2WNSA

Human orotate phosphoribosyltransferase (oprtase) domain of uridine 5' -monophosphate synthase (umps) in complex with its substrate orotidine 5'-monophosphate (omp)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
197
structure length
197
Chain Sequence
ALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQTAQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKVDAETVGRVKRFIQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords OROTATE PHOSPHORIBOSYLTRANSFERASE
publication title Human Orotate Phosphoribosyltransferase (Oprtase) Domain of Uridine 5'-Monophosphate Synthase (Umps) in Complex with its Substrate Orotidine 5'-Monophosphate (Omp)
rcsb
source organism Homo sapiens
total genus 60
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2009-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wnsA00
2H07A 4QYIA 2PRYA 3NAGA 1P17A 4P82A 3ACDA 4RQBA 1XTUA 4WMLA 2EHJA 1BZYA 4PAWA 1P18A 4P81A 2P1ZA 2AEEA 2H08A 3H83A 2VFAA 4JITA 3GEPA 1OPRA 2E55A 1J7JA 4KN6A 4LZOA 1L1QA 5HKLA 4OHCA 5BSKA 1P19A 4P3KA 4RANA 1VCHA 5ESWA 1DKRA 1XTVA 4M0PA 1GPH1 1ECGA 2JKYA 1QK3A 2JI4A 4RHTA 4LYYA 1BD3A 5IPFA 4X44A 1OROA 1G9TA 2JKZA 5JSQA 1QK4A 4QYIB 1I13A 1ECFA 4RABA 3O7MA 1GRVA 5KAMA 3N2LA 1HGXA 1O57A 5HIAA 4RV4A 4MB6A 4P80A 5ESXA 4M0UA 2DY0A 3ACCA 5JV5A 1QB8A 4FYMA 2C4KA 3EFHA 4RADA 1I0LA 1NONA 3KB8A 4P83A 2PS1A 1QCCA 1ECJA 1VSTA 1QK5A 1WD5A 4RHYA 3ACBA 5IAOA 1G2QA 2HCRA 3MBIA 3S5JA 3LPNA 4WN3A 1ZN8A 4LZAA 5BRNA 3DMPA 1R3UA 4M0KA 4JLSA 1I14A 1CJBA 5EUCA 1JLSA 1P4AA 1TC2A 1MZVA 1I5EA 5E38A 1XTTA 1JLRA 4IJQA 1STOA 3GGJA 4P86A 1UPUA 1ECCA 1QB7A 4RAOA 1DBRA 3LRTA 3DEZA 1XZNA 1LH0A 2PRZA 1W30A 4RAQA 4RHXA 1YFZA 1UFRA 3OZFA 4TWBA 3QW4B 3OZGA 5K51A 1PZMA 1IBSA 2GEBA 1ZN9A 4S2UA 1D6NA 1G2PA 2IGBA 1O5OA 1ECBA 4Z1OA 3MJDA 1G9SA 1A3CA 3G6WA 3M3HA 4PFQA 4RQAA 5BQOA 2FXVA 2JBHA 2YZKA 1DQNA 1BD4A 1A96A 1I0IA 4LZNA 1ZN7A 1Z7GA 2H06A 2XBUA 1U9ZA 4ZFNA 5KAPA 1TC1A 1DKUA 1L1RA 1A95A 3DAHA 5BQPA 4X45A 1QCDA 4F8EA 1HMPA 1A98A 1XZ8A 1FSGA 1OREA 4LYGA 2WNSA 1V9SA 1A97A 4RHUA 1NULA 4RACA 3GGCA 1A4XA 1Y0BA 3OHPA 4QRIA 4P84A 1AO0A 1DQPA 1UPFA 3HVUA 1VDMA 1U9YA
chains in the Genus database with same CATH superfamily
1YL5A 4BYGA 3GVIA 3UAVA 3HCBA 5DYWA 3HZOA 5CHEA 1MT3A 4WMLA 4M0LA 2WDPA 4IMRA 1RWBA 1MLDA 3QE3A 1QG4A 2ZSIA 4OOFA 5K6AA 1R0RE 2GK4A 4JXKA 3WVNA 5KQLA 1WULS 1GYRA 3AJ9A 3NH9A 3GFRA 3LT0A 3T3PB 4EECA 1N0IA 2DQYA 4P5DA 5ALDA 5F2EA 2BMAA 1WPRA 2JHPA 1KEVA 3JZAA 3QWHA 4K05A 2PTHA 4MDYA 2AC2A 3RS5A 3MJSA 3O3NB 4HQ6A 4F60A 1RR6A 2O2SA 4ENSA 1SVUA 4F93B 3PUZA 2PTGA 1J97A 1EBUA 1JH8A 1Q95A 3W05A 1KBOA 1M83A 4MPTA 5IASA 4YJ2A 1W29A 3RIHA 4CF3A 1U2GA 1VLHA 2VZLA 1G1AA 3LVFO 4M38A 4QQNA 1P4RA 1J0XO 1DWOA 2BM8A 1F3OA 5JO0A 3RK4A 3WLAA 2XB9A 3TUIC 3V00A 1UZMA 3TFQA 3DVAB 1KP2A 3FWZA 1NU6A 1YDGA 1XD2A 3IMEA 4JA2A 4CM3A 3L4JA 2IBSA 2RG7A 4MRSA 2WYWA 1FTNA 4F5DA 3OPMA 1QKKA 3RKRA 4JYCA 1GY8A 1KYXA 4PWYA 2QSJA 2HLDD 2Q7OE 1RJEA 5NLLA 3MQ4A 3DMTC 3WFIA 4Q3LA 5DI3A 2UUBB 3IQXA 5J1TB 1APBA 1P5JA 2ZYIA 5JD3A 1TX4B 1R9MA 1DTWA 4I4TB 2GPBA 4B6QA 1QHXA 1OTXA 1Y9DA 2J67A 3DLTA 3QOFA 2GNPA 3F4LA 2PIAA 1TC2A 2CHFA 3ESZA 2QZJA 2JIQA 1E9SA 3F5DA 3I12A 3PGLA 5EKUA 1L2TA 4BQQA 2FCRA 1HE4A 2XYPA 4Q01A 2YMLA 3AF4A 4I14A 3L1UA 1U9IA 1NSTA 5AK4A 4KGDA 4BQOA 5A6VA 3H3JA 1GEGA 1D04A 2ZDQA 1J8MF 3T1YB 2TMKA 1GGFA 3N7TA 3LP8A 4BNUA 4BZWA 2XW6A 5KYVA 2BONA 1V95A 3CNHA 2VA9A 2G9RA 3OKFA 1RCFA 2YIVX 4R84A 4TPKA 3TQIA 2P68A 3WB0A 1MC4A 4CEJB 3KM0A 4EB6A 3JYHA 1P3JA 3VO8A 2QB5A 3M4JA 3TSCA 1V0JA 2YZ7A 2J4CA 5AT1A 2AE2A 2X7JA 3WWEA 2VQDA 1LVGA 4PQYA 1PIWA 4ENTA 4LGCA 2IGBA 2XNDD 5AVYA 2NAFA 4E2YA 4AKSA 4FZRA 4PSVA 3OJ0A 3HBFA 1R8SA 4UE2A 3VZQA 1LF5A 1SD5A 4GZLA 4O3MA 2YHBA 2DQSA 1GKYA 1RYDA 1BMDA 3U9SA 3SF8B 4L15A 4TT3D 3OPVA 3D0OA 4FIDA 4AZWA 1VC2A 5K09A 1UBTS 2XZOA 5JZ9A 1WQ4A 5HK9A 2WG1A 4KWEA 3JQGA 4KUGA 4DM4A 5CLQA 2IF2A 2HJRA 1VE9A 3ZDBA 2B30A 2YX1A 4WKBA 4UEKA 4TRRA 1AO0A 3QPVA 2GT1A 3CNNA 3FVRA 1AS3A 1B2RA 4CFSA 1NVUQ 2WTAA 3JQBC 1OX6A 3W6PA 1OZGA 1GDDA 4WLEA 3SJBA 3HWSA 4DG8A 2P2SA 4X97A 1IONA 1SD1A 2VSYA 4P34A 5A0VA 2FXIA 3Q9LA 2AOUA 1RPJA 1EQ2A 4R54A 3RIYA 1PN3A 4FT4A 3ZDEA 1B3BA 1K8ZB 3LCRA 4J94A 3BMCB 4O4LB 4HADA 4PC1A 2QRZA 3VHRA 2HRQA 3NTQA 3HR8A 2P7IA 2DPGA 3EXHA 2QRHA 2BM1A 3NHBA 4MEAA 4F5ZA 3PQEA 4GI3A 2J87A 2R00A 5ALWA 1AOXA 4JA0A 3ICVA 1BYIA 4AMZA 3PEVA 5JAHA 1SG6A 3AZOA 3KJXA 3U7RA 3H5LA 5EP1A 2J9YB 3DUWA 2OQRA 4KIJA 2O1XA 3WQRA 2VJMB 4PZCA 1W76A 3FTEA 3BS4A 4DSOA 5K8UA 3JYOA 3P2IA 2Q28A 1BROA 1Y3IA 2F7SA 4JFAA 4ZOLF 4B40A 3OFND 4W5NA 4II7A 2Q0SA 4H15A 3BKXA 3CSUA 1KU6A 3C5WP 4QTXA 3U7JA 3RARA 1EXVA 4HAYA 4N0QA 2QVZX 1BOOA 5TF0A 3W6OA 2AI2A 5AVSA 2XOKA 4RZHA 1TJ5A 1QYWA 1MW9X 2Z04A 1ADJA 2EFEB 2VYCA 2XITA 3LF2A 3UK7A 3GPIA 2VHCA 2ZWOA 3LRPA 3DDUA 3KAJA 3I1IA 4OA5A 4V38A 5D01A 2HC9A 3HL4A 1VLLA 5A6SB 3NBYC 1PX0A 1KGSA 2A14A 3I42A 1TD9A 3PR1A 4F86A 2RJOA 1WBBA 4HQOA 1MZVA 3URKA 3ND7A 4WINA 1NHGA 1RPNA 3LDAA 1UK7A 3WDMA 1IZ7A 3CRNA 4HTFA 4DA8A 3LAWA 4GKKB 3S28A 1EM8A 1YRWA 4CNBA 2GS9A 3DCJA 1J33A 3E53A 4YO7A 