2WNSA

Human orotate phosphoribosyltransferase (oprtase) domain of uridine 5' -monophosphate synthase (umps) in complex with its substrate orotidine 5'-monophosphate (omp)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
197
structure length
197
Chain Sequence
ALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQTAQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKVDAETVGRVKRFIQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OROTATE PHOSPHORIBOSYLTRANSFERASE
publication title Human Orotate Phosphoribosyltransferase (Oprtase) Domain of Uridine 5'-Monophosphate Synthase (Umps) in Complex with its Substrate Orotidine 5'-Monophosphate (Omp)
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 60
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2009-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wnsA00
1VSTA 1I0IA 3OHPA 4RHTA 4P3KA 4RANA 2C4KA 4WN3A 1A95A 1NULA 1J7JA 1P19A 1JLRA 3ACDA 4RHXA 5ESWA 4RQAA 2VFAA 5E38A 1QK4A 4RAOA 1DQNA 3OZFA 1QCCA 1I14A 3G6WA 2FXVA 5IAOA 2WNSA 1A4XA 1ZN7A 5HIAA 4ZFNA 1L1QA 1VDMA 5K51A 4IJQA 4P84A 2JKYA 4P82A 1BD4A 1ECGA 1YFZA 1U9ZA 3LRTA 1QK5A 1I0LA 1AO0A 1Z7GA 1OREA 1FSGA 1CJBA 1JLSA 4LYYA 3HVUA 2P1ZA 4F8EA 2PS1A 3O7MA 4JITA 1DBRA 1XZNA 3LPNA 1TC2A 1D6NA 1R3UA 4X45A 4MB6A 1WD5A 3OZGA 1QB8A 1DKRA 1QCDA 1A3CA 1GPH1 1L1RA 4QYIA 1G9SA 1DQPA 2H07A 3QW4B 2JKZA 3ACCA 3DMPA 2IGBA 2EHJA 1DKUA 1TC1A 2AEEA 2PRYA 1V9SA 3MJDA 5JV5A 4OHCA 3S5JA 4RAQA 2XBUA 2HCRA 4WMLA 5EUCA 4P80A 1HGXA 4LZNA 4RV4A 1A96A 1G2QA 1P17A 4PFQA 4QYIB 4RHUA 1ZN8A 1XTUA 4QRIA 4RADA 4S2UA 1ZN9A 1BD3A 1P18A 3GEPA 4P86A 1ECCA 4LYGA 5ESXA 5BSKA 4LZAA 4P83A 1QB7A 4PAWA 1LH0A 4RABA 1IBSA 2E55A 1BZYA 1STOA 1UPUA 2DY0A 1UPFA 3N2LA 5BQOA 4TWBA 3KB8A 3DAHA 3NAGA 1HMPA 4M0UA 2GEBA 4P81A 4RQBA 1VCHA 1MZVA 3ACBA 4JLSA 1I13A 1XTVA 1NONA 3GGJA 5KAPA 2YZKA 1ECJA 4RACA 1XTTA 4FYMA 1A97A 1OPRA 4Z1OA 1GRVA 1XZ8A 3DEZA 1I5EA 4RHYA 5IPFA 4M0KA 1A98A 5BRNA 1ECFA 3M3HA 1QK3A 1G9TA 1U9YA 5JSQA 1ECBA 1O57A 1P4AA 1W30A 1O5OA 1OROA 1Y0BA 2JBHA 2JI4A 5HKLA 5BQPA 5KAMA 2H08A 4LZOA 1PZMA 2PRZA 1UFRA 3H83A 3MBIA 4KN6A 1G2PA 4M0PA 3GGCA 2H06A 3EFHA 4X44A
chains in the Genus database with same CATH superfamily
1UJ2A 4K28A 5DLYA 4GR4A 5JISA 3FNRA 4C07A 1TU4A 4Q9AA 4DLSA 3K20A 3PPVA 1WXXA 2D2XA 4M22A 2J5BA 3WLLA 3K94A 4F0JA 4E5UA 3KEMA 1PWXA 4Z51A 3QFSA 4ZCSA 3ZXYA 3ZDFA 2J1LA 2BR5A 5FADA 3HADA 4MI3A 4Q9NA 1O9HA 2ZJ1A 1MENA 4YMWA 1XQYA 2ERCA 1DTWA 1KF0A 3ZWPA 4QT4A 1X1SA 4BJ5A 3M3PA 3WA6A 4QFCA 1NN0A 3T9DA 2LDBA 2QVGA 3MEQA 2EKLA 4Y2GA 2Z2ZA 4LIPD 2P6PA 4IR7A 4PVDA 1NDUA 521PA 3ZBUA 4B33A 4PNEA 5LMZA 2IH2A 3ZV5A 1FE8A 4OGGA 2TSYB 3AIOA 3IXQA 4BCBA 2AS0A 1P7ZA 3K16A 3L0OA 1X92A 1YB4A 3EQ7A 4LF8B 1JIVA 1FTYA 3BWXA 5CVUA 3FVRA 4HK4A 3A4LA 4XX0A 4Q4HB 3V7FA 3DE4X 2HA2A 1YS4A 2NM0A 4X62B 3MW8A 2VRNA 1YR2A 3KJEA 3PGMA 1AG9A 3BMQA 1WSAA 5CHYA 4BVHA 1K08A 1C80A 1GGJA 2X14A 3RFVA 1YVDA 3OMWA 3SLGA 4BV3A 1EXDA 1VJCA 2CFRA 2WVGA 3QKRB 4D2IA 3AKDA 2YCLA 4MLDA 3PUWA 5SY4A 4CG1A 3QG5A 5DNCA 3H17A 4XRRA 1SCUA 4B71A 2JPDA 3EC1A 1B1CA 4YA6A 4QYIA 1LF0A 3QBVA 4BVKA 1QQTA 2ZT5A 2V8BA 1Z2EA 3FCCA 3FYSA 4I99A 1XKTA 2YQ5A 3VYWA 3E3NA 4O0MA 1KEUA 2JJ1A 3MCUA 2W6JD 1ACLA 4G0NA 5IHPA 4JQYA 4TWRA 3FBGA 1QUFA 2G1AA 1D09A 1NBIA 2O2JA 2WHQA 3OQJA 5J59A 2ZR0A 4EX7A 3G9UA 4QXOA 4AK9A 3ED5A 1Z13A 4KHPB 1QYRA 1E5XA 1I4TD 3QFHA 1XSEA 1Z88A 2JHPA 2QRHA 4M0DA 4ER0A 4ENQA 3ROGA 3ZGVA 2XE4A 4L8VA 4QEZA 4I4TA 1ZI9A 1KR5A 4MKRA 2F1KA 1XCGB 3H11A 2NAPA 4PZZA 3FXAA 2HIGA 4BZQA 1QV7A 3P9ZA 1C8KA 1V2HE 4UBNA 5F51A 5REQA 3ZVMA 2XXAB 4DGSA 1MHPA 4D46A 3PE6A 3ZV7A 3NBXX 1QIHA 5K3OA 4Z4CA 3E23A 4MI1A 4QASA 3T6KA 4BLUA 3OTQA 3F7OA 1FDTA 1GADO 1HFEL 1UADA 2HK9A 2QIOA 2I1VB 4NFYA 4HUTA 3UKJA 3KVYA 1IHUA 2XMPA 4XSVA 5SZJA 3JD4A 1CZKA 1TM2A 3U7QA 4A03A 4KN9S 5EPUA 5JXHA 3HACA 4ZJPA 2BV3A 1LDMA 4NYIR 1T1RA 4D4KA 4P5PA 4D9JA 2QAIA 3KKNA 5EE9A 5LSAA 4Q47A 3PNVA 1IOWA 2XZTA 2RJ3A 4N5LA 5DRYA 1TUEA 3Q10A 4TWZA 1SC9A 2NO7A 4B17A 2C04A 2YZNA 3GRKA 4BX8A 1YR6A 4YCNA 2NIPA 5CA0A 1ICIA 1UJCA 3HFGA 4OUDA 3L0PA 1W34A 1PV4A 5DKFA 3EDCA 3CT4A 3L7BA 4J49A 3HXKA 6ABPA 1R0WA 1II9A 1KI2A 1KQPA 2HPHA 1W88A 3BHIA 1DDGA 4X44A 4A0RA 2P2YA 4RVDA 5CEFA 3PTZA 4OB8A 4RD2A 4UCWA 3NVAA 4RANA 4UTOA 4XA8A 3ZUGA 1JT9A 1RJFA 1XF9A 2V8OA 3VC3A 3PEEA 2ZVQX 3CIFA 3PDIA 4M0EA 4BUZA 1NYQA 3FBTA 4AG6A 3LQRA 5JARA 2XNHA 1GTSA 3TFWA 1Z75A 1TU3A 1VL2A 3AZPA 3LBYA 1QS0B 1V26A 1RD4A 1XDGA 3HBMA 3HXPA 4K7JA 4NBNA 4PXSA 1QHEA 4F21A 3D9QX 4IIUA 5JS1A 4EI8A 3LBIA 3OICA 3LXXA 4ZAWA 3AF2A 5LXTF 2OCXA 1AKQA 2PUCA 3HN7A 3ABSB 1QGDA 4H1UA 5ELLA 3ZE2B 1S2LA 3VQTA 4XWWA 2AG0A 2E2WA 3HCRA 1TM7E 3EGEA 4R3UC 5CYOA 1QP7A 2ZITA 5B6JA 4NMLA 4OJQA 3EULA 4PCUA 4GMGA 4HB3A 3ETLA 4MQMA 3PQ7A 2JD1A 5FEMA 3NBAA 3AI7A 1A77A 1MV5A 4ZVPA 3RTDA 4B9AA 1T4CA 1JEDA 3DEAA 2OO3A 4HWPA 2FN9A 3I23A 4NG4A 5EXEA 3WIUA 2FCRA 2FCAA 3WK8A 3ZE9A 2IA5A 2B2NA 3GCZA 3CV3A 2HXGA 4DXHA 4XOIA 2WFAA 3JQEA 3SEQA 3W04A 4ER6A 3HB1A 3L8EA 1FPMA 4G2NA 1OX4B 3JQ9A 1JFSA 1J4AA 2EERA 2IEDA 1N32B 1NR1A 2VTDA 3MB5A 4OXXA 1YONA 3WQHA 