2POCA

The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
353
structure length
339
Chain Sequence
b'GPYKHFMQKEIFEQPDSAFNTMRGRIDFENCVVTLGGLKSWLSTIRRCRRIIMIACGTSYHSCLATRSIFEELTEIPVSVELASDFLDRRSPVFRDDTCVFVSQSGETADSILALQYCLERGALTVGIVNSVGSSMSRQTHCGVHINAGPEIGVASTKAYTSQYIALVMFALSLSNDSISRKGRHEEIIKGLQKIPEQIKQVLKLENKIKDLCNSSLNDQKSLLLLGRGYQFATALEGALKIKEISYMHSEGVLAGELLPIIAFATRDSLFPKVMSAIEQVTARDGRPIVICNEGDAIISVHTTLEVPETVDCLQGLLNVIPLQLISYWLAVNRGIDVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords isomerase domain of glutamine-fructose-6-phosphate transamin
publication title The Crystal and Solution Studies of Glucosamine-6-phosphate Synthase from Candida albicans
pubmed doi rcsb
source organism Candida albicans
molecule tags Transferase
total genus 144
structure length 339
sequence length 353
chains with identical sequence B, C, D
ec nomenclature ec 2.6.1.16: Glutamine--fructose-6-phosphate transaminase (isomerizing).
pdb deposition date 2007-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01380 SIS SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2pocA01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2pocA02
1HR0B 1TZCA 3I0ZA 1NRIA 2CXTA 4LF8B 2UU9B 4U6NA 2I22A 3IFSA 1U0EA 4LF9B 4DR3B 4NXMB 2CB0A 5LL6P 2CXNA 4LFCB 1JXAA 4JV5B 4JI2B 2UUBB 4S1WA 4LZJA 4AQYB 1JEOA 3FJ1A 4M0DA 3LJKA 1N33B 2ZJ3A 4B3RB 4GKJB 1XNRB 1VI6A 1T10A 1NUHA 1XNQB 4DR5B 1FJGB 4LFAB 4DV3B 4DV4B 1J5XA 1N34B 3Q88A 5A2QA 2UXDB 1HM5A 1XMOB 1XMQB 1TZBA 3T1YB 3J81A 3EUAA 4JI0B 1VIMA 1G98A 5BY2A 4DR7B 1IRIA 5FLXA 5I01A 1MOSA 2J6HA 4DV1B 3OOJA 2PUVA 2E5LB 1MOQA 2VQFB 1M3SA 2CXRA 3FF1A 1I94B 1IBLB 2DF8A 4DR4B 1U0GA 1Q50A 2UUCB 3OTOB 2UXBB 3TBFA 3JX9A 2PUTA 3FXAA 4JI4B 1GZDA 1GZVA 1C7QA 4LFBB 1VI5A 4DV7B 5LMNB 4B3MB 4X66B 3TRJA 2CXPA 1X9IA 2CXSA 1JLHA 4LF7B 2PGIA 2Q8NA 3KNZA 5IWAB 3J80A 3ETNA 1JIQA 2ZM6B 3SHOA 4S12A 1MORA 2POCA 4LF6B 3M5PA 2O2DA 4DV2B 3ODPA 2UUAB 1KOJA 1C7RA 2CXQA 2WU8A 1X94A 2AMLA 2UXCB 4GKKB 3JAMA 4LF5B 2E5FA 4JI8B 1IATA 3HJBA 3Q7IA 1X92A 4JI1B 4JI5B 1IBKB 4IVNA 2ZJ4A 2YVAA 2F4VB 2HHHB 1N32B 1J5EB 4JYAB 3BJZA 4KHPB 4EM6A 4YHHB 1U0FA 2DECA 2VF4X 4DR2B 2V4MA 4X65B 2X3YA 4YY3B 1DQRA 1B0ZA 1WIWA 4DR6B 4DR1B 3BCHA 2CXOA 1ZZGA 2I2WA 5BR8B 1N8TA 5IT9A 2O2CA 2PUWA 3UJHA 4OX9B 4B3TB 1X9HA 2XHZA 2CXUA 1N36B 1HNXB 4B3SB 1XTBA 2A3NA 2VF5X 4JI6B 4AMVA 2VQEB 4DV5B 4DV6B 4TOIA 3FKJA 3NBUA 4X62B 4NXNB 4LF4B 4JI3B 4JI7B 1TK9A 1HNZB 2CVPA 3G68A 4X64B 3C3JA 3T1HB 3HBAA 3PR3A 4DV0B 2XBLA 4DUYB 4K0KB 5LMUB 3CVJA 4DUZB 3J7AC 3QKIA 1HNWB 1HOXA 1IBMB 1VIVA
chains in the Genus database with same CATH superfamily
2WM8A 1LSOA 3GN2A 4UD6A 1UT5A 2B61A 2ZYAA 4ZOBA 4UCFA 3EZXA 5EIBC 3DWGA 3WADA 2XNSA 3FWHA 3V8VA 1IVNA 3CSDA 3V9PA 5AW2A 1UMCB 4CR7A 4M1WA 2QRMA 2HK8A 1QIMA 1RQ7A 4R05A 4X24A 2C8LA 4PICA 2GEJA 1KSGA 2QBYA 3IQEA 3JTMA 3R41A 3KXDA 5J40A 2CE2X 2WFZA 3ADKA 1TRKA 4H0FA 2OUKA 3QVOA 2YNMC 4DEYA 3G7UA 1NG1A 5ENDA 2NUTA 1EH5A 4JBNA 4X6LA 3IHLA 4O2AF 5FPHA 4BKQA 5JDCC 4C6RA 3FCSB 2PUCA 1OBVA 4LJ7A 2HA3A 1G7SA 4E5NA 3OQMA 3V1YA 4H7IA 3GLHE 5JZ9A 5ESDA 2Q6OA 1F3LA 1EFPB 1X1SA 1H2XA 1RXUA 1Z45A 3EF3A 1TMGE 3FPFA 5JCXA 4OYLA 5EJ7A 5FUWA 1TJ4A 2UUPA 3PZBA 1T9HA 3NBXX 2ATIA 2F48A 3SE7A 3I58A 1P17A 2XMRA 3TSYA 3U3RA 1Y9AA 2NXCA 3ZVLA 2PWAA 2P30A 5CTJA 4QHTA 5E2AA 2KMLA 1MAVA 4GEGA 3GGDA 1BH2A 3BXGA 2IYNA 1DCFA 5K4HA 2AMVA 2JLUA 1RYYA 3FA2A 3A25A 1GR1A 1KMIY 3KTAB 4GM1A 1KI3A 9LDBA 1XA0A 3SYTA 2CV1A 1TT7A 2XMQA 1OH5A 1QQAA 1X94A 1GXSB 1WCYA 2JI7A 1QYCA 4DADA 1X0XA 3QELB 1JHRA 4M86A 3LGAA 3PKIA 5JDIC 3GRFA 4Q3AA 5A04A 5FH9A 2IZ7A 4Q4AA 4Q3LA 4OBBA 1CVIA 4A5SA 7REQA 1N77A 5F9FA 4RPIA 3V7FA 1CS4C 2I29A 1WSAA 3BJIC 2WTBA 3E18A 2YCBA 3B1WA 3PYLA 1HQCA 4I14A 4KNVA 2MMGA 2OBNA 1Q0PA 3QPVA 1DTWB 1TGVA 3RSCA 3URKA 4C14A 4FMDF 3ISTA 5EPOA 5C4IA 3D3KA 4HUQB 3KSRA 4AUEA 5CIQA 1YZHA 1NIPA 4GWKA 3PNKA 1SIWA 2I2WA 4AKEA 2ZUDA 4CDMA 4M9CA 1XQ9A 3NBMA 3IPRA 4AROA 1NX6A 1SBYA 3AK4A 1ADGA 2PSDA 2PRJA 3JVEA 2C2MA 2GBGA 1OBFO 3IE2A 3HJHA 3MMXA 3QPWA 4LDPA 2GPYA 4LYYA 5EE3A 4EYEA 1GV0A 1GY8A 4TVSA 4IRXA 5ALXA 3RYHB 1XMXA 1A0OA 5EYPA 3GG2A 3JYLA 4XRRA 3P9NA 1UAYA 4D92A 1D4FA 1R4NA 4JJFA 4NP6A 4BBJA 1E1QA 1QO0D 1RPTA 2OY0A 1USUA 4BV3A 2GK3A 1V9SA 4C87A 2PS0A 2OGTA 4YJ3A 2X9VA 1K5DA 3KKOA 5CEEA 5JSQA 3AEXA 5KNCA 1ZEMA 3NRCA 4FW8A 1NNEA 3E9EA 4JAVC 1PR5A 1Z6PA 3D3WA 4FUTA 2P79A 4J7CA 1YBHA 1MC5A 1N2CA 2B4RO 1YRAA 1VP3A 1XZIA 3OQPA 1PKEA 4TMKA 3LTNC 2Q0XA 3G5MA 5HRUA 2IXGA 3WI7A 1DBQA 2Z3WA 1EFUA 1OFGA 4OAQA 4UAUA 4BY9E 3QXJA 4FOTA 2WK1A 3F71A 1AQUA 1YJXA 3BJRA 3GT3A 4ZT3A 4UUMA 3M6AA 2XVAA 3DE0X 3NYQA 4KOAA 1SUSA 1UEJA 2C84A 4N6NA 1GIAA 4U7HA 3C3WA 5SYMA 3S28A 4YDQA 2DC1A 2PD3A 1KEEA 1UK6A 1GOTA 3IVAA 3V6MA 4AUKA 1T0BA 3OZUA 2WWHA 3THWB 1NP6A 1PT9A 4CQNA 5HJ5A 1ENOA 4ENSA 1W46A 2RGRA 1TF2A 3D31A 1VIMA 2GYUA 2QTVA 1XCMA 3E9CA 5A7GA 3W5JA 4BTVA 2IHYA 3QW4B 5HOQA 4Q1AA 1VBNA 2RHBA 3T5PA 1TMYA 1N5IA 1FYXA 2C2WA 4NC9A 4X92A 4YXWA 1YKFA 4PXAA 3WGTA 1HF3A 2J45A 5GZ1A 2AC4A 2DGDA 1N1DA 1JTEA 1M6NA 1WU7A 2EL9A 3DR5A 2JBHA 5HK8A 4D2IA 3K9QO 5K8TA 2NX2A 4H7EA 4A3SA 1IOVA 1GZ7A 1GITA 2B9VA 