1L5SA

Human liver glycogen phosphorylase complexed with uric acid, n-acetyl-beta-d-glucopyranosylamine, and cp-403,700
Total Genus 336
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
336
sequence length
810
structure length
793
Chain Sequence
ENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPNDDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKASKFVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glycogen phosphorylase, liver form
publication title Structure-activity analysis of the purine binding site of human liver glycogen phosphorylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 336
structure length 793
sequence length 810
chains with identical sequence B
ec nomenclature ec 2.4.1.1: Glycogen phosphorylase.
pdb deposition date 2002-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00343 Phosphorylase Carbohydrate phosphorylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1l5sA02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1l5sA01
1GG8A 2HY7A 3L01A 5GPBA 4CTOA 1WW3A 1RZUA 5HXAA 4KQ2A 3NPAA 3UYKA 3ZCSA 1XV5A 3Q3HA 3BDAA 1JEJA 3D1JA 2GT1A 5LQDA 3G2NA 1GPAA 3OKAA 1B4DA 4L22A 4RIEA 3MRXA 3IAAA 1L6IA 2C1XA 2R66A 3E3NA 3QKWA 1AXRA 3BCSA 1XL0A 2X6QA 2F3SA 2FETA 4WHMA 1FU8A 1GZ5A 1BX3A 4AMGA 5DU2A 3C48A 4GYYA 2C9ZA 2P6PA 3NC4A 3HBFA 4GYWA 4BQEA 4RELA 1UQTA 2ACWA 4G2TA 1C50A 2IW1A 3GPBA 3WADA 2VCHA 3MRTA 4EKYA 3BCUA 3S29A 1XC7A 3ZCRA 3HBNA 2VG8A 2SKDA 1PYGA 3RHZA 3OT5A 3BCRA 1KTIA 3L7CA 4XI9A 3ZCPA 2BGUA 4EL0A 1V4VA 4GZ5A 3AMVA 4RENA 3T7DA 3MRVA 6GPBA 3WAGA 4YUAA 1AHPA 3SYMA 3CV3A 3NP9A 3ZCVA 3S2UA 4AY5A 3S0JA 5D01A 2BISA 3C4QA 2QLLA 3QHPA 4F96A 1FU4A 3E3LA 4X6LA 3NCHA 4GZ3A 2ECPA 5TMEA 2QN7A 1FS4A 4AN4A 1SXPA 2XGOA 1Y8ZA 2XMPA 3D0QA 3G2KA 1FU7A 2ATIA 3S28A 7GPBA 3SYRA 3TOVA 1ABBA 1P4JA 3MTAA 3S27A 2KS6A 1UQUA 3VDMA 3NAZA 3COPA 3OKCA 8GPBA 3VUFA 4MRAA 4FKZA 1EM6A 2QN8A 3G2IA 4F9FA 2GJ4A 1H5UA 3VUEA 4RBNA 4CTNA 4W6QA 3MTDA 2QN9A 4KQ1A 1NOJA 9GPBA 3IA7A 4HWGA 2ACVA 2QRPA 3NP7A 4N39A 2XA9A 2IUYA 5TVGA 3T3DA 3T3HA 2QZSA 1L5SA 3CEMA 1L5RA 4FZRA 1JIXA 4GZ6A 1A8IA 1NLMA 4EL5A 5JTTA 1NOKA 4PQGA 3EBPA 1P2GA 1UZUA 2FFRA 2IV7A 1C8LA 2PQ6A 1QKJA 2GPBA 1K06A 4NESA 4BQIA 2G9RA 3H4IA 3G2LA 2XA1A 3MTBA 3MT7A 5BNWA 3VDNB 1F0KA 1YA6A 1JIVA 2R60A 1JG7A 4REMA 4MHSA 4KQMA 2BGTA 3T5TA 1Y6FA 3OTGA 2O6LA 2IEIA 3Q3IA 2GPNA 2QLNA 3DDWA 3FROA 4RIHA 1IXYA 3UYLA 2X6RA 1Z62A 5D00A 4HLNA 1Z6PA 2SKCA 4MICA 3EBOA 3NB0A 1E1YA 4AMBA 3L7AA 2VSNA 4X7PA 3BEOA 1C3JA 3DDSA 3MT8A 4BQFA 3PE4A 2F9FA 2QN2A 2IV3A 4MI6A 2X0DA 1L7XA 2JJMA 1FC0A 3MSCA 2AZDA 3DD1A 3PE3A 2G9QA 3TSAA 5TMDA 4NEQA 1K08A 2AMVA 2QRHA 2F3QA 2XCUA 3RSZA 1Z6QA 2OFFA 2H1FA 1M5RA 