4EARA 5KWJA 1SU8A 3ANLA 3IV9A 1DIRA 1M2VB 1T1IA 5AW2A 4I1YA 2ZU6A 1Z4MA 3KKLA 1XAJA 2JFVA 2R8BA 3MYYA 3HCPA 1LVGA 1YZQA 3D2CA 2B21A 5AICA 3IEVA 1N5OX 1UBOS 5EUCA 1B42A 3AWDA 2C95A 3AVXA 4BLTA 2YIMA 2ZRFA 3KWJA 3VJLA 2GWHA 4X9XA 4LCBA 1EBBA 4O4HA 1GN8A 5EXXA 5LDHA 3ETEA 1E1YA 1THZA 1J09A 1C30B 1V8DA 2C4TA 4PX5A 4UJ5A 3D3JA 4GRDA 1YU9A 4LY6A 2O8VA 3NXSA 4ZAGA 5BSVA 1K7SN 1GT91 1XRNA 2AMLA 2F3UA 1F7UA 2BMVA 1LV8A 1P7PA 3I9OA 1FUUA 2QP4A 3LHSA 2P6OA 3CGGA 4KGXA 2G07A 2WJAA 1WZ2A 2E55A 2E82A 5BRAA 2J3EA 2DGDA 1C1HA 1NYRA 2C4MA 3L5OA 4Z8XA 5E6UA 1RPAA 2OENG 2WK1A 5G1OA 4BKRA 5HILA 4DCUA 4ZYVA 4CGYA 5CB6A 2P5YA 2OAQ1 1U04A 2CJPA 3CNHA 4IICA 1CY7A 2JGKA 1RAIA 1X7GA 1YD7A 2JVIA 4M36A 4RLQA 2NU6A 2RSLA 2B5WA 1RTTA 3LX6A 4IS2A 4B3TB 1JYFA 1RJEA 1U5AA 2GYUA 1B3RA 2X1LA 4ZAXA 5KAPA 2AI2A 4BNJA 5K7SA 1SUIA 4LISA 1QQ7A 2G70A 3GQBB 1KOFA 1DLIA 2GAIA 3GOQA 3ZHQA 5A5FA 1XAIA 2C8KA 3BRQA 2ZM6B 2DTDA 2UU9B 3MGKA 1SVSA 4BB0A 2M32A 1E1CA 4NNPA 4D96A 4GOKA 4DHEA 3CN7A 2O3UA 2QQFA 2CMHA 4KQJA 1SQFA 3KJZA 2OEPA 1XDZA 5CUQA 1QCYA 2VHCA 2JFOA 4RZUA 2FTKE 1QU2A 2VCEA 2QBYA 2PAFA 3D8NA 3B89A 5H3LA 3KKKA 4YJHA 2RGUA 4Q9JA 5EMNA 3CVWA 2J9YB 1E6CA 4JJZA 5GPBA 4RNDB 4EJ6A 3MD0A 3QVGB 2C57A 1ETUA 2YMMA 3AERA 3DVLA 3P9IA 4NESA 5TMDA 1KHTA 4QO7A 2PQ6A 3AC0A 2NT4A 4TSRA 3EVNA 5HKBA 4RIFA 1CUYA 5KQMA 1T0HB 5BNZA 3E2MA 3QBTA 1POWA 3SICE 3FE2A 2IXDA 3UJDA 2KLHA 1KEEB 1RXIA 3K0CA 4UZEA 5KYYA 3KLMX 3ASUA 3BWYA 5D3MB 5TGTA 1PK8A 1X7WA 3ZWAA 1FQWA 2P9ZA 2VNHA 2YJNA 1E6LA 2ZI6A 3WQQA 3T9FA 1U65A 3ELBA 1MPXA 3A7EA 4CCYB 2O5RA 2IHNA 2Q6KA 3D5TA 2QD4A 5HF6A 3JZIA 2BKUA 4A6DA 4UU7A 3KYCA 5H5JA 4S1TA 1NOKA 2GCGA 2JAXA 5EAIA 4ZIRA 2PUTA 1JSXA 2AX3A 2P67A 1QO7A 3EZYA 2QV0A 1PFYA 2P5TB 3O8DA 3VKVA 2ISCA 2VYNA 5K0EA 3RRZA 3USCS 2Q41A 1TKRA 1OILA 2EZ8A 2KM1A 4HDMA 5ALOA 1L5NA 1H93A 4TL9A 4XIFA 1Z34A 3ADPA 2XGGA 3GUVA 3ZXSA 3AHFA 3O4FA 1YZNA 4GECA 3FKQA 2OWDA 3WLPA 1YBMA 2XDWA 4E7PA 2XCRB 2AWOA 2HMYB 1H8HA 1TE2A 3L0CA 1Y8RB 3HN6A 3NRJA 4PC3A 2P3QA 3WO0A 5JRDS 2R3SA 1P9LA 5LOVA 2ANBA 3Q87B 4WZAE 1Z5GA 3B1ZA 1AF7A 3VBCA 1PJ4A 3QJGA 4XLZA 2IIBA 5NULA 3UBMA 4BEBA 3ZLJA 2GBPA 2X5NA 4EEXA 1BE6A 2DWQA 2JHCA 1KJZA 1IEXA 1JKFA 4UXHA 2JASA 1MTZA 2O8NA 1M6VA 1X8XA 1DTEA 3AR3A 2AW3A 3WISA 1GV0A 5B55A 2QX9A 1VBKA 3Q7RA 2WPNA 3LLSA 5F33A 3UJCA 4AMZA 4F9FA 2H29A 2TECE 3NOXA 2X0RA 4HO1X 1WY7A 3OJFA 5ES4B 3STVA 2FA9A 2B99A 2NG1A 3K96A 1Y5MA 3KYDA 4I50A 2ZIVB 4D9BA 2FSGA 2ZTUA 3NHZA 1KSFX 2PXAA 4XR9A 1CX9B 1FLAA 4JZKA 5SYNA 3C45A 1R6XA 1ZU5A 3DXFA 3KOUA 1MZVA 5DNVA 3S1AB 2CFIA 1DCMA 1RPNA 4P98A 1X1AA 3R9KA 2C2WA 1B26A 1EU1A 3STYA 4LSGA 4KQ6A 1G2IA 3O73A 4K8RB 2WWFA 4QL3A 1AGXA 3L4EA 3KX2A 2VAWA 3GJ7A 1KP2A 3GP8A 2CFOA 1H22A 3OAAD 3BGVA 3PX3A 4Y0VA 4EPTA 3KZOA 5DZSA 1NW8A 3FPAA 1IUKA 5DBGA 2CJXA 2CZQA 3UMJA 3W0LB 3VH3A 4CF7A 4TYYA 1QVZA 4U2DA 3CVXA 4O2LA 1ENPA 3WIBA 4AULA 4DAEA 2XYHA 4BGEA 2F2TA 3E4DA 1K5GA 4Y2SA 5BYJA 3V42A 1PQUA 1YRQA 2GYVA 4BO0A 3OHPA 1P73A 1OXTA 3FOEC 1NI4A 2B1RA 3JD0A 1VQ1A 4N40A 3THWB 4EZEA 1N2EA 1O4WA 3A11A 2Q3HA 3FDFA 3EASA 4O2AF 3QFTA 1ZAKA 4BX2A 4EYOA 4ZTZB 1L7QA 4XQCA 4TYWA 1O96A 3DE0X 4CIDA 3EVAA 4KGDA 2QE6A 2FG6C 4IIVA 4AKEA 3STHA 2ZBPA 2V6FA 1MT0A 3HKDA 3JD1A 1RHRA 3OTIA 3PUVA 3GLIA 5FULA 3HYLA 3WSWA 2ZRLA 3ZDAA 4DSNA 1VJ1A 4ZC8A 2HHHB 4XI9A 4PYJA 2IZZA 3OJEA 4EGQA 5M2QA 1RP7A 5FLEX 5EKUA 5JFGA 5LXTB 5ED4A 1OREA 3CZ9A 1YDMA 3H9JA 1CTQA 3TD9A 3IEKA 4L15A 3M2PA 5LC1A 3I6MA 4JXZA 3NEPX 3ROPA 1NNI1 1XQVA 1LQ2A 3PEVA 1RADA 4MGYR 4L2IB 4UHCA 1EP1B 4EATA 3IPCA 5AFSA 2FPUA 1U28C 1ML3A 2A84A 5FP0A 1R0RE 3U7RA 5JI2E 3LFHA 2QR3A 2C7PA 4L57A 4POOA 3HLYA 2HCBA 2G17A 1YS1X 4EHJA 1IWOA 1CS0A 1CVLA 4AS1A 4N7JA 3T3IA 2PWYA 3C0KA 4P33A 4EG4A 5IBRA 1Q44A 1Z0KA 3OESA 3VDXA 3ELUA 3TRFA 5L6MB 4FJ1A 1NKTA 4L9AA 4OHZA 2BFDB 3PD1A 4HAZA 4UE2A 1G64A 4JR0A 3OTHA 3VSEA 5GZ3A 1OB5A 4AJPA 3AUKA 1MAHA 3O84A 4QE3A 5B1IA 3UHJA 1Z0AA 4BE7B 2R5NA 2VZ0A 1ULSA 1R12A 1T0BA 2H1RA 3COYA 1X8KA 1TQ4A 3QKSA 5CMLA 1CB0A 3L01A 4JP1A 1ONOA 5JUWA 1RRKA 2PUVA 2J09A 1OLSA 4DR7B 1EZZA 4I6EA 1ATZA 5FUVA 3O2QB 3UNXA 4TVBA 3TUZC 1GSIA 3L7AA 2NYRA 1C7RA 3T35A 3WGOA 1E3SA 2LR0A 3B9PA 3LT5A 4Y9RA 4D8TA 4WLFA 5HJ5A 4C76A 1UEXC 5HQJA 1J9GA 4YJFB 3V7UA 2ODQA 5D84A 1SBTA 2AE2A 1E8MA 2FDRA 1O8BA 2OC9A 3A0RB 3G0CA 3NKVA 3GLGA 1GPMA 1S9DA 3O9ZA 1BU8A 3F97A 1UK6A 4FYMA 4GZ3A 4B3DA 4O4JF 4TKVB 2WB4A 5ITZA 1ZEMA 1HQCA 4PLGA 4BQNA 3L0YA 5ADWA 3BZUA 3IE1A 4ALKA 4G1UC 2IZ5A 2QMHA 3QVMA 4K9SA 2NU9B 3SFVA 4MGIR 4TRNA 2VHZA 4JBHA 2H31A 3P9XA 2JFBA 2JIZA 1Q0QA 1N57A 2MYPA 3O4JA 3TRDA 2LP4Y 3O3NB 4NZ9A 2VATA 4YMSA 5G02A 3Q5EA 1P0PA 2CLSA 2VHQA 4FXPA 3HCOA 3DBLB 3C8DA 3G13A 3M83A 1X8JA 3NTUA 1Z5OA 5A03A 3I9LA 2GDJA 1P0QA 1USGA 3DGFC 5H0IA 4HRVA 3LKZA 4MQEB 2PUFA 1KO5A 2C84A 2GARA 1AMUA 1F3OA 8ATCA 1QU3A 1A5AB 1QK4A 2EYQA 3V48A 1Y5LA 5FL7A 2AZ4A 3JS5A 4CEIA 2BKLA 3ZGZA 1WMBA 4OHXA 1KO7A 5HRAA 3BKXA 4X92A 2JGIA 4Z9YA 4DT1A 2EP7A 5HRUA 1RYMA 3GPIA 4AL4A 1PWYE 2PY6A 2CBGA 4EO4A 3UBTA 2XI4A 2IDMA 2P69A 1AD2A 1CUFA 3KKQA 3AH8A 1G21B 4NMXB 3R0IA 2PFKA 3MUOA 1P2TA 1K4MA 3W5SA 3ZZMA 1T8WA 