3IMFA 4EB0A 3LLSA 1M7HA 2V7VA 4ZCTA 3I9V6 1DUSA 1TYBE 4CIBA 1NRWA 3A2MA 1AK9A 5J59A 1I3KA 4WPGA 1GD1O 4R8MA 1DDIA 2CDRA 1HYGA 1MQAA 5H80A 2QI9F 1T1SA 2VJBA 2EWWA 3ANXA 1C3VA 4JLWA 3VGJA 3NYWA 3D4BA 5LQRA 2XSZD 3R4CA 4PHFA 4LDRA 3LRPA 2GS9A 1D4ZA 1O7JA 1WQ4A 4N0PA 1Z5ZA 2P90A 4RFVA 5G41A 4XWOA 2EZ4A 3F9RA 4IH9A 5FOUA 4KWHA 2TMYA 1UANA 2XKJE 4WFJA 1D0IA 2HA7A 3OJCA 4WRRA 1FRZA 2BFDB 3TR5A 5IVKA 1PWEA 4S1OA 2PNJA 1ZLYA 2DHEA 2YOGA 2ZTSA 1R74A 4YT5A 1Z35A 1A4RA 3A2NA 3LKVA 5AI8A 1KO1A 4ZT2A 3N3AC 3TNJA 3W06A 2XUJA 3UY4A 2D5AA 5ALWA 4FZVA 1DAEA 1QRAA 2WUWE 2VKTA 1Z2PX 3BH7A 2QTAA 4UE2A 4D8XA 4ZCMA 4PC1A 5EJMA 4UAJA 3ZW7A 3KIPA 2Z09A 4RZHA 3O9VA 2GZ2A 3BCHA 3TAHA 2GKOA 3IXMA 4HNHA 5IZCC 4AJOA 1Y7LA 2J07A 1Q92A 3G2NA 4AZ3A 4YQZA 1KK0A 3KSBC 1ESMA 1UT6A 5FCDA 3ZCXA 1DWPA 3OTWA 3TH5A 1OFIA 5LA6B 3TNFA 4ESHA 1C9DB 1EDDA 1GVNB 4MS3B 2OSBA 4EQ6A 3RHTA 1JWAB 2R6R1 1Z5VA 3GGGA 3I9MA 1YNSA 3IUEA 3BD8A 5DBOA 1T36B 1XKLA 3FPCA 4ND8B 5AUOB 2OBYA 1ZONA 5K3BA 1U2DA 5JUWA 2Z2JA 2A5DA 2GCOA 3KSZO 4N18A 5GONA 5E3HA 3KHKA 4CQJA 4GZ6A 4OQXA 5TX7A 4JJZA 2GFIA 3FPJA 4LN1A 2BI8A 3ANLA 4RZQA 4D9JA 5JSKA 4P81A 4Z4CA 2QTCA 1SK9A 1OIVA 4B4OA 4R1MA 2XT9A 4BP3A 4FJ1A 1V0JA 3PT5A 1IM5A 1YCFA 4MI3A 1UDBA 5KYXA 2QNIA 4HMPA 3TOSA 4PLFA 5HZMA 5HJ7A 3OQIA 1QYXA 4MHOA 4ZI3A 2XRFA 1XCLA 3ZU5A 3IJPA 1OLXB 1WD7A 4G23A 4X3CA 1FQJA 3AFOA 1Z5NA 1JIKA 3SD7A 1HLDA 1VHLA 2C99A 1HETA 3OPYB 2LXNA 5EWMA 4FILA 3GLIB 1YA4A 2QN7A 4NBWA 1KHTA 5I9LA 1QJ4A 4KXVA 4UBNA 4KFSA 4LUCA 4AY5A 4JYZA 2ZP1A 1FFXB 2GPJA 1CQJB 2XOKA 2C04A 1WHTA 2FZ5A 3L41A 5I7FA 4OOEA 4WLOA 3SHTA 3GCXA 1VKNA 3FPEA 1NSYA 4LRSB 3T61A 5KUTA 1IJEA 2DFVA 3ENWA 3GZNB 2JGJA 1T26A 3L4BA 3L84A 4OF4A 5IN4A 1JXQA 2ODTX 3JQCA 4NONA 3AB7A 3FHOA 3OEYA 1A8SA 2A5FA 2NU7A 2GWHA 4G0WA 1VP9A 1GZ5A 5I9MA 5ENZA 4DMUB 3ENKA 1ZMOA 2XZDA 3EFHA 3UATA 4F4JA 3C3KA 4R41A 1SOWA 3L0SA 1A98A 1E2QA 4WJZA 3Q1LA 2IS4A 1JHUA 3G0CA 3VPSA 4MVJA 3OLXA 2VH5R 3UAYA 3FVQA 1H9BA 2HLDD 4RY0A 2WAMA 2W2PA 2JIRA 2X7HA 4O1HA 1JAXA 4JD5A 4D42A 4TLLB 1MORA 1U9JA 2IW1A 1TYZA 1E6MA 3IX7A 3U4CA 1LCIA 2IC5A 5IKXA 2XIJA 5DM70 3OHMA 2B1QA 4MMXB 3JWHA 2WU8A 4F1JA 1RAEA 2C7OA 1CF4A 1N2SA 1NNLA 4HYQA 2GJ9A 3L6EA 5EG5A 2VTBA 2BE9A 2PU5A 4AJ2A 3TRIA 5CT6A 1G6HA 5HRCA 3VU0A 3D8BA 5FUQA 2VPIA 1XZKA 1PZGA 4BVKA 2YHIA 3PEWA 4RPGA 2ZR7A 4QLBA 2ZTHA 1OC2A 4MW6A 4EEXA 3AF4A 1N32B 2IV2X 1PFVA 1YC2A 4QEKA 1YOVA 3T1TA 3N2KB 5JXWA 4CL2A 2GEBA 2C4VA 1MV5A 4UUPA 2GD0A 1DLJA 3FWKA 5ALZA 5F3DA 1YVUA 3WP0A 1CDOA 4C20A 4CM7A 5K05A 4Y6SA 3PHIA 1L5VA 4BKMA 5FWXA 2ZUEA 1R9JA 3TMKA 2IH2A 2O8FA 1E9BA 3SEAA 4TL6A 2C29D 1ECPA 3DEHA 1N92A 2V59A 4E4YA 4MUYA 4EYQA 1MR3F 3TPZA 5ADVA 4HGZA 4KXNA 4ATNA 5K99A 2P67A 1POXA 3QKRA 2OZPA 2ISCA 2I6QA 2CD7A 4OYRA 5IWCA 1MJ5A 1Q0QA 2WUEA 2I9PA 3AXTA 3OJOA 4ZFNA 1U2ZA 3OZTA 4FMCB 1GGNA 3CH7A 3HV0A 1HE5A 5ETJA 3RH0A 3ZCSA 4EF4A 1T3HA 1V3VA 2IZ5A 2KLHA 2X9NA 5JSZB 1YRBA 1XVIA 3UAOA 4ME6A 4F97A 1E1CA 4ZYLA 3AERB 4J0QA 3E5NA 5BQ5A 4MV1A 1QQBA 2WWXA 2QDKA 4PC7A 4CFYA 3ASUA 3H8SA 4BIIA 1IHXA 2FPKA 4TV9A 1GTZA 1B73A 2CWWA 2QMHA 3DEZA 1HL7A 3CIOA 4MKFA 2XPCA 4C0HA 1DAGA 1UR5A 4AMYA 5BPFA 1U0EA 3RVBA 3AF6A 3UT5B 5JJCA 1Z4KA 3NFYA 3ENNA 4FCVA 1XRJA 4DEVA 5AM3A 3AL0C 1VL1A 3NTVA 3GAFA 1EKXA 3B13B 3FTNA 3WHPA 5CB8A 5C8ZA 2JI9A 1QTQA 1V5EA 4V3BA 4XCXA 2AFIB 2QTBA 2VAVA 3BEDA 3Q88A 3HB7A 3RAPR 6LDHA 3LO5A 3NGLA 1AK1A 1IUKA 1TZBA 3BWXA 1N2IA 3HH8A 2P3QA 5AXBA 1VA4A 4E3ZA 4BX9A 3C5CA 3D6UA 2AOUB 4DLXA 3D54D 3UFXB 4DRXA 2L2QA 5KTNA 1OFHA 3L9XA 1J07A 3RVMA 3GH1A 4HKTA 4I3HA 4MQ6A 2NO1A 4WY2A 2TMKA 4A03A 3LHSA 1G2OA 1UMBB 3P0JA 1RPAA 4MICA 4LCEA 1DEAA 2B21A 3GQBA 1N7JA 3HKCB 4RC9A 2P5YA 2YY7A 1KYYA 3BTOA 4BO4A 4MWBA 4AN1A 4Q7QA 5DNAA 4G26A 1O4WA 1W5BA 3N8NA 1GPJA 2BEUB 3MGBA 3OICA 1GNPA 1WMEA 3FNFA 1KJYA 1ND6A 8ABPA 1VG0B 2CYAA 3PJDA 2FSUA 2AS0A 3KE9A 4OXRA 3SZ3A 1OWPA 2XW6A 4YV0A 1X8LA 1VPVA 2OWEA 7MHTA 5KMGA 1Z2CA 1HT3A 1Q2XA 2WD7A 4YASA 1FVXA 1Z39A 3M5PA 4PLWA 3IUQA 4FT4A 4FZ5A 4YP7A 4ZC1A 1CRLA 3ZE8A 5KTTA 3GJXC 1AHHA 1OZFA 1QANA 1UQUA 2B1JA 3KFVA 3LP8A 4IV0A 4US0R 4AS3A 1TA9A 4QDUA 2C1EA 2VSNA 5JAMA 1ONOA 1IM8A 1IMOA 2C3YA 2GKSA 4HJXA 4DLWA 1EVEA 5LQMA 5ISMA 3KAPA 3ZLJA 1OXXK 3GLFE 2IUTA 1EIZA 1Y8RA 3L01A 3BMCB 1GVHA 4IIXA 4K6MA 3LYUA 3STYA 3V7WA 4RTQA 2IYAA 4Q19A 4MIYA 3CLUD 1PEDA 2C3UA 4RWEA 4BNNA 5AJTA 1U8CB 4MULA 5LDGA 5HIKA 3KEQA 3HGQA 3WHLA 1OX4A 1U63A 3IVRA 3RVDA 2I2CA 1YIDA 3O8NA 3DVSX 4P8RA 1J2JA 3O90A 2IEYA 1WXWA 3GA0A 4E31A 4RCYA 4NAUA 2QUKA 4L75A 1BWRA 1ZZGA 1E3DA 1SQ6A 1U1GA 2ZAOA 2OPBA 2LIPA 1RJ9B 4QVGA 5JEEA 5JQGB 1ZSNA 3ES9A 4HB4A 1O1YA 3VOBA 1DWQA 1DKQA 4LV6A 2YJ4A 3PUIA 4Q7EA 4RXTA 2AZTA 2V6MA 3V4VB 4BGEA 4UNRA 5FX2A 1W1WA 1N6LA 3MTJA 4IL5A 1XKXA 3MMSA 1KSFX 4M22A 4UCXA 1MX5A 1R0WA 1R37A 1SBIA 1DOHA 4ZAYA 5A06A 4D26A 1CBUA 3PUVA 2OA0A 2GN2A 3RASA 5HVNA 2NIPA 2IIQA 4NZZA 2YMMA 1J56A 3FHCB 3BORA 1U5BB 2VSYA 3QH4A 2ZULA 3REQA 4NE7A 3TVDA 1DS6A 1UDXA 3NWJA 2XUZA 4D3SA 2Z6QA 4YGYA 4YR7A 4RTRA 3VUFA 2OZKA 3EWSA 1WCIA 1D7OA 2FUEA 2P0EA 1A7JA 2HHJA 2XYVA 4K88A 2JGDB 4MUFA 4CF5A 1Z6ZA 4H17A 3FGNA 5DHFA 1GWNA 3UB2A 4PONA 1SGWA 3GELA 1FVFA 2HU2A 