2POCA

The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
353
structure length
339
Chain Sequence
GPYKHFMQKEIFEQPDSAFNTMRGRIDFENCVVTLGGLKSWLSTIRRCRRIIMIACGTSYHSCLATRSIFEELTEIPVSVELASDFLDRRSPVFRDDTCVFVSQSGETADSILALQYCLERGALTVGIVNSVGSSMSRQTHCGVHINAGPEIGVASTKAYTSQYIALVMFALSLSNDSISRKGRHEEIIKGLQKIPEQIKQVLKLENKIKDLCNSSLNDQKSLLLLGRGYQFATALEGALKIKEISYMHSEGVLAGELLPIIAFATRDSLFPKVMSAIEQVTARDGRPIVICNEGDAIISVHTTLEVPETVDCLQGLLNVIPLQLISYWLAVNRGIDVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Crystal and Solution Studies of Glucosamine-6-phosphate Synthase from Candida albicans
pubmed doi rcsb
source organism Candida albicans
molecule tags Transferase
molecule keywords isomerase domain of glutamine-fructose-6-phosphate transamin
total genus 144
structure length 339
sequence length 353
chains with identical sequence B, C, D
ec nomenclature ec 2.6.1.16: Glutamine--fructose-6-phosphate transaminase (isomerizing).
pdb deposition date 2007-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01380 SIS SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2pocA01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2pocA02
4S12A 5FLXA 1HR0B 1WIWA 4LZJA 1C7RA 1IBKB 1HM5A 4JI5B 5BR8B 4DV1B 1N32B 1MOSA 2UU9B 3FXAA 1HOXA 4U6NA 4B3MB 1N34B 2DF8A 3JAMA 3OTOB 1J5XA 4DUZB 4LF4B 1C7QA 2ZM6B 1KOJA 3IFSA 1VIVA 4NXNB 4K0KB 3KNZA 2UUBB 3I0ZA 1M3SA 1JEOA 1IATA 2AMLA 1TZBA 4DR3B 4LF9B 3LJKA 4X65B 4JI1B 4JI7B 1JXAA 3J80A 4JI0B 3PR3A 4DR5B 3M5PA 4IVNA 1N33B 3FJ1A 2E5LB 4B3RB 1B0ZA 4M0DA 2O2CA 1MOQA 1U0GA 2CXUA 1FJGB 4JI8B 2DECA 3QKIA 2UXBB 4DR7B 5A2QA 1HNXB 3UJHA 1XMOB 4AQYB 5BY2A 5LL6P 1GZDA 2I22A 2O2DA 4DR6B 4NXMB 2CXPA 4GKJB 1I94B 2CXRA 2CVPA 2CXSA 1ZZGA 2XHZA 3OOJA 1TZCA 2CXNA 3J7AC 4B3TB 3J81A 4LF6B 2A3NA 3NBUA 1VI6A 1U0FA 2CXQA 4YHHB 3T1HB 4X64B 2VQEB 1MORA 3G68A 2J6HA 1JIQA 2HHHB 4JI4B 1Q50A 2WU8A 4X66B 4DV6B 4DV3B 3JX9A 3T1YB 4JI2B 2UXDB 4LFAB 4DR4B 1N8TA 2CXOA 3TBFA 4OX9B 2YVAA 2ZJ4A 5I01A 1X9IA 2PUVA 1IBMB 4LFBB 3HBAA 4X62B 4DV4B 3SHOA 3CVJA 2PUTA 4DUYB 4EM6A 4JI6B 4LF8B 4DV7B 4LF5B 5LMUB 4JI3B 2CB0A 1J5EB 2CXTA 1XNRB 4JYAB 1VI5A 1U0EA 2Q8NA 1HNZB 2UXCB 3EUAA 1T10A 4DR1B 2F4VB 5IT9A 3ETNA 4TOIA 1IBLB 3FKJA 1XMQB 2POCA 3TRJA 4DV5B 3Q88A 1NRIA 2XBLA 2VF4X 2UUAB 3HJBA 2UUCB 1N36B 1X94A 4B3SB 1IRIA 2ZJ3A 4S1WA 2I2WA 4DV0B 1G98A 3BCHA 1GZVA 1JLHA 3Q7IA 4DR2B 1XTBA 3FF1A 3C3JA 1TK9A 4KHPB 1HNWB 2PUWA 1X92A 4LFCB 4YY3B 2E5FA 1NUHA 4AMVA 2VQFB 4GKKB 1X9HA 3BJZA 1VIMA 4DV2B 2X3YA 4JV5B 1XNQB 5LMNB 2V4MA 3ODPA 2PGIA 4LF7B 5IWAB 1DQRA 2VF5X
chains in the Genus database with same CATH superfamily
4QUJA 3GN1A 4HG2A 3F1LA 4B31A 1A5SB 4KFUA 1WBBA 7MHTA 1N3BA 2BEKA 3BIFA 2E1RA 1UOEA 2MU1A 4JQOA 1G7RA 4YUAA 4X20B 3HYRA 1IHYA 5DDIP 2Q8PA 3BG5A 2NO1A 4DLTA 1N1MA 5ALKA 5GONB 1XSEA 4FSXA 4M53A 1VHJA 1A9RA 1T36A 2D0IA 2WFLB 4QTXA 4RESA 5FUWA 3COPA 1Y7IA 2XCSB 4BZWA 2BFCB 1CF2O 1MB4A 3D6HA 3DL4A 5DT2A 3FTNA 2REQB 2VWQA 4G4GA 3QVGA 3RROA 4G0PA 5CP8A 1CZHA 3IX7A 3GRUA 4OXXA 4XZ3A 4UDOA 1GGHA 5KVVA 3R6LA 1MEOA 1J56A 3KKMA 5BSTA 1PZMA 3D3WA 2J4FA 2VT6A 4A03A 3G85A 4IDNA 4YRJA 3TTXA 3SYNA 4L6IA 1M6NA 5I7HA 4AKIA 4RLSA 3V97A 3U44A 1QGUA 3A2LA 3HR8A 1RQPA 3RIMA 1N2CB 5E9JA 1MXHA 1OXBB 3JPWA 4RGVA 1I0LA 5K4GA 1EP9A 5TIIA 1X3LA 3Q6IA 4FNMA 1R5OA 1II9A 2GXSA 2VT2A 1WM1A 3MC1A 4K7JA 3RRXA 1PL6A 2HKIA 2CNLA 5LP6A 2PZGA 3OOJA 5GOTA 3TQFA 4IV5A 1GA1A 3EUFA 2PFGA 3K96A 1M6VB 5LIPA 4PBTA 3RS4A 1YUNA 5IXJA 1A8SA 3KQYA 2O8EB 4O2BA 2RC5A 1GFSA 1WJGA 4L4ZA 3KOXA 3JR7A 3P20A 2HAEA 3NC1C 3P9RA 5AW0A 2BTEA 1E7MA 4LCJA 2AH5A 5AK6A 1D1SA 1RHRA 4Z4HA 4FR5A 2R8OA 2WUVA 4YONB 1PT7A 1H1DA 3PFGA 4D5GA 3JU3A 1KMIY 1ONPA 4DADA 3P8ZA 4ERXA 3R7SA 1Z5UA 1FE8A 2PUVA 2FEMA 1FYDA 4BQOA 4GZMA 1XMQB 3VNVA 1G5IA 4IIDA 4IR7A 4DEXA 2Q3BA 4XR4A 4LF5B 3UXHA 1VC2A 4X1IA 2HQBA 5DTIA 4QFCA 3KYCA 4XB2A 4IJMA 3BMQA 1JVNA 2JJQA 3IQWA 4U7GA 3NYIA 3MWDB 1EPUA 1AKRA 4MR9A 2NXNA 1ZMOA 2ZIXB 2IHZA 1WVMA 5BQXA 5MDHA 1G38A 3NYRA 1RAAA 1Z83A 4ND8A 4R40A 3TQOA 3UAYA 4Z2YA 1L4FA 3NEPX 2PKCA 4A6XA 4MKHA 2ZU0C 4P8RA 3PDHA 4C7OA 4B6QA 3DPUA 4WGFA 3L7OA 2GBIA 4MTLA 2BFNA 3PDJA 3N75A 4TLLB 1XALA 2C2WA 2HADA 1NF2A 3F7OA 1DIRA 3IKJA 1H8EA 2IZZA 5KWIA 4NIMA 2IIPA 1W49A 2ZAMA 2ZTVA 4HGZA 5EZYB 3W5SA 4LC9A 1CJCA 5FPSA 3AETA 1UF9A 4M9QA 2V74B 4HRAA 4Q9DA 1XTKA 4Q6WA 4BY9E 1ENOA 2R2GA 3FVQA 3FWYA 5TS2A 1H65A 1T29A 1Y80A 2GETA 2VHUA 3AI2A 2FG6C 3ESXA 3ECSA 1HFJA 1BJRE 5B1EA 1UBGA 3FTFA 2YJ6A 4WFJA 3ZDFA 3C7TA 5IMBA 2Q1WA 2YDXA 3B7GA 3MRXA 4I99A 4O8CA 1DKUA 1YQGA 3NR2A 4MKIA 1GFZA 3UAVA 3WDMA 4TKLA 4U0JA 4XVHA 3W2HA 1EBFA 3UJDA 2JD1A 4POAA 4DRXB 4MZDA 3TECE 3DM9B 4U5QA 4D43A 2I1WA 1H8HA 3AFMA 5DHUA 5BSUA 4FZVA 2X9VA 3USES 3UVEA 3NHAA 3ODGA 3VX4A 1F7VA 4QIHA 1IUOA 5CHYA 3SVZA 3UUWA 3OTOB 2BEJA 2O3JA 3QXGA 1UR5A 2F3SA 3P52A 5EFOA 1NOJA 5JAMA 4CEIB 1TYZA 3A1DA 3T9CA 4KMOA 3IUSA 4I0WB 2O3RA 4YPVA 4PN7A 1HRDA 1AA6A 4DR3B 1FTYA 4HN9A 3U7QB 3PEWA 3UK6A 2Z6VA 5ISMA 2IYYA 2EHJA 2GVZC 2YXEA 3E2PA 5T4FA 4A8TA 1G41A 3NT4A 5KBYA 2ZRMA 4D25A 4WDRA 2CJXA 4HB0A 1NNUA 5B3JA 1AKTA 1C30B 1NQOA 5FWYB 4D9GA 5TQ2A 4G24A 5BQ5A 1ECLA 4M88A 