2POCA

The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
353
structure length
339
Chain Sequence
GPYKHFMQKEIFEQPDSAFNTMRGRIDFENCVVTLGGLKSWLSTIRRCRRIIMIACGTSYHSCLATRSIFEELTEIPVSVELASDFLDRRSPVFRDDTCVFVSQSGETADSILALQYCLERGALTVGIVNSVGSSMSRQTHCGVHINAGPEIGVASTKAYTSQYIALVMFALSLSNDSISRKGRHEEIIKGLQKIPEQIKQVLKLENKIKDLCNSSLNDQKSLLLLGRGYQFATALEGALKIKEISYMHSEGVLAGELLPIIAFATRDSLFPKVMSAIEQVTARDGRPIVICNEGDAIISVHTTLEVPETVDCLQGLLNVIPLQLISYWLAVNRGIDVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Crystal and Solution Studies of Glucosamine-6-phosphate Synthase from Candida albicans
pubmed doi rcsb
source organism Candida albicans
molecule tags Transferase
molecule keywords isomerase domain of glutamine-fructose-6-phosphate transamin
total genus 144
structure length 339
sequence length 353
chains with identical sequence B, C, D
ec nomenclature ec 2.6.1.16: Glutamine--fructose-6-phosphate transaminase (isomerizing).
pdb deposition date 2007-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01380 SIS SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2pocA01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2pocA02
3M5PA 3Q88A 3BCHA 1HM5A 2WU8A 1X9IA 4K0KB 2PUTA 2XBLA 5LMNB 3BJZA 3HJBA 4DV7B 1IBMB 4JI0B 2CXNA 4DR1B 2UXCB 1HOXA 1JLHA 5A2QA 3J80A 2UXBB 4X65B 1X92A 1VIVA 1GZDA 1IATA 4LF9B 1U0FA 1JEOA 3I0ZA 3NBUA 1WIWA 2A3NA 1Q50A 3T1YB 2POCA 1IBLB 3ETNA 4YY3B 3Q7IA 1MOSA 4TOIA 5LMUB 2CXSA 2V4MA 4DV0B 1HNZB 3CVJA 4LZJA 3TRJA 1J5XA 2O2DA 3IFSA 5IT9A 1KOJA 4DV1B 5BY2A 4JI3B 2O2CA 1JIQA 4S1WA 2Q8NA 1I94B 3FJ1A 4JI6B 3SHOA 4JI7B 2PUVA 4M0DA 4AMVA 4JI2B 1C7RA 3QKIA 1MOQA 2CXQA 4DV4B 4AQYB 2E5FA 5FLXA 3UJHA 4B3RB 3ODPA 1X94A 4JI4B 1IRIA 1VI6A 3EUAA 4KHPB 1M3SA 3TBFA 2VF4X 2CXRA 4LF4B 1XNRB 4U6NA 2UUBB 3G68A 4DR5B 2VQFB 2CXPA 2UXDB 2PGIA 5BR8B 1T10A 3FKJA 2VQEB 4LF8B 1G98A 3OOJA 3HBAA 4IVNA 2UUCB 4JI8B 3J7AC 4GKJB 4DV5B 4B3TB 2CXTA 4X66B 4NXMB 4JYAB 2I2WA 1N36B 1U0GA 3KNZA 2I22A 4JV5B 4LFAB 3JAMA 3JX9A 1J5EB 2DECA 2X3YA 4DV2B 1N32B 4DUYB 1DQRA 1NUHA 4NXNB 1N34B 4DV6B 3FXAA 4LFBB 2J6HA 1B0ZA 4LF5B 4X62B 1HNXB 5I01A 4LFCB 1HR0B 4DV3B 1IBKB 4DR4B 2UUAB 2HHHB 3PR3A 1XNQB 4LF6B 3FF1A 1XTBA 1TZBA 1JXAA 2CVPA 2ZJ4A 4B3MB 1ZZGA 1N33B 2ZJ3A 2YVAA 4X64B 3C3JA 2ZM6B 4B3SB 1HNWB 3LJKA 1VI5A 2AMLA 4DR3B 4LF7B 2CXOA 4GKKB 4S12A 2DF8A 4YHHB 4DR7B 4OX9B 1N8TA 1U0EA 1VIMA 1X9HA 4JI1B 1XMOB 1XMQB 2E5LB 2UU9B 3OTOB 1C7QA 5IWAB 4DR2B 4JI5B 4DUZB 3T1HB 1NRIA 4EM6A 1FJGB 5LL6P 2XHZA 4DR6B 2PUWA 2F4VB 2VF5X 1TZCA 2CXUA 1TK9A 1MORA 1GZVA 3J81A 2CB0A
chains in the Genus database with same CATH superfamily
1DRUA 3U3JA 5J47A 2EU8A 2P8JA 1RZUA 2D0DA 2G17A 3CTPA 3GFBA 1SD2A 3BJZA 1QH8A 2DHEA 3L2OB 4IINA 4OMDA 3EAQA 2QM0A 1KYVA 4A0HA 3BXXA 4JJ7A 2R6AA 1ZD9A 1JYFA 2DU8A 2H2WA 4RIFA 4OGGA 3EASA 2B4RO 1KEPA 2HU7A 1B8NA 2WHYA 3ETCA 4ZK2A 4TQAA 3GT7A 1AY0A 1E4YA 5FRDA 4DMGA 3ZZTA 2XXBA 2Q0SA 1Z6GA 3K9CA 3C5CA 1AS0A 4LJKA 3IDSA 1YB4A 3IRUA 4ILEA 2RGXA 3LC0A 1SB8A 4NG4A 5AVTA 2OORC 2I67A 4TTVA 3NV7A 3PFNA 3EZXA 2X8BA 4I7EA 3GHHA 4QFMA 4DB2A 2AOUB 2WJ6A 4C4AA 3ONDA 4FCWA 5GJBA 1TAUA 1OW3B 1GRNA 5KQRA 3I4LA 3BB1A 3CUTA 4FOLA 3M5DA 3HU5A 3ZK8A 1QIHA 4UMVA 2DP4E 1CG6A 3CBQA 3MMXA 4IFBA 4D26A 5EJIA 1NF8A 4S1PA 4ZT6A 3QKIA 3TLCA 5C2JB 4E5YA 4A4DA 3PHIA 1A82A 1JA1A 2ZYAA 5GY7A 5IVIA 2F3SA 4J0EA 1NJ2A 1TA4A 5K8JB 2D00A 1P2GA 4Z1MD 1DFIA 3EOZA 4Z2YA 3N2KA 1GAQA 3M6XA 2BRUA 3Q9LA 4OBXA 5JEDA 1J49A 1M0WA 4IS3A 2VXCA 3AW8A 3DLTA 1DIRA 1MNAA 3UWPA 1H4QA 2GBCA 2JCYA 1KSGA 1JN0A 1AGRA 4DWVA 3KQNA 3OQVA 3BQ9A 4RGBA 2I99A 1IQRA 1H1LB 3GUUA 2FMHA 3RVSA 3UV3A 3A9SA 3FAZA 4L85A 4FUTA 5DIZA 3CH6A 4PGFA 2IUTA 1H8HA 2HNAA 5AW8A 2BP7A 2PAFA 4YI3A 1CZHA 1ZH0A 1K3TA 1PNVA 2B82A 1P7WA 2R7AA 5FNVA 3RRZA 1CUWA 4EBBA 4B47A 2XTMA 3CW9A 4ISBA 1FLNA 1T4GA 3LO5A 3E0XA 4OH7A 1GV0A 5LDGA 1V39A 2RE8A 5CFQA 2GVNA 5BN5A 1PKEA 4ES6A 4R69A 2J5XA 4MWCA 4A5OA 3KVRA 3WSWA 1UPBA 2KWIA 2OV3A 2J07A 1V4NA 1BHSA 4JA0A 1U0OC 3U09A 1A88A 2O7VA 1R6VA 3BMCB 4W5WA 5G41A 1XRSB 2CE7A 2V6IA 3N70A 2VWHA 1UXOA 2OHHA 2PV0A 3FGNA 4QYTA 3UJBA 3WKCA 3NVAA 4B3IA 1MX5A 2B34A 2TMKA 2G9UA 3KSUA 1C3OA 4CM4A 4Q1BA 5JYDA 2F48A 1EQ2A 4NTZA 1EFUA 4OKNA 4TMTA 2VJDA 1DKPA 3OFND 4X6XA 3N53A 2AOVA 2IIBA 4R0NA 4P2BA 3UWDA 1N0WA 1ULAA 3EXHA 1FFWA 1MC4A 1SXJE 4FE3A 4NMXB 1YJXA 1FFGA 4G8DA 4OXKA 1UK7A 4IRUB 1ZM3A 2C31A 1Q91A 3ZKWA 4CLHA 1N8KA 3ZHQA 1YB1A 1JQAA 5J5VA 4CM5A 4FHFA 2LD4A 2ZIEA 3GVCA 3PZBA 1H6CA 2W8BA 4M38A 1YASA 2POQX 4QGSA 1NVGA 4TMWA 5DBOA 4B45A 3EB9A 3I9MA 2CXNA 3S1AA 1GD1O 4IJKA 1PU2A 5C31A 1ISRA 2I78A 3VSEA 4S1OA 4XEUA 3HR7A 1G21E 2BSAA 3FPKA 4NICA 3OJXA 1SHTX 4FOPA 3KEFA 1Z4IA 2ZG6A 1THTA 1H2WA 3ETLA 1NR5A 1I9GA 5FXMA 1JI0A 3PKIA 4HOYA 5FWAA 4D5GA 1YZTA 2LZ0A 3T5MA 2DFDA 1R6TA 3IVRA 1UWVA 4WASA 3REGA 4PFQA 3IIKA 1TYZA 4BASA 2VKTA 3A28A 2P4UA 4L02A 4TKLA 4DA0A 1Y5RA 3EJWA 4JLKA 2PV7A 1HETA 5E0OA 2X8JB 3EH1A 5K3DA 5KYNA 1HFWA 4M0KA 2H52A 3LOQA 2V7UA 4GZ5A 1UOQA 4HX9A 4F5YA 4QJ3A 2QR5A 1XKQA 3EVEA 2CZQA 1FFXA 3TGLA 3T95A 1USGA 2DSTA 1TEVA 4M54A 1KS9A 3UJCA 3EYAA 2QA5A 1M2FA 3AESA 3OZEA 4AZ0A 4LF4B 2C2OA 3TLAA 3E1GA 