2WU1A 2X0DA 3C39A 3DEZA 1YS6A 2FQXA 1Y5LA 2WPNA 2IF0A 2Z2ZA 3I28A 1ZJZA 2ZAIA 3LZCA 4TVOA 3LUDA 4UBNA 5C3UA 3VI3B 4HYTA 5FX2A 3OPYI 4RD0A 4R1UA 3WGGA 4CR7A 3OM1A 3JQ7B 5H59A 4L3WA 3U37A 1OWLA 3K1YA 4MWEA 2FPXA 3E81A 1BSVA 3BSWA 3O95A 4YRMA 1AUQA 1HE3A 5EJIA 5FWXA 1AGPA 3U2QA 3A6JA 5FEMA 3ZJ5A 3ICPA 4KO2S 3ZYZA 4N6OA 3RRMA 1UXHA 4AZ0A 1E9AA 2Z9DA 4IV8A 4XDYA 3ADCA 5EHNA 2P30A 5DM0A 5F77A 1J23A 1EPUA 2O3SA 2BISA 3ZGNA 3MUFA 1C9JA 3K5PA 4KH1A 4O33A 4UMFA 3ND8A 5AI5A 1IK6A 4MW9A 2VYVA 5AUNB 5EMKA 4ZEXA 3HR7A 1XLTC 2ZJ6A 3D64A 4CMIB 1QCDA 1KQGA 3OSUA 1UOQA 1E0KA 4CLEA 2H1CA 4JJZA 3OFSA 5FPKA 3WMRA 5BSHA 1RLTA 2VXBA 1GO2A 3H5AA 4RGBA 1PWHA 3WISA 1PLKA 1R0XA 1U31A 3S1AA 5A02A 5TT0A 4AP5A 3BOSA 1HE1C 1XDZA 4YIKA 4D97A 3KKNA 2C3UA 4HB0A 1AJEA 3IOEA 3QOWA 1ZI6A 1ZQ9A 5F76A 3ACDA 1KK0A 5K3AA 3GARA 3IQGX 3TO5A 3X2EA 4E31A 2WTUA 1NNUA 2MCFA 1AQYA 1U6IA 4MV7A 4AMYA 2AR7A 3L8ZA 1DARA 2UZ0A 3HYNA 1KRHA 1N2GA 3I9LA 3WLHA 3K16A 2HJSA 2WJVA 4RIFA 2NUTA 3RR2A 4EW6A 3H16A 3KB1A 2P78A 5AICA 4R2HA 5GV8A 3DLHA 1CEYA 1YI8A 3ETJA 3E35A 3OTGA 1V3VA 1JLMA 3E5RA 2ADMA 4RA6A 3E9NA 2IUUA 4EVQA 3GNQA 4OHKA 4N5MA 1U3UA 1ZYUA 2PZFA 4B7ZA 4RM2A 2V4MA 4M9XA 1QP8A 5DX1A 1DZ3A 5B64A 5I5EA 2O2XA 3RASA 1I13A 5DM4A 5K6TA 5DZSA 4YP6A 1T8TA 1IOWA 1T13A 2A0KA 2HMVA 5D5HA 4CYMA 1ZONA 2IHUA 4Q6WA 4S12A 1L7OA 4CM9D 1FP4A 2RGBA 2EQ5A 4DCUA 1PT7A 5LP6B 4C2TA 1QHHB 1YR8A 3I9JA 3E7FA 1ORWA 2WIKA 3HV2A 1E0DA 3LBIA 4ND6A 5AP9A 4MOWA 5AH0A 5CA1F 2J48A 1RLOA 4MVWA 4P7JA 3RDPA 4ZMRA 3UXYA 2I1VB 3KLOA 5CLHA 1DXYA 2VP2A 3I3OA 4R41A 4BNLA 5IZCC 5CXSA 3CO0S 1G16A 1GG9A 1N6LA 2WAYA 1QANA 2QUHA 4HN4B 1UIRA 3B13B 3DMHA 3RG2A 4EJSC 3UBTA 3F3SA 4LDAA 3FNIA 3QXGA 4DIOA 4IG9A 1GT6A 3BWEA 2GCEA 4B34A 3SFZA 4L6AA 5A9RA 1KYTA 1L7EA 2X8JB 3AQIA 3TRHA 1Q57A 2XDAA 3SZ3A 5HDQA 1EDDA 1WS6A 1GNSA 1W9MA 2FSVC 1M5UA 4IGKA 3JQFC 1ORIA 4O25A 4OJNA 5AVUA 5EZ5A 4ZVQA 3OVMA 5AVKA 1MAWA 1IVNA 4YMUA 4J1TA 1L5HA 2A5FA 4RM3A 3HCDA 2F3RA 3WYNA 3D0QA 1PCXA 1E6UA 2HJWA 3NTXA 1ICIA 4LVNA 1NXOA 2A3NA 2C2OA 4EPWA 1PSDA 4FYHA 1R5BA 3W5IA 5I7FA 3KUCA 1GDHA 4N0PA 4G84A 2HO4A 5CXQA 3M5PA 1NKTA 5JXJA 2BEWA 2O2EA 1L7PA 2AI3A 3WYBA 1SQFA 3GR6A 1ULZA 4OI0A 2BUBA 1PX2A 2W8BB 1HDYA 2VK4A 2PYDA 3FMGA 4ID9A 3G49A 3CVWA 1E1QA 1Q44A 1A7UA 1U0GA 2GYYA 3AZQA 5DT9A 1RC8A 1RRCA 1Q0TA 1D4AA 4KQCA 1TW3A 3VR5A 1G17A 5GTDA 4DF3A 1RQPA 1VL6A 3NANA 2AJBA 5DJ5A 3VTZA 3TQOA 1OWPA 3OQNA 1R15A 4C5BA 1TECE 3OHSX 3W3AD 3TR0A 1OW3B 5CUQA 5GVRA 1TUIA 1TKRA 1WVGA 1VRWA 1TZCA 2BJWA 4Q18A 3E22B 2ROQA 3AERB 2VBIA 4TTPA 4RS4A 1THTA 4DVGA 4FMCF 4YRDA 5CYPA 2CLFB 2JLQA 2VUSA 3MGGA 4MEJA 4A16A 5CFQA 2EFYA 3UT5A 4ZK2A 3CVJA 3GN2A 3H19A 4C0HA 2ZTHA 3WHPA 4M7OA 4YK7A 6LDHA 2MHCA 1JSRA 1O9GA 3PNSA 1D2RA 2HK8A 2QR2A 1VOTA 4UHHA 4DSNA 2GBCA 2CFRA 2Q27A 4LE1A 4WECA 4AJ4A 1ZEMA 3B82A 3L7KA 3W8RA 4IFEA 4Z1MD 2O23A 1LDMA 2I2FA 2WUVA 2ZWVA 2ZYUX 4OKSA 2RK3A 3FDZA 3ZK8A 5IH7A 1N2ZA 1Q1NA 2QLJA 3BH7A 4OMDA 3TQHA 4PICA 4YAKA 4CKCA 3E23A 4QZVA 5G40A 1Q0PA 4LJ6A 2VJLA 1RLIA 2ZSHA 4KDRA 5ABPA 3KWJA 1G291 3CO5A 1QORA 2IYSA 4C4TA 3FNBA 3FUCA 3M4ZA 1SOVA 3KV1A 2IU3A 3CJRA 3I04A 1NNI1 4MMZB 4XYGA 5L7WA 2VPQA 3EIHA 2HSWA 3DV0A 3JASA 1GL7A 3INRA 4MUJA 1Y8QB 1KA9H 4TLCA 5JBQA 1NI3A 3FKSD 4REQB 1USUA 4MJ3A 1FTSA 2WE7A 1OZFA 1RLJA 2DSNA 3AVOA 3FUVA 4E5VA 4PYJA 1KZ4A 1E2KA 1DQRA 1K9SA 1LK0A 3GLIA 3DMDA 3I83A 4PNPA 5H3LA 1GNPA 4ZAWA 1I3OA 721PA 1UL1X 4P2BA 1D2HA 4IIHA 4CUJA 1ZM2A 2VL7A 4TRJA 4ZU3A 1EVYA 4MP3A 1KYVA 2ZWMA 3C7CB 2O8BA 2EX0A 4YFVA 3ZN2A 1T43A 1Y8ZA 3TLKA 2PT6A 4JUBA 1QP0A 1NX6A 4ZVPA 3EGEA 3GDGA 4UUMA 3NRJA 5DH9A 3RREA 1ILWA 3WWOA 2PUJA 1C1XA 3PF9A 3JYLA 2W5UA 1E1DA 1KH2A 1UBSB 2ZSEA 3BH6A 1F4VA 2W6OA 3FCAA 4J8PA 3AOGA 5FOQA 4M1KA 3TMAA 3WIDA 3P9PA 1P4SA 4QEZA 1AHHA 1OIWA 2JLAA 4JCOA 1TFUA 4HV4A 4IL5A 4PAGA 4M36A 3H11A 1I5EA 3UAXA 1ZD8A 1G8HA 3GLTA 3GYGA 4S0ZA 4BFLA 1T4BA 2PUGA 4J0HA 1X7GA 3N59A 5IN4A 2UYQA 2ZE7A 4I08A 1H3FA 1O2DA 5JAPA 1N5MA 3VU8A 5D87A 1NW6A 1IY2A 2XNSA 3LQ4A 1XZFA 2C7QA 1Z0JA 5EVJA 2BI7A 3UKJA 3X44A 2PGDA 3O8BA 1DHRA 1HQDA 2W6JD 1GU7A 2VDKB 3SDSA 4A0FA 5I4IA 2V98A 2B0CA 3WS7A 3QFTA 4G36A 4ZAVA 3T5DA 5I8PA 2WUFA 3ER8A 2VF2A 2ZI7A 4LXGA 1ZOIA 4YB8A 4U2KA 2MSEB 4JVOA 4PM4A 1KTIA 2CNKA 2JCYA 4BWYA 4D9HA 4D8YA 1F3LA 2EOAA 5BMVA 1J2RA 2WMOB 3P2YA 3K1ZA 2OY0A 1I8TA 1R50A 2ZRIA 3R1IA 1UKYA 1MO6A 5HRCA 2E37A 3IILA 2LIPA 3GMTA 1KQ3A 2FGKA 4C76A 4B09A 4ZAXA 1RABA 3GEMA 4TWZA 3TNFA 5K01A 4HAXA 4TL7A 2YZKA 4RZUA 1G0NA 1DC4A 1RYZA 2QSZA 1OI3A 2X2FA 2BR3A 3JSXA 2J0UB 4IUCS 4X1KB 3UAWA 1K6EA 3QIAA 1YR2A 1ZIYA 1Q1QA 2IEBA 3QLUC 4HFMA 1I3MA 1ZPDA 4NECA 4NYMR 4OFXA 4CI0B 4DJTA 5FYDA 2FQYA 2A0YA 2ZIGA 3CX7A 2OC9A 4IJKA 4E5SA 1AURA 4FQ7A 5U4XA 4YRKA 1NW3A 3HKEB 3DO8A 3KFVA 3OHPA 2HQ1A 3SICE 1JHDA 1WDTA 4J0JA 1ZSYA 2VC2B 4MUKA 3EWAA 1MENA 3GXBA 3FVVA 3K0HA 1Q7GA 2A9KA 2W4QA 4YP7A 5ETJA 4CTMA 3VXKA 1OY1A 1UBUS 3GVHA 3B51X 1SU4A 1MAAA 1YQTA 5D1HA 1JF8A 3CLVA 3LD9A 4ZYZA 1Z5ZA 4OHBA 4N0MA 3F8WA 2F3QA 3BERA 1HQYE 3V1KA 4URXR 4WFJA 3K8ZA 1EDOA 2ORYA 2G4LA 1B93A 3O84A 1ZW6A 5FWDA 3F49S 4E07A 3RM3A 4R2LA 1NU8A 1YQGA 