1ULBA 4Y9DA 3G8DA 4JZYA 5EE3A 3UMVA 3LIPA 3UZUA 1ZH6A 1IY2A 4EVSA 4G0ZA 4X1KA 5BNFA 2PSFA 2OHOA 1EG7A 3UCFA 4WI1A 3HBFA 16PKA 1VGQA 4DV2B 4B0OA 1USWA 4YRZA 2Q6TA 2XD9A 3N7TA 1M8PA 4YJ2F 4HRAA 1L5VA 3S70A 1XPJA 2JFXA 1GTG1 4KOAA 2JAOA 1V1RB 4I0WB 3W06A 2DPMA 3W4KA 5KKCA 3AB7A 4R8LA 1DZIA 4Q3BA 1YK1A 3OE7D 4RKWA 1PG0A 1U4SA 4TTAA 2YYYA 5CLQA 3H7AA 4MX8A 5K0TA 1RQRA 5JECA 5J2UF 4B40A 3KBOA 2OWEA 4R1TA 2IQIA 3OC6A 1O54A 4J03A 3CH6A 1YIOA 2JLRA 1RFLA 4FS8A 4G41A 2D2IA 2AVDA 4DR6B 4IKPA 3EPLA 1CJTC 1NMXA 2YFHA 4WJLA 4C04A 1NTOA 4TVKA 5EIEA 3SQNA 4URWR 1RQGA 3OX2A 2XZOA 3QMWA 4OJMX 4MWBA 4F38A 3ZOZA 4AXXA 4FP9A 3E48A 3U9TA 3AOEC 2MMGA 3PHIA 2CYAA 2Y92A 1KYIA 1T5OA 2B69A 3JARA 2XT0A 3T3EA 3UJHA 1VIYA 5C4MA 4QM7A 3M4JA 2C3OA 5DWQA 1AKTA 1Q0PA 1V1MA 5DNAA 1JHOA 5EMJA 2VBCA 3GPBA 2B6HA 4GEKA 5CFLA 1SCIA 5FORA 1BWQA 1T5TA 3IDQA 2OG1A 2JIQA 4BEVA 1KR2A 3RSFA 3QY0A 5LD2C 3FWHA 4C7JA 1RXWA 1KRWA 4EA9A 1M5UA 1E2MA 3KZ1E 1L1FA 2F55A 2YIVX 1NMQA 1TNDA 2QP9X 2ZDHA 1S3SA 4LZWA 2A59A 2AJ8A 3GJRA 5FV4A 1EP3B 1T9BA 1ZKMA 3K0AB 1CV2A 1XRSB 4JY7A 5L7YA 3HXOA 2UVPA 2VDWB 1OLUA 2PKEA 3KALA 2P2LA 2B0JA 4IDFA 4XR4A 1A98A 2DUUA 5EHXA 1C0PA 1EJ6A 4CF6A 1OYOA 4E4TA 5E1MA 3PL1A 4Q01A 3QV1A 5I7FA 3CNLA 5AUOB 3KSAC 1Z63A 4NCIA 3D3QA 5ENVA 4U3JB 2JH9A 3KKPA 3HWRA 1G2PA 1EHIA 3E4CA 3EW9A 2O2YA 4BN5A 1N2SA 1YC5A 3A9WA 2VA9A 1YTLA 3EXIA 4CLRB 4IEFB 5AVJA 1AKVA 4F5YA 3A0UA 1Y4UA 2ACVA 3GPCA 4BO4A 3RC1A 5SYMA 1N3YA 1L5HB 4G4GA 3T4PA 5JAHA 3O4RA 5K4AA 4D3XA 3D31A 2QSUA 5F7XA 5EXPA 4L51A 3P94A 1X7DA 2FW1A 1X0XA 1CRZA 3ESBA 3H0KA 3PNLA 4V0OA 3FZNA 4KVZA 3SVZA 3WADA 3QLJA 2R60A 4Z7NB 1L6RA 1L5KA 3DZFA 3ZQ4A 2AD5A 5BSRA 4ZDJA 3DOHA 1ZA1A 5E1DA 1XYGA 3NZEA 3AL3A 1KH1A 1KAQA 3K6JA 1CJVC 1U2GC 4O2AB 4QRHA 3WICA 4Q5IA 4UFPA 5A4AA 1V5FA 5AVQA 1F2DA 1K8XB 3U44B 2J3QA 4P3XA 2VCYA 1IZ8A 1JKXA 4YYZA 3WLFA 2GN2A 4YP0A 3VNAA 2R5FA 1K89A 1LNQA 3HJHA 3QE4A 2ODWA 4C1NA 3D0RA 1BCSA 4Q03A 7MDHA 5DHTA 2BEVA 2ZJ5A 3ILYA 2QW1A 3IR7A 4CETA 4J0CA 3GFGA 2GKSA 4NV3A 1W1UA 1WUYA 1NOJA 3I30X 2YS7A 1FP4A 2ZW9A 3BD8A 3IAEA 4MB6A 1NPDA 1WO8A 1OD6A 2X76A 1TVKA 1E61A 4KE6A 1JI0A 2R0QC 5JS2A 1Q1EA 2QRLA 2R1UA 2XB4A 2JI8A 4KFUA 3RAPR 1D07A 2WFLA 1XTQA 4IX1A 1XVLA 1E9FA 2MSDB 1EUZA 1GLGA 3QFCA 5AKHA 1FA9A 1U0BB 3LY5A 1GCGA 4RAQA 3SHVA 1II8A 5B1YA 4BNGA 3DA8A 3OLWA 2GF0A 3RAGA 1JDSA 3UAZA 4XGNA 3G8AA 2D1TA 3FSJX 4MVJP 2FE4A 2IOFA 2P2DA 3LCVB 3MTGA 2ZJZA 2J48A 3GGOA 4PYMA 4ZANA 3RTCA 2ZUUA 3SJBA 3TOXA 4D92A 1AUPA 4X1YB 3V34A 3OIDA 3H75A 3JAWB 1VYUA 2Q5CA 4EGJA 2IF0A 4WT7A 1PL8A 1RJWA 3CC8A 3HY6A 1KRHA 4J16A 1PD1A 4NYIQ 1N1GA 1CJUC 1VHTA 2WFMA 4JASB 2DUNA 1J2RA 1AUVA 3FGZA 3Q7SA 1NXOA 4MWCA 5KOJB 2PMDA 4LQCA 1G5QA 3HSSA 4R1MA 1H1TA 3ILVA 3WJ1A 4R8SA 4W7HA 2Z2JA 1MNAA 3HUFA 3IPXA 3K5WA 3WP1B 3WLMA 4CCAA 3ZDCA 4OX9Y 4U6SA 1PUXA 3GHHA 4ZAYA 3FOBA 1OWPA 3SEFA 1X70A 3QUSA 4FHFA 4U2BA 1FNDA 1XDDA 4PICA 4ACBA 2DR2A 1PGQA 2BGIA 2BMFA 5T8KC 2QLBA 3OFSA 1J2TA 3VDNB 1U11A 2Z8XA 1VL8A 2QROA 4QZVA 1NV9A 4Z7QB 1NX9A 1NVDA 4PGAA 2CHGA 5GJVC 4G1VA 4CF3A 1N0WA 3HKBB 1K7YA 2NQ2C 5AK4A 4GBMA 5DEOA 2D2EA 4BVFA 1J8FA 2C2XA 1MQSA 3U31A 1ODTC 3IAHA 3BSSA 3ODPA 4TWAA 3WGVA 1JQAA 2EL9A 3HVJA 4OHPA 4CQMA 3W5DA 1T4MA 1OXKB 3CW9A 4N5MA 5C3UA 3V8PA 4DA6A 2E85A 4O4JB 1O5TA 4XUGB 5L51A 4FFLA 2VWQA 4XGKA 4D0LB 3PTLA 4DLWA 1EH5A 1LSOA 4ONEA 5EJEA 5KYGA 2DOKA 1ZD9A 3ADDA 2GESA 2UVQA 2HADA 3NCTA 4J90A 4EJSB 3N5CA 3TLGB 4D4GA 4YMVA 4ZDWA 2I7CA 2JK1A 4FYYA 1R9GA 4DSUA 3DKRA 3M1YA 3U3OA 2Y2UA 1U0TA 4LQLA 3GBPA 1ZY2A 1D4ZA 1WW3A 4LDZA 3I2KA 2VFAA 2Q2VA 8AT1A 3KTFA 3R6TA 1PJ3A 3M9XA 3MCZA 3MJVA 4I08A 5ICFA 4ZEOA 3RUHA 3K4PA 4F2HA 1KJ8A 2W4QA 4WUVA 3UICA 3MPOA 3GCWA 2ZJ3A 5BN4A 5AP9A 4L9SA 2ESRA 3NJ8A 4N65A 3TXXA 3BXZA 5K3BA 3GYBA 3NWEA 1KK1A 2RBEA 5DHQA 3IQIX 3N6XA 1TTPB 4GXQA 4WUTA 5G40A 3ZZNA 5AHXA 1FPQA 4WK0B 5C4IA 1GVHA 4OYHA 2J32A 3GFBA 3N2YA 2ISQA 4RFLA 3BRWA 5IC4A 1QTRA 2FQ1A 5DLEA 3AFMA 1SHUX 1XZNA 2A5GA 1G7SA 2G83A 3WYEA 1UBUS 4HGOA 3V1LA 4K46A 2VP4A 1JALA 4BZWA 2FPMA 4II3A 1P2UA 2GK6A 3MJFA 1A3CA 4RX1A 5DGXA 1YE8A 2PXXA 4ZT2A 4YJ2B 4NBSA 221PA 1XWFA 2QN7A 3MRVA 4OP2A 2YNMC 3A8TA 1BQ4A 1AKYA 4MPTA 4E5DA 5CG2A 3ICPA 2ZIUB 2J6IA 1P2SA 4FZ5A 1ENOA 4BBZA 2QKYA 2V6JA 2LIVA 2IITA 1JKJA 1EQ2A 1Q12A 2LKDA 2I22A 3JW8A 4PWYA 4PYNA 1G8JA 2OBNA 1X7ZB 4GX1A 1QYIA 1RCFA 5J2UB 2NVUB 2KYRA 4EKNB 1C7QA 2RB4A 3HDGA 4NDNE 2X0IA 5K2MA 1K88A 3RIHA 3HCFA 4FWBA 3DO6A 1DJPA 4AZWA 5HKAA 1YR8A 1Y3DE 3KVVA 3VR5A 2L2QA 2F62A 1M9NA 4GGOA 2AZXA 3CX3A 1L5RA 5IC6A 3I42A 2W6MA 1IBKB 4KXMA 3DJFA 5DI3B 5E4JA 2BTEA 5CNJA 2SKDA 1P4RA 4DRXA 5K8TA 2HYIC 1R0SA 2O8FA 3QEJA 4NOJA 4DW8A 3ZGYA 1M2JA 2PH3A 4IZIA 4ZAFA 2BLNA 3UUFA 5DIZA 4CF4A 3RFUA 4HVCA 2XCOA 4ZVOA 4CEJA 1K75A 5TXGA 3TRJA 1ID8A 1I9GA 1PUJA 1ODFA 2AV6A 1UXOA 2CUZA 1UJNA 2FQWA 3M4YA 5ALMA 1V3TA 4TKMA 2FFAA 5K0BA 1AK2A 1OC2A 4G5OA 2QSZA 5T3YA 1VPTA 1JG1A 3RRMA 1JR3D 1ZP6A 3W9BA 3A6PC 1JDVA 3E3MA 3IAS1 4YV7A 3NTRA 4JQCA 4PG6A 3L0SA 5B7QA 1QOQB 2KBEA 1R5BA 4MQ4A 3KWMA 5TQ0B 3SZGA 4HT3B 1V8ZA 3QEAZ 1GZHB 4PRYA 4PLPA 3L77A 1U28A 2C98A 4MWDA 3M5PA 1Y0BA 3Q6IA 4E11A 