2PFSA 2P3SA 2JHPA 3OD5A 4JOQA 1L5FA 1XTVA 2K2QB 5COBA 3BJIC 1XCMA 2YZGA 3UWKA 1V43A 3WRYA 2ZWOA 2W6OA 2GR9A 3E9NA 2GS9A 2XRYA 3WLHA 1TOAA 3EH2A 3K72B 1YR6A 3GDGA 3K9FC 5HOEA 3AM4A 2ZJ2A 4DV5B 4JBLA 4W7IA 3RK4A 2CYAA 4GKBA 4W6QA 1X0XA 1Z3CA 1CE8A 1ZPDA 2IP4A 2GGSA 2QM3A 4BO2A 3WDLA 4PVCA 3L0ZA 3OZGA 4H08A 1HL3A 3JWIA 2PXCA 1CR6A 3NHYA 3D3WA 2D6FA 1MX1A 4I36A 3KB6A 1NW5A 3QRWA 4GZ3A 4E1AA 4WI1A 1T8TA 1IIBA 1J0CA 2AI1A 3Q2IA 1TJ3A 1RYDA 4L8VA 3N8KA 3O1IC 5BW5A 3STTA 4UBNA 4LFBB 3DDWA 5B5SA 2Q6TA 5IN4A 4AI6A 3KWJA 1C8KA 2X8WA 2WM9B 3I6MA 1IY8A 1Y7HA 3PNSA 1JA0A 4H18A 2ECQA 1ZN7A 2YYAA 1QK3A 1I5EA 2ZAIA 2FW1A 3E18A 2ADFA 4H4DA 4UOEA 1J9GA 1PX2A 5EQJB 4LZZA 4RMGA 3DOJA 3PWSA 2XCQA 1KZGB 1QVRA 1I80A 3IP1A 4YGYA 5DM4A 1OI7A 2PH1A 4G86A 5EIBD 3H2SA 3P19A 4G26A 3RIYA 5DNEA 3LLCA 3URMA 3HWWA 4BFYA 5BPFA 1TO1E 4B4OA 1U0EA 2IEYA 1RW4A 3LUJA 5JD3A 2CCJA 4EI7A 3MIZA 3LUPA 4HF7A 2PX4A 4LVNA 1U2PA 3EVDA 4JI5B 3RSQA 5AW6A 2R6JA 4TQUS 1BU8A 3K53A 2PUWA 3ZDXB 5DM70 3U7QB 2V3CC 3JZAA 3LLSA 4Y2RA 2FPRA 3DOIA 2JHGA 1QX4A 1HDZA 2FPUA 4FTWA 3LKVA 4B35A 3S8MA 5JZSA 3OE4A 1GKLA 4FMPA 4PSAA 1W8IA 1KO8A 2JG3A 1R6XA 1XJCA 2GNOA 3IP8A 4DAOA 4JROA 3V1KA 3Q3EA 3RKSA 2Q46A 1X70A 1WKCA 2WDZA 4IM7A 2A84A 3RT1A 5ADWA 4C9BA 1GKIA 2R8OA 2ZPAA 4OM8A 3WDKA 3ZXYA 1Y7PA 1HDYA 2PMEA 3TTYA 5SICE 4BNUA 2R79A 2C84A 2ID7A 1U8YA 1PZXA 1V4BA 2J48A 1VE7A 2W2PA 3MD0A 4LJSA 4TN1A 4UCWA 5IJZA 4ZJYA 5K8CA 4HJXA 3S44A 1AXRA 1QO0A 2CXSA 1EI9A 4OQLA 1P1KA 5EEGA 1X7ZA 3HV0A 3BWCA 5D00A 2C4VA 3B7PA 4P4LA 2QZZA 1JLRA 3Q1LA 4Y1EA 2ABWA 2IKQA 4QUAA 3I23A 1N2ZA 1BDMA 2RHJA 1OAOC 3EK2A 2OORA 3S3TA 4BNTA 1M5UA 2X2FA 3O7MA 4WFQA 2VH1A 2IHZA 2W83A 2C00A 2Q2NA 4PM4A 2PKRA 1K7FB 5AO9A 5A1JA 4ZCQA 1F7VA 1ELOA 2FN9A 3IAS1 2YIDA 4EKNB 5JZ9A 2CLDX 3L43A 5KSWB 2ATXA 1F6DA 3ODPA 4P32A 3UK7A 4U02A 1VMKA 1AKTA 1LF0A 4FFSA 3AF0A 4FP9A 4QG7A 4Y2XA 3BGIA 5K3AA 5IANA 1MIOB 4D3SA 1XI2A 1HFKA 2FE4A 3OF5A 3F71A 3PHBE 4FYMA 4KQ2A 2AKAB 1TKBA 1ADGA 1FMCA 3ICCA 2AFHE 3D6VA 4IO1A 4YCLA 2XVZA 3O84A 4PYIA 4N5IX 1NDHA 1QRDA 4K6OA 5FOSA 3HU1A 1AH2A 5GZ6A 4KMOA 1X77A 3GXBA 2HDHA 3FCOA 3BBPA 5JALA 2NPIA 5DBIA 3G0HA 5AHOA 1DT5A 2OECA 4B81A 2PKQP 4KQXA 5KVQA 4DQXA 2NAFA 4BAZA 5H80A 3WWEA 5I9LA 2HF8A 3ZJVA 1A8PA 1JQ3A 3CEPB 4XX0A 3V1YA 2FUG1 1VHQA 4IX9A 2NAPA 5CFZA 4BX3A 2EIHA 3DOCA 3WKAA 2OO5C 1IAQA 2KHZA 4BAGA 1XRJA 3GJ4A 1HDCA 2R5FA 5K0TA 4HQKA 4J0QA 1WDKA 4GC9A 3FF1A 2X76A 1GQRA 2W43A 1G1AA 1Z5VA 2WJZB 3DNPA 1G8GA 1Z07A 3F98A 2B30A 3H4TA 4RX1A 5AKKA 4C3VA 2BJWA 1JFTA 1QLHA 4A1FA 2X9NA 3HJFA 1QAQA 5IKMA 1YJBA 4Z4EA 1F4LA 2UZ0A 1DC5A 3QLJA 1Y1QA 16PKA 4M1QA 1C9JA 4MS3A 3OFKA 1TEHA 3OO1A 1C9NA 5LYJA 3WV5A 4HNHA 3LNTA 4N41A 3RYFA 3KVVA 1TQ6A 4WKCA 5DOZA 1JKXA 4ZT5A 3BGWA 1XE3A 4WK0B 5DO9A 3V8QA 4OGWA 3QXCA 2HPAA 3UB3A 3LWDA 3UN1A 4K26A 4PR3A 3W79A 1X7YB 4HNSA 3I9V6 5KNBA 1E99A 1UCFA 2QF7A 4QTUB 3RAPR 3SS7X 1ENOA 1J2RA 1LRKA 4LQ4A 4L72A 4P84A 4E5UA 5KNCH 2JRCA 3GX1A 1L7EA 1B1CA 2C4TA 3MJFA 3TVYA 5CCEA 2GVZC 1XNHA 3P97A 1M72A 1J1UA 3SVTA 1ZOSA 2BFBB 3AF5A 1SJ9A 3HCFA 3NX4A 1QZTA 4KQEA 2N46A 2WV7A 621PA 2RMKA 1XPOA 1IATA 3R3UA 3H6HA 3TTUA 3ZZNA 4HDKA 1ULHA 1PZEA 3PHGA 3UJDA 4HNVA 2GH1A 1OA1A 2EX4A 3ERCA 2PGAA 4XQ9A 1D6SA 4F5WA 2CF5A 3OIGA 4I4LA 4X8OA 5CPBA 4L3WA 4PLHA 1HNZB 4I5EA 1UDRA 3GROA 4PONA 3UUFA 5JXWA 1NJ5A 2GN2A 2J7PD 4WCFA 2PUCA 3M6MD 5T6BA 1GTG1 1M2KA 3O3MB 3JSXA 2A33A 4CR6A 7ABPA 3DLHA 2QVLA 5I7FA 1VCOA 3D5TA 5F23A 1HDIA 4N0MA 3CF4A 1G3RA 1CT9A 1FX0A 3F90A 3QM1A 1YB6A 4L75A 5K3SA 4DSNA 5I47A 4DM3A 4L74A 4NHOA 2UZ1A 3M83A 1JF8A 3W8RA 1EQAA 4EJMA 2QQ5A 3DDOA 3B12A 3E22B 3QPBA 2FTKE 3GAMA 5L4LA 3U4CA 4DTIA 1L5YA 2QTHA 4Z4QA 4TLDA 2BMFA 2PX2A 3TQSA 4DZZA 3ZLBA 3T54A 3UYLA 5TIIA 3PXBA 1I0ZA 1Q95A 1QGDA 1T1JA 2O0MA 4WZAB 4CUZA 3UPTA 1J0BA 1T91A 2WB4A 1KEEA 3JALA 4JJKA 5M34A 4REOA 3BWBA 4Z4FA 2CXPA 1P31A 3HCWA 2ZW9A 4MGEA 2JVKA 1JS1X 2WJPA 2G83A 4MAFA 1QV9A 3EPLA 2AW5A 1SEVA 1COZA 3W7BA 4EFLA 1XD2A 4YGXB 5C1DA 4MWEA 1T8WA 1A8SA 4BTLA 1CUGA 1OI2A 3C6MA 4M9ZA 4P86A 3Q8MA 1CQXA 3TQFA 3KSBC 3BAFA 1CQZA 1HDEA 3H1GA 3UMRA 4PZUA 2BFCB 3WMGA 1GFIA 5IF9A 1OVMA 5CFMA 1EJ0A 3I8OA 2PJZA 3MINB 4R83A 1VMIA 5HUQA 2GILA 3DE0X 1K3UB 3KZKA 2FSPA 2H1HA 1P9WA 4CLRA 1H9CA 4TMFA 1UOPA 4NYJQ 3V97A 1YB5A 3NM6B 5DEOA 1WQ4A 2H07A 1QE3A 2OFWA 3NZEA 4G0YA 3WQQA 4B4WA 3QU5A 2VTBA 1NJ8A 4ZO8A 4JITA 1UXHA 4AJIA 3EVNA 4WL0A 1UFOA 3RG2A 1HGXA 4KQFA 2YDYA 2WBLC 3BXFA 3MMNA 4YCBA 1B0UA 3OPMA 4ENSA 3KPVA 3OO0A 4QBTA 1QWOA 5EXXA 5AQ1A 1WTCA 1OYOA 2QTCA 3AW9A 5AI6A 5GOZA 5BPHA 2QDKA 5EEHA 4DKXA 2XDYA 3IB6A 4Q9HA 2MCFA 3L46A 5H0IA 2DQ4A 3K30A 3QVGA 3ZBUA 1B0PA 2Y2UA 4GKKB 2C3PA 2ZJ0A 3E7PA 2YY5A 2XXAA 1SVOA 1X1RA 1ODIA 3LL4A 4MPPA 4Z8XA 2I4RA 1MZPA 4UBOA 3OHSX 5EFZA 1XFAA 3ILVA 4JYCA 4QU8A 4EHLA 1H6AA 5JAOA 5JSZB 3IEIA 3IEVA 1NN5A 1LJLA 1NW9B 2BDEA 3LUHA 1Z4KA 3M4NA 2QZ9A 2Q1TA 1A9XA 4TKUB 4B31A 4GGPA 4EG4A 4K6GA 1VLLA 5ESDA 3QI7A 4EYOA 1P3DA 4MLZA 4PFJA 3LI2A 2YYYA 1CQIA 1ESNA 4XAQA 3FYHA 1N5OX 2A7XA 1IOVA 2MYNA 3RFUA 3KVYA 1E1KA 3TLGA 2I4NA 2UXCB 2XYVA 2YMMA 5LP6C 3K70D 3NAZA 3EC7A 3KOZA 2QLFA 4EO4A 2YNMD 1B26A 4XD7A 1XDSA 4XPZA 2JDID 