5ENZA 3MQFA 5DXFA 2VSYA 2G9VA 4YI5A 4N3BA 3BD8A 1RRVA 5TMBA 3RT1A 2GPAA 3BD6A 2AV6A 1JIUA 4LEIA 3D0RA 1RZVA 1EXVA 4M60A 2SKEA 1SXQA 3CUTA 2FF5A 2PYIA 1FA9A 4RIIA 2PRIA 2XGMA 1WV0A 4N3CA 1Z8DA 1P4GA 1JG6A 2F3UA 2ASVA 4N3AA 4F97A 1L5QA 2JZCA 2PRJA 2R68A 2BFWA 3MS4A 1NZFA 1XKXA 4CTMA 1P29A 3CEHA 3L7BA 2X0FA 4EKEA 3OTIA 3H4TA 3CUUA 4RIGA 4CDRA 4Z5XA 1WW2A 1XOIA 2IYAA 3Q3EA 4BFCA 1GGNA 1NVKA 1NOIA 1FTWA 2Q6VA 2X0EA 3GUHA 4MI9A 2F3PA 1VGVA 4EJ2A 3T3EA 2QRMA 1IIRA 1HLFA 3OY7A 2XGSA 1FTQA 3G2JA 2GEKA 2XCIA 3CUVA 2G9UA 1PNVA 2IEGA 4MI3A 1WV1A 2JLBA 3CUWA 1WUTA 1GPYA 1P4HA 3OY2A 1E4OA 1LWNA 4RIFA 1F6DA 4MHOA 3T3IA 5C1DA 2GM9A 1FTYA 3G2HA 2QN3A 3MS2A 5IKOA 2PYDA 1Y6GA 1PSWA 2GEJA 3HBJA 3OTHA 3ZCUA 5JTUA 1L5VA 4WADA 3L7DA 4M7PA 3CX4A 3RSCA 4X7MA 4QLBA 4NC9A 2R4TA 1YGPA 2AW3A 3T3GA 1GFZA 3HBMA 2C1ZA 2QRGA 3TAXA 2WTXA 3WC4A 2QRQA 1P2DA 3CUYA 1LWOA 2R4UA 4LDPA 2XA2A 4AY6A 3DZCA 1O6CA 3ZCTA 1P2BA 4M83A 3MT9A 1PN3A 3L79A 2QLMA 3MS7A 4WACA 5IKPA 4N9WA 4X7RA 3C4VA 2QN1A 4YI3A 3CEJA 2YJNA 4XIFA 3ZCQA 1WUYA 1NZDA 2IYFA 2ZB2A 1J39A 5I45A 3E3OA 2VCEA 3MBOA 5DLDA 1XL1A 1L5WA 2C4MA 3OKPA 2H1HA 1QM5A 3BD7A 1GPBA 2QNBA 1C8KA 4GPBA 3O3CA
chains in the Genus database with same CATH superfamily
5BVHB 1TX4B 3DHWC 3FGOA 1C1YA 1DAOA 2H06A 3JR3A 4MWDA 2E4UA 3I0ZA 4TT8A 4W5RA 3IPCA 5DP2A 1HF3A 1T9DA 4FNGA 1YZQA 4CMGA 3MQ2A 1MOPA 1WNFA 3N74A 1ILWA 3DAGA 3FCAA 3LIIA 4RPHA 1Z4LA 4LDQA 4XGRA 5IBQA 3TTTA 2J3EA 3OEHD 2ZYHA 4MUMA 3IKJA 5KNBH 2C5LA 3IP6A 4N9QA 3Q3HA 3O6VA 2JGFA 3IAS6 2A1TS 1IHPA 3KVNA 5I9IA 4WFKA 1S7CA 4A6XA 2XYHA 4XYLA 4HLUA 4OBWA 3IEIA 3HZRA 1DHTA 1N5IA 4G1FA 3MNFA 4O0MA 3QMPA 1SVUA 1BKDR 4Q4HB 4JI1B 3UMGA 4MLDA 4P93A 3TEFA 5BN4A 1EUCB 1X74A 3GEMA 4MGIR 1E7QA 2OEPA 1BMFD 1NNI1 1T2CA 1RTTA 2E87A 4DDHA 1M0WA 2RD2A 2DLDA 3PGVA 2EFEB 4MMZB 1FDSA 3CW8X 3MJRA 3Q5DA 3RK4A 3GMSA 2J32A 5JXIA 3K8QA 3T9DA 5KO2A 2WUDA 3BJRA 3GD5A 3JTMA 3FRHA 1MVOA 3SQMA 4O33A 5BQFA 3GLGE 3GNSA 2BMEA 4L3OA 4S2EA 4K46A 4NMHA 1RWMA 5AM1A 5ALGA 5ERXA 1VPWA 4JP3A 2WW8A 1ZGJA 1PZGA 3ANXA 3F4LA 4O4IF 4DHWA 5HUQA 4AQYB 1A2BA 3ANLA 3RIHA 3HFGA 5DCUA 5IJZA 2H2GA 4AC9A 2VAWA 2ZWIA 2ZYVX 1YI0A 4D8UA 3NC4A 1QP0A 5JMTA 4FEEA 1VECA 4EDHA 1RJGA 2YS7A 3RU3A 2ACWA 4JEIA 5JWRA 4W1RA 4IJ6A 1PR2A 1DXOA 4N12A 4WXMA 5DGIA 3V8NA 4R71A 2VNJA 4GWLA 2I2WA 2UYCA 3VPBA 2OC4A 3O9VA 3P9IA 2XT9A 4DNPA 4YGYA 1UXHA 5IZ4A 1NMXA 3FGNA 4PVDA 3LQFA 3CH4B 4Q66C 3B20A 2VJKA 3NZEA 3MGKA 4KO8A 4M8SA 3UT5A 1YH3A 1NW6A 1TYCA 1EA7A 1E8NA 1NY6A 1LPPA 1O94D 2ID8A 4DCGA 5C8YA 2E5FA 2COEA 3K0FB 4JA2A 3SNKA 4IEFB 4PSKA 4NG4A 3SC6A 5CCBA 3DWFA 3IPRA 3EDMA 1R6XA 1FXUA 2Q4DA 2ZATA 3DW3X 3I62A 3BCRA 3FKJA 3EQ2A 4LVCA 4IDBA 1E7SA 2WT8A 4FE3A 2H4YA 