3GZNB 1VJGA 5CM8B 2JI8A 3NJ8A 5IW8A 4Z1MA 3X1YA 4HAVA 1FFCA 3ICOA 4GYYA 4LMPA 4OKIA 3T3HA 4AKEA 2RH5A 3OIVA 1N1GA 1D6MA 3ZW8A 1X7DA 4NXMB 5AK3A 1NVGA 4L95C 1VMAA 1JJBA 5JSFA 2PS3A 4UPEA 2A3NA 3HA5A 5GZ6A 1PEDA 1ORHA 2JJ2D 2O05A 3IV7A 3NTXA 3IULA 2OV3A 2WIFA 1KSHA 3OE7D 2JJ1D 3VI4B 2AQ8A 2I6GA 4BVAA 5JSUA 4D9NA 5ETJA 5FL7D 2C31A 3FNEA 4YUXA 3OF3A 3H05A 1CNEA 1HYHA 1XJ0A 1EHCA 3KSZO 3DMHA 4V03A 5E2IA 1UIRA 3GXBA 4EPVA 3M1AA 4KE7A 2CXOA 4KQMA 5KWSA 1EVKA 1DEXA 2ECFA 1ZU5A 1RZ3A 3LOUA 3PUYA 4DTIA 1RS0A 3ESAA 4O29A 2OXCA 5F2KA 5ABPA 4W5HA 4XSHA 5K0CA 5K0BA 3BPSA 3KZOA 1SOWA 4N40A 3V2GA 2IEZA 4LF8B 5HE8A 5IZCA 2G1PA 3FUUA 5FLKA 4B3BA 3PC2A 4UUNA 4YRNA 1J24A 1JRLA 2ZETA 3CEJA 3OCVA 2XB4A 4A2PA 3KFVA 1KA9H 1OC4A 5E4TA 4Z4FA 1H6CA 1B16A 2F3UA 1E1MA 2CLIB 2LE0A 5EUCA 2ZDQA 3V3TA 1JDNA 1DCFA 1RD4A 2YQ4A 4ZGBA 2BP7B 5AJUA 5FI1B 1N7GA 3F6RA 4QVGA 3PTLA 2Y05A 1PR4A 3BMNB 3C87A 4HBZA 1B0PA 4Q12A 5CFLA 3FOZA 2NUTA 1EAYA 1GV1A 1V7PC 2OLKA 3VQTA 4GECA 4F45A 2QTGA 3HYLA 2AE2A 3LC1O 1KMMA 4P58A 2ZW9A 3HQ4O 1KDYA 2Z83A 5KNLA 1Z38A 3OU7A 4S1VA 1RVDA 4TYYA 3EFHA 4BNIA 4IDBA 5LMNB 4OHBA 2C4KA 1BFDA 1NHWA 2CNNA 2I7CA 1RP1A 2XUOA 3OMXA 4ZCLA 1DIGA 1M1UA 4PXSA 2JGDA 1UJBA 1JHRA 2YYAA 3BXPA 3F7NA 3PFKA 2NZXA 4Q3CA 2J85A 3TDNA 5TNXA 4HGQA 1LY1A 2DUUA 2YHAA 3E4DA 3FF4A 3SYRA 3TTYA 4EJSC 2IWRA 3ZS9A 1DWUA 3DCJA 4L2IA 4B6FA 4EY3A 3WYNA 4B7AA 3ENQA 4DLUA 4KVZA 4H7HA 4ZDIA 2E87A 1P4SA 4BU1A 3BD8A 5HFJA 1CY1A 3TFOA 3Q0IA 3L8GA 4IJVA 4R1LA 1JQEA 2QQ0A 1NXOA 5D5HA 5DK6A 4W5QA 4UBOA 1C8VB 4GM4A 3OM9A 4R2IA 4Y18A 2QYTA 1BFUA 1RQGA 1GAEO 1N9KA 1V11B 4Q7KA 5BNFA 3VC1A 3W9SA 1E4OA 3A25A 3AEKB 3QUAA 3R24A 4QBHA 4AJIA 2BFBA 3SP1A 3MTQA 5AFSA 1YRQA 3AP1A 4IXMA 2LXNA 3U19A 3U3MA 2YZ2A 3U7JA 1S89A 3Q85A 5B2ZA 4YQEA 3RUFA 3UH1A 3KU1A 5KHOC 5MFZA 1C1DA 5K6TA 4RWEA 1JJFA 4PIVA 2N75A 4UDXX 2ZRNA 1EX1A 1AUVA 4TSKA 4PFJA 3RVNA 1SUPA 4FN4A 3VRHA 3F6PA 3TZBA 2YZGA 3JATB 3RFVA 4G4IA 1DAPA 2D8MA 3UGJA 1G20E 1BAPA 4IGEA 3R41A 5KHLB 1TQ6A 3LYHA 1NZFA 4MVWA 1W46A 1L5QA 2GA9A 1BMTA 3OP1A 4JELA 4XDHA 3X1DA 4EDHA 2WIKA 4NU6A 5JQGB 3TVTA 1CK4A 2YZ7A 4IQ0A 1MR3F 2OAQ1 2XI4A 4IWNA 3PQ6A 4XTRA 4ANFA 4C1BA 3K0KA 3O8OA 4DXAA 1GGEA 2GZ3A 2QYOA 1NJ5A 3FSGA 4I50B 3QEKA 1U81A 3W5JA 3L8YA 1UBJS 1I5OA 2PXAA 2FFHA 4BCBA 5H3HA 1B00A 1XZQA 5A6VA 2Q5QA 2QXUA 3FKQA 1RM5A 3WKBA 5CEJA 5KYGA 1X9IA 3NV9A 3TOVA 2PANA 5K3DA 4CWAA 2P5SA 3OLXA 4KUHA 1U2RA 1W29A 3LKBA 5F1KA 5A1JA 2LIVA 2NAPA 2NVWA 3LPDA 3NHUA 4RVFA 1PQ4A 2C2ZA 1H6DA 3A9TA 3OEED 2OC4A 4PZ0A 4GXTA 2H4XA 3QGMA 2OBXA 1T8WA 3WZ2A 1RXVA 2QLNA 2X5XA 4ZZIA 1J1UA 1UK8A 3EIXA 3FG9A 5AW8A 1TPYA 4H7DA 1B73A 3EF1A 1BN6A 1NRJB 1T2UA 3A9CA 4W6ZA 5E6SA 2J6CA 5A05A 2B0CA 3F47A 3ZLVA 4DCJA 1OLSA 2QZJA 2ZJ6A 5HF6A 3LUJA 1RADA 5ESDA 5AK5A 1BS9A 4CN9A 1OT3A 1SZPA 3K1AA 3L2OB 5CT5A 4CE6A 5A9SA 3EWAA 2WPNA 2AC4A 3ZNOA 4QBGB 3K05A 1L6IA 2E49A 2HH9A 4DUPA 1WXEA 3N8KA 3NH6A 3RVOA 1SPXA 3LUDA 2CN1A 3C3JA 1T9HA 4MMXB 4S1NA 4RD2A 4ZTBA 4PAOA 4ARAA 2XXAB 1CBUA 4HWTA 4G09A 1KVRA 5ELXA 3WRXA 3FA2A 1Y6QA 4BJ6A 1NDUA 3PXEA 1V5GA 2JGKA 4EELA 5TLSA 5CBPB 1JEYB 3CB2A 4HFRA 1T1IA 4PO1A 3SR0A 5DHPA 3DQZA 5DRYA 1RRFA 4ZOEA 3KK0A 1EXMA 4E94A 4ZK6A 1EBBA 1U5BA 1RYNA 1EU1A 1ZRSA 4O4HB 4XIFA 5K20A 2F43A 3IRVA 3SHTA 5TGZA 1IM2A 1JMVA 4QUGA 4EKIA 5KS2A 2FK7A 3HS3A 3EGVA 1NWCA 3SSAA 1U11A 4XJSA 5CDFE 2PKWA 1M10A 5G53C 5HFNA 1G0NA 1LWOA 1JIIA 1NONA 2H06A 4JL5A 3S44A 3TR0A 1MJGA 3ABSB 3D8SA 1EP1B 4B4OA 5FPKA 5KQSA 1AXGA 4Y2PA 2GPWA 3A9VA 4Y9TA 2CHUA 1ISJA 4Y2YA 5JXIA 4H15A 1UIMA 2BFFB 3PQ4A 1V8BA 2AFIB 3K1JA 2EKDA 2FMKA 3G6KA 2O54A 1WLSA 3LK7A 3U7IA 4J16C 3KT8A 4CT5A 3TRHA 1E79A 1HDZA 3DFKA 5LDGA 3HDYA 4QO8A 1N78A 1KWKA 3BN3A 1J09A 3DUFA 1Z7BA 5T3YA 4D3SA 4MHSA 3WAKA 4LAFA 4LZZA 4RPHA 3B6JA 4TX1A 2D2IA 1PT5A 2VI5A 4A0HA 4WNAB 4PN3A 2XWQA 1VG9B 3EVNA 1GGFA 5DYGA 3VBEA 3D6VA 1BFKA 5AI4A 5LL6P 4WZAE 1NV9A 1WMBA 4QDXA 5C8YF 3D5EA 4HADA 4OYLA 4UHCA 4B6SA 1A8PA 3G9ZA 3ST7A 5I7WA 2I87A 2OV4A 4D81A 4L0MA 5JNTA 1IG0A 2PJDA 3EPHA 2VHVA 5KU7A 4MYTA 3TG2A 5BN4B 4BASA 2FZWA 1DXYA 1HWYA 1ZJ4A 2QX7A 5KMGA 4PRKA 1PJBA 3K0SA 2IU3A 3B6IA 4DCTA 5LKRA 1C7JA 5KCZA 1DEAA 1DINA 2VAXA 5JAOA 3U3DA 2W6ZA 2FRXA 3ELBA 4ZODA 4IXTA 5IBRA 4K03A 3U4QA 4CM9D 1USUA 4WKNA 1YVEI 3KQQA 4OLBA 4EIWA 5IVDA 4OHOA 2Z0MA 3RR2A 2Y1WA 2OCBA 1KEVA 3L5OA 3R5FA 4X90A 2JGMA 1JGTA 2VPQA 3F3YA 1IMOA 2IKSA 2IEAA 1HTWA 3W0LB 1ODJA 4HYYA 4B40A 4PG6A 3T4XA 2CXHA 2EP8A 3RFTA 2XUKA 2B8NA 4KEAA 5AM0A 3CGGA 2ZTHA 3V8EA 3L9WA 1M0WA 1L7BA 1RHMA 1YS7A 2GAJA 2VWGA 3HBJA 3K1AB 4JA0A 1R4AA 2H48A 4K9QA 3G6WA 4KXQA 4G89A 1YBVA 3PE3A 4TWIA 2VTBB 4ZTZB 1B2RA 1WXFA 2GKSA 4C20A 3QLVA 3K0BA 2PYIA 2D1RA 2PV0A 4MLCA 2BELA 5CLJA 2OHHA 2QVGA 3LP5A 1RKXA 3QE3A 2WWVD 1VG8A 1G98A 2R47A 1XZBA 3CBGA 1DIHA 4G01B 4NE7A 4RX1A 5IP5A 3WO1A 3S81A 3OQMA 3BE4A 1SXQA 5T8KC 2AGVA 3T54A 3WIBA 2XB9A 5EINA 4BYGA 5G4KA 1EXWA 5BSGA 1Y89A 3N87A 3FWPA 2EQBA 4PLFA 1FRQA 4ZEOA 4BNUA 2PUAA 2JHFA 3O82A 4N4AA 4HLNA 3R7WA 1DL5A 3PICA 4ZC8A 3F74A 4BGDA 5FL3A 4I9NA 2FWIA 3KG2A 4JVSB 2R6R1 4G0NA 2RGEA 2X6QA 4WZAA 5A7FA 1L5GB 1J2TA 4Y2SA 4I4LA 2EDCA 4BKOA 1AUXA 4NE2A 5K3FA 3ZK8A 