2POCA

The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
353
structure length
339
Chain Sequence
GPYKHFMQKEIFEQPDSAFNTMRGRIDFENCVVTLGGLKSWLSTIRRCRRIIMIACGTSYHSCLATRSIFEELTEIPVSVELASDFLDRRSPVFRDDTCVFVSQSGETADSILALQYCLERGALTVGIVNSVGSSMSRQTHCGVHINAGPEIGVASTKAYTSQYIALVMFALSLSNDSISRKGRHEEIIKGLQKIPEQIKQVLKLENKIKDLCNSSLNDQKSLLLLGRGYQFATALEGALKIKEISYMHSEGVLAGELLPIIAFATRDSLFPKVMSAIEQVTARDGRPIVICNEGDAIISVHTTLEVPETVDCLQGLLNVIPLQLISYWLAVNRGIDVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords isomerase domain of glutamine-fructose-6-phosphate transamin
publication title The Crystal and Solution Studies of Glucosamine-6-phosphate Synthase from Candida albicans
pubmed doi rcsb
source organism Candida albicans
molecule tags Transferase
total genus 144
structure length 339
sequence length 353
chains with identical sequence B, C, D
ec nomenclature ec 2.6.1.16: Glutamine--fructose-6-phosphate transaminase (isomerizing).
pdb deposition date 2007-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01380 SIS SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2pocA01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2pocA02
4M0DA 5IWAB 2UUAB 1TZBA 1U0FA 4DV4B 3J80A 4DR2B 2ZJ3A 4JV5B 4NXMB 3HBAA 2J6HA 4EM6A 4DUZB 4LF8B 1NUHA 5I01A 1XNRB 2CXQA 1VI6A 4LFAB 3JX9A 2F4VB 1JLHA 1MORA 2CXNA 3FKJA 3OOJA 1JXAA 4DUYB 2UXBB 4DV1B 3G68A 2UU9B 4K0KB 3FF1A 2WU8A 2CXPA 3C3JA 3J81A 4JI6B 2I22A 4YHHB 1M3SA 2VF5X 1GZVA 1WIWA 2PUVA 3BCHA 4GKKB 4S1WA 4JI8B 4DR7B 1XMQB 2DF8A 4DR4B 4KHPB 1XMOB 1HR0B 3KNZA 4JI5B 4S12A 1X9HA 5LMUB 2A3NA 3QKIA 3Q7IA 3OTOB 5FLXA 3PR3A 4DR6B 1B0ZA 4DR5B 4JI0B 1IRIA 4YY3B 1N8TA 4B3TB 4JI7B 4DR1B 4B3RB 3EUAA 4LF4B 4AQYB 4DV7B 4JI1B 1IBMB 1KOJA 2XBLA 1MOSA 3HJBA 3FXAA 1I94B 4X62B 1N36B 1N34B 3ETNA 2O2DA 1U0EA 4DV2B 4JI3B 1JIQA 2E5LB 4LF9B 4LFBB 2POCA 4LFCB 2AMLA 1IBKB 3I0ZA 1TZCA 5BR8B 1G98A 2CXOA 2I2WA 1XTBA 3UJHA 4U6NA 2PGIA 1Q50A 2PUTA 4DV5B 4TOIA 1XNQB 2CB0A 2CXTA 4OX9B 1HOXA 1C7RA 1IBLB 2V4MA 3IFSA 4X65B 1VIVA 3TRJA 2ZM6B 2CXRA 2CXUA 3JAMA 4DV6B 1DQRA 3ODPA 1J5XA 4DR3B 2X3YA 2DECA 4B3SB 4NXNB 4X64B 4AMVA 1IATA 3LJKA 5LMNB 2E5FA 1FJGB 2ZJ4A 1T10A 2UUCB 3Q88A 4X66B 2UUBB 1N33B 1VIMA 4JI4B 4LF5B 5BY2A 5LL6P 4LF6B 3FJ1A 1U0GA 2HHHB 2UXDB 3BJZA 2O2CA 1JEOA 1NRIA 2VQFB 2CXSA 4DV3B 2VF4X 1C7QA 5IT9A 3T1HB 1X92A 2VQEB 1TK9A 3T1YB 4B3MB 1N32B 2UXCB 2PUWA 1X94A 1VI5A 3J7AC 1MOQA 1HM5A 2Q8NA 5A2QA 4IVNA 4DV0B 3M5PA 4GKJB 1ZZGA 3CVJA 4LZJA 3TBFA 1GZDA 2CVPA 4JI2B 1X9IA 2XHZA 1HNZB 4JYAB 1HNWB 3SHOA 4LF7B 3NBUA 1J5EB 1HNXB 2YVAA
chains in the Genus database with same CATH superfamily
2W5UA 2L18A 1TYAE 2G40A 3NATA 2QTHA 1DLIA 5ALJA 2Q7OE 1Y7TA 1S3IA 2WIJA 4Q34A 1JT2A 2VHYA 5JOQA 5FA6A 4DSNA 1A7UA 2EJBA 3AW9A 1TTPB 3OQJA 4IAOA 1ZPDA 4CF7A 2Z08A 4QUDA 5HF5A 1PFKA 4TN1A 4ZU1X 3FVWA 4UE3S 3LSYA 4GMHA 1X7HA 2I7DA 4W5OA 2YFHA 3B9QA 2OFFA 3DA8A 3FWPA 3NKLA 1XRMA 3QVKA 1M3SA 2C5HA 3MJ4A 3MUEA 1U3CA 3R0QA 2NYAA 4AKGA 1ISGA 2NU8B 1UFOA 1VLLA 2NTVA 2PWYA 4GNRA 3P7MA 1PS9A 1GCIA 3C1TA 4D82A 5K0BA 3CCCA 5KSPA 4JAVC 1MAHA 4HTFB 4X1KB 5FI5A 4TT3A 2ZJ0A 5ED0A 1VHTA 4O2BB 1WXIA 4B3TB 1KEPA 2VZEA 3V8MA 4M22A 4F9GA 1KE1A 4YMHA 1E8MA 4DMFA 5COAA 1EP3B 3ZK8A 3NW9A 3CA8A 3LV8A 3L4JA 4MVWA 5J1TB 2VKTA 2JCSA 1JG3A 4DUPA 5F4BA 2WHQA 1OU0A 3BCSA 2RJ3A 4EX6A 4FP9A 4ZI7B 2QE6A 3I9V1 4MO9A 2G9ZA 1LK7A 2ZWMA 3QE9Y 5HQTA 1DQPA 1F8XA 3B8EA 3GOQA 3RTDA 3B9RA 5L3QB 4FHEA 4PE5B 2W42A 4YECA 3S8EA 1JYSA 3TJZA 3TNLA 1H8HD 4BX3A 3OJXA 4JUIA 2I33A 3MGBA 3ZPXA 4DQXA 2OAQ1 4TGLA 5JSZB 3UXHA 3MYRA 1V5GA 4FB5A 4NFHA 3PCRB 2VTKA 1EUCB 3UNXA 4XWOA 3KEQA 1ATIA 1P2TA 2H92A 1T4CA 5K7SA 1NVVR 1DEOA 3KOMA 1T0PA 3ETJA 3QIVA 4B6QA 4OQNA 4MV4A 1CIPA 1ZN8A 2Q3BA 4IXDA 4D3XA 1D0IA 1BYUA 1W4ZA 4FDLA 3HJTA 3FVRA 4ZOEA 4G1UC 4XFJA 3CG0A 3LCCA 5CBPB 4BB5A 1CUYA 1YFZA 2GPYA 2UUOA 4LRQA 1EE1A 1JQ5A 2JAXA 4C2AA 5A6VA 5J4LA 4NMLA 3RODA 3HM9A 4GC9A 4EHKA 1QBKC 3OP4A 5ER9A 4BNMA 4AZ3A 3T1YB 3K05A 4IDBA 4HLUC 3FYCA 5J2TF 3AW8A 1JHUA 3KXKA 5CEFA 5ITSA 1XAIA 2FX3A 3RT1A 4Y0VA 3HPRA 3LKVA 4EZIA 1IH8A 5T4BA 1V1MA 5CCXA 3ZWVA 4V39A 2WG0A 2NW6A 1W4LA 3KM0A 4GO1A 3ZNOA 3JYPA 1L5QA 1WDKA 2WFZA 2F1HA 3IEKA 4OGWA 2WTAA 2XT9A 2GF0A 5DO9A 1KAGA 4AWXA 6PFKA 5EZ6B 1GL7A 1TGVA 1FUIA 1UF9A 4KBGA 3VTKA 1BVYF 1TF7A 1OX4A 2CMDA 4KYUA 4MUAA 2PKWA 2XJ9A 5DHSA 3SN6A 5A5GA 3GQVA 1G20A 1RVDA 1FE8A 1J97A 3FAZA 1Z6XA 3SLKA 4YUYA 1T6ZA 3NC1C 1WVMA 3MMSA 1NIJA 2F00A 2B8WA 5ARCA 3DXYA 4H16A 2AKAB 1NULA 4IDQA 3HKCB 2J46A 1N1GA 5ICEA 3LBIA 5C3UA 1KGSA 3ETEA 2P4UA 3WGUA 1P9NA 2IE0A 1NT4A 2Z3ZA 4MGYR 5CDHA 2P1ZA 1VA5A 1YBAA 3JWHA 4RQUA 2VP5A 1PJTA 2K87A 4CQMA 4EHNA 3DLCA 2HXGA 3OM0A 2XXJA 3L9WA 3V4FA 3SHTA 2GM9A 1MIOA 3DWIA 2YWJA 4EHLA 4PTLA 5KCZA 2JFQA 3DW1X 4J75A 4LJ7A 3VPGA 4R3NA 1WUHS 3DSRA 4Q1AA 1FMLA 1KDTA 3D4IA 2WFLA 3H9JA 1Q1NA 2PMDA 2FQYA 3WJAA 4MR9B 1KY4A 1R9NA 4ZTUB 1ADBA 4TUYF 1KO7A 4DIKA 4ER6A 1K8ZB 1COWD 5IJ9B 1ZH8A 1SZJG 4KQMA 5JH7F 1D4ZA 1VYUA 1T9AA 1JQAA 3I23A 5C4MA 5TGTA 4MQUA 2HA6A 2QT0A 3ZXUB 3C70A 4NZZA 4BV8A 2FZ4A 4BMSA 2DERA 1P9RA 2BI4A 2XXBA 1W0KD 3FFAA 4QD3A 4EG6A 5EHZA 4FS8A 2A2ZA 4OYRA 