3PXUA 4YS6A 4IJ5A 1QF9A 2CXNA 2V45A 4KUGA 4YJHA 4W5WA 2QF7A 3GXOA 4M60A 4ZDKA 4JSTA 3ZY6A 3GJ6A 3G17A 1EJ6A 3ZG6A 2AXEA 3QE4A 2DTEA 3U7RA 1A9XA 5IPFA 4YCMA 2Z3ZA 1OAOC 1SXJE 3G8AA 1DTSA 2BIFA 3RJ5A 1W8IA 3ONFA 1NLMA 3D1LA 2F4NA 5TQVA 3SHWA 3VC1A 3FAKA 5DK4A 4AX4A 1PEYA 3NOQA 5F33A 5IXSA 3OQBA 3B82A 4X0EA 1LDMA 1J21A 4IVRA 1VE7A 1DRUA 4LJ9A 1JE1A 3GDGA 2PZLA 1NMZA 4IXMA 5GWXA 3IS3A 2QLLA 2G9VA 3DW3X 3P5SA 5LNK1 1LI4A 1PAUA 2ODNA 3ONEA 4H60A 1P39A 4K9OA 2FTKE 3H8WA 4G5YA 4CHTA 4DIUA 2HT1A 2ZQZA 1V7PC 3HUEA 1QGUB 1LY1A 1S8OA 3N75A 1CUSA 3G5TA 3HN2A 4QT4A 1DXYA 1OAKA 2XLCA 1OU0A 1TCUA 4QVIA 5H8WA 2BHNA 1XF9A 3I64A 3EJWA 3UAGA 3NUQA 3NHJA 1F6BA 2P9QA 3B2NA 5KOIA 3WBFA 2C3OA 2PTGA 2C97A 4XOIA 2C7QA 1WXDA 2XUQA 2QG9A 1PQWA 3MXTA 4CM6A 2GYVA 2REQA 3CB4A 1EBFA 1TZJA 2XUAA 3GOHA 2Y1CA 5KBYA 4C07A 3V8MA 1B74A 2AI1A 1JEQB 4WGGA 3HB5X 2VPYA 4GKKB 2XTAA 2ZVPX 4EZBA 2JJ2D 5T5QA 3UMYA 2DT5A 4YROA 5EJGA 4FXOA 4HAZA 1VKHA 3BDVA 4G0UA 3L7NA 3A1EA 3BREA 1B6RA 1C7ZA 1GPH1 1P5JA 2CJFA 3DV0A 4KUHA 4CPDA 3OFVA 1T4MA 2EGHA 5JY6A 2WB4A 2J08A 3PHJA 4MS1A 4QUBA 4LYJA 2Q5EA 3CLUC 4M8LA 5CJPA 1Y6RA 5C7OO 1R6VA 3TG2A 1E5XA 1IVYA 2W6NA 2WICA 3A6HA 4NL4H 5M04A 4C5BA 1XJWA 3NALA 5JJ5A 2HJVA 3U16A 3OQ1A 1L8AA 3MINA 4AFNA 1GQSA 1Z2DA 3I73A 3JALA 2VNJA 1CUJA 1WPXA 3R44A 4Q4JB 2ZYGA 3RVRA 1N5OX 3E15A 2G28A 2B1IA 4L3OA 2PWZA 1T2DA 3ETGA 4HDAA 3VU1A 4J7XA 5T7BA 3TQTA 3UANA 2EBUA 3GFGA 1V4BA 5E1BA 4XPIA 3DV2A 3JYPA 3AR8A 2W70A 1MIOB 1JJFA 2X5JO 3ASYA 3MWLA 1FUIA 2BJWA 4GBMA 5K2MA 4B6EA 2WV9A 1TVMA 5HFNA 1YB5A 2BFOA 4RNDB 4IIJF 3LK7A 4MW0A 4OQYA 4N65A 4HP8A 1K08A 1Y63A 4S1VA 2CDNA 2Q1UA 2W2LD 1SAYA 3NC0C 3MTDA 1N2OA 4RPKA 4KIUA 5EXPA 1WPGA 1EM8A 5D85A 4HGNA 1L8QA 4G86A 4G81A 5KYVA 4PPFA 4MYSA 3R24A 4YCLA 2JAOA 1R4MB 2P6NA 5E3IA 4WK2B 3ESBA 4BRUA 2WZBA 4LV5B 4BAUA 1E3IA 4CV1A 3CKKA 1SU8A 3B85A 2FRXA 2H4ZA 4LX8A 5C18A 8MHTA 4RKEA 1UEIA 3HDTA 3OLCX 1E9DA 2QRVB 2P8SA 2QTWB 1DKNA 1S4MA 2Q4EA 4KDFA 4OJQA 5ELXA 121PA 3R3YA 3W8RA 1R5OA 4WOBA 2G07A 4BNLA 2QD2A 2D7DA 1ZOPA 2Z1DA 1P29A 4LSMA 1ECFA 3OMLA 4BP1A 4PAGA 1N5LA 2BMFA 3RF6A 1ZP6A 3W8FA 1VI2A 2I3AA 3BAZA 1B14A 2RH8A 4D4IA 1C0LA 2PX5A 5IK2A 1E2PA 3R6TA 2P2NA 5DSZA 3L0CA 5ARBA 5BSKA 1JDJA 2PSFA 2GK4A 3E7XA 4PQGA 3EE6A 1KJQA 3OTOB 2IPOA 1Q7EA 3I72A 4FHZA 5IZ4A 4JZKA 1L4HA 2ASEA 1VA5A 5FYQA 5FPKA 2Z5FA 3MEQA 2C96A 5BVGA 4TXLA 1UAAA 2EZTA 3SIPA 5FLKA 1I0LA 4O2RA 1GDTA 5LBUA 2ZTMA 5AJZA 5BORA 1C2YA 5AO9A 4NV0A 5ESWA 2ZI4A 2D3TA 4QOEA 2GD2A 4QNNA 1H85A 3GMTA 4G5XA 2LVBA 5CH5A 3U60B 4CV2A 2YC2C 3KV3O 2I6GA 4FDTA 1TEZA 2GWRA 4IAOA 3G0IA 2FPWA 1WKBA 5HFAA 1OZAA 3P0HA 1DIOB 1TOAA 1YR2A 5DTJA 4MV5A 1Y7IA 3G0OA 1PZXA 3A14A 1DJNA 1RRGA 3HXKA 5IJWA 2G40A 3FCOA 2F1IA 2WM9B 3OQ6A 5JS2A 4HN2A 2BLLA 4EJSA 1SXJD 5BYJA 1HRKA 3PDHA 5FPPA 5THQA 5BNTA 3COJA 4IBOA 4LBWA 1MHTA 2P62A 4L07A 2DUWA 1JNXX 2HGZA 1DHRA 1COZA 1GU1A 2ZVJA 2PWBA 1RAHA 1XEWY 1RKUA 1SXJB 1W4RA 2QUHA 3AGQA 3I52A 3CNEA 1NMQA 4MRRA 5DT9A 4CEIB 1Z29A 4XTRA 5CVTA 2R00C 4F0JA 1ZH8A 4HO1X 3DZJA 1K0UA 4LECA 2QT9A 1YL7A 2OWDA 5ILOA 4PO3X 1Z33A 2X7JA 4JN6B 4WBSA 4WNAA 2X0RA 1XWIA 5EKSA 1S0UA 2NACA 1HY3A 3EW9A 4P4SA 2R8BA 4U39A 4AF6A 5EMJA 3KLNA 4I9FA 3TOCA 5KNDD 2J7PA 5DYNA 1E1NA 1OKKA 1K8YB 1VPEA 2CMGA 7AT1A 2GTIA 4XJXA 2HMSA 2VH2A 4CIWA 5BQ3A 5T4EA 1K7YA 3JAKB 4PYQA 1KDYA 2ECFA 2I54A 3E58A 3GGCA 4MW9A 4PTZA 3V8EA 3RTGA 2YDYA 4HDMB 4ILKA 1LPOA 4D79A 2G83A 4MX8A 4AKSA 2PCJA 4QBFA 2R1UA 4AO6A 1NI4B 4ZT4A 3EH1A 2AG1A 1M8GA 1KQOA 5AK0A 2HWWA 2E6KA 3BB3A 2PLFA 1PG5A 1CIPA 3E9YA 4FC6A 4FMDB 2BR3A 3NHFA 1TZCA 1BHQ1 1LJUA 1EE9A 1NW8A 1OI3A 2NN3C 2F9MA 1V8PA 1Z0FA 2NSDA 2E4YA 1YWGO 3M1IA 4B43A 1FSPA 1RE1A 4FQ7A 1SVWA 4IW3B 4LMPA 4HAVA 4D80A 2J9YB 1JXAA 3RNOA 1E58A 4BECA 6ABPA 2HCTA 2WWVD 3ZKWB 2I1LA 4OM8A 1BAPA 1M1YB 2RONA 3TKYA 1SU7A 1MGPA 3I23A 1APBA 5DM2A 3FDJA 4LFAB 3MS7A 5EHGA 4MR9B 3FUXA 4MYRA 1H5NA 3IP5A 2XNDA 1UBLS 4HRVA 3CE6A 3LQKA 1P0IA 1UINA 3C98A 5CFMA 2VCEA 5LYJB 4HAUA 3KBBA 1NBHA 4YLEA 4EYSA 3K0FB 5EJ9A 3H42B 2JA2A 1CQWA 2X2EA 3VR0A 4FNMA 2XTZA 1UXGA 1AD2A 1NQVA 3KQHA 3P52A 3M2TA 4D25A 3BGVA 1HYHA 5BN4B 2O6HA 1QG0A 1MDFA 4NMXB 1XRSB 5K3OA 3INYA 3TQCA 5C1IA 2X0FA 4B7XA 2I7CA 1C2TA 3R3SA 2P2ZA 1NW6A 3WBKA 4BS9A 5JNTA 1F0NA 1U7TA 4I6GA 2O7VA 1MVOA 4GPIB 1JSLA 1DO0A 1MC8A 2AHOA 2QL6A 3VISA 3T38A 3M49A 5KMGB 1T1JA 3IH5A 1NBWB 3W5HA 1CDEA 1Q14A 4JBLA 3QF4A 3EWAA 2VP6A 4M4SA 2HK6A 1TUGA 1JAHA 1E63A 2I2XB 3L1UA 5KKCA 4YP6A 3N8IA 3TLJA 4KQ2A 1OZ0A 4FHFA 3TUZC 1SG6A 4OHKA 4ZCLA 2KSQA 4YR9A 2X4DA 5E7QA 1B8VA 4GDMA 1GAEO 3CBQA 2ES4A 4OU4A 4LYEA 3STUA 1XEXB 3CVUA 4QELA 1MKYA 5E7IA 4WKBA 3UMMA 1G7CA 1E5TA 2EZ9A 4WVFA 1SXJC 3UJDA 3QY0A 4QYSA 5IKEA 2PHZA 1E9FA 2GO1A 3KZCA 1MC4A 1IK4A 2B25A 3UMRA 2NM0A 2I91A 4TMWA 2C2BA 3IE0A 1OH6A 3W77A 3HBFA 5B2ZA 4J16C 3KAKA 4B6QA 1MX9A 5KWVA 3L0IB 3N2EA 4KDCA 3GEHA 1LDBA 2RKBA 3DKIA 3Q6NA 3QFFA 2DOKA 3W2EA 1WPRA 4KMMA 3Q3JB 3QUQA 1NQUA 3WYCA 1DC7A 4ER0A 4D99A 5FBRB 1ND5A 5TJ9A 1NBMD 2CE7A 1SUIA 4C03A 4BPRA 4XEUA 4C4ZA 2GERA 1LJ8A 4DB4A 2GD1O 3YASA 4YP0A 2AJCA 3VSAA 3ZGVA 2WNHA 3I42A 1JDVA 5B1HA 1NU6A 2PH3A 2VDJA 3A1NA 3CZ9A 5EJ2A 1G20A 