3SQWA 5EZYF 1YMQA 1QP4A 1Q6YA 1NNLA 4KNWA 3UAWA 3NRJA 2A0KA 4WJKB 3SQXA 4XGNA 1APBA 5KS2A 2X4GA 4EVIA 3FNRA 1VL1A 4BNIA 3NNSA 2ZIFA 3JQ8A 1MOSA 2Z1NA 3GVXA 3ENZA 5BNTA 3RS3A 1ML4A 2VA8A 4O4IA 4DPLA 5ULLA 4EH1A 2E6UX 5IVHA 4QOEA 4ZQEA 1WSAA 4DIFA 4MW5A 2Z5GA 3HB1A 1Z0FA 3UGQA 5FNZA 2H85A 1WB9A 4MRNA 4EMUA 4MA0A 4ZYUA 1RJGA 3DMPA 1B42A 4JB2A 3A27A 4M0DA 2AIRA 1WCIB 4IDGA 2PXXA 3G6WA 4E08A 4F7DA 1R8YA 3WWYA 5C3MA 2FQ1A 2BIFA 3QHPA 4Q16A 5FLYA 1F2VA 4PXSA 3G88A 4M9UA 2W6NA 3BRSA 5DBHX 2W2MA 4N54A 1C1XA 3E7FA 2O8DA 4FYIA 2J45A 4JP1A 4UU7A 1CEXA 1E60A 2B37A 3H19A 4C76A 1OJ7A 3MJRA 5CH5A 3TBFA 1XU7A 4UOZA 1A1SA 3C3BA 1E1MA 1KO4A 2NV0A 2JBHA 1D3AA 3PHCA 2Y77A 2ONKA 4AZ3A 1KH1A 3L1KA 2Y1WA 1W85A 3GJ5A 3I1IA 1J0EA 1Y1RA 2HJGA 2R2AA 3ML1A 4RAQA 2RGDA 1FXSA 4IZIA 1NRXA 4GR5A 2FLWA 2Q50A 1G6HA 2B8NA 4MP3A 1BX1A 1YK0A 5CX4A 1M67A 1XWWA 2WP0A 1K9SA 2MR5A 4I4TA 4X8MA 4DSUA 4CXMA 2EGGA 2H59A 1VPEA 2QGZA 1YQEA 1W4LA 3VM6A 2QLMA 1LY1A 4CKWB 3RUPA 2ZRGA 4GC5A 2FEOA 5AW2A 3LCCA 4MQBA 1WL8A 4P2GA 1E5QA 4WRRA 5A03A 2NZJA 1EVLA 3OLCX 3OT1A 1R10A 3OQIB 1KI2A 1TUEA 2VAWA 4UAGA 4AJ1A 4LJRA 3EE6A 2VI5A 3MJEA 1FUYB 2I6TA 3R9XB 4YWJA 3BRQA 4D42A 4DIMA 3DV0B 3PE4A 4RK0A 5CAEA 1P18A 3I04M 5AVUA 3FWYA 1ZGCA 3F3KA 3AG5A 2OO5A 3AR4A 3GLKA 4KB5A 4KXFB 4ZC1A 4CV2A 5JZBA 4RWEA 4YONB 4L3VA 1Y98A 3TQIA 2KM1A 1BJTA 3X1XA 4EPWA 5JHGB 1M5TA 2IXEA 1O4VA 1GNTA 3ZCPA 1QO0D 4H6WA 3FFAA 3K0FB 3F9CA 1DI0A 4Q7JB 2DQZA 3ZY6A 3AVQA 5A6SB 5CLGA 3TX2A 1VJCA 2H8KA 4M7PA 4GF5A 1PO7A 4M6WA 4V3CA 2QNRA 4TMKA 2QENA 4CM1A 1ORRA 1MAUA 1QCZA 1HFEL 2C78A 1DWUA 3EDCA 1A9PA 2QNBA 4O0LA 2C3UA 2VOJA 4D5EA 4ERNA 1RYYA 1GTRA 1CVLA 1EFLA 2J41A 5IM4F 1R0WA 6REQB 3C16C 4A8TA 1FNNA 1R3UA 4G0VA 2A9JA 3K2IA 1T2VA 2QX8A 2ZR9A 3KVNA 2EKQA 3UV6A 3E9QA 5FUMA 1FXWF 2Y1LA 2I4LA 3WGKA 3N05A 1IHOA 2P5UA 3EG9A 2H08A 1EX6A 3OH8A 3VTFA 1J24A 4BMDA 3UV7A 3GMSA 2IDJA 3IUQA 1XJWA 1E9RA 5G53C 2B25A 3EZ2A 4YR7A 3B2QA 4G8BA 3W6UA 3MMPA 1R66A 3SF8B 3C87A 2C04A 4ZANA 4IL5A 1DAMA 3KHKA 2YXNA 4MUNA 3NTLA 1S9DA 1C30A 4M1SA 5HK9A 2VQSA 3PTLA 4AUEA 1O87A 4N5NA 4GMKA 3ZJ4A 3SR0A 5K0NA 1LS6A 1K68A 5DCLA 3QUQA 3VU9B 5K3FB 3JRWA 1JWBB 4F4IA 1W46A 1Y9AA 3KYIB 3LX8A 1EBUA 4JI6B 3JQAD 4BP1A 1RZRD 1CKEA 1WUHS 3HLYA 3BUSA 1G9XA 1RXYA 3I3SR 5IKXA 3C39A 3VX3A 2C20A 5DIFA 1V5IA 4FKMA 2LR0A 2MHCA 1G7RA 2J3LA 1DJLA 2VBIA 1UXIA 1TCCA 2GNAA 1J33A 1DARA 4DFDA 2A5YB 3QUAA 2JIZA 1HOTA 2OGUA 4IIYA 1N75A 4J1TC 3EFOA 3QKSB 5LM3A 4J7AA 2ANBA 5ALYA 3W3AA 2IDKA 3NP9A 4XDYA 5D1NA 3WICA 1GKKA 1XJQA 4HDSB 4KVFA 2HO4A 3SMVA 4A36A 4GDFA 1Z38A 3M2TA 2GXSA 3WP0A 1ECJA 4ZA2A 1GL6A 3P0JA 1P4JA 2H0QA 4A8HA 4NG5A 4CIXA 5IYZA 3HMKA 3QNWA 2LKCA 5FJIA 3WK8A 4IYJA 2NUPA 3EQZA 1T0PA 4CQLA 2PH3A 3PFBA 4UU0A 5IBRA 3GDOA 4YV2A 3PJRA 2QN1A 4COKA 4IMRA 2QP9X 4MV0A 4IGIA 2X0EA 1G8PA 2WVJA 1ZIYA 3UBTA 1BZYA 2O54A 1G5PA 2BTOA 4I46A 2LUOA 3OFNA 5DMHA 1N6IA 2C2HA 2C4UA 3KTDA 5JYEA 3NHFA 3C7AA 3BAZA 3ZIUA 1KKMA 1DXQA 1SWVA 3KQYA 4YRAA 1YQTA 2QY6A 4FDMA 1K6EA 5JMTA 3CRRA 1T9GS 2ZWAA 1MMFB 3D6JA 3DWIA 3GEHA 3Q87B 5CTAA 3TR6A 4DQUA 1EZ4A 2BW0A 1JKMA 1SCAA 4P3YA 5L51A 1VKOA 2HNBA 3HE3A 4A92A 3RIHA 3ZE8A 3K5WA 2HWXA 2WM8A 3LIIA 3P45A 1IRXA 1CY0A 3LY9A 2H2DA 3GLGB 4MRAA 3LGXA 2ZM5A 3KJQA 1SCUA 4HXGA 4WXYB 1FZTA 2CDBA 1EWRA 2C4WA 2HV8A 2ECFA 3GMTA 3SM3A 1MW8X 1CLUA 3LY5A 4MVJP 2W0SA 4OO3A 1I0IA 1YR2A 2HWUA 3DAOA 3ED1A 3M9WA 5G3YA 3TTSA 2N0SA 2GEKA 2EQBA 5JSKA 1ZI8A 3WO1A 2QY9A 3FYSA 3I4CA 4YQFA 4WLOA 3EFOB 2BDTA 2VJYA 4UARA 4Q1VA 5PNTA 3S2IA 4F6LA 4A73A 1XMVA 2WU8A 4LJYA 3GT4A 1UXKA 1NY6A 2HFJA 3P96A 4GMDA 2UYOA 4JY7A 4C4TA 3PLRA 3VV3A 1LKZA 1J97A 1IL0A 3F3MA 4Z4HA 3TCNA 1N6LA 1H0RA 4Q3EA 2HNKA 4TYWA 1VL0A 3QVOA 1EFDN 4IHAA 2GDZA 1KAGA 1JDBC 3HXPA 1R00A 4ZV4A 3FWKA 4WWHA 4BQPA 1JQDA 3OM1A 4DV0B 3V00A 1C9MA 3RJMA 1ATIA 5IC5A 4HQNA 1UDXA 1KGDA 1Z7EA 2JAOA 2PIAA 4MKIA 1DFHA 4GRAA 3A32A 3GN2A 4I81A 2ISCA 4R9NA 3G85A 2WWFA 3LPDA 3I2JA 3IS3A 1T36A 1C7IA 1BS9A 1U2GC 2J30A 1M33A 3NHBA 4IMPA 4RHCA 4FGKA 4E14A 2BFPA 4K9RA 1SA0A 1M2EA 2NT4A 3SZUA 4YRCA 1YOVB 1CQWA 1HRDA 5EXDA 3UAZA 3GF4A 2HY7A 4BVKA 2QGNA 2CXRA 1KZ9A 1VP3A 2CWWA 3AONB 1LW6E 3KUDA 4K8RB 4JYPA 5KQSA 2CHEA 3FBTA 2PT6A 4PLTA 4EVSA 2RHDA 1G7CA 2B5VA 3HN6A 5FBLB 2Y92A 3G5MA 4C6TB 2ZCJA 5K7SA 4IWXA 1M83A 1Z17A 1AQIA 1JVBA 2QMUA 3KD2A 3KR9A 4UHCA 1EXVA 4D97A 4G1MB 1KDPA 4KACA 4FNOA 5FBRB 1P0CA 5D2CA 2I76A 4MQ4A 2O8EA 3T5DA 3WL4A 2GX6A 4A0RA 3KLOA 3PGXA 5BWNA 2I4TA 4PTLA 3ZGVA 3NHUA 3B7GA 3AVWA 2J0QA 4B71A 1DAFA 3CO0S 2I66A 3IA2A 3LYUA 4F92B 3W9BA 4ZHSA 2NO5A 3I9JA 1ODJA 2IBMA 3SKXA 1ZGZA 1S5PA 1UPCA 2JLWA 4E5VA 4FEAA 3H11A 2X4IA 2XUDA 3I09A 1A8UA 4OU5A 3LT1A 5DGIA 3FB1A 3SSAA 4DUPA 3SXPA 4P7FA 1YCHA 1CUBA 2O1EA 3DTVD 5F2OA 1SD1A 5F1OA 3AEZA 3JSAA 4C30A 4X64B 1AMUA 4LE1A 4ZI5A 3WFZA 4EGJA 3G9UA 5KREA 2PJRA 1XL0A 1CFZA 2CXOA 3GRAA 1AUVA 1AZWA 2QXYA 4L8FA 3EEBA 4GNRA 2OD7A 5HTKA 5EXSA 5CDHA 1RJ9A 1NW4A 3WA6A 1WOMA 4HN4B 5ITZA 4QZVA 1PJCA 3HXOA 5JCOC 1XCBA 1C7QA 2NLOA 4FGZA 3D1VA 2YWRA 3NDRA 4OGFA 3ZD8A 2NW6A 3V4LA 2VATA 3GFOA 3K1AA 1M7GA 1HH4A 2WTAA 4MVYA 1AIPA 2ZIXA 2A1UB 2WKPA 1PX0A 1T0HB 5CGQB 2IU6A 2A5DA 1RPNA 