3AHCA 1W1IA 2D13A 4JGIA 4RIIA 3A9TA 4LY0A 4FB4A 3EJWA 3P32A 3C3KA 4NYIQ 3P96A 2AUNA 2QVGA 3ZX4A 3IE0A 4DILA 3OA2A 4KC0A 4NARA 4ZVMA 2XAAA 3H5NA 5EMNA 1SXJD 1RJGA 2AXQA 2G0AA 5E2BA 3V7UA 1Y6QA 2QAIA 1CY1A 1Z6PA 3OLWA 4PZUA 5FV7A 3X1DA 1NOJA 2IYFA 3IEUA 2P6MA 4PYMA 4R2IA 3EXEB 4TUYF 1NWCA 2AGVA 2WHXA 5ICCA 1NNEA 3UB4A 2ZBDA 2N75A 1FY2A 3JARA 3MN1A 4KJZA 4MKZA 2C7RA 4EKYA 1E1RD 4INAA 1VIMA 3LECA 4JLPA 1VBKA 5EUMA 3N2EA 1Y3BE 2AI1A 5DXAA 3W5VA 1O95D 1ZVMA 3L9XA 3UK1A 3I53A 2WRZA 3S40A 3VVLA 2DX7A 1BMTA 1RBQA 4M53A 1A2OA 4NV1A 3REFA 5F7OA 1M6EX 4RH0A 5EE9A 4E1VA 3OE7D 3RT1A 1XZNA 221PA 4ZOCA 4G8CA 1D1SA 3QXCA 2OCXA 4KB5A 1YFZA 1KEWA 5HEKA 5DEOA 3IBYA 3HCPA 1HEIA 1P5RA 2EW1A 4FJ2A 4RK4A 3TS1A 3UB2A 3ZWOA 4KWIA 5CR9A 5CYOA 1F20A 2O8CB 3TI9A 1QLJA 3AU9A 1G63A 1AHIA 3U0VA 2DMRA 5E6RA 4D9BA 2B1IA 2EERA 3B9PA 4N7RA 1E5QA 2FQWA 4NHOA 1OI7A 5AHOA 1TKBA 4CKBB 2GK3A 1Z0KA 2QGFA 1JU9A 1WOYA 1NLMA 1KARA 2ORWA 1Y6RA 3JZFA 4X93A 2Q5EA 5BQOA 3VJRA 3R6WA 1J06A 1R6BX 1Z5PA 5ERYA 5HQTA 1MV8A 1U2PA 1U3VA 4TVBA 3G13A 1NZJA 4IV5A 1W73A 2YC2C 2ID7A 5CDUA 4RGVA 4ODIA 2V6IA 1IVYA 1GZ5A 1U4OA 3L92A 3T7RA 4D80A 3FMPB 4J1SA 3WRYA 4D9EA 1J25A 1UDRA 3WICA 3QBDA 3PRHA 3NIDB 4PRYA 4UM8B 3WYCA 4RTLA 5KX5A 3BZUA 2R6R1 4HQKA 5CAEB 3ZW8A 1CUYA 1H8ED 2V6FA 3HEMA 4CMBA 3HDGA 4U2GA 5MN5A 1TEVA 3X2SA 1FDRA 5KNCA 1KYZA 3THXA 3K73O 1EDBA 4HJXA 2NVOA 2E55A 2H52A 3AWDA 3CR8A 3I2KA 4HAWA 4LZOA 1AKEA 4OXNA 1P2GA 3VBCA 1AHPA 3AM4A 4HN2A 1CQJB 4KPEC 4FC6A 3LT2A 2EW2A 4Q93A 4ALMA 4E5PA 1AA9A 2Q4TA 3HI6A 2XTJA 4Y6LA 1UDAA 1ZN2A 1XROA 1MEEA 4IVPA 3I04M 5LXTF 1ZBDA 3FNFA 5EYPA 1SQ6A 4H6WA 1PJTA 2HYDA 2JKZA 1KH1A 4B8YA 1ZINA 3BMNA 4AZSA 3NGLA 4BJHB 1UIMA 2AVDA 4KMMA 5H9VA 5DGXA 1UFQA 1NJSA 2HMAA 1GGMA 1RHMA 1AX9A 1SXIA 3O8QB 1CF4A 2XDWA 2ZKLA 3IOYA 4P33A 3ZU6A 1FLNA 2XRFA 4MCHA 3URMA 4JR0A 2JDIA 1LVUA 4WNCA 2XBMA 4P83A 2BHTA 4NDZA 1E63A 1FLAA 4W5OA 1H4QA 2ZYSA 1SHLA 3PXXA 1B16A 2ZXEA 1F17A 3UFBA 4MQEA 4Q9KA 2QDKA 1G2QA 4AICA 3HUTA 1DDOA 3QX9A 3FF4A 2OB1A 4PW0A 5DSTA 3RS2A 3K1JA 3QELB 3R6TA 3WJAA 4YAIA 1JKJA 2FUKA 1EUCA 5EHXA 2GKOA 3NRBA 4IIBA 4QNMA 2IFTA 4L75A 4AN1A 3QVGB 4N7JA 4MIKA 3FJOA 1IE3A 1SC9A 4TMVA 1O94C 2I2CA 4RZXA 3ZJVA 2HQSA 1REQB 4HDQB 3O8NA 2FLVA 2R6JA 4UXHA 4X5OA 4ZT3A 3OZBA 4H16A 1Z15A 3TLBA 1GWNA 4B6PA 2SCUB 4CCYA 1SOAA 2GXAA 1FSPA 4FCCA 1TMGE 2DM6A 4M9UA 4WLOA 5DM70 4R16A 3I5MA 2JAUA 2VSOA 1WD7A 4OQMA 4CM1A 4E0BA 3JD0A 1KNQA 1GM5A 2NTVA 3ASZA 4MKGA 1OOEA 2J32A 1DRJA 4GPD1 2RFLA 5JATA 3LQ1A 4TKZA 3M9LA 3FX2A 5EIOA 5FBRB 2WQZA 3Q7PA 5FFFA 5ALGA 4BO2A 2YRXA 1CNEA 2J3MA 2X5JO 5B6IA 3AUAA 4DM3A 1NVGA 1Q11A 4LTNA 4B4WA 1UPXA 1JG3A 3H5IA 3DTYA 4WVLA 1IBMB 1K4YA 1AY0A 4YRRA 3FWYA 2J3KA 2WFLA 1PL6A 3U4QB 3NHYA 1BVHA 2XRYA 4ARZA 2A94A 2JGFA 1LK7A 4NBNA 3OJCA 1E0AA 4MRAA 2FUCA 1TZMA 4G85A 3NP9A 4U0JA 2ZRDA 4IJMA 1SIUA 4RX1A 1WY7A 3AIIA 4G8DA 3QVMA 4DW8A 1IL0A 4W5QA 3PTAA 1PL7A 2ZPAA 1AGNA 3FFXA 1J00A 3EPHA 3ZQUA 1SJ9A 1OLXB 3C74A 4YJHA 1NYQA 2XXAA 3FFAA 2BKUA 1NL3A 4L6IA 1U6JA 3TDKA 3R6DA 3QZUA 5L4LA 5FL7D 1U9CA 1YGPA 2DJ5A 2X5XA 2JA2A 1X1CA 4GSYA 4TTAA 2OYSA 3LVQE 4UVEA 2ERYA 3ZHTA 4MAAA 1NQAO 1OX4A 3AJAA 3CRMA 1MIOA 1WJGA 1XCJA 3GGOA 4OSPA 3TECE 2EYQA 2GPWA 3VR2D 3GYBA 4FYIA 4E2WA 4BPRA 2Q21A 2B82A 4BNGA 2AOTA 4NS1A 3DZFA 4HNHA 1KEKA 2CXQA 1AZTA 4AP9A 3SC3A 4QXQA 1G5HA 1PD0A 5IW8A 1YGYA 5EKDA 2R8PA 5KNBA 1G9TA 1R4MB 2BI4A 3KSBC 5ALKA 3RAEC 2QL7A 5DKFA 3BGSA 1SCDA 2ZPTX 5CCDA 4JBIA 5JCJA 3F6EX 2PZEA 4IJ6A 4ZQIA 4KFUA 1X7HA 1TLTA 1IHDA 4DA7A 1UMBB 5FHRA 1YFJA 1MA0A 2RI0A 4IP0A 2Y67A 5GJCA 3UC9A 4X24A 1NN1A 4QXAA 3ACCA 2ZJ3A 1XJWA 2ISSD 4BGVA 1H2FA 1OR8A 3B20A 3GRCA 4CV1A 4S1PA 1CK4A 3IKLA 1K4MA 3NBZC 3B1FA 3W8EA 2C2ZA 1VJTA 2JJ1D 4PZZA 1M2VB 1B15A 2HFKA 3L7BA 1GRRA 3OX2A 2P2GA 2WG2A 1VL8A 4G37A 5CTJA 3MBIA 3DFUA 3T1QA 2XD4A 4FT2A 3HY6A 2JKVA 4CLDA 5JDIA 3BWMA 3BGIA 4YUWA 5JU6A 4KREA 3OJFA 4FJ1A 2B99A 4EHNA 2IU0A 5CEEA 5I7SA 2OHFA 3N7UA 5F7JA 4IFBA 4X41A 1NLUA 5LQCA 2QJRA 1RWXA 3DZKA 2EEPA 4F6RB 4I81A 1NQUA 2DUWA 3Q3CA 4CTNA 3EARA 2OORA 3JQEA 4TLBA 4UZEA 4RK6A 1M72A 2Z2IA 1KJJA 3A3OA 3H2IA 3SAJA 1PYGA 1KKMA 3DEYX 2OKGA 2O7NA 3DWIA 2B8WA 3QPCA 1CUXA 1HY3A 4C4RA 1R2QA 2V7EA 4I0WB 2WSYB 1NMXA 2OXFA 3ZDDA 4Z49A 2DY1A 3BAZA 3CWZA 1PFYA 1LV8A 1A1VA 3NDBB 4KEAA 1IM8A 2VAPA 4PRKA 1JFVA 2GHRA 2RGDA 4WJKB 1SC4A 5AIAA 1T9BA 2FLKA 1Y37A 3CT6A 4FLEA 4N3CA 4MW1A 5DBHX 5LOVF 2UXCB 3PNYA 3TFOA 1M2HA 2DWPA 1QIJA 5HCIA 1E1KA 2PKQP 3AETA 3MG9A 2CVOA 1P39A 3H75A 4IGAA 4YAWA 2P91A 3OWXA 4YP9A 3ROKA 1KMMA 6ABPA 4WD3A 1CR2A 1RWNA 2BUCA 3ORFA 4LKRA 1FU4A 4TZTA 2CWDA 3J7AC 4OCZA 1XVIA 2YNMD 5FI1B 4OGWA 1HMPA 3GFVA 4L1KA 3FDJA 2BHRA 3IVMA 3GA7A 1RTTA 3P9CA 4OHWA 4EBBA 3K3PA 3VSAA 4DAEA 1NBME 3LP6A 4RHEA 4M54A 3N2GB 1IPEA 2OUKA 2Y27A 3GJQA 1ZVKA 1MBZA 4CT4B 4CT5A 2G70A 821PA 4R9UC 1ADCA 3GJ7A 4JDPA 5J5VA 3Q1LA 5DTJA 1HQKA 5B7PA 3QI7A 2QY6A 1AO3A 2RHRA 3MGBA 1EUYA 3TR5A 4R2XA 4RQBA 4WDQA 3CR3C 4D8XA 1YIDA 1YVDA 1YZYA 3GCGA 3K0KA 2Z8YA 2WF9A 5DW3A 4MGIR 5DM2A 3CEMA 3LT5A 1TTPB 3NYWA 3FOCA 3N0TA 4ZQEA 5BSTA 2O8DB 1E3IA 1V1RB 1CEXA 2OCKA 3L4EA 