3E1GA 1ZW1A 3T7RA 3ZJYA 4YBZA 3ELDA 4ZIRA 4MB2A 2BONA 2GUGA 3FTCA 3Q2KA 5TF4A 2ZUVA 3EDCA 4KE6A 1WU8A 4Y2RA 2HY7A 2FMUA 5AKKA 4P38A 2W6CX 4EKDA 1FB5A 1H2HA 2HRCA 2X3FA 3EC2A 2JD0A 3HKEA 4Y2GA 3I6ZA 4RTSA 4L2IB 1E9SA 2R8PA 4BMDA 2HT6A 3R3VA 2QRQA 1S9HA 3KZOA 4YRRA 4E7PA 4B4WA 4EHJA 4BFUA 2BH9A 4CI9A 3DPSA 2BKLA 1HKHA 4NCIA 4D81A 1MPTA 3D2AA 3PCXA 3EPRA 3TR0A 4OQEA 2G5PA 4Q9NA 1UKAA 5ITZA 4M7OA 5COQA 5C7IO 1BJRE 4A0HA 3TL3A 3OZ7A 1C41A 3B9PA 5KSWB 4NI5A 1QYIA 2WVGA 3FOZA 2YZKA 1XQYA 4MRSA 3GFSA 1AGPA 4KIGA 3M6LA 4FHEA 3EVFA 4TKVB 4ZT7A 1Y34E 4UBKA 1GGJA 3PT9A 4OA8A 3ZZ0A 2BMJA 3PYMA 4PX2A 2EW1A 3F96A 1GGHA 3PI7A 3ETLA 1TTHA 4U2EA 1GV1A 1L4FA 4RYLA 1T8PA 3WMEA 4UTPA 3VYSB 1U8AA 3ID6C 4BLPA 4ASUA 5FT9A 3PFFA 5AW7A 4XIIA 1KJWA 4NVRA 1SQFA 4AECA 1Q16A 5AKLA 2CVOA 3D7NA 2PXCA 3QENA 1OXSC 3O4VA 1O57A 4L8FA 1PSWA 1Z4LA 3QFRA 4L4UA 3TBKA 5JCOC 2JAXA 4BVFA 1DTEA 5CDGA 1KFKB 4KSBA 3CLTD 2VYND 1H1LB 3HCPA 1D04A 4FOOA 2O3SA 2W2QA 5DXAA 4P0PB 1RZUA 3M81A 2X1HA 4DV2B 3FUCA 2EU8A 2HQOA 2W90A 1ZH0A 4TT3D 4BLRA 4B81A 1V1RA 3RS7A 5KREA 4ENVA 5I9NA 1OT5A 3G88A 3G9UA 4C5CA 1W0CA 3ZE7A 3QI2A 1QKIA 3EBLA 1S2IA 3GDOA 1SJ9A 3K05A 3QYPA 4RZSA 1YR9A 1YQ9A 4WVLA 3U26A 5HM8A 2V3CC 1NNSA 3UMGA 2HGSA 4KCGA 2Q2NA 1I7LA 3ECCA 1KYVA 3MNFA 2ODWA 5DP2A 1ZXXA 3F6RA 4FB4A 1GQOA 3GFPA 4XIGS 1N6IA 2FFJA 4I1IA 3PSHA 4L8WB 4D6YA 4QYIA 1DKMA 3CFYA 4EQZA 3AUUA 4E5DA 2O8DB 4WBNA 2FPUA 4WN9B 4LNAA 4YI5A 2P1RA 2DBQA 2XODA 1BTOA 4I4LA 3WGLA 1O3YA 3DNMA 3LQ4A 2QI9C 2YWEA 4WEOA 3RC9A 2O2CA 3PG5A 1GFWA 1RRKA 2WQ6A 4HR7A 1QIHA 2OHVA 4RBNA 4AY6A 2JAUA 4IIFA 3TUIC 3UAZA 6GPBA 3UJBA 2P68A 3EN0A 1TZMA 3JQFC 1S96A 1DBIA 3FKJA 5EI5A 4X71A 5LZ4A 4P86A 5IAJA 4QA9A 4ZOQI 3IV7A 4QGHA 2PUBA 2FPIB 3MLBA 1G5HA 2J09A 1VJGA 3KQNA 3UMBA 5BR7A 3HA5A 3EDOA 1DBSA 1BW9A 3RSZA 3RIGA 3SR0A 3TJRA 3D6TB 4HH3C 4QXQA 4MVYA 1AUPA 2H85A 3DMTA 4XVRA 2IUYA 4UXHA 3N0WA 4ENRA 2CGEA 2XNKA 5ELMA 3CZAA 4JCCA 2AI3A 4XXHA 4XIFA 2FDCA 2CLHB 1KAHA 1E4OA 4KN8A 4K6HA 4X6UA 3T4UA 2JD1A 1H4TA 2CJWB 5L9AA 1GGMA 1NVDA 2HJSA 5FNZA 3TECE 3UHJA 2QRJA 2OGSA 1A9ZA 4MPTA 2JW5A 2BF7A 3DP9A 3LWDA 2ZIXB 1KOGA 1QE5A 1XX6A 2RHHA 4MJ7A 4P1ZA 1F38A 4RIFA 4UFOA 3MD9A 3R3ZA 2K2WA 3F6CA 3FCEA 2A9FA 2AEFA 3L3BA 3WKBA 3CWQA 2VRCA 3KKLA 3PNLA 5EP3A 1XI2A 1LSJA 3BSWA 2DFNA 1LI7A 3OP4A 2V4UA 4HL6A 4CVNA 3TB6A 1E2UA 4BQFA 1JILA 5ALRA 4AMBA 2WFLA 2I5PO 3O8DA 2I3BA 2ZRPA 3MAJA 3DTVA 1SUFA 1DCTA 4Y6OA 4CM9D 5CDUA 1BHSA 2PGDA 3DDOA 3IOMA 4RD4A 5L40A 3AR6A 1G2IA 2BM0A 1C7QA 1U2GA 3DL0A 3NONA 4C01A 1JH9A 2W71A 1ZCAA 2GDZA 2BDUA 4LC0A 1TCVA 1NMSA 1VL0A 5ITWA 3OURA 3H65A 4GQIA 3SOPA 2KE5A 2R60A 4KPUA 1VFNA 1H66A 2J8ZA 1V11B 2GTHA 4I1YA 5EKXA 2N3ZA 3GLTA 3WLJA 3OT5A 3KDSE 2IHNA 4LX0A 2FDXA 1K86A 3CLTC 4ETWA 1V4NA 2VJKA 1G0OA 1J49A 1YS2X 1YVEI 5JFTA 3IDSA 2O0MA 3LDFA 5I9TA 3GCWA 4B85A 1IE3A 3JAMA 2OQIA 2Q8QA 3RYFB 4YMUA 1TIKA 1OLUA 4JKYA 3PE3A 4N5HX 4BJ5A 4DCUA 3IRVA 1E5VA 2RH9B 1X13A 3E84A 1Z0SA 4XGQA 5IANA 1R18A 3IUBA 5LU8A 1XPJA 1I7NA 3P9YA 4PZUA 5C8YA 3K1ZA 1U28A 3CISA 3OEHD 4KQGA 2ZB7A 3QF7A 3UA4A 2BUAA 2H59A 1ID1A 3FZQA 2Z9CA 3AM4A 4MP3A 1N8SA 5D6NA 5IDWA 3X3HA 4G07A 1ZINA 3WDLA 4JP5A 1R2QA 3MJTA 3F3MA 4M0LA 3VPDA 1L1EA 1L7OA 2H1CA 1BS9A 1AU9A 1RXYA 3AL3A 1NSTA 4FCWA 4L1KA 4PO1A 2MR5A 3C5EA 3N8DA 3UJHA 4BNDB 4E32A 3IKMB 1K92A 2TSYB 2QSUA 4O0MA 5LQJA 2XA1A 1UFRA 4F86A 3IEPA 4WIAA 4RFLA 4ZDWA 3BXFA 4HCJA 1U9YA 1EGMB 3QMWA 3QX9A 3IQDB 4LJYA 3PEFA 4MVJM 4YPFA 9GPBA 2RGEA 2RK3A 4NMLA 3U7QB 2ZM5A 2V3VA 3KLPX 3F8TA 2XZOA 3ZGZA 1OD6A 3CX4A 3F47A 1UZNA 1QONA 4N7MA 5I4CA 1IM2A 1Y4DE 3U0BA 3ZDBA 3AY3A 4FK8A 3SNKA 1BMTA 3LX8A 3I1FA 4TV8F 4OOFA 3OCXA 4KP7A 2XCTB 2C5EA 3I8OA 3R0JA 3HCFA 4D4HA 1B42A 4ZHQF 1DKPA 5JCZA 1CYDA 5CFZA 3AF2A 2V6BA 3FUUA 3ZI0A 3N2GA 1DCMA 3STTA 1VBMA 3L0PA 4Y2YA 4GS5A 4LGYA 5F21A 1FDOA 1IUNA 2DG2A 1DLIA 1C8KA 2INGX 4MQEB 4HFRA 3SZUA 3CPSA 4A16A 4LBZA 1J22A 3HWSA 1U2PA 2X22A 5K0NA 1QAQA 2NPFA 4QJBA 4RPJA 1ONNA 3NHRA 2QMOA 4OKIA 1Z9BA 2IYEA 5HW0A 2KHZA 4QUGA 2F1HA 4RJLA 3B9BA 4H1TA 1CDDA 1HEYA 4JB3A 1Q7RA 2A9QA 3ZHXA 3ZWCA 5BRJA 2CYBA 2ZT7A 5LXTA 3GFVA 5GIPE 5A4MS 4XR9A 2W48A 5G0VA 3SVTA 4QECA 1VKOA 4OLHA 1EG7A 1UBKS 2HCBA 3CS3A 5TRTA 4I19A 1NYRA 1F2UB 3L93A 3SDBA 1K8ZB 3PBKA 3SF8A 1G5QA 2ZBRA 4ZI5A 3BK1A 2LWIA 4J0CA 1ZNXA 3HDQA 2FR0A 2HA6A 1SKMA 2C00A 5FLYA 4KXUA 1S3FA 3EPKA 3RAEC 2OOSA 2EKLA 3AZPA 3DJYA 2OK7A 1C1XB 3AFHA 1NRXA 1QZXA 3H5AA 4FS8A 4Q18A 5D5PA 1XK6A 2XEDA 4MKGA 4V39A 1JG1A 4W8GA 2SICE 5COBA 4Z9AA 3WB9A 3FTDA 1XRNA 1SNYA 4ZAGA 1XTSA 4PYMA 3OZEA 1X9IA 2ECPA 4AK9A 1PO7A 3HEBA 4IDQA 4E5YA 2Q5QA 5CA1B 1IHUA 2F90A 4H7DA 5DOZA 1NM5A 1RHJA 1OGJA 2FEKA 4MYDA 4ER6A 3NETA 4M8SA 3TCKA 2DWCA 2VYCA 4I7EA 5DN6D 2DR2A 3FNQA 3SJZA 3P45A 3CW8X 1GJRA 3PGJA 2FN4A 2J9ZB 3GP8A 2AR9A 2F3SA 1GA1A 3OI7A 4O4LA 2XCIA 3UUFA 1WOYA 1QV6A 2OYSA 4MAFA 3AKDA 4IIVA 4MYTA 4R8LA 4TSFA 4XFKA 3ZXUB 5G0WA 4DQVA 2FX2A 3OOSA 2ABWA 3R6WA 2QUAA 3LT0A 5JANA 2R6FA 4NDAA 4RZUA 2WDPA 3IUSA 1DOZA 1VHDA 1XK7A 3LBFA 2P4SA 1UFQA 5B4UA 2VDOB 2BYTA 4IX9A 4NOKA 1CEEA 2WJYA 2BL4A 2F4VB 3VTAA 1SC4A 2FOLA 4HLUA 2RGUA 4MB6A 3G9QA 3RC2A 4G1FA 4B83A 2VF4X 1C7EA 