4XOIA 1KTIA 2YDYA 2VAVA 3TKAA 3UICA 2HLNA 5ADVA 2FSUA 4EARA 2HA5A 1ZZGA 2QNIA 2ZWOA 3AMVA 4NJOA 4FP9A 2CEAA 2ID9A 2VHCA 4NY1A 1USIA 1UAGA 1ZYUA 3H5IA 4HKTA 2F8SA 4TMZA 3F90A 5IKXA 3D1VA 4I1OA 4LN1A 4I5FA 4KGVA 1UBRS 1I4TD 1B76A 3FYTA 1KY3A 3GO4A 2WWTA 4E6EA 1H23A 3PU6A 5ICFA 4CIVA 3E7DA 3ILYA 3HL0A 4AY5A 4GBGA 3IIEA 3TL3A 4QBFA 5HJ7A 2O7VA 2BISA 1RE0A 1Z75A 3ZV5A 4MQUA 1EB8A 1JHYA 5ALOA 3SNHA 4K2AA 3QHPA 3TLCA 4E5UA 3SC4A 2EG9A 1X13A 1FU4A 1R15A 1YRLA 3CFYA 3S2YA 3U62A 2RGNC 3O5AA 3QOYA 4UE3S 3T0GA 3TSZA 4X6LA 3H0EA 1COWD 4YALA 3VR1A 4R51A 2I4NA 1PFGA 2KMLA 2V45A 3IHKA 3UUGA 3PBKA 4X66B 3ORSA 1RLUA 2OLKA 4RKQA 4TXHA 2I1QA 1Z7WA 3KLBA 1S3IA 1OAKA 2GEUA 3PNKA 4QG7A 4R41A 1ZITA 4ZO4A 1N4AA 5KYXB 4FCCA 1GG5A 2JVIA 1I2ZA 4CYMA 1U8FO 5EESA 4ARBA 4XSVA 1I2DA 3ESQA 4IZIA 2ID7A 2W42A 2ATIA 1HWYA 2BHSA 1N6PA 3MAAC 4YREA 4ID9A 3ZVMA 4AJ4A 4L27A 2GVZC 7GPBA 4HRVA 3V00A 2JCBA 2FSHA 3ICPA 3UT6A 2JFGA 7AT1A 1KZ4A 1O5OA 2PY6A 4GZMA 2WLSA 1Z83A 2EZ8A 3Q2IA 4W82A 1XAJA 3AF2A 5REQA 3VTAA 5LXTB 5CXXA 3NAZA 1JHXA 1QJCA 1W94A 1XZPA 4OKNA 4W8GA 4G56A 3UJ6A 3AOEC 1L4MA 3KQNA 4B6GA 3KDPA 1L1FA 5AVUA 3IEPA 4FSDA 4OQZA 4J0CA 1CHNA 4KRGA 3RIMA 4DKXA 4DMKA 2AJBA 5H7XA 3CTMA 3V80A 1DAIA 3F6PA 3DMRA 4D0NA 2ZRHA 1GITA 2QJWA 3E15A 1U9ZA 1SOMA 1U3VA 4TKLA 3ZDAA 1QYRA 1TKAA 4YASA 1H6CA 5IT4A 1CUUA 1ZI6A 5T8KC 5DSXA 4DFDA 3AVTA 2Z6QA 3D2AA 3OH8A 1ISPA 4YAFA 2G1UA 3KV1A 1CSEE 2NO7A 1HETA 3ASZA 3LK7A 2OV2A 1CUGA 1JL3A 2A6PA 2EJBA 4BRWA 4E33A 2WHYA 4CMEC 3OIFA 2Q3LA 3UZUA 5ITSA 3RE1A 2C8KA 1GUAA 2AC7A 2O7QA 1VLQA 3L05A 4WZ6A 2IPLA 2J5BA 1T5BA 3REGA 4O5OA 4HVCA 4M0KA 2XF8A 1IZ9A 1KK0A 4B6PA 4B45A 5E3IA 2FDRA 2D6FA 5J58A 3UJ8A 4OLHA 1XEXA 5ALEA 4C6TB 1C2TA 2BJWA 2JHGA 1WB6A 3TX6A 1N2CE 3IAHA 4QC2A 1EWYA 1OWPA 5AJYA 4XM2A 4PQGA 4XVRA 1FPMA 2GBIA 4U7DA 1XQXA 3UUFA 4MKGA 5IK2A 3ETLA 1J22A 4ZVMA 3LYLA 1B6GA 1CP3A 1Q0SA 1UFKA 2CXOA 2OB2A 3IOEA 1R7RA 4D57A 1SA0A 4R8MA 4OD0A 3H18A 4OEHA 2G6BA 4YQZA 3LFUA 1ACLA 1WPGA 5DM1A 1XTQA 1GUFA 1RI1A 1WDWB 3GFSA 1HZJA 1L5YA 2K87A 3MT7A 4KIUA 4PIVA 4DBVO 3E7XA 3PUZA 1R0ZA 3IDZA 2V6FA 4PZAA 3L8YA 4P33A 3SXPA 4ADSG 5JFOA 5GONB 2LIVA 1ZUNA 4KUHA 1AGRA 4UDOA 3C7AA 3GYGA 5K6AA 5D8DA 1XZDA 5D85A 3U1VA 4BQPA 4D4KA 1I6LA 1GCUA 1MUUA 1R4MB 4IQGA 2AHRA 4YACA 4Q3EA 3U4GA 2GAFA 2R87A 2FY8A 4LRSB 4MV8A 3LPNA 3NJ8A 1IXYA 3UYLA 1NBMA 4HPWA 3ON5A 5JARA 1AKVA 1L8QA 2DKNA 4DJFC 5A6VA 4HGZA 3CY6A 4MQEB 3FPSA 4U2EA 1W6UA 2J33A 2PS3A 3VMMA 3P0EA 4OJKA 3HZZA 3FPFA 1GXSB 4UFNA 1XCBA 3DDSA 3L92A 2XZLA 1PWEA 4FUTA 5DP1A 1M6VA 2DTDA 1CIJA 2WDPA 1ZH6A 4HWOA 2BTQA 5CFPA 2YOFA 4J03A 2XMSA 3G8BA 1SEPA 3M49A 3BRSA 4B0PA 2HZ7A 4Q37A 2GHQA 2ZKLA 1X94A 3SXUA 4EZIA 4NCAA 2AR9A 3ZNOA 