1L5SA

Human liver glycogen phosphorylase complexed with uric acid, n-acetyl-beta-d-glucopyranosylamine, and cp-403,700
Total Genus 336
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
336
sequence length
810
structure length
793
Chain Sequence
ENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPNDDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKASKFVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-activity analysis of the purine binding site of human liver glycogen phosphorylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Glycogen phosphorylase, liver form
total genus 336
structure length 793
sequence length 810
chains with identical sequence B
ec nomenclature ec 2.4.1.1: Glycogen phosphorylase.
pdb deposition date 2002-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00343 Phosphorylase Carbohydrate phosphorylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1l5sA02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1l5sA01
1FC0A 4LDPA 3WAGA 3HBJA 3G2LA 2C1XA 1JEJA 1B4DA 2GJ4A 4X7MA 1JIUA 1WV0A 2QN2A 2BGTA 3ZCUA 2IV3A 2XA1A 2IEIA 2C4MA 4MI6A 3FROA 1C50A 3BD7A 2H1HA 3E3LA 3L79A 4F96A 3TAXA 3T5TA 4QLBA 4MI9A 4N39A 2IYFA 2Q6VA 1BX3A 1FS4A 3CEHA 4KQ1A 4AY6A 1V4VA 2SKDA 3VUEA 4MHOA 2QLNA 1NOIA 1XV5A 2XA9A 3CUYA 3MT8A 4GPBA 3ZCVA 2C1ZA 4F97A 3NP9A 1F6DA 4MI3A 3OTGA 1L6IA 1FTYA 9GPBA 4M83A 2IEGA 3ZCRA 1EXVA 1WUTA 5C1DA 2QRHA 1XC7A 1VGVA 2VCEA 3IA7A 1K08A 4BQFA 3CX4A 1NOJA 4L22A 1L5SA 5BNWA 3T3GA 2KS6A 1NVKA 3H4IA 3MTAA 3EBPA 4GZ6A 1PSWA 3HBNA 2PRIA 5ENZA 4KQ2A 1LWNA 3RHZA 5JTUA 1FA9A 3MRTA 1A8IA 1WW2A 1GGNA 3CV3A 3EBOA 2QRQA 4CTOA 3NB0A 2XCIA 1P29A 2ZB2A 3C4QA 3CUTA 2F3UA 3D1JA 4NESA 3T3IA 2R4UA 2AV6A 4GZ5A 1Z6PA 3DDWA 3BCUA 3S0JA 2QRMA 3E3OA 1C8LA 2PYIA 2SKEA 1IIRA 2XA2A 1P2GA 2G9UA 4LEIA 3RSZA 3ZCPA 4MHSA 1LWOA 4RIIA 2X0DA 1RZUA 2F9FA 4NEQA 3O3CA 3UYKA 3MS7A 3CEJA 3BCRA 1NZDA 3CUUA 2X0EA 3OY2A 2GT1A 3MT7A 4XIFA 3MTBA 8GPBA 5DLDA 4RIGA 2QRGA 2VSNA 1WV1A 5TMBA 3VDNB 1L5VA 4Z5XA 2G9RA 1QM5A 3Q3EA 1RZVA 4RIHA 1YGPA 3RT1A 3QKWA 1GPAA 2QZSA 4BQIA 1L5QA 1FU4A 1XL1A 5DU2A 3TOVA 3OKAA 5HXAA 1ABBA 1FU7A 5D00A 3MSCA 2X6RA 1SXPA 2VCHA 3MS2A 1JIVA 1NZFA 4F9FA 2ACVA 4AN4A 2P6PA 2X6QA 3CEMA 3DD1A 1FTWA 2OFFA 2GEJA 3AMVA 6GPBA 2IV7A 4RBNA 2JZCA 2IW1A 2ACWA 3UYLA 1QKJA 2XGSA 1UQUA 1UQTA 3OTIA 2GM9A 2G9QA 2BFWA 4RIFA 3S28A 3BDAA 3MRVA 3MBOA 5I45A 2QN1A 1M5RA 1FU8A 3VDMA 5GPBA 4GZ3A 2BISA 4RELA 1SXQA 1P2DA 2QNBA 2GEKA 2VSYA 5IKOA 2R68A 4BFCA 4CTMA 2ECPA 4EKEA 2BGUA 2X0FA 3WADA 3L01A 3L7DA 3G2HA 4N3BA 2IUYA 3C4VA 3OT5A 2AW3A 1Y6FA 4M60A 4YI3A 3OKPA 3VUFA 3BCSA 3PE3A 1E1YA 1Y6GA 1P4JA 3HBFA 2QLMA 2FETA 3D0RA 4BQEA 1C3JA 3L7CA 3G2KA 3BD6A 3PE4A 2XGMA 4MRAA 3GUHA 3T3HA 3ZCSA 1H5UA 1EM6A 1JIXA 3BD8A 4W6QA 1GG8A 3WC4A 3NAZA 3BEOA 4WADA 3QHPA 3DZCA 3NCHA 3S27A 3NPAA 4AMGA 2QN9A 4NC9A 3SYRA 1GPYA 3T3DA 4AY5A 2O6LA 1JG7A 4X7PA 2QLLA 3MS4A 1L5RA 5LQDA 5TMDA 1JG6A 1K06A 2ASVA 4CDRA 1KTIA 3Q3HA 3H4TA 4FKZA 4G2TA 1RRVA 3TSAA 2ATIA 1O6CA 1L5WA 4GYWA 1NLMA 4EL0A 1IXYA 1GZ5A 2QRPA 4HWGA 4CTNA 3OTHA 1XKXA 1C8KA 3S29A 1P4HA 2QN7A 4EL5A 3ZCTA 4WACA 2R60A 1Z62A 1F0KA 2GPAA 3L7BA 2JJMA 3T7DA 4X6LA 3ZCQA 4N3CA 2GPNA 1WUYA 4GYYA 1GPBA 2PRJA 3CUWA 4YUAA 2QN8A 1AHPA 1PN3A 5IKPA 2C9ZA 2JLBA 3E3NA 2PYDA 4EJ2A 3OKCA 2XCUA 4N3AA 5TMEA 4KQMA 3GPBA 1J39A 2HY7A 3SYMA 5TVGA 3MTDA 3C48A 4FZRA 1XOIA 3MRXA 2F3QA 4AMBA 4MICA 7GPBA 1P4GA 2XGOA 1UZUA 4PQGA 2SKCA 3S2UA 2AMVA 1PNVA 3D0QA 5D01A 2GPBA 4M7PA 2WTXA 1FTQA 3MQFA 3COPA 1GFZA 1WW3A 3DDSA 3G2JA 3T3EA 5JTTA 1HLFA 3G2IA 4REMA 2F3PA 3L7AA 3NC4A 4X7RA 3RSCA 1NOKA 2FFRA 5DXFA 1XL0A 2AZDA 3NP7A 2XMPA 3HBMA 3CUVA 2PQ6A 2R66A 4EKYA 2F3SA 4XI9A 4RIEA 1Z6QA 2G9VA 4HLNA 3Q3IA 2FF5A 1Z8DA 1AXRA 4YI5A 1L7XA 3IAAA 4RENA 4WHMA 3G2NA 2R4TA 4N9WA 2H1FA 3MT9A 1YA6A 2VG8A 1E4OA 1Y8ZA 2IYAA 1P2BA 2YJNA 2QN3A 1PYGA 3OY7A
chains in the Genus database with same CATH superfamily
3IQHX 1GKIA 3UICA 3TSZA 3VU3A 4EW2A 4EPVA 4CR8A 5JUWA 3W90A 2AK2A 5DHPA 5ECDA 5IXJA 2ZSHA 4ZDKA 3N07A 4EY4A 2XXAA 4DG9A 3FFXA 1V95A 3E5RA 4JBIA 4PG6A 4U2BA 4BX0A 4DJJA 1A7JA 1J5PA 1NW7A 1Q3KA 2I2AA 3DGEC 4JENA 4MYCA 4UHCA 2QENA 4KX3A 1FSSA 4HX5A 5GZ6A 3MGGA 5K01A 5G0UA 1D4OA 2CFRA 4AZ0B 1OI3A 1DCKA 1Z5NA 2G09A 4FFLA 4UVDA 3RIHA 4QFCA 1VIAA 3GZNB 5DNVA 2EFCB 1ISMA 3OEEA 4FDAA 5IUKC 4BZXA 2XA1A 4MVJI 1KPIA 2AXPA 3TYXA 4YMHA 5J47A 1E5TA 1EHIA 3GQVA 1T6BY 2VYNA 3R7SA 5EHNA 2XWQA 4A16A 1AUVA 1CDZA 3QEJA 4IH1A 4NDZA 3O84A 6Q21A 4ZOEA 4R7GA 3T1VA 1HNXB 2XOXA 1BXZA 4Y2UA 1FS4A 4X8HA 1Z3CA 4W1PA 2C7OA 1V4VA 3D1VA 4MHOA 3Q8WA 2QLNA 1VHJA 3ZU5A 3D4NA 1SVOA 3OPYI 2WLTA 1H22A 3LF2A 1Y7IA 4L9RA 4MB2A 5FNZA 1J0AA 5LB2A 5P8WA 4A3SA 3PNSA 3U4QA 1H6BA 4LOKA 1Y7LA 2LBPA 3N8KA 4LQ4A 4EAAA 1P7VA 2MT9A 3OQIB 4PX2A 2WG2A 1NU8A 1GARA 1SCKA 1FDOA 3OTGA 5CPFA 5BQFA 1GGJA 2PH1A 2W37A 3QVGB 4LGMA 1GDDA 2IEGA 1W46A 3UXMA 2Z1DA 5C1PA 2R1VA 3EQ2A 5BN4B 4O2LA 2HSJA 3MXTA 4D42A 2QTAA 2DM6A 1R18A 3RIXA 3A8TA 5K9ZA 1XTIA 3N86A 3A7EA 4KJXA 5BMVA 1P9LA 4AJEA 5BNIA 4QA9A 5JSZA 2C5FA 1A8QA 1VGVA 2ATVA 4LAFA 5F1YA 1ICIA 1IVNA 1HFWA 3A1EA 4GR4A 