1MENA 4Z3KA 1A9ZA 1E0DA 3HDQA 3O21A 1VGVA 4MWTA 3V7FA 4DW8A 5JPDA 5KQPA 4G5RA 5DNCA 4KITB 3HKEB 3H18A 3UJHA 3ZNPA 1P33A 3ERCA 3SQOA 1SC9A 3ANLA 3ZI4A 1ATZA 2RK4A 1VG0B 3MN1A 1HYEA 1QHHB 4WVFA 2AUTA 1DV1A 1OXMA 2MMGA 3QLTA 4Q0MA 4QDKA 2Q4RA 5SZKB 4I9GA 1T34A 3EOAI 4WFJA 5CA0A 4DNQA 1KEWA 4JSYA 4RD1A 2CK3A 3DDZX 1UKEA 4ZGGA 1LPSA 2YHIB 3W5IA 2PH5A 1JFFA 1C9JA 1FX1A 2W37A 3THXA 3ITEA 4KWTA 1AS2A 1R7RA 1RRKA 4HN9A 2NU7A 4D44A 3GJ8A 4AS3A 2UUBB 3O4RA 4G5FA 1VE9A 2BH2A 2CBGA 2XMBA 3TX6A 2OTCA 1JU4A 3ZV3A 4CW7A 2QL9A 1XQ1A 4PAWA 1ORTA 1C4OA 1WLSA 3INNA 2HU8A 1DJOA 3U3RA 4EL0A 1AMUA 1IY1A 1PQYA 3QVGB 2VF8A 3TKAA 3VVBA 5ENZA 2A9RA 5IVPA 2J30A 3AB8A 3ZI7A 4L6AA 4LQCA 2RK6A 4G89A 5GVRA 3PT5A 3IL2A 1HYGA 1GFWA 5GONA 1U2GC 3VR3A 3L79A 4AQDA 2XLBA 2HU5A 1C9KA 2RGEA 4KPYA 3T9AA 2BGGA 4MQEB 5EP1A 3DLHA 2WD9A 3V1UA 3PDCA 4LZJA 1B3RA 3QLJA 5EOVA 5FYDA 3GT7A 3T3HA 1G5FA 3JR3A 3GXOA 3O73A 4EHFA 1V8BA 2HL6A 4HRYA 5JJKA 1ZK0A 1H4TA 2C2XA 2LVBA 4FHZA 3ZD6A 1XKLA 2GAIA 3REQB 3T1VA 3GGDA 2G08A 3N07A 5D1HA 4F6RA 3QQ5A 2R6CA 2PV7A 4NABA 2R48A 1XN4A 2HFJA 2PGXA 5KX5B 3PYMA 1YZGA 4LJ5A 1C2YA 4RHTA 4BLTA 2Z95A 1PR1A 5L3SB 1E4YA 4TV8F 4IIVA 1Q21A 4RTSA 2X41A 3A6GA 3WIBA 4TYYA 4UXJA 2RKWA 3E61A 1CYDA 2QW0X 3I73A 1TKCA 2GILA 1KFBB 2X8WA 3VR6A 3EZLA 3PGVA 4WZBB 4XR9A 5AM2A 1JIVA 2QUBA 2ZETA 2PJDA 4NICA 4EPTA 4CMJA 1GG2A 5G4KA 3L8FA 4UFPA 5KNLA 3HWSA 3IJPA 5JZOA 1OI2A 2Y0CA 1SC4A 1IQ0A 1T5DX 2FB9A 1N6PA 4KAFA 4EFMA 3DBHA 1B73A 4P35A 4FFNA 4CV0A 4CPDA 3ER6A 1XWIA 1JZTA 3KB8A 2UVPA 4LZLA 2G9NA 3ETCA 5JIBA 4O4IB 2PZ8A 3GLVA 5E8RA 1GNVA 2Y0EA 4E4TA 2E4ZA 3DT8A 4OGFA 1W46A 4EPRA 5DBFA 3ER9A 1KVUA 5IU6A 5K6TA 2FPIB 3K5PA 2W70A 2IPNA 4K6MA 3DV9A 4Q48A 3VH2A 2NUPB 1Y3AA 3HCOA 3W2EA 2OHHA 4TMFA 4LWQA 3WKEA 3PXBA 4CIVA 5M34A 1XZAA 2GO1A 3EB9A 4I81A 5IDYA 1Z5UA 2HBYA 4MWBA 4GL4A 3ZJ4A 4AX4A 1WEKA 3CE9A 4MUNA 4EKDA 3T3OA 4YBZA 4F9FA 2QX4A 2W71A 2PUAA 1ZK1A 2FJUA 2HK9A 4UBOA 3VBCA 3WGZA 5JAMA 3A2LA 4YMIA 4A8JB 1ZGAA 1M5RA 1BDHA 1XL1A 2J48A 5JNRA 4P5PA 1XLTA 3NHSA 4JA2A 4PCVA 1T1EA 4IWNA 3X1ZA 5JVDF 1AOXA 1W85B 2KLHA 4RKFA 4NK4A 3INRA 5EWMB 1IZYA 5IN5A 1X7WB 5BWBA 2FG7C 4TXHA 3ZDRA 1TECE 4CTJA 4IGAA 3RGWS 2GD2A 5CDGA 1QH8B 1J8DA 4KRGA 4ZYLA 1A3CA 1SY7A 2EF0A 4IXWA 2GLXA 2J4CA 1GA1A 1FFWA 2YY7A 1J5PA 1GDDA 3I42A 3PF9A 4IHQA 4BMYA 3U4IA 1U8TA 1ZOSA 1TTTA 2BEUB 1NPDA 3GFTA 4ALIA 4HGNA 1SELA 3STVA 4L22A 3H5LA 3KDPA 3D5QA 4RULA 1TCAA 2LXNA 3FTDA 3KR1A 3AH8A 4XH9B 4YASA 4EEZA 4R3WA 5H8WA 3LY5A 3NPAA 1B16A 2XNDA 2RE8A 2XVZA 3DLTA 2IIQA 4Q4LA 1U7HA 1N32B 2H7CA 3QJYA 4TSRA 1YDEA 2NZVG 4MQFB 5I9LA 3MCAA 1AT1A 2RGRA 3ZHYA 1W36D 5AWFC 1Y8AA 1XZFA 2P7HA 3KJQA 3OSUA 4J07A 2QUAA 3E9CA 2CWDA 2MYNA 2IS1A 1M1ZA 3EIOA 1H0RA 2AFHE 1Y1PA 3GJQA 5MGBA 4GECA 1HURA 1VYHA 4JCOA 1Y8RA 3PQDA 1HI9A 4N5NA 1XDUA 1QMGA 2Y71A 4F93B 5JFOA 2YW2A 2PX0A 1PNVA 4ZQIA 1TI7A 2R5WA 2YRFA 1K75A 3ETDA 2C3UA 3HM2A 2QN8A 2OHOA 4YAWA 3R9WA 3LZCA 4A6DA 2VK2A 1UADA 2IV3A 2EIXA 2XQVA 4O4LB 4MUXA 2BFMA 3L8HA 4RZHA 1NYQA 3FNGA 2GXQA 5IT5A 2EJUA 2CDBA 4DXHA 3TLGB 4ZOCA 3F7TA 4JP1A 4RV5A 1MX5A 3C8ZA 2XDQB 4G86A 4C4OA 4DLRA 1RTTA 3DVQX 5HSGA 3LA8A 1DXQA 2X9GA 3BE5A 1RRPA 1QIDA 1SQSA 2AFIE 1F0KA 4R9SA 3OAAA 5IARA 3I5XA 3R0VA 1KFKB 1YKSA 1SKMA 1ZJWA 1N6OA 1EFTA 1CRQA 1UFQA 1KS9A 1ZMBA 2AXNA 2V4UA 2DULA 1M6NA 5A7FA 4BDSA 2XNHA 2EGUA 1FPQA 1VIAA 2KQUA 4BEVA 3AUYA 3C87A 4H0FA 3CN9A 4PGFA 4XGRA 1YULA 4X60A 4E2XA 2QRMA 3NBYC 5KPJA 5F73A 4R16A 1K4YA 2HLDD 4N8EA 1SURA 3SR3A 2W7TA 3K6JA 3QF4B 1W8IA 1U2QA 2C3YA 1AA6A 5FIUA 4UMDA 1HR0B 3CUYA 4KK3A 3WFIA 3O95A 4HAOA 1DHTA 3KEGA 4XXHA 3ZZ0A 3UAOA 1UFKA 2P6RA 3LM8A 2EQ5A 2I3GA 3CF0A 1GPMA 5H81A 1W8DA 3IIMA 1VMEA 4IDPA 1XDBA 2WT8A 1QMPA 3EPPA 4Q4HB 2XNCA 4WHMA 5DRYA 1AS3A 2A1UA 2ZIWB 5KYYA 2WHPA 3ELBA 3BMCA 1RDFA 5CX1A 3FDZB 1FL9A 3G5AA 4QQ8A 1V6SA 1TVKB 4J03A 3AYXB 2HJRA 3PVSA 1NY6A 4IW3B 3Q98A 2WVHA 2OXFA 3PUHA 4Y9DA 4HLCA 1R2QA 2OBYA 1HTBA 1LX7A 1Z8HA 2FSUA 4II3A 3BICA 3ITDA 1SVLA 1NBMD 2PQMA 1MQ8B 2D0IA 2XB8A 3N0VA 4IICA 4P4NA 3PJDA 4LW8A 5DPMA 2ZYHA 1QCYA 3BWDD 3D1VA 2WIDA 1LPNA 3HADA 1E2NA 3G5LA 3KSDO 4J0CA 1Q0SA 4BXOB 3DZCA 1KMIY 4TMZA 2PGIA 3N7TA 4MVCA 4RF2A 1ISSA 3CPEA 3TE7A 1ST3A 1QG6A 2FEAA 2P90A 3SJCA 3CVWA 1FDRA 1PNQA 1BZYA 3RREA 3U4AA 4ZDJA 2ZIAA 3NM4A 1O8CA 2J3KA 3KYDA 1VMAA 4N49A 4YO7A 4C7XA 2FPPB 4X65B 3NCTA 1N9ZA 1JMKC 3O84A 2IYVA 2ADFA 2PR7A 4MJ7A 3RRMA 3T5PA 2H08A 2PIAA 3LKZA 4F12A 3HBLA 3KEOA 1NGSA 4MPPA 2A4KA 5LMNB 2QRLA 3SEFA 1QYIA 3GV0A 3FSEA 3ZZNA 3WIUA 5IK2D 3RU9A 3W34A 3ORRA 3I5MA 4TMTA 3AFNA 1YZUA 4NNJA 2Y1WA 2VHXA 2AOXA 1LDBA 4ND5A 2CFOA 1R00A 2SHKA 1AQNA 3IT3A 2HF9A 4FZ3A 3RS4A 4W7HA 4DLWA 3S2YA 3KKQA 3PGKA 3A1CA 2VDRB 2B94A 1ORDA 1UT8A 4R2XA 4RPHA 5HYVA 2MR5A 2AHRA 5LA6F 1DDIA 2PK3A 4MVJD 1ARZA 1N5JA 1KAMA 1REQA 2HF2A 2O50A 3H2HA 3PFKA 5DX8A 4ATNA 3LHSA 1QORA 3KJXA 2HSZA 1ZUIA 2JIRA 6ADHA 2LPMA 3LH5A 1X7YA 1CZOA 3KUXA 2HUPA 3PVZA 1Y6RA 4LZOA 4DARA 1PQ4A 3JQQA 3K4HA 1VKJA 3UK0A 1P0PA 5BMVB 2XUHA 1OA1A 1XTIA 1YT5A 4MLCA 3V42A 5CD1A 1B15A 3STWA 1DJQA 1UFRA 4GAEA 3MJCA 1NMXA 1SUIA 1TZBA 1E4OA 3DE0X 4Q7KA 1TKAA 1A9RA 4CXMA 2TMYA 3IB3A 1KFCB 1Y5RA 