2UYGA 2VRCD 2DOKA 3LGSA 4GNRA 1C7RA 1U2TA 3PXCX 5CX4A 2OYRA 2ZUVA 2CSXA 1C3OA 3IDZA 3Q3IA 2W8BB 1TJ4A 2NPFA 1JR3D 2WUDA 2H31A 5DHSA 1YZ3A 4GPIB 3ZDQA 3I6ZA 3RVMA 3U9SA 2CEKA 3JATA 1CR2A 2GZAA 2OD7A 4YLGA 4CV2A 2ZRQA 3UB3A 1YWGO 3PE4A 1MAAA 2XB8A 3VR6H 2ODNA 3F3KA 2F1HA 3KWFA 4D02A 3X1XA 4D96A 4XRGA 2UUBB 4XOIA 1LWNA 5BV7A 1J7KA 1KF0A 2CVZA 3LXRA 5FNVB 4EFMA 1L5MA 1T34A 1MQ9A 2QTRA 3KS9A 1KQOA 4HXGA 4OMFG 4U3JA 2YWFA 3N8NA 3BMOB 4PW0A 1L7QA 2BGLA 2QRUA 1U3VA 2DPLA 3F46A 4EO9A 3HXQA 2WWGA 1QHIA 3AR4A 1Y8ZA 1V11A 4WLEA 1MRZA 1SPBS 3EOAI 3QPBA 4EW6A 2G28A 5JMWA 4ARCA 3I52A 5E95A 1KY4A 2MTBA 3G2PA 3HP1A 1TNDA 2F3TA 3LHSA 4RSMA 3F2VA 1I94B 3K9CA 1RFGE 3CBQA 3KKPA 1FFXA 2HJRA 4ZCRA 3CLHA 4Y6QA 5G3YA 4M6WB 3QKRA 4BVKA 4OP2A 3U3KA 3GUHA 3PK0A 4GM0A 4QOGA 1SULA 5FUQA 4GT1A 1AZLA 2JRLA 5F1OA 4FIZA 4YT5A 1GQOA 2J6HA 2YQZA 3WK9A 4XUCA 2YZKA 3IBCA 3DDCA 3FHCB 4JAVC 5FBKA 4M6WA 4EF6A 1C3EA 3KQLA 2AX4A 5E7IA 3QFSA 1BH2A 4OA8A 5AK0A 1ZMRA 3SJZA 4KVAA 4B1FA 2P7IA 3GHHA 4AKSA 2H4ZA 2YFKA 3M6FA 1MBZA 1U3TA 2XQFA 4CDGA 1XTQA 1PK8A 2H4FA 1HC7A 4JODA 2VUSA 1PD1A 1OZHA 2G9QA 3LVBA 4P7FA 1LLUA 5U4XA 5LOVA 4XCQA 3NAZA 2QZPA 1FW6A 3TLXA 3R4CA 1IPFA 2O50A 3ONWA 3A1FA 3I5MA 1XGKA 4FB4A 1QJCA 3GPIA 4P5DA 2ZUCA 5U1PA 3PR2B 4FE7A 5CYFA 1XAHA 2J67A 3C1AA 1Z2AA 1VPDA 3ASVA 2VQSA 4I1OA 3GEHA 4A4DA 4X44A 5E9QA 1ODLA 2HA4A 5JS2A 3TYXA 4CLRB 1OXSC 3MTAA 3WGUA 1X1BA 5C7OO 4QA9A 4EI7A 3FRHA 5HE9A 2BMWA 3A9SA 2ADFA 1KH3A 2A94A 2R7AA 2EL9A 4PTLA 2ZJ2A 4XFJA 1GG2A 2PJUA 3TH5A 5KNBA 1T9AA 2V59A 2KHZA 2CLCX 2IELA 1RAEA 1C7IA 2PRYA 3L7IA 5CB8A 1IHOA 1BA2A 4PGHA 4QDZA 3GP8A 2FB9A 3UHJA 2CB9A 2GAFA 2X4IA 3SSOA 4DFDA 2RDMA 4YFYA 2FRDA 1M76A 1DJNA 2GD6A 5ER6A 3ER8A 3BM5A 3HCAA 1E66A 1KP2A 4U9UA 5IS2A 4YAEA 2RB4A 2A2ZA 3Q6NA 4UAVA 5I48A 2BT4A 4XJVA 3GV0A 4RSHA 2PNFA 5HIKA 1NVVQ 2VWHA 1CCWA 3UB2A 1ZN7A 2GSWA 3DA8A 4YRAA 4PZYA 3IH5A 4FYXA 2CFRA 2G09A 1ZRHA 1OXXK 1LPOA 4IIBA 5IKMA 3QXJA 1R6TA 1PV4A 4BRSA 2O7QA 4EJFA 4F85A 1JECA 1BX3A 2JLCA 2DCMA 2W2LD 2CCJA 5F5XA 3ZHTA 4KOEC 3WMEA 4MUJA 4KDFA 4MWEA 2G0AA 4FGWA 1FDUA 2WM2A 3EFOA 2VDNB 1WA5A 2AN3A 2RGNC 2VHXA 3C2QA 2IYWA 2PBZA 4JLPA 5EYPB 5FFNA 4BUZA 1GHTA 5JDCC 4LDNA 3GO4A 4TTQA 1PQWA 2IXTA 4Q7EA 5TY0A 4X65B 5H70A 3CSSA 3PR3A 4O4JA 1FFGA 4S2UA 2BAGA 4EL5A 3SY8A 2XZDA 1XEWY 3FYCA 3R7AA 4J8PA 2C4WA 2ZRBA 3C14C 4P4UA 3KE9A 5HZGA 1RI1A 1DMRA 3LT0A 3BEOA 3AKDA 4BVHA 4DN6A 2BEWA 1B0AA 4B6OA 3KKLA 3O5AA 4PGAA 3ZWWA 4GEGA 1YDFA 2BGIA 3VOAA 4N5HX 2O7SA 4LRXA 4MUGA 1MQAA 2Y1EA 2YW2A 4AG6A 4J0CA 3EGCA 1H22A 4EKEA 1GKYA 4JX9A 3AC0A 4EQZA 1YQEA 1NKTA 1MJHA 2IZ5A 3W6UA 3TUIC 4C0HA 4DWOA 5EFZA 2J0SA 1TD1A 4KO2S 3R5HA 3T12A 4AF6A 1SKBA 1BNCA 4Z1OA 5KMGB 4I1UA 4PLYA 1KGDA 3EMVA 1A5ZA 3QF4A 2CJWB 4M1YA 2H92A 1XU9A 3IIJA 3MUEA 2D2XA 1FY2A 4CV1A 4LFAB 1F2VA 3PCTA 1MXFA 4LY3A 3WQSB 4E07A 2FSFA 2YVAA 3ZCTA 5J23A 1RKVA 1CJUC 3BQMB 1GAXA 5HIIA 1Y5LA 5EZYA 1E9DA 1K86A 1YRBA 3S2IA 2QNBA 3N0WA 4J2TA 4ZAZA 2EJCA 3D1VA 1J8YF 1JG6A 1K1EA 3KDAA 1PWZA 1RZUA 1WSBA 1E7QA 2CXTA 3FMIA 3USCS 2HN9A 3CT4A 3CKMA 2R84A 1J97A 1I7NA 1LC3A 2CXXA 2OOKA 4NQRA 5ECGC 3VNUA 2ZT6A 2D74A 3GLFE 2Q5OA 1JHZA 1YE3A 2GZMA 2H57A 4RM2A 3HCBA 3VU3A 3JWPA 4GI7A 4FTWA 2XUQA 3WHPA 2BEVB 2A9OA 3OPVA 5AOVA 1SBIA 3DYVA 3MWDA 3VNAA 3L4BA 4DZTA 4EAAA 1DO2A 3U1BA 1GU1A 1P5RA 1RI4A 2OV2A 2YOHA 3DOIA 4G5XA 3P9PA 4X1IB 3EOBI 4C3ZA 4FWTA 5MHTA 2P4EA 4KWCA 1MW8X 4CI0B 1D2EA 4RADA 1VSTA 3MINA 4GMHA 4ZAFA 3F90A 5F64A 1P7CA 4E4YA 3O4RA 4IGIA 4A92A 2C42A 1D2AA 2XEDA 4GBMA 3DFFA 1TEVA 2B99A 2ZYHA 4BGEA 2F43B 4DMLA 3DMNA 4M9XA 4ZMRA 1CVIA 1DZIA 2HPVA 3GJ0A 2X8WA 2YY6A 3BBLA 5BYBA 2GK4A 1WUKS 4K1LA 5JO9A 1VYTA 2SKDA 4DKXA 3STXA 1C29B 1DBVO 1E69A 1PUIA 2VSQA 3KB1A 1VPLA 4I5GA 4M46A 1R6BX 2BOVA 2YMQA 3G17A 4M0EA 3ZHRA 4Y0VA 5BURA 4AIRA 3CLSC 2IQIA 2HA6A 3E1SA 3ETHA 1GA4A 4ED9A 5BOSA 3SG0A 4JI5B 1AMOA 4LPSA 4YJFA 4BB0A 5JS8A 2ZZKA 3OQ6A 3ZHZA 4HAOA 3ZD6A 5I7AA 4PTYA 1T2FA 3SZLA 1EGQA 4Q4DA 1CVRA 4AZVA 4HH4A 3LT2A 3CUYA 4N6OA 4WV3A 3DZ8A 1XDUA 1G8PA 2X5KO 2BDUA 3B3FA 1O77A 1HT2E 1TB4A 3H1BA 2Q46A 4TTRA 4IWXA 4AUKA 3FB4A 3CZ9A 3TEMA 1I13A 2IBTA 4KR2A 1Y42X 3BT7A 3IQIX 2AOVA 2YUTA 4DQXA 4A3SA 2I2BA 4II3A 1L4GA 4LK2A 3OT1B 2CNOA 3G8YA 4TMKA 3EXIB 4GL4A 4EY7A 3MERA 2OKGA 5HMLA 5AYVA 3UH0A 1R2QA 3A2NA 4P83A 5IH3A 3W8NA 2REQA 3WKEA 1O9GA 4E0BA 1OZGA 4D3DA 2EIHA 3E22A 4HS4A 3LT4A 1XRLA 2G08A 4D8XA 3L0IB 3B89A 1DQSA 3VSCA 4RTSA 3G5LA 2WSMA 4BWYA 1MDBA 2ICAA 1Z2NX 1HF3A 1XCPA 2PT6A 2VCHA 2G6BA 2Y68A 3CFYA 4LDRA 3EWIA 4IDGA 2YVKA 2XR1A 3O8QA 4YJFB 3TW6A 1C9DB 1OTYA 1ZK4A 3JWJA 3LE8A 3HWRA 2PO7A 1IFXA 1Y8CA 1UBEA 2YMMA 5H4HA 3KJXA 1DAKA 1TD9A 2IYVA 5I3ZA 4EPWA 5G2OA 3RS8A 2JLAA 3FDXA 4C7BA 1R0RE 1DTWB 3FNRA 4HJRA 1XF1A 3VH4A 3TPZA 1AF7A 3WLRA 1WF6A 5KTOA 3KSMA 3QU5A 4IFBA 3SYMA 1LW7A 3NI2A 3COWA 4R3NA 3RREA 4TN5A 3MJRA 1AHIA 1Q22A 2ESRA 2PUTA 3DE4X 3KALA 4UAGA 3UG6A 1UK6A 2ZRGA 3MT0A 2QRGA 2FCAA 2VYNA 3KYIB 3HB5X 1P74A 1O3YA 1X7XB 1Z34A 2J9RA 2QS9A 3K8OE 5DOZA 3KKOA 1Z3CA 1JPVA 2BHLA 1VI5A 4PFKA 1P7VA 2FE4A 1QQ7A 2GUWA 1ACJA 4YJ3F 1GADO 2NYAA 1EWRA 1OBCA 4FQ8A 4KK4A 4NBLA 5GV8A 4AM8A 1UMCB 1J90A 2DVMA 