1VGQA 1C1DB 3GLHA 3VPHA 2DFVA 2OILA 3PP8A 4KFUA 5B1DA 4YRSA 1SC4A 4WGFA 5D6NA 5A7GA 4F1WA 3S8YA 5JCXA 2YJZA 2OSVA 4QWWA 3R74A 3SC3A 3HY6A 5ADUS 1ODKA 5FULA 1NOJA 3P0RA 5DNWA 2XUFA 2VDJA 3F73A 1JHRA 1K5HA 1MG5A 1YI1A 2KS6A 2RGUA 1TCVA 5AOCA 2KHZA 4G81A 3SIXA 5BR7A 4RFSB 2NSDA 4H1VA 4P6VF 4WZBB 3TKAA 2ZBUA 3C5EA 5BYKA 5DW0A 1UCFA 4P58A 4B3XA 1IU9A 1WXDA 2D13A 3CH7A 2LPMA 3CXUA 3K96A 3NGLA 1MB9A 3NS7A 3R3VA 4Q16A 4X91A 5CIQA 1PV1A 5GOZA 4N6GA 3NDIA 4NFHA 1KY2A 1MGPA 2C2KA 2ACEA 1GUBA 1GGNA 2QD3A 3W04A 1KYTA 3KQUA 2DH5A 3RRNA 2P4QA 3RVLA 4PSCA 2UXBB 3LT5A 4OKSA 4V0SA 4DA7A 4C7OB 3BHJA 3EEBA 1XFDA 3P26A 3ND8A 4L9SA 4NESA 1WSWA 4YDRA 5DO9A 4R1QA 3UB4A 2MTBA 4DR5B 3UCXA 3VM6A 4NZNA 3MF4A 4TMWA 1XA0A 5K0EA 4J9UE 1A9YA 3PUZA 4B32A 5H3LA 1U3UA 2Q9AA 3VNAA 2VJYA 2WYOA 4FQ5A 1WDWB 3H5OA 3KJXA 4KN9S 4UUMA 2AWOA 1NR7A 1NUQA 3QKRB 2XA2A 1SXJE 1P2GA 4WIAA 4Q01A 1Q0RA 1SUEA 3RB8A 1AHIA 4LEIA 3SIWA 2LDBA 5FWXB 4CF5A 5AR1A 3IL2A 4IJMA 2I1QA 4IL5A 3AF1A 3OE5A 1YO6A 1E9AA 4J90A 4FYKA 4R98A 4X3PA 4B2LA 1B3RA 3LCMA 4A8PA 3LGSA 2O8CB 1HPLA 1COWA 3ISVA 4D3FA 5AHKA 1WHSB 1A4XA 1OXSC 4ZANA 4FNGA 5T4BA 4B87A 3MS7A 1U0OC 3NO4A 3PL5A 2I87A 2CF6A 1ZMTA 3AG5A 2PTGA 1Q74A 4ZZ0A 3I5XA 5ULLA 5DRYA 1OH6A 5TS3A 2L82A 3GU3A 2H1IA 4L76A 2ISCA 4OI2A 3FTFA 1ZUWA 3ILYA 3HGQA 2RJOA 4KUEA 3EF1A 3HXTA 5G0TA 5LMNB 4DV5B 1ZK2A 4UCXA 1CIPA 4TXJA 1K8XB 1EX7A 4NHOA 4MULA 3UAWA 1QIDA 2VWQA 2PO7A 2DUMA 2DWOA 4DMLA 3LO8A 2Q3FA 4TZTA 2Z8YA 4RTOA 1E5QA 2WD7B 2W58A 1YTUA 3AP2A 2Q6IA 4W7IA 1M1ZA 3L46A 4DLKA 4JNCA 1MB2A 2UVDA 4MW7A 1P31A 1HQCA 2FOLA 4NJMA 4CT4B 4WV3A 3VR1A 4HNQA 1GPNA 2X6TA 1NBWB 3ABQB 3N75A 2WK1A 5DM4A 5FA8A 1FU4A 1T4DA 4DZZA 2O1SA 3IQIX 3OKAA 1L5KA 3UKJA 4DR3B 5D00A 4YV0A 1YZGA 4MDFA 2O1XA 1ZESA 2WAOA 4NRDA 4TLEA 4AQ7A 2J4FA 5K3AA 1JEOA 2WVAA 2O05A 3ZN2A 3A26A 3FDZA 6PFKA 1EK0A 4WUVA 2P9CA 3FGPA 4B0OA 1QMPA 1E6UA 2XPCA 4IDEA 4I2VA 4R6WA 1JDTA 4U2FA 3NWEA 5ALSA 5JS8A 1YR9A 4N49A 5A9SA 5AVWA 1PR4A 4FWBA 4KTTE 1Y33E 4BX3A 5KJCA 2BFBB 4BAZA 3IDSA 4XCQA 2W2TA 4BU0A 1C7IA 2NV6A 4MV5A 4YCSA 4WDQA 5KQMA 1QKKA 2HHCA 2CDNA 4XIGS 5ESRA 5DBIA 2JJ2A 2X8AA 1RXSA 3COWA 5GGXA 4DBVO 2YV1A 5E6RB 1MMFB 1BN7A 3URKA 2IZOA 5TQ2A 5ALHA 1UBRS 3C1AA 2LDXA 3HO1A 3FMFA 2DHQA 3N9IA 5JQGF 1LH0A 1UC8A 2FJUA 3AR3A 1GTVA 1CJKC 3RAFC 2Q3MA 2QUIA 3CNNA 2WTMA 1E89A 1XVAA 5DNYB 2Y1WA 1G5FA 3LMKA 3MTQA 2J9XB 3LQKA 3MGKA 3UAYA 4X97A 1J25A 3PUXA 2GN2A 3LCUA 2QTLA 4A6PA 1VG9B 3KP1A 4DQXA 4GF5A 5K4AA 4AB1A 4GMFA 4WN9A 4M8LA 3IP1A 1QG6A 2EKBA 3D5EA 4GMXA 3WMFA 4BNYA 4ESOA 4UKDA 5CDSA 4FOLA 3INGA 4YJ3A 4BRZA 4J43A 5K0SA 3J80A 4RNCA 3VBEA 4X1KA 5K6AA 3ANYB 1PR1A 1MORA 3EUAA 2Q5EA 2HK7A 4XEUA 4Y2TA 2GHTA 5EE3A 5H0IA 5J4KA 1GAQA 2X19A 1IZYA 2O3QA 3G5AA 1EJ0A 1XKLA 2V8BA 3L0OA 3P2EA 1OU0A 1VB5A 3LKDA 5DULA 3U1TA 4X20A 3HL4A 5LZ9A 4UE3S 4Q6WA 3U4HA 5A5FA 5JSUA 2H1VA 1I2MA 1BVRA 3M33A 3UXHA 3G9UA 3BFVA 2HA0A 3LYAA 5B1EA 2PRZA 2AMYA 3A27A 1N0WA 1T9KA 2XB8A 4YR7A 3G6KA 4JCOA 3TX6A 4F9GA 1YNOA 1VKJA 2DG2A 1PZEA 3BXEA 1ZWLA 2CE7A 3DR5A 3RG8A 3ZHTA 4DL9A 4MUJA 4M9ZA 5AESA 4H3KB 4F1KA 4MRMB 4LDQA 4JNKA 4D57A 3B48A 4EB3A 1Z0ZA 3PNVA 4KQEA 3CBGA 3REOA 2D1YA 1LVUA 1OXMA 2C2HA 3UMCA 5KPJA 1D6JA 1LXCA 3A6EA 1HT0A 4KOAA 1M34B 5K0GA 3R9XB 3ZJYA 3HB7A 1NJ5A 2DRIA 3GRZA 3DE5X 3VZRA 1Q1AA 1Y81A 2P4EA 3TD9A 1O0BA 2HA2A 4ETNA 3C70A 1DG3A 3EAQA 4K9NA 4YJGA 5KX5A 3ZVNA 2QMYA 3KV3O 1A5ZA 1D09A 2QW8A 4HWOA 4YJ3F 2BCGY 2W2KA 3TFQA 5K45A 1SKYE 2B0CA 2OENG 1PTJC 4PGHA 5AM1A 3RHSA 5LNK6 4KR2A 5ICGA 2B20A 3FF4A 2J5BA 4HX2A 2YVAA 3FPEA 3V4PB 1IVSA 3CZAA 3HP1A 1PFVA 4X41A 3UBTA 1LD3A 1Q92A 5ALQA 4OUDB 1NPTO 4P4UA 3DEIA 1U1CA 3BTUA 1QBGA 2Q7OE 1VHTA 1ONBA 3CCBA 1Z5WA 5LQSA 3AWDA 1JPJA 4QYIA 2CL6X 9ATCA 1Q0ZA 5KNDD 1Z6GA 4PWZA 1NLYA 2Q21A 1ORVA 3GA7A 3ZZUA 5JNUA 3ORSA 2CCJA 2QTFA 5KYKA 3IOEA 3LDUA 3V7YA 4HNTA 3AERB 4F5EA 4EVQA 3AFOA 3KQTA 3OX3A 3TLEA 4GVPA 4M0EA 2JLVA 2ID9A 3KKMA 1TCCA 3DA8A 1GG5A 1M2GA 4OXXA 3GEBA 3Q88A 3RROA 1W1WA 1SXGA 1L5RA 2GTHA 4MUFA 1ZGAA 2EJCA 4I6JA 2PGXA 5DI3B 3GFFA 3GLHE 4X3CA 5DNUA 5ETJA 4UDOA 3WGNA 3NBAA 3M6LA 4HB0A 3E27A 4JLJA 3U44B 3RK4A 5FBQB 3D5QA 1GNRA 3NTVA 2JLUA 3M82A 4S12A 3ELUA 4X44A 4YMVA 3LPAA 2AEEA 4DARA 2ATIA 5TJ9A 5KYXA 3S81A 2D0PB 4PANA 5J4VA 1U3VA 1Y6RA 1QH0A 1GKYA 2NADA 4HF7A 1XZIA 4XQ0A 5EZ5A 5J63A 1NSTA 4HXYA 4ESVA 3F1KA 1GGKA 5FWXA 3STXA 3P9YA 4EJSC 3HNPA 1LQ2A 4G4SP 3D3NA 1LTKA 2X5OA 5E4TA 4LRUA 5WRFA 1C1YA 1QWSA 3QSGA 4RF5A 1P4HA 2OBBA 1FQWA 4C0BA 3VYRB 4DR6B 1COWD 5LA6B 5B4UA 3ICOA 1U0HC 2FPGB 4KXXA 3GAMA 1QHHA 1KSFX 1SWWA 2AF4C 3LBHA 1XVTA 5DGCA 2DE0X 5KJEA 1OFVA 3OFSA 3OPMA 1Z6ZA 4M86A 2HDNB 2VTVA 5B2ZA 2VP3A 4TXMA 1PTJA 1T2FA 1R0SA 1G1AA 2WSLA 5T57A 1NJ6A 1SU7A 4BPRA 4EK9A 1J24A 4JT9A 1KI7A 1R9MA 4IUBS 3VZBA 2QAIA 3WP0A 5DTMA 3LCVB 4J29A 4YBRA 4DQVA 3R6WA 4LJYA 5BRJA 3LM8A 1QHFA 1HK7A 1HDEA 1G291 4F72A 1MB0A 2I7DA 1H1LB 1PUXA 2ZAYA 3OCCA 3QM1A 4LTMA 3WKBA 1TQ4A 1JEYB 2O8DA 1QUEA 1GZDA 1XDSA 4ZYWA 5ERXA 5KOYA 2HRRA 4R84A 1ZI9A 2AFIA 4XE5A 5DX1A 2WT8A 5KTPA 1MTOA 1I4LD 4FILA 1KP2A 3KQQA 3NIGB 1GSHA 5KYXB 3WJAA 3BZWA 1OZAA 5CFMA 1FRVA 3MPUA 1ANKA 1V45E 