1KHHA 4KXMA 1UZAA 1VIVA 3HLTA 1ESNA 4W6ZA 2YVLA 3OT4A 2QM7A 2X3UA 3OQIB 2BD0A 2BFEA 3DNFA 3H2ZA 4OQNA 4L9AA 2EKLA 5L3QB 2D54A 2BGGA 1SUIA 3E53A 3QPUA 3CRZA 3JRNA 3DTTA 4IIFA 2DFLA 3KUXA 2HU8A 4Y1GA 1IY0A 2PJZA 2OHIA 3VO1A 1FYXA 2EDAA 2ZJOA 1DRJA 3HDGA 2ZSAA 3WGLA 1ZHOA 2G72A 3MXTA 4P4LA 1CY1A 1Z12A 4RF2A 2JGDB 2H0RA 4S0ZA 4P81A 4BVGA 3L7OA 4EPXA 4RD4A 1Q1QA 4FSHA 4JHLA 3CW9A 1QG2A 4UU8A 3U4QB 2DGDA 1YJCA 2A0KA 3AJAA 3FPGA 3GEBA 3RKUA 4HEHA 3V1YA 1L5NA 4E31A 3W3ZB 2ECQA 5FT9A 1BXRB 1FL9A 3PC8C 3MJFA 3EGDB 4RK5A 5JD5A 1BTOA 1QQ6A 4FX5A 3WYFA 1NL3A 4E6PA 4C7OA 1W88B 3WNVA 3TLBA 2HU5A 3PUHA 3CUTA 2PV0A 4O2AF 3UMYA 1M74A 1VCNA 3UUWA 4LBVA 1O0BA 1IEWA 2D00A 4ML3A 5CX4A 1Y63A 1OXSC 3AHDA 3EWIA 4NYMQ 3AUKA 4GR9A 4LDRA 1BCRB 2P79A 1YZTA 2QR5A 1ARZA 3DF7A 4OKSA 1IQRA 4TV9F 1FFSA 3DO6A 4DUGD 2CJPA 4GPD1 4UE6A 1NVDA 2BFFB 4OK5A 1RD4A 1GQFA 3B78A 4MUJA 3T06B 5INTA 2BUCA 1RPNA 4N6NA 4NU5A 4CI9A 1U9JA 4ND4A 1V7PC 3KQWA 2F8TA 4QJ3A 1V7CA 2ODEA 1KU0A 2A0YA 5CLQA 1XP5A 2L2QA 4TSKA 3KTOA 3QE3A 5HIMA 5KVQA 5EMKA 3U7EB 3I5MA 2VBFA 5LBUA 3UJNA 4N6GA 1NVBA 3EC7A 1KZ1A 1OC2A 1H0KA 1SIBE 1YZYA 3QV2A 3DWIA 3SLKA 1JMVA 3PHLA 1L7AA 2Z9DA 1X1DA 3OSUA 1MIHA 1NV9A 3OE5A 4HFNA 3CO0S 1ESDA 1TIKA 2JHFA 2ZDGA 4OK3A 1L9KA 2Y6VA 5JJ5A 4GBMA 2WHXA 4DRYA 3VR5D 3PT9A 1HT2E 5JYEA 2C8JA 1G21A 1VMEA 1NJSA 1RPTA 2JASA 4M99A 1CY4A 1BDJA 3CLVA 3ES9A 2WZCA 4H1VA 4OFZA 4OJNA 4WLOA 5ALMA 1YTUA 5MGNA 3H4MA 3E9CA 4ABTA 2BYTA 3ZZMA 1B43A 1EX1A 2EFCB 4D46A 3C3EA 4N48A 5BV0A 3AR9A 3PENA 3HCNA 3K94A 1NRIA 1NYRA 1CY0A 4EEXA 5JANA 1FLNA 3JR7A 1ULTA 2JGKA 1IZZA 2Z4TA 5K0TA 3AB8A 1KORA 3D3QA 2XOEA 2XQKA 1MB0A 2GN6A 2QMOA 3IFSA 1JT2A 4J0JA 2R8ZA 3ZZ1A 3BREA 2OZVA 4JEHA 4L85A 2AXNA 5DTJA 2FKAA 2O05A 4KDFA 1NT4A 3SC2A 3ZWWA 4ENVA 3UGJA 1N32B 5ICSA 4UOQA 1LWNA 2QMQA 5AHOA 4UAGA 2G1PA 2UVQA 1PEAA 1QVVA 3NHWA 4RXTA 3CF2A 4DLYA 1MT0A 4DVGA 2FZVA 4C5CA 2E55A 3FZYA 3ILVA 1RXSA 5FA8A 5B36A 5AJTA 3ZHQA 3HH8A 3PQ7A 1G3UA 4FGUA 2VJMB 1I10A 1R9JA 3WMWA 4A36A 1CZNA 4C2BA 3A58B 3T3OA 1Y80A 3EVNA 1E2MA 3B53X 2VZ9A 3WGJA 2ODNA 4ZWNA 1COZA 2XIJA 3BJZA 3D2CA 1U5CA 4OXQA 1E2UA 2B82A 3DE5X 2HPHA 4ND5A 4NC9A 4OLAA 3WWEA 4E2FA 4EVSA 1QZUA 2QD3A 5BNTA 2SICE 2QI9C 3UFXB 2WD9A 2FR1A 3FNRA 1K5PA 2GCIA 3T3GA 3I2FA 1GFZA 3A3NA 4OJQA 3NANA 1TJPB 3P9KA 3KELA 4ZV4A 1XYVA 2NTYC 4YONB 1IUOA 1LPBB 3V6LA 2NYRA 4DIKA 3D5TA 3SXJA 2PLFA 4G5RA 5K8TA 1AS3A 3DVLA 3FHOA 5KWJA 1BW9B 2QK4A 1XZNA 2P6OA 1FFWA 2ZSKA 1WXXA 1Z7GA 4OAOA 5HFNA 2K6GA 3C7TA 1AK9A 2WJVA 3TMKA 4OUDA 3G89A 1QYDA 4HDOB 5AXDA 1SIOA 1UJMA 3U4IA 3K1TA 4HZGA 3USZA 2GCOB 3VBCA 3ZV6A 4KWEA 2WM8A 3NVAA 3IESA 3BTUA 3H6KA 3LHKA 3CN9A 4D92A 5EPOA 4DIOA 3DFZA 3IQEA 5KYNA 1MC5A 3O4RA 