3TX6A 9LDTA 3MYRA 1IVYA 1XR3A 2PRJA 4G5HA 3KQVA 5JTUA 4DV1B 4R8KA 3JYPA 1E89A 3OIYA 2A9RA 5CFNA 5F76A 4ECAA 1P44A 3GNLA 4CEHA 5BVGB 3UAWA 4MMZB 2W4IA 1C0LA 2Y9PB 4LJLA 1YQGA 3L7JA 4DTIA 4ND2A 1T6ZA 4O0LA 5CYFA 3BTOA 2IZ1A 4JL8A 4YQYA 3KLPX 1UEJA 2VBGA 4ZP1A 5ADHA 1N9GB 3EPJA 2IY7A 5IWAB 1Z83A 7YASA 1J23A 2AFHA 3U3KA 3QE3A 4QNRA 5ERXA 6PFKA 2A78A 4Y30A 1H8HD 2GWRA 4ND7A 3IJRA 4G4SO 4C7VA 3IJEB 3EFOB 3W5VA 2R8YA 3T7CA 4YAJA 3T52A 3JPWA 5A06A 4DYHA 3L8DA 4PHCA 1NKSA 2Z2IA 1N5RA 3L6CA 1DFHA 5DGTA 4CUZA 1XQ6A 5IJ9B 5AKIA 3T1TA 2RHWA 2GR9A 4DUZB 2C61A 1DI0A 2QAGB 1EXNA 4TLEA 1SUBA 2LGJA 2IP2A 4Z9BA 3R3ZA 3L18A 4H27A 2H92A 3X44A 1L7NA 2DY1A 2JFGA 1JIUA 4QFMA 1FQKA 2CHVA 5EMLA 4CLOB 5EJFA 1NGSA 3QWIA 4I55A 3W6PA 2QJFA 2ZULA 1OWOA 2EARA 2WMYA 3FMGA 2WMDA 2YTZA 5IAKA 2PX5A 1DEOA 2ACKA 3I9KA 4NE9A 2FUCA 4LY0A 1HA3A 4EW6A 4IYJA 3DH0A 1MIOA 4REQB 4BRWA 4J6FA 3TNYA 4V2UA 5GMOA 1YOVA 1ZH8A 3U3DA 4K9LA 1ST2A 2Z8ZA 3E61A 2P91A 4IDEA 1MXFA 1KQ3A 2VOJA 4JJ4A 8ADHA 4YUVA 2WU3A 2HRRA 2JJMA 3N70A 1QG0A 4QGAA 1JQBA 1JUDA 3DEHA 3MA0A 3U3JA 1B7GO 3K1ZA 3KAJA 1GUFA 1K3TA 1P1KA 3R3XA 4C21A 3ZNNA 4LYAA 1SVOA 1DJLA 1UKVY 3OU6A 2RB5A 2PX0A 4JJ7A 4OUKX 4QARA 2XX3A 3RQIA 3HM9A 1N5KA 3M4ZA 5K3SA 3KQNA 3AU9A 1F8FA 1HBJA 4HAIA 1SO8A 5KVQA 3IDFA 5A4FS 4IJUA 4KAAA 3WGQA 2V97A 4JENA 2GZ1A 4GVXA 3A14A 5KNDD 4EMUA 5HX7A 4QOIA 1RYZA 3K9HA 3GRVA 2HO4A 5A3QA 3C4QA 3RYFA 3G1UA 1A8PA 2FQQA 5F5NA 5IJAA 3STTA 5BWMA 2Y6UA 1SBYA 2NZ8A 3AFNA 4A8JB 3TIIA 4FYJA 3LQQA 3DOJA 4J94A 1F0NA 3G88A 4ENPA 2NZXA 2WVAA 3GGPA 2ZWPA 1G18A 3G23A 5F1KA 4G5SA 3IVGA 4HNVA 2VWHA 3MS7A 1T5LA 3ICQB 4ZYZA 3PT9A 1UP4A 1OBFO 1G8SA 2A9JA 3UJ3X 1E32A 1VZ2A 1OAKA 2UZ1B 1XZMA 1T26A 1E64A 2PK3A 4UVIA 2WHRA 3RIYA 3RV4A 1AUQA 4JYPA 4NF2A 2GX6A 1O5OA 4C2BA 5JD6A 5U9CA 1GKLA 1VG0B 1R9MA 3OOEA 1EDZA 5C8ZA 3QKUA 2JGFA 2CVQA 1XMVA 2QENA 1NVEA 2ZJBA 1YVUA 1Z7EA 4K6CA 2FKAA 3D7NA 4TL7A 1JIXA 3DMNA 2H65A 3GY0A 2CY0A 1JIIA 2M6KA 3MG9A 1P1FA 4MS1B 3LLUA 4ZQHA 4JI2B 1T8YA 2I76A 1O9BA 5F2EA 1C9DB 1K7EB 5HVNA 1VLMA 2QNIA 2FRXA 1GA4A 2AOUB 2V03A 3UK7A 3DVAA 4J1NA 1P80A 2O7SA 4URXR 4YP7A 1MB9A 2OVFA 1AUXA 2G40A 3B13B 4R2HA 3HVRA 2LD4A 3JZMA 2BEWA 4ZA2A 3BK2A 5BWLA 1Y8QB 4KIFA 2DWPA 3RGWS 3EZ2A 1ZWKA 2OLKA 1AKEA 4UNRA 4RF4A 1ORWA 2LNDA 3INYA 3Q41A 4RM2A 5LZ4A 1GFWA 2QXTA 2VXCA 5IUNC 4FCCA 2ZYSA 3RVQA 1HG0A 1VBMA 2GNPA 5BURA 3AINA 4XM2A 2DB3A 1R6DA 1H65A 5AMXA 1ORRA 1CVRA 1GZ3A 3FX2A 5THXA 1ADYA 1IB6A 1RZVA 2B78A 4GM0A 4TZKA 1G3QA 2HNKA 4LRXA 2NU8B 4DJEC 8OHMA 1L0BA 2GN9A 4L3OA 4M37A 5E6RA 3THWA 4A0HA 1E7WA 1UK9A 2PU5A 2VJCA 3MM4A 1OF1A 4FINA 1D3AA 3D2BA 1NUPA 3GEDA 1WLYA 1K8QA 3E82A 3NAQA 5FPYA 1VL5A 3EDRA 2DLCX 3I2JA 2ZRJA 4CMGA 4JJEA 3CH4B 3NG1A 3SK0A 1R00A 3ABOB 3VYVA 1ZL2A 2FMKA 4EECA 3LCRA 1F06A 2A0KA 4IQGA 5KQRA 3ESXA 4WXEA 5JZ9A 3Q3CA 4EHHA 4II7A 2WV7A 5DP1A 2ODAA 3GLKA 3OD1A 1QYXA 1Z5WA 1T2UA 2ALJA 3K5IA 3IVAA 1GZSA 4L8LA 4OBBA 1ZX1A 4BVGA 1XBTA 1A4RA 2XSZA 3BXFA 1UIMA 3C5EA 4HH0A 1T13A 1U0OC 2FF5A 2OGTA 2VJMA 3DTNA 3OI7A 4K0RA 4Y9TA 5JW6A 3TG2A 1JU3A 2LW7A 5DHRA 1HDIA 1PIWA 3H1GA 3SKVA 5BW4A 4HWGA 3GUCA 3T3MB 4B8WA 3TXYA 1DEXA 2BBSA 3IMGA 4EPRA 1EAMA 2CVHA 2FEOA 2OO5A 3FGPA 2HQOA 4CV3A 4HVLA 4NOMA 2JIZD 4MV6A 4Y2XA 4FNAA 3NRBA 3L1UA 3WGTA 3N8HA 4N0EA 1EWRA 1IPHA 1B8VA 2QLTA 5FV7A 4UPDA 1IN6A 4B87A 2R1ZA 3DFMA 2BE9A 3HG7A 1U2GA 3OCVA 4LWPA 3WWPA 4DRYA 1JYSA 5BWBA 1NN1A 1UKEA 3HUDA 2HHLA 3Q11A 4P31A 1KAOA 4QQ8A 3KXDA 4KDCA 1JEEA 4CMCA 4F2PA 1AQJA 4PU0A 1DC7A 1GNVA 1U2DC 2H1LA 2OR3A 3W2GA 3EPKA 1W5SA 5FA6A 4A5OA 2JI7A 1CJSA 1M1NA 1UMDB 2BM1A 2YZMA 3WO1A 2IS4A 2I1LA 4J1TA 4P3YA 3H42B 4LJYA 5F1PA 1VPEA 2ECFA 2HF8A 4PC1A 1GNQA 1ZM4A 3MAAC 2RAUA 2VF2A 4KPUA 4HNUA 5JCJD 5FIUA 3IVXA 3IAS6 5IPFA 1EZ1A 3GRRA 1C81A 1Z2AA 3GU3A 1UC5B 3HA7A 2VG8A 4IOKA 3MWEB 4C0XA 2O7QA 3GZ4A 2F3PA 1JYEA 4C43A 1KAHA 3OZDA 4WXMA 2PTHA 4FZVA 3DEIA 5BSGA 5JYEA 2AZMA 4KRGA 1FDWA 1JDBB 3FAKA 4HXFB 4DIEA 5GINE 5CXUA 3T7SA 4X54A 4KSYA 2QW0X 4R98A 1SELA 1JIKA 3CF6R 3IH5A 1SG6A 5LP6F 3A4NA 3DV0A 3BSWA 3AEZA 1Y4ZA 3GT0A 2PFSA 2DZDA 3KT0A 4GQBA 4DLKA 3I1FA 4GO1A 4G84A 3AO0B 4NENB 5BVHA 4S0ZA 4UUOA 2I6QA 2IYFA 1HEIA 1ZNZA 2PRIA 3EIUA 4YMTA 4Q24A 2BKVA 3THXB 2HK7A 3ND7A 3SE7A 1YCDA 5DX1A 2ZBDA 5HQTA 5EMMA 4BGUA 3LPAA 5EIHA 4GWGA 4XYGA 4PSCA 4YYEA 5EPEA 3LBNA 4ASUA 4C4YA 3A4TA 3LD9A 3L8FA 1A76A 4HJXA 4OOEA 5G3ZA 4BO1A 1L4UA 2COEA 2FUG1 3GIWA 5TPZA 3WL4A 2PUEA 1Z6AA 3KEGA 2WSYB 1ECGA 1RYFA 4M98A 4P82A 5IRCD 1G1MA 3ASZA 3BL5A 3CJTA 3V1MA 6NULA 3MVEA 4HZUA 4FGJA 2Q28A 5T8KA 2YOGA 3AM5A 3AI3A 1E6EA 3OQIB 4IJVA 4NYJR 3WWZA 2I4LA 4F8EA 1Q7BA 3TTUA 1Y3HA 2F8SA 4C3ZA 2WF8A 4JLAA 4Y1EA 4DAOA 2ORYA 4P7GA 4JGGA 1TRHA 1Z8HA 2H2AA 1Q7RA 1WD5A 1GXSA 1RS0A 3CONA 3QVLA 3OPYA 2O6HA 4OHVA 3TSYA 3V4RA 2J8ZA 2AQ8A 1E9DA 1HT2E 4L07A 5CDFA 2F3QA 1XJCA 4NE2A 2XB2A 4F3CA 1M2FA 2QTZA 5I7AA 3OJLA 4LF4B 4EG7A 5KJ6A 1XTBA 2HA4A 1O7JA 4N0DA 1QC5B 1VB5A 1ZM9A 1UBSB 2XA9A 4K6OA 4Y67A 4AWBA 4EKDA 5BSHA 1BVYF 1E6WA 1FBNA 2IUYA 3H6HA 4BVAA 1OJ7A 2EFHB 3K92A 2H48A 4OJTA 3HR7A 2OORA 3GLHB 1MJGM 1XDBA 2LRHA 5IVHA 5LQDA 2EQBA 4H1HA 