2Y3IA 2JEOA 2GB4A 3SOPA 1OY1A 3P19A 4DF3A 1LXCA 1OMOA 5HM8A 5I5GA 1RXWA 1UDRA 1SQSA 1VMDA 3KLNA 3QHPA 4E5VA 4FFPA 1UZUA 3T38A 1JXOA 3VR3A 1IZ0A 2HFJA 1BD3A 5J47A 3NTUA 3PHBE 2VJMB 1JG1A 4P3KA 4AN1A 4YUZA 1QWSA 1ZLXA 4JVLA 3O83A 3SC3A 4L2IB 1C5KA 3PNPA 1W2GA 4OHKA 2HIAA 5HKKD 1MZPA 1ZD9A 1SUEA 4S2EA 5DYWA 5T4HA 3A1UA 3AVQA 3I42A 3K4PA 3MN1A 4PONA 2XRMA 1JSLA 2HY7A 4DV2B 3AV3A 2GFHA 3AF1A 3QUBA 5EWLA 5A4JA 2I2DA 1NVFA 4AS1A 3PPYA 5IAJA 5K9ZA 3DMFA 3DLIA 5CXSA 1SU7A 3FHTA 3KXKA 4Z99A 3JVUA 5EMMA 4HEHA 4TLAA 5BRAA 5HYVA 1ZJZA 1S7GA 4JC8A 1MB0A 3F5MA 4MW5A 5TMPA 3HXOA 1KJIA 2A5LA 4MRNA 2FSVA 2JFPA 2Y99A 3EEBA 3KL4A 3QE0A 4DSTA 5COAA 5TQ0B 4MVJM 4OB7A 5AK4A 2AFHA 5A1TA 1BDJA 1S4MA 2IV7A 3ZGVA 2IY7A 2HU7A 1IWPB 3IDAA 2P90A 1JYSA 2BMDA 5GVSA 4BB5A 4DMHA 2GK7A 4MQUA 2C9YA 1LTQA 1Z2EA 4ATNA 4EJSB 1H5QA 1EK0A 2OE2A 4JLMA 2E4AA 4OK6A 5KKAA 3RVLA 3B51X 3EGWA 3IILA 4J1SA 3EIFA 3NB0A 3OCZA 2Q8QA 5CDGA 1DEKA 4X6LA 3QYFA 4XWGA 1P9LA 5EMHA 4ZHQB 2NO5A 2LP4Y 3FJ1A 4Q03A 4ND7A 3RSCA 1KTVA 1CTQA 2DUMA 2DGDA 2O4UX 3WY9A 1TLLA 1FW8A 1J8FA 2P0AA 1HDGO 1XD9A 4KI0A 3TIXB 3U1TA 3REQA 4XDGA 4MUBA 3DP7A 3VX3A 5LB2A 5DX8A 1SUAA 1NMXA 2FPUA 3Q4GA 3TCNA 3GPLA 2H2WA 2KB0A 2Q1SA 3E3MA 4KN8A 2QSZA 4YCMA 5KYXA 4IFIA 4W1QA 3SK0A 1S7CA 2UZ4A 1TKRA 5YASA 3BGWA 4Q9HA 2KJQA 5BWOA 1ZN2A 5CH3A 1H93A 1GCOA 3OZEA 3WTBA 2ZUDA 2FDCA 4LHZA 4ZI5A 2LIPA 1HV8A 2GPSA 1YS1X 2IK8A 2ZPUA 3OWOA 3P4XA 4GE3A 4NJEA 3STYA 2QQGA 3CE6A 3TJZA 1H9CA 1Q1AA 2ZAGA 4KWEA 5REQB 3DULA 3OY7A 4AP5A 4C6SA 5J1SB 4IQ4A 3B8HA 1V1RB 3OM8A 1IOLA 1L5ZA 3GD7A 3SDBA 4FWBA 1JHPA 3UV3A 3BWDD 4A6EA 1SN7A 4E7OA 1ZJ5A 2FPRA 3UF0A 4YCNA 4NK5A 1TUIA 2QG4A 4MHOA 1MX5A 1RU3A 2M2IA 3PGXA 4PZPA 3SXPA 3O3OB 4HWOA 4HXYA 2O52A 3BXXA 3KPWA 5CHEA 3PFCA 3NGLA 2FUCA 4C0JA 2WLSA 4DCGA 2CF5A 4PG4A 2QP9X 1JDTA 2VQ3A 1B14A 3EW9A 1TT7A 4CQMA 2Q1TA 3M2PA 4AS3A 1USWA 3TL3A 1NU8A 4RTRA 1BO6A 1FUIA 1G291 2JC3A 5HDQA 4I8XA 4YYEA 3L46A 2MSCB 3CVOA 1EG7A 2ZB4A 3DHYA 4PHFA 1ADCA 4V24A 5DXAA 5K8CA 1UZMA 5AKEA 2E18A 2JJMA 2JGLA 1A76A 4KI7A 3QNMA 2UUAB 2PU5A 4LJ4A 3VR6A 4U9IS 3S2EA 5B4UA 2R65A 1AQNA 1H2ZA 1ISFA 3RRJA 4AULA 3ZZ0A 2CLOB 2HJWA 1CFZA 4IEFB 2PH3A 4CIBA 2SCUB 4L5JA 3DTVD 1JVBA 1T3HA 4EY4A 3QOXA 1QNLA 1H3EA 3LIIA 3AF0A 3E1GA 4BN4A 3G3EA 3BA6A 4N6NA 5F5NA 4DPLA 4ETMA 5KTSA 4V38A 1OBFO 2Z8XA 3UJCA 2FPKA 3G2OA 5AW5A 1LV7A 2OB2A 1BMQA 1YACA 3UICA 4CVNA 1NFQA 4PNEA 4WN3A 1S4QA 2UZIR 4HB4A 1KYZA 5L7YA 2VF5X 1QGDA 3EMKA 4S12A 1U9IC 1KO5A 3AETB 2WKQA 3HUEA 2A84A 3N0TA 1P2VA 5BMVA 1CIPA 2VDVE 1OX5A 1YK0A 2WTAA 3B48A 2NUAA 3GLHA 4TL7A 3V4SA 3LY8A 3WLHA 1HTTA 4NEHB 3EWNA 4YDQA 1E8MA 1TM3E 3M5DA 1NLMA 1U8XX 1Q95A 2XF2A 5EJ6A 3K5HA 5K3BA 5L3ZA 1CS4C 2FUG6 4TUYF 1J6UA 3B9QA 3GFVA 4MPJA 4PR3A 5LQCA 3WRVA 4C7OB 1FDVA 4BV2A 4B3DA 3MJEA 2AMLA 2EARA 2PBFA 5K8TA 3D64A 1SC9A 2O6LA 2R1TA 2H54A 3HZHA 1USKA 2PQ2A 4MK4A 5EEGA 1VXRA 2EW2A 2FA9A 4ZIRB 1V8FA 1AS3A 1UFOA 2DYKA 1F17A 2I80A 4PLWA 3C48A 1OVMA 4L57A 2UYOA 2FWNA 4MR7B 3A05A 1JHOA 4NG4A 1HE8B 2HDWA 2QRPA 4N8EA 5DI3B 1Q83A 2Q7DA 1H4QA 1L5SA 1XXHA 1EESA 1TCCA 1M8JA 3IQEA 3GFBA 4LGYA 3RU2A 2A1TR 4BO2A 1I30A 5ITZA 2HW8A 3IP7A 2HO4A 4DTCA 5D7NA 4S0ZA 1SCBA 1E4YA 2A0KA 1YJCA 1U28C 2QUZA 3VU8A 1PHRA 3FOFC 3EPKA 1PSZA 1SQ0A 5AM5A 3BWVA 5IG2A 4UXJA 4WVFA 2XGOA 3AVTA 2WNHA 3I0MA 4F7DA 2ZCUA 1C0EA 1OIVA 5JG7A 2QP3A 3ESYA 3ADCA 5JSYA 4P5EA 4WBXC 3RWMB 3GPBA 1ZKDA 5F23A 4X66B 4F0JA 4R2LA 3V5NA 4QTYA 3SKVA 5IDQA 1E1LA 3DEYX 1HLFA 2I78A 2R00A 2ZCJA 5C0OE 4TVKA 4NYIR 4W5RA 1XZIA 1XMOB 1TYCA 2PBRA 4C7XA 3VR5D 4N49A 1IBMB 4ARBA 4HPJB 3TTSA 1KH2A 4MMZB 3R9WA 3OFVA 5G4KB 3ZPXA 4CMHA 2A9PA 4BS9A 2LV8A 2QX8A 3WZMA 4JI6B 4DLBA 2JFZA 4TSFD 4EGAA 2IS4A 2R79A 4E6EA 5EWMA 3SJBA 5KTPA 3TZ6A 4DJAA 3RS9A 4QDTA 3HB4X 1GGVA 1V71A 3JZMA 3Q72A 4UDYX 2V7EA 4BNLA 4RY2A 4EI9A 4AJ9A 3QMPA 1YIDA 4DJDC 4XYEA 3T1QA 2V4UA 3PKZA 2JBAB 3HSYA 4H3HB 4JBWA 2WVGA 2GLUA 3BCHA 3ICEA 1YB7A 4ZOCA 5BNIA 2Z4SA 3GRYA 4FCTA 2FQ1A 4G5YA 4CGZA 2ZGVA 3ILVA 2P0EA 3HFJA 3STTA 3JWIA 3K70B 3NTVA 1GNRA 2E48A 3GLQA 3WK8A 4V2IA 5M34A 3H99A 3ONDA 1NY5A 1W4ZA 1CVLA 3EYWA 1CF9A 2QPTA 4IKOA 4LX0A 3QBJA 5DU2A 3QE9Y 4KR3A 3B9RA 3HJCA 2LKCA 3HBMA 3TZCA 1PQPA 1CHDA 1S2NA 1L8OA 2JLQA 3OEWA 1T5TA 2JL1A 4PCLA 4OQLA 1F9EA 3WL8A 1XPOA 1CUVA 5SICE 5C4MA 5FFFA 4DJEC 3D3KA 2V6FA 3N8HA 1XZMA 3D3QA 3WG9A 2GASA 2HUPA 5BN4A 1E32A 1QBKC 1TC1A 2C8VA 2LD4A 2WSIA 3DM5A 2QV0A 1RC1A 4R7TA 3CZAA 1CRZA 3HKBA 4BRWA 4WCVA 3BQNB 2J0EA 2B34A 3V33A 3L9XA 5KC9A 5ARCA 2ZVQX 2XF8A 4QPNA 4AQ7A 1Y4UA 1XMSA 2C84A 2J5BA 5ESWA 3C3WA 3HE3A 4OXNA 5CVEA 5FPPA 3IFSA 3TNLA 4JQSA 3CKYA 3FPHA 5ALIA 5IN5A 4C3OB 1FTSA 3A1VA 4LNHA 2Q5HA 4OO3A 1M7GA 1P19A 2APJA 4UBLA 3FYTA 1X7ZA 3LJKA 4TMZA 3MRSA 1BGXT 3D8HA 2YC4C 4FZ5A 2PT5A 3DUFB 4BTLA 3ZCPA 3NC4A 2HWWA 4JCCA 2G7ZA 3F3MA 3AVWA 4F9GA 3VBCA 4X24A 1ELOA 5CYGA 3L8CA 3E5HA 3RDPA 5IDXA 1QRSA 2FV8A 1H0RA 1DKPA 1JSZA 1M1XB 4QQFA 5I9SA 2IPOA 5AQ1A 2OGZA 4CIXA 3G5MA 1JHQA 1NMZA 2D1FA 2HBZA 5LMZA 2G72A 3KXLA 4G5FA 3RQIA 4H4CA 2OV6A 1X2BA 3TK1A 1FS5A 1ADYA 2IIQA 1ULUA 3DL0A 4FC7A 1RJ9A 1Z4JA 2BM1A 4DPMA 5FAKA 3AKCA 3V4RA 1SVNA 4W5OA 1HT3A 1N1EA 5JJ5A 