3O75A 3ADDA 4AP5A 3ZKWA 3T15A 5L51A 4I8XA 4RA6A 1ZOIA 3CKLA 1FK8A 3EGVA 3R3UA 2E48A 3Q3GE 3IPYA 1EFRD 4F2GA 2XEDA 3CHYA 4JYCA 3H2GA 5F3RA 4ARBA 1RQLA 4DGSA 1J39A 1KTVA 2VH5R 1D1SA 4G9GA 1SC6A 2V45A 3D81A 4DBLE 1JH9A 3IMCA 4ZU6X 2FI1A 3NTVA 4NE2A 2IL1A 5ABPA 1V5WA 1YIAA 4KVAA 2D2XA 3M4ZA 3ESZA 4JC8A 4KAJA 3W5VA 2OBNA 2LRHA 1E59A 2ACEA 1C1YA 1UC4B 1BH2A 1MC1A 1C3VA 1WIWA 2OP0A 2Y1CA 3OESA 4KP7A 4PLZA 3VKWA 4Q9JA 1HTTA 3HDHA 1YVUA 2C2GA 4EJFA 5FBLB 3ZHVA 1K4MA 2GTHA 4PS0A 5FPHA 4RTKA 2ZGVA 1U2TA 3TIVA 2DPHA 5F7XA 2E4XA 2FR8A 1A5ZA 3L04A 4UVGA 3WGNA 2JFWA 3B78A 1WU7A 5THKA 2QVBA 2L82A 1E3IA 3B7PA 4YP0A 3NR2A 1FS6A 1WW8A 3ABSB 2QPTA 1IN6A 5KS2A 4FT2A 5B1HA 3VZSA 3S99A 4CM4A 3JVIA 1PO7A 1I14A 1VB5A 3N5CA 4FU0A 1I5OA 8LDHA 4HT3B 4QHTA 5ARBA 1N3IA 2JLWA 1KI9A 5HRAA 2J5RA 3GXBA 5DNVA 3HC7A 1K1EA 3MCZA 4YK7A 4BLOA 3ZU4A 2OCLA 4Q1FA 4CMGA 2JA1A 5CB4F 1ZAYA 4WV3A 1K63A 5BQ5A 2IP2A 2PRYA 4E31A 1XP8A 4TMWA 821PA 4R83A 4C7BA 2PGNA 3Q3JB 2XZDA 1D2RA 3VU3A 4I6JA 4Z3DA 5A3SA 5TVKA 1UWKA 3BE8A 1V3VA 4I5FA 1FFHA 1WBJB 3PJEA 5BRJA 3MTGA 3ADOA 5B7PA 1QIFA 1UJBA 3CNBA 4TN5A 2XUPA 3UH0A 3WLMA 2PIDA 3FRIA 1GCOA 1QQ5A 2J9FA 4GPEA 4GKBA 5EI5A 5EGNA 5TX7A 2BUCA 1UP4A 1W25A 3W3AA 4CLHA 3VQTA 3L7AA 4E7OA 2IUSA 1H8EA 4P8RA 1N57A 3C1OA 1JWBB 3UMSA 5IZCC 1VPDA 3ZHCA 4NCXA 4X66B 2CT8A 1UKAA 2XXAA 1S2DA 1N25A 2VJPA 3HLKA 4LF6B 2D2IA 1Z4MA 2V8OA 3L7NA 2PG3A 3CKMA 1CJCA 1VKNA 4DA6A 1YC5A 3RAPR 3PGA1 3F7OA 4TS4A 4R0MA 2PX4A 1E3MA 1RYDA 1EHIA 3IBSA 3PYLA 3VKFA 5JZBA 4E33A 4HQ0A 4H77A 3ENNA 4U7DA 1O94D 1W44A 1CE8B 1XVVA 1YQUA 2ES4A 3KQQA 3ZCQA 2ZE5A 2DYKA 4PLTA 4R40A 2PMKA 2CL5A 3LPLA 5HKLA 3D6JA 1OBFO 4GRDA 4WKBA 3QVVA 1E5TA 2IP1A 3JQCA 4L0QA 2XVXA 2VYND 5GINE 4YJFB 3ESYA 1Z5OA 4X63A 1MV8A 5E7IA 1IDOA 2YWCA 3L1VA 4H35A 4HC4A 3D0OA 3MMNA 4FINA 2ZS9A 4LOKA 3VOTA 4HH1A 4P7BA 4CM6A 1WQ4A 1A96A 5ALKA 4YACA 3WWOA 2WV9A 4CV1A 1XNRB 2P62A 2BEVB 3WDMA 2HADA 4OSPA 1LV8A 2IT1A 2J08A 3UY4A 4W9MC 5HK9A 3PPWA 3FTEA 4M0CA 3T9BA 1NW6A 1E7YA 5K0LA 1O95A 3FNFA 2H8GA 5KMGB 1K5PA 3VZPA 3WGTA 5KBYA 4QO8A 1X1QA 2R60A 5TMEA 3ZWBA 1ULUA 2BYTA 4X94A 3J81A 1R3UA 1V47A 3H84A 3CWCA 3RUHA 3NHMA 1B43A 4ZAZA 5FD8A 2FE1A 4F5WA 5DE3A 3HJRA 2XWQA 3P9CA 3MWEA 5EHGA 2ZIZA 2FWJA 4J1SA 4K6KA 5EJ4A 3Q6NA 3ESRA 5FOVA 3HJHA 3O2NA 4LDZA 1VBMA 4FFVA 4DA4A 5FP0A 4CE6A 4BNDB 1BWQA 4YHBA 2MSNA 3BOSA 4KQIA 3VO1A 5AK0A 2FLKA 1XXHE 3DL0A 4DQKA 2W6ID 3ZOKA 5ADHA 3INYA 2OAGA 2KI5A 1FU8A 3WO0A 4U8HA 2NZ2A 1YO6A 1E9BA 3H75A 1NM5C 3WHPA 1QVWA 3BL6A 3FGZA 2IE8A 3OIYA 3NT4A 5GV7A 5ITVA 1FXSA 4MQ5A 4V0RA 1PJSA 3KQVA 1DBRA 2JLBA 3ANSA 1DT3A 3OZDA 3E9QA 3E84A 3T12A 3VAYA 1ESEA 1V5FA 3AJRA 3NHKA 3QU2A 3T4PA 4Q4JB 1OOEA 2BEJA 2EKQA 2HFKA 3G23A 3ONWA 5CVEA 2JVJA 5JRJA 1ZD3A 5IVIA 3L0BA 2CGEA 4UM9B 3LT0A 5BW4A 2QORA 1KZ1A 1YZHA 4R05A 2Y67A 3ZU2A 3OO1A 3ZUGA 4AQ7A 1V45E 2H0QA 2I3BA 3IUQA 3DBRA 4UBIA 5CB8A 2VTDA 3LF1A 5ALVA 1R0WA 2B61A 3IUBA 3BC1A 1M7BA 2HBQA 5K6AA 2FW1A 1N2OA 4BFSA 3LWNA 3QHPA 4FDVA 1L7MA 4FYXA 5JCXA 4D3DA 1RLOA 4K0RA 4QDUA 3AR2A 1M2GA 4YRAA 1D9ZA 3WLPA 5EJ8A 1YQTA 1F2UB 3UJPA 4DDKA 2MYPA 1DPFA 1XLVA 2O7VA 2QZZA 4YYZA 1XVAA 3MLEA 1B41A 1F8FA 1Z47A 2J9RA 4H59A 4PHFA 4HEJA 3ZJUA 2GF2A 1ZYUA 4FOSA 3WWYA 2RAPA 3PA8A 4FX5A 4MZDA 3WXBA 1Z56C 1EE9A 1MDBA 2JJ2D 4RVOA 1Q0RA 1P75A 2AN5A 2QEQA 3EFOB 4M89A 3FYTA 1MABA 1PEAA 4D99A 3QNMA 4TYQA 1UKCA 4BP1A 3EVBA 3H17A 3S68A 1E3TA 2WUEA 3A3YA 3M9LA 4UU1A 4TWJA 4LYHA 3OEHA 2QPOA 1VYVA 3GPIA 1DHRA 3LK6A 4TS3A 3M5PA 3F2VA 5JADA 3Q3HA 3EEBA 1I94B 2OZKA 4HAZA 4UHDA 2C83A 4HWPA 4U2CA 3O2QB 2C9DA 5F9MA 3NOOA 1DRKA 2CSXA 5DK6A 1NYTA 5FO0A 5AD1A 2F8MA 2C84A 1MEOA 1L7PA 3AVQA 3CLHA 3P52A 4Q19A 3VX3A 3T94A 4BATA 1YZLA 4ZI7F 2FDCA 1ADCA 1JI3A 1NWCA 3EE6A 5JDCA 4I5EA 2BFPA 5JJCA 5L6MB 1C50A 4HWKA 2DKFA 1Q16A 4CIDA 2BMFA 3OLZA 1E9RA 2EARA 4DE5A 3RE1A 2ZRIA 2IIVA 3LUAA 4QX6A 3OETA 5FEUA 1OIVA 5CT9A 1V9SA 1YS9A 4JUFA 4KREA 2JZOA 2F1RA 2XUAA 5EJ5A 3ADKA 4CBVA 3V1NA 1PV1A 5DSTA 2WAMA 4O8CA 4EO9A 1G5TA 1XMXA 1HQCA 3K16A 1DT5A 3OKAA 2ZI9A 2CLOB 2J5XA 1U2DA 3MJFA 4W99A 1MG5A 3GUCA 1XKQA 3O31A 3BFKA 1U2PA 2ZUBA 2ZW9A 4IS3A 3HB0A 4KXVA 1AMNA 1JEYB 3TB4A 5ALUA 4EPYA 2I6SA 1RJ9A 3O7WA 1DE0A 1QIKA 5K3AA 4EB3A 5KYTA 2IDJA 3IP7A 4UDYX 4KO1S 1DZ3A 2VQ3A 1EFVA 3HCPA 4PBRA 3RYCA 1V8DA 1U0LA 3CR3C 3TCKA 5LD2B 1P0MA 3HP1A 3N2KB 4B3BA 2HBRA 3AF6A 3NEYA 1G17A 1LSJA 4UEJA 3OPVA 3MRXA 1H2XA 1M2WA 1Z0JA 4JL6A 4LE1A 3EIUA 5FBQB 3AKCA 4RY0A 3UUWA 2ONYA 2OYCA 3ZGVA 3C7AA 3F9RA 1PWYE 4G1MB 5IVHA 3M3DA 1PRYA 5B58C 5B36A 3MJSA 3YASA 5DNEA 5CNMA 3BRSA 4MLZA 1BO6A 4Q3EA 1KMHA 2CHUA 2VWPA 2XIQA 4QC2A 2GAFA 4WOCA 1E9AA 5J3JA 4NQRA 4COKA 3RIGA 4RKQA 3PT9A 1MBZA 4KO4S 5E6SB 1XCLA 4NOMA 3D3WA 4GWLA 3TLKA 3V3TA 1KMMA 1W0CA 1TDJA 2D06A 3OCZA 4EG1A 2DWOA 1JE0A 4C3OB 1ZXLA 3V4ZA 4ND4A 4XAQA 5JFTA 4X61A 2I5PO 1QKIA 3HFRA 4Q93A 1FC0A 1YRQA 4RENA 2GCIA 3IFSA 4JUCA 4HDNA 4Q1BA 1NE2A 2RK3A 1DAIA 2I3DA 1TU3A 1AA9A 1QH1B 1QXSA 3WNVA 4X7MA 5JAZA 2IJGX 1H9AA 3CVVA 4ZCRA 3O26A 2BVNA 4HRVA 1JNXX 2Z09A 1B76A 5BY2A 3NWBA 3IDAA 3OY2A 3DJYA 2CCJA 2YMLA 4NCHA 4HDMB 4HO1X 3L7DA 1VHQA 1OY1A 4IJUA 3JQ8A 5LQUA 1QIGA 1RHRA 2R8PA 