4EPVA 1LY1A 1W76A 4IDDA 2WTMA 3BORA 2BZ1A 1OWMA 3LDUA 4KQ1A 1A0OA 1J97A 4PSDA 5DK4A 5IBQA 4RA9B 3RWMB 2YWFA 3IP3A 4BNVA 1IG3A 3TZQA 3K8ZA 5JDIC 3VVMA 2NUBA 2PIDA 3MELA 4NU5A 1JSRA 3G1TA 1X3SA 1RIIA 2IHJA 3DMTA 3HJRA 4I8DA 3WB9A 4YTEA 2GXAA 4MW0A 1CY0A 1NW4A 1C3XA 3MMZA 3HVIA 4M1KA 2ZI5A 4PSUA 2J6BA 5KWIA 2XUKA 4M9UA 3HDHA 2O2GA 3R76A 4EW1A 2PJRA 3OPXA 2R4QA 3HKCA 4HGZA 4JBIA 2BMJA 1ONSA 1K3UB 1P60A 3AVOA 4XFJA 4BEJA 4BUCA 5JR3A 1XTVA 4IRXA 2XF8A 2NPFA 3VUFA 2QPAA 3KYJB 2AMJA 2Z95A 2DERA 3PHJA 1YR1A 5K1ZA 4H7KA 4QPNA 3THYB 2J5QA 2PANA 3L8ZA 2FZEA 2OA0A 2MSLA 2C8VA 2ZSAA 5L3SB 4F72A 3ZY6A 1E8DA 4BV9A 3JAMA 1PR0A 3B2EA 4GUAA 4EA7A 4QGSA 5B4TA 1HWYA 2B4AA 4C5CA 3IVCA 1NY5A 2NUPA 4J7UA 2ADFA 4PBTA 2VUIB 7AT1A 4UE3S 5ENDA 5DNEA 5GZ1A 2FEMA 4UW9A 2E5FA 2MSWA 3CF0A 3PE4A 4ME6A 1PWHA 1EX7A 3HYSA 4HD8A 4E2XA 4KGVA 1GYRA 1MPTA 5FI3A 5AH0A 3TG8A 2WZCA 3RBZA 1ABFA 2Y1GA 3IGFA 4KIWA 4ATNA 1PNVA 1BFUA 3Q7QA 3T8YA 5C7OO 1V35A 1Z35A 2AX4A 1M1YA 1MEEA 4P08A 1XMJA 4B48A 1HRDA 3C70A 4AAYA 2G9NA 1KI6B 4JP2A 1DMRA 5AXCA 1DCKA 4P4NA 1KTVA 3M6XA 3GRCA 4FT2A 1F2VA 2QUZA 2ZBQA 2Q0SA 1FS4A 3AIKA 1KMIY 2QG4A 3AILA 3CW2A 1V8PA 2IYRA 1W46A 1K63A 2XMQA 4DCOA 2ZE5A 3K9WA 1EWTA 2VH1A 2HZBA 1KOLA 3U3RA 1IIBA 1I8TA 3B6KA 1H69A 3H5RA 2PRSA 3SYTA 4A7PA 4ZK2A 1FTGA 2WSSA 4QG7A 4BLSA 2B94A 3ZJTA 5CNKA 3EF3A 1MTOA 3K0FB 1MBZA 4MROA 5IW8A 1J21A 1SXJD 3DZCA 5I45A 5KHLB 1UKAA 3A1DA 1YRHA 2GLTA 4Q48A 3QLUA 2UYGA 3UV3A 2ATIA 2SKEA 1YUBA 1H2YA 5EIWA 1ADBA 5L3RA 4CLDA 2DLDA 4RH0A 2KS6A 2V7QA 1QCDA 4WLVA 1VMAA 4IFTA 1A7KA 4BY9E 2VPWA 1Y98A 3EQ8A 1IBRA 2I3AA 4BC1A 2PCLA 5ESRA 3N2EA 1JBQA 2OHFA 2LBPA 3EC2A 3OPQA 4RZ3A 4XD7D 1QPZA 1ZXLA 4GX5A 1C3VA 1HE4A 3GNQA 2AFIA 1KI1A 3DNMA 3IBSA 4WMLA 3KR2A 3B9QA 1DXOA 2F64A 1LSUA 4QLAA 5TV2A 4BPBA 1VRWA 1W73A 2OV3A 2DQSA 4CKYA 3BFKA 3HFRA 3ITDA 5CX4A 1Y81A 1UQRA 1W75A 4XXHA 1KYXA 4F93B 3JVVA 1OI7A 3BXGA 1TCCA 2X1MA 5I9BA 3A04A 3TSOA 4EG5A 1VXRA 3OEYA 1QHHA 2NYVA 3Q3GE 3RW9A 4OHWA 4BTLA 2AJBA 1O95A 4HWRA 1V41E 5IG2A 1WDTA 4LRUA 8LDHA 3C3JA 2OCPA 2OPBA 4FDLA 3OECA 5G41A 5JTTA 2GM9A 3HO1A 1LD3A 3CNNA 3D4IA 3IHLA 3H5AA 1AIPA 4V39A 1YQXA 1PZNA 1V39A 1T9GS 2FPGB 4FNGA 3T3HA 5H8WA 3GFPA 3OSZA 3UF0A 3PXUA 4JVSB 5CAEB 4WNAA 3HPRA 3FLAA 2MWMA 3R6GA 4ZVSA 2ZPTX 3EXHB 4RXMA 4DZTA 3K1AA 3TAUA 1M6WA 3RNOA 1AOXA 4RW0A 4B4OA 3TQSA 3W1VA 3H99A 4M38A 2QRVA 1AMOA 1CP2A 1GQRA 4G25A 1KDPA 2APJA 4KUHA 4UBKA 5L9AA 1GM5A 4DLBA 4HLDA 3VKHA 3AM1A 1WZEA 4YFYA 3DL4A 2IRWA 1I4WA 1MO2A 4KU4A 4NJEA 4RZXA 3VX4A 1T2FA 2WUVA 4CMJA 2UZAA 1VL6A 1PQPA 1X9IA 2O2SA 3LVRE 4J29A 3GP5A 4XUEA 1DFGA 5AT1A 1OC4A 1XYYA 3TW6A 4GF5A 3NTOA 2Z3ZA 2WM3A 5C7LO 4MH0R 3NC1C 3F5FA 4F56A 2J5KA 1CJMA 1RRMA 5CLIA 1KJWA 1S3GA 4RVOA 5CT5A 3KVRA 4PV7A 2W6PA 2XRZA 4G5QA 3GHYA 1U99A 3K05A 1IY1A 5LP6B 2GHRA 1MEOA 4FEAA 4RULA 1SMKA 1TM3E 2O4CA 4HL6A 1Y5NA 3I6BA 4UCQA 4CM8B 1J24A 5TJHA 4NPAA 1Y34E 2ZQYA 2C9ZA 3VVCA 4HN2A 4ECEA 4ESHA 1QORA 5HG0A 2I2AA 4C87A 5CFRA 3BMCA 1R4MB 4GG1A 4YUXA 1KPIA 1NI5A 1SURA 4I66A 4LTDA 3U37A 4AJ9A 1LUAA 2ENWA 5I4BA 1EFLA 2FR8C 2FUG6 3ROTA 3H4MA 2O06A 4FFMA 2FSPA 4NCJA 4NHOA 5LDDC 1X6VA 5D6NA 4AICA 1Z5NA 1ZN2A 1VIVA 2G04A 2OSVA 3PYMA 4KSCA 3U1VA 1QFXA 3VR5D 5C9ZA 3C43A 1SOAA 5CBPB 2R65A 4BLQA 2X5XA 1G60A 3SHQA 1BEZA 1ADFA 1CY8A 2JZCA 3AUFA 3B5IA 3HFSA 4X5OA 3ZGOA 5B7NA 1MN6A 4HCJA 5BORA 1Z2OX 2FLKA 3V1KA 1EE2A 5BUQA 2QE7A 4RHFA 3OUUA 1WEHA 4N8EA 2DFPA 3BFXA 3DEYX 3K2EA 3MCWA 5GADl 1UZAA 2CNWA 4UULA 4YJGB 4RA6A 3JQ7A 4TZTA 1KWKA 1TKCA 4EGCB 1CY4A 4HAYA 4F06A 3WMXA 1V8BA 2IIQA 4MDEA 4KFRA 3DDHA 1HGXA 3MOGA 3QYJA 3WDSA 5IAAA 3FFTA 2IYTA 2ZIXB 2G06A 4ARZA 1PF7E 1KP9A 2EG9A 2P75A 4K81B 3S55A 1KNXA 1UXKA 3A58B 4DC0A 4OI4A 2LKCA 3RSLA 1SR8A 1VIAA 1Q2UA 2O0KA 3T9BA 3QLVA 2IELA 3G2PA 3ZZ1A 1QB7A 1X14A 3ZE7A 4PAWA 2YXEA 2NACA 4JR2A 3BCRA 1W85A 1V16B 1YRBA 2QPLA 3GT7A 3HI6A 1ACJA 1GHTA 3FYUA 4PW0A 1LQTA 3FLBA 5CT4A 1GTJ1 2JEYA 3VR2D 1E1DA 1H1LB 3A2NA 3X1YA 4J0FA 2JFPA 4MHOA 3S0JA 3DFZA 2FW9A 1MD9A 2R6ZA 3FDXA 4ADSG 5K20A 4FCVA 2RMKA 1KC3A 4CTKA 1TA9A 3UVEA 3FPJA 2WF7A 1HQDA 4GP7A 1LI4A 3AVTA 2W2QA 3EB9A 3DFUA 1BE1A 2LCIA 4ZALA 5LU9A 5E6SB 1O0SA 1QWSA 3L7YA 4ZD6A 1ECJA 1K27A 2H2DA 3F46A 1DQSA 1XP8A 4HMPA 2DKOA 2WUEA 4F7DA 3JU3A 3TYXA 3TVYA 5K0ZA 2ZJ0A 3GVIA 2DTXA 1XTSA 2WU0A 1QAOA 5CFMA 5FJIA 1V4VA 3ZXUB 1RWQA 1IUNA 3FF1A 4YRFA 5B53A 3W6NA 5A4DA 4UTXA 5JAZA 2I4NA 3ZV3A 1YB5A 1XGKA 2REOA 3KTAB 5KS2A 1X2EA 4WN9B 4YRNA 3BIFA 4LDNA 4TS1A 4DYVA 3U48A 3FOFC 1DAFA 1BMDA 2ONYA 3KJFA 4IIJA 1I7QB 1LW7A 3GJSA 1VP9A 3GL9A 5E95A 1M72A 1E94E 3VFDA 2P8SA 4JB8A 1PT8A 5AKZA 1FU8A 5C1BA 2GPAA 2C4KA 3PE3A 2D8AA 4ZTBA 1O97C 1CCWA 4P54A 2I54A 1UZUA 4FFNA 2XOXA 1K2VN 2LV8A 3LP6A 4OGLA 4PHFA 4YIHA 1U6IA 3HP7A 1K06A 4HTAA 4TN1A 4C7XA 5L7WA 4UTPA 3MRSA 4HB2A 4GRIA 5IAEA 5KOIA 2W6IA 2Y1OA 5CB4A 2A4KA 1UK8A 4Q12A 3AEUB 2COKA 3G5UA 1GRNA 3EDMA 4RF2A 1M5TA 4KIGA 1JQJC 4GR9A 421PA 3QNWA 4TROA 2WD8A 1ZGGA 1FRFS 2BGWA 3PT5A 1PNRA 4O3MA 2CSXA 3HNRA 3FDZB 1C14A 5IXYA 1E1RA 2BJVA 2W90A 4MULA 5KYUB 1TAGA 2XADA 2R6HA 4PFJA 3RS0A 1U2DA 4Z4GA 4PYQA 2BFOA 4ITUA 