4RLQA 1V3UA 3BWVA 4WSOA 3GT3A 4JX8A 3UBMA 2FMUA 2IYUA 1YA6A 1IBLB 2ZBPA 3B3FA 3RJMA 3UWSA 1A9QA 1ILEA 4AY6A 4QL3A 4GI1A 2QYHA 3NTRA 3G5TA 4A2QA 5LUAA 3CINA 2W83A 4MTLA 2O8VA 2CNLA 4IEFB 5FBKA 1RXCA 1OTYA 4YRPA 5FEUA 1EYZA 2IZ7A 5LQDA 2PLRA 5IUKC 3RSOA 4N49A 1GRVA 2GASA 4W8OA 4BVLA 3H7AA 1LS1A 3ESAA 3L1VA 4MPPA 1P74A 4EJ2A 4PO9A 2YJGA 4NRDA 5HQ3A 3GAFA 3RODA 3I62A 2CHQA 5FP0A 4QATA 4YWJA 1SU7A 4BE7B 1NW7A 1QKJA 1U11A 3Q7TA 3ZGXA 4A0GA 5BWBA 4LRUA 4ZP1A 1RHUA 3UY4A 1UMDB 3K1AA 2PSEA 3QUCA 2GM3A 1E1NA 4PSUA 4CMHA 3ELBA 5AI4A 2NXNA 5JZMA 2GHTA 1OV6A 3GFSA 3NYQA 5A05A 4GRIA 3WGQA 3W9UA 2HNKA 5GM2A 3BJMA 5EP4A 4Z0PA 4WN3A 3LUCA 5FPYA 1WTCA 3EISA 1HL7A 3GJ3A 5B3JA 2OAEA 2ZJOA 3AOEA 3UMRA 4X94A 4B3XA 2D0DA 1K3FA 3BHIA 2GO1A 1P80A 1FS6A 5D1NA 2ZG6A 2C7VA 1K98A 4RMNA 1FSFA 4U7FA 3AG5A 3CKYA 3G3EA 1WHSA 1VSUA 4Y2UA 2XQIA 1J8VA 1LH0A 1U1DA 3H5OA 3LLMA 3SM9A 2ZRMA 1P2DA 2M2IA 4G1EB 4RFSB 1ZJWA 2IYYA 5AIBA 3LX6A 1R0CA 4YCDA 4YMWA 4C2AA 3UJBA 5JNWA 1R0KA 3VPHA 3K9HA 4UNNA 4C6HA 2F3SA 2CCJA 2Q5HA 4TS1A 1W87A 3RHFA 2BJHA 5C34B 4F21A 4POOA 3OEWA 4OP1A 1LJUA 4A8JA 4L4RA 3VZPA 4GVLA 2QPTA 2J45A 4GO1A 2OAGA 3CH6A 4CF4A 1W2HA 1E7WA 1NLYA 3WNDA 3IUEA 5I4KA 1T5IA 3H1GA 1TIBA 5EXDA 3UANA 4DCTA 1DQNA 5G4KB 3ZY3A 1AKYA 3NMUF 4W63A 2O3JA 1JPJA 2N47A 1YA8A 3K70D 5KYGA 1Z74A 2DF8A 2B61A 4CLRA 1KBZA 2A8YA 2CFOA 2DFPA 4V3CA 4PPGA 2R8BA 3FCEA 3OM0A 1T5BA 3R7DA 1H6DA 1Q22A 1VGQA 4BUJA 4OQ4A 2G9VA 2YZNA 2ZW9A 4EKDA 4EW2A 3IJPA 5FBWB 3BSSA 1G55A 2KJQA 5TX7A 1MF7A 4GF5A 1DT3A 1QIMA 1G2OA 2QP9X 3EZLA 3STYA 5ILGA 5CB6A 3CRRA 1E5XA 4GXQA 3OUZA 4PNHA 4AJOA 1FX0B 1DBPA 1Q77A 1I3LA 2HRCA 1S1MA 3V97A 1YV9A 1E1LA 2EHJA 1PBTA 4QUGA 3ANNA 3ET4A 2W48A 3BD7A 3HNOA 3VNBA 3HVJA 5CD9A 4IDOA 1UBJS 1FRNA 1QNFA 3GRYA 4KQMA 2QI9F 1J6UA 2ONZA 5C8YB 2Z8ZA 1SU8A 3DTTA 2QJOA 1J0AA 1TM2A 3OTWA 4GL4A 4O5OA 5HKKD 5JS1A 3E9YA 2WF6A 4GMDA 1T1JA 5GV7A 2A5YB 1XRJA 3WYAA 2C78A 3TIGA 2C96A 1XNRB 2ZK7A 2C9MA 2VTBA 2IYLD 5JIBA 4ZALA 5KDOA 1NG9A 2O5VA 3V55A 3ERCA 2PGAA 3L04A 3AVUA 3SDZA 3TGPA 2ZQYA 4NX2A 2P9TA 4PTLA 2WF5A 1JP7A 3KJFA 4NYJR 3ZNPA 1SURA 4MI6A 4D8VA 5M04A 1DBQA 4UDXX 2DERA 2AFIB 1DC5A 4BLRA 1MTOA 4Y7DA 3AIMA 5MHTA 1A7JA 5DX0A 3RRBA 2ZVPX 2R6AA 3LBHA 5EQJB 3WQQA 4P4UA 2EX4A 2Z1DA 3BCRA 3GZJA 3I3SR 3OFKA 4QODA 1SUAA 3D7KA 5CFMA 5JASA 2BHNA 5IM4F 3U44B 4N41A 1FSZA 4NCAA 1JU3A 1W48A 3UMBA 3I72A 3AEKA 4B2LA 1DBWA 2RG1A 4JZKA 4BEBA 3OEHD 4MCAA 5F9MA 3MXTA 1D1TA 2FRVA 3SQOA 4WXPA 3LUBA 3AI3A 3F5SA 1KVQA 4YT8A 3W2FA 2PMDA 1NFFA 4D26A 2HJVA 4E6EA 2Z43A 3UWPA 3GFBA 3W1WA 2I62A 5IG2A 2QBYB 4AUEA 1L4UA 4QU8A 4Z7JA 4ZOLA 5E38A 3BE6A 1A2QA 1THZA 4LJ9A 3AMVA 5K3BA 4UZSA 3ELUA 2GKGA 4NFLA 5CB4F 2REQA 2ZBGA 1O89A 3F7NA 1XRLA 4WKCA 4KPYA 3QTLA 2I6XA 1WEKA 2CXUA 2XE8A 4RVUA 2Q49A 2FUNB 3P71T 4QFCA 3RF6A 1W8IA 2OBBA 2WWWA 3TX6A 3EA0A 3DE3X 1EE2A 4TMFA 5A7FA 1SAYA 2OAP1 2PXCA 1R0WA 2IHTA 3DSRA 4PLYA 4TXJA 1NM5A 3E27A 5DB4A 3SYLA 5KYYB 3QVWA 1P2UA 1G41A 5GJWC 2PRSA 3WB1A 4ER5A 1YQEA 1RXVA 4F06A 2IYXA 3HEBA 3MT7A 3QVLA 1EKXA 1EFPB 2QHXA 4R8VA 4DDWA 1C9EA 4FI3F 4O02B 1QU3A 2QENA 1UBCA 1XTJA 4DEXA 4EDFA 1JILA 2FEAA 4MWCA 5AQ1A 4R3WA 4NONA 5FBQB 4TTRA 4BEJA 4BQSA 4FEYA 4P5PA 4ZV7A 1Z06A 1FBTA 3RO7A 1XSEA 1KZ7B 2QRVA 4LDQA 4QTZA 4Q3EA 1F12A 2Z6VA 3ZE0B 3WLKX 4EOGA 5C37A 1I9CA 3Q3HA 1RQGA 5D84A 3KIPA 1T91A 4LYGA 4N7BA 3WTBA 3I32A 1PJBA 3K0AB 1YOBA 1DRWA 4CCAA 3EG9B 3KQNA 4MYHA 3KSMA 1XA3A 2NO6A 2UZIR 1QRAA 4RELA 1DZIA 1GAXA 1UDWA 2ZUDA 1CV2A 3SHTA 3NEAA 4C7MA 3IC5A 4EAAA 3GGGA 4I1YA 4ALIA 2HHJA 1T5SA 1YQ9A 4JCCA 5DVZA 4J16C 5SYMA 2XE4A 1RRKA 1QQAA 1KDYA 4K2HA 4C06A 3QVXA 3MBKA 3VV2A 1G7RA 4OB7A 4F7DA 5ADUS 2UUCB 3VPAA 4YO8A 4L5BA 3UA3A 2GCOB 1KMNA 4ZAZA 1SCQA 4BBPA 2P8SA 2Z6QA 4A10A 5JPIA 1T8PA 2QP4A 2RHBA 4A2PA 3H1EA 3PYXA 2FX5A 1W5AA 4FQ5A 2H7XA 4X91A 2YOHA 1T5LA 1H9BA 1ZCFA 2ZREA 1JNYA 2HJHA 2NZJA 3FHJA 2IS4A 4CLHA 1Z8NA 3QKTA 5TB5A 4H4CA 1JJVA 1SOWA 4Q7MB 2ZYRA 4QBKA 3I6YA 2AMYA 3TPFA 3EGXB 3TTUA 3HO6A 3TRIA 4Q1CA 4O8CA 5AKLA 3THRA 5L6MB 3VPBA 1V6CA 2TMGA 2X0IA 1RZRD 5JOQA 3KOMA 5BSVA 1FJXA 4BMPB 1JAIA 2C61A 1QCCA 5IDQA 1VBNA 2QG6A 4FFDA 3LKVA 4KYUA 1VSTA 4CIXA 4RBNA 2P2CA 3FPEA 4BBAA 3U7FB 2E4UA 2HCRA 3KS9A 1OH6A 2CJFA 2EBWA 1HTBA 2PS9A 3LH5A 5EC8A 1S96A 3SJ7A 1ZH0A 1QGED 4YT2A 5KMGA 4BNDA 4LS3A 5K5EA 2BFAA 3M89A 1GCGA 4YP1A 3BBPA 2Y1KA 3QEOA 3RWMB 2IP1A 3WLMA 3MLEA 1JHUA 5CA1A 1UAAA 4L9WA 2QGNA 4YRJA 4JNKA 3GGJA 2FR8A 1LBIA 4F2HA 1UPUA 3BD8A 1E2NA 2GH1A 2OBXA 3QVUA 4MZDA 4D6YA 4F6LA 5CDGA 3U1TA 4J7AA 1V6AA 2VDWA 3M1AA 2PLAA 3KTOA 1WBJB 3NIWA 5I9LA 1EK5A 4QM6A 4RAQA 2BL4A 1KVUA 3S5UA 2E82A 4AJEA 5C1DA 5INTA 13PKA 3G9XA 1DCMA 3MCZA 3D02A 1SVOA 5EOVA 2EQAA 2Z08A 3CSDA 1ZWLA 3OTQA 4MR9B 4WA8A 3HRHA 3G0DA 3RVBA 1F8FA 2PAAA 4P0TA 4HRXA 4U9HS 3LPLA 3II6X 1OFUX 3BIWA 1K6IA 1IDOA 1D7AA 1U90A 1W85B 1A7KA 2AF3C 3MIZA 1HFJA 1GARA 1OFVA 2H18A 3A9UA 3H1TA 4MH0R 1QYCA 3SS9X 1IXYA 5EJ4A 2GJ9A 3KSRA 1LUAA 2UDPA 3EGIA 3RUCA 4D43A 5I3ZA 5KTYA 5CCXA 4WDRA 4CEIA 1TIKA 5KAPA 4HDOB 2QT1A 3F1LA 4V0ME 5HGXA 1Q0HA 1NVFA 5LP6F 1WCXA 1AK2A 3GRAA 2OBLA 3AJDA 3BTSA 