3GW8A 4OUDB 1SUFA 4IHJB 3PR1A 3GLFB 4RGBA 3GPCA 3T3GA 2VT3A 3NDPA 1X92A 4OKNA 3HXPA 2W48A 3C41J 2EZ9A 4HBGA 3ZVRA 3OZGA 5DM0A 3U3KA 1OFTA 1QO9A 4JB3A 2FEKA 1IMJA 4HLDA 1KAEA 3MQFA 1ZH6A 1YBFA 1U02A 3JWPA 1CJMA 4KE8A 1BHSA 4XTCS 1UPFA 1MD9A 1KC3A 4L3WA 1KQGA 1HE5A 3LKDA 2K4MA 3H2KA 3O92A 5BN5A 1ZR2A 4AJ4A 4PFKA 3R74A 3FETA 4L7VA 3LPMA 4BFWA 3FYUA 4IF4A 4M8LA 5LP6B 2J32A 2Q5EA 2QRKA 3VH1A 2F62A 1R0SA 2EJCA 3IO5A 4RCVA 2YVAA 3TZCA 2OZLB 3FH0A 4KZPA 4MP8A 1XGKA 2DPGA 1WV1A 4WBNA 3ZHXA 3EGXB 4WTOA 1EEXB 3DL7A 4Q9AA 1TYEB 2LR0A 1T0JB 1ZCBA 2VDOB 1CDDA 2FUG1 4UU8A 5LR6A 3B3FA 4GXTA 1Y4AE 3TW8A 3WIEA 3VU9A 4U5QA 2DPMA 3LVRE 3DCYA 3WGLA 4EYQA 2L42A 5M04A 2F4VB 5LC1A 1MFZA 2QRGA 3CX4A 4XX0A 3VO8A 2GM5A 1IXYA 3RC8A 5HGJA 5BWNA 2D6FA 1JEQA 1J2TA 5FUVA 2YWHA 1NVMB 1Y3CE 3FHJA 4K0KB 2BGNA 1J4AA 2Z43A 3GROA 3IQFA 4BQNA 1CUGA 1HMYA 2XYQA 4W9RA 3U3OA 2O6HA 4ES6A 5FX2A 1URPA 2QR3A 3CEHA 3LT5A 5AKKA 3SDZA 2IBMA 2A7QA 4X95A 3DOFA 5K0TA 2VT7A 5LBUA 2HW8A 4ZJZA 3M5WA 5CJJA 2HOQA 1P6XA 5CGZA 2XGOA 3ZJTA 1FSFA 4RJKA 3FMFA 4EKNB 3CBQA 5B2FA 1MNAA 1AO3A 5T64A 1BGWA 4TV9B 2QX8A 3I58A 1THGA 1ULZA 2G36A 2GPSA 3TINA 1VCMA 3T7AA 1OFUA 3N8IA 4O4HB 1QF9A 2I55A 5KNBD 4ZDIA 3HBNA 4A6PA 5A4KA 3GZTB 3EGOA 4I0WB 4Q9IA 5BSKA 3A4MA 2FN8A 4ZHSA 1TRHA 3EAQA 1NU8A 3CSSA 2E5LB 5C8VA 1MKYA 2I76A 4OBBA 4RF3A 5IT4A 1MA0A 2C9CA 3C3CA 3JASA 4Y8VA 4PNEA 3K5WA 2H2HA 1E3DA 4DLUA 4B8WA 2R66A 4OB8A 4B4WA 4MW0A 1N3LA 3UMCA 1XF9A 3LDUA 1R8QA 2XYHA 2B25A 1W96A 2JAHA 5KX5F 1JLMA 1LLDA 1U7WA 3NTRA 1VSVA 1KXZA 3FI9A 3DFKA 4EUKA 4UNQA 5EJ7A 4YMGA 5SICE 1XZ8A 4OK6A 2F3PA 2Y2VA 5DHFA 1T1GA 4BNZA 3PNLA 3OZXA 2G70A 3LLMA 3H6HA 3DDCA 2IPLA 3ZDFA 2B99A 2P3SA 1XUOA 2FE4A 5DLDA 2JIOA 3A4LA 1HPLA 4KIJA 3W05A 2AV6A 1T5OA 4TRNA 5LZ7A 5HXAA 1GIAA 1CVLA 2VJYA 4QUAA 3TFWA 4JI4B 1AZLA 1E60A 4L9WA 3ZHTA 1EVKA 1QCCA 5CFRA 4BC1A 4KEAA 2QJOA 1NN3A 1WMEA 4HNHA 4GW3A 1EM6A 3EGDA 2I2CA 4MVYA 5JAUA 5LPNA 1U7ZA 2D2VA 3OZBA 2WZCA 5GJCA 3AG6A 1OROA 3E81A 4O4IF 4RFVA 2XDAA 3GZNA 4UHJA 3ZG6A 3VHXA 2UXCB 3FB4A 3CW9A 2M6RA 4MV9A 4DTIA 5EP2A 2VPZA 3W6NA 2GN9A 1NURA 1FLDA 2FPRA 2I2AA 1B00A 5A0TA 1GG8A 3E3AA 1WUTA 4MWEA 3H1PA 4OREX 2ZSUA 4PC7A 3IHTA 4Z49A 1KE2A 4Q01A 1D8AA 4OFXA 1YOVB 5DT9A 4DWWA 4MYSA 1QSGA 4NOKA 4WERA 3GEHA 1R0BA 3PDHA 2J3MA 4NAVA 1HL3A 3FPKA 3SHVA 2IZ7A 5CU7A 4ZHQB 1IZ0A 4AXXA 1I3MA 1IDN1 3GQBB 4Q3DA 3U4DA 1JDUA 1LBIA 1NN0A 2FZVA 3QVMA 4UHKA 1PJQA 1I4WA 2H1FA 2QIOA 2WHXA 4OHCA 4LXTA 4ZC8A 5E6RB 4ZOQI 1L7AA 1E2LA 2D8AA 4K6OA 3OLYA 1WD5A 4L8LA 1HC7A 1YA6A 1HE8B 2J4DA 3E5MA 1ZCAA 4RH1A 4URZR 4Y9TA 2Z5GA 4H0CA 2P30A 2W2KA 3TQHA 1D04A 3EG5A 4K6HA 1E64A 3RYFB 3MMZA 3NXSA 2VJQA 2GCEA 5LQCA 2ZU0C 2O8CB 3SF0A 1W19A 2GPNA 3LBAA 4S0ZA 3LC1O 2X2EA 1C41A 4DLNA 2ETVA 3WB9A 4F3TA 2G5PA 2ZE8A 1QNLA 2ZIEA 1P1BA 3PPVA 4XB1A 1SCDA 3I6YA 3H5RA 4H7EA 1WS6A 4F4FA 4TKUA 3KE9A 1E2EA 1G5RA 1LJLA 2WTEA 3VYSB 1EFUA 2C99A 2ATVA 2CWWA 2YY5A 1QWOA 4H31A 5CH8A 5F9FA 2CLDX 3KPWA 4LSZA 2Z6AA 3ABOB 2HCTA 3KZCA 4J7XA 5IPFA 3OQ1A 1KWGA 1P4HA 2X40A 4F3RA 5M7EA 2VQ6A 2Q28A 1XFAA 3U61B 2D1SA 4MULA 3WZ2A 1W5EA 1Q77A 4MPJA 4B81A 3JQEA 3A04A 4DNFA 4BWVA 5GGYA 4J76A 1UDXA 4DQDA 5CT4A 4TLCA 5K51A 2F9FA 4ZVTA 1IN8A 4D8WA 2RH9B 3BFXA 3C4QA 3KTFA 3TSYA 1T35A 4KQFA 4ZODA 5KDLA 3EXG1 1EFKA 1HZZC 2JLXA 1IBKB 4NMHA 2DUWA 4YIHA 1B42A 2V3WA 2BC9A 3QY9A 3Q9SA 5L3VA 4YNBA 4EI2A 2V65A 4O4LF 1IXKA 2H7YA 1ZD9A 1BFDA 3C74A 1FMFA 2OQRA 3CR8A 3AEUA 3H2SA 4MUYA 3HCWA 4NCJA 3LUHA 1IY0A 1ZUNA 2HGZA 4JQOA 4E5SA 5HJEA 4GOOD 1NW4A 5BUZA 1VB3A 1JZSA 1QPGA 1EDZA 1ODSA 1PDVA 1PGJA 3CIOA 4PINA 3RU2A 3SMVA 5K0EA 1NTOA 1PZEA 3HEAA 1GYRA 4NU5A 4LJ9A 1FFDA 4M9RA 1IK6A 3E7FA 1UK9A 4RKEA 2W2QA 2AZMA 2GH1A 4UHFA 2W6MA 2X3UA 4JITA 3OQMA 2CJWA 3QV2A 4D3ZA 2WW8A 4F71A 3MHTA 2DHQA 1JPJA 2QZPA 4JQZA 5TQVA 4BN5A 1CHNA 1Y1TA 2DE0X 1ZSNA 3JD4A 1NLYA 1T8YA 1I8TA 3CTPA 4RE6A 4WXEA 4A6XA 3HUFA 4ZZ1A 3T9CA 4EDHA 3O5AA 2J6BA 2PZEA 5C8DA 2ZUCA 2ODNA 4TSKA 3SC2B 3PFCA 1BDIA 4BVGA 2RGGA 2BDUA 1RSZA 4RTQA 3HXTA 1OD6A 5BORA 3TNJA 5BPHA 5EJIA 2B78A 1P8JA 1QJCA 5LZ2A 3LY9A 3OU7A 3NYRA 1EXMA 1M34B 3S27A 1N0WA 1W73A 5JD3A 5B4TA 2G63A 2XW6A 2GHIA 4FJ1A 2Q2VA 4I55B 3PI7A 4ZI5A 2YYSA 1G7TA 2X8AA 1EIWA 2O1SA 1U2ZA 2F59A 1CZUA 1V8OA 3CE6A 5FR1A 4KK4A 2WC1A 3UJ7A 1DINA 2CSUA 2MSKA 5BW5A 2QN6A 1W9MA 3V46A 2CNOA 2JJQA 1T26A 3CSUA 4DILA 4F5DA 2QY6A 1J0AA 4RLQA 2IEGA 4AT1A 2DOKA 4UMEA 2E6KA 2EATA 4O1MA 1JS1X 3PC4A 2QNRA 1E1CA 3VU1A 4Y6QA 1AQUA 4M60A 1U28A 5A6SA 1RPJA 3GGOA 1WVGA 1M0TA 1DQNA 1TAGA 5E7MA 1R0RE 2HYDA 3EEFA 3H6KA 3M9XA 4NMXB 4R68A 5EJGA 5ESXA 5FWDA 5SYNA 2R44A 1EJ2A 1W35A 4QFBA 1SXJD 5ECDA 1F12A 1NJ8A 5BV7A 1M6EX 3MOGA 1IWPB 3B1JA 4UTOA 4J43A 2O1WA 4N18A 1QC5B 3OPQA 3HXMA 4MA5A 3I34X 3AVVA 2ZRCA 3KLOA 3NPMA 4RSHA 4EPVA 3GJ4A 4KG7A 4CKBA 3B1ZA 3Q8XB 4ENWA 4MAAA 3PNKA 2H0RA 3K72B 3UGQA 3I0MA 1N78A 1NF2A 5FPPA 1GZVA 3FR7A 3IODA 4HRXA 3O8CA 5BYAA 4D9IA 1EPUA 4IFTA 1F9AA 2B35A 4X0EA 4O1IA 4KE7A 4CF6A 5AIBA 1V25A 4JYPA 1FTSA 4FYWA 1Z4QA 5AMXA 3I4FA 3Q7IA 4RFSB 4FYIA 1CUHA 1QHSA 1P3DA 1GRVA 3NNDA 4I6GA 1F0PA 2W2XA 1IRIA 2FH5B 4MUBA 4RVHA 3S2EA 3TLBA 3E0XA 4EABA 5J2TA 2P78A 3VYVA 