1CDOA 2VH5R 3E2PA 1EX9A 1FSGA 2AVNA 2OM6A 3HCAA 3PCRB 4RS4A 5SYAA 1YJQA 2OYRA 1B4DA 4GXQA 2DSNA 2XYRA 5JVDF 1U2ZA 2O8NA 2LP4Y 4X65B 1O96A 2QK4A 3OIDA 3IUBA 2VJMA 2X0RA 4DIDA 5A71A 3OZVA 1R6BX 3NPAA 4EMSA 1WCIA 5KHLB 4J2HA 4O08A 1XTRA 4JN6B 1RXUA 3DGEC 3PQFA 3K70B 1YL5A 1IMOA 2J6BA 1QHSA 1PFKA 2HPZA 5J43A 1L4MA 1Y81A 1KI1A 3V8PA 4M99A 2OMKA 3DMFA 3QOFA 4QFCA 2R25B 3PNPA 3KQTA 2WIFA 2DUWA 3A25A 3IAXA 4QOIA 5HR5A 2D1QA 1OPXA 3O9ZA 1KZ7B 2ENUA 1OIVA 3GP8A 2F1IA 4QHYA 3C45A 1CJMA 2JS7A 1NTOA 3STUA 1EE2A 5HA5A 2Z95A 2IX3A 1RSZA 1YVEI 3SAJA 3DCIA 1YB7A 3UA3A 4RWZA 4KQJA 4YRDA 1DIAA 4DIKA 4BO4A 4H4CA 3ZHBA 1ZHHA 4HAVA 3KRTA 3LVBA 4C7JA 3QITA 3V7UA 4U00A 5M29A 3FKSD 4ER7A 2M98A 2XB9A 3EAGA 3HMQA 4HCJA 4DKJA 1UMBB 1U80A 4QQKA 3SHTA 1YRYE 5FLKA 3PC8C 2DUJA 2W2KA 1TECE 3PJFA 5C8DA 3W8NA 4KC0A 3F73A 3ZW7A 3ZQ4A 4MDFA 4B82A 1NONA 4UTXA 5B58C 1L7OA 3UW3A 3O2SB 4R0VA 1NMZA 3CLTC 4QTYA 1U7UA 4ZOLB 5HF9A 2JJQA 4EYGA 4MYUA 4ZEWA 2H48A 2YJ3A 1QFMA 3ETGA 4G0ZA 1Z0JA 3C97A 5P8WA 1Y3CE 1WHSA 3A1WA 1NN3A 3FBGA 3LLVA 3W3ZB 4ZMBA 4ZYYA 2ZS7A 1X7XA 3RAFC 3A6JA 1G2OA 5EHZA 1CETA 2HM7A 3K5PA 4YXFA 4OBWA 5FO0A 4JMPA 3NASA 1WKBA 1M7HA 2AFHA 3C1TA 3RC2A 4ESOA 5HIKA 4NXNB 5KOHB 3KQWA 3PFCA 1CUFA 521PA 3I6ZA 3C98A 1MQ9A 3PPYA 3WYNA 1IB0A 3RNLA 5KPDA 3TLMA 2Q3EA 3PXGA 2HHHB 2IHTA 1IXRC 3R4CA 1XQWA 2PGXA 3QVWA 2NO4A 5BW4A 1VJ1A 4R3WA 4G5FA 4HDCA 1H8HD 2I03A 3N2ZB 1XZBA 3PUVA 1ZUHA 1O03A 4R51A 4L5IA 4D9EA 2QD3A 3A3KA 4FEGA 4MOWA 2OCIA 1QH8B 3JD3A 4RHFA 2ZYTX 2RG7A 3K2EA 4MHSA 3RFVA 4YRGA 3RK0A 4HV4A 4O4JF 4YECA 4OX9B 2J9XB 2B69A 4TMVA 1XMSA 4JC5A 4JJ8A 4JI1B 3WHPA 2FVYA 1SVNA 4N49A 1OXBB 2Q4RA 4XD7D 3PXXA 2GF9A 2PZBA 3LDAA 3ZWKA 2IV3A 3FYUB 1H8ED 3KR0A 1Y48E 3OEHD 4NZYA 1K8QA 2HSZA 3O91A 1JSCA 5C8YB 4YPVA 5D87A 3HKCB 4IPTA 1T2AA 3VGJA 3Q15C 4EGQA 4O2BF 1CS0A 3SIXA 4PFSA 3HJBA 3UT0A 3ZV5A 3MJ4A 1YS2X 2W6QA 5CHYA 3DAYA 4WXRA 1W1WA 1HOXA 2GJSA 4G1FA 3MT0A 4AKEA 3UHFA 3KCQA 3P9PA 5EWMB 1U98A 2JGRA 3OKCA 4GR9A 4LF9B 2RAPA 2Z3VA 2CUKA 3D4BA 4NBTA 5KNBH 1ZO8A 3FCAA 1GTSA 4GRDA 3ICQB 3MGKA 4WZ6A 1NBEA 1IHUA 2DBQA 2ZTHA 3BJRA 2K6GA 5C7IO 4C29A 3K5IA 3KWLA 5TJHA 1KTIA 4IFEA 5IARA 1JAHA 1KMHB 1YRLA 3QEBZ 3A11A 3KPUA 3KZNA 1PW5A 4XLZA 3H1TA 3H8JA 2HGSA 2WA2A 2WM2A 3B5JA 2D1RA 4JOBA 5E1BA 4DL9A 4YMGA 4DV1B 2VZEA 1Y42X 2A14A 4WGFA 1ONSA 1N0HA 4WY5A 5TGZA 4ASUD 2E0IA 2NM0A 3MS2A 4M4SA 4AIIA 1JH8A 3G23A 1C0PA 3ZLVA 5KX5B 3AUJB 1JEQA 4KKXB 1DFGA 2CXQA 4UXIA 3W5SA 4MJ7A 4OCZA 2E5FA 4YCNA 1PZGA 2JFOA 1ZCJA 3EY9A 3FTQA 1U7XA 3R1IA 1BWPA 1SU4A 2QL6A 1RR6A 4QRIA 2QRUA 4EW2A 3AFMA 3E2IA 2ZGVA 3B3AA 1JVNA 3K1TA 3KSMA 3QYPA 1RKQA 5CT4A 1CZUA 2GA9A 1QO7A 2WIAA 3A1SA 4KIUA 3WYGA 2NMVA 4D43A 1O58A 4URFA 1PE0A 2XMPA 4WE3A 1HDOA 3KL2A 2Q5LA 3KT0A 4Z53A 1CQIB 4A8JB 2R87A 1FB5A 5HS6A 4OSPA 1KOLA 1G98A 3BE6A 2AJ8A 2DPXA 1KVRA 3B5EA 1SOWA 4HMOA 4MWSA 1SGWA 4G36A 4Q12A 3R9WA 1RI2A 5GJWC 4I1VA 2FZEA 4E13A 4GQBA 1WW2A 1H3NA 1LPPA 3C6YA 3FLAA 4X00A 1A8QA 1P5ZB 4N3NA 2C94A 2P6UA 3NQ41 4S1NA 1ZVMA 2AC7A 2D5BA 4QHSA 3TRIA 2DXIA 1VG8A 2GBIA 2JVJA 5JO9A 2TYSB 4NAHA 5AW5A 1FYDA 3F6EX 3L4BA 3RC3A 2W6ID 3TQRA 4D8UA 2GBLA 3RASA 1DQRA 4DGSA 3RWBA 1PL8A 3DFZA 3NKVA 3OLWA 4EBFA 1L8XA 2JLCA 4EELA 4GXNA 3AR5A 3AUFA 2HW8A 1UBKS 3GYBA 4O4LB 1LX6A 2X86A 3L1IA 3NHJA 2P7IA 3RUHA 1ZJ6A 1P29A 5DTRA 3B5IA 3FSEA 1OGJA 3DFKA 1E69A 1Z2AA 1WY7A 2UUAB 4YAJA 4NQZA 4OH1A 1K9VF 2PKWA 3MWDB 4RLSA 5KYUA 1NIPA 3FRIA 3PUHA 4M3NA 2DR2A 1SC4A 1HRKA 1N7IA 1RMTA 2DH5A 4DLUA 3WAGA 2A4MA 4Y0NA 5FD8A 2ZAGA 4J90A 2BVNA 4QULA 3RHTA 2DOKA 3RS7A 3OTHA 2AE2A 1RJFA 4JR0A 1E0AA 1AKQA 1PR1A 4LY9A 3TPCA 2XIQA 1FLVA 1N2XA 1OXKB 3E4CA 1RLOA 2BUBA 2EWWA 2FE1A 1M9NA 2WAYA 3DBOB 3O1JC 3O4IA 4BRWA 1RP1A 2UU9B 1CQJB 3ZTYA 3TLBA 1XRMA 3H2HA 2PMKA 4MXDA 1U8UA 2Q0XA 1YDGA 3BMOA 2ZRDA 2G6TA 5IAJA 4UVGA 3UUWA 3WGIA 4G2TA 1XRLA 5DLEA 2B99A 4MUMA 2XWQA 2Q27A 1YUBA 1BDIA 4X92A 1E1LA 3C3PA 2WHQA 4ZYWA 1VJGA 2OZPA 3GDFA 3STVA 3IURA 4DG5A 1TT5A 4XE5A 1A9SA 1V6CA 4J7CA 2X2OA 1NM5A 2P6OA 3CA8A 5IULC 4LXQA 3AVXA 1RC8A 1R0RE 1K6MA 1KDZA 3OEWA 3TTTA 2GN9A 3GIDA 5DNCA 4GFDA 5C37A 5KO2A 1KK1A 3ACCA 2OILA 4M36A 4FILA 2JJ1D 3M81A 2Q7OE 1U7ZA 2BI8A 4I9HA 3T7IA 2GCIA 1T9AA 2QQFA 4D7AA 2IHYA 4BEBA 4IOKA 4Q00A 4NE7A 1BDHA 2AG1A 3QTLA 3R74A 2REOA 2HOQA 2Q9AA 4WQMA 1PAUA 3CSUA 2IPOA 4M9XA 4QXAA 3ZJ5A 1BW9A 4DQVA 4LOLA 3CLSD 3PFIA 2FEMA 2YIJA 3LS2A 1FW8A 1ZJZA 2YBDA 2W90A 2YFHA 1WD5A 2JJ1A 1IRIA 2OFOA 2PVSA 3GUVA 3A4TA 4QYSA 1Q0QA 1T2NA 2MINA 3TO5A 1QSGA 3OCVA 2HCTA 5F5XA 5EJAA 4DC0A 2VPQA 1UF9A 4OHOA 5LA6A 4PBTA 4F3CA 5ITWA 1Y8RB 1ID8A 4EUNA 1ONOA 4CU2A 2H7XA 4KQIA 4OHZA 4U2EA 1LSJA 4WESB 3USES 1GPUA 2ZRQA 3AHFA 5ER6A 4DG9A 2BGJA 4LDPA 1E2JA 2VJQA 1O6GA 3T94A 4DMCA 5KYWA 1UBCA 3DFMA 3G2MA 4BKMA 1QWSA 1X19A 4AROA 1A4RA 4KLRA 2O5RA 5CH8A 2BKVA 3FTNA 1F9AA 4YO7A 1E62A 2WUGA 1H0HA 4S3MA 5IXSA 1TYDE 4WZBA 2W6PA 1RDFA 2RH9B 1CJUC 1NXWA 3OI7A 4KSYA 3DBLB 2FHPA 1ARZA 1G6KA 4KVGA 4CT0A 4E03A 2ECOA 1IHPA 3RU9A 1E2QA 4LF5B 3TZEA 2EP7A 1YCFA 2HSDA 4YROA 4BN4A 4CL8A 2VEOA 5JEEA 1CNMA 2OOKA 3INTA 1EDEA 3ABRB 3OZCA 4BZWA 3AL0C 1VYUA 2Y2VA 5F7JA 3OZDA 1KEVA 3LUCA 4ZIRA 4KN6A 