4E3ZA 4A82A 3BB1A 3D6VA 1II9A 1Y7PA 2RBGA 4WZAA 1BTOA 3OEED 2BDEA 4R4JA 1GDTA 2L18A 4LJSA 4G4JA 2ZRNA 4MGYR 5EAIA 3F96A 3W7AA 2FN3A 1CBUA 2CK3A 2WIFA 4INOA 4JQZA 4LXHA 4MCIA 1TTHA 1RT9A 2JIZD 3F6SA 1TPYA 2NVUA 2XKKA 4MPDA 2VCHA 1Q1AA 3JXEA 1R6VA 1SD2A 1WPXA 1R66A 1XKQA 2ZRCA 4M1QA 4E5MA 1T1IA 2Y6UA 1T2NA 3ZU3A 3AO0B 3IKJA 2TS1A 5HMMA 3M7IA 1SXJC 3ZV7A 1E6MA 4QYMA 2QJWA 3MERA 5AVXA 5ITZA 4XFKA 1P19A 2X3FA 1SA0A 3KR2A 2R7LA 3IPCA 3NHMA 4JOSA 5K4AA 2Z2YA 1A8QA 4WK4B 3LE8A 3I2JA 3NHUA 2DAPA 4ZRNA 2XB4A 4LNHA 3H87A 4CKXA 1VKJA 1UXOA 4P9NA 1NMQA 1U5AA 2DPHA 1CQXA 2BUAA 1A8UA 2HU2A 4IDEA 5A5EA 1YZLA 4H35A 1A0OA 1YZFA 1M2EA 4QQ8A 5ICEA 1EVEA 2X9QA 5C35A 1HSZA 1TK2A 3L7LA 3JRWA 4HZUB 1BDHA 5KYUB 1W4LA 3E3NA 2RGGA 3DXFA 3HLKA 1PVVA 4NAVA 4K6GA 3D43A 2PUEA 1BMQA 5D3ZA 1OAOC 1JR6A 2Q1WA 2C1XA 4CDGA 4U7PB 4X7BA 1RAAA 1KR5A 2CZQA 2MSNA 1XXHB 2VHZA 3FSGD 1OKKD 4BB6A 5AVZA 3M4XA 3E0XA 3JVDA 1F0YA 4N6GA 4F0JA 3HXLA 3L8HA 1PJLA 1WWKA 4K87A 4NE9A 4QYSA 4B2PA 5C8DA 2JVKA 5L8VA 2QT0A 1P4AA 1F51E 2N0SA 5HFAA 2FOXA 4YBZA 2YWEA 8ATCA 2YFHA 2B3TA 2HZ7A 1MOSA 5A3SA 2HA3A 2JGDB 1TM5E 3KFLA 4FQ8A 1XVTA 2BLNA 1QVRA 2J9ZB 3FMOB 3O4RA 1R4NA 3MFYA 3OX3A 4JJ4A 3ONEA 4Q34A 5A9SB 2JEZA 3OIWA 2FZCA 1Z6TA 4NYMQ 3KC2A 1E79A 3N8GA 4MQMA 5CM9C 1M54A 3MTIA 2OP0A 3ZKWB 1N3BA 2QXTA 2XUIA 3GI1A 4ZYLA 3AW8A 3JATA 4IZOA 3AR2A 4PBTA 1E8DA 2NYUA 1WXHA 3CG0A 3RYCA 3PX7A 1QV7A 3MUEA 3PDJA 5EZQA 2PS0A 2VBCA 2ZP1A 1ZHFA 3VR4D 3AVVA 3LUHA 1VMEA 1S8OA 3HM2A 2X8WA 1TA4A 1KZGB 1FXWF 5CT5A 2AFHA 2CE2X 1Z35A 1E98A 2PH7A 3DA8A 3KR9A 3HU3A 4JIGA 3L41A 3H8SA 3N1UA 4A36A 3BYZA 5ESRA 1Z4PX 3R7FA 3TLCA 3ZG6A 4BTLA 1COWA 1Z4MA 2QN8A 4RCVA 2D5CA 2G5TA 4QLAA 4MUGA 4EB3A 4JXJA 1NI4B 4I9NA 1GSOA 4I99A 5DHTA 4BIMA 1VJRA 4EFNA 1I9GA 4MUHA 2EG9A 1YRYE 4Q4HA 5CLGA 5K0GA 1L4NA 5HTKA 4GPZA 2OKCA 2A7QA 3PQ8A 3TVYA 5LD2B 5FUMA 5K8TA 4LI0A 4KR6A 4O63O 4R69A 2FQ1A 3ZS9A 1A4IA 1IU9A 2H4YA 2IKQA 2XMGA 1UODA 1GG8A 4O4IB 3BXZA 4QPNA 5TMEA 1C3OB 2BZSA 5IF9A 3RVPA 1Q5PA 2Z57A 2E4ZA 4A4DA 2X15A 5CBPA 2DKFA 1GQOA 5DN6A 5K0SA 1OH5A 4QXPA 1GU1A 2LVBA 2D2XA 4JVNA 3PQCA 3LTEA 3EVZA 4IIXA 1ZX1A 1B23P 1Y7LA 4KP7A 3I5AA 2GEUA 2ZEJA 4BEWA 4Y1RA 3H13A 3ZLBA 5A2GA 3CMMA 1E2FA 2FP3A 3TOCA 4FWBA 4QQFA 3WWYA 4FHZA 2NZUG 4E6PA 2IZZA 1HNWB 1JLHA 2GRAA 4AS2A 1BFKA 4I7EA 2Q3LA 3GFTA 4J0GA 3TE7A 1RMQA 4EI7A 2RIPA 1UH5A 1GKLA 4C01A 2F43B 3GFFA 3V1NA 3W9SA 2WMYA 4ARCA 4DIDA 4AYTA 4DTIA 2NO7A 2WU8A 3HNRA 3ML1A 1VYTA 1VPTA 4FYMA 3VOBA 3PI7A 4RVFA 2O4CA 4G4GA 2Q29A 1INLA 1V16A 3NOVA 4YQZA 1PT5A 4M9CA 4GOOD 2C4NA 2WJAA 3AF5A 3OCVA 3D1LA 3OQBA 1TMOA 4DYDA 1TU3A 3KZKA 3LQYA 2OZLB 3L1JA 2EWVA 3C1OA 4FCTA 4O08A 5HFJA 1EP1B 3FBWA 2XMRA 4LJ5A 4Q4AB 1O9BA 3LUAA 5ALXA 2O52A 1HQCA 2RHDA 4HDRB 1U8EA 2O3RA 2Q0HA 2EWWA 2GD0A 3EB9A 1S2OA 1ONSA 3STTA 4FFBA 1LBQA 3F3KA 1T4CB 3A6PC 2AJCA 1A7AA 1YT5A 3K94A 4TUYA 5AKIA 2GSDA 4O4JB 5JMTA 4GNRA 1FVFA 3ENVA 2J3QA 2FB9A 4D9GA 5MDHA 2PSSA 4PY2A 3LIIA 1K88A 1KAGA 3DWFA 3RPEA 3OAAD 2BGUA 4JL5A 1K0UA 4DSTA 3O91A 1XNQB 4HEA6 4C4PA 1H94A 3GB9A 2EYUA 4COKA 2MSWA 4ZJUA 2R8RA 4A73A 1KK1A 2AIRA 3ZVKA 4KSCA 1CHDA 2VCEA 4PE5B 1RXSA 5EJ7A 5DCYA 1H65A 4DZZA 2VH5R 1ZRHA 2GJAA 4Y9UA 4HATA 3SX2A 1Y4UA 1JTEA 3EIEA 1IY8A 1E3DA 2DR2A 3ABSB 1KHHA 3A4YA 2C5AA 1N1DA 3P2EA 3QPDA 1F2VA 2XQKA 3DTVB 4RA9B 2CEAA 5P21A 4B0OA 2RD2A 1I6KA 4QGHA 2CFTA 4NENB 1KQPA 3A4VA 5DXFA 2R79A 1QOQB 1Z5OA 2VBGA 2QTAA 3GD5A 3LX8A 1UOOA 3CF4G 3NOXA 4BATA 2XVZA 4UPVA 5G1PA 1X19A 1M1NA 1H1TA 3N05A 5LJIA 2AC4A 1HZZA 1YI0A 1C29B 1U80A 3LGXA 3ORSA 4LXYA 3RSSA 2PS3A 4PU0A 4UATA 3PC6A 3ICWA 1JAZA 5JAUA 1NN5A 2FSPA 4H1TA 4JR1A 3GIDA 5BSUA 4CGYA 1SPXA 1X7ZA 3NWEA 4L5AA 5JVDB 4ND8B 1U7UA 4TN1A 1W96A 2WNIA 2BMWA 1L4MA 3CLUD 4G5QA 4MROA 3TB6A 7MDHA 2YV3A 5KWSA 4FR2A 4R0NA 3BMOA 2VP3A 2ST1A 1EWQA 2OEPA 1IC6A 2EU8A 4C88A 4OLAA 4I9HA 3ISVA 1RAEA 2FPUA 1SOMA 3E7WA 1HE5A 2X40A 4RD4A 1LI5A 3SJCA 1H5QA 4RHCA 1IBRA 4XQCA 4ARIA 2V7QD 1W47A 1DKRA 3PKJA 2DPLA 5CH3A 2RGEA 2OFWA 1S2GA 1JG6A 2WHPA 4FYJA 4DA6A 4Y18A 4YJ2B 1OZAA 1SCJA 5EINA 1SWVA 2B7LA 2WPDA 5FORA 1ADFA 5BW5A 3Q0TA 2XYRA 4EL5A 3VPXA 3WLQA 3IQWA 3L0OA 3NU1A 3EHEA 5LYJF 1XD2B 4HWOA 3AWIA 2C3YA 1BCSA 5DIZA 5IBRA 3CF0A 3ITKA 4V1CI 2YOFA 1Q7CA 4HXYA 2PV7A 2H8KA 1UT6A 1I7QB 3FD8A 4EKNB 2XJ4A 5K4GA 3MSXA 3QKWA 4FUQA 5DRYA 4UPEA 1BXGB 4R5HA 3OECA 4OLFA 5LXTA 1ZL2A 4R8SA 5F12A 3VUFA 2LBPA 5DI3B 5BYJA 4PZYA 3AVQA 3B38A 5IC5A 4X65B 3LTNC 4L50A 3P45A 5JD4A 3KZVA 4M1EA 1DTWB 4ROSA 3VNVA 1KZ1A 2HDOA 4Z2YA 2QD5A 1ZIPA 1ZD1A 2E4WA 4AT1A 3KT8A 2E85A 4WKPA 1TT5A 3MB8A 3BIXA 1Y1QA 2GZ2A 3NAZA 3QYJA 2OO3A 2BW0A 4OBBA 3A25A 4UMEA 3JS5A 3ICEA 1CUAA 1E6LA 4LW8A 3W90A 1BC5A 4MW0A 1G18A 1KSHA 4B80A 1ZMXA 4CGZA 1OLUA 4FS8A 1G3MA 1QVVA 4BGUA 3KVYA 1HPLA 5EXEA 1DFIA 3D6TB 3HU1A 1DE0A 1XDDA 5EZYF 2FZVA 3LX4A 5ILOA 3GU3A 4EB6B 1VHJA 5REQA 4KG7A 2OZPA 1PR5A 1QMPA 3T99A 3AR7A 2YWGA 2YFKA 3OCCA 3GLFA 1WMFA 1KOGA 1O6ZA 2COEA 2OVFA 2Z58A 4TTJA 3SQWA 1SHJA 3ZWVA 1WX1A 3KWLA 5KVQA 3VAYA 4QXMA 1IY9A 1XTKA 3GK3A 4R2KA 1NLZA 5BN4A 3IH5A 4ALNA 1PD1A 2AHOA 4D9JA 4EEXA 1BQ3A 3DT9A 3MIIA 4NNOA 