1PFVA 3LHFA 2ST1A 1A72A 5I9TA 5DTRA 4BO7A 3RSZA 4CKCB 5JUWA 1L7NA 2VJCA 1VZ3A 2H1SA 3HO8A 4DLAA 1PYOA 1QU3A 1GIAA 3N8GA 5A3QA 4TTTS 3F49S 3LP6A 3NX4A 5CBPA 5I47A 2R4TA 1DRWA 4LGMA 3EE6A 1P8AA 1R9JA 2AQKA 3RTAA 3VAYA 5GV7A 5E7JA 4HKTA 4CR8A 1PNRA 1AV6A 2HXSA 2C2KA 4Y2GA 3U39A 3BYZA 3TEJA 5AVUA 4YIKA 2FF5A 1Z0IA 5U4QA 4KYUA 1E9BA 3BIJA 3KSUA 4MVXA 2OCIA 4CEHB 1QM5A 1EAMA 3D4BA 5BQOA 4EGFA 1KE1A 2Y0BA 4AWBA 1MTOA 1FS6A 3THYB 1P1FA 1NRXA 4M38A 3D4OA 3EJWA 1IBLB 4Q9AA 2YWRA 4P2BA 2BZSA 1JHYA 1NYTA 4YJ3A 5BPHA 2FSSA 3WDLA 4HGRA 1ETHA 1XDZA 2I99A 3FCXA 4M98A 2DBVO 2UYYA 3HR7A 4G65A 3RUCA 3KP1A 1O2DA 2PGJA 2C8LA 1DJLA 2AS0A 5EAIA 1W73A 4MW9A 5DTEA 3MA0A 1LGYA 3GCZA 4IIYA 4HWPA 3RNOA 1KYTA 1I36A 1U4SA 5DGDA 2CCKA 3UEOA 4UEJA 3ZH9B 3H97A 1G7SA 3NWEA 4QGBA 4QXPA 1JU9A 3RTCA 3FNIA 3EDQA 4AG5A 4GR5A 2A7QA 1CUIA 3FR8A 1Z4IA 3OKPA 5JRJA 4OBBA 3B36A 1XZPA 3L0ZA 2R60A 4O63O 3M6LA 3R9XB 1PP4A 3ZU4A 1OLUA 1HDEA 4WGGA 3RUDA 1P2FA 2FXVA 2GRUA 4B47A 2AF4C 2YVQA 4GP9A 4TWBA 2AC2A 3KR2A 1JHDA 4HRXA 1ZJJA 3ANLA 4U2GA 5FR2A 5B7GA 3SQOA 3FOWA 4K6FA 4HYEA 4MRMA 4CLDA 1ULZA 2EWVA 3W2TA 3T7JA 4OMCA 5DSTA 5EWJB 2N42A 8MHTA 2HNKA 3TD9A 1E6MA 2IBMA 3GDFA 3P5BA 4MRAA 1VP9A 3MWKA 4R1MA 4D4MA 1KMCA 4MLDA 4HZIA 1JLSA 5I8PA 1KYXA 3MTGA 3W06A 3D54D 2VDUE 5LA6F 1CC1S 3BWCA 1AQUA 3TQHA 3TBKA 4ZCSA 3ROEA 1JW9B 1TADA 2PX0A 1TOAA 3DDOA 4FP9A 5TX7A 1J0XO 1WMSA 3G13A 3GW8A 5CA1A 3VV2A 1SCIA 4IVNA 3V7FA 4ZCMA 3GXOA 2C5HA 3TLMA 4MVYA 1EK1A 2YHUA 2FQXA 2IW1A 2Q62A 5EQTA 4BX8A 4F97A 1JFTA 4B3RB 1BRMA 3DOUA 1JIXA 4KNWA 1D09A 5TF0A 2Q4OA 1ZMXA 3L41A 3L92A 2BBSA 1Q0LA 3MM4A 1OBOA 4PC7A 4RFLA 4NABA 3ZHBA 4YRIA 4QHYA 4QODA 1U2ZA 2IU4A 2VNJA 1WE2A 4OGWA 4QRHA 4Q5IA 4WX2B 3LQ2A 1RLTA 3PT5A 2QL7A 3ILYA 1NQWA 2OUKA 1UEIA 3DPIA 4JQCA 4C14A 3BTOA 3SQXA 1P91A 1SKQA 2XUAA 1V16B 5KZMB 4RTLA 1JF8A 4IQ8A 2PZ8A 2UZ1A 4PZCA 4KPEC 4OUKX 3CLTC 1UKEA 1A5BB 2C3YA 1NUPA 2QD1A 1KR5A 3IAS1 2IXAA 1K2VN 1QLHA 5BV2P 1R50A 3TS1A 3M49A 3GHYA 4MNTA 3ETDA 4P6VF 4TLDA 1P1CA 2GN2A 4RKRA 1QRRA 4TV8F 2OLJA 2OHOA 1P29A 1XG5A 3QEAZ 4H0CA 1NR1A 5K5EA 1G59A 1UP7A 2UKDA 2JJ8A 1B1CA 1PCXA 4JD5A 1W36D 2R1UA 2Z5VA 3DE6X 4WKGA 5SYNA 3GRRA 1C0KA 3JAWB 2V1UA 1J0BA 5KREA 3G2LA 1L3BA 3KDSE 1JIKA 3W5BA 3B82A 4L3VA 3M9LA 4RTJA 1GCUA 1KY2A 4WBNF 4YV7A 3IKTA 3V8NA 1ADFA 2MR6A 4LBYA 5IJWA 5M29A 1MPTA 3IUQA 3BD6A 2AMJA 2PQ0A 4JEHA 4B6RA 4O33A 2YWXA 5EHGA 3WV5A 4MIEA 1QZUA 2VP3A 2VTEA 2POCA 2ZKLA 5C8DA 2GPAA 1WCYA 2GPNA 4FU0A 1PWYE 1V1MA 1IXRC 4I4TF 1JNYA 4JWKA 4WXYB 5GY7A 3PPWA 2EW8A 2W2VA 4D4LA 2ZJ5A 4EBFA 1UXJA 2Q21A 3PC6A 1K5PA 3RABA 3C8DA 1X1QA 4PYOA 3AF3A 4YCCA 3K0FB 1ZVVA 2ONZA 3KFXA 4LE2A 2ODWA 1EGAA 1N2IA 2IUYA 3WGIA 2QDXA 2W83A 3DW3X 5EHQA 3UATA 4R69A 1H0HA 2QENA 3VOBA 3KUCA 4GPTA 5IAGA 3VSAA 3UJNA 1N2HA 2NSHA 3SNKA 1BXRA 3L82B 3GWGA 4ML3A 3RAFC 5DISB 2BHSA 2YXPX 4QELA 4MPDA 2GN0A 4RACA 3CRVA 3V1MA 3R7WB 5HQ3A 3EPJA 1MUUA 3UMCA 4PM4A 3ZVMA 1U0TA 4RSGA 4X6UA 3M3HA 3O4GA 2P6OA 4EMTA 1RLJA 2JIQA 4HRYA 3PXUA 1OWLA 2XMGA 4PSCA 2JGNA 4E2FA 4EDFA 2XYGA 3N2LA 2XLBA 4GC9A 2BGGA 2B21A 5A0VA 4GOOD 1Y3HA 5AXDA 3GOQA 3W8EA 3BRCA 1GNPA 3O3MB 3EASA 2CHFA 1HE4A 3GZNA 5IPFA 5DZSA 3QXHA 4H6WA 3BHNA 1EVQA 4F2PA 1DIAA 3RO7A 3F78A 1GAJA 1SKUA 2J0VA 2VPXA 2HJHA 4M2LA 4MIKA 2ZJOA 1D2RA 3B7PA 3D7KA 3IQDB 4AROA 4OQ4A 2ONJA 1C81A 4N1AA 2FG7C 3NPAA 3CWQA 3OEYA 4ND3A 4LXHA 3V6MA 4M1ZA 3B3AA 1QB8A 4ESHA 2IUFA 4ETWA 2D2VA 1G18A 3EGDA 4CR7A 1K6MA 3EMBA 3HYTA 2ZLBA 2AN5A 1FLNA 1TC2A 2JANA 4G23A 3ZHVA 2O2XA 2ZIGA 2OKCA 5EGSA 4DBVO 3ZV4A 1Z22A 3OETA 2P9TA 1U1IA 1BWPA 1MZVA 1UPBA 1GTL1 2I2FA 3LBYA 3ZHUA 3PX7A 1KO4A 2HEIA 4XIYA 3BFXA 1UJ6A 3AYXB 1TJYA 1VRWA 3T3IA 2JHPA 3ESDA 3SJ7A 4DRXA 1O95D 1NQXA 3GAFA 4EA9A 1PQUA 2BGKA 3WR5A 1DUVG 1T9GS 1WULS 3WGHA 2VQEB 3C74A 4KDRA 1JTFA 1NDHA 2WHQA 3BH7A 1U7XA 4CKWA 2FKNA 1LV8A 1SD2A 1AUOA 1XZGA 2OGUA 3FSJX 3R3HA 1LF5A 4DLVA 1U3GA 1BXGA 1E59A 2QD4A 1CEYA 2CLKB 1TKAA 1HKHA 1UL1X 4MTCA 2XQKA 4TL6A 2DPXA 2L2QA 1JFFB 3CNEA 3QU2A 3NANA 2ZJ4A 3C15C 4G41A 1E98A 4D4GA 1KEZA 1UBNA 1NM5A 3WNQA 3TLBA 4ZYXA 1O0BA 5IHPA 5EUMA 1M1YA 3LQFA 2ZBGA 4ACAA 1QHNA 2PR7A 3HZZA 3R3JA 4BTVA 5JEEA 3N2YA 4H6XA 1LQUA 1LDGA 4KSBA 2IP1A 4NI5A 1SG0A 3T5MA 1V1MB 3NTOA 4DXHA 1EE2A 1VB5A 2J9ZB 1UBOS 1FA9A 1WD5A 3JQ7A 4LHWA 4Q1VA 2KE5A 4PO3X 5IC4A 1CEXA 4AJHA 3TLKA 2LPMA 1V6AA 1Z26A 3IESA 2RK3A 3UG7A 3W77A 4IFEA 1KI7A 1EM8A 4LVCA 1Q74A 1Q7EA 4P5PA 5D3MA 3UGQA 1SBNE 2PD4A 2B6NA 4HUJA 5K51A 3CEPB 5JZMA 3KSDO 4BATA 5AVJA 1U4OA 1LVUA 4KQ1A 2RHTA 4YRRA 2XUFA 1H94A 2DWPA 4B2IA 2GEFA 2P9EA 4ALJA 3NH9A 2ZS9A 1IQPA 3CRRA 2IRWA 3DAPA 4YP5A 2FI1A 4RVDA 5FNVF 1EXNA 1FS4A 5CEEA 2CUKA 3EXAA 3ERCA 3TUJC 5HM6A 5DFAA 5J3JA 1VJ1A 3HV0A 4PVDA 1M5TA 3HU3A 3LRPA 1KK0A 5IAOA 4N0EA 4I1VA 2O2GA 3V2HA 4D9HA 2IYTA 3OD1A 1TYAE 1HR0B 4A8HA 3AEUA 3LFHA 4MVCA 4WK0B 4MW7A 1G60A 2OAP1 3I9FA 2Y93A 3BZUA 3AZPA 2ECPA 2QG9A 1H2HA 4GSLA 4I9HA 4WBNA 2R7NA 2OZLA 2RJ3A 1U0NA 5LP6B 1L4HA 3UMSA 3DT8A 1J21A 1GKLA 1GN8A 3AHCA 1XEWX 1KJ8A 3IDOA 3PX3A 2ZRDA 3AR2A 5GP1A 5LMCA 1HYBA 2VPWA 3O8LA 2X15A 1QP8A 1TZBA 2G0TA 2FZKA 3OZRA 5DW3A 5E6SB 1H5UA 2C2BA 1L5FA 4PC2A 2RC6A 2PL5A 