1HEIA 5AW5A 4ZTUB 2ZITA 1DO8A 3BGIA 1BOOA 4MVJG 4Q1BA 2IS1A 1RM0A 2YW2A 3IVXA 4CDNA 3CLKA 5G02A 2REBA 1TX4B 4A6EA 3EFOA 3F5SA 3MOIA 4YT4A 4MSUA 1XLTA 2AEJA 3MCWA 2FGJA 2HI0A 3K0CA 3CMMA 4LOIA 4NPAA 2A3NA 2H9YA 4PRYA 4X66B 1CLUA 1GQQA 4CMEC 3ZJ4A 3GVCA 1XZLA 1J33A 1BFKA 5LYJF 3STXA 3EXEA 3PYXA 3I4CA 4YTEA 5E1OA 3UFBA 1ZA2A 5DYGA 4C0SA 1MJNA 4OJKA 1NONA 2QA5A 4YO8A 2EFGA 1F48A 1W88A 3WYDA 1O0CA 4M54A 2PQMA 2R66A 4ARZA 1QTIA 3O8OA 3KOWA 4LOHA 1MD9A 4HS9A 4NOLA 1IQ0A 3FOAA 1U6KA 3FYSA 3B36A 4S24A 3ZPXA 5D1NA 1SKBA 1FQKA 2FN7A 3LG2A 3WTCA 5L3SB 4M98A 4N9QA 5HKKA 4BU0A 5E4JA 5EZQA 1XG5A 4A15A 5U4XA 1HOXA 4EY7A 1Y9EA 2O2JA 4MKZA 4O1IA 5TPWB 3ZHZA 5K4AA 4A2PA 1NRIA 3UTCA 3VYTB 4D8UA 3QWHA 3RS4A 4YUAA 3AIIA 4MA0A 3PXCX 1I7DA 1D03A 4EUNA 4DR3B 5MN6A 4KWIA 4HDRA 3BC1A 4Q48A 1JG6A 1GP2A 2N9UA 2NQ2C 2CLOB 2ZRMA 1JA1A 1CY6A 4IXTA 5JMPA 2Y67A 2ZBEA 2IYOA 1PZHA 2NZXA 3WY9A 1J2UA 4BNTA 1M0WA 2FQQA 2VK1A 4OQNA 4Q7MB 4YBRA 5AVXA 4YYZA 1N34B 2GX6A 1U8XX 2X1MA 3EYAA 2B7CA 4M0CA 3R0VA 1W2HA 1PKXA 4BQPA 2VDKB 3ACDA 5FOXA 4IIJB 5DYTA 5K0GA 4AG5A 1D9ZA 2YWJA 4XOUA 1XD9A 3PITA 1NVGA 3B9RA 4IGAA 4PPYA 1ZQ1A 2IY9A 1RWNA 2GN0A 4A0SA 2NO6A 4GOXA 3T9EA 4CCAA 5ESRA 4MDEA 3I28A 2AUTA 2RHGB 1A72A 2GSDA 3DCJA 3EGIA 4BO9A 3SC4A 4BFLA 4DNXA 1ILWA 5LOVA 2JLVA 2IIVA 1CNEA 4UXIA 2B6NA 2CNDA 1NF9A 4PIPA 3ZS9A 4BLUA 3A37A 4AF8A 3GH3A 4BX2A 2PXHA 3IP3A 4QTYA 1W35A 1C5KA 3HDGA 1EXMA 4O4JF 2FOXA 5IDVA 3AJAA 4IINA 4BUJA 4DIEA 2FWIA 3VU9A 1ZJJA 1JDZA 2HX1A 2UUOA 1UZAA 3CJQA 3PNMA 4JUCA 3H2BA 4OYHA 5T6BA 1ZK0A 4Q4HA 3ZBUA 4FFRA 3QU7A 4RL6A 2ZYSA 1ZM2A 1QRTA 4F4DA 5LP6F 4KXFB 4DCSA 3T3OA 1ADCA 1BGWA 4GICA 5GY7A 3UG7A 1E9RA 4LAFA 2V55B 4LNUA 3F6YA 5ARCA 1IONA 1E5QA 1QH8A 2AI2A 3DHNA 4IDOA 4B6OA 1YZGA 4LG1A 1QU2A 4AJ9A 4NE2A 3A6EA 4B40A 4RD0A 4ZYWA 5LLTA 3BMNA 4L0CA 3OPYI 1R0YA 4JP2A 3HI4A 3EF0A 2ZZMA 2I34A 1UKCA 2MT9A 3UJNA 2ZYIA 4UDYX 5JATA 1PSZA 3ZDRA 1M67A 2RG7A 2FZWA 1ZEJA 4B4KA 2VRNA 5B3JC 3O21A 2YV3A 4HZUB 4NE9A 1MEEA 5IT4A 5BR8B 3JQ9C 3EXIB 2EJVA 2JANA 2NU9A 2OCGA 1S9DA 1VJTA 3DJFA 4UOZA 3O38A 5ALHA 1NC3A 1QHXA 1BQ4A 4JI6B 5G0UA 3IP9A 1OSNA 3C8HA 4JQYA 5FOSA 3ZGXA 5KQSA 2JEZA 1BEUB 3QWIA 3UWOA 1REQB 2AK3A 1N7GA 1Z0AA 2YN2A 1X2EA 5DYIA 4UU7A 5IEBA 4ZYZA 5F9HA 5IG2A 2BI4A 1NDHA 1A2QA 3E3NA 2O3TA 3ZLTA 2IIBA 5ALSA 3QU2A 2ZAYA 5DBEX 3W2IA 2ZUTA 4ZVLA 3RIHA 3EVTA 1YJAA 3JY6A 4G4JA 4WV3A 1QIJA 3DDNA 3HBJA 2ZCUA 3PL1A 4WMLA 5J4HA 4RL4A 1TTPB 1YZNA 3UHPA 3JX9A 2IODA 1G4AE 5EC8A 4UPEA 2P77A 3A9TA 3LK6A 2FWNA 3D4IA 1TYEB 4U6NA 2X1LA 1GSHA 1V96A 1KEZA 3HWRA 3LUKA 3RLIA 3VAYA 4CCSA 5H9WA 2BUBA 4JR0A 1XDGA 1KIFA 2VDNB 3UBTA 1KTVA 2Y6UA 3S2FA 4NFYA 3GFOA 4MWOA 3E0QA 4I46A 4O6VA 3B6ZA 3G7SA 4GVLA 2XBMA 2WAYA 2Q5CA 2DUJA 5AOVA 2V7GA 5FOTA 4KOEC 4NBLA 2B83A 2WQZA 2P41A 2ZUWA 3AETA 4QUKA 1W7AA 2CCJA 1K5HA 2VTEA 2ZUCA 4D0GA 3KSAC 4FTWA 1E7YA 3GAMA 4AS1A 2QY9A 4DR7B 1LUAA 2FVYA 2MU1A 4IO1A 1QHYA 3O8LA 4OQ4A 1JDTA 2P69A 2Q28A 2VO1A 1MJGA 4LY9A 4O2BB 4RVNA 3JVUA 3VC3A 3ZD9A 1HE3A 4U3JA 1JLLB 2ONKA 5EZSA 4Z4EA 2CYCA 1Z07A 2WYWA 3EY9A 3H05A 4RIIA 1G2QA 2VJMB 2FMKA 3KOXA 4WXEA 5DLYA 3KUKA 2DFDA 5BT9A 3ZWPA 1C7IA 3DFIA 2Q07A 4KPEC 5KDDA 3DBRB 1IQUA 2ZT6A 2ZSUA 3FDFA 3TGPA 3K30A 1AS0A 4H7PA 3OZGA 5HS6A 4PG6A 4OUDA 3TZKA 3AVWA 1BYIA 3AI7A 2J0SA 2HADA 2PX8A 2BBSA 3GIWA 4PX5A 4L02A 4WT7A 5E38A 2PN1A 4XEHA 2NU8B 2WTUA 1VCNA 3VC2A 2F8TA 3IB6A 3A6ZA 1GA6A 1UBGA 2JCSA 3IR7A 4W5TA 4P0TA 3ZDEA 3GLFA 3L49A 2R8YA 3KVNA 2UZ3A 4WSOA 1CJSA 4LWPA 2HYDA 5MF6A 2J46A 2NXJA 3VH2A 4J0HA 2QMUA 1E6WA 2BFEA 5TDHA 4Q1VA 2VJQA 2B0CA 1ZGHA 4KGXA 2JPDA 1CK4A 1N1EA 3A1UA 4QU0A 4UUNA 5G3YA 5REQA 4ODIA 2WE7A 3QOYA 1KK3A 3OM0A 3GMIA 2UVPA 4DYDA 2QJTA 3TCNA 5A0TA 5GJBA 3G3EA 2P65A 3IERA 1NSFA 2NADA 1RP1A 5H3LA 4OHOA 2PX0A 4Z1MD 2IEAA 2Z1MA 4PF1A 4DAEA 1LPSA 1UBNA 1JL3A 5L7WA 2D5LA 1X1AA 3SXUA 3R7DA 1U90A 2VYQA 4HVAA 4IFEA 3LCMA 4ZPXA 4CG0A 1VJ1A 5KQGA 4DR6B 4G67A 5LZ9A 5LIRA 4RELA 2Y3IA 5EZ5A 4PZEA 1XFAA 4BO7A 2V97A 3ACCA 2GN8A 1C8LA 2H17A 4CF6A 2CK3A 4EHDA 3AM1A 2ZJ7A 4B7AA 2H52A 1O0BA 2ZAIA 1RTTA 3SHFA 2E89A 3TR6A 1HDRA 1WS6A 2AFHA 2VRWA 3N2YA 2KBEA 4L0MA 3F4BA 3HY3A 4E15A 5BV0A 1G6OA 2RBGA 2IHVA 2TMGA 1ATZA 3L79A 3ZDCA 2R7AA 4PBRA 2G5CA 3KQMA 4QAQA 3JQAA 3A6PC 4AWBA 1IY8A 2EV9A 1WL8A 3ISJA 1VSBA 2OXRA 2SECE 2CUKA 1A2OA 3P8ZA 5FBVB 4LGCA 4C4AA 5LU9A 1BXGB 1QPBA 4EY3A 3IIEA 2JVIA 3DBLB 2BBTA 4JSYA 5HJ2A 4NSNA 3AFMA 2H2DA 4OSEA 4B09A 5I3CA 4ND5A 1UM9B 1DG9A 1P6QA 2C5SA 2EWMA 2YOHA 3EUFA 4R9VA 4TM8A 5DISB 5TQ0A 3ZLVA 2AT1A 1O9BA 1L7DA 4M87A 4EHHA 1GLGA 3B3FA 4PM4A 1SC6A 3U62A 4ZGBA 2QWXA 4KKVA 4L5YA 4DCVA 1ZG3A 2IF0A 2DP4E 4HRYA 1E7QA 4EHBA 3ICQB 1N2JA 1ZJ5A 3PVZA 1DAPA 2BPOA 1ULHA 1FP4B 1ZDMA 2QP9X 1R6XA 1ISIA 2UYYA 2Q45A 3ZV3A 5ALVA 4YCSA 4AUMA 1X6VA 1G8JA 1NQ5A 1XJ0A 3WYFA 4ITRC 1C3JA 4OHUA 2FRDA 4RA6A 4NY1A 2YVKA 4KYUA 5KYNA 1YUNA 2PIAA 4O25A 1NR7A 1XXHE 4WEQA 3KFXA 4ZEOA 3SI7A 1USIA 4EB8A 1G5TA 2D59A 4A4DA 1JV2B 1FS6A 1NY5A 4DJEC 1ZBQA 4OFZA 1IBLB 1XZMA 3BGDA 1ABBA 2Q5JA 4IDNA 1NHWA 2NUAB 2UVQA 1XCOA 3W5VA 2NT4A 4LZPA 4TMXA 2DQKA 2HOQA 4GL2A 2VWQA 1T8UA 3IEKA 4CLHA 1Z7BA 3L6CA 4HX9A 4LI0A 1TNDA 2WTXA 