2VDLB 5AW5A 3IRVA 4GRIA 2P0AA 4KL8S 3DEJA 4YQEA 1V1RA 3ETHA 1JPUA 4TPKA 1M2KA 2HMAA 3AFOA 1GUAA 1SBZA 1Y63A 4PQFA 4EWLA 5BMVF 3QH4A 2XQJA 1E1RA 3I6QA 4KHZA 3COZA 4BMXA 2F48A 3I83A 4UVIA 2ACKA 1UBSB 1JFRA 1KYWA 1QZUA 4P4UA 5HWSA 2JEYA 5TS2A 3SOPA 3TNYA 1G4AE 1BW9A 1CETA 1Z4JA 1HBJA 4US1R 3CO0S 2XCRB 4ID3A 5SY6A 2IV2X 3NUQA 2RGWA 1H1TA 4B83A 2EBFX 2WTNA 4AF6A 4V3CA 2MJLA 3CY6A 5LCXA 1U80A 3PCTA 1NZJA 1OBVA 2HKIA 4IY1A 3O83A 1M7HA 2QL7A 2EFGA 4DMRA 1NMYA 3GA0A 4G85A 3DKIA 1IATA 1L7BA 3WSVA 1U7UA 5E38A 5T3YA 1YVDA 3WSWA 4DIOA 3L07A 1JJVA 2YINC 3VDQA 2O4CA 3EMBA 2QROA 4OXNA 4BLVA 1GO2A 5CM2Z 3KJGA 1U0GA 2YMPA 3K4QA 1QKJA 3BTOA 3Q5GA 5JZVA 3RJMA 2AOWA 3K70C 4EZBA 1SIBE 2Y2UA 1PT8A 4L02A 4LOAA 2OPBA 2JPDA 3WLIA 3DDSA 4AM8A 3H65A 2IQ5A 1X94A 4X85A 3EG9B 5C32A 5HZMA 1M8FA 2H4WA 2VATA 2ZUSA 4PPQA 4F2PA 4BB0A 2Q5IA 4QEZA 4XYEA 4AF7A 1YU6A 4TUYA 1LI5A 1G2PA 2PZAA 2YR0A 3QELA 1ZZGA 3R3JA 4AUNA 4JNKA 4WLEA 4OAQA 1D2NA 2V8BA 4QDOA 4EBFA 1BHJA 2IHYA 1IN7A 1BCRA 4HY3A 3RK0A 4L85A 2FRDA 3PQ4A 4F56A 3OCWA 5FPKA 3BXXA 1RYZA 2WILA 4C0JA 5KNDA 3VI4B 3TLXA 1R4MA 1CVRA 2NUAB 4PGMA 3IUEA 3C15C 1S4QA 1G20E 4BCCA 4MR8B 4G81A 5KAMA 5P21A 3GRKA 3WYFA 2FVYA 5AVWA 2H4ZA 3IKTA 5JISA 1YS2X 3PIIA 4GX0A 4MI6A 4FMDB 1ORIA 3KAQA 3AKZA 3OC0A 1WZCA 3W1VA 1UMBB 3L8ZA 3FPLA 4GOND 1RW4A 4WXRA 4PRKA 1E0KA 3UGKA 3WA7A 5A4IS 1OHHD 1BSVA 3A1TA 3ZBUA 4YGXB 3HWX1 2C3MA 3KBBA 5EEHA 2JW5A 3FHTA 3S7ZA 2KX7A 5E2BA 4MVJH 1N3YA 1SBIA 2JHPA 4GLLA 4YHHB 2JIPA 4FIDA 5ELMA 2V55B 4C7OA 1X87A 1XTUA 2WMDA 3MTEA 4OMFG 2AW3A 1TTHA 2GAOA 2W6JA 1QGDA 1OLOA 1DUSA 4KVGA 3T5DA 4X6YA 3QQPA 1XEXB 2PL9A 4BN4A 1II0A 1A2KC 5EJFA 5DNYB 5IVDA 3NNNA 4UULA 4EB6A 3PHGA 3P2JA 4ZD6A 1N0VC 4GR4A 4XLLA 1M6YA 5AVJA 1GXSB 1BX3A 4MWSA 2KHZA 2IH4A 4CMHA 3GLRA 1C3XA 1LZLA 4D46A 4YUZA 5IXSA 2JFUA 2GVNA 3BMOB 1U9IC 1AD2A 3MK31 3NCHA 4XUCA 1QHGA 1ORWA 4LISA 1G5IA 2BFEA 3EC2A 4M1WA 3U0BA 1BMTA 1V7CA 1PT9A 4GLOA 5KC8A 3RRYA 2O7RA 1TL7C 1R50A 1JSZA 1O95C 1A69A 2GFHA 4NZMA 5CFZA 1D6MA 1NDUA 2I2WA 5EIBD 5CM9C 4OX9Y 1FX0B 4ZQCB 2GJSA 4FFBB 1U1DA 2IVFA 4KAAA 4C4AA 2OEPA 3OU2A 2ZQ5A 3S2IA 4ZICA 1NHGA 2JCYA 2CLCX 3F78A 3LYAA 1VMIA 5DGTA 3IP3A 1HOXA 1TQ4A 2FFJA 2GKOA 3PGJA 4AWAA 1AC5A 4L9RA 1Q1AA 1IAVA 5F76A 5H59A 5BYBA 3GH3A 1JIJA 4TV8A 2OCXA 1CQIA 1GNTA 2GRUA 4EA6A 3HFGA 5ERGB 2QD3A 2HK8A 1C1XB 2G1AA 3K0CC 1KERA 2WT9A 4L4ZA 2HH9A 1UDWA 3DCJA 5E2AA 3SQXA 5HK8A 4YJDA 1XB2A 4POAA 4JIMA 1QFJA 5E9AA 3ET5A 1W4RA 3F5MA 4MKIA 5EXTA 1TAHA 3FF4A 1RD4A 1FP2A 3L41A 1HZJA 1J2UA 5CURA 5AHKA 4R8SA 3USZA 2NO0A 3HXLA 3TDMA 2BGJA 1B8OA 4L2IB 1HH4A 1SC1A 2H4HA 1QR6A 3G89A 5FADA 4KE9A 5I47A 2UZ1A 3MJVA 4HDCA 3M1YA 1O6CA 2WU4A 1W1IA 2ZUWA 1YS1X 4X84A 4RNCA 2P2DA 4Q37A 4KU4A 5AHXA 4PLHA 1O6FA 2XUDA 2YWFA 3GDFA 5DXAA 4Z2YA 2CFIA 2RGNA 4U0KA 1KIMA 2QB5A 5TMPA 3AM1A 2WJIA 4Z1MD 3TR0A 5TJHA 1WX1A 3DAYA 3UWSA 3OLWA 5K3DA 4PYJA 1ULTA 4DRYA 1P39A 2EBWA 4YPFA 2ZYRA 4M1EA 1JEDA 4DFDA 1E1MA 3K31A 2FPWA 5DOVA 4YCCA 1CUSA 4BNJA 2IPMA 2X9LA 4ND8B 1JHVA 5T6MA 1H6DA 1TCCA 1IB0A 5CLIA 3U4CA 1PZFA 4ARSA 5GZ1A 4BBJA 4GI5A 3UMJA 1WLYA 1BOFA 3HRHA 3PYXA 4R2HA 4FW8A 3UT5B 1I3OA 1QB7A 3RJ9A 1R0KA 2VQDA 5LQKA 5JVDA 2YJ6A 3KQYA 3Q1LA 1Q6YA 1E6KA 4P4SA 3IV9A 2GJ4A 2V6GA 1A04A 3BM5A 4YJ3A 3QEKA 4PU0A 3GJZA 5AUNB 2FSVC 3GEIA 1MOPA 4IX1A 2EDCA 5D87A 1NBOA 1J20A 3FUTA 1XCPA 1RHQA 4KZKA 4AZ0B 4DCJA 3TOXA 4ND2A 1S2NA 1TE2A 4FVTA 4RFLA 4C1NA 4D5EA 4HNGA 1O6ZA 4HATA 4PXAA 3QYJA 1UAAA 1DAOA 3UJ6A 1TYZA 1PL7A 2QGNA 2WD7A 4YMLA 3F74A 4W63A 2H1OA 3OM9A 4CL3A 1FZTA 1J00A 4QBIA 1M5UA 1V16A 5BQ3A 1AZSC 3LSTA 3M0EA 1FJ2A 1IBSA 2JKYA 5HKKA 1TEZA 1D4AA 1YZKA 2PSEA 4RH0A 3FNHA 1AGXA 5FA8A 5AT1A 5THXA 4PSCA 2GDJA 4IIJA 4KSBA 3F7NA 3S5UA 3FPEA 4OMUA 2WLSA 4OJMX 5P8WA 2JGIA 4BV9A 4C01A 3JD1A 3VKUA 1BS1A 2NXWA 1GDTA 3GLTA 4IV8A 2YZKA 2REQA 3EAGA 2HMYB 4NPAA 3U13A 2P5YA 1SZCA 2ZS8A 4ZN6A 2DPYA 2O19A 4TLBA 1R37A 2WU1A 3U1BA 3T7SA 2R1TA 4YA6A 3G6WA 1RWXA 4B75A 3T6KA 3OCVA 5BP7A 4A5SA 3AV3A 1MJHA 4YTEA 3P2MA 1PVDA 1TLFA 3EWSA 3GGCA 3VO9A 5IC4A 1GY8A 1OZHA 1USGA 2EWWA 2RHHA 1Q1BA 3MS4A 4WE3A 2JK0A 4W7SA 5AK4A 3RSSA 5MF6A 1R4NA 1Z9BA 3U3JA 3NT2A 4AG6A 2HA3A 1O1YA 2JCVA 3DZDA 4OGGA 4UM8B 3TAHA 3K20A 2WAOA 1BEEA 3LLVA 2JS7A 1CDOA 1MQSA 1UPAA 1DIAA 3REFA 1T5LA 2FLWA 2QX6A 1L4KA 1DWPA 2PPLA 2A7XA 2QN7A 4TMVA 1UDCA 3AC0A 3GBVA 1Z29A 4QPJC 3SXPA 4OM8A 3ZR4B 4OXYA 2GESA 3ZNQA 1N5IA 1VYTA 5FLKA 1JX6A 4CMCA 2AOUA 3G7SA 1SRQA 2R3SA 2QSZA 4OHFA 4K7JA 1XMJA 2C00A 1OBHA 1X1RA 1ZESA 1K9VF 4JC0A 1PSZA 1IEQA 4ZV4A 4ML3A 4HPJB 3K9WA 4TLMB 1KYYA 2F64A 4D1YA 2H1LA 1BTOA 2HEIA 1EHCA 3GEPA 4HYTA 3CZ4A 3A2MA 4MW6A 1QOPB 1DG1G 5JG7A 3MWDB 1PJ3A 4Y6RA 3KQSA 1A50B 3B5JA 3EBLA 2D7DA 4E5KA 2OESA 4FGWA 5CXXA 1VPVA 2DQKA 1C9NA 2SKDA 1ZC4A 2XHZA 3GRAA 3CJQA 3E7PA 3KV3O 4P08A 3R9KA 5JCZA 3EX7C 1D1QA 3EGCA 3EYAA 3OM8A 3PU6A 2OV1A 2BAGA 3LC7O 1NOIA 4L6CA 3UWDA 3MCUA 5JHGB 3RUEA 3TUZC 3M5DA 2XWJI 1XHFA 1CQXA 5H02A 1UXJA 3QU5A 1M10A 1NKVA 3DW3X 2ZI3A 3JQFC 4KH0A 1I3KA 1M0WA 2P0EA 1DVRA 2WM9B 4UU0A 4IGIA 2BJVA 4PX3A 1H6BA 1OLUB 4PQRA 3A6EA 1XLUA 4PLYA 4R71A 4BVJA 4LMAA 3SZGA 4XPIB 4YR7A 1CY7A 4OHPA 1M1YA 1NKSA 