2J3LA 1RU3A 3L18A 3VR6D 4LNAA 1C1DA 4B6GA 4URWR 1D0IA 1E61A 4WFIA 2WM2A 4NCNA 4DIDA 3OZUA 3MMNA 5DNCA 1Y98A 2P90A 2IYTA 2YV5A 3A3OA 1PNVA 1LBSA 1PGOA 2ZJ7A 2YBDA 3REFA 3JVIA 4G9BA 4K86A 5CA0F 1O7JA 2J08A 3VVBA 1Q11A 2YVKA 3FVQA 2I29A 3ZE9A 4ANFA 2B2NA 5BUSA 5I5EA 1NRIA 3DXZA 3VC3A 1I2AA 4GR5A 2O8FB 2C57A 5DHQA 2ZJ5A 2VVTA 3ISJA 1RWXA 4P7GA 1GFZA 2D2FA 3JQRA 1KMNA 2ODTX 4F2HA 5DBEX 2FQXA 2C92A 5HF6A 3TL2A 2HCBA 3U1VA 1G16A 2P41A 3K0AB 4II7A 4TMTA 5D85A 1NVAA 2RH4A 1PYOA 2PJZA 2YS7A 3AXSA 2LIPA 1U8CB 3NHFA 4G63A 4P83A 1AD2A 3NEJA 1SVNA 4GHWA 3HHPA 4JMPA 5DTJA 4V39A 2C9BA 3NASA 2C59A 1LPSA 2QF7A 3AY0A 3NC4A 2HMTA 3PTLA 4OREX 4B3TB 2OHHA 5DXFA 4F3TA 3FPJA 1JXOA 2CB0A 4DM3A 1ES9A 3H5AA 3NYRA 1ZUIA 3AG6A 4BO3A 4DQLA 1S2OA 1A2KC 1SQ5A 2RGXA 2A1UA 2V7UA 2O7SA 2I22A 2VQDA 2O2CA 2GZSA 3DFKA 1CY1A 1W52X 5IAJA 2OVFA 2AF3C 5ECYA 5EINA 4DTCA 4HLNA 1P9NA 5EPEA 2GBLC 3M1AA 4K0RA 1CIJA 1AXRA 2L2QA 1K6MA 1F2UA 3GIWA 3K9NA 3OMLA 3R0ZA 3F1LA 3L84A 2PJRA 4QUBA 4DLYA 1G8AA 1LPMA 5J2UA 2BKUA 3DBVO 4OAOA 2QYHA 1Z4PX 1GA1A 2WSSA 4QODA 4YT5A 2CBZA 2FHSA 3ASZA 3NU1A 1E1RD 3OD5A 3LRXA 3MT9A 1MQ9A 1T6ZA 2GMWA 3DF9A 4QNNA 4A0SA 4IPTA 5FUQA 3Q0TA 4GLOA 3B5IA 5G3YA 3CIFA 3SXPA 1PR0A 1XUOA 1VI5A 4ZAGA 4C20A 4XDZA 3HA3A 3IAUA 2MR5A 3IVCA 4DT1A 3TWOA 1CTQA 2I6UA 4DDUA 4IXWA 3CVOA 4FZ3A 1RVV1 5AUNB 2BR5A 2EKLA 5BN5B 2Q1TA 4MA4A 1AV6A 4Y8VA 3MJHA 4GLBA 3CBQA 2WWFA 4HEQA 1EAYA 3NGMA 3CNOA 3CW2A 3QVSA 3QY0A 3GFRA 4CMEA 5DN6D 1IBSA 4ARVA 3W1EA 4JLSA 5C9ZA 3TUJC 3T3PB 3G2LA 4CIVA 2IF2A 1QO0A 3ZEIA 4WERA 4ZCQA 1MEEA 3T9DA 1B4DA 2IDKA 2MMCA 3IGFA 1NNUA 3KYCA 3H99A 3O9MA 2OUKA 4FBLA 3U4DA 2WTBA 3TQSA 4ZVNA 5LD2B 4G89A 1OFGA 2C2BA 2P7HA 4RHFA 2ZANA 2OYCA 4LHEA 4RHTA 2C8VA 4WZBE 1Y4AE 1IONA 1SEPA 3BUSA 3ER8A 4IWNA 4L5IA 4XD7D 1PJBA 3R8CA 3CVYA 3CR8A 3HJCA 3I72A 4W82A 3P7MA 5D3MA 3GRAA 4GP9A 3BWDD 5JVDA 4LMBA 4R2XA 2YJ4A 1A9PA 4PCLA 3KEFA 5JD5A 1IUOA 4WN9B 5F4BA 5BUQA 5IT5A 3Q8MA 1ZSYA 1IQPA 2H11A 3ZY3A 3I6ZA 3O8CA 2F1OA 2CVZA 2B82A 5KAPA 2QYOA 1W0JD 2IYLD 4G37A 1VB3A 4AY4A 4ER6A 2UXDB 2X1VA 4OQLA 3F46A 4QSMA 1FFXA 1GYPA 3H5VA 3P96A 2YXEA 4QO7A 2FG5A 3O2SB 1EVZA 1P81A 3ONWA 4ZI2A 3ABSB 4GPBA 4DLWA 2VJCA 1F8YA 2XNKA 2ZJ1A 4KDRA 1P1CA 2Q5IA 3EXAA 1Q16A 4YJHA 5FHQA 2R6HA 3TBFA 4D74A 2IDZA 2Y3IA 1JHPA 2FAXA 4C4SA 2LNDA 2PQ0A 4RD4A 2JD2A 2XQKA 3EQZA 1NTOA 4NJEB 4S3MA 4QOGA 1Z16A 1RQ2A 3ZLTA 3JAKB 4PG5A 1K8QA 1MO6A 4TT3D 1T5SA 2FWAA 4A36A 1W4ZA 2FZWA 1W94A 1B74A 1P72A 1PE0A 2PV0A 3G17A 3A9VA 3M4XA 4QQKA 1P9WA 1YZNA 2EBWA 1ZIYA 4KH1A 3FDZB 5INTA 2UDPA 2WMDA 2IYZA 3R0VA 2ORIA 5HUQA 1AUXA 4OUKX 3DTNA 3F90A 1I3KA 4YCAA 2PBFA 4CLHA 4CM4B 5F9MA 4KW7A 1UDAA 4HRYA 1CUDA 4L27A 2GK6A 2J07A 2V3VA 4F84A 5JSZB 3GQBA 3N39C 5B1HA 2UZ1B 1JR2A 2A30A 2Y1EA 3PVZA 3VC7A 5JPCA 1PSWA 1U8XX 3HBNA 2Y0BA 5E7QA 2YUTA 3CSDA 3DLPX 3EY9A 1EBBA 2VHVA 3RHZA 2HO4A 1T4CA 4CBVA 2QAGB 4YAWA 1JH9A 3O93A 5FNVF 2PLFA 1WJGA 3FPSA 4X6YA 2P2NA 4IJ5A 1BXRB 3HTXA 1F5NA 3H83A 3NAQA 4MO9A 5CGZA 4XR4A 2ZTMA 2BGRA 4ASUD 3FIJA 4G23A 3IUSA 1M72A 5BV8A 3K2QA 2ATXA 4INPA 3ILHA 4X71A 1EJ6A 3P9ZA 5IDYA 4WESB 4B31A 1ZAKA 1Q12A 3T3IA 2R4UA 4DA9A 1NYTA 3IDOA 5BSGA 2OV8A 4ME6A 5IDWA 5HGJA 1BU8A 4KKXB 4RKFA 2V6JA 1KKUA 4YA6A 3GLGB 4NBNA 4DJFC 5JYCA 4YV2A 2A5YB 1Y8QB 4DNFA 3PPWA 3EEOA 4ED9A 3KQPA 1A72A 3K09A 2OD9A 5JJKA 4WCVA 1XVLA 1Y8RA 2J9ZB 4F3NA 1PTKA 1ADJA 3OX1A 4DY4A 4WXYB 1TJ3A 1Y3AA 3FOWA 3JTMA 5FOTA 2I1LA 2ZROA 4F5WA 5FDFA 5DCUA 3H2BA 3Q98A 4GFDA 2FEPA 1QVVA 4ND7A 2HQRA 3J7TA 2WWIA 1B0AA 1Z2PX 4DRZA 3IHLA 1ODJA 1KYQA 5IZCA 1DDIA 2VP5A 1SGWA 2X2OA 2QW1A 4FHZA 2G0AA 3DT9A 3QMMA 3F7MA 1US8A 1SCNE 2B4QA 4EYKA 4DA4A 1CQJA 3IE0A 5LYJA 1Q91A 2Y27A 3CU5A 1X39A 1AB6A 3P0FA 1NDHA 5CITA 3ASVA 5A4JA 5I7UA 1H2XA 1HZZC 2RJ3A 5F2KA 2Q8QA 1FVXA 2GN0A 4DA0A 4PZ9A 4QM7A 1YR1A 4H17A 1KO1A 4OHMA 4R3UC 3W8RA 5TMBA 3IEUA 2DHRA 5G02A 4Z5XA 3BK2A 3P19A 1QC5B 2G7MC 4RVSA 4Z0PA 2BGIA 1UPXA 3TXAA 3IO3A 4LYFA 4QQRA 4RIHA 4FEAA 4UATA 4C30A 3U3JA 5FLKA 1QH1B 1CUZA 3OZBA 1WP9A 5CFOA 2XZTA 2GZAA 1VPTA 3CM0A 3KB1A 3ZWQA 4B3HA 4CKEB 1G1MA 2UUOA 2NG1A 4PLPA 3Q5GA 1A7KA 2ADMA 2P4HX 1SBCA 3T9AA 2AG1A 2OLKA 2D2EA 3LP6A 1IN8A 1KYZA 3AFMA 5C4GB 4UPEA 1GNVA 3ZD7A 3T3OA 4UOZA 1XDDA 2FWIA 2CY0A 3DZDA 3VNQA 3P32A 3ESCA 3MSCA 3ZJUA 1XKTA 3A04A 3UZUA 3DOUA 1XDZA 2MU1A 1U2SA 2QM3A 4JLDA 2BGGA 5B3JA 2WTEA 3Q5DA 5EE1A 4B8WA 3F6YA 3X2SA 4FYVA 4G0YA 4YBZA 1OXBB 2RKWA 1FYXA 3EMDA 3X1KA 4AN4A 3X1ZA 4LWPA 4R7TA 3WB0A 1ECJA 5FXMA 2OV4A 4S2UA 3SYNA 3ZWDA 1TQHA 3VFDA 2GEJA 4WRRA 1D2HA 3ER9A 4UTOA 1MC8A 1NW9B 4FD2A 4IW3B 3VOTA 3BHNA 4M9CA 4ILKA 2JZCA 1SKBA 1GTMA 3M4JA 1J56A 2EKDA 2HJHA 4I3GA 1ZJ6A 2GJAA 2Y1CA 4OHRA 1I24A 2QLJA 4C2BA 3ZVMA 1AXEA 1SXJC 3Q1LA 2FSVA 5F1OA 4CU5A 4RDHA 5LBUA 4ZO6A 1J6UA 1TLFA 4YRIA 4H2DA 2QUZA 1MJNA 4PRKA 5IVIA 4DRXA 1PGPA 3QH4A 4DG5A 2E82A 1BN6A 5DLQC 2EF0A 3V8EA 1DELA 2CMKA 2IU3A 2VDQB 4LCEA 4LXGA 4U7TB 3WYEA 3BGOS 1K8RA 3ZHBA 4AMVA 5JFTA 4BNMA 2W4MA 4Q4HB 2EV9A 1L5ZA 4JR1A 4OHUA 5AJWA 1DGQA 3I45A 2XNHA 4FDMA 2B36A 2VH1A 3GZ4A 3R23A 4NS1A 1G55A 4UEQA 3LK7A 2HR1A 4V0OA 4GZ3A 3Q9UA 3C3WA 3FBWA 5I9TA 5HNKA 2E7ZA 