4UTXA 1V3VA 2X9NA 2M1XA 1RLIA 4GMHA 2HCRA 3H97A 4R40A 3UGQA 1LPAB 4G01B 2DERA 1T3HA 3X1MA 1Z73A 3ZOKA 1N6LA 2CZQA 3JZAA 1KY2A 3PC6A 3UMJA 5DHPA 4IH1A 2IEZA 1MF7A 1NATA 2LCFA 4PPNA 3KR9A 1FW8A 2OXFA 4XIFA 2FPPA 3GNQA 2QTLA 5TJHA 2YYAA 2G4CA 3O9MA 3RO7A 1E3WA 5F51A 1RJWA 3WGHA 3GC6A 2CYBA 5FPYA 4B17A 5JV5A 3AXSA 3C16C 2HB6A 3B6EA 1OVGA 3LI2A 2X9VA 3FPCA 4Z86A 2VK1A 3FMVA 1KXZA 2X41A 2PZEA 4ARUA 4JI2B 1P81A 5JCJA 1I3CA 1D2EA 1LU9A 4MGZR 3RGGA 4J1TC 4EI8A 2BL4A 3DTYA 3DYIA 4IOLA 4NMMA 1IXSB 1Z4QA 2IS6A 2QLFA 3VR3D 2XUOA 1EP1B 3Q5EA 5AQ1A 5LQMA 2IEDA 2FPUA 5C1OA 1CZKA 2HWWA 4F93B 1BWSA 1VE7A 3FIJA 4OU4A 3N05A 1PZEA 4UTZA 4MKXA 5E1MA 4BKOA 2RE8A 4FWTA 4DDWA 2JD2A 3AX6A 3OPYI 5EHGA 3SEAA 1EFVB 5DNCA 3R8FA 4GYJA 2R97A 1Y1LA 2DF8A 4OMUA 1A4RA 1P72A 1V8FA 3F6CA 3I9FA 1GRVA 5A9SA 3P2OA 5G41A 4EW2A 3THXA 3F46A 3KUUA 4JUIA 4U7HA 2ZU6A 1DAKA 4FJ0A 4Y9SA 1PJ2A 2HSZA 2JI6A 3D1JA 4ERNA 3ADDA 1JHZA 2D0PB 2VH1A 4FE7A 3TZKA 1X7YA 4J4HA 1JP7A 4FD3A 2P78A 1QGUA 4INZA 5DWVA 4YUZA 4FCTA 1P9LA 4QT0A 4QE3A 1SAYA 1OWOA 2OM6A 3BXEA 3I6BA 5FKJA 1Z4NA 1WUJS 1CIPA 1JHOA 1ZAKA 4ZCQA 1J2UA 3X2FA 2BM0A 2FR8C 1NBME 5FB3A 4KITB 2HQRA 5J4VA 4N41A 3THSA 1RRFA 3IPXA 3QKWA 1PJ4A 4HNRA 1DBIA 2ZPUA 2VF8A 4ON9A 3FVTA 1D09A 2RHGB 3RSHA 5JAIA 2X6QA 3UENA 5ECWA 5IC5A 4LMBA 3WLJA 5CDYA 2IXGA 1AG9A 3OEYA 4UBMA 3CVWA 1QDUA 2B20A 1SCAA 3UH1A 3IOBA 4YMVA 2PS0A 3A0UA 5JASA 2R6HA 1THZA 2C9CA 4YDHB 1V1JA 1T8YA 2FHPA 3G0GA 5BSRA 3EPHA 3STUA 3BH7A 2ZKIA 4WE3A 5HDBB 1J0AA 4X61A 4YV1A 1GJRA 3L6CA 3NIFB 6YASA 5J2UF 3ECCA 1QRSA 3T38A 2WKPA 1ZK2A 2I3DA 4F46A 3AT1A 1UMCA 3WZLA 2I4RA 1HYGA 1K4KA 3GPBA 1S5PA 1OT5A 3PFGA 1JDUA 4YQFA 1JU4A 4X6UA 3RS7A 4EY3A 2H48A 3VH2A 1ADGA 3PQ4A 3UGTA 1XYYA 3QHAA 4KR7A 2DPHA 1OY1A 4UZSA 3V33A 3ONEA 3M6IA 2GS9A 3P9CA 2WFLB 5IC6A 3ZCRA 1EDEA 4OHUA 1ZLYA 4Q9DA 5LQKA 4BX0A 1UM9B 1GEEA 1YA4A 1YO6A 4HDNB 4Q7LA 2I6FA 4IZ6A 2W22A 4X1IA 4EX6A 3IBFA 5EKSA 4EHKA 3F7MA 2W37A 1FFHA 3CHYA 3IVRA 3R1IA 4H6PA 5HM6A 1E3QA 2ZYWX 3UT0A 3MWYW 3EXFB 2WRZA 1R9MA 5IDXA 3WO1A 1HDZA 1GILA 2ZSDA 2F00A 3H11B 3HZHA 5B1HA 5CM2Z 5FTNA 5J40A 1NBHA 2P6MA 4M1ZA 3UXHA 4H7KA 3VH3A 1DDIA 3ABRB 1WLYA 4YRIA 4MRMB 2IHNA 2XMZA 4B1FA 1S2OA 1EINA 1RSZA 5DRYA 2LP4Y 4NYIR 2B0CA 3L07A 2QY9A 2EIXA 4ATNA 5CVJA 4IZOA 4R1TA 1JMKC 2GCNA 3VNAA 2P3LA 5TGDA 1RWKA 4INAA 1VKOA 3ZW8A 5DX0A 4CU2A 5LYJB 4WBNA 5C7IO 4Q02A 3ASVA 3G82C 3HR4A 3W0LB 4LF5B 2UXBB 2YW2A 3IDSA 4HMOA 3G7SA 1XZMA 2GN4A 4XWWA 1UC4B 3EY4A 3PX2A 5LNK6 3EK2A 2HJRA 1BJRE 1DEKA 1E3DA 3FI0A 1ISGA 4J8PA 2VT3A 2VHJA 2JBHA 2EFGA 5DHSA 2BCGY 3WYEA 4IINA 2PLAA 3DV0B 4KQKA 3DS8A 2VDUE 2C97A 1CUDA 4HTAA 3HCOA 4O6VA 4CCSA 2XR1A 1ZJZA 5E3JA 3AVWA 1UPXA 3EDYA 1C9NA 4P2BA 