4Z0NA 5IXYA 1KRHA 3L0CA 4QXRA 3G68A 5TPWB 1OCEA 3TJMA 1IBRA 4GPZA 1MC8A 3SS9X 3FZEA 5EXSA 1SXQA 1ZKMA 2ZRQA 4M3NA 5ERXA 1DIGA 2C8KA 4WNAB 3PNYA 2O1EA 2GXUA 4HDQB 1TK2A 4R84A 1FS5A 2CLFB 2DU8A 3OIWA 1OLSA 2H5LA 2B30A 4LOJA 2P3QA 1ZW1A 3SU8A 3NBQA 1K5GA 5F33A 2FJ0A 5AI4A 1RACA 4E13A 4U02A 2G1UA 4S12A 5C0OE 4EB0A 5HVNA 2IELA 1ZI6A 3P2IA 4JELA 5CNIA 3I01A 3F6SA 4LHZA 3NYIA 1MFPA 1CFZA 2J6IA 1ZH4A 3FA2A 4ZRMA 1EZ1A 1CR6A 1JVSA 1FSSA 1BRTA 1YS6A 2V7XA 5EVJA 3CG4A 2HT1A 5LA6A 5J59A 1RZRA 2ZPUA 4QDXA 5TT0A 1KZHA 1UXOA 1ZK4A 5LP6F 3OZ7A 4CMIA 1G2QA 4DHWA 5CCDA 2ZJZA 3OT1B 3EEIA 4LFCB 3TL3A 3ZGNA 3G2JA 3RIXA 1VFNA 3QVWA 4OMCA 1FRZA 5BN4B 5LLSA 2PZMA 3EFHA 4B3HA 2QZJA 2G8LA 3HFSA 2WTXA 2YNMD 3IQWA 3BG5A 2BGKA 1RU3A 4KO2S 4UOEA 1EVQA 1A4XA 4TTTS 1BXZA 3GMIA 2QLMA 2PMBA 1TZ2A 5ETJA 2QAJA 1DC5A 1GNPA 2F55A 3UHJA 2GJAA 1Y5NA 3CXUA 1HDXA 1U1EA 3OMLA 2ZR9A 4ZPXA 1HFKA 1G0OA 3FDIA 3GLGB 5DB4A 3MJDA 5HW0A 1L8LA 3I04A 1FOEB 3EBPA 2X8JB 5U1PA 4XVUA 1G2OA 1OYWA 2B7LA 4DJTA 3QTLA 1QO0D 4F8JA 3H2IA 2BMJA 4YMUA 3DTVA 4P5DA 4Q3LA 1NSYA 1U6KA 5AJXA 3VNRA 1UUFA 5BSMA 1IN4A 4NJEA 1RQPA 1N4DA 1GPUA 6Q21A 5CDSA 4LZWA 4LGMA 2JARA 3VR4A 2YW9A 4KLAA 2D7JA 1C7QA 1NOJA 3QWBA 3I53A 4ZK6A 1ZIOA 4Y2QA 5FKJA 1QAQA 3OF5A 2NNLD 3LUJA 3I30X 3OE1A 4GFDA 4O4HF 5LYJB 3JTEA 4LA4A 4D4KA 2HPAA 3OHPA 5CDTA 5ALYA 1UBEA 3QKWA 1P19A 1AKVA 4IVPA 3Q8LA 2VP2A 2IOQA 1Z74A 1NPTO 2OCIA 4J0GA 4F4CA 1H2YA 2PD3A 1VE1A 2ECQA 2OY0A 3GLIE 4B6GA 2V7QA 2YWGA 1MZVA 2JD1A 2C2ZA 5FLYA 4A16A 3HN6A 3O47A 2OB1A 2Q5FA 4P6VF 4DDVA 2ZJYA 4AO7A 2CNLA 4UMVA 4EECA 5CB4A 2OCYC 1ABEA 5JU6A 4YBRA 1ABBA 1PF7E 3CLRC 1P61B 3QA3E 3FI0A 4CCYB 1EM8A 1LGYA 3A10A 1IWBB 1GPDG 1Q19A 3QFSA 4B5LA 2QUIA 3CLUD 4D3YA 5I51A 3E22A 5LB2A 2NZ8A 3QPBA 3AY3A 4OQPA 1LVGA 1NQVA 3STXA 4Z4GA 1ZH0A 3QW4B 2Q3LA 4J0KA 4YXFA 3U5ZB 1KPGA 4QHSA 3I5YA 5IJ0A 2O57A 1EVYA 4FFLA 5EYPA 3PXDA 1OZAA 4HL6A 1VTKA 2GVZC 3G2LA 4UHCA 4Z0TA 3F1KA 2AQIA 8ABPA 1RYEA 1E94E 2NO1A 1A9SA 2WKRA 2GTIA 3DEZA 4F3YA 1MR3F 4FGJA 5FWYA 1YMVA 3TW0A 4NULA 2NN3C 3T61A 3MD0A 3KQHA 4HMPA 1MNQA 2X14A 1YRLA 2PNJA 4UXIA 1WA5A 1TYBE 3AOEA 2XZTA 2AN3A 1J42A 4O8ZA 2A0UA 1S1CA 1N8TA 1S2GA 1T2AA 1T4CB 1ZGJA 3NDBB 3D2CA 1NVTA 4UZFA 1HFWA 2PUBA 3CPSA 4DSOA 5CHEA 4DCOA 4LC0A 4A2QA 4HH3C 4DDUA 3R9IA 3D3EA 3O8QB 5DX0A 1J1UA 1X8XA 4JC5A 4CMKA 5IMSA 4P80A 4DREA 4ERNA 3LDHA 1KNXA 2XB6A 2VK4A 2IGTA 2JRCA 2V0CA 4MO2A 4YI3A 4KJZA 4BX9A 2J3JA 4FYKA 3SJUA 3PWKA 1PX2A 3V7NA 4ZHQF 1LB1B 1A77A 3N2EA 4PAOA 2CVQA 1NDQA 3E5NA 2TYSB 3K8YA 3CTMA 2J33A 2R65A 5KCMA 2GPAA 4LPKA 4D45A 1XI2A 1EGAA 1RAAA 1E1LA 3BMQB 2Q5CA 5K3BA 2OGTA 4HEQA 5CLFA 1V1MB 1RRGA 4EO4A 4EVRA 5AJYA 4KPUA 4PXYA 1KYTA 1OVMA 1ZRNA 4UAVA 5DKFA 4B46A 1NP3A 3MJTA 3TQCA 4G2TA 1YI0A 3I2FA 3QUBA 2BFDB 1T2NA 3TRKA 2AE2A 2PH7A 3IQGX 1C0IA 5KNBH 3OFNA 5KU1A 3BIOA 4ME6A 5FQOA 1OX4B 5DIZA 2G28A 3KKNA 1A5TA 1NJFA 2QJTA 2WP8J 1N0HA 1PQUA 2YOFA 1EDOA 4ENRA 1WPXA 1VCIA 3BCUA 3K5HA 3PUXA 3IXLA 5A0FA 5JARA 5BR7A 1ULBA 1UR5A 2VF4X 4M99A 3TEJA 5AKHA 4ACAA 4HAUA 1Z73A 3QKRA 1HETA 3SGLA 4XX1A 2VQEB 4IH9A 4EO7A 2Y99A 3OD5A 2PUWA 3M4XA 5KJEA 4QKQA 2K2QB 4FCCA 4JLPA 5JZ9A 3GEMA 4D9EA 1T8SA 4MINA 2ZI6A 2H7XA 3T7IA 1JKXA 5AI8A 9ATCA 2HF8A 3HBJA 5KHLB 4H6VA 3ZW9A 5A7HA 4P86A 2VVTA 2G1KA 2W22A 5CEEA 1RXUA 4CQMB 3BGWA 1AZWA 4C76A 2CYAA 1LPPA 1SWVA 3DHWC 4QYMA 1ML3A 1YGPA 3A1WA 3KPVA 4N9QA 5F21A 2A5LA 1OWMA 2G7MC 2IXBA 4KC0A 4GPBA 3EQ6A 4Y6GB 1OTXA 3DTTA 1IMOA 1TXGA 3K1AB 1USVA 3RS8A 4CKWB 3OLCX 3A1DA 5IWAB 2C0PA 4GXRA 3SIRA 4EA7A 3IC5A 4DNXA 2IS4A 3WIDA 3WRYA 1NQAO 2X7HA 8AT1A 5JSUA 1JLKA 4DC9A 4KMOA 1W4BA 2JDIA 1Z6PA 3AUAA 1E1NA 1Y9EA 4ZVUA 2OCDA 3RW9A 3AF2A 5TC4A 1ZD5A 3A37A 1E61A 2HCBA 4Q16A 4GLBA 3F2IA 3GNQA 1YE5A 3C45A 2RKOA 5FUYA 3EUEA 5EMNA 2A5FA 4LHSA 2P9FA 4C4YA 2KYRA 5U4QA 4FLEA 4OQLA 5B37A 4IILA 4LG1A 4WNYA 4YS6A 2ZZNA 3F6PA 4XVHA 3VAZA 4XPZA 1UK8A 3X1KA 3C1AA 4KMRA 4S0XA 4E32A 3WSTA 5DMXA 5FV7A 1U8YA 3RWOA 3HCAA 2NU8A 2Y0DA 3WR5A 4B35A 2XRFA 2HSDA 1JN0A 1OTYA 1K6XA 1U4SA 3RTAA 1T8PA 3OTOB 1HDGO 1TW3A 4F6LA 1FDWA 5A9SB 1FMTA 3L2OB 1KDRA 1PZGA 3FSGA 5HJ2A 2ID9A 1FYVA 2YMQA 4RZIA 1R5BA 4AMZA 1D2GA 4I55F 1VDZA 4QELA 4ZARA 1PFGA 3BB3A 3TJRA 1HQDA 4HNRA 3TTUA 3THXB 5DW3A 4Y9RA 4ZYXA 4DIBA 3VOBA 1KJQA 2Q5QA 3LPNA 2BSQA 1ADYA 4I1RA 5T8KC 2C1EA 4CNBA 1UP7A 2HQSA 4QU0A 3TSZA 2BTOA 2Q0XA 4MMXB 4X00A 5FBHA 1OXSC 3TMAA 4N41A 4ZI7A 4EJ0A 1EXWA 5JLAA 2VNKA 1JSCA 2V7WA 1JE1A 4PAGA 2Q6TA 1AKUA 3VKVA 3HA3A 5EUMA 5L3QA 1FJHA 1WL8A 3CEJA 3MQ4A 4FGLA 1MMFB 1RM4A 4YJKA 3SIXA 4CG0A 1O03A 1OX5A 2CNWA 1F7UA 1JLSA 4BNXA 2JFVA 3L6DA 4B4UA 2EKDA 3Q6IA 3P26A 1A7AA 3KQLA 3R5JA 4B6RA 3QPDA 3C3BA 1PLLA 2G9VA 5DWVA 3O0TA 3EMKA 4IG4A 2VYVD 4NOJA 3VR5D 1UBTS 1I36A 3KPJA 5BWCA 3RAEC 3TD6A 3RUCA 4QQKA 1WXGA 3UUEA 3ETGA 2Q2NA 3ESXA 4PBTA 1SBNE 1JR3E 3OHMA 3OWHA 6YASA 1GQ2A 1G0NA 1G8AA 2P3LA 4Z1OA 2E1PA 3QLUA 4C21A 3PQ5A 4F6RB 2HK7A 2OR3A 4MWGA 2PWAA 5F7JA 1A0OA 1ZVKA 2GNAA 1AU9A 1K68A 1SHKA 2M98A 1TFRA 1KP9A 3BL5A 2IBTA 2X6RA 4LV6A 1IB6A 5E0OA 4P98A 1PGQA 2VHTA 3IUMA 4R1SA 1XDDA 1QPBA 4R3UC 3G9QA 3N2ZB 1SU6A 3LOQA 3OI7A 4QXMA 4XUGB 1HORA 3H0KA 2WPNA 5JSFA 1B6GA 3LO8A 