2POCA

The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
353
structure length
339
Chain Sequence
GPYKHFMQKEIFEQPDSAFNTMRGRIDFENCVVTLGGLKSWLSTIRRCRRIIMIACGTSYHSCLATRSIFEELTEIPVSVELASDFLDRRSPVFRDDTCVFVSQSGETADSILALQYCLERGALTVGIVNSVGSSMSRQTHCGVHINAGPEIGVASTKAYTSQYIALVMFALSLSNDSISRKGRHEEIIKGLQKIPEQIKQVLKLENKIKDLCNSSLNDQKSLLLLGRGYQFATALEGALKIKEISYMHSEGVLAGELLPIIAFATRDSLFPKVMSAIEQVTARDGRPIVICNEGDAIISVHTTLEVPETVDCLQGLLNVIPLQLISYWLAVNRGIDVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords isomerase domain of glutamine-fructose-6-phosphate transamin
publication title The Crystal and Solution Studies of Glucosamine-6-phosphate Synthase from Candida albicans
pubmed doi rcsb
source organism Candida albicans
total genus 144
structure length 339
sequence length 353
chains with identical sequence B, C, D
ec nomenclature ec 2.6.1.16: Glutamine--fructose-6-phosphate transaminase (isomerizing).
pdb deposition date 2007-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01380 SIS SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2pocA01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2pocA02
4LFCB 4IVNA 1HR0B 4LZJA 3FXAA 2PGIA 2CB0A 1U0GA 4JI1B 3T1HB 2UXCB 4NXMB 4X64B 3NBUA 1IBLB 3KNZA 2DECA 2XHZA 1G98A 2UXDB 2UUCB 5FLXA 1JLHA 4YHHB 2Q8NA 3BCHA 1X9HA 1NRIA 2E5LB 4DV7B 4GKJB 1X94A 4YY3B 4OX9B 5I01A 5BR8B 4DV5B 5LL6P 3C3JA 4S1WA 4JI6B 1J5XA 1IATA 2V4MA 2VQEB 1IBMB 3J7AC 4JYAB 1VIVA 2WU8A 1HOXA 3ODPA 2XBLA 1X9IA 4DUZB 3Q7IA 1MORA 2ZJ3A 2CXQA 4KHPB 1TZBA 1WIWA 2ZJ4A 3G68A 5LMNB 3PR3A 4DR6B 1C7QA 4DUYB 4JI3B 3QKIA 1XNQB 1XMQB 4GKKB 1JIQA 1JEOA 3LJKA 2UU9B 2PUVA 3CVJA 4EM6A 5IT9A 1I94B 4LFBB 1HM5A 2PUTA 4X66B 2POCA 4DR7B 4JV5B 1VIMA 3FF1A 4U6NA 4K0KB 1X92A 3SHOA 2CXUA 5A2QA 4JI7B 4JI8B 2AMLA 2A3NA 4AMVA 1XNRB 1N32B 1JXAA 2CXOA 3IFSA 4NXNB 2HHHB 1GZDA 4LF5B 4DV3B 3HJBA 3OOJA 3M5PA 4JI2B 2CVPA 4LF9B 3Q88A 3FJ1A 1ZZGA 1N33B 3BJZA 2CXNA 5BY2A 3EUAA 2YVAA 1B0ZA 2F4VB 4LF4B 4DR5B 2VQFB 4DR4B 2O2CA 1T10A 3TBFA 2E5FA 1MOSA 2CXSA 1HNZB 2VF4X 1HNXB 2CXPA 2PUWA 4DV1B 4DV2B 4M0DA 4DV0B 4LF6B 1TZCA 2CXRA 5IWAB 2UUAB 1U0FA 1DQRA 1HNWB 2UUBB 1IBKB 1IRIA 4DR2B 2ZM6B 3J80A 2VF5X 4DV4B 3T1YB 1Q50A 3UJHA 4JI5B 1FJGB 1VI6A 1NUHA 4B3MB 2UXBB 1M3SA 4JI0B 1TK9A 2I2WA 1N36B 4S12A 2I22A 1XMOB 4B3TB 3ETNA 3JX9A 4DR3B 1MOQA 1XTBA 3I0ZA 4X65B 4B3SB 4LF7B 1VI5A 1J5EB 4DR1B 3J81A 2DF8A 3OTOB 3JAMA 4LFAB 4JI4B 1KOJA 4B3RB 4X62B 1C7RA 3TRJA 2J6HA 5LMUB 4LF8B 4TOIA 4DV6B 2O2DA 2X3YA 2CXTA 1N8TA 1U0EA 1N34B 4AQYB 3FKJA 1GZVA 3HBAA
chains in the Genus database with same CATH superfamily
3G13A 3ES9A 4MS4B 1QMPA 3OC0A 4LRWA 1TM3E 4DA8A 1SVKA 4C0LA 2WHRA 1HRKA 4PNPA 4ZU3A 1A82A 4KXQA 4JI1B 4HGOA 5JJBA 1GZ6A 4PLWA 3TZQA 4H2DA 4CZ2A 3OQIB 4X64B 3I5MA 3MQ2A 3HI4A 1YASA 3PUIA 4D0GA 1YQQA 1CRPA 4KYUA 1JIIA 3KKOA 4EZIA 3IEKA 4TM8A 4ZVLA 4YY3B 3ZIUA 1N8KA 3EH1A 1AK9A 4PAGA 3QUSA 3R7WB 2AMJA 2BRUA 2QTMA 3F67A 3KCNA 2VZ8A 4KIGA 5AJXA 4D42A 3RVJA 3TLXA 3L1IA 2IUSA 4DCSA 4F6RA 3PZBA 1CVRA 1Y9AA 5IKPA 5KWJA 4EW1A 3CUWA 3TTYA 1NVMB 3TX6A 2E48A 3ST7A 3PNVA 4ZYUA 621PA 2FEPA 4Z9BA 4PR3A 3BFJA 3G2HA 3WDLA 3TO5A 3N2EA 4KMRA 1QV9A 4FZRA 4MUHA 4R8RA 4YJHA 2KBEA 3QELB 4OL0A 4CEHB 2YNMC 3BFKA 1VJ1A 1AKYA 1EGVB 1L5OA 1XXLA 2NO0A 3FYUA 3PLRA 2D4AA 4QGGA 4ER5A 3I72A 4QYIB 4BMPB 3O4IA 4AO7A 3R6DA 1XU7A 2G4VA 3EIHA 1EVKA 1N0WA 1WTCA 2GESA 2FSIA 3F5FA 2I29A 1QIEA 5FIUA 1TEHA 4WY2A 3H3FA 4Q1VA 3UA4A 4C89A 2WB2A 2VAPA 1JKXA 2DFNA 1K7CA 3HMQA 3VNSA 2O0HA 2GZAA 2GNOA 1EFVB 5EPEA 2IBSA 3FNHA 2OZVA 4MRMB 1BRTA 1PHPA 1VA4A 3GNSA 4WERA 4ZCLA 5IAEA 1G4HA 3IDZA 3W5CA 2PZLA 2AZTA 1M73E 4ZYLA 4V02A 2XCIA 2GD1O 1G20B 1NVKA 2QL9A 3IOEA 1YTUA 4C4OA 4YVFA 1E7QA 3FFTA 1T2FA 5L6LB 1NATA 1UJ5A 2G7MC 1R10A 3HDJA 1UPCA 4YMLA 3ZHTA 2X9QA 2XB6A 5ICCA 2VQFB 1I5EA 4B3DA 2KE5A 3LX6A 3WA7A 1O8BA 1M54A 2A59A 1Z8DA 3OUZA 2WD7B 1NP6A 4LOIA 3GD7A 4L7VA 1QQBA 4C29A 5KYVA 5IDXA 3TKYA 3DONA 4TYPA 3D8SA 2G25A 3D81A 4IF6A 4OYLA 2DULA 2Z3ZA 3H18A 2XITA 5EINA 1FRVA 4XUEA 2NYRA 4IJMA 2G5GX 1P62B 3ZU6A 1QK4A 4JB8A 4JN6B 3LNCA 2JG3A 1XFAA 1MX9A 4D5GA 3K9WA 4DWJA 4WCDA 1JDVA 1NUQA 4Q6BA 3L6CA 5COAA 1KY5A 5T57A 4B6QA 4HF7A 1E32A 2H0QA 1NUUA 3FNGA 1O94A 4W5RA 2GPTA 4MR7A 2GSDA 1KORA 3FNFA 3U7JA 4E4RA 5B1HA 2R8EA 4OHOA 4NJOA 5KQGA 5EJ8A 1Y34E 4B45A 5TXGA 1GR0A 1RACA 2G9QA 5K2OA 2OD7A 2NU6A 1AGYA 3V42A 4DNQA 1CUUA 4C4RA 5MDHA 1UBRS 4EGQA 2P68A 1RWOA 3AHGA 3CUYA 1QVRA 3J81k 2YFKA 1J2UA 1Z25A 4LJ4A 2N0SA 4H17A 1EM8B 1Y4SA 2A0WA 3HYTA 1V2HE 1XQVA 4N3AA 5DN9A 5KTPA 1CUSA 2XI4A 2ZYRA 4AIIA 1BGWA 3UZUA 1WDMA 3DE7X 1C0EA 3E81A 4GNRA 1ZAYA 4PG7A 4AS3A 3H8WA 4FEGA 1LW7A 1R4AA 5EZ5A 4L02A 2CT8A 2ZJ6A 3FHJA 2O8CB 3IT3A 1QB7A 1UBSB 1RE0A 1X2BA 3EHEA 2QR3A 1Z6QA 3ZWBA 4ZZ0A 3RSSA 4J0DA 5DYIA 3FDZA 3FG9A 3IQFA 1LLFA 3SXUA 4N7RA 3JY6A 2J32A 3VU9B 3QLJA 4AXBA 1D2GA 1L5ZA 4H7DA 3S28A 3QE4A 5IYZA 3SOPA 2G17A 3ZD6A 2WIDA 3SG0A 1RPZA 2XGOA 4E03A 1VJTA 2DUWA 2VZ0A 5F5XA 4JYAB 4HK4A 1N2EA 1KMIY 2K87A 3C3PA 3HYLA 3PJDA 1H05A 2IU3A 2QVGA 2ZJ3A 2WU3A 1JFFB 4Z4FA 1IOWA 4DYHA 4RF5A 2Z9DA 3G68A 4I9FA 1LWNA 4F3NA 3SNKA 1M5TA 4Q39A 2GEJA 3Q4GA 