4YMLA 2ZI7A 3EZFA 3ZLTA 4JODA 4JXKA 1M7HA 2XUZA 3QVGB 3C6XA 2V55B 3AG6A 5JSZB 4FDVA 2XBUA 4C78A 1WU7A 4L3WA 3IUJA 2HNBA 5JSQA 3P9XA 1E79D 3MFQA 1EVZA 3BGDA 2DTEA 3PE6A 3C3AA 3PP8A 4WERA 1LPOA 1XA3A 1UQUA 2LW7A 3GLSA 4HQOA 1G21E 1K8RA 2OD7A 4PG6A 3IBGA 3VDMA 4DZZA 1I0IA 1N8NA 1NW7A 2VZ0A 1NNSA 2XTZA 2ZUWA 3KTAA 4UPVA 1FNMA 3KXLA 5FJIA 5H81A 1KI7A 3ZY6A 5DT2A 4R8VA 4FKZA 3WLFA 5I8PA 1SUPA 4E88A 4F4CA 3DBVO 5K4GA 1J1UA 1U4NA 1LVHA 1ZMXA 5JI2E 1FIUA 5JH7A 4F9FA 1U3GA 2WUEA 1AZTA 1H5UA 1NN0A 3G0DA 3UG6A 4B6RA 2PL1A 3KQYA 4G26A 4I1SA 1U4SA 4CM9D 2VQ3A 5CLHA 2QZPA 4AJKA 2P41A 4I50F 4LZOA 3V1UA 5GJBA 4PNZA 3KYCB 4O2BA 2YZKA 3DZBA 3ABIA 4NENA 1EQUA 4B2YA 1MHTA 3L7YA 4G81A 3OAAA 4OXXA 1RC0A 4DQDA 5KTSA 1ATZA 2V0CA 2XF2A 4A5SA 2JPDA 4JYPA 4EFKA 4IHJF 5M7EA 4KDCA 3ZJ4A 3D5EA 1QR6A 2QP9X 3HYCA 3UIEA 2Q0QA 3ACCA 1Q22A 2CCJA 4QNMA 3ZY2A 3ZX4A 4N0MA 1YZUA 4EG4A 3B1KA 1EVYA 3HQ4O 3Q7EA 1U2QA 1CEQA 1AKMA 3FPKA 2C58A 1T8WA 3FYUA 4JR1A 4DR5B 5CXUA 3NC0C 3LYHA 2PR7A 4Q15A 4MR8A 4CHGA 1NOKA 5AVSA 3LHDA 4M1YA 4H08A 1NI3A 4HVAA 4O4LA 4IWXA 3SICE 4GM0A 4EG8A 4MLCA 1CUYA 1R9NA 1J7KA 3SSNA 4BZZA 3PIRA 4S35A 5AUNB 4A0FA 4BLTA 2YFHA 2VSFA 2DCUA 4BQIA 2H5IA 4O1IA 4UMDA 1XRQA 2DBVO 2IP2A 3GF4A 3G2LA 3HY4A 1Y42X 3LRPA 4ZC8A 5T41A 3VDNB 3LP5A 2FWIA 2GBFA 3BH0A 4EYEA 1L4LA 2A35A 4FFSA 1W6RA 4R5MA 1PT9A 4AJOA 2NPIA 1TJ4A 2Z3WA 1VG1A 3OLXA 1G60A 4KRYA 4W9RA 5GV7A 2C7VA 2ORYA 2PX0A 3BERA 2BGTA 3DH0A 2PWAA 3UK0A 1DIGA 3GAZA 2GHRA 2H1CA 5F7OA 2JLXA 4LFBB 1RPJA 3AY3A 4INJA 4OHPA 4NCIA 3JYQA 1QV7A 4KYVA 3BKWA 4PS1A 1XMPA 3C24A 1K86A 1W2GA 4P4GA 3WRVA 3N70A 1B3BA 3PB3A 4LBWA 2OV6A 5JQGB 3A6FA 3PWTA 1LB1B 3NOQA 1KEUA 1XMIA 2VP3A 3A9SA 3DYVA 3QVJA 4AUKA 4V1CA 4HLNA 2V8OA 5EE0A 1J09A 5HIIA 1GKLA 1WW8A 3KAKA 4TMVA 3LG2A 3LX8A 4GKKB 3EBOA 5DGXA 1HR0B 2DHCA 3HSKA 4Y2QA 4I5GA 5KNDD 2VHXA 1NI4A 5TEWA 2BBOA 4HUQB 3ZWNA 3BXPA 1N5DA 1XYGA 2VSNA 4ND7A 1OH6A 4CVNA 3BEOA 4J0DA 1ULHA 1GZSA 1N0IA 2WU0A 4K7JA 5JOQA 4W1SA 2WJPA 3D4IA 2A3RA 2P2GA 3N2GB 2UXDB 1P3JA 1M6WA 3IB6A 1BCSB 2E4YA 5L7YA 1G8GA 3MWDB 2L17A 3K9HA 3U9TA 1OBCA 2QQ5A 3ZYZA 1FQWA 4BIMA 2Y1DA 3V1NA 4G0OA 5JS6A 1FYFA 5FL3A 3AZPA 5CT6A 4J7AA 3TXYA 4QU0A 5JD4A 4DQ0A 2N3ZA 3MLEA 4R1SA 5KYKA 2B7BA 4NEQA 1L5FA 1FVFA 5CIQA 3WA6A 1GY8A 1H2FA 3NYWA 4OHFA 3EZ9A 4MP3A 3N6RA 5CPFA 2NVUB 3UO8B 4KE8A 5CFMA 1TUIA 1W0JA 2PH1A 3VR2A 3ORYA 1YVPA 4WJZA 3BB3A 3K8OE 3P5BA 1CHDA 4DLWA 3K2EA 1GPH1 2BEJA 1N92A 5DEOA 3SZLA 5JJBA 2DBQA 1J8VA 4OI1A 4KXFB 4FR2A 2F1HA 4RHYA 5EXPA 2GYWA 5G40A 2IEBA 3DE4X 4YAKA 4ZTUB 2AQHA 1T6BY 2CHVA 1XCLA 2OOSA 3AESB 1U9IA 3K5IA 2VYNA 2O4UX 3EG5A 1EDDA 2XTAA 5HJEA 2W2MA 5BT8A 4TMWA 4PQEA 2IZ7A 3DEFA 4HDQB 1KZYC 1JAHA 2AR0A 2VL7A 