2XA2A 3OC6A 1II8A 3IIIA 3QKSB 1Z25A 3QRWA 2OMEA 3W6PA 1A97A 3N7AA 5SYMA 2L17A 1TU0A 4IIHA 4KR7A 1E66A 1AUOA 1KP3A 2NPOA 3OCCA 3G49A 2FV8A 5H9WA 4RZUA 1I4LD 1Q7RA 2K2WA 3OZAA 4NV1A 2H17A 2XPCA 3SHOA 3DBHB 2JFPA 4B40A 3O9MA 3PUJA 4O6VA 1WJGA 1ZQ9A 1G21E 1UDBA 2B7CA 4Y18A 1L3CA 2I1QA 3H1GA 2ID7A 1VSQA 1CVIA 1JG1A 1KIFA 3FDXA 1JXQA 2VRWA 3TUJC 1ONSA 4DLLA 3DS8A 3INTA 4LJAA 3TR5A 5G41A 2JEZA 1MXHA 3SD7A 3AM4A 5FOTA 3HKCA 4I2VA 2BI7A 2NVUB 3EVZA 3WE7A 1P7VA 2ZJOA 4ADSG 3TGLA 4Q7LA 2W58A 1O9GA 3E3NA 3LGAA 4L9SA 3RCBA 1AHHA 2RGYA 5B6JA 1MT3A 1XVIA 3O1IC 1AVTA 2YDXA 4J2TA 4ENPA 3PJFA 1CPYA 2PVPA 4D9BA 3T5CA 4EG7A 4M54A 2XCTB 4QEDA 2Q2WA 2DFDA 3LBHA 5DHTA 5FF9A 3RVOA 1O4VA 1UBJS 4J0QA 1WXHA 2PM8A 4OTZA 3RFFA 4PEVA 5DGXA 4B6SA 4CM5A 1W47A 2X0IA 1IXSB 2FWIA 4Z6KA 1Q6ZA 1FYDA 3DWGA 5KVVA 1RR6A 4C7MA 1YB1A 3H9QA 4YPVA 3L77A 2GD1O 2PAFA 4MR9A 5ALXA 1QYWA 4PRYA 3G79A 2PLAA 2QRUA 4DTCA 5IJ9A 4LJSA 3DONA 3AFHA 4MH0R 4CQLB 1C9EA 1THTA 2DP4E 3BL8A 2DFTA 4G09A 2YQ5A 4K5QA 3GP5A 5A5DA 3NI2A 2Q4EA 5KYXB 1U0EA 2QTCA 2YIMA 3F4KA 4I36A 5TVGA 3L18A 3WQHA 2J1LA 2VHQA 3GRPA 4D6YA 3RHZA 2Q6LA 2XODA 2M9MA 3WP1B 2PO5A 4EVSA 1NV8A 1Z12A 2CBXA 2CD9A 1PLJA 3QM1A 3OOEA 3CLKA 3F3SA 4DB4A 2E0IA 4HFNA 3A3OA 1W4AA 2VIIA 3PC6A 5ALTA 3R7SA 1RXVA 4DIDA 3LQ2A 1TVCA 1M6HA 1QHHA 2VAXA 2XYRA 3DV2A 4FMDF 5T3UA 3WL4A 4ALNA 1YNSA 5BV1A 1IBLB 2QDKA 4B0PA 1XTVA 4UVHA 3WBKA 1YCGA 4M98A 4S05A 5FFMA 3FNIA 2YHIA 2WVJA 3EQ7A 1BVRA 2GBPA 1Q1EA 4V0KA 1NJGA 3AXTA 5JWHA 1UH5A 3H5WA 3DZBA 2GK6A 2HHLA 2IUEA 3G9XA 1XCJA 3H4MA 5LZ4A 2D0DA 5HM6A 1JIUA 1MQAA 1Z2PX 2Z57A 3KSZO 3VJKA 3OF2A 3U19A 1RZVA 5EJAA 3SKYA 1TJ4A 1ECGA 2G5CA 2YHUA 1ANKA 2H1VA 4N6OA 5L7TA 1YB2A 2Q0QA 2WAXA 3ZBQA 3G7NA 3MWKA 5AM4A 4F38A 3L8EA 1VRCA 1KH3A 1YDGA 2PZFA 3NS7A 3O3MB 3QVGA 3A6DA 1RWBA 4K3UA 1HOTA 2QENA 2BFFA 3HB5X 2Q1WA 2WZDA 2Q3MA 4PGAA 4HQKA 5CW1A 2R4TA 1NBMA 3V4SA 4YAJA 3ORSA 4W5HA 2HNKA 1SHZA 4MA4A 5F1PA 5FOSA 4RPJA 4GP7A 2DFKB 4YJGB 4KFRA 2ODBA 1RM3A 2J8ZA 1E8NA 2QSUA 4B3JA 1NC1A 2H57A 3VR2D 3BD6A 4MQEA 1MF7A 4N6NA 4ITVA 5GOZA 1Z6TA 2YIDA 3R7WB 4AMBA 1EUYA 5IKEA 3ZEIA 1JEJA 4ZKDA 1RCUA 5AM5A 1NLZA 4C07A 1Y7IA 3E3OA 5GIPE 5EHIA 1IPHA 2AZXA 4PICA 4UFNA 5C7OO 1L7VC 2PD4A 1BJTA 1CR1A 5JQGF 1CUDA 4YONB 4HK4A 1DWQA 1ULSA 3FKSA 3HXKA 3PB3A 3IS3A 4QPDA 1M2EA 1NUHA 4ZQFA 1E62A 4HF7A 2QUJA 5KX5A 2Z6UA 3BMCB 2C31A 1PR4A 3WLQA 3G8DA 2PUGA 2VBFA 5L3SA 1RJEA 2VAMA 4RDIA 3VPXA 4MGIR 2YDYA 1ZMOA 2W2LD 1NXPA 3GLSA 1FNCA 3OLVA 3EVCA 2ZSAA 2SKCA 4WZBA 4L27A 3T3EA 3ILVA 2QG6A 4J0JA 2XUGA 3LA6A 4J49A 1G63A 1RWQA 1PK7A 1M33A 4MVJA 2WJWA 2C2KA 1A76A 2CY0A 2FFRA 3NV7A 1L9KA 2BMEA 2GFIA 3IVMA 4QUBA 5GOTA 3FTFA 2BZGA 3L7BA 3V8NA 3V4LA 4AS2A 2FKNA 1K92A 4J16A 1X9HA 1GGFA 3CYFA 3KQOA 4QQFA 4J3NA 2WWHA 1EBUA 3BZUA 4UUAA 5KHOC 4MWCA 4ETWA 1JKIA 2XNKA 2NQTA 3OZUA 4DRXA 4IIEA 5C37A 1K3FA 5FXMA 1SVWA 2PSHA 2FPIA 1L5LA 2XCLA 2NUPA 4LCBA 1XN1A 4MGZR 1MOSA 1B7GO 1DEAA 2DBZA 3D4BA 3G0OA 2OB2A 3MWFA 3M3HA 2YXLA 4B44A 4W5WA 4BKRA 3GDGA 3WWEA 1EFRA 2VHVA 2PPVA 2GM4A 4IHAA 1O4WA 5HQJA 1YDHA 3H9GA 1I2CA 3D3JA 3V32A 1Y8ZA 1N2GA 1E4EB 3D02A 4N3AA 4TSFD 4HQ6A 4A8JA 1FVXA 2EFEB 2EV9A 4KV7A 1SBTA 1BEZA 4TZTA 2EXXA 5C4GB 3ZD9A 1DDGA 1W85A 1REQB 1WP9A 2QL6A 5EWMA 5JD5A 4TX1A 2PUJA 1X7WA 2IVZA 5BVGB 1E2FA 2W83A 3I9OA 4XIIA 4IJWA 1J6UA 2FZLA 1LX6A 1ZU5A 3FIUA 5FB3A 3CF6R 4UE6A 1R3DA 4W5RA 5IF3A 5DM70 4AG5A 4K9MA 4NAHA 2PXAA 2RIPA 2BEUA 4XIYA 4JC4A 3T0IA 3C39A 5HR5A 4I99A 2F43B 1GCUA 3TGWA 4PVCA 4I4LA 4LYGA 2ODWA 4TZ0A 4R2WA 1JHRA 1UMDB 4WNIA 4IO1A 1LPOA 1ZR4A 1UZMA 2I6TA 4ISCA 5G1PA 3FUUA 4NZ9A 3BDVA 1SCUB 5I8PA 1U9YA 3E5HA 4MQFA 2CNBA 2LV8A 3UENA 1P91A 4CWAA 1S96A 3P9IA 2R8EA 2Z5VA 4YJHB 3K9CA 5F35A 4YAKA 1EB8A 3L5KA 2F8TA 3NDRA 1CZRA 1GZDA 2IOFA 2OGUA 4Q7JB 4YRCA 5IP5A 3R24A 1JWLA 2QZ4A 3QY0A 4WFQA 1CRWG 1C3JA 5EWJB 4HH4A 3VC3A 3ONVA 1DKOA 1ODIA 4JLAA 1L9XA 3FOAA 6LDHA 1DC6A 1EJ0A 3WQRA 2OL4A 4UW9A 4F7DA 1FYWA 3RHTA 4B6EA 2JGNA 3E9ZA 1PT6A 3LW7A 2J6HA 2IY7A 5EIWA 3WTBA 4XJXA 3TLGA 1P7WA 2ANBA 2H3HA 1JKJB 2I99A 3HP4A 1XRJA 3WGMA 4CM4B 1GQYA 3SIPA 3FLBA 3NU1A 4CTOA 2IXAA 4L3OA 3K70B 1WULS 3QSYA 4OGKA 3GT0A 4BAZA 2FUKA 4QTTB 2AFHB 2B8EA 4MHSA 4MEBA 4D80A 3A9VA 3M6FA 5EN4A 3ZWNA 5EE1A 3O82A 3RLIA 2ASVA 3A6LA 3TWOA 1RKBA 3PX2A 4GMXA 1PIWA 3D7NA 3W5SA 2FPKA 4EY4A 1H5NA 2RCYA 4PYMA 3KX2A 2BGMA 1FP4A 4IJMA 4O63O 3V6LA 3LQKA 2QW8A 4MV7A 2C7OA 1ECPA 3EDYA 4JX9A 3MC1A 4I9FA 2P4HX 4OHOA 3E7WA 4H4DA 4HADA 3W79A 1OX6A 2WIAA 4JJ6A 5HKBA 5FR2A 2GPBA 4BMZA 2AX3A 2VYNA 1OV6A 5BXQC 1P1CA 1P7PA 3NVDA 3Q0IA 2CJFA 1OE0A 2H63A 5CGQB 4S2UA 3ETLA 1CR2A 3C24A 4FPXA 2XTJA 2JH3A 2Q3EA 3VZCA 2OHFA 4E2YA 3ORHA 3FDZA 1C7EA 4M1QA 2O2JA 3MTAA 3MCWA 2CN1A 4Y1FA 1V4NA 4MYDA 4BPBA 4R6WA 2AI3A 3LL7A 3TLZA 1XL0A 2YS7A 2MCFA 1IUNA 2GEJA 5CYFA 1GHTA 3UK1A 2WG1A 3OTGA 4V0LA 4F2HA 3HY3A 1IFXA 4XM1A 4ERXA 2OCBA 1KRWA 4BXOA 1GZ6A 5IAOA 4LZZA 5SV2A 2BM1A 2BZ0A 4U2FA 1Z36A 3RJ5A 3H9UA 3TLCA 2O23A 4J2HA 3BWEA 1C9MA 2W8BB 1I7SB 3FPSA 3NFYA 4PSAA 2XMDA 4HNVA 4PYOA 4QJBA 2X9VA 3K09C 2WEKA 2H3EA 3IAM1 1Y34E 5JC1A 5KWEA 3O90A 4LCEA 3QI2A 1I2AA 1Z7GA 2A0FA 5CVCA 1IL0A 2M1XA 4JVNA 2HRBA 