5JH7A 1YRHA 4ETMA 4YUZA 4DAEA 3MSCA 3S2EA 1CY1A 5EJMA 1CDEA 3HSYA 1PK9A 3IIMA 3V8RA 1SIUA 2DQSA 2N9UA 4HZUA 4IJQA 1GSOA 3E9MA 1HEYA 2GAOA 1EZZA 5E2IA 3K71B 1E7MA 2ZI3A 5EAIA 4LNUB 4DLKA 3QIAA 1RM0A 4A15A 4YDQA 4ZAGA 4PO3X 3G8YA 4ZGBA 2G25A 3FTCA 4FWIB 4K81B 4PZZA 3SF8A 5JDCA 3CNNA 4KEAA 1UT5A 3THXA 3HBMA 2H3EA 1ML3A 2QMQA 4DXDA 2P41A 3GRZA 4P54A 3U16A 3MXOA 1C8LA 1TTQB 1JAZA 4UZSA 3E3MA 2C82A 3L7LA 2XGGA 3LG2A 2VF5X 3G79A 1E4EA 5JV5A 2VPZA 1TK9A 3T7EA 2EG5A 3B6EA 3D5EA 5LLDA 1W87A 3O8CA 4YCAA 4BP8A 1KQFA 1E3DA 1J0AA 3IJEB 3IE0A 1CF4A 3IHLA 4FLEA 4FSXA 3RC1A 1E8NA 4FZ5A 3FBWA 5CJJA 5HQJA 2O07A 3BERA 5TRTA 1M6EX 4BV9A 1XXHB 1PYOA 3SN6A 4RIIA 1RWWA 1VM6A 1H93A 3EGVA 3F9IA 3I0ZA 1C4XA 2ZRBA 2WSIA 1KORA 4N5LA 1KMCA 4B2LA 2LWIA 5AM1A 4B17A 3I32A 6CHYA 1KBQA 3G9QA 4IKOA 3PFKA 1NSYA 2NG1A 1RZVA 3L04A 5HJ2A 1OE0A 4IS2A 2JHAA 2P65A 2ONZA 1W8DA 2G88A 5F12A 3KIPA 3FUVA 3DYBA 2P27A 1NASA 1L7BA 3VJLA 3EPKA 2O2IA 1YTLA 3LQQA 2VNKA 3FUCA 3H9CA 5L7YA 3SNKA 4OU4A 4AG6A 1G8KA 5IH7A 1L5HB 1JP7A 4S1WA 1XO1A 1A71A 2BFCA 3AUYA 3OURA 3M3PA 4HB4A 1CR0A 2QRZA 3BIFA 2QDXA 3BTUA 4IQ8A 4XARA 3T7RA 2I2AA 5KTMA 1L5GB 4ABTA 1NMEA 3WLNA 3E9EA 121PA 1ZRMA 5A02A 5IKEA 1JAYA 2CLIB 4URHA 5DHTA 4B0OA 4DG8A 4M6WB 3UJHA 3F67A 3BEOA 3A4YA 3JYHA 4M21A 1Y1TA 2G7ZA 5FT9A 1L4NA 2QLTA 2CDAA 4OJKA 5TF0A 1N78A 4EFDA 3FPHA 2FWRA 1LPAB 1SHUX 2D7CA 2QZ4A 3HNRA 5TPWB 4ALIA 1EWYA 2V5AA 1UFVA 1PT9A 1M34B 2LDBA 4ZO9A 4DZTA 1QUEA 3DEHA 5HSGA 2R8XA 2AN9A 3EEIA 4EY7A 1RWPA 4UOQA 1I13A 4X54A 4XCQA 3I01A 2IK8A 1K86A 1G8YA 3H97A 1YI0A 3DEAA 4WERA 4OREX 4FFMA 1LTKA 1U1FA 3NIFB 4Y2HA 4CDNA 5AUPB 3Q7PA 2PRSA 3BH6A 1H8EA 4KFSA 4URWR 3V8NA 3ZHXA 1V11A 4KKVA 4EPRA 1Q7TA 3TPZA 2R1ZA 1NVUQ 3UEOA 1DCMA 4BXOA 1ORIA 4J0HA 4BGUA 2E4AA 4BVGA 5EWJA 4PYNA 5G0WA 2RGRA 1QGOA 2GPSA 2CJFA 5LFAA 4Z4IA 1IM2A 5LZ5A 5LXTF 2O50A 1B76A 2YV1A 2XMCA 4H0CA 4MWZA 4ENRA 2JGEA 1KOFA 1FE8A 1HFJA 1KJIA 1GQFA 1L2TA 2HXGA 4HWPA 4MV8A 5F76A 4M8LA 1AS2A 2O8BA 4C5CA 1T8SA 5AKHA 3G1WA 3WK7A 3H5NA 5BN4A 2V6FA 1MABB 2ZYHA 3HVJA 3QY0A 2WP8J 1MB0A 1NU6A 2JD0A 4QUGA 5KDDA 1Z5ZA 4BXOB 5D1HA 4PLYA 3JQ8B 1C3OB 4CM4B 5LQDA 3B70A 4R54A 3IOCA 3EX7C 2B1QA 3OHMA 2VSYA 1D5WA 2QUBA 1GCAA 3MB8A 1R7RA 4H7IA 4IHKA 1ZSVA 4TZTA 4Y2GA 3R7SA 2I8LA 3HN7A 3FVQA 4I99A 1GCGA 3C15C 1H5NA 1C9DB 1U3GA 3D9QX 2GMWA 2QSJA 4YJDA 3A4VA 4GI5A 1JRLA 5JE8A 2EJWA 3OZUA 4KSBA 3GPLA 1JLHA 1I4LD 2I6FA 1P8JA 5YASA 4PG8A 2WTXA 1UJNA 2XNHA 4PAWA 1GTVA 4GHWA 1DLIA 5LJIA 1Y4SA 3L6RA 3H1FA 2XKAA 3B8EA 1KC3A 4N3CA 4L73A 4QSMA 4O4HB 4GDMA 1I4EB 5DWVA 4DLVA 4RTRA 4P0TA 4PEVA 1N3YA 5DX1A 1H1DA 3VAZA 1TTTA 3NC0C 4ZDJA 5JSQA 1R64A 2CFIA 4B73A 2XXAB 4YJ3F 3LOUA 4RBNA 2IUSA 2PX8A 3U4AA 1JIQA 1QBGA 2BEJA 1V5FA 1ZP6A 2Z98A 1D0SA 2Q3MA 2ZBRA 5EHXA 1J9ZA 2OLKA 3SLGA 2O8EB 2BN4A 3DR3A 4XVQA 2C5LA 3U44B 1JAIA 5EPUA 3L0BA 4XASA 3PBKA 3NV9A 4P4SA 2GJ8A 1UPAA 3RO7A 1XC7A 2R6CA 4TTQA 5JPIA 3VR2D 5CT9A 3DBRB 4XB1A 4IGFA 4F5EA 1UADA 2JPDA 3NTQA 2BC9A 4KGDA 2W93A 3B36A 3DBLA 4NCXA 4UHBA 4BNDB 4ZQGA 4E2XA 1EDZA 4X8HA 1L1FA 3LK7A 5CDUA 2IA5A 4D4IA 2PSEA 1XEWX 3II6X 2GBFA 1OZAA 2C95A 2P2SA 3TLKA 2YBEA 3GGOA 2DHCA 2J0EA 2V45A 1YK1A 2DUNA 2PKQO 2XZDA 3BE5A 1KIFA 4L5BA 3SICE 3ACDA 4KR3A 1AOXA 3AI3A 3KLNA 1F8YA 1GZ4A 4N18A 5TXGA 4BMYA 1D2NA 5CLJA 3T1VA 2WI8A 4JLVA 4LRWA 2VJPA 3KB1A 4IJWA 5TY0A 3U1VA 2NZXA 4BKPA 2ZBDA 1W44A 4DLPA 1MXHA 1ZG3A 2KPOA 4N8DA 3TZQA 3HC7A 4HFJA 4X1IA 5LCXA 3UENA 1PR3A 3O4FA 4D6YA 4EQ6B 5K0FA 2CK3A 4DIEA 2R47A 2F59A 5SZHB 4QEKA 3O3CA 4D4HA 1UQRA 3OPYI 3VR4A 4CL2A 2VQ6A 3N2LA 5CX1B 1XTUA 2O8CB 4EHIA 4ZZ1A 3IPYA 2RJ3A 4TYMA 5J63A 2YZKA 3NTUA 5JJBA 1NHWA 2GDJA 4R8LA 2OXIA 2BAGA 3ONVA 4YUAA 3GN1A 3MBIA 2X5OA 4TWAA 4YXWA 4RKQA 2WKQA 3TYXA 4YCCA 2FFJA 4JDPA 4KXWA 2C83A 1HT1E 1PLJA 3WI7A 4C4XA 2ZUCA 4Z0HO 3CVVA 3K3PA 5LZ7A 2R8RA 1X9HA 3HEMA 1CR2A 1CUHA 1E3SA 1NI4A 5FBZA 4LE0A 2E21A 4K9LA 1WRBA 4WACA 1VLMA 4KZKA 4X63A 1E7SA 2WAAA 2PSHA 1B1AA 3JQAB 4JWTA 3C3YA 2Q28A 1PLKA 4N3BA 4WDQA 4WBSA 4DANA 1OH8A 1OFUA 5EZSA 1XA0A 3TQHA 4F9TA 3W06A 3SHQA 2VP3A 4P83A 3UCXA 1C7FA 2OCBA 2UUPA 5LJLA 4GI2A 4MEAA 2WQ6A 3EXHC 3IIJA 4IJUA 1NBAA 3ONWA 3SLRA 4DBLE 4BQFA 4HSGA 1L5HA 2EL7A 2HH9A 2L69A 3ZI7A 2XLCA 1DXOA 5DOVA 2ILTA 1K08A 2QLBA 3C6ZA 2O7RA 1SC9A 4UFOA 4FQ8A 2GTIA 4BO8A 1ORVA 4OHFA 4MPDA 1MC8A 1WQ3A 2YUTA 4BFZA 3E61A 4BVFA 2G1PA 4FFOA 2HDOA 4R0MA 1GG8A 5A3SA 4C4RA 3AP2A 4HQ6A 4KK3A 3HUDA 5ALKA 2Q3LA 5DX0A 5JT1A 3OVMA 4K9PA 1GL3A 4KYIB 4AN4A 3R0JA 5TQJA 1Y4UA 3FNGA 4GZLA 2XWJI 3EHEA 4AXXA 1PN3A 1S3SA 2YXLA 1JQEA 3WGTA 4AWAA 3L49A 3NHZA 4IR7A 4L95C 3ZDZB 3NH6A 3PUXA 2J3DA 1ODKA 2J7KA 1ZM4A 1XLVA 4KYUA 4MLCA 4NCJA 4TL7A 1U1DA 1O2DA 3EGXA 4BIMA 3S27A 3EBOA 4E30A 3I34X 5EKDA 5JECA 5TVGA 4C0WA 1JLKA 4ZT3A 4I2VA 1S2MA 1NVWQ 2H1SA 3EULA 4C1NA 4R2HA 4UBLA 2DQYA 4ZC8A 2QR3A 1D8AA 3PI7A 1HG0A 4N0EA 2VDRB 2Z8ZA 3AETA 4BLTA 2VZ8A 3IPLA 4A0GA 4K2HA 3F4KA 5CJPA 1BJRE 1AKEA 1FBTA 3JD2A 4LQLA 4M76B 1V6AA 2IYEA 3CB2A 3VJKA 3H7IA 4U7WA 4IRMA 4NESA 3AF3A 4TS4A 1W48A 5FTLA 2I3AA 1A2QA 2O0KA 4LISA 1GWNA 1MOPA 2RONA 3UMBA 3VSBA 2PAAA 1XN4A 4EVRA 1CHNA 3JXEA 4LBZA 4Q9NA 1Q12A 4DQDA 1N2JA 2I1VB 