1JDBB 5GGXA 1CYEA 5EMHA 4UVGA 1ZCZA 3TQCA 3ZE6A 2O0KA 1Q0RA 2Z1NA 1AS2A 1PHPA 4TYMA 3IP8A 3MJVA 3T3NA 1Z07A 3JQGB 1P33A 1C8KA 3QX8A 4QYWA 5HF8A 4ZICA 1DVRA 1VQ1A 3OO1A 1YACA 4Q7QA 2PGLA 2Q3EA 2FMKA 4LPKA 4FHGA 5J40A 4MYUA 3LRXA 4WFQA 3IJEB 4XWOA 4KHPB 2GBIA 4YCSA 1SN7A 3HDTA 5AUOB 3DAYA 4X62B 4F97A 1IN1A 3DQZA 3FGOA 1EK6A 3AR3A 3BFXA 3RUHA 1Q1ZA 4DLKA 1CF2O 2J09A 5C4IA 4JQOA 3PFCA 3FOEC 2AOUB 4OOEA 1L8LA 3PJGA 4ZRMA 1MUUA 1OYWA 3HU2A 4LOLA 2ZS8A 2A5DA 4Y2YA 1QV9A 4RSMA 1X74A 1TTQB 2F1KA 3AGQA 1XTVA 4Q03A 2WDZA 2CLSA 4ER6A 1ZNWA 5KQPA 1SZPA 4CMEA 2PSFA 3DR5A 4EG3A 1GSIA 1OWMA 2Z4TA 1ZVVA 3PUVA 2BZGA 3R44A 3D6MA 1RDFA 2Q3BA 2QPLA 2V7PA 5HBGA 4V0MA 5J4YA 1LCIA 4A26A 3H3XA 1GPLA 3GQBA 4IUDS 3PLAE 3W9BA 2O6LA 3ENKA 1H4SA 1VJGA 4B2YA 1N9GA 1U28A 1JHXA 3MPUA 1EK1A 3QUTA 4RZQA 3SZLA 1YS2X 1E9BA 2VTDA 3RABA 2HU8A 3CW2A 3PVSA 4K9QA 2WMNB 2AOXA 4K9PA 5BSMA 2OWEA 3IJRA 3T0GA 1CR6A 4H3HB 3HBAA 3MRXA 3FZQA 4K46A 4NEHB 3T15A 3KK0A 4UEWA 2GJ4A 4AROA 3O93A 4CV0A 2WICA 3E9MA 5K3FA 3L18A 3EIQA 2IS6A 1XO1A 4OJMX 8LDHA 1D03A 5D3QA 1Q1GA 3TLYA 3ZGVA 3RQIA 1FUEA 2JIDA 4B3IA 1GYPA 1TD1A 5T67A 3DDZX 3SQLA 3I01M 3VJKA 4RPCA 2PWPA 5CB8A 2JS7A 2MOKA 3VR0A 1Q92A 2XECA 3H6GA 1Z8FA 2ZT5A 4MICA 5JZVA 3BIOA 4ZDKA 4ZI5A 3PWTA 5CJJA 5I8ZA 2NU7A 4HZIA 4C7OB 5THXA 5I45A 3ZZTA 1EVIA 3MILA 3KQQA 4UM7A 5T3YA 2H5IA 3V8EA 4Z4IA 4LDRA 2CDRA 1UFRA 2JRLA 1TJYA 1RC1A 2VCYA 3K70C 1A1SA 1YU9A 2FV8A 5FWXB 3W0LB 4D25A 1HYBA 1LKZA 2YVUA 4TV8B 2FJPA 3DD5A 2JFVA 4UUPA 2GRJA 2OWDA 2NUPA 3MA0A 1QR6A 4OFBA 5FD8A 5HGJA 1V7QA 2VG8A 6GPBA 3PYLA 2W43A 4GLJA 2H5LA 4O0MA 4XFJA 4JKIA 3M8KA 4B9AA 1BVRA 4S1TA 2PUHA 4K28A 3FWHA 5DMHA 5BSFA 1W52X 2C9ZA 2Z98A 4Z8YA 3C6MA 4BYMA 3OSZA 1Z34A 2HMWA 3NBAA 1V37A 1CUZA 1H2EA 3I09A 2C04A 2NPFA 1PG0A 1K08A 3IA2A 1Q14A 1W6RA 2CKMA 4CR8A 3ORHA 1L1RA 2HUNA 3OZ7A 4J29A 2IX9A 3CUTA 2WWGA 1E77A 1XDWA 3QU7A 3R8XA 5BN1A 1TJ3A 3NDRA 3RRFA 4FTWA 2R1VA 4JWKA 4RKRA 1HMYA 2G17A 2W9XA 5LOVA 5DMXA 1PQ4A 1U04A 3UWKA 1CSEE 3LQQA 3PICA 4MGKR 1UJCA 1V3TA 2I8CA 3EZ2A 2WV7A 3O3OB 5AKYA 4IXTA 4OATA 2WKQA 1MV5A 3MD9A 2QLBA 3QHPA 4TRNA 4L8GA 4PO1A 5HE8A 4NOMA 4QIHA 2L17A 3RTEA 2B69A 3B9RA 2GJSA 4L9AA 5HF5A 1JQ3A 1KEUA 3WGLA 4B6FA 3FPHA 3NC0C 4ZYVA 2X0JA 2R96A 1FDVA 2YBDA 2QG4A 4URZR 3JVIA 4BLQA 5CNKA 4Z0TA 5PNTA 4N9WA 4Z3KA 3RFTA 1G20B 5FYQA 4J76A 3U49A 1JR2A 3PWKA 2UZ4A 1QFYA 1RBZA 3CRW1 4MI1A 4RA6B 4LCBA 4PYNA 3ZZMA 4C43A 2XE7A 4Q9AA 3SDBA 3HYSA 4UARA 2V7WA 5IF3A 4JFRA 3GHHA 2XUQA 5KC8A 121PA 2H0RA 3PE3A 1U0SY 2YCLA 3H65A 4LYYA 1ID8A 4M3NA 3VFDA 3THOA 3I9V6 2B3DA 3GELA 1X0VA 1AKTA 1XJ5A 2OO7A 2PZGA 1B00A 3D1JA 4OJTA 3W9YA 2RGNC 4W9RA 1YJ5A 3CF4A 2XUZA 5IYZF 1QZZA 2IH4A 2QU8A 2NXCA 4MQFB 3QOYA 4D56A 2AH5A 5I9BA 4LMPA 2Y1GA 2J33A 1H5UA 2Q8NA 3IOBA 4QVKA 1J9GA 4RYDA 4URFA 1PWXA 4P3YA 4ZTUB 2DCUA 1MOPA 1C50A 1DPGA 2PU7A 4Q3AA 3SC2A 4ZZ3A 5JS8A 1Z7WA 5F35A 2QTZA 1Y8RA 3DEAA 1QGUA 3JX9A 2X5KO 4I1OA 3ZCPA 1QZUA 4ALKA 1MH9A 1M2GA 2Z56A 2JEYA 1RW4A 4KFRA 4KIFA 2V8BA 3DYIA 2XIJA 2O14A 1Z16A 3O26A 3VDMA 2SKDA 1H2XA 2Q1SA 1LW7A 3KCQA 3QKRA 4C21A 1G59A 3EWNA 4WOPA 2APJA 1L5VA 1QQTA 3FH0A 3ZBUA 4NMWA 2CJYA 1L5HB 3PQ4A 4TTSA 2D5BA 2XDQA 5B6JA 1A69A 3WLPA 1KP3A 4HOYA 1QLWA 2O1EA 2OMEA 3BXOA 4BRZA 4FSDA 3AR5A 1IHYA 2GYVA 4EYSA 3ILSA 4RZIA 4D0RA 4QOEA 2BEWB 4FONA 4E2ZA 2A9PA 1E2GA 4E5NA 2OP1A 3ZCSA 4CQMA 3MOIA 1CE8A 2NVBA 1I6WA 2ABWA 4OAPA 3PDCA 5CHYA 3UAGA 2QX7A 4R31A 5BNIA 4UCQA 1KC1A 4E4RA 4UFNA 1W0JA 1KMHA 1U7PA 4LISA 4EG8A 4WCVA 5HJ2A 3RFUA 4JBHA 2BT4A 3ORYA 4L74A 3CW9A 1X1QA 3ANLA 4WXHA 4DYHA 3GGPA 2GAFA 2OO5C 2QZ4A 2NXEA 2J4FA 3MOGA 2F1IA 4X6UA 4Q9NA 2ID9A 3HCAA 3QWFA 3O0TA 2Q0QA 4PZ0A 4C4YA 5F5LA 4CG2A 5CB0A 3IBTA 4QWMA 1WUIS 1WKBA 1G4AE 4FDAA 2BKVA 1N2JA 1Q91A 1XELA 2FE1A 4AS1A 2YKGA 3AFNA 1AKMA 3KOOA 3FHTA 2QP3A 3AR9A 2NU8A 1HETA 2HBZA 3OZWA 1OBCA 2O50A 1HLFA 4W5HA 2WW8A 4OQQA 5DGCA 4IWNA 1U2SA 1E2BA 2NPIA 3I9MA 3A3YA 3A7EA 1A8HA 1RTKA 2I71A 1JRLA 5L3RA 3OQMA 4CIWA 3JVUA 1ZQ1A 3QE0A 3RVSA 3VYVA 3KQSA 1U8TA 4GZ3A 1AKQA 1KMQA 3C4JA 3PJFA 2YYZA 2XUDA 3C7AA 2HXSA 4LWPA 4W7IA 3TM4A 2GCIA 3UEOA 5JAIA 4NZNA 3UF0A 5JXGA 4MUXA 4D2IA 1EGHA 1IEWA 4P7FA 2J7PD 7AT1A 5JMWA 2ZYGA 4NYJQ 1GPBA 5DCUA 5BOSA 1UJ4A 4AL4A 3FDZB 3GJYA 4MKIA 4GM4A 5DYNA 2NW6A 4F84A 3W5JA 2XIQA 5IAGA 1K8XB 1PLJA 3NATA 4CKCB 1W5EA 1C14A 1CR1A 3AQ4A 2FEOA 2D2FA 3AI7A 4TMTA 4ALLA 5HTOA 1US8A 1C0LA 1EK0A 2VSNA 3EODA 1T4MA 3DVAA 1BGVA 3NUQA 4HRAA 1JXQA 3T9DA 1CDDA 1GA6A 2DUUA 1XZPA 3K31A 5EMMA 4DCPA 2AB0A 2JA1A 3SX0A 4FW8A 3TRKA 4RANA 3JASB 4I1PA 4IDHA 1M3SA 1DRUA 1VTKA 4Z54A 4B6JA 3TVTA 2I6FA 1RQ2A 1SHTX 3TPCA 1TVEA 3TL6A 1C1YA 4IGEA 8GPBA 1K66A 2DR0A 3G9TA 5HZHA 1W4CA 4W1RA 1FK8A 3MTBA 1YZNA 3NX4A 3GMSA 3GLIB 5FO1A 1ORTA 4IIJB 4OXIA 4PSKA 3A36A 1KDTA 1PJ2A 1RACA 2YV5A 2IP4A 1MJ5A 2JGRA 4HS9A 4PLFA 3QVVA 3EXAA 3P2KA 4H0CA 1KJ8A 1W0KA 4RV4A 4EK9A 3UMYA 4NMLA 4M0UA 2O8BB 1MTZA 5H3CA 4TGLA 2QL9A 9GPBA 1Z7YA 3TLMA 2KHZA 4R05A 1B8UA 1MHTA 3AIKA 4PGHA 4WVFA 1R88A 1C1XB 3A14A 4JR2A 3VH1A 1KORA 2HRBA 2QNIA 1DP4A 2WIJA 4GUAA 3CWQA 2QMOA 3JD1A 3C3AA 1IPHA 4EA7A 4Q7JB 5BSGA 