4RIGA 3H5VA 3PC7A 5FQNA 4HB0A 1OMOA 3HU3A 5A71A 4LQDA 1WETA 5AI6A 3KLBA 1V41E 3U4GA 2C78A 1I5EA 4P92A 1NWHA 3DQZA 3A32A 2C2WA 3V97A 4RW0A 1DCFA 4TQ9A 5C8XA 1ZDMA 4PC3A 4PN7A 1CFJA 1SCIA 2UZAA 3E8XA 5SZJA 2QX7A 2WV7A 5HIMA 3VI3B 2VLBA 4QFMA 5K8CA 2PO7A 5KB3A 1RWVA 2H54A 2ZUVA 3EPLA 4MS1B 1OB2A 2I1LA 4DCTA 1GYQA 4TKVA 4BEWA 3H05A 4EW1A 2PLNA 2LKDA 1SU7A 2C88A 2MMCA 2R5NA 3Q7TA 3IXMA 5IKXA 4C2TA 3LDGA 4ZXPA 2EIHA 1D2EA 2FWMX 4ND1A 5KYUB 5BMVA 4KIUA 3MJRA 2WKPA 5FOWA 1XTZA 3UCFA 4D96A 1ZOLA 4E6PA 1UAYA 2GZAA 4OBXA 5FORA 1R66A 2P2LA 1K4KA 1SZDA 4OCZA 2Q99A 4R8VA 1H0KA 3VYRB 2RC5A 3WAKA 4DR2B 1VQ1A 3WRXA 2EHJA 4ZVKA 1FA9A 2Q07A 3ROTA 1C30B 4S1PA 2PQ2A 2AL7A 2I9KA 3CXRA 1JECA 4DM3A 2VZLA 1FFBA 2DKOA 2HRRA 1JHAA 4FILA 2HSWA 4HBZA 4JVOA 4LQLA 2RB4A 5BYJA 3M1AA 3VOSA 1JDBC 1L7EA 5JI3E 4IZOA 4BQQA 4XWAA 1UFVA 3W9SA 2J45A 4GDFA 2XCSB 2GYWA 1U8UA 4KXYA 3L7LA 5JASA 3PWZA 1TMOA 3GFOA 4YCJA 2JCXA 1DBIA 3DBRB 5HA5A 3SNHA 4C0WA 4DKXA 2PSDA 4KHPB 3NGXA 4G23A 2TMGA 4MW4A 2YV4A 3KVNA 1AK9A 1YIDA 1NP7A 4RZ3A 1A9XA 4N5LA 2B3TA 1XJ0A 4QUHA 5LYJF 2OECA 4FX2A 1G6Q1 3AR8A 1L7XA 3HGQA 3EPHA 1RRCA 1H3NA 4WGFA 2GA9A 1SUPA 2R5FA 1H2AS 4EVIA 4BJ6A 1AH2A 1F2DA 1B74A 4NFSA 1XX6A 2R0QC 2IYXA 1KWKA 1A71A 4XD7D 1NZFA 1V7ZA 4BWGA 1L8QA 3GDOA 2HRCA 5EP3A 3RU7A 4F85A 5TQJA 1L5MA 2REBA 1NBAA 1EX7A 1GTZA 3LNCA 4MS4B 2PT9A 3WMGA 2ZDGA 1Q92A 5B57C 3H99A 2W0SA 3E7XA 3TLYA 1V7QA 2XD9A 1FF9A 1I5RA 1Y7PA 4YLGA 4DIFA 1P1RA 2DHEA 1QHXA 3JZMA 1XNQB 3JY6A 3HMKA 2AXEA 1V8FA 4I14A 3GHYA 3P4XA 2G1PA 2QM0A 2QNBA 4DGQA 2OMKA 5EKSA 2XMPA 3FAKA 3IQDB 2C61A 4OLBA 4EMTA 4ZT3A 2O8BA 4BNHA 1BYIA 4R9UC 4GMDA 4WIAA 4B7AA 3PD0A 3D6VA 3C6KA 1Z2OX 5BSHA 5J4HA 5KSWB 2FG6C 4RTOA 5C7IO 1KQNA 3QX3A 1M2HA 4NH4A 5FOUA 3JAKB 4MJXA 1XBTA 1R5OA 1R12A 3LLCA 3N70A 1H6AA 3UTDA 3VO2A 3KJNA 4GBGA 3L0OA 4N7JA 5AVZA 3AZOA 3L92A 4UBLA 4MRAA 5J2UB 4FONA 4EY5A 2IEYA 3UGJA 4JVSB 1X15A 3TB6A 3M81A 3OP1A 4F8EA 1IOLA 1MX1A 1YUNA 1P18A 1ZIYA 3IT2A 3R0XA 4BTEA 4IVNA 4DV0B 5JSKA 4CHTA 1KKUA 4G0QA 3PPXA 1O6BA 4L6IA 4U7TB 4Y1EA 5F4ZA 3S5JA 3RAFC 5EA2A 1JR4A 3GD5A 2AG6A 1LFDB 1JDPA 1E1QA 3ZHSA 5TQ2B 2RI1A 3NBUA 3OFJA 5DRTA 1P80A 4M6WA 1GTVA 1EFVB 3RYCB 3P0IA 4YJFA 5JYEA 3MT7A 4QLOA 3QKTA 1GGMA 3TMYA 4GM1A 3KJZA 3JWEA 1ZWKA 2C8LA 1RYMA 2GRAA 1G5PA 3P5BA 3SAJA 4OLAA 1N9KA 2O3RA 1YCHA 4KI7A 4NBRA 2CFRA 4ZP1A 4C6TA 7MHTA 3MWLA 2C96A 1F5SA 1Y6GA 3IO3A 4M7OA 1E6WA 5JS8A 4W1QA 3CVXA 3QX9A 3EGEA 1F7VA 3ECAA 1Q1QA 1H2RS 1WNTA 2X9NA 1KMHB 1LPBB 1M8JA 1WOYA 4JNCA 2Q1TA 1O9BA 2JJMA 4KFSA 4L5AA 3KXPA 4JI6B 5D8DA 2NSYA 5D00A 4LVNA 5BOVA 4TWAA 2ZP1A 4TRRA 2PUVA 4EA8A 1NUPA 1AMOA 1A1SA 4K1LA 2QX9A 4GQIA 1ZONA 1F6WA 3P27A 2B8JA 2FN7A 4BNDA 2EVWX 2VL7A 2YOHA 2HA5A 2A9KA 1NR1A 5EC8A 3SVTA 3EZ2A 1MT0A 3C6XA 4HDNB 3ZE0B 4LV5B 2GEVA 1ZW6A 3N2NA 1YQGA 5JRZA 1ELOA 2B1IA 4PANA 4KQ9A 4DADA 1IBCA 4NONA 1E7WA 4BFCA 4CLRB 1YZQA 5K3SA 3ONDA 2DM6A 1YA8A 1T4DA 1ZMRA 1UPUA 5DW0A 2XTNA 2H2WA 2C4UA 3WLTA 4GI3A 1FTGA 1GZHB 1QAOA 5AICA 2VBIA 4DABA 5ER6A 3ADBA 1L4LA 1RXEA 4FDTA 1F0NA 1JAHA 2IF2A 4XQEA 2E4YA 3JQ8B 3BFVA 4OLJA 3P1JA 1DBWA 4D6PA 1X9GA 2J7PD 1CP3A 3D6TB 3Q87B 3ZV7A 1J99A 4LJLA 4F97A 2P9CA 3NHZA 1DSSG 1X1SA 3R41A 3OJFA 3ELDA 1XXHB 2DQSA 3TL2A 4L7QA 2GHRA 2V5AA 2VN8A 3BRWD 5J4KA 4I50A 4QJ5A 3CCFA 4EUNA 1E89A 4RLSA 3NAMA 4CR6A 2IW3A 1E9FA 1H3EA 3X1XA 1AUXA 1Q5PA 2BRUC 4PW0A 4U7JA 3K0BA 1IHDA 5BN5B 4B3SB 4H7JA 2XTMA 1AKQA 1F2UA 2CFSA 2D8MA 3IB6A 3FYUB 3O3OB 1GKLA 2WSBA 4OHKA 1MB3A 5FDFA 2Q3FA 1PLKA 5M29A 2VNAA 1Y5IA 4RD4A 5KNBA 1K0UA 3MTBA 1B6RA 1KMQA 3BJZA 3DV0B 1MVOA 1NRIA 1VZ2A 2AF4C 2G67A 4C43A 1VP3A 3EFOA 4E5DA 3COWA 2ZQYA 4C14A 1WBBA 5E8JA 1YV9A 5E4YA 5K8TA 3TW8B 2P2SA 3F67A 1WNFA 4BO8A 1H4QA 3KHSA 3FMPB 16PKA 1Z5WA 5LKRA 2JKVA 1TOAA 3KCNA 5JDIC 2V3VA 4DY6A 4BGIA 4S1NA 1VJ5A 2BZ1A 3FNBA 3SZ3A 3ZVNA 1JEQB 2D5BA 2V03A 3UOGA 1LZKA 2C8VA 3A9CA 3HDVA 4PZUA 3UYLA 1BXKA 1N75A 4J0HA 3W6UA 4DAEA 1OAOC 1UZUA 4DCVA 3DNMA 1A9TA 1SXJE 2G83A 3DEHA 4J0DA 4UU7A 4BHTA 3WBJA 1T9GR 1R9JA 1QZTA 1ZGBA 1YGYA 3N9IA 4LRXA 4GU5A 1Y7HA 2EGHA 1BA2A 1E9DA 4XGKA 2WE7A 3PC8A 3WQBA 1TQ6A 2HMWA 2VJKA 1TUEA 3B6KA 4YFVA 2A5JA 4GRAA 4YC7A 1V11B 3DMTC 4LDPA 5DGHA 3SR4A 1KL7A 4A0GA 1U99A 2G7ZA 2WWFA 3CV3A 3KB1A 4DLVA 2W4MA 2JK1A 2PJRA 4FE3A 4GP9A 3FRHA 4PGHA 1IWOA 4PWYA 3HEBA 4IVQA 5KKAA 4HEHA 5KYWB 2HBZA 3EPJA 3N5KA 2PRKA 3BFJA 4R54A 5BSEA 1Q17A 3LAWA 2B69A 3J81k 5B7NA 2Q62A 3G0DA 1ZM9A 1SXPA 2ZT5A 4DJ5X 1TK3A 3JASB 4KFUA 5KTKA 1P0FA 1TIKA 1G4UR 1DGQA 1QQBA 3L4EA 2W6OA 1JHMA 3SHFA 4E03A 2J3QA 1U81A 1ZN9A 2EYUA 2OO3A 3RTCA 5IKPA 5E1OA 2XAUA 4GPTA 4AURA 4GGPA 3ZHUA 2AC7A 1XMOB 2K5UA 4RK6A 4E5MA 5K0CA 1NBIA 1YI8A 2AVDA 5AHRA 1APBA 2ZXFA 5D51S 5AI0A 1SBYA 3DXXA 3CEPB 1H42A 2A5DA 1ONNA 3D0QA 3N2KA 1S2IA 3DGFC 3S44A 3DPUA 4M9QA 4F1WA 2VP4A 3KLPX 4JJKA 4WD3A 5JY1A 2Q1XA 2FKAA 2W98A 3ACCA 3WVNA 5JXWA 4XTRA 3VC7A 2VRCA 2W4IA 5KC9A 3G6KA 1YQWA 3FTQA 5DM60 1KGDA 2R7MA 3RS5A 2PYIA 3JPYA 5BV2P 1FSZA 1Y37A 1L5HB 4CMEC 1SBHA 3QK7A 4BEBA 3QVTA 1VC2A 3R40A 4XWYA 1YSCA 5F2KA 4BUZA 1MJGM 4Q3NA 5E6SA 4AY2A 3K1ZA 3T9DA 3TIXB 3GZNB 3HSYA 2ZT6A 3KWJA 4RPCA 4XVQA 3VHRA 1I3LA 3VHXB