2GN0A 1JIKA 1H1LB 1IQUA 1UDCA 1DAPA 1USWA 1ZQ1A 3OFSA 2FEXA 4MYHA 4CGYA 4EAAA 3I5AA 3IURA 5EPEA 4MW5A 5H4GA 4LV6A 3K2QA 5BWCA 4RIIA 1EDZA 4HDMA 4DC9A 5JAZA 3DB1A 2QAGB 2FP3A 2HJWA 3LT4A 1QK4A 2P2YA 4MQFB 1ZU5A 4WASA 1Y8CA 5H8WA 4UC0A 4IQ4A 2XQGA 1SPBS 4ZOLA 4KRXA 2JLRA 4JP8A 1NVAA 3QUSA 2P9GA 4GU5A 5LQNA 3GLIA 1EVIA 2HCFA 5JZOA 1S0UA 2MSDB 1C1DA 3C8ZA 2B4YA 3ESCA 3NXKA 2DFPA 3EDOA 4O29A 4QSMA 4DNXA 2CZGA 2ZZMA 2D5IA 4KNVA 1JLRA 4JOQA 4RVNA 3T5AA 1OU4A 1MB3A 1U1CA 2G4LA 4PX2A 4DMLA 2NU7A 4BUCA 5A02A 1N2HA 1ZS9A 4WNYA 3E6AA 2WG1A 3BGSA 4E32A 4BATA 4BXOB 5EJ6A 2A92A 1M67A 1DJNA 1OXTA 1T0UA 5FA6A 2FSVC 1M7GA 1CRPA 4GMKA 5HEKA 1R6VA 3A06A 1X8LA 2WSSD 2WD7B 3GJSA 1RQRA 2ZRQA 2VTBB 1JU3A 4CEHB 3AERA 2O4CA 3B13B 4JT2A 1D6SA 2HA7A 3M1AA 3DO8A 4EHBA 1RW4A 3T1HB 2F3PA 4BX2A 3S5UA 1VGVA 3NHUA 4AWAA 3GCWA 1D9XA 2WPDD 1BEEA 3HCEA 2J7PA 2IHKA 3T3NA 2BKXA 4V2IA 1PDWA 2Y2UA 3CF6R 3FGPA 1E98A 3DHVA 2GRAA 5J23A 3M1YA 4Z6KA 2JFNA 3FZNA 5LN1A 3H1GA 4HYEA 3QWAA 2XGSA 3QK7A 5CJJA 5CT4A 1NVVQ 1RHQA 3VR5H 3AY6A 5K7SA 1XRSB 5C81A 5TS3A 3KV3O 3RBAA 2JB9A 3D6MA 1I36A 2YYSA 4M8IA 4J0GA 1YONA 1U8EA 4M7OA 4I99A 4UUOA 3FYCA 5B58T 1ICEA 2IEGA 1CIVA 1DE0A 1M8FA 1X1BA 1KTVA 1NKSA 1RABA 2O3UA 2FKNA 5SYNA 4IJQA 3MQ4A 4OGWA 3A32A 1A2OA 4RA6B 3W8FA 2EHDA 3DEZA 2BGNA 1HURA 2WYHA 3MJTA 4PPGA 3C1UA 3LT5A 3STWA 2A5JA 1HC7A 2DQYA 2R7MA 4J4TA 3R74A 1TTHA 5EG5A 2ZR7A 1GTRA 2R00C 5HX7A 4ZV9A 2GZHA 2GM9A 3I2JA 3AF3A 4YV7A 2W8BB 4IHJB 1T8RA 3OHSX 1PD0A 5JRDS 3W5UA 5AK0A 2ZRDA 4PYMA 5K8LA 3VJLA 1O9BA 3JD0A 1HT1E 1P1FA 1PNTA 4HAVA 1GARA 1OGJA 1PT5A 2B61A 4JS0A 5AK6A 5GP1A 4BLSA 4D80A 1NQWA 1SQSA 5CA1F 4M7PA 1XAHA 1WWKA 2LWIA 3DBRA 1F51E 1L4FA 1Z2EA 2JIZA 2VSXA 3ESXA 1BFKA 3BSYA 4GOOD 4JOSA 4X7MA 1E60A 2IZ5A 5AK4A 3HDHA 3L0SA 3DEHA 2O8CA 1UJNA 2AOUA 1KE1A 3GROA 3QEMA 1SKMA 3U1BA 2A7QA 4V24A 3V55A 3QTLA 1IBLB 1VKZA 2FYTA 1J8FA 3E9ZA 1TC1A 4A2CA 2C1ZA 3WZMA 4N4AA 4RACA 2C7RA 3LF2A 4JU9A 2VXCA 4WGFA 3X0DA 2A14A 2X0NA 4D9IA 4LF4B 1XPUA 3Q1KA 1YRHA 4XXHA 1N5LA 4B8WA 4JJ4A 1K27A 2SBTA 3UJAA 4RY0A 4LJ8A 4YR9A 1BG6A 3JQBA 2ZDHA 5L7WA 1MX9A 4KMSA 3TVTA 2B69A 4RETA 5GZ3A 2KYRA 4MJ3A 1O6CA 1XTTA 5KWEA 2MINB 5B1IA 5HWSA 1P2BA 1VXRA 2IZZA 1Y9ZA 4Q4JA 3MT9A 5ADWA 4JKYA 4MUNA 3CMCO 4QVIA 3I9KA 4M0EA 3RUIA 2C4WA 4AJHA 1VHWA 5IKPA 1KSHA 1UFVA 4RJJA 3GJZA 1SOAA 1KRWA 1UBNA 3IA2A 4S2UA 3QU7A 1E9SA 4IOKA 3MN1A 4O63O 1G9SA 1R6TA 3CKMA 5EWMA 1CF9A 1ECBA 5EQDA 4LHZA 2OO3A 1Q57A 4UCFA 1GFSA 4R1LA 3ABOB 2C5BA 4HFRA 5FL7D 3K5PA 4B32A 5LOVB 2IPNA 1Y33E 4IAOA 4G5QA 3TBKA 5KHLB 4YTEA 5FRDA 3QF7A 5H4HA 1L5MA 4DLNA 2FAXA 5C1PA 1DC7A 4ZTZB 1VQ1A 4RORA 5LBIA 4ZCMA 1IB6A 2FMTA 3D5QA 3M1IA 2ORWA 4O4IA 2NO4A 4IS2A 1WF3A 4OGFA 