3MWDA 4GNRA 5H5JA 3QYJA 4K03A 2XDQA 2HH9A 5JZMA 1AZSC 3KZMA 2IX3A 1CUDA 1SUDA 2W2VA 3SSAA 2V0NA 5I7SA 3KNZA 1QP4A 4B5KA 3MK31 4E09A 2D7JA 1MTOA 5H02A 3SJ7A 1SR8A 2ZIZA 3VVBA 3MAAC 3QV1A 1GQFA 3LV8A 3HDVA 1N6HA 1ORTA 4XVUA 3L7CA 4IMRA 3NAZA 5K6AA 1V43A 5HMLA 3TIVA 5AW8A 2YKGA 4TUYA 2I67A 2YWGA 4A6DA 1YDMA 4BO8A 2QRUA 2H6EA 1BDMA 1BXZA 3LW7A 2RI1A 5C34B 1H2EA 2EJBA 1A04A 4ND4A 1C81A 1NURA 5K0EA 2W8BB 1RI3A 1GT91 1PIWA 2AOVA 2F3RA 2WPDD 2XUDA 5YASA 2H8GA 3QKWA 3WBBA 3IELA 3Q4GA 3RTBA 2PS9A 4UEWA 2YYAA 3B48A 4RA9A 3MT0A 1I36A 1X14A 1M2JA 3OZXA 1EK0A 3P4YA 4PCUA 5LYYA 3RGGA 5CAEA 3PKJA 1LFAA 1FF9A 3AHDA 4OX9B 1X9HA 3D8HA 3EXG2 3O31A 2B34A 3K09C 1BCRB 1G21B 3TD6A 3FCYA 3I8XA 3TNYA 3VHQA 4BCDA 3WLQA 1DC5A 5HF9A 4WCFA 1XWWA 4HVTA 1QORA 3TNDA 3BJMA 2QOEA 2CY0A 4H3VA 1WOMA 4TVOA 3IBCA 2P1ZA 4WJLA 5KVSA 1PJTA 1KS9A 1PBTA 3H99A 4PSCA 4B3IA 4ES6A 1CQPA 1LDGA 4UM8B 5DCLA 4R83A 2GJAA 5LMUB 1XTKA 3GEGA 3MUFA 2BFBA 3GVPA 5C35A 1MJHA 1PR9A 4D5GA 2E5WA 4JXKA 5HUHA 5IUNC 5K20A 1TU4A 3GU3A 3KKKA 5ALFA 5A3RA 1NJFA 2PVSA 2H7CA 2FOIA 4XH9B 1X8JA 4JL5A 2E3JA 2D5BA 2FPGB 2P9CA 4CT0A 4D9BA 5K9ZA 3PFIA 4HDNA 2DBVO 1E3SA 4KJZA 2Z6AA 2O9JA 3HJNA 2ZSBA 5AM1A 1XO1A 4Y6GB 1NBIA 4F9FA 4ZN6A 5KTSA 4C4YA 1M83A 2X0DA 5BW5A 4N5LA 1GDDA 3GJTA 3A4YA 4YCNA 2XB4A 1HFJA 2YJ3A 4LTMA 3MT8A 4PE5B 3KJHA 4JLKA 1E32A 2ZSKA 4DA7A 2JD2A 4Z9YA 2K5UA 4MYHA 3BRWA 1WB5A 4OJYA 3KEMA 3TW0A 5T67A 1VCIA 2FZKA 2VH1A 4DE5A 2KYRA 3HSYA 4EPYA 1KO7A 1GTG1 2QNBA 5BUQA 2JFGA 1XRLA 2C7BA 1M0SA 4GMKA 3I5YA 2O8BB 2C2GA 2CDCA 3ERCA 1E7SA 1XKQA 3H0CA 2LTAA 3G1TA 4I2VA 1KI8A 1LX6A 2JFWA 2R3SA 1I4DD 1IBSA 5TPZA 4MV3A 4EHLA 1IOZA 5JLAA 1M7BA 4RMGA 2JLZA 4HAOA 2FPMA 3P0IA 5LBTA 1TF7A 1HTTA 2FN9A 1ORIA 2QVCA 3E2MA 5CVVA 2ZIFA 2F1KA 1KEVA 3W3AH 4F04A 1E3QA 5BXQC 3ANMA 4N3AA 3ZIUA 1EFVB 4P3NA 1KYXA 2I1VB 2H4XA 3P96A 5HPYB 3WGYA 1LWOA 2YZ7A 2D8MA 2PV7A 4C4RA 4EZEA 2FPRA 3MXOA 4HNSA 2J1LA 2QU8A 1MXFA 1DO2A 3THYB 1F2VA 5HOEA 1KMNA 1PWXA 3QITA 2M6SA 3QWFA 4AJKA 4QFDA 3FNRA 1TECE 1WUIS 1NR5A 2AMLA 4MUJA 4LC9A 4P98A 1G18A 1JQDA 1JUDA 5GJVC 4AQYB 1YR6A 2PT6A 3BZWA 5EMKA 3JAWA 5FRDA 3RQSA 1Y9JA 3V7NA 5PNTA 2LCFA 3KLOA 1RYEA 4G9EA 1IQRA 1QP8A 2P4HX 5EXXA 3U7JA 1W87A 2PLWA 4KNWA 4MZDA 1NVMB 4MRPA 2EQ5A 4R5HA 2IELA 3BJZA 3C6XA 1T9KA 4B8WA 3LH5A 3PD0A 3I3SR 5LM3A 1TIPA 2GH1A 2RJ3A 1RMTA 3ZWXA 2O2IA 4HDKB 3ZNNA 1DMSA 4B3XA 1K8XB 3H1FA 5H68A 4L0DA 4Y1GA 4DTCA 1VBKA 3A2KA 4Z2AA 5TY0A 4JWKA 3UK7A 4C7KA 2WSIA 4OGGA 1DWUA 2C77A 1WR8A 2F7SA 1RRVA 2ZJZA 3HWX1 3IXQA 1U0HC 3PI6A 3L43A 1QDEA 3SHQA 4B6FA 4YAJA 3VX3A 3MUNA 3H7IA 4EHNA 3E9RA 5J2UA 2WYUA 1RCTE 2EZ8A 3KSUA 3VO8A 2Q4RA 2PKQP 3HO6A 3WZMA 3Q15C 1K9VF 4LZLA 5HMMA 4C2AA 4CIXA 5BXYA 4JKOA 4WXRA 5B53A 3HU5A 4M83A 2PFKA 3PR3A 2V8OA 4BLOA 2R85A 2XBLA 2XCOA 3DT9A 3IYLW 2FN8A 4C0QC 3PLNA 5FNVF 3HHEA 5P8WA 1VRCA 1H8EA 2P2DA 5KNBH 3EXFA 4ETNA 5DU2A 4KU4A 3F7MA 3CA8A 2WF8A 3H83A 5JU6A 3TX6A 2GEKA 5AKYA 1TPZA 1KZ7B 3E05A 2AXNA 3SZOA 3U9SA 4DZTA 5BNFA 1ODIA 1WG8A 4MW5A 5HRAA 4Z4HA 3OZBA 4DLTA 5K0ZA 3VZPA 1CJMA 2I3GA 3E2PA 4BTLA 3AUAA 1T8RA 4LRUA 3ZW9A 3V4PB 2QMEA 4C05A 2HV9A 4FX2A 3PXDA 3C7TA 3OIWA 4AG6A 4DT1B 4BKUA 2G88A 521PA 5LQCA 4LZNA 3KUCA 3DD1A 3I5AA 4BDTA 4XFDA 1EFRA 3AKEA 4C0KA 3L6DA 4QFMA 4GM4A 5EZYB 3I0NA 4MHSA 3V2IA 4HWGA 1TO6A 4X1IA 1TQ8A 5CXUA 2BOVA 4LMBA 4P36A 1E2HA 5CDFA 3VKFA 4WECA 5CG1A 1SXGA 2I7VA 4TV8B 1UK9A 1RMYA 1QM5A 1ULTA 1PQ4A 3DTTA 3WGZA 4EGCB 1YJCA 3L8YA 2O54A 2J5KA 4ZHQB 1KY3A 3CF2A 5HIIA 3TS1A 5KB3A 1WBJB 1G3UA 1OOEA 1PUXA 1RWPA 2OMEA 3FSGA 3WICA 2Z4RA 4D56A 5KWJA 4JEUA 1DP4A 3MPUA 2OORC 1Z4NA 2R7NA 3DXFA 1ISPA 1AXGA 1DE0A 2OM2A 4FIZA 4L27A 4C7JA 4A36A 3MHTA 1RLUA 1YBVA 3LCCA 1FDSA 2VHQA 2BV3A 1XYYA 1L0BA 4O4HF 2ZIUB 4X7RA 2C82A 3R5SA 2FR8A 5IWAB 4LOKA 1ACMA 2QHXA 3NHZA 5FFNA 2F55A 1X0VA 1ZA1A 4HQ6A 2HHCA 2JKVA 1EUCB 2I7XA 3IKJA 4C9BA 1RCUA 1AKQA 4UHCA 3IAUA 2PUFA 2Z5GA 3ND9A 3ODPA 2II6A 1U6IA 2VHXA 3WC4A 3UJAA 4YRQA 1U5AA 1WDKA 3SAJA 2QEQA 1ZMBA 4EIWA 3S81A 1BVYF 2D13A 3B53X 3JD0A 3FDZA 4TN5A 2IXTA 2PX3A 1EFLA 4IXDA 5E6UA 3ETJA 3VJLA 4F2WA 3KPUA 2X0NA 1YRWA 4D3DA 4KQ1A 2ZROA 1WDLA 1WZ2A 5KZMB 3PQ7A 3VJRA 2NV6A 2XNCA 3Q72A 2EWVA 4DFDA 3K72B 1KR5A 1CB0A 4JYAB 2Q3CA 4RTPA 1NQTA 5BSRA 4E1AA 3VYWA 5TMPA 5A05A 2GLUA 1NVTA 3A1CA 3EC1A 2I7TA 3OQVA 1C1DB 3ANNA 1EX6A 1P73A 2QTLA 1N5RA 2Q3EA 2R1VA 4MW2A 4BV9A 3DHYA 3HUTA 3OIGA 2P6MA 4PZCA 3WHKA 3C39A 2J3DA 1DNPA 1XVAA 1DPGA 2PKWA 2QGNA 5JJBA 5JSYA 3V1KA 1CIJA 4X6YA 2HDHA 1XP8A 2G72A 5A3VA 2XVYA 4OCZA 4QGSA 1E6KA 4J9VA 4DB2A 2Q9UA 3AKYA 3WXBA 5C1DA 2ODBA 3FWNA 4UZEA 1S7CA 3PNOA 5KYWB 3S1AB 1O87A 3C85A 4FDVA 2E48A 1BDIA 4ZQEA 4KFUA 2A9OA 4RE6A 1YVRA 4PZYA 1LPAB 1I0IA 1JIJA 5FUMA 4TLEA 1P6XA 4Q9AA 1HT0A 4P3KA 4EJ6A 4D6PA 1ISMA 1E6LA 1OTHA 2G9QA 2O1SA 2ANBA 1Z06A 1VB5A 1E0DA 1FYFA 1RWWA 2YYYA 1KKUA 4REQA 2R47A 4CMHA 4CLXA 1HNWB 1FDVA 4PSDA 4ZOLA 2ZRKA 1E98A 5B37A 2QZ9A 3E2IA 4YCJA 2CXTA 2CFCA 1FRFS 3SY8A 4N47A 1LC3A 2EFDB 2VAMA 3GDHA 2E2WA 5EIAA 1KAEA 2CB0A 2KX7A 4IUCS 3PNSA 2QLTA 4WJKB 4YQYA 2FQWA 5GJCA 3L7OA 4R2JA 1XLWA 2VRBA 1KHHA 1O95D 3LIPA 3Q0EA 3ZHSA 1OH8A 1BN6A 2JAQA 3F1LA 3QW2A 4AZTA 