2CLEB 2XMDA 4NZPA 5DP1A 1KZHA 1RXUA 3ZLBA 2JKVA 5D1NA 1G17A 1X7GA 1T9BA 4F6CA 4UBJA 1VP3A 1P9RA 4L02A 1N3LA 2IUTA 4LVNA 3FTNA 1POWA 3DTVD 4P7KA 4CTKA 2AI2A 3EZ7A 2XSZD 3THOA 1V1MA 2NW6A 2PMWB 3OIDA 4BFCA 4D6PA 3PTZA 2VHQA 2NLOA 3FCXA 1NF2A 2DETA 4EPWA 1EVIA 4JYPA 4Y2HA 5FOSA 5T64A 2X0FA 1GQFA 1AGPA 2Q8NA 3G9QA 4ZV9A 4C0WA 1UR5A 2JAWA 3T7IA 3LUDA 2IUYA 1FJHA 3PHCA 5FOUA 7AT1A 1E6MA 1CUGA 4DDHA 3MIIA 4BYMA 2BKLA 2BVNA 2CXHA 4ZEXA 3KQSA 3I23A 2QRVA 4B2IA 2X3UA 5J58A 1T8UA 4L7QA 3ETGA 1GU7A 3T94A 3RS2A 2QE7A 4QSHA 3RTEA 1MOZA 3I6IA 4QUGA 4MWZA 1IEQA 1RPTA 3HKEB 3QY9A 4H35A 4NE7A 4ZQCB 2I78A 4BRUA 2CB9A 4BLWA 3NH6A 2BD0A 1YR7A 2ZRNA 3K2IA 4K8OA 3TQIA 5L6LB 4Z9FA 5DM70 4OP2A 3B78A 2ZUFA 4AS3A 1G6OA 4O2BB 2HCRA 5M7EA 5LMZA 1RWNA 1CF4A 4U5QA 1T1EA 3BWEA 3NKFA 4JI7B 2WYIA 2C5LA 2P5UA 4KO4S 1ULTA 3R20A 1EZZA 2VSXA 4MQLA 2PMBA 4JJKA 3V6LA 3MJFA 1PW5A 3OQHA 4H0CA 4YUVA 1WA5A 1BO6A 2ZTSA 3EIFA 5TF0A 2ZJBA 1KDTA 1OYOA 3EVZA 3L1JA 3S1LA 2XAAA 1FTSA 2TSYB 4UBKA 5KTKA 2FEAA 1UZNA 3V8VA 5E0OA 1PJAA 4CVNA 2OFXA 4HADA 3HADA 5KPDA 4OIMA 1REQB 3L5OA 4RY8A 4IF6A 3NG1A 5BSVA 5KSZA 3TLYA 3ZLJA 2DUWA 2R8RA 3SZLA 3M6UA 3BMQB 5CT8A 1Z8NA 4JUBA 4UVGA 2PLNA 2BM8A 3EIOA 2NZJA 3M1YA 4W5QA 3CLSC 3MC1A 4OCZA 4LXHA 3CRW1 1GUFA 4KI7A 4DS3A 2V7TA 3OLXA 4Q39A 4MTCA 4WFQA 5FTWA 4HXEB 2VTBA 3AR8A 2X4DA 1U11A 2E4VA 2YC2C 3B9BA 3L8YA 3NGXA 2GPJA 2O0HA 4MQBA 2AQIA 4RMNA 3AUJB 1W581 5A1JA 3RUFA 1UXKA 3W2HA 3C1UA 2O0LA 1TW3A 2ASVA 3NHWA 4YP9A 1M2VB 2VPWA 2PX4A 5EMHA 4AT1A 1CJMA 3QKSA 4EM6A 1NXTA 3BA1A 3ZU3A 4KPYA 3K53A 3ZNQA 2F9MA 2NZVG 1IB6A 2FW9A 2XZPA 4JQCA 3EJ6A 4V3BA 2RHMA 4L95C 2AYZA 1ORHA 1I1QB 2EKQA 2JA2A 3OPVA 1SD5A 3WGGA 3KR0A 3W8NA 1PI3A 3P27A 3TOSA 4EL0A 5B5SA 3ICEA 1YZVA 3F6RA 1I7LA 3WO0A 1F3OA 2ZRGA 2LP4Y 4NOKA 4HWGA 1UPAA 3BDIA 1KO4A 3I8OA 3PFGA 1NNSA 2BFEA 2MMGA 2N1BA 1H0KA 5B36A 2G06A 1UJNA 1L7BA 4WA8A 4QUIA 1KYWA 2JGAA 2CNOA 3E9MA 2EGGA 3E8XA 3HEAA 3HUTA 3LUPA 5IBRA 3H9BA 4OF4A 2Q5OA 2HF8A 3MUOA 2BUBA 3T99A 1SPXA 3WGYA 2PMFA 4WFKA 4ZA2A 4MVYA 1J8QA 2HEIA 2P3OA 2ID7A 4Y1GA 4PF1A 3IRVA 4YY3B 1NUAA 2H59A 4ZODA 2NXCA 3PC3A 1D2MA 5JBIA 3AW9A 1VG1A 3GT4A 4NYJQ 1GGVA 1JQJC 1L5GB 1DQZA 5TC4A 4IDAA 3UFBA 4HI0E 1QIJA 4OXIA 3WGMA 1P5HA 2JL1A 1QGOA 3H5NA 4LC0A 4BVBA 2CL7X 4BVAA 5BORA 3O3NB 1IJEA 3PNLA 3U4AA 3O5AA 4NEGA 5IHPA 3H04A 4LF9B 1J39A 1WDTA 3M6IA 4ETMA 5KIAA 4W5OA 3G13A 4IDQA 4UBMA 3L41A 1L3BA 2Y1KA 1J7KA 3CVJA 3TVDA 3IS3A 3R5HA 4FYMA 3H11B 3DPSA 4PNZA 1J0XO 4N5NA 1MW9X 1YS7A 3L1HA 3GLSA 1OC2A 1YQGA 2I8AA 5HFNA 5CM8B 2IX3A 1MDBA 1NFQA 4RD2A 2BHSA 2HIHA 1MO5A 3OFKA 4GKAA 1DJPA 3EW7A 3PEVA 4B5KA 5K2MA 5AI0A 4HMOA 3UNXA 2G1KA 3WL5A 4F2PA 4UHHA 4NYIR 3EGWA 4IILA 4XDGA 2HA3A 1L7DA 1IEWA 1J2UA 4QYXA 2OM2A 3IP9A 4FFMA 1NBEA 4DQ0A 3R3WA 3X3HA 3EPJA 1VKRA 1SN7A 1VRVA 4N6NA 1FYEA 2IP4A 2DT5A 3L06A 1I2BA 1Z2OX 2AC7A 2Z95A 1SWVA 4QFDA 4Q4AB 4RY0A 3V8MA 5EMMA 3KRTA 2SCUA 3BRCA 3LUCA 2A0KA 4O8ZA 4EYGA 3NHSA 5IS2A 3HN7A 1I32A 3VR4A 3U09A 2A92A 2HL6A 3MMPA 1UDCA 2DPLA 2IXDA 5K3DA 4GUAA 1WHTA 1U8ZA 3B1FA 1XNJA 2BMJA 3JQAB 3NBUA 1XN1A 2B25A 4ECAA 4ZGGA 4QUDA 5JDIC 3E82A 4E2WA 4TTVA 1CUAA 4OQDA 2QTNA 1TYAE 2YOHA 2CV0A 2JEOA 4ZCPA 2A2ZA 4RVUA 1L5HA 1H2BA 2P9JA 5CFRA 5FCDA 2XB9A 1D1PA 2A9JA 3OJLA 1KEEB 4Q1BA 2GBLA 5CX4A 1S4QA 4NCJA 4OL9A 2ORED 3UFXB 1RNLA 5JSHA 2F3SA 1AGRA 1SVUA 1EU1A 3V80A 5KKCA 1L1QA 1M6VA 1T3LA 5BW6B 1TT5B 2ZSKA 3T7CA 4PYMA 2F59A 3LDFA 4XRRA 3V7UA 4P2BA 2ZSJA 5BRAA 1RHJA 3B7PA 3KLPX 3IP5A 4LFAB 1DLJA 4XIYA 3CW9A 1Z83A 2X1LA 3C39A 3DDOA 3NTLA 3UF0A 4ZICA 5AVXA 1JJAA 1TF5A 1JNYA 5HQJA 3O92A 5JS2A 1B8UA 3RC8A 2J4DA 4Q3CA 5J5VA 3UQZA 1ZMOA 3QQ5A 3CKYA 2WWRA 3F4BA 4TTIA 5CT6A 3SSMA 1U6JA 2ACKA 4BQRA 5TIIA 1M7GA 1ZD3A 3U37A 5E6SB 3PKJA 4DXAA 1SJ9A 4RPCA 2FPUA 5DE3A 5CCXA 5LDGA 1P7PA 3T1OA 1LS1A 4EHLA 2ZB4A 2G08A 1Q0QA 1KE2A 4QZVA 3GFTA 3KZCA 4H4CA 4J0CA 4CYMA 5CNKA 3VSAA 4CCYB 4WZAE 2PCJA 3TTSA 5K03A 1CUYA 4C7VA 3K5IA 4KLZA 4LK3A 4OLJA 1DC3A 1Y1SA 2VUSA 3IBGA 5LIPA 1H6DA 2RK4A 4X20B 4EYQA 2VTEA 2CJWB 3V8QA 3P4UA 3OCUA 1JNXX 3B38A 5A4DA 3KQMA 5LU8A 1DB3A 2QVLA 2D5IA 1XU9A 3RVNA 1LGYA 1AQJA 3FROA 3K5WA 2QPLA 2P2GA 4K9PA 1V26A 3CKKA 1LI4A 2FSHA 1UC4B 2JAXA 4F96A 1GEEA 2ZRFA 1N8NA 1PJSA 2F48A 2X0IA 2VDVE 1YA4A 5KVQA 2EFGA 3T7KA 1BHO1 1DSSG 4BC0A 1OAAA 2X2FA 2XIJA 1P17A 1ECPA 1TLLA 3KPVA 3PSHA 5JYDA 1JWLA 4OI0A 2B2XA 2IHYA 3HR4A 1PT7A 2OZVA 2VDRB 3VUEA 4G09A 2XQVA 3H3JA 4QU5A 3P2YA 2Q5LA 2EBHX 1T5HX 3QFRA 4HSGA 3WIVA 2NP7A 2R6ZA 2OCBA 1EJBA 1H93A 1VJTA 3MLEA 2B8JA 2HSWA 3OIFA 2DBVO 1FLNA 1QH8A 3IAFA 2YY7A 3K9LA 5LQRA 5JS7A 4GNRA 3LVQE 3R0IA 4J0HA 1KQOA 1ZS9A 4A2WA 3OTOB 1NWCA 2VT2A 4F8EA 1JDPA 4A6XA 4M83A 5BURA 5CIYA 1PL0A 1XDUA 8ATCA 1YHZA 4BX2A 1JJVA 1QIMA 1RHQA 3EC2A 3ES9A 4P3OA 4Q19A 5ALUA 4DGSA 1K7XB 1C30A 3NC0C 2V4UA 3WICA 4CQMD 2VUIB 1D6SA 4RHYA 1OWLA 4BNXA 2WM3A 3FXAA 4IVPA 1RW4A 3I52A 4UC0A 3UEOA 4A0HA 4WMLA 1WCYA 3E1KA 4MVJH 4LHVA 2DUUA 4BC1A 4WW0A 1JXMA 4FWIB 4LMRA 1ZVJA 1QPGA 3OHPA 3COZA 4MUYA 3GB9A 3LL4A 4Q9HA 1SC3A 1L4EA 2C3UA 2PQMA 4PFJA 1XTVA 2P62A 2H9IA 1IIBA 1U9CA 4R81A 2OAP1 3JY6A 1HT2E 1JX6A 2J3KA 3JASB 3OM0A 