2X0IA 5BN1A 5EUMA 2R6R1 3EIXA 4UTVA 1DT3A 1WTAA 2BEVB 2CNLA 2ZAOA 3QELB 4MVJE 4KODA 4PHHA 2YJ4A 4Z9YA 1NLYA 1IQPA 4DPMA 4OQDA 3AFOA 1U3DA 3HRIA 4WV3A 5AVSA 5AJWA 1R74A 4IH9A 3CKYA 1J2TA 4ZOBA 2NU7A 4RPGA 1IXYA 3OOSA 5LOVA 4Z9XA 2PL3A 4BJHB 1DUSA 3R4VA 5ALDA 4HTFB 1LQUA 3B53X 5DYYA 5FR1A 4CGZA 4MKZA 3QW2A 1GPWB 4DLSA 2DERA 2F43A 1EXNA 1OROA 4P7BA 3EC1A 3FCUB 3I6BA 4XWTA 4F1WA 3OG9A 1W0JD 4D0SA 1VJ0A 4GBMA 3CLUD 1G5QA 4S2EA 4Q21A 3RJ5A 4ZHQF 4GMHA 4IQ0A 4A0FA 1LRLA 1YKFA 3SJZA 1UAAA 1NVXQ 4F06A 2LCIA 3PHJA 2QTRA 4Z4GA 1NQUA 2DTDA 3SP1A 1D2GA 2GK6A 4YMWA 2AC2A 1T9ZA 4E09A 2CZGA 4RIGA 2PUBA 5FTJA 5TLSA 4CMHA 3QWHA 4PN3A 3RYFB 1V47A 1H4VB 2IXAA 1JEJA 1T4CA 2PZEA 2Z9DA 3IQFA 3RJTA 4AF7A 2G4VA 4CTOA 4HFNA 4BYGA 2Q29A 4BNMA 1AUXA 4FR0A 1YQGA 2ZR0A 2HIHA 3ABZA 4IF4A 3M1YA 4GW3A 4JI0B 3DBVO 3IP6A 3PX3A 4HRXA 4ND5A 5IJXA 4BLSA 5IT5A 5JAMA 3IQWA 4DCPA 4TUYF 3WNBA 3PQEA 5LIPA 5DYWA 4Q05A 1L9KA 5HMLA 1NVAA 1L4YA 1X86B 4HWRA 3MILA 1ZUNA 3P0FA 1T25A 4W7SA 2A5LA 5DLQC 3W5CA 8ADHA 3I8SA 4QJ4A 1T4CB 3CFYA 2J46A 3K70C 3P9YA 1NBIA 2QVXX 5DSZA 3VHQA 4D56A 4Q3CA 1D09A 3HKBB 3GLVA 1N3BA 1OB2A 1J20A 4NV1A 1JU3A 3HO1A 1V16B 2Z56A 2IUFA 1P0IA 1SG6A 1GPDG 1PJ8A 1YGPA 3IIEA 5CR9A 3JS5A 5FWYB 1VSQA 2I3BA 1K89A 2OFPA 1P1HA 1AX9A 3L0DA 1MVLA 1GY8A 4GOOD 1XUOA 5FNVB 1MGOA 4MW4A 4Y9SA 4NMMA 5BUCA 5K6AA 5AKEA 2NZ2A 2FF7A 5AJTA 2XNDD 1AGNA 2Q1XA 4PHFA 4HTFA 1LV7A 3NBKA 3GV0A 2EKPA 2NVWA 1ZGAA 4ZTBA 4IUDS 2O1WA 3GLGE 1RWQA 4NCIA 1BX0A 5AK0A 2QN6A 4ISCA 3BD7A 4OD0A 4CMIB 4TYQA 2VZ0A 1VMDA 3G2IA 1C0LA 4FUQA 2HJSA 4K1LA 3WBBA 1SBYA 2P1ZA 1AG9A 1KFCB 5ELLA 2XUAA 1RQ7A 2W2QA 2DKFA 3P2YA 4NV0A 4WN3A 1FLAA 10MHA 8MHTA 1CWUA 1DP4A 2VHUA 1L1QA 2ZJFA 5JW6A 4IMIB 4FLFA 4KK4A 3PSHA 4LZNA 2X15A 4KYTA 1MAAA 1POXA 1T8RA 3GPDG 4MCAA 1LK7A 2JFVA 3E9RA 2F9FA 4A6DA 5TMBA 5T4FA 1T35A 3FPEA 3MWDA 5KYUB 4HGZA 4ENPA 4U2GA 3MZ0A 4EGSA 2Z1DA 2YZ2A 1UOOA 4F04A 3WNCA 3A70A 3SBDA 3H1EA 4Q93A 1HE1C 1P7YA 4EFNA 2QQGA 2QROA 4JHXA 5EE0A 1H9AA 3AVUA 1W34A 5FKJA 4YQYA 5K99A 2Q0QA 1ES9A 3DT6A 2BJVA 3KQSA 3GJ7A 2IZ7A 2A92A 3AI7A 2RGNA 1T6ZA 1F0PA 4L07A 1EFRA 4NR0A 1LLFA 2GXUA 3CNEA 3JQAA 1DINA 5E7QA 4Y2VA 2ZUUA 4P0PB 4R8RA 3MWFA 2IP1A 3A8TA 2C4NA 3UIEA 2OUKA 8AT1A 5KCZA 1T2EA 2HREA 3KKPA 2ZREA 1P2DA 2MSDB 5FHQA 4D3FA 1E2FA 3EUWA 2B3DA 2IEBA 1P9RA 2VJAA 3H4MA 2AMLA 4Z6KA 1SXJA 1G38A 5DK6A 3EGIA 4J3FA 3K4QA 4TS1A 1I3LA 3EQ8A 5I7HA 4LC9A 3HLKA 3FNQA 4J3NA 2NIPA 2PMBA 2WUFA 4WXMA 2XWSA 3T1HB 3L7MA 4BNFA 5CXUA 3V4PB 1FNMA 1ZNZA 2YXBA 2Z30A 4HAXA 2EC5A 4RETA 4BRZA 1QQ6A 3DTTA 3KS9A 1DAOA 3RAGA 3LYLA 5THKA 2VK1A 4KLAA 2XUGA 2P62A 1MGPA 4KFTA 3HYSA 1GTJ1 2BI4A 2BM1A 3RROA 4OEHA 5EMKA 1M34A 2ORYA 4EHBA 2E87A 4HYEA 5ALLA 1I7SB 2AWOA 3ID6C 2PRYA 1K7SN 3CZPA 4TTSA 5CW1A 1KU6A 1IN6A 1DDOA 2ZQYA 2ZYWX 3DP7A 1DOAA 1E2GA 2D06A 2BDUA 3E3LA 2D2IA 2ZROA 2ZUDA 3TR5A 3ASYA 4UVHA 3T7AA 4BGIA 2REQB 2W6JA 4RJKA 3DQZA 4UM7A 4W5OA 3T34A 5B1HA 2CXHA 3LGSA 1N6RA 3BIOA 5AOVA 2G04A 3X43A 2OAEA 1UIMA 4X1YA 3R0ZA 4UASA 5GOTA 3RC9A 1E7WA 2WINI 4UZEA 1EUYA 5AK3A 2B6HA 1GZ3A 5KJ1A 2IVFA 1GU0A 4Q03A 5KU7A 1XALA 3TKAA 1X7WA 3C6BA 3JALB 3K92A 1SUCA 4ND4A 4W99A 5FUYA 4AWXA 1Q0UA 3GLTA 3N0XA 4HWKA 3SIRA 1D4OA 1TRKA 3KP1A 3O82A 2OCLA 3C4JA 4AX4A 2YL2A 2IL1A 4X90A 2VYQA 2GYVA 4MKRA 3RARA 5M5BA 4RMNA 1J56A 1NUQA 2ZSBA 3RYHA 4U2FA 4A2CA 4UUOA 2BM0A 3MWEA 5CCDA 4U7TB 5DISB 5BSTA 4HH0A 3FI9A 4YWHA 2DTXA 5KOJA 1U7WA 2CVFA 4X60A 1A77A 2I3ZA 2PH7A 1PL6A 3CUUA 3G2PA 3HHEA 3IMCA 4G0NA 4P4GA 4PLVA 2Z6AA 4IAOA 1K27A 4JEUA 3PJDA 2NZVG 4HR7A 2HD4A 3GD7A 4MWTA 4J4HA 1P5HA 2Q5OA 3QJYA 3ZBQA 2Z3ZA 3LA6A 2X6QA 2BP7B 1X38A 1OGYA 3GPIA 1KEZA 1BCSA 6GPBA 3AV3A 3LQ1A 1RD4A 3CU5A 5DTIA 1JEAA 1MLDA 2AX4A 2YIVX 1KY4A 3UJAA 3E81A 3OUUA 4QASA 1QOQB 3LCUA 4WUTA 3VVBA 2H54A 4GLOA 1FRFS 2QRGA 4E07A 2QD4A 2UYYA 4HC4A 2OBLA 3AGQA 1YV9A 1NP6A 4F4JA 1WDTA 1RKUA 4BE7B 2HK8A 3I5XA 3NO4A 2CDNA 1EWTA 1U4OA 1ULUA 1YMUA 2HLPA 2BGKA 1NWCA 2XDQA 4GL4A 2VYND 1PNOA 1JIXA 2K87A 4FYHA 5IVPA 1YTUA 2WUVA 2RHCA 1KZ1A 3KHTA 5BWLA 2AN1A 2IPLA 1KYZA 1X1TA 2A9QA 2W11A 2P5TB 2D3TA 3EN0A 4GMGA 4M88A 2PX3A 7MHTA 4HVLA 1AKRA 3ZDRA 3RBZA 4BWFB 1TZBA 4RVOA 3A4NA 3OJCA 4MIKA 1JJAA 2E85A 4EM6A 1RKXA 4KW7A 1CRWG 1HT3A 2ZBEA 4FGSA 5ITSA 2FZKA 3VO9A 4RV4A 1H2XA 1A9XB 4HPJB 1C14A 4JJFA 4M1MA 1OZFA 1PJ3A 1XD8A 4NCNA 5JMPA 1BGWA 1BC5A 4Y2PA 3HDGA 5FORA 1DV2A 2WU0A 2AFIB 2FSUA 1X7YA 3NHMA 1LVUA 5CYOA 1QQBA 5FAXA 3HI6A 4I5FA 821PA 2WF6A 1Z34A 3DD5A 1TEZA 2Z5FA 2CHFA 4OLFA 2JFHA 2F4VB 1T8UA 3F5SA 4ZYXA 3T1NA 2CXUA 1E6LA 2VF7A 5KI6A 1M2JA 3ZHVA 2D0PB 1F12A 1X9IA 1Z7GA 1PBTA 1WZCA 3TBKA 4CKBA 1JG1A 2PSFA 1SVMA 4WBXC 3CJTA 1H2YA 3DE7X 2OHVA 1P74A 3P71T 3WIEA 5A2QA 4LTMA 4ZRMA 4A6PA 1QPZA 3E15A 1W5FA 1HY3A 3IT1A 2ID9A 5FL3A 1JEOA 2Q8QA 3VZRA 3AUTA 5REQA 1NFRA 5K2MA 1U2DC 3FMOB 2OSVA 4UPVA 1E66A 5EP3A 1JR4A 4NHEA 2AZTA 5JNSA 3EDOA 4GI7A 5ERGB 1M76A 4P1ZA 3ORQA 1I1OA 4Q3BA 4FB5A 1J5XA 1K4MA 3MJCA 1ISIA 5JLJA 1P1RA 4N12A 3TMYA 5CM2Z 4XR9A 3WYBA 3KETA 1ZOPA 3HZHA 4O33A 4GZ6A 5FA8A 4ND6A 1XPUA 4NOJA 3MC1A 4OM7A 3GG9A 3Q2OA 1MCZA 4OBEA 3P9IA 1WWKA 3V4ZA 3HDHA 2FEKA 3MMSA 4YV1A 1ZKDA 4YCMA 4MQ5A 5DEIA 