2F00A 4F4FA 5JSHA 4HY3A 1XDBA 3GMDA 1Q15A 1RIFA 2GEUA 4GI5A 4JK3A 3D4NA 4JJ6A 2FSVA 2WU1A 2OHXA 4J0FA 1ZGGA 1ZOIA 5IVPA 3L9WA 1L5NA 2DX7A 1J23A 1DEHA 3DEFA 3HA3A 4KXYA 3VKUA 4YV1A 7YASA 1FFCA 1P62B 1JKJB 2CNNA 1LGYA 2D7CA 3PVSA 3SSNA 4QPNA 2EKPA 2WMOB 1R0KA 2H9AA 4WCVA 4UUBA 4YB8A 2QTZA 5T3YA 3O7WA 3ZHRA 1E1RD 1GSOA 2QLJA 5FWYA 2XY4A 2J32A 2NZ2A 5E1MA 3O7MA 4R40A 3HPRA 1YRHA 2WM3A 3C1UA 3AILA 3E48A 1ZU5A 2DUMA 2Q4OA 3KJFA 3PEEA 4I5IA 3UMCA 3BZBA 2PZKA 1VG8A 1O0SA 1GZ6A 4MV6A 4RHYA 4UFNA 5LUBA 3WJ7A 1Z15A 1ZGCA 2H54A 3M1LA 3NWEA 2WUFA 4MS4A 3RK4A 4QC2A 1CZHA 4X97A 4D43A 4YMVA 3MWEB 1NJ5A 1RBYA 4DDVA 3B3GA 4N40A 2B7BA 5CB4A 1U8FO 3DOEA 1H94A 4ZYTA 4DLBA 1EFTA 2OFWA 4L4YA 3HADA 2RGCA 1HZZC 1HYEA 2JVKA 3AF5A 1QQ5A 1SCJA 1T6XA 2VBCA 3AJ9A 3DZFA 3OD5A 4TRMA 5LUAA 1G9SA 3HP1A 3TSCA 3TVYA 3T52A 4BMOB 1HLPA 3L82B 3M0EA 2QM3A 3K2BA 1HFWA 3PDIB 2CHVA 4L78A 1WZUA 4Z51A 1J1ZA 3WIDA 5IHXA 3FMVA 1Z4PX 5TS3A 1M6YA 2YXLA 1RLIA 4DG9A 2FLKA 4YRKA 2OAGA 1YBFA 2GZSA 4RJJA 1BJTA 1R0CA 2HIGA 5CJJA 1NUUA 3HJBA 2O0KA 1ZAYA 4B3HA 3GXBA 4V2UA 3D7MA 3FYHA 3CRRA 1AKTA 3PQ8A 2IVZA 2DQSA 4QYMA 2A30A 3PDJA 6Q21A 4Q1EA 1TVKB 4H27A 1UC5B 2RG1A 1M34A 2C03A 3ZWKA 4ITVA 5D51S 5G1OA 3B51X 3ESXA 2M1XA 4BLWA 1B0ZA 3AFGA 3T99A 3C7CB 4XYMA 3NIGB 3URMA 4E88A 5H0IA 2BCEA 3IJEB 3G5UA 3ML1A 2O2HA 4P7KA 2JGIA 3U4IA 4I08A 2W9XA 1YI8A 2QPTA 3JCZA 4WA7A 5E6RA 3PIIA 1L7AA 2AJDA 3OCZA 1H05A 2HMAA 5FTJA 3ESYA 3BMOA 2APJA 1UBMS 3JWPA 4ZD6A 5LP6B 4DW8A 1E0SA 1UCFA 3BE8A 3MQFA 2QAGB 1NZJA 1Q74A 3NLLA 4WZAA 1N0IA 3NBAA 2V7WA 2VF8A 3MBOA 3FMGA 1AT1A 4FFOA 5IU6A 2O8EB 2OV8A 2Q46A 2VKQA 2XZTA 4IMPA 5B4TA 4AZ0A 5B2FA 3RRYA 4TKLA 1CJBA 1FXWA 3CV3A 1PT5A 4FJ0A 5AJXA 1EFAA 4F3NA 4JC8A 3KOYA 5E6SB 4F6RA 2IOFA 4TMTA 1RKBA 2LIVA 1TQ6A 1G3MA 5BNZA 2XAUA 3E0XA 2RAPA 3MJRA 4L50A 3L05A 1BJKA 1Z0UA 3IVCA 3N7TA 3IC5A 3X1YA 1Q22A 3WJAA 3IL2A 5C80A 2UU9B 1VHTA 4L95C 4U63A 2JLQA 3KOUA 2V7PA 5AESA 2QX8A 4DCCA 3SC2B 2RCNA 1JQ3A 4X95A 5FXMA 4ZAFA 4JV5B 5FLEX 3ZZMA 3TFWA 3CEMA 1Y8CA 1G7TA 3OH8A 4V0ME 1KYQA 3ZQKA 4B3RB 2CLDX 4QYXA 5IABA 4EPVA 1YMVA 3FNIA 1O95C 4Y1RA 5IARA 3H3JA 1ZIYA 1I1QB 2IP1A 3DE6X 1RYFA 4MPJA 4EFDA 5JDCA 5KHAA 1LDYA 1HYBA 2BEWA 2JJYA 2OCXA 2YYZA 3GEIA 3K15A 4LNHA 1YZVA 3D0RA 1I5EA 4UTVA 1QGOA 2XKBA 3PICA 1SXQA 3SZRA 4ON9A 3DE1X 2JHPA 5CX1A 4ND6A 3OIFA 1KDZA 3F7TA 1VHQA 4FCTA 3VKHA 3CF4A 4LVCA 4TSKA 3RO7A 4N7RA 3FXAA 4EDFA 4EY4A 3OZFA 2M32A 1GZVA 3T4XA 1KZGB 2ZE5A 4ZTBA 5H70A 1AGNA 4JLSA 4JBXA 4O4IF 4FYYA 3R5HA 4FR5A 3IDQA 3OFND 4ZI2A 4XARA 4HQLA 4EYKA 2G1KA 3QPUA 5AI6A 4B48A 3SM9A 2GPNA 3GMSA 4H4DA 4YWJA 5K0BA 3S8EA 1E5DA 4H3SA 3GFBA 1F51E 4AS2A 4KLNA 5EINA 5ED4A 2PGLA 5IUKC 3IAXA 4FOPA 4ZEMA 2JH3A 5JZBA 2C9CA 4HXEB 4J0KA 1C7RA 2E9SA 2KB0A 3GLGB 4DL9A 3FMIA 1YA6A 1QMGA 1S3SA 1YCDA 1C7JA 5HGJA 5LP1A 2IKSA 5DWQA 5JDIA 5SV2A 2O05A 4IV8A 1Z25A 3QYAA 5JAUA 4O3FA 5EWLB 2DBYA 4F6CA 4GZ5A 3KPWA 2I78A 4RFSB 5TGZA 3EQ9A 5CA0B 4HGYA 4PIVA 3LWZA 1HOTA 4QZVA 2WJ4A 1T35A 4RM2A 4PGMA 1OB5A 4XYGA 5A9SA 1AZLA 2IHJA 2ZPTX 1QR6A 5M5BA 4DVJA 5NLLA 3CX7A 4F2GA 1V47A 1H3NA 4M37A 2QV0A 1DXOA 1WV1A 3ETDA 2HU7A 4INJA 4V0NA 1E7WA 4OGLA 3JQ8B 4X3OA 3WLSA 2WIAA 4YONB 4ZK6A 3L1KA 2V7EA 1E79A 1V7ZA 5LP6C 2N46A 1L7NA 1XEFA 2FPSA 3FOWA 2H29A 2QAGC 4FGJA 5FA5A 4DLAA 5CLJA 1NFFA 1PSDA 2KI5A 3RVPA 2IZOA 1Z22A 5JAHA 3T4PA 4NXNB 3M5CA 2E4WA 3KZNA 4G97A 4HSEA 5EJEA 3E3AA 4WN3A 1KDPA 1KVTA 3B7GA 1H2FA 3TZHA 2RGGA 4IS2A 2FAXA 3LRXA 1FBTA 4IRUB 2OYCA 1KJJA 3OTGA 4MROA 5HXAA 3E8MA 1P2DA 1R88A 2ZW9A 3SR4A 1WABA 5HF5A 2VSXA 4MA5A 1DZIA 3ISVA 3X2SA 4OEHA 1P4JA 3GUYA 4P3OA 1B3RA 4U2FA 1ZU4A 5DCWA 3QK7A 2FE1A 1UMCA 3GT7A 5KHOC 1SVIA 1NBEA 5JYDA 1LLCA 3HEAA 3NIDB 4N5DA 3CZCA 4X91A 4B9EA 2OAQ1 3KXLA 1KAMA 4YIKA 4EA9A 1V26A 1GN8A 1Y37A 4N49A 5AH0A 3C3EA 2IHUA 3ESDA 4WK6A 2BD0A 3A0RB 4ICIA 3R3WA 5HX7A 4FEYA 4O8CA 3NHLA 4KXXA 4NPCA 4HBZA 4TMFA 1RXWA 3TAUA 3TLBA 1R6DA 3MVEA 1AVTA 2GJ4A 1GFIA 2IE0A 3BPSA 3RUDA 4KN5A 5CD9A 5K0TA 1EUDA 4M0MA 1HE4A 2BSAA 3MJVA 5DEIA 1TUIA 3I1JA 3G9TA 4J1TC 2XWJI 5E7JA 5ILQA 4BEJA 3AFNA 1ZCJA 2HBRA 1XN4A 2CW5A 2G76A 3E5HA 3WSVA 2W6ZA 5FBZA 1TAQA 2SCUB 4DEXA 2DUUA 1QVRA 4P34A 3UMVA 4BU1A 2PUTA 4DXAA 1GTSA 4X1OA 2XWBF 3O4RA 1FTWA 1VCMA 1XGKA 5CRIA 5ALNA 3T7SA 4LFBB 4K81B 4E2FA 6REQB 1L7EA 3CR7A 1QZUA 5LMNB 1JKFA 1TM3E 5FOWA 2QX6A 1ZMRA 3C3YA 4CKEB 2CFRA 3KTAA 3L6BA 3DLIA 4DA9A 2QLNA 2F2TA 4OI2A 1XT6A 1JLHA 2FW8A 3VOTA 3SEQA 1V8DA 4BNMA 3TMYA 1JX6A 3H5OA 4FFBA 1W76A 3Q2IA 4GBGA 4DG8A 2I8AA 2ZM6B 1GXSA 3K8OE 3QELA 3GPDG 4EBBA 2J4FA 5CPFA 3KPYA 4WINA 4B79A 1NTRA 2VL7A 5C3UA 1E2KA 5ED0A 1K7XB 4U7PB 3BF7A 3U7IA 1IB6A 1QHGA 1C0PA 2MMCA 5INTA 1R0ZA 1EP1B 1IIBA 4HEA1 4AMZA 1DTWA 4UNIA 4EJMA 4Q3KA 2CNKA 2GQ0A 3TTVA 4IMIB 2B0JA 2XE4A 1U4NA 2P6OA 1KFJB 2Z2IA 4INZA 2YFQA 4N4AA 1EU1A 4NF2A 4LDJA 2MYPA 1J5EB 3D6FA 1CR1A 1RPJA 2FP4A 4BZQA 1ZR4A 1TKAA 2JLAA 2DECA 4GP9A 4I1UA 1DU4A 1EB9A 5FIUA 3GYBA 2X40A 2ZJOA 4PHCA 2YN4A 1B6GA 1UODA 3DMYA 3RDPA 1MJGM 1FLDA 2E18A 4LXHA 4EG6A 5IZCA 1Q77A 1ARZA 2B36A 1KYIA 3PRHA 4Q1DA 3Q40A 3LW8A 1XZDA 3KYJB 4Q16A 3AIMA 1P5HA 1QFYA 3RYHA 3PHGA 5JI3E 2VQEB 4YRNA 1Q0LA 3P9XA 1GLVA 