 1S1CA 4BNVA 1NMEA 4DPMA 4GUDA 1YMVA 3IFSA 4NEQA 3MC1A 1G5RA 2LZ0A 1S9DA 1M0SA 4CVNA 5AVUA 1F1JA 1FXUA 3I04M 4JR1A 3MJ4A 2QBYB 4ZAVA 4K9PA 1R8QA 4U0KA 3T0GA 1C9DB 4R8MA 1RWNA 4QODA 1RS0A 4PC3A 1RI2A 2FR0A 1P0IA 1G4AE 2L69A 2PAAA 3CPJB 1BEZA 1XQWA 3FSRA 3QMWA 4U2CA 1ZIDA 2KWIA 4N1AA 4N7MA 2R60A 2UZIR 1VPTA 3K0BA 5E7QA 5ALLA 4DREA 2OC9A 1GG5A 5DN9A 4EI9A 1OAOA 1RYZA 2AZMA 1EXMA 1OFGA 1M1YB 3OZEA 4N7JA 3REOA 3ZLUA 4DWWA 2P9QA 5KTKA 4RTPA 2RIPA 2ZUUA 3K09C 3FLBA 4IY1A 1OLSB 1ZYUA 3QM1A 3T1YB 1P7VA 3GPIA 5JXGA 5A5FA 1T2AA 3GD5A 1GQQA 2ZSFA 4GPBA 5LPNA 4I4TB 2AUNA 3TQCA 3T1NA 5BWMA 2PZMA 4ZXFA 5TMBA 3IYLW 3L7IA 2P27A 4JYPA 2C4KA 3EX7C 3I72A 4OHVA 2IPLA 4I2VA 3RC8A