1AT1A 2QUJA 1QX4A 1ZJYA 1T0UA 1BWRA 3QG1A 5DM70 1H9BA 3MGBA 1IQ0A 2PEZA 2WYIA 5IUJC 1S96A 5FTMA 4EBFA 2NQTA 4FYKA 1DBRA 3I3OA 2A94A 3JAKB 4ZO7A 5FAKA 4OLAA 3X43A 4KJZA 3ELDA 1ZEJA 1EE9A 4CCYA 3GFRA 3GD7A 4JP5A 2HSGA 2GZSA 4A4DA 3O4VA 3RRNA 2JEOA 3H9EO 2QD5A 5FJJA 1GZDA 5I51A 1N7JA 2WQZA 4Q1VA 5ALKA 5FBWB 4ODIA 4D4HA 3TFOA 3CLSD 1ITZA 2GH1A 2NZJA 2XMZA 4G07A 2J0EA 2X0NA 4GOMD 1UDAA 4R2XA 3IKJA 3LC2O 4X24A 1OB2A 1RYYA 2CXPA 3VV3A 4NBVA 3NBZC 1IYZA 5KNDH 1T43A 5JNLA 3DV2A 2IJGX 2XGSA 3T61A 2GOYA 4YDRA 1Z12A 3KS9A 4JR1A 4D43A 5JNSA 2G9UA 1SCJA 2V54A 2ZR7A 5BT8A 1ZU4A 5LQAA 2O2ZA 4MR9B 4LYGA 5AHKA 3ZGLA 4PG4A 2FWIA 1YS9A 1OH5A 4EJSC 3ONWA 4F04A 1EK5A 3LWNA 4O02B 4DJTA 2J0VA 1G0NA 4CDMA 3CTPA 4MW7A 5A4IS 3C5WP 3EGIA 4DQVA 2F00A 1Q3TA 5C8YA 4EWLA 4L0DA 1SVUA 5MF6A 3I01M 4JXKA 1IXYA 3KL2A 4RY9A 2YHUA 3Q8LA 3U1BA 4M89A 2VF4X 4MV8A 3GFVA 4R81A 3OZ7A 1N5LA 2IV3A 1P8AA 3T9EA 3QVTA 4BLPA 3J81A 5JQWA 4KPYA 3R7FA 2OSBA 4BFZA 1TUBA 4DB4A 1IOVA 4OQDA 3ZUPA 2XH8A 5E0OA 1ISRA 3PJGA 2Z3VA 3HEMA 3N2GB 1VHWA 4RQUA 5HXAA 1IM5A 2ACWA 4TV9F 1N4AA 4INJA 1QV9A 2FLWA 4EIWA 1ZD2P 3QPCA 1LB1B 1J9ZA 2C5EA 2E0IA 2I7TA 2W6NA 3CRNA 4ND5A 5F1OA 2B34A 3TWOA 3KQQA 3R5HA 1V25A 5C7IO 2EX0A 4B4KA 2IODA 3MTAA 3KWLA 3TZHA 2XYPA 1JLLB 2C2ZA 2RGCA 5KZMB 5AQ1A 4MO2A 1I7DA 2D2VA 1E3LA 1UAGA 3F3YA 2NO0A 3KAPA 4IDQA 4NU0A 1H2XA 4TQUS 4YUAA 4K6GA 3BXOA 5K0LA 3ZW7A 4FC7A 1FUKA 3DAGA 4HADA 2H0RA 3LO5A 1L7AA 4OHBA 13PKA 3WLJA 9ABPA 1NLMA 2D4AA 1JHDA 2H1SA 3NORA 4ITVA 5FH9A 1KKLA 3DMHA 1D0VA 3UWKA 2VP6A 4C3UA 1V1JA 1U9IA 3UENA 5EJIA 1R4ZA 4KWHA 2WPDA 1BIFA 1H5NA 1Q15A 2ZRPA 3TIGA 1KKMA 2ZAGA 1MFZA 1RM4A 2FZGA 2IXGA 2TMKA 3E9CA 3D6AA 1N2JA 3H2HA 4IZ6A 5AM5A 1YJBA 5TEWA 3RUIA 2Y67A 3C7DB 3GRFA 1WM1A 4KOEC 2VTBA 3SWWA 5CEEA 4D3YA 2H4FA 1RYEA 3EY9A 4DLLA 5JSUA 4MR8A 2IYAA 1N25A 1VDMA 4GOLD 4C22A 2CE7A 1CJCA 1FFGA 2NGRA 2PX2A 2FEKA 2JKYA 3SKXA 5J4HA 4B6PA 2PX3A 2WJYA 5E3IA 3W7AA 4UREA 2XUDA 3L6RA 3LS2A 4RK7A 1Y48E 1JAXA 3L1KA 3O3MB 4LYYA 4ZZIA 2ZB4A 2VUUA 5IXJA 2YXPX 5DLPA 2YVQA 4EKGA 3NATA 2IUSA 3MS2A 4U5XA 3FUUA 4XDHA 4C5BA 2D1RA 1OFTA 1UOPA 2F9MA 4JHXA 2K4MA 3D43A 1T9GR 3VZSA 1MORA 2RGWA 2AN4A 4ZO8A 3CLUD 3LQ2A 1PHRA 2C2YA 2O3QA 1FC0A 1HZZC 1VYTA 1PHPA 3ECCA 2QK4A 1L7DA 3WTBA 3GRZA 4RO0A 2RGNC 3ZQKA 4A36A 3ILXA 1S01A 1SKQA 4BNYA 4JH0A 1IUPA 2EYUA 5AI6A 1Y3BE 4B45A 2VPYA 2G82A 1WDLA 4MA4A 1L4MA 5KMGA 4C0WA 1EKXA 4AO8A 4O1IA 3RTBA 3LUKA 5JCZA 4LHXA 4FKBA 1ZCBA 1NVKA 4O5OA 5DBFA 1PR4A 3OCXA 3UA3A 1OAOA 1BD3A 3IBFA 1ZR4A 4F8YA 3UAVA 1PE0A 2HQSA 4JI3B 4BLWA 1R8JA 1Y1KE 3BICA 3D8BA 1S1CA 2L42A 2UYYA 3DBVO 3E7DA 5A62A 4DIFA 4HN9A 2CHFA 1G17A 3S2SA 1YTUA 3EUWA 4YBRA 3ZJVA 4JLMA 3MMPA 3TW8B 5KJEA 4G0QA 4BNLA 2YQZA 1J0BA 1DC5A 1XFDA 3CGWA 4AF7A 3TLEA 1C5KA 1BSVA 2X9NA 1WB9A 2ZQ5A 1TLLA 1U8YA 2V7UA 2ZRNA 5LZ8A 3TEMA 2GAJA 2JFUA 4CIAA 1C9YA 2RKBA 1NVBA 1FUEA 1M34A 3D3WA 3FUCA 3GFFA 3JY6A 3MQFA 1C9JA 4CRWB 2EBUA 9MHTA 4KWIA 2OK7A 3EZGA 1OV4A 1PL0A 4QUEA 3UYKA 2ZM5A 2A33A 1FQOA 4TXNA 2OBLA 3VR3D 4L4ZA 5J2TF 1X77A 3DM9B 2ZUEA 2BTQA 4RHYA 3X2EA 5A5DA 4E21A 5EHIA 3U39A 4E14A 2QGFA 3DYIA 1RLTA 1I01A 1QIEA 3NIDB 4MJLA 5D7NA 5DYYA 1IFXA 1I2MA 1BQ3A 2QSJA 3MTEA 5TPZD 3SP1A 2CD9A 4IUYA 3DBIA 3S5UA 3E7PA 2QAGC 3LX5A 2FK7A 4PC7A 1EQUA 4X20B 5F5LA 1BDBA 2QMQA 3TLKA 5JATA 3UWOA 3BD9A 3L2OB 3A9SA 3PUHA 1T1EA 4G24A 4CMEC 4XD2A 4WBNA 4BNZA 4MDFA 2QB5A 1XZKA 3E9RA 1U8TA 3L1VA 5ERGB 4ES6A 5KSWB 2R7MA 3NYQA 4KXYA 4NBRA 2WYHA 4P32A 1CE8A 1RCUA 1UWVA 3MTDA 1GGVA 4MYDA 4UPVA 3RIEA 3AY6A 4M7RA 4JA0A 1K8RA 4NYJQ 2OMKA 4AUNA 3U2QA 2A9PA 1W0KA 4RY0A 3RASA 4Y2UA 4EELA 3HCAA 4RQAA 4C0AC 4AUEA 3BDAA 2XQGA 3B1VA 1ZOPA 4QGGA 1LLUA 5H16A 2CXOA 2RH9B 4BECA 2B92A 4AU1A 1HH4A 3PHHA 4K6HA 1EAYA 4U6QA 4XCQA 3ZHYA 2PBLA 3N8IA 3GUHA 2WQ7A 1TZKA 2RC6A 1FSFA 3DT9A 4DILA 3RC7A 1C0EA 1IN4A 1M6EX 1RWXA 2WM8A 3K0HA 4OQEA 4XWYA 3TS1A 2DFNA 3OM8A 2FMXA 3QIVA 4PLZA 1NUHA 1ZNWA 1U6JA 3JYLA 4S1PA 3VR6H 2BFAA 2JGJA 4K88A 3PEWA 3AEKA 4R7ZA 4WFIA 3V3KA 2FI1A 3BE5A 3F5MA 3RC9A 4BAZA 3U4MA 2QIPA 3ADCA 4TN5A 5PNTA 1ISGA 1CQXA 3UXYA 4DPKA 2GXUA 4WBSA 7ADHA 3UMYA 4JUCA 3OM0A 1PQYA 1IULA 5EEHA 1LS6A 2OV2A 4MARA 5AVWA 3GPDG 1QJ4A 4RC9A 4AURA 3CPJB 3MT9A 1JA9A 5E7JA 1NQAO 3L1HA 1SOUA 4A8JC 3ACCA 2CV2A 5EWLB 2VHXA 3REFA 1N77A 1EM8A 2L69A 1S5PA 3MINB 3BJZA 3G2MA 2OB1A 3CUTA 5F21A 4AI6A 2WSIA 1GO2A 4JGIA 3F47A 1NW7A 5E9WA 2LWIA 4NZNA 2ORIA 3CVJA 4FOPA 1BNCA 1XD9A 4JUFA 3ITNA 5CDUA 2O2CA 4EG1A 5IZ4A 3WL3A 3HCEA 1UPTA 3WRXA 2D4HA 5DSZA 1OXXK 1EESA 2JGDB 3E1GA 2R6JA 3UOWA 1HLFA 4NBWA 2IYYA 2QAJA 1PQ4A 2I4RA 3DWFA 4GVPA 4R1SA 1H2WA 3Q3EA 3AI2A 1C7EA 3OF5A 4OA5A 1XEAA 4ZO4A 3ZX4A 2J31A 4HTFB 3WA7A 1IQUA 5B3JC 2YJ3A 3IKMB 3IQGX 3FOWA 4XQ9A 3ACBA 3EZNA 2CYCA 5CYGA 4CDGA 2XUOA 3RS9A 3CLSC 5JHHB 1KYQA 3PFKA 1JP7A 3PBKA 2XEDA 3QP9A 3OU7A 1GIAA 3KSMA 1IG0A 4IGFA 4IVRA 5J1SB 3RBXA 1PFQA 1E9VA 3CNQS 4DLAA 3MMXA 2VNAA 1RP1A 1KEZA 1IEWA 1XLWA 2HTFA 4TV9B 1WUHS 4D8UA 1VL0A 4C7KA 2DXIA 3VTFA 2JKVA 1G8FA 4J0KA 3SXJA 1MB2A 5FBHA 3G7SA 4W9MC 1FX0B 2H08A 3HJCA 2WSSD 1JECA 2W2OA 4UUAA 2FETA 3H8JA 3LHKA 1KH3A 3PXAA 