2BT4A 4XEHA 4BB5A 3TNFA 5C8DA 1CYDA 1LWNA 1OT5A 1I7PA 3ABIA 3FLAA 3IP6A 3WYGA 2VK2A 2QMEA 4WK6A 1DC7A 1VZ2A 1Y4UA 4DMUB 1QP7A 2ZUBA 5EIAA 3SHFA 1WW2A 2C2WA 4LY0A 4A5OA 2XWBF 4X3OA 2ALJA 3ZE6A 2C3MA 4EA7A 4J7UA 3BDVA 2C9OA 4BEJA 2OQVA 5F1KA 1JTFA 1V9LA 4DCCA 4BNNA 1B6GA 1RCFA 1LBHA 1RYDA 2A59A 2B98A 2YMMA 1Z0IA 4FQ8A 4QFMA 5D2CA 3TLBA 4ZOLB 2NWQA 4BEBA 5KNCD 5K99A 2CZQA 3WMEA 1GGHA 1RWBA 1ISGA 1H2HA 1ST2A 3HU1A 4ZCIA 2ZS7A 3FNFA 4HGPA 4L5JA 2C5EA 5I48A 3KT3A 1TX4B 3UJDA 1UBCA 3PPVA 4QTTB 3EVFA 3L4BC 1XD2B 5LM3A 2PYIA 1O6ZA 3HWSA 2N0SA 1NATA 2CNWD 2A5FA 4TQUS 5EL0A 2TMYA 3STWA 1L4MA 2DFNA 4RD6A 4C3VA 2G9ZA 1TU4A 3QHAA 1MB3A 2BP7B 4U2CA 3WSVA 4E0BA 3GPIA 3NM6B 3F7NA 3CT6A 3ZQ6A 3HZOA 5E7JA 4BXOB 1A98A 3ML1A 5F78A 2OZPA 2AKEA 3GLUA 2JFHA 1F7VA 3T7EA 3FMIA 2RGNC 2K7ZA 3DDUA 3KTDA 3R7WB 3T9CA 3WDLA 2AJLI 4ID3A 4MTLA 2JI4A 4TMYA 4UNIA 3ONDA 2BDTA 2YZMA 3D6FA 4BNTA 4R1NA 4QXMA 2O2GA 3ESXA 4AMYA 3GDHA 4IO1A 2ODBA 1TGVA 4V1CB 1DG1G 2DSNA 1TTHA 1ZC4A 1A69A 3WNVA 5A9RA 4CETA 2VAPA 1ZDMA 4OB8A 2Q41A 2P68A 3EVAA 3T3MB 4N7MA 2A33A 5K3EA 1AY0A 3OX2A 4BGEA 3QF4B 1CX9B 1QM5A 2YFYA 2FMXA 3BJRA 4JC0A 5EZ6B 5K8CA 4E1VA 3W2GA 3SYLA 4GD3Q 1E2IA 2VUHB 3AR4A 3HCOA 4JBLA 1RSZA 2FN4A 2VBGA 3NUZA 3PWTA 4IDOA 4WLVA 4ZO7A 5DM1A 3TKLA 5A1TA 4Y6OA 3AIKA 1RLUA 2HSZA 2YHBA 1E7RA 2NQTA 3MWEB 2UZ3A 3OE7A 1YBMA 2Q4EA 4JJ8A 3LKZA 4X60A 1KRXA 1ZM4A 3BMNA 1Z22A 2P2CA 3FNGA 4FSHA 3W7BA 1BXKA 2JFNA 1XYVA 4PYNA 4K6MA 1RZRA 4J1QA 3OTWA 1T4GA 3VYUB 4BRWA 3D6AA 1JG1A 3EFOA 2O5EA 4YRLA 5CYFA 3DFZA 2Q07A 4GBJA 4O4HF 4YCNA 1OI7A 5T3YA 2QTBA 2H4FA 1J8VA 5B4TA 2IIVA 4IKPA 9ABPA 5L7WA 3ZDCA 3V7WA 4KV9A 1FTWA 3ZNPA 4ER3A 1NVBA 1RM0A 2ZS9A 3HR7A 3ICWA 2AYXA 3VISA 1UWVA 3KVOA 3AR2A 4Y6QA 3KKOA 1EFPA 1PF7E 4R2WA 4DM7A 1CJSA 4BQQA 1Z74A 5HTOA 3ACCA 1KJIA 3AHJA 1XMSA 2SCUB 3FCOA 2II6A 1DBVO 2R6GA 3HDVA 3QPVA 6YASA 3PTAA 1IK6A 2ZR0A 3KOZA 1FYVA 1OX4A 3U7FB 3IR5A 3T3NA 4BMYA 1M0EA 4G26A 2GB4A 1BGVA 1YQWA 2F1RA 4MV4A 1Z0AA 1UQUA 2FSUA 1JWBB 3TL3A 2ZI4A 3K9FC 2J46A 3LQ1A 5ENDA 1NXXA 1TQ6A 1W8DA 4XM0A 4MW1A 3ZGNA 4H6PA 1TW2A 3H1EA 3HVJA 2VSFA 2HKIA 3KSMA 2PVSA 3WKEA 3W5VA 4B84A 4CF7A 1GG2A 4QELA 2XB4A 1G8JA 2CLDX 3I42A 3OI7A 3GV0A 4I5DA 4TKUB 2A1TR 1FNBA 4FKMA 1XZDA 2PS9A 4KXFB 4R1PA 1T91A 2W6MA 2JFWA 4EJMA 2CK3D 1XDWA 4MH0R 1TIKA 3WL3A 4G8CA 3WLLA 3VAZA 1SXQA 4BKRA 2ZTVA 4E32A 2JHCA 3AR9A 1SOWA 1Y7HA 2ZG6A 3BMOB 3TMYA 4Q4HA 4X63A 3QU5A 4L73A 4HJRA 5BT8A 5ESWA 4OJQA 1CIVA 5TT1A 1DUVG 3R0QA 1QZXA 1SCUA 4BL5A 3QEMB 1C80A 1GL9B 5DIFA 5KNBD 3ZGZA 2DFKB 5D8DA 1OLSA 3VV2A 2G36A 4E94A 3L01A 1PR3A 2F1KA 2XAUA 3ABRB 3QSYA 4N3BA 1VYTA 3R0JA 1XA4A 1UKCA 3CZQA 2OCIA 3OQNA 2CLIB 4LF4B 1KZ7B 3STYA 4Q1AA 1V1RA 2EXXA 1LSJA 3I4FA 4LVUA 1VYUA 4LNUB 1UC5B 2RB4A 2FMFA 1X7HA 3E3AA 1MO4A 3BCSA 2I9PA 3N7TA 1WR8A 1PG0A 3AONB 5LCXA 4A23A 4AICA 1HKUA 1XTUA 4IIUA 4WOBA 2CXPA 1S8NA 2X5KO 1GNTA 4GG1A 4LE1A 2B0JA 2IYUA 1ST3A 3AHIA 4RE6A 1CBUA 2Q3DA 3KYDA 4ZEOA 1DTEA 3QELB 1P1BA 2E89A 3G8CA 4RVDA 4DLZA 3HBFA 5K2OA 1Y6GA 1YVEI 2CHGA 3L4SO 5HK9A 1QHXA 4BJ6A 4Z4EA 2EBUA 2EHDA 1BS9A 1ZFNA 3JD2A 3WLIA 1ZM3A 1VDMA 2E6KA 2XY4A 1SFRA 1DKUA 3SBXA 1CEXA 2QJWA 2Y1FA 3O2NA 1B00A 1KJJA 4DLUA 3GUHA 5ADVA 1NVTA 1XB2A 3HN6A 1NNLA 4KO1S 2FSGA 1OWOA 1J00A 2OHIA 4LJ6A 3VO8A 3U3MA 2VJDA 1CQXA 4FYHA 4CG0A 2B9VA 3GG9A 4JLUA 4WXPA 1E1CB 1C0IA 2AZMA 2VYCA 1SXJB 1WY7A 3GA0A 2WI8A 3NIBA 5DLEA 3JPWA 5HBRA 4D46A 4ZRNA 2P9GA 4UU0A 1KF0A 4HTFB 4HNVA 1AMUA 4YAOA 2FW6A 1FNSA 3WLEA 3BH0A 2VKTA 4F8JA 5F7XA 3P45A 4UCFA 3PBKA 4KVFA 4ND1A 4RZHA 3D7MA 1LF5A 3KU4A 3KUXA 3LPMA 1FP4B 3OFVA 1P0PA 1V4NA 3DE4X 1SBYA 2BTQA 2Z98A 3WMXA 821PA 3HB4X 1YJ8A 2FUNB 1T2CA 4RPGA 1W2HA 4DR2B 1QFZA 4KQIA 1TCUA 2LZ0A 4AY5A 2ZUUA 5JROA 5EERA 3I6MA 1JA0A 3I83A 1RXIA 1TLTA 3WFIA 2BBTA 1SVSA 3C24A 1KFBB 5TMDA 4WGGA 1FFXB 4Y1RA 1RJ9B 2A67A 1C7JA 4E31A 1LV8A 1K06A 3A1DA 1U9IC 1RYEA 4CDRA 5KU1A 5HM8A 3VI3B 3R7WA 3AI7A 1BQEA 5DJ5A 2OGTA 4AROA 2OGWA 1YCDA 2FP3A 4JL8A 3UAXA 1GV0A 1O6CA 3IB6A 1I1NA 1LDEA 4OBBA 4HQLA 3PC2A 4U0JA 1TQ8A 1OR8A 1R0RE 1SVKA 3RAEC 3FA2A 2D06A 3AYXB 4IXNA 3VZQA 1QG2A 4IH4A 4QVIA 1XZCA 2MSEB 4QBIA 2R25B 1NVVR 1U1DA 2ZJAA 3PHLA 3CRQA 1TK2A 3CJQA 3E3MA 1QHSA 3E9DA 2XUGA 1VE3A 1SD1A 2UYCA 3AHCA 3I2FA 3MGAA 1HC7A 5BQ5A 1XKQA 4EFMA 2CLLB 1IY2A 1IE3A 3DDZX 1QYVA 1Z7BA 3U26A 5CVVA 1CYEA 5HQTA 5HZHA 1XZBA 2WFLA 1F60A 3QLEA 1GLVA 3FCCA 1EWRA 1B0UA 1ZD5A 4CW7A 2EZ9A 3KTAB 2GPNA 2O2SA 3HO8A 3QFFA 4Q3KA 3AR5A 3WHIA 3BJEA 3PUKA 3PNQA 2QT0A 3ZS8A 4I19A 3EIQA 4JIGA 3OT1B 5SZKB 3DS8A 2L69A 2QMHA 3O7MA 1J22A 2C9ZA 5KC8A 1JKXA 1Q0HA 2PHZA 1RWKA 3IPLA 4ZRMA 1JDUA 3RC1A 5BVHA 5IN4A 1SBIA 3LZ6A 1J9GA 3MCZA 2J32A 2CKMA 2H5LA 3PXDA 4B2PA 3PITA 1STOA 4HV4A 1JHYA 2GESA 3IOMA 3JRWA 3KAPA 2MHCA 2Y1OA 2YJTD 4DJDC 2K2WA 2P91A 1EWQA 4JI3B 2YHIA 3NYWA 6REQA 5IM4F 1PD1A 5DX8A 4LX0A 2ZYTX 2VDLB 1WSDA 4MICA 4ALJA 4YUZA 3J7AC 1XMIA 2EKZA 2WUDA 3IEVA 2NPFA 4BBJA 3PC4A 2ZQ5A 4Q9DA 5ANRB 4PQGA 5I7WA 4J3NA 3FNIA 2YKGA 1EE9A 1JR3A 1XF1A 2P6MA 3KT0A 1V6SA 3B51X 2EWVA 4H0FA 4PGAA 4L16A 4AM8A 2HT1A 1QGAA 4OG2A 4EFLA 4BFWA 3D0QA 5AW2A 5L4NA 3SSOA 4RGYA 2BDEA 3F3YA 