1J1ZA 3IPLA 5G3ZA 3I3SR 1DNPA 3WYFA 1T4MA 4F4JA 1DFGA 5JFGA 2I4RA 2JIRA 2LCIA 2Z9BA 4WA8A 1L5LA 4A2PA 3PXAA 1Z6ZA 4YCDA 1UFOA 3RFXA 4ZYVA 5C4MA 3VH4A 4D8TA 3AP2A 5IEJA 2DHQA 4PS0A 1BROA 3D3WB 1PEYA 2XB4A 3IO3A 3LBAA 3LLMA 4A6DA 4CM7A 4KPYA 1NWCA 2O8BB 1PJQA 3LA8A 4QZVA 3WC4A 4GOOD 4Q3OA 3WGHA 3NKFA 3ZDXB 3H13A 1WNFA 1D5CA 1DE0A 2Q1UA 2IYPA 4KV9A 3I3OA 2HKIA 3I09A 4NOLA 3C6QA 3F71A 2C59A 2D74A 2CVPA 4FI3F 3SE0A 3MZ0A 2G8NA 2Q5IA 2WG2A 1HF3A 4KQJA 3U9SA 1G4AE 4EUKA 4M0LA 1FP2A 2XMPA 3VPHA 1OXKB 3M89A 1C41A 3TTWA 1XEAA 2REXB 3AM1A 1N2JA 3GV0A 3TX2A 1XP8A 5C8VA 1PO7A 2LCFA 7AT1A 5JI2E 1RKXA 5HUQA 3PXDA 4N3CA 5CW1A 3S68A 4F72A 4RCZA 4O1HA 4OUDB 1PTJC 1ZOSA 5JNVA 4WXYB 5T7BA 3B9BA 3IBFA 4OATA 1ML4A 2LUOA 1FTWA 1A71A 3ZK9A 2IU4A 4UM5A 1F12A 1KTVA 4GRDA 2Q1WA 1MO6A 4U9HS 2VK2A 4H7PA 3HJUA 3DEFA 1TUBB 5J43A 1N2HA 1KI3A 2F9FA 1L7MA 2FVXA 2JL1A 3CRNA 1HE1C 1DXYA 5CURA 3A32A 3MJHA 3GNLA 2ZRNA 1E69A 4QU9A 3TEFA 1CB7A 3ZWQA 2WNSA 3PVCA 1Q0LA 1EINA 4K88A 4X20B 3WL5A 4ZI7B 1MOQA 4HNVA 2HDOA 3ZXSA 2ODNA 3GJRA 5DTJA 4KWIA 5JCJA 1WW3A 1XXHA 1YOBA 1FIUA 1XKLA 1RNLA 2R3SA 4PPGA 1QCZA 3I92A 1XWFA 5LOVF 3D7RA 3PFWO 4GL4A 1CLUA 3FFXA 4OHYA 1PL7A 3NM5A 1H69A 2FQWA 5EMLA 3ZV7A 2GVDC 4IG4A 4OXNA 1UIMA 1AX9A 4V0MA 4CG1A 2UZ4A 1M75A 1ZGGA 2AFHA 2LPMA 2WF5A 3HXKA 3QJ5A 3RTBA 4ECEA 2FUNB 3VX3A 2DQKA 3OI7A 2BVNA 3N0TA 3N39C 2VAWA 1SXPA 3OZVA 1CK4A 2YY6A 1V8DA 2WTBA 4M4SA 4X54A 1AUPA 1D1PA 1Z4LA 3H05A 1TVKA 3L7NA 4Y3UA 3V9AA 2ZJ0A 3EDOA 3O8OA 3T6KA 1XVUA 2G9ZA 3DV2A 4QTXA 1AT1A 4YCAA 4X94A 1NYLA 1GIAA 1E3LA 1Q0HA 3JARB 1ULBA 3LX5A 4Q3KA 5BOSA 3LF1A 2PX6A 4FU0A 3IDSA 4KK3A 2ZJAA 1E4EB 3CNEA 2NO9A 1KKUA 5I3ZA 4LYGA 2V7GA 4Q4CA 1Z8HA 4AWBA 2R62A 4K3UA 4FFVA 2RB4A 1CXZA 1UM8A 1N4AA 2ZRDA 4A92A 2VH1A 2C58A 3M2PA 3GWGA 3OE7A 4QT4A 5IXSA 3GMTA 1C4XA 5BVHB 4L9SA 2FZVA 4YJ2A 3WIDA 4F2PA 1SKUA 4JWKA 3ZW9A 4XLTA 1R8XA 5KTTA 1QLWA 5K3BA 2C9OA 4BMVA 1LZLA 3GPDG 1NX6A 1PJBA 1Z22A 2GETA 1O8CA 5CR9A 4D97A 4L8YA 4DM3A 1ZNYA 1PQUA 2DWCA 2CLEB 2J6CA 4YRQA 1KDVA 1R9JA 4AF8A 2FN4A 4QLOA 1I7QB 1KNQA 2WAMA 1V45E 3CUSA 2WF9A 1KKLA 1QRAA 2R1UA 1F4VA 2ID4A 3P9NA 1Q0RA 5FBRB 3GLGB 1JEYA 1FNNA 2CVHA 1YBHA 2FP4A 1QO7A 2GD0A 4ZZIA 3BSYA 4KXMA 1SVNA 5B7QA 5HX7A 4MGKR 3ZXXA 4OBEA 1O08A 4JBWA 2ZIEA 3JU3A 4IFBA 5CNMA 2BKEA 3N7AA 3VR6A 2OZLB 1BOFA 4GSYA 4FYKA 1JEJA 2I3DA 3KDPA 1E2HA 3S8YA 3SYRA 2G5TA 2VVTA 4YPFA 1JBEA 2HZBA 4E2XA 4CM8A 5JEDA 3H1EA 1MQ9A 3EQZA 3MQFA 3D7MA 5T4FA 4BNUA 4PSUA 1MJGM 3NALA 4BLUA 3UGJA 2ABWA 4PG5A 3NHRA 2I6GA 4ZREA 4J29A 1NU8A 1CEQA 1NOJA 5FTWA 2VEOA 4EMTA 2VDMB 3C3EA 2DHDA 3GJ0A 4JNKA 3BMQA 3PDJA 1IU9A 1MJGA 2C9CA 5CCBA 2BGTA 2P5YA 1IEVA 2G82A 2R4TA 3CSDA 4XR9A 3KLNA 3KQKA 1MEEA 3DE2X 2SKCA 2D0IA 4LRQA 1TLFA 4IIFA 1NJFA 2GEKA 4GHWA 1I3MA 2YC2C 1I5RA 4IDCA 4OBXA 5KNBD 2VT3A 1VCHA 3JWEA 1KK1A 5KU7A 1C3VA 3ENVA 1PG2A 5JD6A 4RKRA 4BO4A 2ZAOA 3QOYA 4UUMA 1OFGA 3LRXA 4NCKA 2OO7A 4UFPA 4FFPA 5LD2B 2X76A 4OXRA 1XTBA 1H4TA 1WUIS 2IYXA 1C0KA 1VI5A 4WLOA 4YO7A 5BVGB 3VH3A 1G8YA 2R4UA 3H8VA 1VOTA 3M6LA 4HEA1 5ETJA 1SUWA 1QF6A 4TM7A 4OHRA 4R16A 1T36A 3WGQA 3PL1A 2OFPA 2F8MA 4O3FA 4N5LA 1C2YA 1ZO8A 4EF6A 4X6XA 2TRSB 5LP6B 4JVOA 5DX1A 4ERNA 2EARA 2NUBA 4DA6A 1H6DA 3TQFA 4FOLA 3MT9A 4DCJA 1XTJA 1NW6A 1ECCA 4FHEA 4G24A 3VI4B 4PYRA 2RHLA 4FCWA 4GQBA 1IBLB 3U4MA 2P9JA 4TROA 2GFHA 3IEXA 5DV9A 2IV2X 4G5SA 2J0VA 2GM4A 1KRWA 3X1KA 5KJFA 3VBEA 7ADHA 4Q34A 1ZNZA 2V03A 3ZU4A 3CH7A 5KX5A 1Y8CA 5EJIA 3CVVA 3CG4A 4IRUB 2OM6A 3GJ7A 1NDUA 5I9NA 3MJRA 3R41A 5K3DA 4Y2SA 1XSEA 4I1YA 4TLEA 5H9VA 4LBZA 1N1MA 4RK6A 3EFHA 4NYJR 4O8CA 1ULUA 1R0SA 2YZNA 5EHIA 1IY0A 4L3OA 1FRQA 1LSJA 3PC8A 5GJVC 1IXZA 4UEWA 2IU0A 3SM3A 5DNVA 4DLRA 1NLMA 2LVBA 3AI3A 2X8BA 2PT7A 4HEHA 3GU3A 4N7BA 1JQ3A 4UNRA 3AKCA 4UTVA 3U49A 3VR2D 1ZPDA 2UKDA 2I6FA 4P4UA 3DAYA 5IS2A 1QFZA 2BC9A 4XX0B 4LHEA 2R8ZA 5LIPA 2FG7C 1BN7A 3W3AA 1X2EA 4KGXA 4M1YA 2NVWA 4URHA 4ID9A 2VHTA 4AZVA 4F3KA 5JJIA 3KPVA 4HNSA 2VF2A 4LQCA 3MB8A 3N6XA 1AKRA 4L0MA 5JCOA 5C4GB 3FRIA 3TYXA 3B1FA 3QENA 4L8GA 1BMQA 4NYJQ 3GLUA 3WV4A 3OOEA 1JIUA 1X1SA 4BVKA 4URVR 2EQAA 3K70B 3O83A 1TVCA 5DO9A 3JQGA 3RFVA 3L77A 1GL3A 1DT5A 1BC5A 1GUYA 1EFDN 3CWCA 3GRCA 4MIOA 4A0FA 5I7EA 3ADKA 2VXYA 3LPAA 2FQ1A 5B57C 1JHMA 3EF0A 3NBFA 3WGYA 3OE5A 3UWOA 3CGWA 1FXSA 3B6KA 3KXDA 4FW8A 5K99A 4H27A 4EB8A 4PICA 4KR3A 1SXIA 5G4KA 3QTTA 5EWLB 1LPSA 3H2SA 4MMYB 5HRAA 4ESEA 3OZCA 3M4NA 2VFAA 4PG8A 2IP4A 1W2HA 4UM7A 1AY0A 1GHTA 4GZMA 4PZAA 2J0SA 1G2IA 3BHMA 1TC1A 4ZVMA 3AHFA 5JJKA 1M34A 1B14A 2YV5A 1UKVY 3L18A 3VYTB 3BQ9A 3ZDQA 3OM0A 1WD7A 4ARAA 4HO1X 1R0YA 1SBIA 3SIXA 8GPBA 4OQEA 4Z0NA 5KJEA 4QYMA 5L4SA 2Y1FA 2HCRA 1RE1A 5KHOC 4ZN6A 2DQ4A 3F4BA 4DMFA 3LFTA 2MSDB 2ZSEA 3T3GA 4YX9A 3H5LA 3ZDDA 4QOEA 4LZPA 1TK9A 3WQHA 1IPEA 2NSJA 4TTVA 1QYRA 4WHMA 1A88A 2BFCA 2FY8A 1K3UB 1SPXA 5IYZF 1KO7A 5T8KC 2IITA 3M6UA 1JHDA 3OTHA 3OWOA 1J39A 1WP4A 5UKDA 3TKAA 3V4PB 5G2OA 1BHJA 2VR1A 3HVIA 1WQ4A 2PL1A 2W5UA 1GPJA 3BXGA 4IVRA 4TQUS 2H4YA 1G17A 1HEIA 1SM4A 4YTEA 5E4TA 5TQJA 1DT3A 1XEWY 1GLGA 1U1FA 1XPJA 2FZGA 2IOQA 2IYVA 3K09C 4WLEA 3WMXA 4DAOA 4NZMA 3ET5A 3GHYA 4NBLA 3RVOA 3L07A 1O54A 