3ZCPA 4DDWA 3RYCA 4RTRA 1EFAA 3OEEA 1VPVA 4A2CA 4OXKA 3AJRA 2DQYA 1AKNA 2R9VA 3H0EA 4GOJA 4OQMA 4G0XA 4LUCA 5FO0A 1BKYA 2WR8A 3DXZA 4Q7MB 2LDXA 4Y0NA 2G72A 5I9SA 4BNUA 1XPOA 1TD1A 1RRCA 1NE2A 4KL8S 5LR6A 3LT0A 4N6OA 4UQOA 2KSQA 3WLNA 5F4BA 2OXIA 5ECDA 2BFCB 2DP4E 3A1VA 2DHEA 1APBA 5A1JA 1NJ8A 4PNHA 2P9FA 4COOA 1KQOA 2XNJA 3OETA 3B1FA 3WXBA 1EA5A 2Y76A 3ZLTA 3F4BA 2QZJA 2Q3CA 4XQ0A 3SIRA 1WPGA 4DIBA 2C03A 1L3CA 2H63A 1IQRA 1QLJA 1C1DA 3EISA 2Y4NA 2Q3EA 1JQDA 2ZAIA 3MJSA 2UZ0A 4GLLA 3KPJA 5GP1A 4B6GA 2RCYA 4DPLA 2JLZA 3AUXA 3NKLA 4F11A 5IKXA 2VPZA 3CZAA 2RGXA 4FUQA 4YCBA 3W3ZB 3QF7A 1UFVA 5LZ7A 3WV4A 4O2AA 4X41A 1YSCA 5KWEA 4KWEA 3RRXA 5GAJA 1NJ2A 1N34B 2V0CA 2AHRA 1O95D 1PQWA 1TJ5A 3CB2A 2QTGA 3FPEA 1A8QA 2J9RA 1Q17A 1NQWA 5KVSA 3BPSA 3KHUA 4LOIA 1YIAA 4KQIA 4ANFA 2Z5FA 1KPGA 5AWFC 3KDSE 2WIKA 3Q8WA 3ZGNA 4E51A 2L18A 3PQEA 3WK4A 5C2JB 4B3GA 4DCCA 4BCCA 4KV7A 2WHPA 4ZT6A 2GHTA 3GJ3A 1Y1QA 4KXVA 1G5HA 2PH5A 2DFLA 2Y1CA 3QGMA 1ANKA 1J07A 3AP2A 4CIBA 5EIAA 2D1FA 4TUYF 1J8VA 2AKYA 4DLUA 4J43A 2J07A 2WLSA 2FOLA 3EOAI 3V1TC 1N0IA 1JDBC 2G77B 3GWZA 1US8A 1V11B 1XRMA 2PS3A 3E1SA 3M81A 2OCYC 3IEPA 3MNFA 2I2WA 5HTKA 2RHHA 2JBAA 2Q1WA 3U7JA 3GVXA 1B16A 3UATA 4ZN6A 4ZZ3A 1WPXA 2W2LA 1Z16A 1CF2O 2C99A 1FJXA 1N6IA 2DUJA 3LV8A 1A9QA 1TJYA 3RTAA 4GXTA 2G09A 3I5AA 1YB1A 2VH2A 4IUCS 1JR3E 4KQEA 3E05A 2E1PA 3TJRA 3VR1A 4EKEA 3GYGA 5KB3A 1NR5A 2H4WA 1UANA 5KVVA 4D25A 4ZI5A 3L8CA 5JO0A 2BGLA 3T95A 4KR6A 3BZBA 2XQFA 2WWTA 1F4PA 3FA2A 5EPOA 4E5YA 1T2NA 3F7MA 4HWTA 3AHHA 4YDSA 1U80A 3VH1A 4URHA 1ICEA 4IL5A 5FNVA 3OP4A 2DAPA 4GQAA 3IPAA 4D44A 1OHHA 5IX8A 4IZOA 3FVWA 4I19A 1WHTB 4X8HA 1E2FA 3GWGA 4WW0A 3UA4A 1CXZA 2UZ4A 1C3OB 4L73A 5J2TB 2X9VA 3ZY3A 1WMEA 4LYHA 4JBNA 4MUFA 3VJKA 3ZDQA 1JHUA 1HI9A 3O8OB 3A7DA 3T5PA 2HOQA 2YH2A 1KARA 1N2GA 1H85A 2Y1FA 1BEEA 5AOCA 5FBVB 4IZHA 4Y1FA 5E4TA 1A04A 2W2PA 4UMDA 4RS4A 4YCDA 3B6JA 1UJ5A 1N2IA 2AFRA 4JI6B 1CRPA 3UJNA 3W34A 1PJZA 3BJRA 4LW8A 1ABBA 1Q0RA 3AKEA 4KQWA 1THGA 4P7KA 3ZYZA 1B15A 3ORSA 4KTTE 2QXYA 3RBAA 1JEAA 2RH5A 1CIJA 2C92A 2TMDA 2Z6AA 1ZOOA 5F7ZA 2QE7D 3IUPA 2Y0DA 3DM5A 1CR0A 2RGYA 4D3ZA 1YASA 4LF6B 3TLGA 3FUTA 3WOVA 5KYTA 3U16A 5FLYA 1L5ZA 3RVKA 1KEPA 1BCRA 3HU2A 3PPXA 1TJNA 3JVUA 3RR2A 1GZ4A 2IPMA 1W25A 2FSSA 3COWA 1OMOA 2WZBA 2O0JA 1UMCB 3KIPA 3HJNA 2NQ8A 1WDMA 1QZTA 3KZNA 3PLAE 1DAKA 3DHNA 3F7TA 4L8WB 4EG8A 4FB5A 1ZH2A 2QRMA 3I12A 3PCTA 4FD3A 4FQ5A 4S05A 2O3TA 4Z3OA 5KCZA 3ICEA 1DOHA 2YV4A 3RRBA 1R5JA 4R40A 4NI5A 1BG6A 3TRIA 1UP7A 1JTEA 2HZ7A 2J46A 2VI5A 1SUDA 1J99A 4BBAA 3T4XA 2R6DA 1QYDA 1L5QA 2RGDA 2IY9A 4C1BA 3DZGA 4YJ3F 2YVUA 5HZHA 2IW3A 2O1SA 4L4YA 4ZK6A 3NWJA 1YI0A 4TXHA 5CX1B 3BB4A 4KNWA 4D4MA 1EVZA 3GUYA 3S1LA 2QRNA 3KL4A 3GI1A 5KYWB 4QBHA 2BCEA 3HDJA 3H9BA 3R0XA 4MV3A 3S5JA 3DZIA 4ZHQF 1CUUA 2J4DA 1TYCA 3SDSA 4JU9A 1ZBQA 3CMMA 4X60A 3SLRA 4Q9LA 2C88A 2E4UA 2LE0A 3N05A 1SEVA 3C39A 3JXEA 3LHDA 4OU4A 5T6BA 2D59A 1P77A 1NZDA 1RRFA 2QN1A 5C1DA 4IKEA 3OZSA 3NPAA 1ZUHA 2B8TA 1TZJA 4GSKA 3OTWA 4Z8YA 1N6RA 2HHAA 3HXLA 4ZVRA 4F4HA 3LQFA 3L4BC 4QOEA 5HKKA 2HJ9A 3GT3A 2FOXA 2WSBA 3MTQA 4QJBA 5ALNA 3GAMA 5DX0A 4YRJA 1MW9X 5I9IA 4UU1A 1QVWA 4M8LA 5I3ZA 1NF3A 5C53B 1EUDA 4B75A 1AZLA 1L4YA 3WWCA 4NCAA 1IBCA 1SIBE 3U13A 1AGNA 1XEXA 2CHEA 4C0BA 1H4SA 1QP4A 2VJLA 1NI3A 1VLVA 2FW0A 3AIMA 1EMDA 4FW9A 3C5CA 5JG7A 5HQ3A 1V71A 4NIMA 3FPFA 3PGKA 2ISSD 4JKOA 4NAVA 3CR3C 5DI3A 7REQA 1WQ3A 2C9OA 4F5DA 4MR7A 5FBKA 2NO9A 3SF8A 1M73E 1UM9B 1ZXBA 2VT3A 4YPOA 2HF9A 3C4JA 1TMYA 4K9NA 1AB6A 3K0EA 3O8QA 4OGFA 5DYNA 3UG6A 3EVDA 1JMYA 1HZZA 1N9ZA 4OP1A 1ISIA 1SKYB 5JSQA 3WKDA 4QTUB 1CRQA 2VP0A 4I14A 4I9UA 3OZXA 1NDHA 4G0YA 1GQ2A 3CXUA 3HR4A 1H42A 5HKLA 4AWXA 1SA0B 1JPVA 5BP7A 1XQXA 4ZCTA 3PDJA 4R31A 4U9UA 2X13A 4K1LA 3GFSA 4MUKA 3RJ5A 2XW6A 5AJZA 2HRBA 3CLTC 2JD0A 3D4BA 3A4VA 3AKCA 3CQ9A 1E3WB 2B8JA 1N7GA 4MUXA 3B7GA 2HMSA 5KQSA 4IOJA 5AO9A 5LN1A 1YK0A 2ZUFA 1Z36A 3A2LA 4DM7A 3X1XA 2YV2A 2H9AA 1LRLA 2A30A 3LYLA 1DTSA 5LCXA 3SJUA 1EA7A 2DULA 2WJWA 2XE8A 4C2TA 4KQ9A 3N74A 1B0AA 3PFIA 2WNSA 4XVCA 3BJIC 4ZYTA 3E84A 2Z58A 6CHYA 2SCUB 4BQPA 3ZDEA 4YALA 2ZROA 2QYSA 1YE5A 2QA5A 1P3DA 5DFAA 2IOQA 4BMOB 4J6EA 5IN5A 1UIRA 3PZRA 5JO9A 2F1JA 2HU8A 4EF4A 3KO8A 1EWQA 1XNHA 2VR1A 1HTWA 1N9GA 2R7NA 4N54A 1LX6A 1P9OA 1P1IA 1F9AA 5F78A 1A71A 4ZI7F 1TW3A 3OLCX 1GZ5A 1DKQA 1ISFA 1NU6A 2XUIA 1KBOA 3HYTA 1GPBA 3R5SA 4ND3A 4UPEA 2NXEA 3GG2A 2FSFA 4AYXA 4KSBA 1MC5A 4OYLA 5BWNA 2OHIA 1JG2A 2IYWA 3HO6A 3PD0A 5CLHA 1E7MA 2H5EA 2HDHA 3OE5A 4GX0A 2DECA 2XOKA 3BXPA 2X0EA 3O94A 4HDRB 4M83A 2ZB2A 3RYHB 1WF6A 2C5BA 4L5JA 2Z8YA 1ZM3A 3RLFA 1G21E 3LBHA 3QE2A 3K70C 3QA9A 2P65A 3UC5A 3CX7A 3OFVA 2IEZA 2E4WA 5ES3A 1JR6A 2AC7A 1KQGA 1M76A 2IQ5A 4AMYA 2EV9A 5FO1A 2J9ZB 2YXDA 3D8SA 3LP5A 5BQXA 4NJOA 1AN9A 2FP4B 1R9JA 2XCQA 4PAMA 4QUHA 3C8MA 1P0MA 4TYQA 4EDHA 2ODNA 4IWYA 4OQ4A 1NUAA 1H0SA 4XYMA 3RC3A 2Y0PA 4R84A 5ALYA 4OLFA 3AZQA 3DC2A 3SC2B 3N5KA 2HLDA 2WOOA 1PFVA 1SOWA 1YQQA 2EKDA 1YBFA 3DAPA 4NOKA 4FYPA 4TUYB 5EJAA 4BDTA 4Z7OB 3G2OA 3FZGA 3UT6A 1Z26A 4R41A 1J70A 4WNIA 1XEWX 1KIAA 2MMCA 5CJ2A 4ZZ1A 2DWCA 