1BU5A 1KAGA 1I13A 4G67A 1I6WA 1QO0D 3GW8A 3MQFA 1A9SA 3QVXA 4NJEA 4ARIA 2AS0A 3HDGA 1U3WA 2QVBA 2RCNA 3D2LA 1O5TA 2JFFA 3BB3A 2MSCB 3A2MA 4MV9A 4NOMA 1RVDA 4QOHA 4R16A 2NO1A 4CLOA 5IABA 4OHKA 3E4CA 5HOQA 5JTTA 4D9BA 4A73A 1PQUA 2C3YA 1GT6A 2HWWA 3H5TA 2P40A 3NYQA 3PFKA 5LD2C 3FSGD 1SUAA 2PFKA 2W0SA 2PGIA 5LP6F 3N76A 4O4JB 3KUDA 1S3FA 3DAOA 1ZOLA 3V4VB 3VKHA 1YS1X 4UUPA 5IMBA 3V97A 4E6PA 3TZLA 1TM5E 2H3HA 4FDTA 2OFWA 3N6RA 4Y6PA 1ZOOA 2FYTA 5FX2A 5TARA 4RLFA 2PL5A 5KQSA 1A1SA 4FGSA 4MW5A 4K2AA 4YP7A 3TRIA 2E5LB 1JAYA 4RXTA 4BWGA 2D6FA 1YFKA 2F2TA 1WX1A 2WYVA 3M5CA 1ZP6A 2I2CA 3G9ZA 4LHYA 2I2XB 2HJGA 3KXLA 1U2TA 1IOZA 5KMGA 4W8HA 1NM5A 3JZAA 3MIZA 1JH8A 3O74A 5F2EA 3GCXA 3BTVA 3ZWWA 1XRNA 1RRFA 4UZSA 3IIJA 1G7SA 4CFZA 4FGZA 1UFQA 2EBFX 2HF9A 5IJZA 1EQUA 3WOVA 3W77A 4DV2B 1ZHFA 3FFBA 1H0HA 3LQ4A 4JY7A 1QH9A 3PUHA 4K87A 4J7AA 2A1TS 3S44A 2WIAA 3EZLA 3DKKA 1KNQA 3AJRA 2XB2A 3KAJA 3KVVA 1D2CA 2Y76A 5DDIP 3GUZA 1OZ0A 2ODPA 3JRNA 3NHAA 2D7DA 5AFSA 2Z9CA 2P5YA 5J5CA 3GEHA 1V7PC 5KYTA 2GYUA 3TZBA 2VTDA 4LOLA 4UHDA 3RAPR 3RTGA 3RG2A 3B3AA 3IH5A 4IVQA 4M46A 5BSWA 4ZYXA 2CFSA 4F93B 1YB1A 3EF0A 5J2UF 1WB6A 2NTYC 5IFKA 4C4ZA 4XQCA 1KQ3A 4TWRA 5F9FA 1LY1A 4G1VA 5FADA 1GYQA 5FLYA 1RKVA 3H0EA 2CNDA 1NVFA 1HWYA 2AFVA 2GJ4A 4AJPA 4EVIA 3FZEA 3DBOB 1WU8A 2C95A 2Y1XA 4X7MA 1YR3A 3HYSA 1JIUA 2I4OA 2ZJ4A 4MSUA 3S3TA 1SUBA 5JC1A 1Q0SA 4GE3A 3EIWA 1E2UA 1YBAA 4OQEA 3L0IB 4QGGA 4TX1A 3H1FA 4XJXA 2HGSA 4BTEA 5KTYA 1W9HA 1IM5A 1CC1S 2GNPA 2IEDA 2QTHA 1H4VB 4CUKA 1RADA 2IVZA 2H1HA 1H2RS 4CM1A 1ITZA 5LZ4A 1E1LA 1G42A 1RYHA 4E30A 3HCPA 4GI1A 1N8KA 4MK4A 3PIIA 1K0FA 1MQ8B 1NDQA 1ZOPA 2N1MA 4WNAB 4C43A 4B6EA 5FTNA 3F98A 1FLVA 2VXYA 1LDMA 1OZHA 1R9NA 2Q0HA 2HXGA 3IJEB 3O1LA 4KPUB 1TF2A 4NQRA 4OGLA 4X00A 5FI0B 4D1YA 1BMQA 3HHEA 1S2IA 3KJGA 2ZUTA 3O7WA 4BNJA 2M9MA 4YRPA 3SF0A 4NV0A 3R5TA 3TTUA 4F97A 4I1PA 3SLGA 1R8QA 1LSSA 2VF8A 1I5OA 1N7JA 3KQWA 2WY2D 2R0QC 2ZTLA 4MHTA 4F86A 2OL4A 1A97A 2PX8A 3TW8A 3MHPA 5C8VA 2WM8A 3F4LA 1LPOA 3DZBA 2PWPA 2YN0A 1YS4A 1SH7A 2WDPA 5DLYA 4GPAA 4ML3A 1T6NA 1HYQA 4LIPD 2VPYA 2OGSA 5HGXA 4BO7A 1GTL1 2CF5A 2Y6UA 4CZ2A 1IJBA 4G0PA 4I1OA 3PT5A 3IA7A 4EPTA 5BV2P 4GXQA 2LR0A 5FTJA 4LOHA 5AKIA 3G0IA 3VYWA 4LMPA 1HOXA 3CG0A 4OQXA 3DMHA 3MGBA 2WVGA 2JASA 4ZCMA 1WMSA 3SEZA 3W5JA 1AVTA 1FB5A 2HJWA 1H65A 1WCV1 1AA9A 1M2NA 2QLBA 2XLBA 3P9RA 3WMRA 5AHRA 3AVXA 1HMYA 2ZETA 4B2YA 1QX3A 1ZU4A 4NARA 1QS0A 1DCTA 1NZJA 5B3JC 2DJIA 3SICE 4HD8A 1VSUA 2W6PA 1AZLA 1WVMA 5CH3A 2FI1A 1HDOA 5ENZA 1Z73A 3DKIA 3CUKA 1EP2B 3ER6A 4I14A 4JDUA 5U4XA 1OVMA 1G59A 1OGJA 2QQ0A 2IXAA 1KH3A 1M74A 2XUJA 3B8HA 3S8EA 5TS2A 2GBGA 4M6WA 4QGFA 4NE2A 4YHHB 3OOHA 1M1NA 1T0HB 2WAMA 3EBOA 4CCAA 4PZDA 1EE1A 2WJHA 4HNGA 1GUZA 2BL4A 5CYPA 3R24A 1F8FA 1R50A 1BWRA 1M2OB 1BX1A 1KHHA 2BJHA 4EHJA 2H7XA 4XPIB 4NI5A 3BXFA 4D3DA 5HRAA 3DDWA 1GL7A 5CJPA 5SYMA 4Z7QB 1E1KA 1WEKA 2RK6A 5CEJA 2QW0X 4YIHA 4L3WA 3SXJA 3MM4A 2H51A 4MKXA 1XVVA 3TVYA 4ZVQA 1KY5A 3TAHA 2GBCA 2ZXEA 1J8MF 1G0OA 1QFXA 3GEDA 3OF2A 2R5NA 5IEJA 5JJ5A 4M8KA 5AW9A 4GQAA 4A92A 2SKEA 3IP7A 3IDQA 1X7XB 4G8BA 5LLSA 2MSLA 4C06A 5A62A 5CG1A 4M89A 2G9UA 1H5QA 3K2EA 5LQUA 2XODA 2H1CA 4PS1A 3RHTA 5B7GA 5CB4A 3RV3A 2JZNA 1Z7YA 4W5NA 5JBNA 4RCVA 4TL6A 1R0XA 3DCJA 3MINA 4JD5A 2ZB7A 3QA3E 4ZOCA 3VJRA 4D4IA 1DAOA 3WAKA 2EW2A 3FSGA 3O3CA 5DGIA 1UM9B 4RNDB 1A5AB 4WY5A 2UKDA 2VT6A 2DH6A 4IDGA 4I4TF 2EG5A 1V35A 2H1WA 3FTCA 2EX4A 3RVDA 3GLFA 1FXSA 4E07A 4M87A 4Z51A 3UW3A 1AQLA 1ZGZA 2QM7A 1WDLA 1AK9A 1ZSVA 3IRUA 1AUOA 1R6UA 1V7ZA 1C0EA 2VHUA 2ZIEA 3RS7A 2TECE 2JIZA 1WXHA 2Y1DA 2FQQA 3GFOA 3VR2A 4EF6A 3NRBA 3SEQA 4INAA 3UT5A 1TMGE 3L1KA 4P4SB 4GOKA 1R6XA 2CFIA 5KNCH 5IXSA 2LKCA 2XCSB 1LUAA 2YV2A 5F64A 3A4MA 3KHTA 1MV5A 2C58A 2G04A 4WOJA 2GFIA 3H9UA 5D5HA 1E9CA 1SO8A 2GR9A 4ATNA 2XSZA 3GFSA 1BWPA 2VRWA 1E6WA 2BEUA 2G0TA 2QGZA 4YRQA 4H6WA 4Z9YA 4Y9UA 2EATA 1ZMXA 1YB7A 1CJTC 3BL8A 1CZHA 1V48A 3NBYC 2DMRA 2JBAB 1E9VA 2OP0A 3CSUA 2W8BB 5IPFA 5FV7A 3KVYA 3MCTA 4UHEA 4BNLA 2P2SA 4RJKA 4HAOA 2BUCA 3NOXA 2R8OA 3CZ9A 5T7BA 5ELMA 3ILXA 4J6EA 5B1IA 2D3WA 2P6PA 2QSJA 1U80A 3I4LA 4KVZA 2WYUA 2Q4TA 3GCZA 1UXHA 3T5BA 2GAIA 1WCXA 2KJQA 2Q6LA 1TD1A 4UW9A 5C7LO 4Q7QA 1KI2A 1RD4A 2RKOA 2JCVA 3AF5A 2J45A 4ZZ1A 1PZMA 3GNSA 1Y34E 2VC2B 2VP4A 2BWJA 1UBSB 4FS3A 3TW4A 3VR4H 4F6RB 5BSKA 3P2MA 4AECA 1U3GA 5BWMA 2ZP1A 1IHPA 4FYWA 3N2LA 4P22A 1NYLA 1T5LA 3V1MA 1PUIA 2FN8A 4CM9D 3LLVA 4PQYA 1UFOA 1R4AA 2XJ9A 1PEAA 1DEXA 1CY0A 3S28A 1UBOS 4MRRA 5H1YA 2B7LA 1FMJA 3SQNA 3UJ6A 3WA7A 1CS4C 4X90A 3MK31 4N12A 1ENYA 1ADGA 1IUKA 2DC1A 1E3LA 2YY6A 4X1IB 4LV5B 4L3OA 3C6XA 1I5EA 1NRJB 5E2AA 5EWMA 3SZGA 2KYRA 2WJPA 4RD1A 4JU8A 5HG0A 2QTCA 4OBXA 5GPBA 2XT6A 4IJ6A 5F2OA 1UOPA 4I66A 5L7TA 2XRYA 4M1EA 3ZGVA 2JHPA 1CUBA 4XWGA 1GGMA 5JDCA 4X1KB 1MDFA 5H02A 2FDCA 5MFPA 5DBFA 1VMIA 1G21A 2X7JA 1AGNA 1EAMA 4I81A 3T7SA 4C03A 5K4GA 1AIPA 4K05A 4R1SA 2J41A 5K20A 1V8ZA 2AG0A 2V1XA 1W87A 1WG8A 3M5WA 1JU9A 4M36A 5DKFA 1VMAA 2IKQA 4TZ0A 4QYWA 2OOKA 3WKCA 3HJRA 4JSRA 3L5KA 1DWUA 2C0QA 3L7DA 4AJ4A 3O2QB 1YACA 2PX0A 1DC4A 5EE5B 1EFKA 3WK8A 2HGZA 4ALKA 1AXGA 3LK6A 