4DIOA 1ZK2A 5U4XA 3CNQS 4IYJA 1SU8A 2YZMA 1G59A 1GPMA 1G6KA 4N03A 3N9IA 2YJZA 2HRZA 4N48A 2P5UA 3DEAA 4YQYA 1ZJ4A 2XE7A 3HCFA 3KDAA 4MLPA 1OBVA 1WXHA 2QY6A 4C4ZA 3DR3A 2P6PA 4HZUB 4P7GA 3ORRA 4Y30A 2HFKA 4CV3A 3CW2A 2GDJA 1RQRA 3QTLA 1A5AB 4IDQA 1TTPB 421PA 1COWA 2ZIXA 1NRIA 4YCLA 4RTNA 1KI6A 1V1MA 2L82A 1EA7A 2W2QA 2J09A 3CIOA 4PIMA 3I8XA 1L9KA 1CT9A 3SPXA 4NCXA 1FYXA 4IHKA 1E0DA 1PT8A 4R8MA 3ZHUA 4AIRA 1N9GA 1T4GA 4ND8B 4Q12A 2PGNA 1ZQ9A 1XEFA 1E2EA 4GUDA 3U16A 3DOCA 3BMXA 3DPSA 2DWOA 1IOVA 2JHPA 4LDJA 2P65A 2A94A 1EFUA 1HDIA 1PK7A 4IEFB 3FWYA 3ROKA 1CG6A 2Y3IA 1R4NA 4MH0R 1OT3A 4D9BA 2GCEA 2V6JA 4ZCRA 1OV6A 4MPPA 2JIPA 3AO0B 4YJFB 1JR3A 1WG8A 1JIQA 4KVAA 1VE6A 2WA1A 3R6TA 1DMSA 3DVAB 4BMXA 4HH4A 5U1PA 3SHVA 1M8PA 2BEUA 3D3KA 5COQA 1WVGA 2H4WA 4IJVA 3NCTA 2JD1A 2I2XB 1N78A 1U0RA 2ZPUA 3R7BA 4XVCA 4RWEA 5CH5A 3Q8XB 1SMKA 3AF5A 1KYVA 1SHZA 1BWPA 3TK1A 4YPVA 5JH7B 3TW6A 2C61A 3DMFA 5B7NA 3COVA 2CJPA 4PGFA 4FYHA 1NQXA 1DVRA 1GSAA 1FXWF 3DKRA 2ZIZA 3PE3A 1S2LA 1KVQA 1PJ2A 2G0TA 2PNFA 3Q88A 2MSKA 3TGPA 3FCUB 3PUYA 3U3RA 1L5NA 4N4AA 4NTZA 2XGJA 2JIOA 3IP9A 1ZGJA 4RZUA 1VE5A 3IKLA 3OQ1A 2PRSA 4QDJA 3G5UA 3AV3A 2MCFA 1LTKA 2Q50A 3BJRA 3EUAA 3ABZA 3FHOA 2WTUA 1D2NA 3H65A 1OYYA 3E4CA 4OEHA 5HIMA 3WYBA 1KEZA 2JIMA 2QTVB 1P6XA 4ZAFA 4CVNA 4YLEA 2Q7OE 7YASA 2FFQA 2FPIA 3VHXB 3D6VA 2J08A 4BEVA 1P17A 4OFBA 4L3WA 1ZI9A 4MWOA 3NHMA 2HRBA 2GYVA 4UDYX 4D80A 4PZPA 2ERXA 1VBKA 4YECA 5D3MA 2AX4A 2ZM6B 2RAFA 4RY8A 3WXBA 2B8JA 4NQZA 4RTOA 2OCGA 1NW7A 5EJ2A 3EEBA 4WNAB 1MFPA 4XGRA 4KGZA 3EPPA 2Q5LA 2KBFA 3HUUA 4BC0A 5JQWA 4P0TA 1V9CA 1TO1E 1I36A 5BW8A 3VH2A 2C95A 1OZ0A 5H70A 3RVDA 3BWCA 3CLUC 1CS0B 3KXLA 4AY3A 4G86A 1HO3A 4FC6A 1ZMTA 1H8HD 1CJVC 3A11A 1JQ5A 1BFKA 3UQYS 2L17A 3V4ZA 2H54A 3DVSX 4KC0A 3P9KA 5EZYB 3RVNA 4NONA 3R0IA 1QE5A 3M2TA 4EGJA 1ND5A 3K0AB 4XD7D 4IQ4A 1KBZA 2V9CA 5TC4A 5KHLB 1QGAA 1T1IA 4YJ2F 2IK8A 2YQ4A 1ND6A 3WLEA 1XLTC 1C2TA 1GGMA 1XFDA 4RESA 4PPYA 5GINE 3C14C 2ORWA 4YRJA 2JFZA 2Z4RA 3DTVA 1FYDA 2B2XA 1W85A 3DF7A 3OZWA 3QX3A 4Z4HA 2X5NA 1OYVA 3MINB 2R6HA 3SQLA 1Z06A 1I10A 3JWPA 2ERYA 2G77B 1GO2A 5EGNA 3U4GA 5CD1A 4HH0A 2UXDB 1R4MB 1UMBA 1NI4A 2Y1CA 3U4QA 3GH1A 2P41A 3A26A 4OREX 4R81A 3W1EA 2V0CA 3TLZA 1BCRB 4HLQB 2JLBA 3SIPA 1PJLA 1GV1A 1HTTA 1ZP6A 2D0DA 2QMOA 3U81A 5IAKA 4DLLA 3ZUGA 1V95A 2Z0MA 3OLYA 4FYMA 4KIWA 1H23A 1K75A 3R7SA 4GMXA 5HW0A 1CQIB 2X1LA 4R0VA 4JENA 3RC3A 5ESRA 1O95C 1CR2A 1G9SA 2ET6A 2IEYA 2O3TA 3HCEA 3TQSA 1GRQA 3ZX4A 4F4DA 4BX0A 1P73A 3JS5A 2PKYX 3RH0A 4XWWA 1C0IA 3P94A 1ZCJA 3D0KA 1ZC4A 4UNNA 5TY0A 3VNQA 3ROGA 1ABBA 2P2ZA 1CJCA 1RAGA 4RM2A 3EXAA 3KKEA 5I7FA 3P20A 3NOXA 1RS0A 2BZ1A 1M2EA 4ETIA 2B8WA 4LWQA 1WUHS 4Q4JA 4EUNA 2BEWA 5CD9A 1TRKA 1GPAA 1QDLB 2FWIA 2IOFK 3IR7A 3AP3A 5ISMA 3L7AA 3EFBA 3W2HA 4L4YA 1XTRA 5J4HA 2CFRA 2HMAA 1LBSA 1YA6A 2O2EA 3RVBA 3WGOA 1Q1EA 3DNMA 3PYLA 2BP7B 3ND8A 5TF4A 2HHHB 3GDWA 3X1YA 3D1LA 3L7CA 2WJVA 5DSTA 2BZGA 2GD2A 1MLDA 3KQLA 4XX1A 2QRVB 1MGPA 1KI8A 1T9DA 2DBVO 3DOHA 3ECCA 3R77A 3W77A 2MSWA 3KOOA 2GK4A 3TSCA 2PO7A 5EKSA 2EBWA 5DP1A 5BY2A 1JJ7A 3FFAA 5K01A 1E8MA 3KJFA 2KB0A 3AVOA 4HDNB 4UVHA 3NM6B 4KTVE 4S24A 1IPFA 1T5DX 3E2IA 1OGYA 3FCEA 3WZMA 2BKUA 4OMDA 2XODA 1ZEJA 3PNQA 5K0ZA 2Y0DA 2IUYA 4A5OA 1LPNA 3SHQA 3EBLA 1T4DA 1PJSA 3K0FB 1HT0A 4BV2A 2Q3HA 4HB4A 2EIHA 1C7IA 3D8NA 5FBHA 5CNKA 1YQTA 4A8PA 2ZJ7A 2FSPA 2OK7A 5TPZD 4DUGD 3ELBA 4LXQA 4GBGA 1KZGB 4WMLA 2CD9A 1GPYA 4EMBA 1UJNA 1I5OA 5KVQA 3TMKA 2VTVA 3D4IA 4CTJA 2FH5B 3SVZA 5KX5F 4N40A 1T13A 5DISB 1D1QA 3SI7A 3BKXA 4HMOA 4MYHA 4XB6B 3PJEA 4IIVA 3WIBA 5ADHA 4DLSA 2DWPA 2XD4A 3DL0A 1CBUA 1CUBA 1HMYA 1NSFA 3O4RA 3KETA 2VTEA 3MNFA 5LB2A 3GQBB 3DL2A 1NPYA 1W4RA 5FR1A 4AMGA 1OAOC 4HNGA 3RUEA 1G2QA 3KPJA 3UJ6A 4IS3A 4QX6A 4MRSA 1WCIA 3DH0A 4PWYA 3VZQA 2O1WA 3AVQA 3TI7A 1YR9A 1CUDA 3FF4A 2DE0X 2ZXFA 1TI7A 4CDRA 4KLAA 4X1IA 1MHTA 2OHOA 3T1HB 2O23A 3I8SA 2HPAA 1T6XA 4FFWA 5GGYA 3VSDA 2DHRA 2A9FA 2H3EA 4JQCA 5DHQA 5FOXA 3EGOA 1NRXA 3QKWA 1O95A 3AWDA 3DGEC 1CVIA 4AUKA 4EFNA 5BR8B 10MHA 4WASA 1A5BB 4KPUB 1W47A 2NWQA 3VBCA 1EJ6A 3ACCA 2NU7B 2AEJA 1Q14A 2F48A 3GDHA 4JEUA 5SV2A 3WYCA 4PTLA 3D4NA 1MJ5A 1KMMA 4LZNA 1L5GB 3MCTA 3KK0A 4NFHA 1OFIA 4V38A 4UU8A 1VPTA 5DEOA 4PCUA 2E2WA 3SEFA 1VYVA 5ESWA 2H1OA 2VWPA 1M0SA 1N2IA 4PS1A 4EY4A 1GQQA 2ECPA 2JGNA 3UMCA 3WYAA 1RWBA 1VLLA 1AZTA 2QN3A 4BNXA 2FJUA 3EX7C 4CT4B 2A9KA 1MAAA 2WJHA 2QP9X 4Y9UA 4DXHA 3AOEA 4MROA 4WVLA 3NG1A 4MW2A 4QIHA 4RGBA 3FHLA 1NQVA 4RTLA 1OJLA 1Y42X 1KK3A 1ZJZA 3B89A 4O2BF 1HG1A 3CX7A 5AXBA 3B36A 3KPWA 4KH1A 2IZOA 3VNUA 3L9WA 3WG9A 2XJ9A 2Y1LA 2YYSA 2G9NA 3PE6A 3BB3A 3VZPA 1CR6A 3EVTA 4Q7KA 5DLEA 1HXHA 1NW5A 2XUKA 1Z16A 4F9GA 4AN4A 2I91A 4PANA 3CMMA 3A1EA 4MV1A 5EE1A 3OZGA 2FK8A 4AMZA 1ZMOA 1AKEA 1U9IA 3KD3A 4U2BA 3RU2A 3VR3D 5LZ8A 4ABYA 2ZFUA 3ANSA 1G63A 1IHYA 1XHEA 4YK7A 5I8WA 2P9HA 1U8UA 1C8VB 1G8SA 2PLNA 3M49A 4G23A 3JQAA 4UTZA 4FXPA 4DQLA 1IN1A 2DLNA 5CFOA 2FWNA 3AW8A 4DCNA 3L1HA 6CHYA 2NV0A 1X8KA 1BU8A 5F4ZA 1SOAA 3PCRB 4HQNA 3MJFA 2XTJA 3KYDB 4TL9A 2RK4A 5TVGA 4X92A 2IL1A 3HADA 2X9NA 4RJIA 2TMYA 4QQKA 1YUMA 3BWDD 1SBZA 5F76A 4URZR 4DRXA 5IWAB 4HSGA 