1I3OA 3DZHA 4P7JA 4G23A 2C83A 4FHDA 3I04M 5LP6C 1NW5A 2VJKA 3LG2A 3N2LA 1CB7A 1ZK4A 4FR2A 3EAFA 1PGJA 2WWGA 5EZ6B 1DWUA 1MRNA 2HBQA 2WPDD 3CPEA 4V0LA 5GOZA 1OTXA 4QOSA 5DN6D 4Y1GA 4YRSA 1TEHA 4PGHA 2VT7A 2ZJ7A 5DCWA 3R3SA 4HJRA 3RIXA 4AJHA 5TY0A 2D54A 1LKZA 3L6OO 3M3HA 4PRKA 4KTVE 1C3JA 1WZUA 3EXFB 1G8HA 3IURA 5DM0A 1JSCA 1RVDA 1Y4DE 1B2RA 5IYZA 1G291 1MJNA 3Q12A 1DJMA 1G20B 2EWVA 4A8JA 5LQMA 4MWTA 4G85A 3R9IA 3ICCA 2VZ8A 3TBHA 1SZJG 1W96A 4R9RA 3TBKA 4XPZA 4MIOA 4RZQA 4TVOA 2VF8A 5FOUA 5DOZA 3VZRA 4MJ3A 4MLPA 4DV4B 3RPEA 3D0KA 2K2WA 1TJ3A 2SICE 2UZ1A 3H87A 1Q7TA 1RYNA 4NPHA 4YFVA 5EWJB 4EGSA 5ICSA 4HFJA 2XTJA 5JYDA 1Z3CA 4R1LA 1CFZA 2AW5A 4V3BA 5AK6A 3U4GA 4BMDA 3ER9A 2GPTA 2YWRA 2XWBF 4NONA 2RI1A 3K0KA 2OHJA 1JG3A 2ZI7A 4CKXA 3BBPA 1EGHA 1N8TA 1KU0A 2OXRA 3C48A 3EVZA 5AKJA 4MS1A 4PO1A 3EXG1 3RFTA 1DKMA 4B82A 4C2AA 4D26A 4B31A 5BWOA 4CNBA 1Z18A 1JDPA 2GPYA 1A50B 2BHRA 2YHIB 4R1UA 3WOHA 1XNJA 2XCTB 1SOMA 2FUNB 2WE7A 3VR0A 4UM7A 1XMIA 2BGMA 5B3JA 1C0IA 1VMKA 1Y7TA 1HOTA 2G4CA 3K8OE 3KD2A 2GQ0A 3QUQA 5F52A 4DF3A 4Z0PA 2RI0A 3MGGA 3IOEA 1M8KA 1DARA 3O2JA 3G7NA 4KZPA 4LZPA 4UHBA 5PGMA 2OCGA 4O2RA 3ZHBA 4Z54A 3W5CA 3FFBA 3WYNA 1XV5A 5L7TA 2BSQA 1JDZA 3P9RA 2W7TA 5BV0A 1CY1A 1SZPA 1BGWA 4W1QA 1ZI6A 3B3QA 2DUMA 3I2IA 4MVJA 3GLTA 2ZDGA 3FPBA 1IE3A 4Y7CA 3SHWA 2QZSA 4BE9A 4G1BA 2IPLA 2PV0A 3CLRD 3GR6A 5DULA 4R54A 4GZMA 4EO9A 2H07A 1FDOA 4YWHA 5IWCA 1DKUA 1VJTA 4FIDA 5F77A 4C7BA 4QQFA 4YJ3B 3EGVA 5JNTA 5BV2P 5L3QB 2C7OA 5IVKA 3P7MA 4XB1A 3UT0A 3PQCA 1K6XA 1SHLA 2CDAA 3HDTA 3SFTA 3EPRA 1Y1SA 3LCJA 1ZFNA 2BHNA 1RC1A 3A36A 3G8BA 4L7QA 1UJMA 2EFGA 1GCUA 3MJRA 3QWAA 2IZ0A 1FTQA 2QT0A 3SYLA 3ULKA 2G9ZA 2J30A 1BJTA 2KJQA 2OP1A 4YCAA 5DHUA 4F96A 2SHKA 1KMCA 2FWJA 1XROA 3BG5A 3WDMA 4A16A 4X94A 1HPLA 1NVGA 3B3JA 4FFPA 3UMBA 3IDZA 4PLFA 3ECAA 2O8DB 2WA2A 4PGGA 4E07A 1OZGA 1ESMA 4NTZA 2YL2A 4KQCA 4ZDKA 4CBVA 1T1JA 3LU1A 3K5HA 5EP1A 1LJLA 3JR7A 3WYDA 2BYTA 1XRLA 2OM6A 3ZJ5A 1G3MA 4IS3A 3ZWOA 5A5VA 4GXRA 3EG9B 5ALVA 5EXDA 3M1LA 4MICA 3HABA 3SJCA 1T8UA 5K8UA 1W0KD 2PNJA 2RAPA 1I7SB 5H9WA 3ID6C 4DNQA 3K9FC 5UKDA 4DUYB 1UPBA 2H2HA 1VRVA 2WNHA 1IATA 2OVBA 5MN6A 3A6GA 2AG8A 1IN5A 1XZAA 3P9KA 3QITA 2JCVA 3KQTA 3ZD9A 2BMEA 5ANRB 5A7FA 2CUKA 4W5WA 5IP5A 4GT1A 1NM5A 4GM1A 4IIEA 1E2NA 3LUDA 2YRFA 4FUTA 4NK4A 1ZH4A 4RY2A 5HUQA 4F5EA 4FTWA 4EHKA 2PO7A 3R09A 1S1MA 1VPDA 3PNSA 3A4IA 4IV0A 2JHAA 2P3OA 2WIJA 3TQOA 4ZYXA 5LQJA 4G0OA 1J0AA 1R50A 3FHLA 5AR1A 3HLTA 3AUUA 3RHZA 1QHNA 2EP5A 3LIIA 3U26A 4QAJA 1U0FA 1SHTX 5D1NA 5JY6A 3ELWA 4GP6A 4JHLA 4TTIA 2QTWB 4AX4A 3F73A 1HNNA 2CXUA 1T8SA 1R15A 1L5FA 6REQA 1FDIA 1Y6JA 1YA6A 3LBFA 1JR4A 5ETJA 5JCOC 1Z6PA 3E9EA 2GRAA 1K6EA 2OFWA 1ZGAA 2AT1A 5B3LA 4TTJA 2YWXA 4HSGA 4OLBA 2X2OA 3L1JA 3WK5A 1GPDG 3UM9A 3IAXA 4P5DA 4ZFNA 3TLYA 3UOGA 1EVLA 2JATA 4XKJA 1ESZA 1SXJE 2FYTA 3FRHA 4YLGA 4M1ZA 1TIPA 1Y6FA 2YHBA 1EFRD 1QR2A 2FMHA 3BEDA 3E3LA 3FUVA 3LC7O 4R8RA 5JS7A 1DCTA 1KMQA 1SXIA 2OT3B 3I72A 2I8LA 3L82B 5K6TA 3SYNA 3U49A 3QMPA 3EGXB 1KVQA 1BW9B 1UINA 2C4UA 2O7RA 2OILA 2QVCA 3L9WA 4HEA1 4L5IA 2ZJ8A 4QOFA 3O7MA 4YI3A 4MHTA 1P6XA 2OQ2A 2QYHA 3DGEC 1O0CA 2G6TA 1JEYB 5DYGA 1UM8A 3MWYW 3C16C 4X3CA 1II0A 4C0JA 3B52X 3IS3A 3OZWA 4PHHA 4ZI7B 4BVLA 4Z53A 1A9XA 1BVUA 1WMFA 4BB6A 5BNIA 2I66A 2BGTA 5IVIA 1M0TA 3JRNA 3PWKA 2FFJA 3ISJA 4H17A 1OSNA 1ZD5A 2DRIA 3COZA 2E21A 2GT1A 3GN1A 4P4UA 2QG9A 1NE7A 4J0GA 1XFAA 4WESA 3T34A 3MJDA 3UIEA 2CMFA 3QZUA 4ALMA 3OOHA 2VDMB 3PJEA 3JV7A 1Q84A 2NUTB 4Q9HA 2JAQA 2WAAA 3N7AA 3WFJA 4TYPA 5EZYF 1GL7A 3P52A 3O83A 4NXNB 3PR2B 3RABA 2H5IA 1NBMA 1F2TA 1QGED 2EGHA 2OMEA 2HJRA 2QUIA 3OSUA 5C4GB 3SX2A 1GL9B 3UXHA 4BO9A 1N5IA 1U3UA 4AW9A 3AVYA 3EVFA 4FE7A 2BBWA 1S8AA 3N2KA 2ZRHA 1RHJA 4JC8A 2ZR8A 2FDCA 1H3EA 1G4UR 2P35A 1JFFB 3LPLA 4QXRA 2PZEA 4ZCPA 2WKPA 3GDHA 1F51E 4RSGA 3QEMA 1AKWA 1NJ1A 3E58A 1G8PA 2W8BA 2Q3DA 3GLHA 4MIEA 3T5AA 3OEED 1X86B 2OQIA 3I5XA 2WDZA 4H0FA 2C5HA 4NG5A 5CIQA 2RE8A 3T3OA 1GPJA 1XDWA 2QDKA 2WUFA 3G5LA 3LBAA 3L0IB 4BP9A 3ANNA 3I58A 1YQ9A 3MWFA 4L0QA 3RI3A 3LA8A 1XTIA 3ZY4A 2PJDA 5B58T 1T9ZA 3GDOA 3ZJ4A 1EUCB 5DRTA 4U7TB 1OPRA 1RXSA 5GZ6A 1J5PA 3N9IA 1I51A 2X8BA 1VG9B 2QYTA 4L08A 4XJXA 4C20A 4I9NA 5JEEA 5F9HA 2HJHA 3QMMA 4UVHA 1IJFA 2ZIGA 2BJWA 1N2CA 2G9VA 4A0SA 1CUBA 2RJNA 3C3PA 3I1IA 5I8PA 1E7YA 3HU1A 5TLSA 3BFPA 1YA8A 5CM2Z 3N8GA 1X13A 4FGLA 4BJ6A 1DE0A 4BNNA 2GK4A 3JCZA 4FEGA 1Z6QA 2BY4A 1SB9A 3URKA 2GTIA 2C7VA 1F4LA 3NCHA 3FCAA 2NT3A 4JVMA 1Q7GA 2D0DA 4F7WA 5K0NA 4B35A 4LDAA 5EVJA 1TDJA 3BGIA 2ZK7A 3GZTB 3I1YA 4P22A 1PD0A 1Z0IA 3TTSA 2F3SA 2DR3A 3JQGA 4Q7LA 2WKSA 3L7DA 4L74A 4TMYA 4MQ5A 3ZDRA 1PNOA 4WRRA 1GFIA 4XB6B 3TOVA 3CM0A 3VO9A 4ZYYA 4ZTUB 2OBMA 5EQJB 1OVMA 1DO0A 3TFQA 2Q3FA 3GJ0A 4MPRA 4D02A 1ZJWA 3FUWA 3JATB 1IY9A 1T9HA 1YVEI 4P4TA 4BHTA 1T36B 2C1EA 3EK2A 2WMOB 2OYSA 2N9UA 3AF4A 1R0YA 2AE1A 2G3YA 2NSJA 4KYIB 5BN3B 5MFPA 5EIBC 3HB9A 5A0FA 1XTZA 3P2KA 2GPWA 1C9MA 2XKJE 4PQRA 3RKSA 1H9CA 1Q1QA 1WA5A 2ODEA 3GX1A 4AZ3A 4Q15A 4OREX 5AK5A 4H2DA 1KI6A 2C7RA 3LPDA 4C06A 2R86A 3AMVA 5JFTA 1OU0A 1RJ9B 3NHAA 3ONEA 3C7KA 5HGJA 3ZV4A