5C8DA 2ZBUA 1TQHA 3LYAA 3PLRA 4KYTA 1CS0A 3IALA 2V1UA 4IGEA 2QJRA 1P2BA 5IM5A 2EX4A 2WNIA 4MWZA 1TCBA 2JIQA 3ZJVA 5G4KB 1ZI6A 2WAXA 3TQSA 2YWFA 3WWPA 1MO5A 1QO0A 5F51A 5AW9A 2ZRNA 2BEJA 3FUWA 2NQ8A 3G13A 4P82A 3U7EB 3CVJA 3LGSA 3KOOA 2Z2YA 3P19A 4L5AA 5FP0A 5KTRA 4IEIA 5EWJB 3ZNOA 3MLEA 3U3MA 1DJMA 2X8BA 3QJ5A 3OX3A 1RQPA 2OR3A 2I22A 5DM0A 2QQ5A 2VCYA 2VK4A 2A4KA 4CTKA 1HI9A 1M0TA 1I4OA 3E9ZA 2J0UB 3LQ2A 1A69A 1ZCBA 4CIAA 3THWA 3B1JA 4I55B 1V16B 1UPUA 2I4OA 2QDXA 3H84A 3AW9A 3KTDA 3OQJA 2QLFA 2V74B 4LC1A 5AJHA 1KSJA 2AE2A 2VNHA 5TF0A 4CDGA 2ZEJA 4KLZA 3ZK8A 4Q24A 5AVQA 4XFJA 3OA0A 1B41A 1QH1B 1D07A 4PFJA 2NUPA 1CFZA 4FGWA 4G5GA 4MV8A 5DBFA 2DY1A 1W49A 3OFJA 1H4QA 2P40A 2H4YA 2ZUFA 4XD7D 1FBNA 4QODA 4FR0A 5KYKA 4A8TA 3L7YA 1WMDA 4RPCA 4BHTA 4OLJA 5JXIA 4KMRA 4B44A 4OLFA 1FPQA 4G4IA 2ZVDA 1KK1A 1VGRA 4ZGGA 1QIFA 2Q0HA 3BEOA 1GG2A 1MEOA 2QRZA 5HQ3B 3RU3A 1LJLA 3ND6A 3WYBA 5KOYA 1ZUIA 1MNQA 3TRJA 5DHTA 1MABB 2VJAA 3RBAA 1X7GA 4B3CA 1NLFA 2VSFA 4LZOA 3ZWDA 4IJUA 4RKYA 3F6SA 1PJSA 4ZVPA 3PWKA 4GOMD 3C41J 3IA2A 3H9QA 1RJGA 3R2JA 5E2BA 2XSZA 3S5UA 1Q91A 1E64A 3OE7D 5A4DA 1BA3A 3CX8A 4FYMA 1XTIA 4MQFB 1XOIA 3IESA 2IHZA 4MWTA 2ZOSA 3W78A 5IAOA 4E3WA 1JEYB 3CXUA 4MZXA 1STOA 3CRNA 1U9IC 4MOWA 2GUWA 1OCEA 1P4GA 1JDPA 2BFPA 1V1JA 3MQ4A 1T0IA 3NORA 3BN3A 4KVAA 3T1VA 3UOGA 4AURA 2V6FA 4CL0A 4ESVA 1YGYA 2PANA 3QWAA 2FWBA 2YFKA 4BNXA 4TZTA 3EVNA 3DG9A 4QIHA 4Y67A 2HFKA 4ENUA 1YBMA 4QXPA 1SRRA 4MS3A 5D3MA 5J5AA 2H92A 2KQUA 4NENB 4TTRA 1VCHA 1V4VA 4P92A 3K2IA 1X87A 1L5OA 4ND8A 4P2BA 4BJHB 4DWVA 1HNXB 1D5WA 1MFZA 1XTBA 5HBRA 3AV0B 1PFGA 4NZOA 1L3CA 4YMWA 1HMPA 4OP3A 4Z3DA 2QTGA 3EEIA 3OWOA 1R15A 5HG0A 3IPLA 2D0DA 3ETCA 3X1WA 4DXDA 1MTZA 3JD3A 1VZ3A 3A3NA 4I1VA 4XWWA 4PVDA 2FXIA 1Z37A 1D5CA 3KJGA 3NWOA 3DHVA 3DZKA 3TEMA 3WLNA 1DKUA 2F6RA 4K6FA 2O57A 1LTKA 4MAAA 1O58A 4DJDC 1D4AA 1CWUA 5LVAA 2W2KB 3IP7A 4V0KA 1P5ZB 1G0NA 2Y1EA 3WLPA 3FKQA 4ZI7B 1RWOA 5AD1A 2BJHA 1AUVA 4GSLA 3I34X 2A57A 4BMPB 4C2BA 5EGNA 1MT3A 2WILA 4W7SA 1Z47A 1OLXA 4GYKA 3QXHA 4A73A 1EP9A 3EZ2A 1WBBA 4L57A 1H3FA 3DOHA 4FD2A 3LGXA 3E61A 3PDUA 3OPYA 4UVEA 1F2TB 5I7VA 2PL9A 1P74A 1A1SA 2GASA 3MBIA 1P9WA 2PQ0A 4WL0A 4JBIA 2PKXA 2Q5LA 1TK3A 1CQJA 5AW1A 3BHMA 2C5GA 2PGXA 4C4PA 3MF4A 3G6WA 4HX2A 4S05A 4KI0A 4W9MC 4LJ8A 4AKTA 4IH1A 1BKDR 3GZNA 1HM5A 1V5IA 1LNQA 1NVXQ 2PL5A 1JT9A 1EK5A 1EAYA 2I76A 3VZCA 3ZI4A 4EMUA 3EZGA 1YS7A 2RD2A 2WSMA 5DMHA 5FLXA 1R9MA 2C58A 1PG2A 4RD3A 1TD1A 1A9YA 3LM8A 3A7EA 4BJ6A 1KIMA 3GA5A 3Q9SA 3DOOA 5FNVB 3AU8A 1KORA 1UOEA 1DB3A 3MUEA 2I8CA 3BQNB 2XVXA 3OHSX 4FEGA 4IJ6A 3VDMA 2UUCB 4LXIA 2ZJFA 3MTGA 2JIMA 1COWD 4DCMA 1CUVA 3DBIA 4H2DA 2EFYA 4KMSA 4FGKA 5KX5B 2ZTUA 1DEKA 1GFSA 4A9AA 4BFVA 3WJ1A 4DSOA 1ZC4A 4TWIA 1PI3A 2E49A 5BQOA 3TL2A 3UJCA 3EWIA 5KI6A 1UJMA 4L8LA 2J4CA 2OE2A 3ME5A 4URWR 1G41A 1Q1EA 2M9MA 4MPPA 1AMUA 3W9YA 2BM9A 3KOZA 1L5QA 1NMYA 2G1JA 4JENA 2H0RA 2HLDA 3SS9X 4CKWB 1KOLA 4KQCA 2Y1XA 3NYRA 4CG2A 1QGZA 4AJNA 4HF7A 4MUNA 4XKJA 5HQJA 1MH1A 1WLYA 3BGSA 4QXAA 4TYPA 3V4FA 5K8JB 3AVXA 3FFWA 5ILGA 2VZLA 4LRTB 1S5PA 5HYVA 5IS2A 4JGIA 5H4HA 1IXYA 3A06A 2WJVA 5LQNA 2G09A 2V5AA 3LQYA 2I71A 5CMLA 2OSVA 2Q5IA 2QJFA 3LS2A 2H9IA 1GFZA 1Z28A 4NARA 4D7AA 4AP6A 2PYZA 3BDAA 1IXZA 2O2ZA 3IAAA 3UKDA 2HB6A 2PSHA 3WYAA 1Z0KA 5IYZB 2YMQA 3N2KA 3UB3A 2GYWA 5F1YA 2Q9CA 3PPIA 2VYVD 4HTAA 4N3GA 4CN9A 1Z0JA 1RACA 2XGSA 3GCGA 3PNVA 3ZNPA 3C5HA 3CRZA 3KHUA 1GL3A 5I9SA 5KYGA 3ESRA 4G8JA 4RJ2A 2A9VA 4JH0A 1WRBA 3JVVA 4MLCA 4O4HB 4BQOA 4Q37A 4Z4QA 4FSDA 2B8JA 1B8PA 1P75A 1T9GR 3HR7A 1ZNZA 4FYIA 3FYUB 5CTAA 4UQPA 2ZRLA 5E8RA 4F06A 2OLEA 4C7OB 3GLUA 1MVNA 4GOLD 4OIFA 1DXQA 3JQ7B 1GYQA 3Q12A 1SQSA 1N2CE 4FPXA 3FM9A 3FGOA 1K63A 2RBKA 2QGZA 5J4KA 4BAGA 3JSAA 3NATA 4M9SA 2ADFA 4DDKA 1W581 1EPUA 1PW7A 5JSZA 1O8CA 1DHTA 4U7DA 4Y2HA 3RT9A 5JRDS 2PUDA 2WP0A 3AERA 4FB5A 1L4NA 2FP3A 5JBQA 1FU8A 4OAOA 4Q9KA 1S2NA 1T2FA 2WM2A 1E99A 3M1YA 3OLQA 5MFZA 4LPSA 1Q1QA 1JMVA 1U2TA 4XIYA 4K9MA 2B92A 4B6SA 1MJFA 4K9KA 4Z0TA 2X0EA 2J30A 3NV9A 2VPPA 5KU1A 1DV2A 4OHWA 4Q4LA 4QWWA 4XQ0A 5F2KA 2BEVB 3UT5A 2OZLA 5BN3A 2JIZD 2JB9A 1KETA 5DN9A 2QRNA 1N5DA 3IOEA 1H6CA 1IN8A 3U19A 3TIIA 1GNSA 4GNKA 2Z43A 3VR4H 2Y1GA 4AYTA 3DCNA 3IDZA 1R9NA 2ZWAA 4AJIA 2GF0A 4DLVA 2AFIA 1N33B 4DGSA 3WB1A 1J0CA 2Q2QA 4URVR 2FUG1 3GBPA 1OAOA 2OHJA 4XCQA 4MCHA 4HG2A 4WUVA 5CHYA 3RCBA 4DSTA 4TGLA 2AOUA 1MA3A 4ABYA 5A6SB 3UFXA 4B32A 1OFUA 3DL7A 5HCIA 4JB0A 2P4QA 3KUDA 1XMQB 4NEQA 4PX9A 2W6QA 4IILA 1UMBA 4HX5A 3AM3A 1OGIA 4B33A 2H4WA 3ZW8A 1Y6ZA 5I01A 3AR7A 5M2QA 3O03A 4N5MA 2EJTA 3HKCA 2GBFA 3OVMA 1P1HA 3S2EA 4TYWA 4R54A 1T4GA 3HVHA 4Q1FA 4C6TA 2B5VA 5CT5A 1DFIA 2P7IA 4MRVA 1WHSB 1KPHA 2P9HA 1SXPA 1I24A 1ZJZA 2BEUA 4FYVA 4O2LA 3TDKA 1W30A 3ZOZA 4AP9A 3HB0A 4KWCA 4MW7A 1SY7A 1OT3A 1Q1BA 1IY1A 1CFJA 3M4ZA 4X7BA 4FONA 3ZDQA 4UDNA 4YRZA 3CRMA 1DT5A 4N39A 2A5JA 1SQ5A 4MRMB 2XGJA 4PYKA 3CVXA 3Q9LA 2C8KA 4BVJA 4YAGA 3T3GA 2QBYB 3ZU3A 2LNDA 4GXTA 2HUPA 3R9XB 1GPKA 1DIRA 4R2MA 3GR6A 5LC1A 3FDIA 3ZXIA 4E94A 4EW2A 4D74A 1AKNA 4O33A 4O02B 4NYIR 2NUTB 1G7RA 3NKFA 4IIBA 3L46A 3VYUB 3IEVA 1FCJA 3BMCA 4OY3A 4EYOA 1TMKA 2HC9A 3QSYA