3PX7A 3HXTA 2JD2A 1B42A 4YR9A 5KNCH 3NJ4A 1UBEA 4K7JA 4JYPA 4OYYA 1HORA 2IUFA 4G67A 1K63A 1SCAA 1ZGBA 2RSLA 4J8PA 3I2JA 4LSMA 5JADA 3U4IA 1JLSA 1L5YA 4MVXA 1NASA 4AJ9A 1YBAA 1VKOA 2ZSFA 2CYBA 1IZZA 1TLTA 3AESB 3FPSA 3IL2A 1HDXA 4FWTA 3GFPA 1OI3A 5JXHA 5DM2A 4EP1A 4HNHA 3VTKA 1OAOA 2Y1KA 2YR0A 1RM0A 2JGFA 3EODA 1KARA 1W0CA 2PS9A 2H4ZA 2RBEA 4OO3A 3ZGYA 5A5VA 1DTWA 2ZUCA 5E38A 2NO6A 4PQFA 3PL5A 3TBKA 1U28A 3ZD9A 4ZT4A 3KC2A 1XXHE 2R7AA 4E5VA 2WILA 2WHEA 1VE3A 4HLNA 2W2MA 1AM4D 2QX9A 2ZULA 5FTJA 3LLUA 1F1BA 1EZ1A 4V0ME 1OI7A 2G1AA 1S5PA 4FBGA 2AFHE 2HCFA 3UHJA 4ZU6X 2I6TA 4NLLA 1MV5A 3FXAA 4MHSA 3H2HA 4O6VA 1U7ZA 5E3IA 4BLQA 3UG7A 4PQRA 2WTXA 3PT5A 5BSHA 2ZI3A 2IX9A 1PR2A 2EJUA 2WD9A 2HA7A 5KU1A 4G25A 4DB2A 2JI8A 4EY8A 4F5ZA 1FDTA 1ZUNB 4ESVA 3GZNB 2H63A 2NW6A 3EXHB 3KQSA 1YR2A 3NBMA 4URXR 3UANA 2B83A 3RJMA 1TCBA 3TFOA 3P97A 4UASA 4HQFA 4NG5A 3ROTA 2X77A 2V9PA 2GBCA 2IVFA 3EGDA 1VSVA 2EZ4A 3UMVA 2GJKA 4PCAA 1T8YA 1AS2A 1ZIOA 1NXXA 2ZGVA 3GT4A 3MS2A 1E3TA 2O0LA 2IP1A 5EA2A 4EEXA 2Q6KA 5BSGA 4MMXB 4LGCA 1U0JA 2B7BA 2HRDA 3Q87B 3WVNA 2GKGA 1GGHA 4KQ1A 3R7FA 3CU5A 3RYFA 6PFKA 1FU7A 4LVCA 1KDZA 5CB6A 2V4UA 4J16C 1JP7A 2GR9A 2P4QA 3ILYA 5EUMA 3V2GA 2NSHA 2RJOA 3EE6A 3K2EA 4UEJA 4CM9D 5ED0A 3DCYA 2UZ0A 1IN7A 3MBIA 1FW8A 3WS7A 4E22A 4EH1A 4DDKA 1F9AA 3KELA 1IONA 4CLRB 4CT0A 3JSAA 1AV7A 3O2JA 1ZJJA 1KEEB 1QX3A 2NQ2C 3SQMA 1DV2A 5FWNA 3RC8A 4C7MA 2QGZA 6Q21A 1GTG1 3O8LA 4RBNA 5DK4A 2PSDA 3ZXUB 1YS1X 3EPRA 1EUQA 3B3AA 1KJQA 4GRAA 3WDKA 5DBOA 4A6EA 1W9HA 1F60A 1ECLA 4FYWA 5TS3A 3W4KA 2VPYA 4AKEA 3K9GA 2JBAB 2ECQA 4YWJA 1IZ8A 4C2TA 4OLAA 1EFPB 3IBTA 3D3NA 1VLVA 1QC5B 1UBKS 1XZHA 4NVRA 5EXDA 5A5GA 1BMFD 1K6IA 1QRSA 2V7WA 1U3WA 2D5BA 3ESRA 3FNEA 2ANBA 2ZI7A 3DLPX 1BVUA 3DTYA 3UV6A 1DS6A 2FRDA 3R5TA 4XVHA 1XB2A 1MTOA 5IJAA 5KQRA 3VYVA 2OGSA 3PPWA 2I7VA 1DOHA 2YOHA 1B3BA 3IUNA 1KH1A 5FBLB 4DPKA 4LF4B 3OLWA 1TCUA 5A3JA 2EZTA 5BN5A 1IIBA 2WSLA 2GUWA 2IIVA 2E5FA 2XPCA 1EUCB 3GJTA 3NDPA 1OW3B 3ZHVA 4B84A 3SZLA 4YRPA 5H81A 3AZPA 4KUGA 1M2VB 2H31A 2XMQA 2YJ5A 5AJWA 1EK6A 3IJRA 4R9UC 5JSHA 1FYEA 3GY0A 4KWTA 1Q7EA 2VF7A 2ZK7A 3GLRA 2A5DA 5JALA 3R5FA 5CGQB 4FOOA 1MJHA 2P78A 4I6GA 5KTOA 2D3WA 4JA0A 3SEZA 5DNWA 1GITA 4OI2A 5K6AA 3E70C 2X14A 1SO8A 5CFZA 4HNTA 3UOAB 3VZCA 4DADA 4F5YA 1G55A 5DEIA 1M1NB 1VKZA 5F33A 1NX9A 5FOTA 5TGDA 5JPCA 4UPDA 1V25A 4TT8A 2W48A 4LG1A 3N7UA 2BDTA 5EOVA 1U2GC 2IEZA 1B8NA 1H94A 1NJ1A 1GR1A 2C4TA 3NOQA 3OO1A 2IYAA 3OHMA 5EJFA 4JJZA 4B80A 1R5NA 4X62B 1TM7E 1C7RA 1QF7A 4K6KA 4WXHA 4CM5A 4CQMD 1UM9A 4P3KA 8LDHA 3C1AA 3E5MA 5BW4A 1AF4A 1R8QA 3QMVA 4L57A 2TMKA 2R6AA 4V3BA 3CC8A 2V54A 2ASEA 3RLIA 2G04A 2OCYC 1UFRA 3GJ6A 4INZA 1EDEA 1HYBA 1UWLA 5JSQA 5LQMA 3FLBA 3OJ0A 1EWYA 5CX1A 4YXWA 1O9BA 4DC0A 2QVLA 5MN6A 1F48A 3PRKE 4NABA 2C4KA 2WTEA 1EG7A 2GXUA 3WMFA 5EZ6B 2IYOA 1PWZA 3RSCA 5KWEA 1ZOIA 1ZAKA 3R75A 4LWZA 2C2WA 2NTVA 4JK3A 4DV7B 3BIFA 3MVEA 4I1RA 1Z0SA 5H59A 1AB5A 3A9WA 3IQWA 2QAGB 2REQB 5ALTA 5J4LA 2HNAA 1F2TB 3EVBA 2WJPA 1BNCA 3AWIA 3O75A 2OP0A 4J16A 2X8JA 1P60A 1Q5PA 3L7JA 4Y2HA 3SC2B 1FDWA 1Q7RA 2IHBA 1Y7PA 2R8XA 1BS9A 3HA2A 1GUDA 1TT7A 3LWNA 4TQGA 4BNZA 4WUTA 2QUKA 4QJ3A 1TFRA 3A36A 4I3FA 3VR1A 1OCEA 1YB2A 3ZBUA 2ZS9A 4F6CA 3GK3A 2Y93A 4Y6LA 5D5PA 3BGSA 3SCZA 4FNMA 2E3JA 1M83A 1KVSA 2H4XA 4ZYZA 4OOFA 2DXIA 5E1BA 1PNOA 2OHJA 3HKDB 3DHEA 3OZ7A 4F9EA 4RPHA 1XTTA 1SQFA 2PBRA 3QWHA 3I62A 2VCEA 2BH2A 2I4IA 2QG9A 1TQHA 2F3QA 1VIMA 2WWFA 2EOAA 3EEYA 3PQEA 4IJWA 5DM4A 5DTQA 1EVYA 2PBFA 4X41A 3UN1A 3WMRA 4JLJA 4EJSC 5IXYA 4MWDA 5I5EA 1QPGA 3SFZA 3G0OA 2BAGA 2Y66A 3G5AA 3G6KA 4RPLA 5FA8A 2ZP1A 4MJXA 4IIHA 5CVCA 4A4DA 4BECA 1AS3A 4Q7EA 2FUEA 2ZBGA 5BSVA 2EG5A 2Y2VA 121PA 1CE8B 1QG6A 1UOPA 2C1EA 2EF0A 1YJAA 3N53A 2PZFA 5HGJA 1PYOA 3R0QA 5BMOA 4C0AC 1L8XA 4OHXA 3KE9A 5EJAA 4WCFA 2J87A 1C1HA 2FR1A 2F3RA 1ZU4A 3EXG1 3K5WA 3M6XA 4II3A 1T9ZA 4M1OA 4FT2A 4M98A 4RK7A 2C8KA 3OURA 5A9SA 3OZFA 1T8WA 1RLMA 4MKXA 2BEVA 3TH5A 3GH3A 1A9XB 3AFMA 2WLSA 1M34E 1PG0A 3CLSD 2CW5A 3QU5A 1J00A 4CIWA 2YIDA 3KEGA 4WKCA 4LDZA 4PZYA 5GVSA 1AA9A 4EVSA 1F0YA 4U2KA 5FORA 1GPWB 3C3WA 1DC5A 5HCUA 1DWPA 1S2OA 1ZH0A 4M6WA 4TSRA 3LLVA 2B4AA 1PD0A 4JI5B 5EJEA 3SQDA 1PUJA 3AB8A 3ACDA 3IPYA 3D1VA 1M3SA 4BJHB 2I2WA 1K2VN 2ZT6A 1B15A 1C7EA 2ZWPA 1NQAO 5ICMA 4XWKA 4M37A 3PNMA 3HKBB 2QVZX 4I3HA 2ZBFA 2ZJOA 1DQNA 1ZD1A 2IYSA 3EB9A 5F7OA 2QLLA 3WLLA 2R5WA 2JLQA 2POQX 3GGDA 4NMHA 3WJ2A 1A9SA 2WE7A 1G1MA 5GMOA 4EQ6A 5KSWB 2H65A 3P9RA 3RUCA 2YJNA 4XIGS 2V6GA 2C20A 1Z0FA 2I34A 2ZXEA 1MT3A 4UBMA 2ZR9A 3A7DA 3E5NA 2FPRA 4QG3A 3CWQA 4KUEA 2OPHA 3RVKA 3ONWA 4MAFA 3AJ8A 4NESA 4HT3B 3WSWA 2O8NA 3WKCA 4E5SA 2RHHA 3JD3A 4QG7A 5EJGA 1RLIA 2DECA 5A2GA 2EJWA 2R751 3SDBA 2PH7A 4G84A 3AEUB 9LDTA 5H4GA 1SCUB 3A9TA 3ZJYA 4AG3A 4CMAA 1Y5RA 4FYXA 3VUFA 2CLIB 2X2EA 4MNTA 1SIUA 3P0HA 2O7SA 2XT6A 4MQ5A 2ZT8A 3KQWA 4RXMA 3TRKA 4EA8A 1I1HA 5LWHA 4LRTB 3VJKA 2D7DA 5C7YA 5HNKA 3I01A 3PC2A 4EAQA 2JGDA 3A1UA 5BRJA 1THMA 4EA7A 3E53A 3D0RA 5ECDA 4DSUA 5I7OA 1VJGA 5LQRA 1ZR4A 1GTL1 4BDSA 3KQPA 3A6JA 1UC4B 5G0UA 2WM9B 4XGNA 3DF9A 4QPNA 1GPNA 5HF9A 4EJSA 3LDHA 1N7GA 3CZCA 3GVIA 3VTAA 2B34A 