1E5TA 3TPFA 2PX0A 4YRQA 5BNFA 3VZDA 5U4QA 3OLVA 1VBFA 4GZMA 2QPLA 1SKBA 5HNKA 2Q1UA 2ZIAA 1NLZA 2HXSA 2NZ8A 4Q82A 3OF2A 3UMJA 2CNNA 2CK3D 3KDPA 5IBQA 1BEUB 1JZTA 3K20A 3V55A 4NCAA 1QLWA 3W7AA 1JILA 1SURA 2E4ZA 1W0JA 3PICA 3UOAB 1A7AA 2EFGA 2OGWA 5GIPE 1HXHA 3FJOA 1XBTA 2CNKA 3HZZA 2WVHA 3H2GA 3TW0A 3VPXA 3ZGLA 3WX0A 4AULA 4KG7A 2P67A 3LLUA 4R8SA 3CKMA 4FHDA 2XTJA 1OBOA 1V2GA 1XA4A 3QEKA 1CR4A 3HG7A 3EMDA 4HLNA 3KZMA 4R1LA 4V2UA 4C78A 4URVR 3JQFC 2XTNA 4XH9B 3WFIA 3KTAB 5E2BA 3B6JA 3C70A 4HQFA 1SXJB 5BQ3A 4OJTA 1SCUB 4QWWA 4CQLB 4BOYA 2C99A 2EJCA 2VYFA 4FK8A 4G1BA 4Y9TA 3T3NA 2I1LA 4P36A 5ESWA 1JGTA 4OGLA 2OHJA 5C1PA 2Y8EA 4YP7A 4LNAA 2HMVA 2ZP1A 3C48A 1YVDA 1M1YE 2B8TA 2CLMB 4YRSA 1JDTA 3OCZA 4Y3UA 4Z86A 3EZ9A 2P8SA 3UH1A 2GRUA 3PGLA 4PYLA 2CHGA 5SYMA 2JATA 3KQHA 3FWPA 1T9BA 4YHBA 5DHFA 4F93B 2E2WA 1RIFA 1ZOLA 2HQSA 2KYRA 2QX6A 3CV3A 5AK4A 3QVGB 1YNSA 4CT5A 3J80A 4JEHA 1JFFA 4D6PA 1U3TA 1SUBA 1SXPA 2VJBA 1II8B 4YJGA 3CYFA 4EW1A 5A4JA 1PFGA 3U17A 3O4VA 1EEXB 4QUKA 3OUZA 1TA9A 3NCHA 2D0OB 2EZTA 1GCOA 2W6IA 1K7XB 1YB2A 3QA9A 1ZEMA 4WD3A 3D7KA 4M9CA 4GI3A 3PKJA 4EL5A 5KNLA 5DFAA 1MQSA 1OVGA 1UC8A 4Z3KA 4DR6B 3P5SA 4EUKA 3CRW1 2QMZA 5H9VA 1UFRA 5E4JA 1F4PA 3CUYA 4ZEOA 3RF6A 1M0SA 4EK9A 3VXKA 2JLVA 1U9IC 4J1SA 5GM2A 4A82A 4RA6B 1TQ4A 3HCEA 5FI5A 1L5QA 5EQTA 3OJEA 4DQLA 2XITA 3BCUA 4PYKA 1DTWB 1Y6RA 2XQGA 3DSRA 4RPJA 4TLEA 4BMVA 5A4FS 3AK4A 3HFGA 2BRUC 4M1KA 3C7TA 1VBKA 2WTBA 4HLQB 1K98A 1U0RA 5JWOA 1VFNA 5I9NA 3IAHA 3V7YA 1CV2A 3FCSB 5INTA 1R4MB 1RT9A 2X13A 4O8ZA 4FIZA 4JSYA 1CRPA 4DOMA 5IASA 1KHHA 1NATA 4L9AA 4FWTA 3VNRA 1KBOA 3LQ2A 1NZDA 4JU9A 5ENVA 2ZR8A 3RUEA 1NXSA 1M2VA 3TJRA 4YBZA 3HGMA 3INRA 3L6DA 2HLNA 4RMIA 2ACEA 3MWGA 1LWNA 3FYTA 1MA0A 3TDNA 3H16A 4D44A 3G0IA 4N0QA 5CXQA 1LCIA 4U2DA 3PNOA 1L6IA 3SM9A 1YDHA 5JAUA 4H7FA 1RM4A 2GFHA 1BKSB 2ZT7A 3HCBA 3QFFA 3VR6H 4C21A 5A4MS 5CBPA 1C1HA 1FFXB 1N2HA 3NEPX 4DNFA 2Q6IA 2WU3A 1NP3A 4R9SA 4DCSA 5KB3A 1RJEA 3DUFB 4LYDA 4CJXA 1EFRD 2QVBA 5BYBA 4L0QA 1FFDA 3PL5A 4DNQA 1OT3A 1Z6XA 3K4HA 4L6IA 4CTMA 4ZRNA 5K0SA 4JC8A 3PQDA 3QLTA 3QXJA 3O75A 1OAOA 3PDJA 3OX2A 1VPWA 2JK0A 2AFIE 1W6RA 1KYTA 3UK1A 3P26A 3O95A 4JC0A 3ONEA 3HL4A 1SQ0A 3UTCA 1CS0B 4Q1FA 2F1KA 4XPIA 2QL7A 4UHKA 1JSRA 1Q5PA 2BH2A 2HMWA 4C6SA 2ZJ5A 2NNWB 4CKCB 4MTCA 3QF7A 2AWNA 5JH7F 3L7AA 4WK2B 2JJYA 2G70A 5DH9A 2PZGA 4BPBA 1XZLA 2LE0A 3R5TA 1W5BA 1TYAE 1UDBA 4L7QA 3JAMA 2XCIA 1KPGA 1NI4B 4NSNA 4OHRA 2QG9A 2Q5EA 5BWCA 5E4YA 1U9YA 1TFUA 2GB4A 5TGDA 5GTDA 4LTDA 4C7XA 3H0CA 4HB2A 4CF7A 3U4GA 1KMHA 1X14A 1I3KA 2PR2A 3LBYA 2HMYB 1Z12A 1K0FA 4MX8A 4RF4A 2ZSIA 3JV7A 2D2EA 1U0BB 1DBSA 3PC7A 4N9QA 5CAEB 1I7LA 2BR4A 3H75A 3CEAA 4R1PA 2V4ZA 4E2FA 4EABA 2DEUA 1XB2A 3SSNA 2JCGA 4LF6B 5FUVA 5HILA 4XIYA 1DTEA 2PL9A 1US8B 1P3JA 2BZGA 5DBGA 3BD6A 2V55B 3BQMB 3M9LA 4DLYA 1Q21A 3N6RA 3UPUA 3LP5A 5KWEA 2GN0A 2ZLBA 3A26A 5J2UB 1TW3A 1O77A 3LUGA 1H2HA 1DCFA 4F6CA 1VMEA 4KR2A 1YCGA 2PGLA 2VSXA 2I7VA 1H69A 3GHYA 3N2EA 2VYVD 4YDSA 3ESDA 4MRSA 1KRWA 2VLIA 2WD7A 1P2TA 2GKSA 3CUWA 3HFJA 1H65A 1U0TA 3GMDA 2JEZA 2P2ZA 2UVDA 3NIBA 1EM8B 4L8YA 4CPDA 1RC1A 4H0FA 2F00A 2W42A 3E7XA 2AB0A 1MO3A 2PZAA 2PRJA 2WG0A 3KKQA 2XHEA 2IBTA 2GHQA 4EY6A 3UK6A 2ZYUX 4MMYB 1TU4A 2V0CA 4YFVA 5CDGA 3KK0A 3QLVC 4RCVA 2BEVA 3QELA 3L0OA 1D4AA 3PP8A 3TGWA 3A6LA 3VZSA 3GLIB 4KX3A 2CLSA 1GZDA 3MCTA 1GOTA 2QI9C 1KDRA 2XGMA 4PTZA 5EVJA 3THSA 3WFJA 3U9SA 1A5SB 4ATNA 4NBSA 1S2DA 2JFNA 2PBZA 1YGYA 4O6VA 5LQCA 1YA6A 1WUYA 1P1JA 3QVJA 4FDTA 1GG9A 1R37A 2DFVA 3NUGA 4TOIA 1H2BA 3EXG1 1QYRA 1UIRA 2QZPA 3ASZA 3LY8A 5ALNA 1PZHA 1UAYA 3IAUA 1C2TA 4RY8A 5F2KA 1Z4NA 1OV6A 3EIUA 4E5MA 3EGOA 1XK7A 4N7BA 3SS9X 1CNFA 1KSHA 2AOUA 2WZQA 3LWZA 4IF6A 5T8KA 4DS3A 1DC8A 1RADA 4EYQA 1X7XB 4XJTA 1USUA 3ADBA 4JI2B 1EDOA 1JIUA 4BVJA 2YWFA 3BT7A 3V7NA 2O7SA 1BCSB 4XCVA 4KH0A 2PH5A 1LRJA 2JL1A 4EPXA 5K0GA 1KI4A 3O0DA 4WOBA 4C3OB 2F1OA 5AJXA 3F3SA 3JVIA 4U9UA 3CZ9A 4DE5A 5BVGA 4AKGA 2Z4RA 4OYYA 3R9IA 1FNCA 1IBSA 4TLBA 3AHHA 1T1RA 1KYWA 3NJRA 4LGMA 1P1CA 5KVAA 3R7BA 4K9DA 4IV0A 2HAEA 2AHRA 2PS0A 3CVXA 2ZWIA 1DB3A 4K03A 4PZEA 3T5BA 4Z9BA 3CGWA 4ND7A 4RVFA 3RABA 3TNJA 3EGWA 4C20A 3NANA 1ADJA 1SCIA 3H17A 4G5RA 4D79A 4O2AF 4CDMA 2GYUA 4H16A 4LOKA 3EARA 5BP7A 4J07A 3FFTA 4XRRA 1R12A 4PGAA 1JL3A 1CUZA 1YJ5A 2XQKA 4YRFA 3RUIA 1MRNA 1ZICA 2GZRA 3G89A 3NBQA 4EJSA 1MOZA 1UZMA 3EDMA 1UODA 4YJGB 4FYKA 1Y4AE 3HKBA 3UUEA 3MQ4A 1G41A 4CIWA 1JHRA 3I9NA 3EUEA 1JEYA 1IWOA 4DV6B 4I6JA 3BWYA 5EJ6A 1DMSA 3IQZA 2FP4B 4D92A 3GL9A 5FOWA 3UXEA 1EUDA 3I9FA 3QXSA 4D02A 3M70A 1W30A 2VJCA 2NZWA 1YOBA 2NYAA 2YV2A 4LXIA 5JI2E 5FTMA 4O63O 1IY9A 1VKNA 4XLTA 4TSKA 4GLFA 1G8FA 5JSHA 3OF3A 3A6ZA 2MTBA 4BTEA 2NYUA 3BILA 4S12A 1SO8A 3CX6A 5TPWA 1E1CB 4HDAA 4ARVA 3K4PA 4DCGA 4E88A 1R6DA 5K3EA 3KUCA 2ZTMA 3G7NA 4DVJA 3NP7A 2ZDHA 3ZE7A 3ZWBA 4EHFA 4YEDA 3RADC 3MWEB 4Q3AA 4D8YA 1RZ3A 2Q2WA 5MN5A 4FFVA 2ZXEA 3L7BA 1V95A 1KO5A 2FNAA 4DN6A 4MR7A 4M9QA 2COKA 2XCTB 1UKBA 5C35A 3HWSA 3IHWA 1RYZA 3MT7A 3N39C 2RB5A 4GO1A 1CUEA 1FFCA 2FWMX 2CB9A 3RVLA 4K5QA 3RPEA 1Y6GA 5GGYA 2WOOA 3KTFA 3NJ4A 2C3YA 3UJPA 1U0FA 4ZCIA 2BTQA 5IHPA 3NBUA 3WKEA 1RMQA 