3D3WB 2GVNA 5G1OA 3NWPA 2G67A 3OWXA 4E46A 3JS5A 4G1EB 5EVJA 3E70C 3W04A 4C43A 5HIMA 4E51A 5D5QA 4MGIR 1LPNA 1JAIA 2O8NA 4V0LA 5DGHA 5BYJA 3ONNA 4KUGA 1J7JA 1DIOB 1PDOA 3CWZA 3BAZA 4GLOA 3LVFO 4WE3A 3MAAC 7MDHA 2C9ZA 1FFBA 2A4KA 3HBFA 5GONA 3WFZA 4EG7A 4MYCA 5K8VA 3V1LA 2IS1A 3OHMA 3DEKA 3E23A 4DM4A 1B7GO 1XR3A 1EFKA 2EAUA 3IIKA 4UVEA 4B45A 3TAUA 4BMPB 4YRBA 3DDSA 4I50A 1QUFA 1T2CA 4MRMB 5LA6B 1U2QA 1A7UA 2YZNA 2J0QA 3O8DA 3K9BA 4RMJA 4WNIA 4Z8XA 5IJ0A 1MHTA 4G0UA 1V7CA 1PK9A 1UQUA 1Y9DA 3KTDA 9ATCA 1GWNA 3INGA 4G0ZA 3LS2A 3ZE0B 2PWPA 5SY9A 3HDTA 1OTXA 2VZ0A 4DW8A 4MWSA 3O4IA 1LI7A 1DC3A 5AOCA 1LKZA 4OP1A 1EDDA 3T5BA 5A4IS 3DDHA 5LP6F 1X8JA 1CUYA 3A1CA 4DDKA 1PIWA 5FRDA 1X14A 4H16A 4NZPA 3W9BA 2JLYA 5JHHB 1XNHA 4AJ1A 1T24A 4BKPA 4Z0NA 1C1DB 1PJ3A 3MILA 4TQ9A 5AOBA 3FVWA 2QU8A 1IDN1 2V7GA 4GSYA 4MLZA 1T3GA 4IDOA 2XGJA 3WB0A 3PR1A 1WW3A 1ZXXA 4H7PA 1RWVA 2CHQA 3TEFA 2PD6A 1R6XA 1I10A 4MRPA 3ZXYA 1PE0A 3NHJA 3EZLA 4MR8A 4UE3S 1YF3A 1X77A 1CHNA 2A78A 1O5IA 4CG2A 1M2KA 2E6UX 4GZ5A 1AKMA 1VL6A 1QGZA 3CX8A 4AYWA 5IUJC 1GYQA 1T9BA 4QEKA 3HCEA 2E85A 1R5NA 3ON5A 2DKOA 1Y4DE 3PRYA 4G8BA 1TYEB 2IYZA 4F4JA 2CKDA 1LUAA 4GXNA 3A11A 5HBRA 2HIGA 1KEKA 3AEUB 2FHPA 2NXWA 2H5IA 4WXMA 4DIDA 1QP0A 2JNWA 2Z1DA 2DFNA 2FP4B 4Q9NA 3SYTA 1KDTA 2B30A 2V98A 3RT9A 1RYZA 3U31A 3A14A 3EZ7A 2VXCA 3R1IA 4O1HA 2XB6A 2B8JA 2PSJA 4JK3A 1A77A 1D2CA 1CU1A 3DEIA 2PGAA 3L4BC 3L7AA 5BSFA 3FMPB 3NETA 3FPEA 2TMDA 4BKUA 3HFGA 1J22A 1GSAA 1NNLA 3UIEA 1OH5A 1PSDA 3PFBA 1A82A 5AW3A 5K8IA 3OH8A 1RMTA 5ULLA 3Q2OA 2Q0HA 4WNCA 1EJ6A 1WU7A 2ZYGA 4RHUA 1K06A 5JSZA 4OHCA 4BMXA 4WDQA 1NVBA 5HS4A 1YV9A 2EJVA 3QH4A 3H18A 1ULTA 2VLBA 4IOLA 1N7JA 1ZZEA 4LZOA 1Y0BA 2W2TA 1W4CA 4RPGA 4ES6A 3T9FA 3K0HA 3AP3A 4G8CA 3LW8A 5DBIA 1T6BY 2NZUG 1EE1A 5TGDA 2WB4A 4FFSA 3ONEA 1TM7E 1Z6ZA 1HE3A 3ABRB 3EMDA 1UKZA 2ZBEA 3DGEC 3WLQA 4BO5A 2AZXA 3PDIB 1IJFA 1VHWA 4XXHA 5BWLA 3RV3A 3EXEA 4L15A 2BMAA 1PZHA 1IZZA 1FFDA 1NA5A 4AW9A 4KFRA 4HOYA 1X74A 1TM5E 5JAIA 3MW8A 5G0TA 4FKBA 4D99A 4GYJA 4EHAA 1RLMA 3F8TA 3MNFA 4V0QA 5F51A 3TLZA 4M0PA 3DE2X 2LRHA 1J2RA 1J23A 1W94A 1Z18A 2CXPA 3AFHA 3QKSA 3RG2A 4C0KA 2X2PA 4MEJA 3IDFA 4CMEA 4RANA 3B38A 2JFQA 4ABYA 1JDZA 1IMJA 2AG5A 4BRUA 5BUQA 2G9NA 2FTKE 1M75A 4QPCA 3STUA 2C29D 3URKA 3IIEA 5IZ4A 1CYEA 1OGJA 2BCGY 4NICA 2DQ4A 3NP7A 4V39A 1QVAA 3BVPA 4ENSA 1KETA 1EKXA 2HQSA 3CONA 3FZNA 1DRKA 4XWWA 1E7RA 5NULA 4N6GA 2ZJBA 2O8FA 1ZBQA 1W93A 1DAFA 3TLEA 2WP0A 1XD2B 1TZMA 3K92A 4S04A 2J9FA 4DSUA 2ILTA 5IZCC 4R1SA 3NHSA 1O1YA 4FFBB 2GZHA 4OIFA 4HAYA 4CKEB 3QG5A 3KJGA 2XGMA 1D9XA 3ZWBA 3GLGE 2G07A 2H4HA 2MR5A 4IQFA 2IYNA 4HWSA 1ZITA 1G5PA 4TWAA 4QYXA 3KQMA 1MC1A 1Y6JA 3H1AA 1LBTA 5G0VA 2WEKA 3UK2A 3FMVA 3PNBA 4Q24A 5L3QB 1OWMA 4R1UA 5TQ2B 2BGUA 4XWKA 5FWYA 3ZI7A 4Z7OB 4OU4A 2WSYB 1Q0PA 4FDMA 1GTRA 2PGNA 2ZAOA 1LTKA 2RGUA 4GMGA 4NATA 4TKVB 1TU0A 4FKMA 4XUDA 5CT6A 1UZNA 3QSYA 1V5IA 4GVXA 1P1IA 5K4HA 2WVJA 3W5DA 1DAMA 1QIKA 4LMAA 3BHIA 3HEMA 2ZFUA 4Y2HA 3C6YA 1DP4A 4EZEA 3Q3GE 2QLMA 4E1AA 2WG2A 3IUBA 2ZRHA 3HJBA 1XLTC 5EWMB 5CRIA 1Q20A 3GLRA 4CEIA 2PRSA 3DFMA 3NONA 3KELA 1UJ4A 1RACA 2DBQA 2PX5A 4RF5A 4MVJF 1RMYA 2QT0A 3KQTA 2NLOA 1P9NA 3I5AA 1CUUA 4KQFA 2CSUA 3FCCA 4BE4A 3AVUA 1PTJC 4BX9A 1TCVA 1OYOA 3HXMA 4ZVOA 4G1VA 1NAIA 3ORQA 1VCOA 2WJYA 5JWOA 1H0KA 3L7MA 3LPMA 5EIOA 4CCYA 3QVUA 3ZDAA 1C3XA 1KY5A 5C46F 3DR3A 4CIVA 5HQ3B 3IAM6 3LAWA 4QGGA 4CKBA 2W0MA 2YNMA 4IS3A 4Y1EA 2LBPA 4KQEA 4XUEA 1Y9JA 3FDJA 5CVDA 2R8PA 3IBGA 3MUFA 1FTGA 1C2YA 1G6OA 3KLPX 3SEZA 5BQ3A 1OYWA 5FNZA 5IX8A 2P79A 1YCGA 4DSZA 2GN6A 3EXFA 1U9JA 4UBMA 2LDXA 4B43A 2ZIZA 1E2MA 1S5PA 1XJCA 2OHIA 4UHBA 2WP8J 2V6IA 2Q2QA 4S3MA 4EYSA 2A14A 1FQOA 2J6IA 2O0KA 2IUTA 3LTNC 1J9EA 3MOIA 3NYWA 1N9GA 1ZGAA 1DV2A 2AXPA 2JGAA 1GDTA 1QYIA 1M74A 4HLUA 5HCIA 3CLKA 2SKEA 2XIJA 1FBNA 1ODIA 4NBTA 1NOIA 4QPZA 4RGBA 4YK7A 3UB4A 3V9AA 1YQXA 1D7AA 1J8VA 1KAEA 5FWAA 3T3DA 4AY6A 4G8JA 5DLEA 2NU9A 4TTPA 1E77A 1L1QA 1M2EA 2CVFA 3FIUA 3IQXA 3ESBA 3NGMA 3TQTA 3W5UA 3P0IA 4P32A 4TMXA 5HIAA 4HI0E 1V9SA 4OKNA 4CNQA 5KDDA 1Z4QA 1Z35A 3WJ2A 3IPXA 3S7TA 4FFNA 2W6NA 2R5NA 1O94C 3ILHA 3P94A 2FQWA 2JFNA 4XM0A 2BJHA 2VXYA 2XWJI 1VMEA 4KW7A 3W8FA 1VB3A 2YJ3A 3CF6R 1Y4SA 3MAJA 4HDMB 2P9YA 4JH0A 4Y0NA 4CQLA 1GEGA 4HAUA 1CY0A 4GWLA 3H3XA 1QG6A 4TM7A 3ZDDA 2O8EA 2Q0QA 4GS5A 1SB9A 1ZD4A 4RGQA 4BP8A 1M6HA 2PCJA 4GG1A 5EE1A 1QHFA 2C0QA 1CUFA 2MJLA 3F4LA 3GIWA 4J1TA 4KBFA 2QXYA 4PWZA 3KTAA 4K40A 3PQ8A 3CW9A 4PPYA 3RUAA 1RWWA 2VUHB 3FMOB 4URYR 7ADHA 4W8GA 4PFSA 2QLLA 2XUJA 3EW7A 3FOCA 2HC9A 2GO7A 5IYZA 2GYVA 4PFQA 1LDNA 5JCJD 2ZPAA 1XNRB 1NW7A 1A9XA 2H8GA 1JPUA 1NM5C 3W1WA 3KU4A 1MO4A 1WXGA 3MJ4A 4A5SA 3GN2A 1YFKA 4KE8A 2GEDA 4DLPA 4FGZA 1M54A 1J39A 3G8CA 2GH1A 3OBBA 3F3SA 3ZNQA 4NZZA 5LM3A 3RAJA 3UWSA 3VISA 2V58A 4GKBA 2GHTA 5I7FA 1N1DA 4KIUA 4D0LB 3HACA 4OJKA 4I9FA 4IVRA 1Y1KE 1KORA 1T36B 2WFLA 1IZ7A 1OW3B 3L01A 2QWXA 4E31A 1SXJE 3OSZA 4X20A 3TLGB 4BUCA 4YCLA 3O8RA 1PR5A 3GELA 3WMFA 3AFIA 1NTOA 3FPBA 3PENA 1SC4A 3QLVC 2WYUA 3TLAA 3C3MA 3IMKA 4AC9A 4LJKA 1JQ3A 2BVNA 4HZUA 3V6LA 1I14A 2ALJA 3A3PA 3TLCA 2QGFA 4NDZA 1SOVA 2Z5FA 4XRRA 5HF5A 2VZLA 5JPDA 