1JR3E 2JCSA 3ZH2A 4F91B 1FL9A 3EEQA 2QOEA 4LRSB 4P3PA 4ZC8A 4F97A 4D5EA 3KSRA 3R76A 5JVDA 2IH5A 3U5ZB 5A02A 1NF3A 1U2QA 4XDHA 4RW0A 1ENPA 4GKBA 5I9LA 3M9XA 2PBLA 5GIOE 2GTPA 5JWHA 4D9HA 1I3NA 3A1VA 2N47A 1GL7A 1LI5A 1X8JA 4BXOA 2J6BA 5JPIA 2JCGA 1PQYA 5LZ2A 3E0QA 3AHCA 4P9NA 1N6RA 3E7WA 1MX3A 1XCJA 1W96A 2PAAA 4NXNB 3HFSA 3KBBA 2HIHA 3ANMA 3FPFA 3AUJB 3GP5A 4JBYA 4C20A 4JX8A 4JMPA 3LGAA 2FZEA 2IUUA 3UF0A 3P9CA 3T12A 1RYYA 2C77A 2Z5LA 1QXSA 3BIOA 4UHHA 2Q9AA 1N2SA 1YIAA 4Q3CA 4I4IA 4QPZA 5EXXA 2JNWA 4TYYA 1EDBA 3FTPA 3I0MA 3R5SA 3DBLA 4FYIA 2ZYHA 4C0QC 2GEUA 4AY6A 2QSUA 1DLJA 3DV9A 3LI2A 4V0OA 1JNYA 2A1TS 5G3YA 3ENZA 4D8WA 2FMKA 2WYUA 2APJA 5LOVB 2IY9A 3PWSA 2EJTA 3VV2A 3H5OA 1FDRA 4KNYA 5CGZA 4KGDA 5C5IA 1WF6A 5EQTA 4RD1A 5KQLA 3PDIA 1LVGA 3UATA 1JI0A 3O9MA 3V32A 4Z7NB 1MFZA 2H5EA 2J41A 2EDCA 4MDHA 5HZHA 1FJGB 4OB6A 2ZTMA 3P1JA 4TL6A 1W0JD 1NG1A 1YQGA 1U5BB 1Z8FA 3BS4A 3CO0S 3QFHA 5AVUA 4JL5A 1QTRA 3EY9A 2F1IA 3HCCA 1FNBA 5AICA 4HGQA 3ADOA 3C3KA 3H9UA 3TRHA 3WK7A 1F3LA 3HKCA 3NPMA 3SGLA 4IUCS 3AFNA 4NV3A 4R2XA 4S35A 2GCPA 1ESEA 1US8B 2WYWA 3M6FA 4NPCA 3VQTA 3STTA 5TIIA 2JLAA 2KHZA 4NJEA 1BDMA 2QF7A 5KYNA 2JLWA 1K8RA 1M6WA 1C0LA 1XQYA 3I9MA 3NEYA 3QA3E 4X7MA 4MW1A 4U7GA 3WGTA 1WQ3A 3ZYZA 2O2DA 1RWXA 4Y8VA 4BMDA 5J2TA 4YV0A 1UH5A 2YWJA 1L1EA 2QQ5A 2Y6VA 4IDFA 3HPQA 1DWQA 5FBQB 4GL2A 3ZBPA 1VQ1A 4Q9HA 2Z1MA 1S8OA 2REBA 3KV1A 5JMTA 1JDBB 2QRKA 2QZ4A 1E1LA 2VUUA 4G85A 5B55A 5JFOA 1MDBA 3DZ8A 1PBNA 1A7UA 3NIGB 1XJ5A 2HCBA 3P9YA 1HPLA 2I8AA 4JJ6A 2XMGA 4IIDA 3RAEC 4P8RA 1TU0A 1CZNA 3NT5A 2R0QC 1Y48E 1BD3A 2Y8EA 3IIJA 4JYZA 4C7OA 4U0KA 1XZKA 3DG9A 1TJNA 2YIJA 5HRUA 4FKBA 1Z35A 5K3SA 3P0RA 1BEZA 4HB3A 3GYBA 4WY5A 5K20A 1G7RA 5EQJB 3AILA 3CF0A 4I50F 1V4BA 1G21A 1H1LB 2GPYA 3G2NA 4UMVA 3W5IA 3ZWMA 5IWCA 4R3UC 4B44A 5A04A 2CMDA 3TMYA 4BBAA 5JYCA 2LW7A 2HGZA 3ZD7A 4EKYA 1KYIA 3HB5X 3H9CA 5DGHA 5KYKA 3BL8A 3RD5A 3O7MA 3WLPA 2OHXA 4BNDA 3SFVA 3SJUA 4Z3DA 1KSJA 2P6RA 3DXZA 1MR3F 4HAVA 4LZLA 3AV0B 1N2OA 2WUEA 2PKRA 3N6VA 4ILEA 3NC0C 4NDNE 1Q12A 3LL4A 2ZIAA 3SSAA 3V8MA 1IEWA 2E9SA 1WB6A 3V1KA 5FYDA 2OESA 4PO3X 1UBCA 3L4EA 3PS9A 4ENTA 2H00A 1XZPA 5BMVA 1OYWA 2Z09A 3NGMA 1KSGA 3HBFA 1U9ZA 4C06A 3KD2A 3K32A 3U37A 1B6SA 2BCEA 3QNUA 3BQMB 3BGOS 4FP9A 3UJ9A 4RF3A 4F6RB 1YDWA 4K6OA 1E61A 1CUJA 5KVVA 3ORSA 5EERA 2OA0A 2FN3A 5D5HA 3GA7A 1P9OA 4M3NA 4NZNA 3WJ1A 2GPBA 4NY1A 1HNXB 4BHTA 1XTUA 3SQNA 3BXOA 2MJLA 4EY6A 2I71A 4J1SA 3ZWWA 1N6OA 4FUQA 1Z0ZA 2PPVA 4DIFA 5E9AA 4YJHB 1YJ8A 1JAHA 3ILHA 3RFFA 3SOZA 1QZZA 1WDKA 1YDGA 5JISA 1VHJA 3FYUB 3QHPA 4C6HA 3EC1A 3OAAA 2ASVA 2EFHB 2WYOA 4BUZA 2ZAMA 1RYNA 2VF5X 3PBKA 4AZTA 4ZJYA 1RP1A 3K16A 3LOQA 3S2YA 1M67A 2WEKA 1QR6A 4Q03A 1ZOPA 3B5EA 1NIJA 4QXQA 3TJRA 4G9EA 4F9TA 3K6SA 2QR5A 3TLCA 4KQIA 1FX1A 3MJVA 4WJZA 4KE6A 1P44A 5TV2A 3K30A 3VTFA 1F8GA 1WMDA 2AMVA 2VYQA 1TYDE 3IA7A 3TINA 4BV9A 5K8VA 2VDWA 3PI7A 5CB4A 1CQWA 1E3WA 3NBXX 2AOWA 2AE1A 4OM7A 4LKRA 3RK4A 5M2QA 1AN9A 1Y4DE 1U94A 4ON9A 1Z0UA 1KOJA 1YRBA 2QQFA 3EWAA 3WB9A 1CD5A 1EM6A 1P4JA 1VL2A 3BYZA 2GOYA 2HWXA 1BDHA 1L8OA 1JLLA 3H5TA 1NVGA 2WHQA 1JFSA 4RENA 2UAGA 3GC6A 3V8VA 1WBJB 2ZYUX 3ONEA 4ERXA 4YBZA 5HUJA 4K8RB 4AP5A 2XH8A 2VHYA 2QTCA 2W2NA 1Z4JA 3O90A 3SVLA 1HWYA 3P2IA 4XZ3A 5D3QA 2V7QA 1BE1A 1RWMA 3WGLA 4BQFA 3O9VA 1F4LA 1A96A 1ISPA 1KZ9A 2UZ3A 3MJSA 1R64A 4IUYA 4MCJA 3SHWA 4BAUA 4YXFA 5F98A 2GRUA 1AHHA 1L4HA 1PZEA 1U4SA 3FDXA 3E27A 1C50A 3EZXA 4KL8S 4KFRA 4LPKA 4B5KA 5BPHA 3FD8A 3IKTA 4P80A 4N7JA 3PQCA 3QVTA 2FW9A 4OA8A 4DQVA 2JW5A 3AW9A 4QTTB 2HIMA 5JNSA 1P8AA 2JIZA 4MR7B 1QVVA 2E89A 1X9IA 1VDZA 1TJ5A 4R1OA 3SBOA 1DPGA 1OHHA 2MMGA 3RARA 3GFQA 4PNEA 1JJVA 4Z7JA 1L7OA 2O1EA 3EZ2A 3ND6A 2I9PA 4NAHA 3MRSA 1B76A 1RIFA 3IP6A 3Q7RA 3CN9A 4A7PA 4PXYA 2NU6B 4GPTA 5EKXA 3V4FA 3FR7A 5AVTA 3K9HA 2W0SA 2VRBA 4N9WA 5F52A 3CVJA 4FGZA 3PDUA 2VK1A 4JGGA 4LK3A 2BEKA 2H07A 4X71A 5KI6A 3M34A 4MVJG 5BQPA 2W93A 5JARA 3FF1A 1F14A 3B7WA 2HHJA 2W71A 4F4HA 3PKJA 4Q16A 1QPZA 1AA6A 3A4VA 3OOHA 2FMUA 4A8TA 1PV2A 3AI7A 4PZZA 2YH2A 4DLBA 4MRVA 5BUQA 2J48A 4MJ7A 1HDOA 3CZMA 1NBAA 3Q2KA 3UAGA 3U7GA 1ENZA 4IPTA 4TV8F 3DEJA 2PL5A 5FOUA 3RJTA 2XADA 1C81A 3EDQA 1KZ4A 2X4GA 1EWVA 1EX7A 1U0NA 2BLLA 3F4KA 1V7CA 1JA1A 2XMBA 4RZSA 1I6KA 4Y7DA 2P3LA 3IHTA 1GJRA 3R0VA 3FDZB 2PXHA 3SS7X 2AHRA 4DA4A 3B70A 3SXUB 4BLRA 1BTOA 4Y2GA 3BD8A 1VSQA 5BT9A 3VOBA 3BJZA 3D8RA 4HGNA 4C4YA 4YR7A 5IYZB 4RPCA 4CM1A 2BHSA 1VGQA 3U7QA 1NR1A 3S1AA 3A1TA 3UWMA 3TBHA 1MDFA 4Y2YA 3H4IA 5BV2P 1QGZA 4PWZA 1Q1NA 2RCNA 4P93A 4XUCA 3IYLW 4N6OA 1NNEA 5IT4A 1AKMA 4EG8A 1E9VA 1N0IA 1N4DA 1RTKA 2H08A 3H2IA 3WQSB 1ILEA 1HNWB 4GEKA 2BCJQ 3LUAA 2AG1A 5BSUA 1SVMA 2Q6LA 4H1UA 2A0XA 4FDUA 1YBVA 4HH1A 4OAOA 4C3ZA 2IPAB 3C7DB 3A3NA 1QO0A 1II9A 4I66A 1FJXA 4ZAZA 5TDHA 2ZRAA 3CISA 1SBNE 1XWIA 2X22A 5CFLA 4R69A 3IODA 3O82A 4QBHA 2RD2A 3S44A 2X9VA 1NXVA 3IIMA 3QA9A 4LCEA 1WEHA 5KJCA 3VR4D 4UHFA 2Z6AA 1O77A 1QH8A 4WFJA 3QZUA 4BO7A 1AO0A 4S1VA 4LOLA 2QPAA 3ESZA 1W88A 4KH0A 2X40A 1PLKA 1Z4OA 4L95C 4WOKA 2D62A 3S40A 1XJQA 3AR4A 4JFAA 2NG1A 4K87A 1KVUA 1ZA2A 2CYCA 5DTIA 4Q4LA 3RI3A 5AJZA 4YT2A 4YH1A 3OFVA 1KAQA 2F3PA 5REQA 