3EEOA 1O8BA 4O3FA 5KQGA 1ACJA 4E7PA 1OA0A 1Z6GA 3H11B 3ZWDA 5C3MA 1FP1D 1JXMA 2HA7A 2YN0A 3A1VA 1UJMA 3M34A 4JYZA 3UK0A 2VZ0A 2NSLA 3TG2A 4D0LB 3A2KA 4DJDC 3TOZA 4M1WA 4C0LA 2R5WA 4H4EA 4JU9A 1X1EA 5IM4A 4GMKA 4RMHA 1TGYA 5AW1A 2AZ4A 2C97A 3FFTA 5LCXA 3T3GA 2LR0A 1J2TA 3HB4X 3HC7A 3WYEA 4D42A 5K6AC 3TJMA 5KC9A 3O8CA 4F91B 5B2EA 3I2YX 4TMKA 4EJ0A 2OOSA 3RVQA 5F23A 3KJEA 3HKBA 3BM5A 4M9QA 4QPDA 1G3UA 1FIUA 3E48A 3EULA 1JQJC 3JR3A 3T1TA 4GC9A 4Z7NB 2Y05A 4H18A 4DQXA 4WCDA 1EE9A 5DTRA 3JQ8A 3SNKA 4BX9A 3ZHCA 3C3CA 5B12A 5CB4A 1DTSA 1WXDA 4DNQA 4KN9S 1YDHA 3HWWA 4S24A 1N6NA 4IS2A 4OXKA 2WBLC 2QM0A 3CVOA 4RIHA 3PHIA 4GGMX 2ZJAA 1RAHA 4AYWA 3AR4A 2ZIEA 1VPEA 3EQ7A 3IX7A 4QDKA 1NMYA 4UD6A 4GVPA 3ZDZB 5KPJA 2FMHA 2YN2A 2YWRA 4C0JA 3G1UA 1KSJA 2EW8A 3H9CA 1EIWA 2C2XA 1VPLA 4DSUA 1ADBA 2BPOA 2IXBA 5FWNA 3G8DA 4B7XA 2I76A 3FPBA 4HGNA 4C7JA 2QV0A 1C30A 1Z2EA 3BMCA 5KZMB 4EG5A 3DP7A 5E7IA 2W6CX 3AW9A 3COYA 4QBTA 1Y1LA 4U2DA 1A50B 1DL5A 3KR0A 2NV6A 4C9BA 4H3KB 4HG2A 2LDBA 5LMZA 2DU8A 2X76A 1A9RA 4Q1AA 5B2ZA 4JI2B 3A1DA 3OE5A 1S3SA 3R3SA 3TTWA 4DRXA 2O1SA 4COOA 1Q3HA 1L3IA 1TM4E 4PS0A 4JEMA 1TVMA 2A35A 4ND4A 4NMMA 3HR4A 3DO6A 5JJKA 1U9IC 2OV8A 3D8NA 4OHUA 1CZHA 1ONOA 1XK6A 4BP8A 3ZE9A 2JLZA 3Q6IA 1UZAA 3N28A 3T7DA 2YW9A 3MHTA 3QG5A 3RT7A 3KKPA 3U5TA 2X86A 4EAQA 1QMGA 2CF5A 2C2GA 1FPMA 2HN9A 2OK7A 4HWRA 1SC3A 5IN5A 3TLEA 2IHZA 1R9GA 2VRWA 1K86A 3IUBA 3R3JA 4KRGA 2EFGA 5HCNA 4LHYA 2ZDHA 3AY7A 1KSFX 3HA7A 3KLPX 3LHIA 2B1GA 3OQ6A 1W4ZA 4G5FA 4N7MA 4UEOA 4YNBA 3RI3A 3TZ6A 1RXYA 1ZK0A 4PAOA 4OX9Y 3K0FB 2VPIA 4M86A 1CF9A 5JAQA 2GOYA 4GAEA 3T7JA 3IMKA 3N5KA 3DE6X 1DJLA 3TFWA 3PP8A 4DV7B 1PR2A 2VK8A 3KE9A 4CLXA 3JCZA 4LJAA 4EZIA 1YCHA 1O08A 2KSQA 1A8PA 3CRQA 4HQFA 4LGYA 1CUCA 4RVSA 1SBTA 3BWYA 4MVJF 2V0CA 3I5YA 1HDIA 1BEZA 5EPEA 3JARB 3BRQA 5LIRA 1SUFA 1JA1A 3C4VA 4RDHA 3K53A 5IWCA 1CRWG 4H77A 3SYTA 5EEHA 3JQ7A 1VHLA 3P27A 5IHPA 3NHFA 3ZZ0A 3KCNA 5BRNA 1LU9A 1N92A 1G8GA 1N9KA 3HCEA 4QREA 1CQPA 3W1EA 4BN4A 4F3YA 4JVMA 1U94A 2Q5FA 2UKDA 3LCVB 1SZJG 3T4EA 2IZOA 3M6FA 5JEEA 4OBEA 4XLLA 1POWA 4QUHA 4DA4A 3LL7A 4JL8A 4TYWA 2VNSA 3L7YA 4IIGA 4IDPA 2JLUA 5G3YA 2QNBA 3JPWA 2JLBA 2ZU0C 1E96A 5A4FS 2J0EA 1I80A 2RKOA 1G38A 4CN8A 4CW7A 1PYDA 1M7GA 4IILA 1PUJA 3PHLA 4HX2A 4C0BA 1T0JB 1VPWA 2PPLA 4GR9A 5E6RB 4UBKA 5I7WA 1EFRD 1EWKA 3EXHC 5CNIA 1OXTA 2OR3A 5BSRA 3FHCB 1B73A 1YC2A 1ZVJA 1WUTA 2I6GA 2POCA 4J9UE 4C0KA 1N2CA 5HZGA 4Y30A 5IBQA 4UVDA 2R00C 1NVVR 5SZJA 1DLJA 2NO5A 3IP6A 3WGNA 4AWXA 1U8ZA 4H3VA 3WOVA 2IIQA 4D46A 2HMTA 3L4SO 3SMQA 3HP4A 4MS3A 4QX6A 4KI7A 1SNYA 3QXSA 2X8LA 2PDAA 1PGQA 2BKAA 2UYOA 2VSXA 4IKEA 4KK4A 3WQBA 1A9PA 3CYFA 2LCIA 3AL0C 5BV8A 4KQ1A 4HY3A 4R3NA 4QULA 2ACVA 1JL3A 2ZTMA 1MIHA 3DFKA 4Q9HA 1LTQA 2FGJA 2OSBA 3ZGZA 3OESA 1R5NA 5FUWA 4F4IA 4L9RA 4NFYA 3NIBA 3CLKA 4XD7D 4BX2A 1XP5A 4E70A 1P6XA 1QIIA 2EL9A 3QFSA 1C41A 4PFKA 3W06A 2FU5C 1Z56C 5JY1A 1QF6A 2VP5A 3FCOA 1I2AA 4RULA 2FPWA 3L0YA 3WG9A 1ZM7A 1HI9A 3ZZNA 1BE1A 2B8TA 1LA2A 5KOHA 3THXB 3T4UA 1KS9A 1LQUA 1U8UA 3VPSA 2RHJA 3A28A 2R0QC 1IUNA 4WTOA 5LP6A 1U4SA 5J2TB 1PR4A 2IPNA 3DDCA 1FXUA 3JWPA 2Q8PA 5E95A 1XDGA 5GOTA 1KJWA 4ZXPA 4D9CA 4JOQA 4TMYA 3FF1A 3Q98A 2JAPA 1Y33E 4KOEC 5LQRA 4EARA 5LMNB 3G0BA 4XLTA 3B1JA 5AESA 2XSZA 4CM6A 1I7NA 1L7XA 4I55F 3ZWNA 4JHXA 2X5NA 3QGMA 3Q9UA 3BMNB 1LRKA 1YQWA 3NRCA 4RSRA 4FM9A 1P60A 2WJ6A 4YMHA 3CEJA 3DFFA 1K1EA 4IH4A 2XUAA 4F5WA 2QG9A 3FNRA 3U60B 3V6LA 2CNWD 2X9VA 5FKJA 1N8SA 1YDEA 4G8JA 4EFMA 3PEWA 1LRLA 5TGDA 1GPWB 3DL7A 3IDQA 4P80A 1I2CA 4EJFA 1QIKA 3WFZA 2XDYA 3Q7SA 3R3VA 5CYFA 4PBSA 4TXMA 1NJ1A 4D8UA 2EFJA 1PZHA 1C9YA 1DCFA 5KSYA 4HYEA 3SQMA 3SFVA 4FHDA 3EPRA 4MQEB 1FLVA 5HUHA 3H9BA 1NBIA 3UHAA 5KYWA 2FW0A 2GXQA 4CV2A 3GJXC 2XKJE 2Z3VA 2ZSUA 4YRFA 1JKJB 4ZJPA 1ZXLA 1EUZA 2AT1A 2G83A 2CT8A 1XCBA 4YROA 1U7HA 1HDOA 1Z9BA 3S27A 1LF0A 2WIAA 1ORRA 2B78A 1LX6A 2Z1MA 1G7SA 1W25A 2HSDA 3RYTC 2Z83A 2OB2A 4FDVA 4GRDA 5D00A 4HNRA 2NXWA 3W6UA 5ALVA 1YK0A 4NZ9A 4KPFC 1S0UA 2IHYA 4ZKEA 4HP8A 4CCYB 3N75A 5LWHA 3ZGYA 4U7HA 1FA9A 2RSLA 1QCYA 2E87A 2HQBA 3AERA 3BE5A 3SE0A 5T7BA 2HBYA 2RKBA 3OF2A 3DHEA 3H5TA 4KGXA 1XWFA 4QDOA 2ZUFA 4L5JA 2BEJA 3KO8A 3R3UA 4JLMA 4BNTA 4AU1A 4QQRA 1ULHA 3ET5A 1U2EA 3PQ6A 3K9FC 1FCJA 1IN8A 1R0YA 3AFOA 4YCLA 2PKQO 4CF7A 1HKHA 1JWLA 3A27A 1CQIA 4FYWA 4JJAA 4US2R 2FZLA 3UQZA 3RSFA 4BGDA 1CT9A 4K03A 4WOKA 1CR4A 2WFLB 4YAEA 1C8VB 3CLUC 1GUAA 4ARZB 3NBFA 4HGQA 3CIFA 4JI1B 3EGDA 1AKRA 2XT0A 4B48A 3FVTA 4CKYA 5B7GA 1RSZA 2JFPA 2HKIA 2MR6A 3ZDAA 1P0CA 4C7BA 2BM9A 3GLRA 4XPIA 4BZZA 1FXWA 1I7LA 3E3AA 4M8IA 2FMFA 4QT4A 4OK5A 2YHIA 2ZAYA 1SK9A 3CN7A 4J0EA 4XUDA 4YJHB 5DBFA 4F2DA 2XXAB 2OD9A 4JLBA 3HSSA 1GEEA 2O20A 4G25A 1NVEA 1M8KA 2QUAA 4JIMA 4P84A 4QO8A 3S2IA 3HKCA 1OLSA 1K8YB 5BNTA 3IIJA 4GP7A 2QQ5A 4OXQA 1MQ9A 5ADHA 1YRQA 1ZG3A 3RSGA 3ZVRA 1Y6GA 4YREA 4WK0B 2KWIA 3V7YA 3ZQ4A 1QJCA 2XADA 3EF1A 2H1RA 3MCAA 4WRRA 1MIOB 4FDMA 4J1TC 2AWOA 1GCAA 1D7OA 2J6BA 4WFIA 5ALHA 1T36B 5LLSA 5CFPA 3U7HB 2PX0A 5CIWA 2J59A 4LY6A 3DBHA 4Y9SA 3ZHQA 1ZXBA 2EG5A 3HBNA 2QVYX 4FYVA 3S1LA 1C9MA 4BO7A 1USKA 2JKYA 