4GI2A 5BW6B 1RP7A 5BT9A 2V65A 1XL0A 3M89A 1Z4NA 1RLOA 1XEAA 2PA0A 4ER5A 4FSHA 3TLJA 4HFNA 1H2RS 4PQYA 4Q3OA 1PGNA 2QQFA 3I4CA 5JNWA 3PLAE 3UBMA 1OX6A 2HXGA 1KVUA 2G76A 4IX1A 2GJKA 2E3JA 3UJBA 2I9PA 1XYGA 5KB3A 5LPNA 5DHQA 4QJ4A 2FR1A 2L82A 1ZK3A 4U7FA 4C29A 5G1PA 1J33A 1QOPB 1VLLA 2QAGB 2EHDA 4WNYA 1LNQA 4IMJB 3D7SA 4HDNA 1L5HA 1U0OC 3H0KA 3I0ZA 4RF4A 4K81B 3A4IA 1E1CB 4AUNA 4JXKA 1PJ8A 1S2LA 2IKQA 4P92A 4WOJA 5DHAA 3G5AA 5FLEX 5IF9A 1ZJWA 2O1XA 1Y1PA 2OAEA 2FUG1 1OBHA 1R6VA 2KM1A 2OBBA 2VDOB 4KH1A 4DG5A 3TFWA 4ZHQA 2P8SA 4H3VA 1UBFA 4XQEA 2GHQA 2H7VA 1UQRA 2ZWIA 4RAQA 5T3UA 3RCBA 1CY7A 5JU6A 3UJHA 2EQAA 1CJBA 2EKPA 2JAHA 2WM8A 3UY4A 1QZZA 1E2PA 2R1VA 2GJ8A 4MX8A 3MCTA 3UFXB 1YDEA 1CUAA 2VJDA 2Q3LA 5JD6A 2YFQA 1UUFA 1Y48E 3IODA 4WT7A 2JAOA 2WAYA 4FQ7A 3N6RA 3PF9A 4Q7MB 5GINE 3RKSA 3L6DA 1EYZA 2WJHA 5DTQA 2C57A 1HO3A 5K45A 3AG5A 1MB2A 3GUUA 3BKXA 4ZU6X 4P33A 4HVLA 4INAA 5AI6A 3QI2A 1VECA 2VN8A 2Q0XA 3EZXA 4P7JA 2XKKA 2QG6A 3EXHA 3OA2A 4EB6A 4F2WA 2VNIA 1WQ3A 4R54A 4TN1A 1YFJA 1N0VC 4TSRA 2DCUA 1R16A 4IDEA 5A3JA 3D43A 3EG9A 2B9EA 4CEJB 5FEUA 4HN4B 2ISQA 2VKTA 1Z7GA 4Y8VA 1DAOA 1W44A 2C4UA 4HT3B 3L4EA 3Q7EA 4W1PA 3UFXA 1U94A 2V03A 4TRNA 2WRZA 4YCBA 2J33A 1IY2A 4PQFA 3VOSA 3UAXA 1NQ5A 1N3YA 5CK5A 1J07A 3B9BA 1ZISA 4WZ6A 1KJWA 4GI5A 4D1YA 4WEOA 5JIBA 1XHFA 4GZLA 5KOHA 2CUZA 3QV2A 4CF5A 2IVFA 3IQGX 3CCCA 3REFA 4I66A 5J5VA 1Q5PA 2R6HA 1UAGA 4KB5A 3EVGA 3BSYA 1CRWG 5ERYA 3B3QA 1X7GA 3HKEB 1NXVA 2CY0A 3UJ8A 1O6CA 1UBTS 4KTVE 1UMCA 1P0MA 3A6DA 2YHIA 3ZH2A 1CDOA 5J2UB 1DKNA 3WRYA 2FZLA 2PL9A 3KOYA 1SUWA 1KFKB 3CIOA 1P2GA 3RUPA 2W6JA 3M1LA 2X1LA 1WZEA 4HV4A 5B6PA 4ZOQI 1FVFA 3B6MA 3BRWD 4L8FA 1NVMB 5EPOA 1WKBA 1RBYA 4W7SA 1GVHA 3L8ZA 3ZBQA 4R05A 2HSJA 2ON6A 5MN4A 1DRUA 1E5VA 1L7XA 2RGRA 1QCYA 2C5FA 2PQ6A 4CUKA 5IT0A 5HTKA 4E5NA 1OROA 3GP5A 2YOFA 4D56A 4F4DA 3IP3A 4YP7A 1YOVA 3D4NA 1MGPA 4GHWA 3L0OA 3L0CA 5C7YA 1KI2A 1RI3A 4BWFB 2IEIA 5KQPA 1YIAA 1UKAA 2D62A 1TEHA 2OORA 3I0NA 3ZN2A 4BO0A 3BXHA 4E09A 4ZXPA 1IEWA 1C1XB 2ADMA 2FX2A 3HCCA 5AVRA 3QEMB 4I1YA 5KTRA 4C7JA 2Q3EA 3K9QO 2IHVA 3K0AB 2TS1A 5EXEA 3WYGA 2A0XA 3RW9A 4K6OA 3ZLJA 3MRTA 4NAUA 5DRTA 3B5EA 3DZKA 3QPVA 4O5OA 3HCWA 3T7RA 3U26A 4J29A 2WTNA 4CI9A 1K88A 3E0XA 1NF8A 2ZYVX 1HZZA 3HJGA 3HXKA 5C52B 3LW7A 1R4NB 4EMUA 5AKJA 2O2JA 2R8YA 4AY5A 2P67A 4IRMA 4UZEA 3WVNA 4D7AA 1J2EA 1U99A 2PKXA 2PRIA 3MQFA 4L7QA 1MPXA 4UE2A 1KKUA 3O2QB 4YCAA 1NVUQ 2AEEA 3G8AA 4AYXA 3QOFA 2LGJA 1HQYE 2VK8A 3E9NA 4M0DA 4ILKA 4EH1A 3TRFA 5H9WA 4DMRA 4MCJA 3OX2A 3I9NA 4B33A 2OECA 2OSBA 2P6UA 4UU0A 3S2SA 4YV0A 1FNMA 3NBYC 2J8ZA 4S0XA 3MMNA 3ZW7A 2D7DA 1DC8A 4RKEA 5K1ZA 1E9CA 3ILSA 3LKDA 2Z09A 3JD4A 3NUGA 4MICA 2P3SA 4XQ0A 3G0CA 3GA5A 2GFIA 5D86A 1F0KA 1UJCA 2BIFA 2F8LA 4LQLA 4P82A 2ZWMA 1ESNA 3TIIA 4ZV9A 4ENRA 4FYIA 3SZGA 2FNAA 3FCYA 1JDUA 1MVNA 2AOUA 5IAKA 3F9IA 1I51A 1W75A 4WK4B 4IIGA 7AT1A 2FMFA 3IO5A 5JRZA 1PBNA 1XRSB 1BCRA 4A6PA 1X6VA 1X0XA 3CX6A 2NM0A 3MCAA 3X44A 3H83A 2Q4BA 3PGKA 1ACMA 2YHBA 2NO9A 2GNPA 4KV9A 3BMCA 4AG3A 9MHTA 4TMWA 2H5JA 5CEFA 3MIIA 1RPAA 3GLTA 3THOA 1ZUWA 2BLNA 2WG1A 2YXLA 2JPDA 3K8YA 1V8ZA 4NMXB 1V3QE 4YJKA 4AUMA 3UW1A 5JECA 2H9IA 1LA2A 4KO1S 2YJGA 1XXHB 1SXGA 3ZQ4A 2HLNA 3QLEA 3QVJA 1QLJA 4BMDA 2CYCA 3AW8A 3IB6A 4RIFA 4D8TA 3QVTA 1L7OA 3FUWA 4O4IB 1Y3AA 2HSWA 3KR1A 3U3OA 5CURA 4ZIRA 3KPUA 1EM8B 2J0UB 4HYQA 1P0IA 4P3XA 4ABTA 3W2IA 1OD6A 5D3QA 4HWRA 2C7PA 1Z47A 1OASA 3R7FA 1J0AA 1BS1A 1SIOA 4G5RA 3W9YA 3ZE1B 1CSEE 2ACVA 3MWGA 4GXQA 2BBWA 2YR0A 1UZLA 2I8LA 5AW9A 3RM3A 1LX6A 2Q5LA 3SC6A 4A8JA 1YU9A 2H5EA 3HGTA 3NWOA 4N3GA 1Z63A 4UEWA 4LTMA 1Z4KA 2DH6A 3QJYA 1HETA 2JI4A 2YWCA 4KQIA 4NRDA 3FYUC 2PVSA 4CM3A 1U8CB 4WERA 3JQGB 3UUEA 3DF7A 1X8KA 2QF7A 1ZJYA 3O3CA 1QO9A 1X9HA 3CTPA 4IG9A 4RFSA 3WXBA 5JFOA 2H0AA 2IY9A 3GG9A 3IOCA 4QAJA 4I8IA 3LWDA 1HBJA 4CKBB 3W2FA 4UZSA 1J20A 4KWHA 4AYTA 4Z2AA 4X9XA 5JPCA 1OSNA 4I1PA 3CVVA 4Y7CA 2LCIA 4BV9A 5BN3A 2Q5EA 4Z3DA 5ALRA 1Q7GA 2HWKA 4OQMA 5AJTA 1KXZA 2B7LA 5JDCA 3KPJA 1FMFA 1GFIA 3BB3A 2O8FB 1MO3A 5E8RA 5T4EA 4OQEA 1EVEA 3R7NA 3WBKA 3DBIA 1CZUA 5EP2A 4UKDA 5L6MB 5CFZA 5IM4A 2X9GA 4EB0A 3FVRA 3BL8A 3RHFA 5CCEA 4I7EA 2ZBVA 3NEYA 4LVUA 1FNBA 4FZJA 2O2EA 1XQVA 2WWWA 5TDHA 3UWDA 2FEPA 3QJ5A 1C80A 4DR5B 4TTVA 5BMOA 1BYUA 5CNMA 4BNKA 2JKYA 3NFRA 5LKAA 3B2EA 1PTJA 4RE6A 1N9ZA 3S1AB 1OA0A 3I8SA 1ZM3A 2XMDA 5EYPA 2A33A 5EJ5A 3OC0A 3WMRA 1JLLB 2A35A 3E82A 5IM5A 2ZJ0A 3DPSA 3R8CA 5DIZA 3T6KA 3V2UA 3VM6A 3AJRA 3GJ3A 3N59A 1PGPA 5GJBA 2Q5FA 2V0NA 1OFUX 2AA3A 3IVMA 3UK1A 1RW4A 3K2BA 4QYWA 5CBKA 3KR9A 1UJNA 3UT5A 1X0VA 1A9QA 2RAUA 2QUJA 3ZNNA 4KXWA 2ZTUA 3IKMB 1DJMA 1A2KC 1HI9A 2O9JA 4LI0A 3C5EA 3EJ6A 4N8DA 3TZLA 2GN9A 2VSFA 1E0JA 2FEXA 4QDOA 1WQ1R 1QHYA 4HWGA 3SMQA 2JLUA 4UFPA 1C9NA 2I1QA 4XIGS 1A8HA 1KL7A 3JVIA 2O0LA 1I80A 1HL7A 1U6IA 1UJMA 1URPA 4GPD1 1GLVA 4RPLA 1KYQA 1VSBA 1L7RA 1VYVA 5FCDA 3UJAA 2ZIAA 5FPTA 1YB5A 6AT1A 3DLBA 2PLNA 1KWGA 3D8NA 4DIMA 1VKZA 3D9QX 2JATA 3R6GA 3BC1A 2HK9A 2A8YA 3BGDA 3IEXA 2EJTA 4QFDA 2GBPA 1V0JA 3FNHA 2OEPA 4POOA 4ETNA 5LSAA 3REQB 3N0XA 1J5EB 4DR7B 4EG3A 1UMDB 2R6FA 1B4DA 4ERNA 4F3KA 3PGLA 3G8DA 2FDXA 2H2IA 4F9TA 