3TQOA 4BZQA 2EJCA 3C3CA 3W4JA 3FTCA 2GJ8A 2RGUA 1JHZA 1Z28A 3IA2A 3NAGA 4GIBA 4IO1A 4L6AA 4PAWA 4ZVOA 2VYNA 3S2IA 1Y8ZA 2DFVA 3UUEA 4QJ5A 1RQLA 1MRZA 1XZNA 2LV8A 3AB3A 4AW9A 5I7RA 5JLJA 3KXKA 4BY9E 2QIPA 2IFTA 4Q47A 3K73O 4NFYA 5IJXA 1OB2A 2ZE6A 3GELA 3K1JA 4J2TA 4HFMA 1PV1A 3CO5A 2WWRA 3KZXA 1D6SA 4O02B 1Z5ZA 3HLYA 3HM2A 2X4DA 1AUVA 4I08A 1JR4A 4X8MA 3RWMB 4B8WA 4PV7A 4ETWA 4W5OA 5PGMA 4TPKA 4EG4A 1PGQA 1ZVKA 4MQLA 2XDAA 5G4LA 3U7EB 1XMPA 3B2QA 2VYVA 2VPTA 2VQ6A 9LDBA 5HJ7A 5I6DA 5KOHA 1VI2A 4H31A 2WSSD 4NAUA 2BGGA 3PP8A 3COYA 2YOGA 4W1RA 1EU1A 2B5VA 4D3SA 1MAHA 3MJ4A 5AVQA 4P2BA 1E1DA 3T9EA 5IVKA 1V6SA 1KJJA 2QKYA 4K1XA 2O7NA 3O3OB 2XT9A 4TUYA 4IMRA 5DHTA 4FK8A 2NZ8A 1QE0A 1XXHB 3RBAA 3C5VA 2OAP1 3HDVA 3O84A 1BE8A 1Q0SA 5KB3A 3WGMA 6REQA 1P80A 3X2SA 1RCFA 1V1RA 1R7RA 3QY9A 2AFHB 2RK3A 4DCMA 2W2KA 3JQ7B 4D3ZA 1A97A 5ERYA 3GOHA 4ACAA 2JHAA 4YDSA 3DL7A 1CDEA 2XYPA 3IMFA 3ME5A 4XEHA 3KU4A 1RPAA 2ACEA 4J0CA 3ZE2B 1TVKB 3GUZA 1MA0A 3O8OB 3WO1A 2FUKA 3ZGVA 3LY7A 3R09A 1F17A 1P7PA 3PEFA 3N8IA 2VP6A 5CJJA 5BOSB 3ZHBA 3TF5A 4MR8A 2B21A 4NSNA 3ECSA 4YRLA 3JD0A 5M5BA 4AZ0A 4R40A 2XUFA 2ZETA 3JRWA 2WPDD 3OCXA 2ODQA 1R4ZA 1WWKA 4E51A 1XD8A 2VJQA 2WDPA 4G5HA 2PWBA 3MFQA 3KJZA 5CK5A 5F12A 1JU9A 1RT9A 4F12A 1IZ9A 3QNWA 4B47A 4AYWA 4EITA 4J0GA 5J2TF 4YAFA 2GHIA 2AFVA 2UZ1A 4YJ2B 2EGGA 3ND9A 1ZK0A 2CE7A 4L78A 3A25A 3AYZB 3X44A 3I42A 1SUSA 2AW5A 2PK3A 4UM9B 3ENNA 1Q2XA 2W90A 1R6BX 2YV3A 3DVQX 3LXXA 1OMOA 4G2NA 4ML3A 2BFWA 4J43A 1VMKA 5KO2A 2BGNA 3TL6A 3HSSA 5KNCD 5B12A 2OY0A 4F1JA 1ZA1A 3WLRA 2AB0A 2C8VA 2QRNA 4DLUA 2A30A 3SFTA 4B40A 1JEYB 4Z0TA 2FP4B 3C1UA 4BNYA 3HU2A 1XZJA 2B69A 4PY2A 1IVSA 1SU4A 2F59A 2QRGA 3M9WA 2VLIA 2Z5VA 1REQA 4JLBA 3RWOA 4K6GA 2ZYSA 3DMGA 2AVDA 4YCNA 3AUUA 5F73A 2JLUA 4RTKA 4LQDA 4BEBA 2Y05A 3RYHA 1T1GA 2RHOA 3HVKA 5CFQA 1PVOA 4KWEA 3GCDA 2XNDD 3MMPA 2BMVA 4CM8B 3DE3X 5CVDA 1S2GA 3TTXA 2RG1A 1S0UA 1JBKA 4PFJA 1E9RA 1VG9B 2Q1YA 5DRYA 3WGZA 4HYEA 1I9CA 1ZN7A 2QQ0A 2NVBA 1KI4A 1SBYA 1C1XA 4I5DA 1NFFA 4MV0A 3KWLA 3SHTA 5CTAA 1OLOA 4EI9A 3DBOB 4AURA 4YHHB 4G97A 1H6AA 5CVVA 1GKKA 4J90A 4OHPA 2NTNA 2PVPA 3B3GA 1U2TA 3BSSA 4K9PA 4LDQA 4O4HA 3BREA 1E4YA 2IODA 2O6HA 2D8MA 2OKGA 1W44A 4LC9A 4KMMA 2D4HA 5GONA 1Z2EA 4D79A 1ZM3A 3QI7A 3RS4A 3TFWA 4Z51A 1EWQA 4KRFA 3E8SA 2R6FA 3PSAA 4CTMA 2W83A 4HPJB 3RAJA 1GCGA 2VL7A 1MB3A 5C37A 3BEDA 4FR5A 3P32A 4RMNA 3D6AA 3FLAA 4Q9NA 1T6BY 2VBIA 3D2BA 2OD2A 3B38A 4RA9A 3WK4A 3UJ3X 4EEZA 4ZOAA 4DR6B 4QAQA 4B6PA 2H6EA 1W8DA 2PX0A 3R3WA 4BBPA 3EG5A 4XRRA 1QQAA 3EDRA 4JH0A 4JR0A 1T36B 1K98A 2HLDA 4U7DA 4P33A 2DY1A 2IOYA 3DB1A 4V0NA 4A6PA 5CH3A 4E1BA 3MM4A 2LXNA 4FE7A 4MQFA 1X38A 1VL1A 3QWBA 1ZBDA 4MZDA 5A0VA 3IAEA 1PJ3A 1S3FA 3HY6A 1D2AA 4LOJA 2VJCA 1J99A 2F6RA 1XN1A 1JXAA 1DKOA 1XDUA 4MVCA 5K6TA 2MSCB 3QLVA 1TPZA 4CCAA 3TECE 3TL2A 1XMSA 3S2EA 2QPOA 4MIEA 4EYSA 4ONEA 2PD4A 3C3BA 1JZQA 4OYHA 4CWAA 1F1JA 3CIFA 1ZZGA 5J58A 4YP6A 5KX5B 1II0A 2P8SA 5D7BA 1LXCA 1DIBA 2WFAA 1XCPA 3Q3IA 4CCWA 1UBLS 5CB4F 3PD1A 4L4SA 3KZOA 4WKGA 3QU2A 1GNQA 3KWMA 1P9LA 2O2CA 3PFHA 5A9TA 4YRMA 1N75A 1RCTE 1NN1A 2A1TR 1X9GA 2HWWA 3NH9A 4RNDB 1H3NA 4TXNA 5JTUA 2HRQA 1HQDA 1QH1A 2D54A 1XPRA 1TZCA 2CV1A 1Y7LA 2D2XA 3WBFA 2NZUG 5BOVA 4BPBA 1X7DA 4KO2S 3CZ5A 1WCYA 4G1CA 4UUNA 5KTMA 5KC8A 5JSYA 1MAWA 2BV3A 4D4MA 4CV1A 4D3XA 2RMKA 2OBLA 3MEQA 1V5WA 2ZYWX 3UM9A 2QN7A 4MKGA 1LX7A 4L16A 5IZCC 1JAYA 3ZWOA 1STOA 2BN4A 3CRZA 1PFUA 2GD6A 4HLCA 4OUKX 4PVCA 5BN3A 3NNSA 4GD3Q 2O7RA 5TB5A 3E9YA 2Z6QA 2WF8A 1YB7A 2DFLA 3PRYA 2C1ZA 1KRXA 2B7CA 1VXOA 2JFWA 1XMIA 2ZIVB 4FT4A 3JQGB 1SOUA 1LDEA 1PS9A 4URUR 2ZR0A 3COWA 3U4CA 2LIVA 1R74A 1X3LA 3O26A 2NT4A 4BCCA 5C2JB 1IUOA 2YBEA 3MW8A 2QQEA 5FNZA 5AVSA 4DPLA 4P98A 3ZS8A 4NE9A 1QU2A 1WXFA 4P35A 3AI1A 1ZXBA 1VLHA 2X5JO 3V7UA 3WIOA 2XAAA 1LCIA 1RRPA 4F2WA 3IB6A 5HOEA 2PKWA 2ZVPX 3EDYA 2CL7X 3BGWA 3C39A 3NJ8A 3QIVA 4KZPA 1W4LA 2BI8A 3T1OA 3WKEA 1YVDA 2SKEA 3T1NA 2DQZA 1EGAA 1M34B 4EB3A 2WQ7A 2C7GA 2OQ2A 2RKBA 4RTPA 3CJTA 3CVWA 3IUJA 3S3TA 5AJUA 3ZGZA 5HFNA 3LRPA 1XI2A 3AFIA 3MCVA 2CGEA 2ID8A 3IXMA 5FI5A 3R7LA 4YDQA 1T5LA 1KAOA 4R8VA 2BLNA 1KRHA 3OCYA 3U1VA 4BO1A 4XWOA 2X86A 1LS6A 1B16A 2NM0A 5H3LA 1ZCBA 1B0PA 3AR8A 3OFJA 4YS6A 4NMXB 3DT9A 3VPXA 5JBQA 4M0MA 1TRHA 2BFCB 2PNJA 4YYEA 2C0CA 5KTYA 5KINB 3IAM1 3ZJUA 3HEMA 3MGAA 2DJ5A 3AFOA 1SD1A 5HHTA 4MHTA 2D8AA 2ZJ4A 4RMGA 3AHDA 2HA0A 8ATCA 3CCFA 5DDIP 2QM0A 5JECA 2EW1A 1U80A 2AOUA 4ZDIA 3VKHA 3IBGA 5FOSA 4UBLA 5GZ6A 4J0QA 4BO6A 4GW3A 4R6XA 1NQOA 3WYNA 1U81A 2UDPA 3NGXA 5IT9A 2DUMA 4KMSA 1NW3A 1I94B 3TVTA 1V96A 3BE6A 4G0PA 3HLKA 4B8YA 1WCXA 3BHNA 3MJDA 1ZK1A 4HYYA 1A8IA 2BGRA 2CXUA 4OHZA 4KMOA 4HQOA 2C5HA 4E15A 3A3OA 3PPYA 1U6JA 3MA0A 2ZIWB 3W6NA 5EIBD 1VSUA 2JHFA 1T9GS 3HJBA 1W6UA 3TCNA 4ZI2A 3DWIA 2HIGA 4LYEA 3VTZA 2ZIXB 4MK4A 4BCDA 1ZLYA 1KI6B 2BMDA 2XUHA 3ZNPA 3BB4A 1OPXA 3OSZA 4MEBA 3RW9A 4TV9F 3OPXA 2B4QA 2I1QA 1LC0A 2EFEB 4R2MA 4GLLA 1TUEA 4A0HA 1N9GB 2OTCA 3RS9A 3WBKA 4EJ0A 2AQIA 3Q5EA 1WZUA 1RQGA 4KBFA 4I4NA 3ZIAA 2Q5EA 3T3IA 5LQDA 4MA5A 4PPNA 2XZLA 1QAMA 4AO8A 1DCFA 4KLZA 2ZWAA 1L1QA 1R4NB 2BI7A 2VP3A 1C7ZA 2IBMA 2VSXA 2Y0EA 4OQ4A 