1KWGA 1WB6A 4U7JA 3ZDFA 4NMHA 4DIBA 3ORRA 3NRCA 1NULA 1MU0A 2J8ZA 3U1TA 1DEXA 1Y4ZA 2FP4A 4FMCB 2FG5A 3CB4A 4JYBA 4LY0A 4YY3B 1QJ4A 1VRCA 1EUDB 1FP2A 3HGTA 2GPAA 3F6CA 3K0CC 2B1RA 2H29A 2WU4A 3BCSA 1WABA 1D04A 1H6DA 2QV0A 3A6HA 2HA0A 3PL1A 4N4AA 4QXOA 1ECPA 3WK5A 5KVVA 2WFZA 2ZUBA 4YB8A 2R97A 2W6MA 2FEWB 4NJMB 4B48A 2I91A 3PUKA 2C9MA 1MOQA 4C06A 4HNAA 1H42A 5IDXA 3FW1A 1ZL0A 3ELYA 3H83A 1LLQA 2H11A 3H5OA 1KJ9A 2XSZA 1O94D 2WJHA 5EJ5A 1JWAB 1G4UR 1KGSA 4WLVA 1GR0A 1WZNA 3LECA 4JL8A 3T61A 3ZOKA 1AN0A 5LNK1 4GXTA 2F8LA 3DKRA 1UKZA 1W5AA 2WJIA 4GICA 2UYHA 2H4XA 4ZOEA 5THXA 1G5HA 4XYBA 3RS4A 4AZ0B 1N1DA 3BRWA 3IRVA 2F62A 3IEKA 3AERA 4RYLA 3RVKA 1PNRA 1PR9A 4RTLA 2PVPA 4M7WA 2IYUA 1Y34E 4OAOA 2H1VA 5H82A 2W8ZA 3WGMA 1DV1A 4JR1A 3FB4A 2NSDA 3V8VA 2O2GA 4C6TA 1BFUA 1XTSA 3Q6NA 5LQUA 2PY6A 3QYJA 3I12A 5DP1A 2GCNA 1RXSA 1A27A 2FUNB 3R7NA 3DXYA 4ZV9A 4WOPA 4Z2AA 4ZEVA 3DE1X 1BH2A 1UKAA 1YR3A 3HJNA 1QH0A 3IAFA 3MCUA 3FSRA 3BN3A 1JFFB 5FJJA 5DYIA 4ON9A 5HDBB 4KXVA 1X8KA 4U9HS 3DLCA 4ZI7F 1QVVA 3CF6R 1S2NA 3NI2A 3QKRB 3EVBA 1UPFA 1HYEA 4HGNA 1KVTA 4JNKA 3CWCA 2VP4A 4AK9A 1NNUA 2C5EA 4BNXA 2HUNA 3ROTA 2J4DA 1NMXA 2I34A 1DJOA 1K6JA 2J4FA 4MB6A 3DHYA 4OLHA 4PZ9A 4FW9A 3LQRA 1AQLA 3AHCA 1CP3A 1M54A 2GBPA 3KJNA 2VCYA 3S7TA 4EF6A 1VKRA 4CEIB 4XVCA 3HP1A 5A6SA 5H83A 3UMYA 4BTVA 3ZXXA 1ZJYA 3H6KA 1PQWA 3HVUA 1NMQA 4NONA 4RA6A 5EWLA 2ZSFA 2GK4A 3I1JA 1ABFA 5AOBA 5FEUA 3KJXA 4AJ2A 2DGDA 3I92A 1L5WA 3KU4A 2ORIA 1NUAA 2VS1A 4MB2A 3CIOA 2F67A 2TS1A 4AJPA 4JUFA 3QMWA 5T64A 4YRBA 2X23A 2CGEA 2NT3A 2XOEA 2BGNA 4LYFA 4HDQB 1CJVC 1IXSB 1UBHS 5HIIA 4G4JA 3TXXA 3KAQA 4EY4A 4EW3A 3HB5X 1E2LA 1HQDA 1U0HC 3DE5X 5CXXA 5KMGB 5H3CA 4JI8B 3OLXA 4JUCA 2YY7A 3NBXX 2RCYA 4MQUA 1HM5A 2IZ6A 2QAIA 4WECA 2ZUTA 3ZE0B 3FMVA 3OX1A 3AERB 4GH5A 4NEHB 3F2IA 2Y0PA 4XDHA 5K0CA 3EY4A 5L95A 1WCV1 3RVJA 2VHQA 5AW4A 3AL2A 1NXXA 2IE0A 5H5JA 1XZKA 5LIRA 4GQIA 4XGKA 4HADA 4Q1EA 3S29A 1GTL1 1HK7A 3H1BA 4AY6A 2E1PA 3U7FB 1TL7C 4W1QA 4Q39A 1AHIA 1DX9A 1OY1A 1T26A 3Q85A 3MTBA 4MULA 2ZR7A 2SKEA 4URXR 3DWGA 2VFAA 4I5DA 1B73A 4KIJA 1WMAA 2JLQA 3AJ9A 4KR6A 1IM8A 3AWDA 4Z1MA 3AIKA 1E6UA 1T0JB 1OLXB 2G0TA 3AC0A 5HPYB 3FHTA 1KI9A 4MVWA 5DV9A 4CMGA 3OZBA 3AYZB 5EL0A 1POWA 3IBGA 4N1AA 2IYLD 1QB8A 5BSRA 3RTBA 5JAHA 4EO7A 4WNIA 4XFDA 4E5PA 2OAP1 1U1GA 2FDRA 3Q7RA 5LU9A 5HTOA 2ATVA 3FWHA 4GECA 5JRZA 2YVUA 2AI2A 1SOVA 2FOXA 3EVCA 3JATB 4PZCA 1Q0HA 2FV8A 2PLAA 3L07A 3S5UA 2FMXA 4ECAA 3U81A 3LRPA 5A5GA 3A1UA 2FZVA 1VPTA 1PL0A 4BNHA 4GGOA 4J9VA 4POAA 4F8YA 1AHNA 1WBBA 2QX7A 4HDKB 4IJVA 2VK8A 1I3NA 1QFXA 2DTEA 3EUAA 4XCXA 2VRNA 3KBBA 2P11A 4E11A 5LLTA 4KAFA 2DM6A 3VBEA 4Q7EA 1DBPA 1H85A 3NWJA 4HSEA 4V1CI 2WPNA 4EITA 2VP6A 1O0SA 1EX1A 1LS1A 3QU9A 5AHKA 2C1ZA 3QFSA 3OLZA 2CYCA 2O20A 2X8AA 3FVVA 1B8VA 1N57A 3DTVB 2P2NA 2FP3A 4RPCA 5HMMA 4Q9AA 4X66B 4NXMB 3SDBA 3T7CA 3E4DA 2IXGA 4LRYA 2Y0CA 3GZNB 4RSGA 4H1WA 3IKTA 2X9VA 3QKWA 3WRXA 3FPGA 3KOWA 2AEJA 4DJFC 1ADCA 2XRZA 4MCIA 4F4HA 2GZAA 1Z35A 2YJZA 2BELA 2CDCA 1WP9A 3TZLA 4LNUA 1SCNE 3HU3A 4GVLA 4HQRA 2VRCD 3VHRA 3A1CA 1EP1B 1KEUA 2YS6A 2AR7A 1VDMA 3AM5A 1K6XA 3GFRA 4FDVA 3OT5A 3WYDA 1QV7A 5JWHA 1JVSA 5CA0B 5KWSA 3OQ6A 3DYIA 1NYRA 3DV0A 1EAMA 4PAMA 1KU0A 2I87A 1Y0BA 2XE6A 2X6TA 3A31A 5EFOA 4XIGS 5SY4A 5FAKA 2W48A 2XMQA 1KE1A 1ZH8A 2ZSUA 1ND5A 4QXPA 3MUEA 5IMSA 1PJTA 3P9SA 2WYWA 1X87A 3E58A 2WUEA 4AMYA 1TK3A 1M10A 3W4KA 4GWKA 3AEUB 5AOAA 1XMPA 2B1IA 3NYWA 4TT3D 3AUUA 1RAGA 2AC4A 4J8PA 1PL7A 1SUDA 3AETB 3AX6A 1NX9A 2XA1A 2EF0A 2DR0A 3AZPA 3V4SA 4BNDA 4B76A 4C0JA 1JPNA 2N75A 1MENA 4PLPA 2IS2A 3HJTA 4ZICA 1ODCA 4W5JA 2G5PA 5KWJA 1ZA1A 2Y27A 4BBPA 2TMYA 4QEDA 4CQMB 4Z49A 3MK31 4KE6A 4REQA 4O3MA 5UKDA 4N03A 4YQZA 1SIBE 1N2CB 1V8FA 3MUOA 2V7TA 4G63A 1EJBA 1OX4A 2VUUA 3K09A 3GJXC 3RVNA 1U99A 2I4MA 4LOJA 4KQWA 4LYJA 2R6FA 3DZ8A 3IBYA 4IH1A 1GZ5A 4FW8A 5B58T 3KT3A 2NPFA 1LFAA 4UEJA 5KKAA 3SVLA 1XDUA 3EYWA 2AFVA 5D5PA 3MVEA 3TW8B 1GFSA 1IBCA 1FEZA 3WGYA 1YBAA 3LBFA 3THYB 5LDHA 2VSQA 1AXGA 5CX1A 3VH4A 4JYZA 4HDSA 1V41E 4PO8A 3OLQA 5SZKB 3WLMA 2GAFA 2Q3DA 3TD9A 3MB5A 3R3JA 4DXHA 2ZRIA 3AL3A 3QIVA 4RZUA 3UXYA 4UUQA 2ID4A 2RG1A 3H9QA 2ZTSA 3LCMA 2CVZA 1AVTA 2IFTA 1YFKA 3EFHA 3MN1A 5DJ5A 2I7CA 3JVEA 1LLUA 3GFGA 4JT9A 3L7CA 2W2OA 1YR9A 4BO6A 1EWQA 2I5PO 3KOOA 4KQCA 1SC3A 4RVCA 4G5SA 1SB9A 1JMYA 3SF0A 5H02A 1NN1A 4EB6B 3ECAA 4NNPA 4P81A 4B74A 4PIMA 5B6JA 2JJ8A 2GJAA 2PGDA 4LZAA 1O7JA 5GINE 2V58A 5LOVF 3JD0A 2O19A 1KVUA 2Q99A 5HF8A 4GD3Q 1UM9B 5ILQA 3LBIA 3M4XA 4P53A 4TKVB 3BSYA 1H3EA 2JEYA 2H4FA 5EESA 3SOZA 3SFZA 2VC2B 1GILA 1OREA 1OX4B 2GN1A 2YOFA 3I04A 3B9QA 5BSVA 1N6HA 2DC1A 2XBUA 1VKZA 4MUGA 1E2UA 3RTCA 1FUEA 1USVA 3EFBA 5DBEX 1NBMD 4OOEA 1AO3A 1L7RA 1ZUNB 1YWGO 2EFYA 3QYFA 2P6RA 3D6AA 5EP2A 4Q4CA 3FOAA 5HQ3A 1PG2A 3AESB 2R48A 2CJWB 4P33A 2BHNA 3PEUA 1RACA 4EHDA 4L5YA 3VHXA 2FGKA 1V11B 1B0ZA 1ODSA 3WQBA 3VPDA 1H1TA 3I30X 2WMYA 4JXKA 3OJLA 1YZNA 3VDRA 2PD4A 5CNMA 2FN3A 3IT3A 2YHUA 4PHGA 4JP2A 1VXOA 1Z16A 4G4SO 4HTAA 4D1YA 1UM8A 4Y1RB 1AKUA 3ACBA 3HL0A 1YU6A 4NY1A 2JANA 2HA7A 2SICE 4CQJA 5BQXA 5CYFA 5HE9A 1UKVY 3WHLA 3NPMA 3P9QA 1TMKA 5IHXA 5KHAA 3BTVA 3RFX