4C7OA 2EQAA 3IB3A 2WFAA 3LLSA 2P6UA 4MPPA 1YZLA 1BCSA 3CN9A 4JROA 5EOVA 3M49A 1L7QA 4KAFA 1GN9A 4NECA 1YAJA 2PLWA 3UHOA 1M1YB 1VKOA 2FMTA 3RV4A 3ZZ0A 1XEFA 5E3HA 4TV9F 2AFRA 2I4TA 2N75A 1W36B 4AWXA 5KYVA 1L7NA 2YMLA 4K6FA 1GNPA 2Q4OA 3IAM1 4C0KA 3ND9A 1HQYE 3RBZA 1X7YB 1C3JA 3PQ7A 2IGTA 4JVOA 1P91A 2ZXUA 3M70A 2VHZA 2QR2A 4ZHQA 1KS2A 2WDZA 1KR2A 3HVUA 1Z0KA 2QROA 4MRAA 4QBGB 5DNEA 3WL7A 2ORVA 2Z6UA 5LIRA 1DC5A 1QE3A 1H5UA 1EM6A 2FPMA 3ZWVA 3LWBA 3DKRA 3WXBA 3UK7A 1IHOA 2XMQA 2BMVA 2PGAA 3C5WP 4RL6A 2IY8A 2IBSA 5AIAA 4GM4A 4Y9SA 1ZR2A 1J0CA 5C0OE 4O4JA 4F4UA 3CLTC 1MHPA 3NCHA 3NWOA 1Z35A 1PQPA 3TZ6A 2MYNA 3NWBA 5U1PA 3X1YA 3NPAA 2UZAA 1VJ5A 1XCJA 4PZCA 5JZSA 1WXXA 1DOAA 1I2ZA 2XDAA 3DNPA 4FZVA 4FBMA 5ALLA 4B17A 3ITDA 3OFJA 4ZJYA 3BRWD 3C3XA 2ZYVX 1RWWA 4TYMA 5ALVA 4W8OA 2XB6A 5DMHA 3V9PA 2ZPUA 4CM7A 4OHOA 3QNWA 2NYAA 1FYWA 4W4TA 1NG1A 1MENA 3F2VA 2K6GA 4QG7A 4EO4A 1LNZA 1OVGA 1V5GA 2WZCA 3LP8A 3N2NA 1FBNA 4FR5A 1AOXA 3O26A 2WKWA 3KD3A 4BVLA 2BR3A 4R0NA 4E3ZA 1NULA 1P5RA 2EU8A 4BATA 1XWWA 2XH8A 4H7EA 1EM8A 1XVIA 3ETNA 4JLBA 5FYQA 4C2TA 5ADWA 4GBED 4V0MA 4HRVA 3TDMA 1LNSA 2OHJA 1CJVC 4OKNA 2JFGA 3V8PA 4JEIA 4F3KA 5JAHA 4RCYA 3VBCA 4WOPA 1GU0A 1TYDE 5H70A 4DCNA 4LJAA 1SBNE 3QG1A 2DF8A 4O2BA 2W71A 4C87A 1DWPA 2JFXA 1W25A 2JI8A 3QE3A 5JY6A 5LQCA 3Q7SA 3RTBA 4G1BA 3UC9A 5JAOA 2GZ2A 4QFBA 3ZXYA 3G1UA 4D26A 1CFJA 1RYYA 3DVAA 1XWIA 1R0WA 3GI1A 2Z6AA 3ADPA 1YL6A 1W34A 5D5PA 1RQLA 2H8KA 2ODAA 4KSBA 4NOLA 5AM5A 3TLZA 3QV2A 2ZJ2A 5CLFA 4FHGA 4DIEA 1CUJA 3KPUA 4K5QA 3ZXSA 5CDFE 3D3WA 4MCAA 3U5ZB 4EGFA 1GADO 2Z5GA 2QUJA 4RV9A 2AL7A 2RGNA 4IZIA 1NBHA 1CW2B 2HDOA 3RJTA 5JAZA 5IYZB 5FWYB 3KAKA 1WUYA 2FFQA 1H2FA 2V03A 2P27A 3PC7A 4Z9AA 3WRVA 4DY6A 1E5LA 1OBHA 1PR9A 3CF4G 2CVPA 1KQPA 1ZLYA 4DUPA 1CJUC 3M9WA 4B4VA 2ST1A 2ZRBA 3QUAA 1ZWKA 4Y9DA 2ZWAA 3M4ZA 2HA6A 3OOSA 1UEXC 4OLHA 1TA0A 5DK6A 3H3XA 3K72B 1XALA 1XMVA 1YE3A 1UDXA 3EEFA 2XUPA 5F9HA 4EOGA 2D5AA 1MT0A 1JMYA 4AMUA 5A5GA 3UAOA 5B64A 3BWBA 4UTNA 1GD1O 1GSOA 1R37A 1O8BA 4ROTA 1ECBA 5EJMA 5HRCA 4WINA 1ZINA 1W7AA 4AKIA 2IHNA 3KUKA 4CTJA 3MD9A 3U0VA 1CVRA 3N8IA 4TRRA 3KT6A 1UK9A 2CT8A 4TLLB 4B4KA 4KQWA 2X15A 1JHMA 2WW8A 3DZIA 1CF9A 2IZ5A 4J0GA 3WNBA 3IVMA 3AP3A 5LXTA 1NQ5A 2H06A 3BS4A 3N8HA 4ASUA 4L5BA 2ZWMA 1Z6AA 3IIKA 1T5TA 3D0OA 4R54A 3CEPB 2HN9A 1OYVA 1YDGA 1P1RA 1P33A 1NVWQ 4JVLA 2H08A 1DOZA 2IOQA 4LG1A 4MS4A 4O1MA 5E6RA 5TPZA 1DPFA 3REQA 3ZK8A 3AJEA 1GCAA 1P19A 3M5PA 4GGPA 5IULC 2RDMA 1N5OX 2B1QA 3QYAA 1T2EA 2YBEA 4YGYA 2W2QA 2IP1A 1I36A 4G3XA 4REMA 2NSYA 4XIJA 4F85A 1HBJA 3NEAA 1TYBE 2GO7A 2YOFA 3CX6A 1YNSA 5K3FA 4D0GA 4H3HB 1V6CA 4P98A 1O96B 4PTLA 1H3EA 4C05A 1F4LA 4UTRA 5B1YA 2HI0A 3PDUA 1GRNA 4XFJA 4BVGA 1R0BA 1LVHA 5DTQA 1ZNQO 2KE5A 4D3YA 4L85A 1JQDA 5FPQA 1QP8A 5DZSA 4OHCA 3V55A 1AN9A 1C3XA 4KXMA 4GKVA 4LTNA 3SHOA 3DKVA 4ZMBA 2ZR9A 2V0NA 2GEBA 4LY9A 3KYJB 4BLVA 2XVAA 3FJYA 4MLCA 4DLBA 1UPUA 2PLAA 3IAAA 3QJ5A 4G0VA 2D7JA 4W9NA 2Y4NA 4WHMA 5ICSA 2EKPA 4AW9A 4I1UA 5I4IA 1K7CA 2VAWA 2XWSA 1JMKC 3ISTA 2QM8A 4YS6A 5FBHA 4YAEA 4BMXA 3WDSA 2RCYA 5CB0A 1Y8ZA 4KACA 1E3WB 2VDWB 4JJEA 1YMVA 2IH2A 3AKEA 4B76A 2RGDA 2X42A 1PFYA 3LT2A 1ZQ1A 3PHHA 4O4IF 5GV8A 1Q7GA 3THRA 1IBMB 3O8RA 1EBFA 3LUFA 1IK4A 1U5BB 2I4MA 2NUPB 3W9SA 2VJOA 3JQCA 4H7HA 3RF6A 3L6CA 3WNQA 3ZVLA 4EJFA 5IX8A 1RC8A 4RCZA 2PUHA 1K8ZB 3T0FA 4L4XA 2GUWA 1N4AA 3ZQ4A 3FH0A 1SCUB 4IS2A 1R6TA 1RLOA 4N54A 4ZVSA 2ECOA 2C7BA 2IDMA 2QAGC 5LWHA 3PGVA 4NCAA 5EIOA 1EVQA 3ECAA 1IUNA 4ZQEA 5F77A 4H16A 3OUUA 2H0AA 5TXGA 1AS2A 5HWSA 3G6WA 3I76A 4H27A 4BTLA 5L3QB 2W6JA 1F2UB 5LXTF 3DBLB 1G21E 4YDHB 4KE7A 1C7RA 3UA4A 1QJ4A 2G77B 4YRZA 1PZGA 2OBMA 4N65A 3CLSD 1J1UA 1RTKA 2A1UB 4O25A 3W3ZB 4IDHA 5DRTA 3FKSA 4LWQA 2PUBA 1X9HA 3ETDA 1EGAA 3T5TA 3DXYA 3W78A 1N5JA 2ZE7A 5DASA 2HMSA 3IAXA 4C14A 2X0NA 4LJSA 4QL3A 3L4EA 4R8MA 3NATA 5AKHA 2ET6A 5E2IA 2PAAA 3X0DA 4YYEA 1JJBA 3DEHA 1U2ZA 2NNWB 5G4LA 3ADBA 1KZYC 4HPXB 3RUIA 2R11A 3JS5A 2V6IA 4ZVRA 3RDPA 2DLCX 3X1XA 4ZKDA 3WLPA 4OMUA 1F2VA 1BXRA 3R3HA 4F9TA 1RXYA 2BFAA 2FE1A 4O2AB 3JTEA 3K9WA 4MIYA 4TWJA 4TSKA 4C0SA 4DQUA 1Y6JA 2GBPA 4GGMX 3KYIB 3KD2A 1E7SA 1AB5A 3H9EO 4JITA 4IIEA 4DJEC 4D4MA 1FTYA 1Y5NA 3BGDA 3BREA 4IFTA 4MS3A 4NDAA 3G7NA 4DWJA 5FLEX 1WU7A 3ZCRA 1JDSA 4E5MA 1E62A 3JD1A 1Y3FE 1S9HA 3DV0A 4CG2A 5CMLA 5EJ7A 5MDHA 4OJKA 4NYMR 2FCRA 3SC2A 4EY6A 1IXSB 2ZIAA 1UJCA 4J0KA 4NG4A 2R5WA 1WY5A 3EQ6A 1NNI1 4N5IX 5AI4A 3CX4A 3U7JA 1SZJG 1O58A 4P36A 1NC3A 4PLZA 4MR9B 4Y1FA 1ZPDA 3T3GA 5JEDA 4UHJA 1G7CA 4HY3A 1YVPA 4LPKA 1I7SB 2I9KA 4I4LA 3H4IA 3MTAA 3BPSA 4PW0A 3HEBA 5C2JB 3D0KA 3BB4A 3JD4A 2O3RA 1P74A 1K75A 4FOTA 5JZVA 1J2RA 3GVIA 4IUDS 3OZFA 3UPDA 4HUQB 4KQ2A 1H3NA 5G0WA 3USZA 3U4MA 3GAAA 1R6AA 5DYNA 5C18A 4R9VA 2A7XA 1DKPA 4QNMA 3TTYA 1QQBA 1M6EX 4ARCA 1QHEA 1A8IA 3W9BA 5KDOA 3QBJA 4MS1A 1V1RB 3UMJA 4F0JA 3GH1A 4HEA1 5BVGA 1CB7A 4NCKA 3TRJA 1G3RA 1UJ2A 1JQ5A 2YJ5A 3A36A 2Y9PB 3I6YA 4DMRA 3C4QA 3UVEA 1CZRA 2PV7A 2F3UA 4V0KA 3T4XA 5IH7A 1KEKA 1DJMA 4KPGA 4MAMA 4NMLA 3FKQA 1QK5A 1D7AA 4MUNA 3GEIA 1DS6A 4Z8YA 2VRCA 4HN9A 4XGNA 5JXJA 5LYJB 2BF7A 2GDZA 2OFPA 2WIBA 3TTTA 1KMHA 