2ZE7A 5EHZA 2AD5A 4RENA 1Q1GA 2CVOA 2I4LA 2Z5GA 3EZ9A 2AJBA 2GUGA 3G88A 3P9CA 4GO1A 5B7NA 4LXUA 1MX1A 4NYIQ 1PS8A 3C6MA 4JLWA 4Y2XA 4A2WA 1UKCA 5AKIA 3PGMA 3KQPA 4FC6A 5TPZA 4FOLA 3MT8A 5FPQA 4BQPA 5HOQA 1FTWA 3GLIE 2X14A 2D8AA 4RC9A 4RH3A 1QCDA 3FCSB 4MS4B 3AVXA 1GT6A 4FBMA 1G2OA 7REQB 2GLTA 2H1WA 3AV0B 4JP5A 5KOJA 4P98A 4MQEA 1C2TA 4DV0B 4NZNA 3CH7A 4YGXB 1GRNA 1U1CA 1KFCB 4ITRC 1N3LA 3DFUA 1BHO1 1R0CA 1LSUA 3IEUA 3EDMA 3M4ZA 2WIDA 2DJIA 3NNSA 4IDCA 1Y8RA 3NTLA 1FL9A 2DTDA 3T3PB 2CVQA 1TCAA 3NOQA 4QU8A 2CD7A 3EA5A 2X3YA 4QRDA 3UC5A 2A4MA 3DDWA 1A7JA 4W5TA 3KBOA 3NOXA 2H4JA 3ZZMA 4ENTA 3I5XA 3B3JA 3C4VA 2ORIA 3TLYA 5G41A 2AFVA 5FYDA 1U9CA 3UPDA 5JMOA 3CPHA 4Z7NB 5J4VA 1BQEA 1C9EA 1ZQ1A 4K9MA 3MS4A 4XIJA 3ISJA 2LCQA 1BHJA 3TBHA 4B8YA 1C4WA 3N53A 3V7UA 4U7WA 4YLYA 1TVKB 5C4IA 1RTKA 3L6OO 5EKXA 1EFPB 5LYJA 3OCUA 3LUCA 2Q7XA 4AUEA 1ECCA 1XEXB 2KS6A 3H2BA 1I24A 5CM9C 3T7TA 3TTUA 1YCDA 2DPGA 2COEA 2DBZA 4OHVA 3P9ZA 3V8BA 3MRVA 3RIGA 2YXNA 2PGOA 1R0XA 1VA5A 4GUDA 4K0KB 1NL3A 4HX9A 1P73A 4IRXA 1ISMA 2NZYA 1K92A 3R5XA 5TQVA 3TKYA 5BV0A 3JWEA 5EPEA 1OFHA 5F76A 3DG9A 5LBIA 3VVBA 3M5CA 3Q3EA 4PPGA 2J08A 4I50F 2HCTA 3MGAA 2F59A 2Q3JA 1Y9EA 2H4YA 3K5WA 1U7UA 2Z08A 3LQKA 4MZXA 4H7EA 2OHXA 3PXAA 3UXMA 3WWDA 1XZLA 5DXFA 2CD9A 5L45A 4P35A 3NAMA 1J0DA 2Z98A 1M7HA 3GPDG 3ZD7A 1N6LA 4HMPA 2O59A 1JU4A 1HEUA 1BDBA 3RYTC 4F3CA 4UCWA 4MWOA 1JA0A 4N9QA 3FJYA 5EWJA 1C50A 3TKLA 2XNDA 1T8UA 4MV5A 2AYYA 2GZ1A 1DTWA 2WVHA 2Y0EA 3A1EA 2HXYA 4MYDA 4TXJA 1ZR4A 1KO8A 4IJUA 1QOQB 3UXYA 4HDRA 1EX6A 5KYYA 1NLFA 5GM2A 1OC2A 5GMOA 4XH9B 2C58A 4DJ5X 3LDFA 3ZY3A 4CQMD 4D41A 5C8XA 4LYJA 4X7MA 1XI2A 1BHQ1 1DS6A 3Q0TA 2HHLA 4WFKA 1FFHA 4DLWA 2F3PA 1FSPA 4OAOA 4L8YA 3WWEA 2P3LA 3U0BA 1GG5A 1I3NA 1PZXA 4HEA1 3O2JA 4GMFA 3QM1A 5HHTA 5JH7A 4J9VA 3BE6A 3RF7A 4R16A 5EJEA 5CDHA 5DLDA 4YXWD 1E6LA 3S99A 3ZCXA 2RB5A 3OLYA 4OCZA 1QHXA 3HRKA 2GEJA 3GLFB 2GK6A 1E8NA 3T99A 4CG3A 3DP9A 3ACCA 2GN1A 5C8YA 2EZTA 1XTZA 1YDMA 1O08A 4G97A 4RA9A 5CT4A 5F78A 3V4VB 3VKHA 1B6RA 3VU9B 1JA1A 1NW9B 2W5UA 3AUSA 1KXJA 5HP4A 2PMBA 1KVQA 2WILA 3P9IA 4QUIA 1Q1QA 2BKVA 5HDBB 2J41A 3GJZA 3Q8LA 1TVEA 2QN1A 4LC1A 5A5GA 5HTOA 2IPXA 2VTVA 4EA7A 3F5QA 3SGLA 1L1EA 3BD7A 1NV8A 5LQNA 2I7DA 1T43A 3QZUA 1YZNA 4IO1A 4LWZA 3OI7A 2RIRA 1M2WA 2H1RA 4UARA 2IUSA 3H65A 5C9ZA 1AS0A 1M8FA 1XQYA 2PAAA 4R7ZA 2QBYB 4UNIA 4WOKA 3QU9A 1RYMA 4RXMA 4DDHA 1YS4A 2ZQZA 3VC7A 2HK6A 3OAAD 3QKTA 1VIYA 2AT1A 1UAAA 3T0IA 3KZXA 1T8TA 3HKDA 2XTZA 4MSUA 2Y9PB 1EFUA 4RVGA 3NAQA 2Q99A 4R68A 1I8TA 2RIPA 4JLVA 1U7WA 1UBUS 3FLBA 2FEWB 2ZSFA 3AL3A 4NMWA 2P75A 5ITSA 4YCJA 3RE1A 1OOEA 1HYQA 2GOYA 4DILA 5DBOA 2UVDA 4Y6SA 3GCXA 1NBWB 3GA0A 2WUGA 1TM2A 5L4LA 4NJMB 5D3MB 1XP8A 3TSWA 2HWUA 3S40A 5ELMA 1L2TA 4WNAA 2F9MA 2WMOB 3DUWA 3KXPA 1M2VB 1QP7A 1BW9B 3I12A 1F3LA 1KEWA 2FSVC 4H27A 4C4XA 1FMLA 4KX3A 4JI1B 1LK7A 1SXIA 1XLUA 3F4BA 2DSNA 1Z37A 1XJQA 2ZB7A 2YJZA 4BDSA 2NYVA 1RSZA 1AVTA 4GM1A 1UFQA 3Q98A 4I4TB 2R5FA 2CK3A 2PJRA 1B3BA 2C5GA 2DC1A 1HPLA 2I67A 3KV1A 1BW9A 2GBGA 4LZNA 3CW2A 2NG1A 2VUTA 3I6BA 2GBCA 4NJMA 4CPDA 4DQKA 1AKQA 2HJVA 3DMRA 3U40A 3SIRA 1T4CA 5B5SA 4MMYB 1UOQA 3O7MA 2OXTA 3OO1A 3BGIA 3LX6A 1GNLA 1N2GA 2QTNA 4HVAA 4MV1A 4I3HA 1N5LA 2QSYA 3QU7A 3MWJA 1U2GA 2W43A 1OLOA 3LHKA 4WAUA 5BPFA 1M34A 1OT5A 5KPDA 3ZK7A 4QUDA 2WZQA 1EWTA 1SKAA 2Q27A 1D2GA 2VYQA 5CGQB 16PKA 3C3YA 3MOSA 5ENVA 1A9TA 1FXSA 1LPSA 2P4HX 2RG7A 3HUUA 1NBAA 2WF5A 4FCVA 3TX6A 4C0XA 4E5UA 3L7KA 5CIQA 4E03A 3MTEA 5F73A 2C1ZA 3A8TA 3KFLA 3LRXA 4KE6A 2IXBA 3HYCA 4HUQA 1OJLA 4OBEA 5TMDA 2GM3A 4C6RA 4JHLA 4EQ6B 2NPOA 1PGQA 1QLWA 1RPTA 3GRAA 1N25A 1RYYA 2AZDA 3GD5A 3Q7PA 4AF8A 2BEWB 3T5GA 3A37A 4MGKR 5I3CA 3N2GA 1QH1B 3GCGA 4H1HA 4Z9BA 3V7NA 3ZU2A 4E5PA 3OIGA 4E2YA 5TMBA 2AHRA 4DWJA 5D2CA 5CXQA 4DWWA 2DQZA 2UZ3A 2Z3VA 2C4NA 1MO5A 1PNTA 1N7IA 2Y76A 5GM1A 3CZMA 4J43A 2BHRA 1PZGA 4S1OA 4AN0A 4BU0A 3PYXA 3GWZA 1W4AA 5FBWB 3HLYA 2I55A 4FI3F 4MA0A 2JLWA 2RHJA 5KNCH 2H59A 4MQFA 2C9BA 3DEAA 4EX7A 1VCIA 2OHGA 5DF1A 2VDKB 5DNVA 1RYBA 1U3FA 4EZIA 1S96A 1YVRA 2B1GA 2DBRA 2R11A 3HLTA 3KBBA 3PIRA 4IIJA 4J4BA 4WZZA 1NZDA 2A88A 2O0JA 1N5DA 4RA6B 3EVBA 4D80A 3JVEA 6NULA 2VH1A 4ZKEA 4WK6A 3FCEA 1WHTB 1Y1LA 4Q1FA 1RZRA 3DAOA 4DBZA 1FTQA 3MB8A 4O4LF 2ZVPX 1MNQA 2XOKA 1JTVA 1PS0A 2QGNA 3QNUA 3OTWA 1A69A 2VDWA 3Q10A 4EMBA 1ZL2A 1CQJA 3FGNA 4MWTA 4P4NA 2H5LA 4EB3A 5K0ZA 1Z4LA 2VP5A 2O1EA 4ZVRA 3V3KA 1GXSA 2ZU6A 3K4HA 2JI6A 4GX5A 5J2TB 1KP3A 3BWXA 5JTUA 2P3QA 2VNHA 2Z8YA 3N5CA 4TV8B 2TMGA 3MQ4A 4C88A 3AUYA 3IV9A 4GRDA 3LFUA 5JNLA 1KAHA 1EHIA 1Y8AA 2AOTB 2WIGA 2Z3WA 2WU0A 3NRJA 4QBKA 3UMVA 3ZK9A 1AKEA 4PYIA 3WGMA 5BWNA 2H1IA 1NBMA 4GDMA 4P3PA 2OO7A 2YV1A 1KH1A 2PTHA 2Q6OA 4GBGA 1EFLA 4R9SA 5DI3A 4DA9A 3IT0A 4XARA 2INGX 5I4CA 3NASA 4L8WB 2WYOA 3C8ZA 3PCRB 4AIIA 3IE1A 4ZANA 3TNJA 1NMQA 3IJRA 1MV8A 2OCAA 2R1TB 2RGGA 3S6JA 1IOVA 1D4FA 3E9CA 4NNJA 5D7BA 5FBRB 3IAXA 2EG5A 3R5KA 1TAQA 3LCUA 1G2IA 3G7SA 1H69A 4U2DA 4QM6A 2CFOA 1GZ3A 3V00A 1EUCA 2PKQP 4MVJD 3OQNA 2HQRA 1HT0A 3UHPA 4QQKA 3HJRA 3LHDA 4K5QA 4A6DA 1KMHB 2ODTX 4NBRA 3UNXA 4A15A 4NPCA 4OXRA 5IN4A 5HZMA 4FEAA 4JXJA 4KAXA 2EX1A 3MG9