3CXUA 1JAYA 4XASA 2ZWIA 1LI4A 1Y5NA 4K9OA 2ZIXA 3IOCA 5DSXA 3ZBTA 1E3TA 5CEFA 2DEUA 1FL9A 2DCMA 1DJMA 4EPYA 1OXUA 3FPGA 2ERXA 5ELMA 4O59O 4ZU6X 1YD7A 2CEKA 1H8HA 3D8SA 3CNBA 2OGUA 4KBYA 3FLAA 2FWMX 5FB3A 3IHWA 4E12A 1O0BA 4DIUA 1USGA 1RAIA 4GT1A 1C8LA 2KX7A 4OYHA 1RYEA 2R62A 4KRXA 2WSMA 2LD4A 2XVAA 3UMMA 3HB7A 4ARVA 4A7PA 3DG9A 4Q4CA 2B20A 5I01A 3U19A 3KYCA 4L8YA 3BXGA 3MWJA 5A5GA 1NXXA 4Y1EA 2A67A 1U0NA 4MRMB 1WQ1R 3A70A 3LDFA 4I9UA 4L5IA 2FDCA 2YQZA 3Q6MA 3W3ZB 1NY5A 1N6KA 1D6MA 1Q17A 1UP7A 2VRNA 3EVEA 3WMGA 4ABYA 4AMUA 5IT9A 2G9QA 2O07A 2PXHA 5DU2A 1YOVB 1GNQA 3L4BA 3L4KA 1ZU4A 2ZVQX 5KB3A 5KKCA 1GXSA 1V8OA 2A84A 2GN2A 2WYVA 4FW9A 1RXEA 2KYRA 4H17A 4PLZA 4DLUA 5ALYA 5T4HA 1ATIA 3PIIA 5AM3A 5FBVB 2DBZA 5CFLA 1NSFA 3RW9A 4BTEA 1WUJS 1YB6A 1VHWA 4A8TA 2FEPA 2GNAA 3WGYA 1RP1A 1PJRA 3VTKA 3CJTA 3TW8A 1NYLA 4NABA 2PWZA 3KZNA 1N1GA 2QVCA 1FNSA 2VK2A 4P4LA 3IAUA 3TCKA 1AHNA 1BE0A 2FN4A 1Y7IA 3A4LA 2JHGA 4NR0A 4MQLA 3X3HA 1XALA 4BFZA 3MT0A 4RDCA 4J1QA 2VJYA 1I5OA 2OHXA 4HS4A 4DCJA 3KTAB 2VHVA 2LKCA 4IUBS 1ODTC 1X15A 3KL4A 3C7DB 5EJ2A 3V4OA 4YLEA 3T94A 4NCBA 5F64A 1Z8HA 1NR5A 1NXVA 4GZMA 5BORA 3OQOA 2NV2B 5COAA 5FJIA 4XGQA 2H2WA 4TX1A 1PL8A 3HDYA 3ED1A 4P54A 3PWZA 3LNCA 3P5SA 1GGNA 5DLDA 4JBLA 3DOHA 2QDXA 1E6KA 2JLVA 1R6DA 2HRRA 2P35A 2QMQA 3BCSA 3HDVA 3QV1A 4HQRA 4L0DA 4R68A 1P1KA 4B4KA 3EC7A 3LYUA 4W9MC 3TRJA 4ER0A 4P4NA 4CMAA 4ZAGA 1BU5A 2ERCA 5JC8A 4G67A 4RJKA 1A88A 5CFNA 3CF2A 1V48A 1V3QE 3GHYA 3LY9A 4B83A 1EFDN 1E2QA 2VPYA 1TT7A 2EKQA 3HVKA 1EI9A 4G9GA 2JK1A 1WF6A 4IYRA 4DXHA 4F4CA 1Y8AA 3PD1A 1BO6A 1DOHA 3SWWA 4J07A 3CQ9A 4JZYA 1QDEA 1PG5A 4HYQA 5FOXA 5KNDH 3KKEA 4CG1A 1VL1A 1XK7A 5AM2A 3G5LA 2QTFA 2XXJA 3C3PA 4GOXA 1B14A 4O4JF 4EHAA 2J85A 2BMFA 2JB9A 3M1IA 2J41A 3NP7A 5LL6P 5TGTA 1NZFA 5TEVA 3K8OE 5LQJA 1SBYA 2XB6A 3BRWA 1KRWA 2D1SA 5DNUA 3VZRA 4WY2A 1MNQA 1OFHA 4QM7A 4OJKA 4X44A 5PGMA 1IY0A 2IS2A 1X14A 3MQFA 2PQ2A 2IV7A 4EL0A 1SUBA 4D45A 5HQ3B 4QG7A 3EOBI 2Q2NA 3AUYA 3IV6A 3PNMA 1MAUA 1RI3A 4X8MA 4FHFA 3NTUA 4UDNA 1T9DA 3RROA 4BMXA 2FZ5A 4TKUB 2PBZA 4CUKA 5KO2A 4OUKX 3AHDA 4KR2A 2HDWA 3VHXA 4DABA 1PNRA 1CZUA 1NYTA 3ONFA 4DTCA 1YE3A 3CHYA 3ASVA 4L28A 4TVKA 4KH0A 1GZVA 4L5CA 4MV5A 2DBYA 3T9EA 4OSOA 5FL3A 5JI3E 1FRVA 1V11B 4PWZA 3B2EA 3DDNA 1Z2CA 2W2PA 5DGDA 3GLGA 4GXNA 1I0ZA 3NBKA 4MI9A 4FC7A 1TF5A 4EBFA 4Z4HA 1OBVA 3CRVA 3TUZC 1PL0A 4S05A 4LE2A 2ZTUA 4UJ5A 5LYJA 4I4NA 1NASA 4YJFB 1AUOA 1ZH4A 2VOEA 3RYHA 5B3KA 1IJEA 2EGGA 3L3BA 4W5WA 2IXEA 2YASA 5EIBD 1WHSB 2ORVA 4WZBE 4Y2VA 4XCXA 1UWKA 5EE1A 3ZHVA 2D59A 5JVDF 2I6UA 5LZ2A 6CHYA 5JYCA 3R09A 2DVMA 4AB1A 4DANA 2I66A 3AIOA 3DEKA 4KQEA 3E9DA 2OBFA 1JFFA 4U7JA 4URHA 4RGYA 3GJRA 4JEUA 1KFBB 2KW5A 3FGNA 4AQDA 2PH5A 4TWBA 2AFIE 3BWBA 2ZCJA 4AN0A 4RSHA 5HKOA 2F1OA 4LF8B 2CK3D 1EVZA 2FFBA 2P6NA 4A8JB 3QKSB 2WOJA 3DUFB 4IKOA 2Q07A 1E2MA 1XF9A 4WX2B 2CJPA 3D1VA 2JW5A 5CAEA 3HYTA 1P2VA 3KUDA 3QFFA 4OHFA 4IWXA 4QTUB 5EZYA 3QUSA 4UHEA 4UVIA 1E6EA 1E1CA 1PTJA 2F9LA 2H06A 3R3ZA 4CLRB 1NRWA 5LZ7A 1QIEA 2HI0A 4YT4A 4F6CA 1YF3A 3GDHA 1CUFA 2FPIA 1OBFO 1MB2A 2IH2A 1CQJA 4DFDA 5AW9A 1LNSA 1QC5A 5E7JA 3T35A 2I7VA 3H18A 3VU9A 3H7IA 2QAJA 3IURA 3Q40A 5BQXA 4HRYA 5GWXA 1S89A 1VE7A 3P9NA 4NPHA 3FMIA 3UPUA 1FQOA 2CNOA 1NJ6A 2G71A 4W5RA 1EJ2A 2WF7A 1K7EB 1SBQA 3PRJA 4DV0B 2BV3A 1AUXA 2IHKA 3U81A 2BR5A 4JLWA 1U8XX 2B98A 4P82A 1N2SA 5MFPA 4U39A 1K5PA 1NBMD 3LHKA 2GCGA 2O0HA 5HJ7A 1C0IA 1LWOA 1SUCA 3G1TA 3I23A 3JWHA 5K3SA 5DNCA 1Y1TA 5FAKA 4PHGA 2FK7A 1NDQA 3DXXA 5IEBA 5FV4A 3NC1C 2UYHA 2PM8A 4D74A 1LLDA 2VPZA 1OZHA 4IAOA 5JLJA 1BQEA 5JALA 5L3SA 1Q12A 4D3XA 4D3YA 1JT2A 1CZLA 2VTBB 1F2UB 2AN4A 2P8JA 1YCDA 2PSDA 1DXHA 3TTVA 5EXSA 3WB9A 1SVMA 3QBVA 2GN4A 1QS0B 3B7PA 4NDAA 1X3LA 3DO5A 3NI2A 1SKMA 4CDRA 1GTG1 3IIMA 1ZP6A 4E32A 3I34X 3O74A 2MYPA 4AUKA 1K7FB 2VSFA 4E15A 3IUQA 3JYPA 4OHOA 5B7QA 1CCWA 4MO2A 4PQFA 3QSYA 4UXIA 5DISB 2VDRB 3DDOA 4BVHA 1GIAA 1GSHA 4HLDA 2BE7A 4MB6A 5JEDA 4DV2B 2I6SA 1O3YA 1X87A 1XQ9A 3FGZA 4DR4B 2XUJA 3F4KA 3I2IA 5EWJB 2JAQA 2B4QA 3A04A 3MWLA 3PFWO 1NVTA 4M99A 4F1WA 2J31A 1A5ZA 3A10A 2BY4A 1W6UA 5AOAA 1JMYA 2HHCA 2A57A 4NBKA 3JY6A 2IPAB 2XUGA 3P97A 1VLVA 1WXWA 2FFQA 3GPCA 4MYTA 1UMKA 2VF7A 3HLTA 2PUTA 3GEHA 2JLYA 3KHUA 3NT5A 3C5VA 4K2AA 4ZOLB 1RCTE 2R25B 3PHCA 2BLLA 4HD8A 3E9ZA 2O2YA 2VEOA 2REQB 3SOZA 1S2LA 2VYFA 1HG0A 2C59A 3KZMA 2DLDA 1I1HA 2G8NA 2E0IA 2MSCB 4XCVA 3COWA 5DPMA 4ZCRA 3I92A 4LPSA 5JH7F 5EKXA 2ZS7A 1AKWA 1DKPA 1WY5A 4HGPA 1P31A 1NATA 3QIVA 5EFOA 1BMFA 4M9ZA 1E0SA 3HB5X 1TAGA 1F6WA 1SXHA 2V3CC 2ZJ1A 2PANA 5SZHB 1T3SA 3DBIA 4JC4A 3OQJA 5CBKA 4X8OA 1PP4A 5KOIA 1OYOA 3MJHA 2QZSA 4RV5A 4S1WA 3V4LA 4CM5A 3PL5A 1U0LA 2Q1XA 4I6GA 5CDHA 1X1RA 3IYLW 5ALZA 5MF6A 1E3MA 2XWBF 3ND6A 3D3EA 3HO8A 2BEUA 4PIVA 4ARUA 5EXPA 4DZTA 5C32A 1TQ8A 1MP0A 2X4IA 5DSZA 4G4SP 3TTTA 3GVCA 3IB3A 2V5VA 2GN1A 2ETXA 2C57A 1ESDA 1G21B 4HBZA 2I55A 4KQIA 2QRVB 1OFTA 3NDPA 4BHTA 3D6NB 2O7QA 4ZU1X 3T4PA 1FX1A 3W6NA 2ZJ5A 2AQ8A 4PPYA 4UDYX 3LYAA 1YJBA 2WZBA 3F6RA 1O97C 3SMVA 2RAPA 2QTNA 2XMCA 1HUQA 4QU9A 1N25A 3BAFA 2GQ0A 5JWHA 2BVNA 3E5NA 5C8XA 5FLEX 2