4MVJA 3E3OA 3DLCA 1NURA 4G9EA 4N01A 1QPZA 4FX5A 1M1XB 1T0UA 5JVDB 5CA0B 3GGGA 1EFAA 1EB9A 4RK5A 1VPWA 5K3OA 2QG9A 4KZPA 1YVUA 1SUWA 3HPQA 3B1VA 4UM9D 5B3AA 3V8NA 3LSYA 3N8GA 1ND6A 1DZ3A 2GK3A 3O8DA 3QJGA 2OBFA 2Z43A 3EMVA 1VXRA 3Q0IA 5SY4A 2QIPA 2Z2KA 3KWLA 1L7MA 1W75A 4AMZA 5HVNA 2C5SA 2Q46A 2QZ9A 4OU5A 1N9ZA 1K3FA 5CA1A 3DMFA 2FSVC 1GRVA 1ZW6A 2J9FB 1KK0A 2GAAA 3A0RB 3ANNA 3EH1A 2D4HA 2H1SA 3IT0A 4HWSA 4V24A 1WVIA 4E4TA 4KH0A 3Q12A 3MWYW 4BMCA 1ZUD1 2RE8A 3LC2O 2BOVA 2GA9A 3LTNC 4HKTA 3LGAA 1YS9A 3EXEA 4XIFA 1FFAA 4B47A 1S96A 2GF0A 4B6JA 2PUCA 3ETCA 1ZH2A 2LCIA 2JVIA 1EP3B 3N0XA 1LU9A 4G0OA 3CH4B 4GWLA 4J0EA 4L5AA 3PXGA 4DLRA 1USVA 3WOHA 4QEKA 5GZ1A 2DTEA 1EK2A 2AR9A 2P1RA 3NNNA 2IBMA 3C5HA 3SP1A 3P9PA 1KO8A 4C4PA 1OLUA 1E6EA 1EFPB 1JFRA 1Z13A 4O4IB 4UUAA 3JASA 4LBZA 1WMBA 1NV9A 2FJPA 3RT1A 4D9HA 3FUXA 1Z37A 5C8YF 3ZJTA 4KRFA 1K3UB 2JNWA 2YICA 4Z4IA 4ZU1X 3PEYA 1DOHA 1Q83A 2R5FA 4ZQGA 5FUWA 4A27A 4WJLA 1E92A 1P1KA 5F3RA 4YXWD 1TKCA 3ZIUA 2AQHA 1KK1A 3BE6A 3LLUA 1JIVA 2DLDA 2O8EA 4N4AA 2DXIA 1Z2DA 5FPHA 1UBMS 2O4CA 3HUDA 4N0DA 3WWYA 4KGZA 3OPQA 3ZOZA 1VZ3A 4QGHA 1BYUA 4XVCA 5BW8A 3Q0EA 3EQ7A 1CR2A 3HCDA 4GRDA 4KK3A 1JDVA 5CU7A 3GT0A 3HDYA 5H7XA 1XRSB 2O2IA 4J9VA 5HM6A 2XCTB 1BMFD 1ZN8A 2K5UA 3PD0A 3L02A 4LYEA 2JIMA 4EG6A 4GP7A 2J5KA 1O0SA 4PAOA 1LF0A 3FVWA 4WLEA 3HJFA 2ACWA 1UWLA 4PLVA 5EGNA 2AIRA 2W70A 1JFLA 4Y2VA 4Q21A 5E38A 2XKAA 4AU1A 1E6KA 1HLPA 2ZYAA 3IA2A 2H29A 1BSVA 4PRYA 3CRRA 1UQTA 4QLOA 4TVBA 1YJAA 3OTIA 1Q15A 1XXHA 1T13A 4RMGA 2ZM5A 4W6ZA 3FRHA 4BNDB 4D56A 3V4SA 4WEQA 5BQOA 4MEBA 1EGHA 1USWA 3LUJA 1SB8A 1OJ7A 1GZ6A 2KLHA 4R8KA 5I45A 1SMKA 1DC6A 4YRRA 2ILTA 2BAGA 1PWHA 3DFUA 3GVHA 3M3HA 2GPSA 3K1AB 4TV9B 4N0QA 4DCUA 4GKKB 1ZM7A 3Q5EA 2H63A 3U7QB 4A10A 2IH5A 3PRKE 4CM8A 1Y9DA 1YR8A 1C14A 1OZGA 4NQZA 5EESA 1P2DA 2Y2UA 5AH0A 4PO3X 5F12A 1EXMA 4MUGA 1CV2A 1KBOA 5FPYA 4Z1OA 4Z54A 4ZI3A 5G1OA 1O8CA 3B1YA 4JUAA 5GM1A 4KFCA 5IKOA 4Q48A 4X45A 5EE9A 3W06A 4E51A 3K1YA 4O4LB 1HKHA 1OI4A 4LXIA 2PZAA 3RVPA 1TYEB 4CTMA 1IXRC 1XEXA 2ZYHA 1L1FA 1G20A 1UMBA 4RW0A 3TZHA 4M0UA 1FP7A 2XUIA 1YWGO 3SX0A 1UJMA 1FFDA 3NBFA 1Y6ZA 3W79A 1FL9A 1B26A 1MXHA 1N5IA 2ZTHA 5LR6A 1ECLA 2R7LA 2ZJYA 3UWOA 3BEDA 4QIHA 3ZHUA 5LU9A 5LKAA 3TCNA 1CS0A 4V2IA 4BU1A 1GKKA 1ORWA 2C8LA 1D0SA 4KLRA 1ZMRA 4YI3A 2GN8A 3A11A 5JZOA 2PUVA 4WVFA 4ZMRA 1M8JA 2PUGA 5JCJA 2OXTA 1X80A 2A7QA 4XYMA 1ISFA 1VLVA 221PA 3FNBA 3ZXUB 1II0A 3L7LA 2PAFA 2QT1A 4P4NA 1RRKA 4H7IA 3RAGA 3VNUA 4AIRA 1LBQA 2V7PA 3K0BA 3GPLA 1TIPA 2VZEA 2PEYA 1H85A 3FRIA 1XPUA 1L4BA 3B5JA 1EX9A 1IBCA 2QLMA 3LXUX 1Z88A 4GI5A 3V46A 3ZH9B 2RGGA 1AKRA 1NT4A 3JAWA 3NR2A 1BDHA 3L7CA 3KL4A 1U63A 2D3TA 1I14A 2P9YA 3BD6A 3BGSA 4BFVA 2O8EB 4D8UA 3CVUA 4F2WA 3E1SA 5E3IA 4O59O 4ZYYA 2A94A 2EZ8A 3L7IA 1KEEA 3GPDG 2VJKA 4MWBA 3ZZMA 3PXAA 3HCNA 2CDBA 3ZE1B 5JSQA 1PS0A 3P9NA 4FLEA 1T35A 3UWKA 3U44A 4EI9A 1NBMA 5JSFA 4FI3C 1SURA 2DFTA 3BEOA 3Q1KA 1XDGA 2VP2A 2Z08A 3VHXB 1NNEA 1BQ4A 4UDXX 3S27A 1NA5A 3DSRA 1MOPA 1YJ5A 3H65A 3SIRA 1SK8A 4AMGA 5FAXA 2YJGA 2GBIA 2WICA 1K97A 3I3OA 4FINA 1GY8A 4LJ8A 1MR3F 2G1PA 1V9SA 3IJPA 3WTCA 1KZ4A 3CGGA 3O8OA 1PKXA 4WCFC 1AX9A 1WW8A 1Q0UA 1RAHA 3HJHA 1OBCA 3OCZA 3AGQA 1JPVA 1O5IA 1G63A 5DLPA 2YV3A 1GAWA 3ENKA 5LQDA 3QEBZ 1FXUA 1M0TA 4OA8A 1ZW1A 2GN1A 3BC1A 4K1XA 3OCWA 4KQKA 6ADHA 4WJZA 4ZK2A 5JU6A 2BEWA 4KYVA 4WKCA 1ZD1A 1U1EA 4IXDA 2Y77A 3HFSA 4NATA 4QUHA 4FWTA 4BQSA 3UC5A 1Q0TA 4TKZA 1E59A 1T8SA 3A1FA 4DW8A 1PQWA 4EBBA 4M55A 1E18A 1PJ4A 3KYBA 3FYSA 1L5WA 3RVKA 1MX5A 4LWZA 1GPJA 3N2ZB 5DNAA 3DB1A 3EEYA 3WGIA 4TUYB 4DMGA 3RU9A 2YR0A 2OR3A 5F23A 4B3MB 2P3QA 1XJ0A 3JCZA 3S2YA 4F45A 4ZALA 2FPOA 2G83A 3OJWA 1AF4A 3KCQA 2JCYA 1NR1A 3W2FA 3IFSA 4CE6A 1SHZA 3AEKA 1PJZA 3I9FA 2OCGA 3ANXA 2ZBFA 4JK3A 4ZJZA 2QN7A 2O8VA 1X80B 1UH5A 5CXSA 4BJ1A 1KMHB 2TMDA 4TWBA 2W6OA 3R0XA 4KHZA 4HFNA 1QQAA 3ZDEA 4FMCF 2OXFA 3M6MD 1I6LA 3IALA 4J0JA 4IQ0A 5C31A 3OLZA 2EL9A 2ZIGA 2WF9A 4OHXA 3DE2X 3PNOA 4H4DA 3PUIA 4L07A 1J2EA 1L8AA 2GO1A 1DVRA 2FSPA 1F51E 2DFDA 2OPHA 1QGYA 2NTVA 3GZJA 4EY8A 5KWIA 1HDIA 2VDOB 1JZSA 3AIOA 3O21A 3UAVA 1QHHB 1D2EA 4GYYA 2AD1A 1QFYA 2PZ8A 3C97A 2CHUA 3UO8B 3DB2A 4K9KA 2NUTB 2AW5A 1M76A 4HDMB 4OLFA 2FZ4A 3FWZA 1XVUA 1AO0A 1BVHA 2OB1A 3O94A 5ARDA 5ILGA 4FSXA 1Y4ZA 2YQ5A 3UA3A 4ITVA 4HUQA 4OY3A 1X8XA 5BNZA 5I5GA 1M9NA 3TK1A 3UMRA 1N8TA 3UANA 3IJ5A 4UEWA 4WWHA 2IS4A 1RAAA 2JGIA 3JARB 4ALNA 1QIKA 5KS2A 3L7MA 1SUFA 5DTRA 2ZYWX 1IM8A 3FZQA 4HGZA 3UOAB 2GEVA 3U49A 2PXHA 4QRIA 5LC1A 1XIVA 1YK0A 4QUJA 4BBAA 4C4TA 2XGOA 4Q7JB 3NLLA 2Z9DA 5L45A 3AW8A 1HT1E 1GSAA 5BV1A 3PI7A 3B60A 5E9JA 2PWZA 4X94A 4JBHA 1W85B 2V5AA 5G1PA 3FFAA 3HJTA 1HO3A 4C21A 2IELA 2NU6A 4YTEA 3A2NA 3L6RA 4YP0A 4D9CA 1JPUA 4ZEWA 3G2PA 3GC6A 3H5RA 3FDIA 3DDSA 4O4HA 5KWJA 3TMKA 4RH0A 5C51B 1R00A 1RP7A 4IJWA 1EP9A 1YVRA 1QAMA 2GK7A 4LC1A 4TTPA 1UJ4A 3TKYA 3VTZA 5I7RA 3IQZA 1REQA 3EPKA 4ZC8A 3EIUA 3WYCA 4I6EA 4YXFA 4GVLA 1JKMA 5JWRA 5CUQA 4HDNB 3FTDA 4W1QA 4WK4B 4KWHA 5JH7F 5FA5A 6NULA 2G5TA 4J16C 1SHKA 2OGZA 3COVA 4ND2A 4Q3BA 1BA2A 1OA0A 4TXNA 2GCIA 1XZPA 2YCBA 1VBNA 4HQ6A 1SUCA 1TZCA 3D4LA 2AOTA