4ZQGA 4G5YA 5H16A 2GWHA 3DLBA 4CM4B 2AXPA 3FNQA 2NV6A 1NBOA 4TRNA 2DLDA 2WYIA 1C8KA 5FFNA 3TCXB 3T0IA 1NLYA 1V3UA 2BEUB 2MYUA 3DE0X 1JEQA 1XZFA 3I1JA 3QWFA 5AKXA 5DP2A 1SIBE 3GCZA 2R68A 2W2LA 4MUIA 3VR5H 2DGDA 1WXIA 1MUUA 4Q3LA 1JH9A 1Z7GA 1A7KA 2DHCA 3FUXA 5LU9A 4MDEA 4L5BA 5M34A 5GM1A 3M70A 1AQLA 3P9IA 4QGSA 5IH3A 4YRNA 2GAOA 3EQ7A 4FDLA 3DMPA 4QDKA 1E5XA 1P61B 2P67A 1CZKA 2NXNA 4L7QA 4PSVA 3BE4A 4RFVA 1Y6ZA 1W5SA 2IZ7A 2J6IA 2AC7A 4Y9DA 4XUDA 3T54A 2HT1A 1P7WA 2A9JA 2SICE 3QVSA 4TUYF 4I8IA 5LZ5A 4D43A 1E0JA 2B3TA 2N3ZA 3BG5A 4M7PA 5AKEA 3W6ZA 4AULA 1HEYA 1YQDA 2R44A 4DDVA 3LFUA 2FPIB 1G6Q1 3CX6A 4I4LA 3GW8A 4YUZA 1LKZA 4LXIA 3WWPA 2WP8J 5AW1A 3U60B 2ZYVX 4NOJA 4EARA 4HRXA 1NY5A 2OBMA 1WKVA 3AEQA 4BBZA 4ER7A 1KERA 1Y1TA 4DYVA 3CNHA 4MGHA 5D3MB 1CLEA 1UBFA 3HLTA 1SPBS 5JC8A 2X6TA 1ZM2A 3A1NA 3LC2O 2WRZA 3QE0A 5AI9A 3QPAA 1GZHB 4M0UA 3C3JA 4D9IA 5M7EA 4LYHA 3H87A 1T2DA 1VG8A 1ZH8A 1J97A 4JEIA 4XH9B 5E2BA 3VC1A 5J5VA 4DJJA 3J7AC 5KAMA 3KHKA 4F5DA 2JRLA 1WZ2A 3IP5A 4CYMA 2GPWA 1XRMA 3DZCA 1YDHA 1WD5A 3KOWA 1TPYA 4JSYA 4KAAA 2Q6IA 1G21E 1QBGA 3H86A 5C32A 3CH6A 4N5IX 4IOKA 4PFQA 4ZPXA 3OCUA 4GWLA 3FETA 4CMEA 4EPWA 3ICQB 4HX2A 5P21A 2V7PA 2WVGA 1ZUD1 4U39A 2ZRBA 3DULA 4I4TA 3GGSA 4UUPA 1T0JB 4V24A 2QTBA 4PFSA 4U6NA 3IE0A 4W1QA 4BGEA 4PX3A 4J6FA 4YCJA 2OBXA 3WV5A 5FJIA 2AF3C 2QG4A 3DR5A 1Z88A 3X1XA 4DZTA 3DTVB 2ZE8A 1T3ZA 5JDCA 1W85B 1BMTA 4C0SA 2B6HA 4UDOA 3K31A 1WLSA 1IAVA 4REMA 4PLZA 1PDVA 2JI6A 4FDMA 4KXUA 1Z12A 1DJNA 4RV9A 5IK2D 5DIFA 2O5CA 1UMBB 4GFDA 1NI4B 3U4QB 1K3TA 1VP3A 4TZ0A 4W9MC 1QAQA 1Y5NA 1FW6A 1DX4A 3N07A 5ULLA 2FSGA 4JC8A 4GF5A 4X63A 1K1EA 3N05A 1U4OA 3VYWA 2PH3A 5BSTA 3G2LA 4EJFA 5KOYA 1Y8QA 2DG2A 4K9MA 5TNXA 16PKA 1A2OA 2PYDA 3D2CA 2PUGA 2HJ9A 3AVVA 3RRMA 2HHLA 3BSFA 1T1SA 3K9QO 5TRTA 4KK4A 1M5UA 5CLFA 3F90A 4I4CA 5H82A 1KGDA 4YMVA 3HA3A 4LBWA 1HTWA 1W29A 1NBEA 3BA1A 1YWGO 4XCXA 4C76A 2GHTA 2QJTA 3WOVA 4DZRA 4R31A 4DCCA 4N3GA 4QT0A 3T52A 3KL2A 1ECJA 4Q4JB 4H1TA 1L5SA 2BEWB 2PA0A 3C7CB 4ENWA 1Y6FA 3PU6A 2O7VA 3R44A 4DE5A 3SVTA 3G9UA 4JXZA 5CA1A 4GRIA 5GONF 3CVYA 1YH3A 2VWGA 2B20A 4M7RA 5DXJA 2JD0A 5AHRA 1OFUA 2QV0A 3DE4X 4HX9A 5FAKA 2PJRA 3REOA 1WU8A 2PRZA 3ITNA 4D6XA 5I4CA 4WTOA 1P5RA 3VNVA 3D54D 4F60A 1O0BA 2V7TA 2J0EA 5D2CA 3U62A 3K0EA 1A9OA 4NICA 1FF9A 5DNCA 4RVOA 2WIBA 4ZMSA 2Q9UA 5F78A 2PX2A 4KRYA 3HBAA 5GJBA 3KP1A 3H5IA 2BGKA 4IDNA 4JHLA 1E2PA 1EX6A 1I7PA 2C84A 2GFQA 1RADA 2RONA 3NZEA 3QQPA 3WOHA 1KSHA 2JDIA 3ESDA 3Q9UA 4NQRA 4ZVUA 3N8HA 2QY9A 3T3HA 5IABA 4B09A 1UMCA 2H59A 3LHFA 3PF8A 4E14A 3VZBA 3ASUA 4NFLA 2HADA 4AY4A 4B7ZA 2CL5A 5C52B 1N9KA 2F2TA 4WOCA 1RXEA 5BUCA 1JFRA 5KSZA 1A8SA 2Z3WA 2EGUA 3K15A 4BVFA 4IIBA 3Q8LA 1FVXA 1E8DA 4K6HA 4YJKA 5AYVA 1PIWA 3B13B 4EW3A 2QG6A 2FOXA 4BFWA 5E1DA 1AMOA 2W6JD 3EPHA 1J70A 4WX2B 4P08A 2XBLA 4FBMA 5A71A 4A91A 1BZYA 2Q29A 3UMBA 4RJKA 3NX4A 1JTFA 4L51A 3SK0A 4PLFA 5AUOB 4EO4A 2D06A 2NZXA 5DM0A 5C31A 4DUYB 3CX3A 2PXAA 1DRJA 3HRHA 4IX9A 3ZPXA 3OX1A 5IHPA 5JI3E 2EGHA 2VNSA 1SKBA 1YUNA 3IESA 4HG2A 2FZKA 1OYOA 2UUPA 1WCIB 4DMHA 4KQ2A 4MHOA 2QL5A 4X1IB 3N75A 4OCZA 4LQ4A 4C7XA 4P5DA 5HKAA 1Q3HA 3HYCA 4PZCA 4Z49A 4WN9A 3WGGA 3M4YA 5A6SB 2A57A 2GQ0A 2FWPA 3HJGA 3V7FA 1OLXA 4L76A 3D8UA 4L4UA 3ZG6A 2FGKA 2FLWA 2VDVE 4AJ4A 2HYIC 5F64A 4NZ9A 5KTNA 4LPSA 3BE8A 2E4AA 1IQUA 3LKVA 5JJCA 4EG5A 4QYWA 2J3EA 1I32A 2BDEA 2QS9A 1GN9A 4NARA 3T7AA 2GXQA 1W4CA 2PKEA 1KMHA 4BVGA 2C29D 3N6RA 3G89A 4OGWA 2W2TA 1NPDA 2BHLA 2NSLA 2RDMA 2ZVQX 3EZ6A 2RGNA 2YXLA 4DQUA 2R79A 4P34A 4PC3A 1YJXA 4REQA 4PSCA 3BT7A 3THWA 5DRTA 3GEBA 3ANYB 3LZDA 1Y81A 4HWRA 4LV5B 4CF3A 3IDOA 4LS3A 4GE0A 3HNOA 1IRIA 2ZVJA 5DPMA 3DZDA 5A5DA 3EISA 3HA7A 1IH8A 1ZCFA 2JEOA 3T1YB 4IZOA 2ADFA 1RBMA 2C4VA 2ZYIA 4BKPA 3PQ2A 2AFIA 5ALSA 3UWSA 4YPOA 5LA6A 4OHVA 6LDHA 1YRAA 2QTZA 3G9TA 2P75A 4DLVA 3HDGA 3IDAA 2SCUA 3LO8A 3LQ2A 4L15A 4N5NA 4NCJA 2Y1XA 2YXNA 3CPHA 2VPQA 3L0YA 1JG2A 4TXLA 3JQAB 4U2GA 4WIAA 3S55A 3UOWA 3WRXC 2FTKE 1AKWA 2C7VA 4M9SA 1AIPA 5DOVA 4ZDWA 4EUFA 2HREA 3X1ZA 4CV2A 4Y2JA 2AL7A 2YVUA 1NNSA 1WF3A 3C6KA 3HA5A 2RHTA 4B17A 1EXVA 4GI5A 1L7NA 2WMDA 3RV3A 2IS2A 2A5LA 4IM7A 1SWVA 3B8HA 2NAPA 1R6DA 2EU8A 3L0BA 3WMGA 4EPTA 2QV7A 4UAJA 4PEVA 4DRXB 1BXKA 4Q9DA 4MW5A 4ZA2A 2E4WA 1LW6E 2QTNA 3H83A 3L92A 4IY1A 3GFBA 4DLTA 3FVVA 3A2MA 3MS4A 1EUZA 1VL8A 4ADSG 2ZIGA 1GCIA 3AR5A 4UNSA 5ALRA 3A9CA 2LKCA 4DBVO 1V7QA 3FCYA 4E1AA 1M8JA 2FPUA 1L4GA 1IE3A 3MCZA 4J0EA 3FR8A 1BHQ1 1I7LA 3OVMA 3IPXA 3E9MA 4KV7A 4NEQA 1E94E 3ITEA 5DTEA 3WLSA 4X7RA 5JY1A 1YS4A 3GR6A 1SZCA 1LF0A 4UMFA 3D6NB 5AHXA 4EUHA 1DTWB 5DGDA 4ZOLA 1CR4A 1TMKA 2VNJA 4XUGB 4BKRA 3UB4A 2INGX 2YV4A 3IBCA 4LJAA 3PXXA 2ZITA 3JATA 1ISMA 1C4OA 3H2BA 3NATA 4GPD1 4IIYA 3NDRA 4I6JA 4RC9A 1NVBA 5EAIA 1P2FA 1RKQA 1Y33E 1P1KA 4UVDA 5FNVA 5L7YA 5JT1A 1OTYA 1NAIA 1ZQ1A 3SHOA 2XZTA 1ORIA 4GGOA 1NTOA 2Q5OA 4Q82A 4WEOA 1TX4B 4ILKA 3MBOA 1YI8A 3C6BA 4P3XA 3UFXA 1G5HA 2AJBA 1FNCA 5CYPA 4PN7A 2GN8A 3MMXA 1L4KA 3ESXA 2XUOA 1WE2A 3FFBA 3L8HA 4FZVA 3FSJX 3OJWA 4ITVA 5BQFA 2IYUA 4B3BA 1FU4A 3R3JA 2WVHA 4NI5A 3S99A 5BYKA 3CKKA 5ALXA 2XYQA 1OU4A 4V03A 2P2SA 1P0IA 3PD0A 1Q6ZA 1GCUA 3LKBA 4GPIB 3M4JA 1DX9A 4J0IA 1GG9A 5F1PA 4AJKA 4D44A 1NONA 3EGDB 2QLNA 3PUHA 4JJ7A 4R54A 3BRQA 4FR2A 3TZKA 1PJ4A 4WLFA 3T95A 4Q93A 4G0WA 1F7UA 5LJIA 3HG7A 1PRYA 3FZGA 3R0XA 3DWFA 4PAMA 3RYFB 3KQTA 2NO4A 1H8ED 3IAS1 4XWAA 2ZRCA 3WQRA 3I83A 1MIHA 4JCOA 4KQWA 2YXPX 3TR6A 1JSXA 3GD5A 2EYUA 2HL6A 2LP4Y 2CJXA 3L4SO 2JAHA 2YWGA 4I0WB 1U3GA 4KVGA 5GM2A 3QE9Y 3FCSB 1VMIA 3UAZA 3R40A 4EHKA 5FBZA 2JLRA 1FDOA 3CBQA 3RC7A 3HJNA 3WRXA 4EYEA 2HCTA 2X23A 1QV7A 4E2WA 2YDXA 5B36A 3NBZC 4GLFA 5L4NA 4BV8A 1HT1E 1ZD8A 3RWBA 4JWTA 1D1SA 1GTZA 1V5EA 2WMNB 3O4HA 4CUKA 1VIAA 4EYQA 1GILA 3GJ5A 3R4VA 4LF7B 5BNZA 1JYSA 1M8KA 4KVZA 4X60A 2DPLA 3V80A 2AG8A 3CUVA 2IC5A 5FFMA 1TD9A 1QGED 1UPFA 1ZEMA 3LV8A 2P30A 4DLKA 1TJ4A 4ER6A 2XA9A 4ZGWA 4I8XA 2CVOA 3RQSA 3K2IA 1JZTA 2P91A 2FR8C 1LI4A 1H3FA 2IYNA 3NTLA 4M46A 5BN5B 4CIYA 3FWKA 1HR0B 4RELA 3QOWA 4I4TF 4QM7A 2AK2A 4DQ0A 2HK7A 1CF9A 3DOFA 2G8LA 3UJ8A 3F9RA 1YQEA 4WBXC 4R4JA 3HWX1 2WJIA 3L41A 1C3LA 4FNGA 2QRQA 2JVIA 4QPDA 5KNBA 2BGLA 4NYMR 2IXAA 3WNZA 2J3MA 3I52A 2RH4A 3K53A 2OZEA 3QPDA 2P2YA 3GGGA 3OHPA 3GLQA 4TTSA 1DRWA 2JFUA 2JPDA 5AOVA 4NCAA 2JH3A 3L8FA 3MAJA 1HDGO 3ROXA 3TQQA 5LSAA 3EXFA 1G8JA 3AEKA 4KN9S 4PO9A 2HHAA 2FXIA 3NFRA 1V6AA 1CUYA 1GDHA 3NVAA 4JXXA 5BSRA 1U0OC 2J7PD 4BGIA 4RTMA 2EVWX 4G36A 3CX8A 2JH8A 1KQ3A 1MJFA 2YC4C 1ZLXA 3ADPA 2B4KA 2I3ZA 4IR7A 1Y1KE 2EW8A 3CEAA 5CLIA 1W0KD 2OYCA 1AF7A 4LJRA 5LD2C 3OICA 4QDZA 2BTEA 4DIUA 4ARZB 1QOQB 3RO7A 4NYMQ 3VX4A 3C8HA 3EK2A 2HHCA 4J7XA 1E7WA 1UM9B 3FTEA 1GVHA 1Y98A 2YJTD 1IPHA 3OJCA 2ZPTX 3VR6H 2GN2A 4HAZA 4LX8A 4MCHA 3R9WA 3PVZA 4GNKA 4BVJA 3LCCA 3OKPA 4G65A 4JBXA 2AYZA 3VOTA 3Q9LA 4C43A 4X90A 3RVRA 3R74A 1B8UA 4ZICA 1ORTA 2X5KO 4FHCA 5LP6C 5CX1B 1RHRA 3LG2A 2VRCD 1YR3A 1OOEA 3I4FA 3IFSA 3D8BA 1NWHA 1T9GR 2GZHA 4HEJA 3ZHXA 1DJMA 1CUGA 2WF7A 3AIKA 5DGXA 5F9FA 1YCHA 2A0YA 3OQPA 5CA1F 3EXG2 3FRJA 3WAKA 1T29A 2I03A 3QPWA 1KMQA 4C04A 1RU3A 2P9EA 1BQ3A 4YCSA 2XW6A 2AYYA 1G6HA 2MDTA 1LS1A 3IR5A 4MINA 3L43A 3LE8A 3MN1A 2BUBA 1PEDA 2FX2A 2VNKA 2IZ5A 4JCCA 1N7IA 5AK0A 4QTYA 2XUGA 2YVAA 2X8JB 2A9OA 3JRNA 1LTQA 1JSRA 2C1XA 2JA1A 4MQEA 5JO0A 3ZHOA 1JL3A 4KLCA 3E2PA 4WBNA 3HYNA 2Q3FA 1JKIA 3VR2A 1ZJ6A 2O1XA 1DQYA 1ADFA 5DYYA 4X84A 4US0R 1QM5A 4Q4DA 3GMDA 4QNMA 3JZAA 5FQNA 3N2KA 1LNZA 2QQGA 4ZOEA 2NVOA 4OLJA 3ZTYA 2R8PA 3TLGA 5KQMA 3CM0A 4JUDX 1XZ8A 3NHJA 3SKVA 2O3RA 4F1WA 1OI2A 2E1PA 5KOIA 3JWHA 1BJKA 1FFXA 1YQUA 2ACVA 3HRIA 2BMFA 2C57A 2AEMA 3AFHA 3EF3A 5AHWA 3DT8A 3STXA 1DAFA 1Z07A 3DC2A 5THQA 1NNUA 2A9VA 3TZBA 1OZGA 2AG5A 1N5DA 3HCPA 3W5HA 2HPZA 2H2FA 3R5KA 3U26A 1VL6A 2C5LA 3JQRA 1M74A 4E88A 2ZTSA 4LECA 2FR8A 1J49A 1GPDG 3DM9B 1L7XA 4Q05A 1C1DA 5IF3A 4UU1A 1E66A 1V35A 2Q46A 3K70C 2OZKA 3TW0A 3NHUA 4IDBA 4L5YA 4UBNA 2NO7A 4TYMA 4WUVA 1AQUA 1Z8NA 1Q1QA 4WZ6A 3KKPA 1JS1X 3SZRA 2YJGA 2CE2X 1A8PA 4MKIA 2QX7A 4XQCA 4WCFB 1HLDA 1NJGA 3O2QB 1I2DA 2K4MA 3LSYA 1E64A 1ESCA 1FUYB 2FUCA 2V3WA 2Y1GA 3ILXA 4OBBA 1QYWA 4A8JC 4AZWA 5IAGA 5A9SB 4DJAA 4Q6WA 1E2DA 2Q3EA 3LP8A 1UL1X 2BEVB 1F5NA 1R8SA 2OO5A 3JD4A 3PENA 2RKOA 4JY7A 1MNQA 1XRJA 3H1PA 1CUHA 4N9QA 1CRWG 5E8JA 1IUPA 3LTNC 4A1FA 2YOFA 5JS1A 3P4YA 3HGQA 4HNQA 5ALFA 3LSTA 4UFOA 5LZ7A 5GTDA 1UDAA 1LRLA 2IGBA 4GDMA 4DKJA 4QA9A 3LPLA 4M6WB 2XNCA 4UFNA 4JLWA 2ZJ1A 4WXPA 1R5BA 3NOVA 1UXJA 4RSGA 3AR9A 2WDZA 5EN4A 3T1VA 5BR7A 3I45A 5AM0A 1L0BA 3SXJA 3W3AH 5TPWA 3LY8A 2BL4A 4OGGA 2XQKA 5LUBA 1X7XA 3KQYA 3RVLA 4HVLA 1A2KC 3K92A 2F9MA 1E9DA 4JJAA 1TO6A 4BWVA 2W37A 2CLLB 4OMUA 2GN1A 5CH8A 1Y1SA 3M6MD 5ENVA 4YROA 2YS6A 2OBYA 1XR3A 1YJQA 2WINI 3IJPA 3W5SA 4EI7A 4A27A 3SZUA 4EQ6B 2PFSA 4BLTA 3KVRA 4M8SA 2J4FA 5L3QA 3LBNA 3FPLA 3PDWA 1WX1A 2FF7A 3PI6A 1TNDA 2FPGA 2HJHA 3BGIA 2J9ZB 2F00A 3DW3X 3RK1A 3F78A 2PZEA 3ROMA 5AM4A 3BSWA 1CC1S 1JWAB 3DGFC 4DJDC 2ZT7A 2DP4E 2PGDA 3EXEA 4JI2B 3OU6A 4Z4QA 5TT1A 4OQLA 1P4SA 4AX4A 2MR5A 1JPNA 4UJ5A 5LA6F 4D9KA 5CJPA 1O5IA 4RU1A 2I76A 5EGSA 1ODIA 2CVFA 3MSCA 2P9GA 4E2FA 1UPAA 3GEEA 5EJMA 2XUPA 1V7ZA 2JGDB 2BFOA 3ODGA 4U7HA 1TK3A 1N6HA 1WV1A 1Q0ZA 2PUJA 3A6FA 1XF9A 3QE2A 1XHFA 3H9BA 4EJSB 1P0PA 3ED1A 3I05A 3QEOA 4PGMA 2IW1A 5L7WA 1XVLA 4EMSA 1H0KA 1DTEA 3ASZA 1SOVA 2OHGA 3BBLA 3KKNA 3LH5A 4JLNA 5FULA 2XUZA 5JVDB 3ZNOA 5KYXA 3P0FA 1X7WA 2PR7A 4GPEA 5HKBA 5ALHA 1QHGA 2JIBA 5K03A 3FGZA 3KU1A 1BMDA 1KK0A 1U9JA 2UYQA 4DLZA 5DX8A 1QIIA 4BXOB 2X0JA 1YNOA 2HM7A 3IXQA 1SUFA 1RWNA 2VHJA 2VP5A 2ONZA 1VKRA 3KZKA 4L8LA 1NMSA 2J67A 1A4UA 2VRWA 1D8AA 2D5IA 2FLKA 3PC6A 4R1LA 4XCQA 4YDHB 1L5HA 1Q22A 2IUTA 5J4KA 4A8JA 1SBTA 1KI7A 3UW3A 2JVJA 3FMGA 3NTOA 3QKSA 3LQYA 1THZA 3ER6A 2XHEA 5AXCA 4DWVA 5LLDA 3A4TA 1AKVA 1I2ZA 1ESZA 1UDCA 2CL0X 1B73A 2GN0A 2GZMA 3DBLB 4D0NA 4ZOLF 2OLJA 3UPDA 2M9MA 3TLAA 2V3VA 4E13A 1I51A 1LC3A 3DAPA 2OQIA 4W5JA 4KR6A 2O54A 1DIRA 3QFTA 1W35A 2BKVA 1K8QA 2DUUA 3DO5A 3RG2A 4AICA 4FD2A 5ITZB 5FUMA 5FNVF 5JU6A 2A9RA 2WHPA 4CL8A 1IHOA 5L95A 1PHRA 1G291 3DZJA 3EZFA 4LYYA 4RK4A 2HNKA 5KTRA 1H2XA 1AZLA 1GADO 2X6QA 3FSGD 2CBZA 5AKHA 4P4GA 3PDIB 4OX9B 1XT6A 4NU6A 1MQAA 2ZE5A 2PFKA 5FUBA 1SBHA 5HZKA 4GZLA 1H0HA 4MA0A 4PW0A 1H8HA 1IAQA 2H4JA 3PT9A 5EUBA 5C1PA 4P0QB 1WCWA 2IT1A 2O8VA