4FGKA 2VJBA 2VPWA 3GGSA 4G4JA 1DG1G 4PLTA 3RREA 5EZQA 1YACA 3WRXC 5CNKA 1J1IA 1GL3A 1PZMA 2ZJ0A 3PNLA 4A8JA 1V4NA 4CN9A 3BD7A 5D3KA 2EBHX 1XDZA 2H9IA 4GPBA 2QT0A 1TMOA 1GQ2A 1VJ0A 1YUMA 5ITZB 1AZSC 3D7RA 5C7YA 2JLYA 2CDBA 4GOJA 1T3TA 3BMCB 4BMPB 1R5OA 4HO1X 1Y8QB 2D1YA 4M89A 4AIIA 4WOBA 4ME6A 1II8B 3H16A 1NMSA 3RVBA 3V5NA 2CYCA 2JJ2A 2WAMA 3D7NA 2PK3A 4B43A 3CX6A 3CSUA 3OKFA 5ICMA 1O58A 4DUYB 4RF3A 4QNNA 3IUMA 1V5FA 2JGDA 4LWQA 1PFYA 4DB4A 2WWRA 5I4CA 3SJBA 1AO0A 3W7BA 3QGMA 4G5SA 4FJ1A 3S2EA 2BMJA 3OKAA 3BJIC 2NUTB 2QP4A 3K30A 4WWHA 5GWXA 1DIBA 2M9MA 1WSWA 2DJ5A 1B15A 2WUVA 4O4HB 1TQDA 2J41A 2XDYA 2O1WA 1TA9A 1Z4MA 2MSWA 2V1XA 4P0TA 4J4BA 3OQJA 3ND8A 3RT7A 2FMIA 1ZVQA 3ZBPA 2R66A 1KQGA 4RTOA 1VRVA 2ZI9A 3NBQA 3PLNA 5FPSA 3WTBA 3DE0X 1EWRA 2YUIA 2C2HA 4K03A 4KK4A 5A3SA 1PO7A 4D9NA 4CF7A 5JEEA 1I94B 1M6NA 1UIRA 1YHNA 2QRLA 1C1XA 1CP2A 3FSJX 3LD9A 3M6UA 2FX3A 3C48A 3LRTA 4K87A 4UBOA 2DUJA 1J70A 3IUQA 4PFJA 4FS8A 3KR0A 3ENQA 2G0TA 4QXMA 2GUWA 4ENTA 2RG7A 1RCTE 2FJ0A 3P27A 1HFJA 1WR8A 2IUSA 1IOLA 2VA9A 4F71A 5A4AA 2O1XA 4KX5A 5DIFA 1E5DA 1UQTA 2KQUA 1YBAA 2G07A 1C50A 3AINA 1LBSA 1T5OA 3PT5A 1JEQB 1J0DA 2VVTA 3B3FA 1K0UA 3EZ7A 3B2QA 4MWCA 4LF8B 1A9XA 3AVVA 3NKLA 1J00A 5B1YA 3OFNA 1I4EB 2J4DA 2JI9A 3L46A 2PE5A 4MCHA 1E9VA 2ZK7A 3HM2A 4ZOAA 1FJ2A 5A6SA 2B4QA 3MRSA 2VCHA 3RB8A 1WXIA 1X92A 3L5OA 4LXHA 2B2CA 1PLKA 4XLZA 1FFGA 1OMOA 3PZRA 1P1JA 3HBNA 1KFJB 3DPUA 3FNQA 3N2KA 4KLNA 4QFMA 4TRMA 5HM8A 4BFSA 1JYEA 1A9SA 3HXOA 1E6EA 3LUAA 1ORHA 3GYBA 5ALYA 5KJEA 5AKIA 5IBCA 2CUZA 2OD9A 5I9TA 3C5CA 3K31A 4ROTA 3GJ3A 1E9FA 2DUWA 2O0JA 4I9UA 1ADBA 1C81A 4QDOA 3TJMA 1QRTA 1ZD3A 1SXIA 3SC3A 3L82B 3KQUA 3ONNA 4HAZA 2QKYA 2ZSUA 3DBOB 4P6VF 1XFAA 1MA0A 5DH9A 1SD1A 2Q5OA 1EWVA 2GEFA 3BMXA 3GVIA 4JI5B 2CWWA 3SHOA 2VF5X 3UF0A 2OC9A 2XWJI 3FUXA 4YUAA 2WTUA 1ZR4A 4JIGA 1OBVA 2P40A 3QE0A 3LUFA 1W34A 2HF7A 2O2IA 4OHWA 5LQUA 2PL3A 3SX2A 2R4QA 4RHFA 3WP0A 1VZ3A 1A97A 4FYIA 4GEGA 6ADHA 4R2KA 2E21A 3WWCA 4FLEA 1HKHA 4ZEOA 4JB2A 3C4QA 1XWIA 1AQIA 1LK5A 1QVZA 1V11A 2QTVA 3DZJA 4JDUA 5GJCA 4C5AA 1P0CA 3TTYA 2FK7A 1Q1NA 5TQVA 4D9GA 1H0HA 2JKYA 3V34A 4MH0R 1K5HA 3GLIE 4UDNA 5LSAA 4YRCA 4IIXA 1ZW6A 2PGLA 2QRVB 4C04A 2ZJAA 4RLFA 3MA0A 1AIPA 1PG0A 4F0JA 2VN8A 3ICEA 2C2KA 1KARA 2OP1A 3FFXA 2P5TB 4FEYA 1PV2A 4AN4A 3FJ1A 3H2YA 2VJMA 1I2AA 5HS4A 3HB7A 2EFYA 1GZUA 4DMRA 5JBIA 1JT9A 1H1TA 1IDOA 3LPMA 2VWHA 4E5VA 5DHUA 2WU4A 3V32A 2B36A 2NN3C 4ETWA 1U63A 4G0PA 2F59A 1QP7A 2VT6A 4IDEA 5CW2A 3IUEA 1IPEA 4ZK2A 2UVPA 4R16A 3O8OA 3PJGA 4KAAA 4OJTA 4PLCA 521PA 5A2GA 1ZIDA 1UPUA 4DY4A 4ZCIA 5KQPA 1HY3A 1IH8A 2Y92A 4OJYA 3UFXA 4ARVA 2BIFA 3BHJA 2FX2A 1XPRA 1YT5A 3ET5A 3OTOB 5AHKA 3I05A 1JAZA 4M36A 3IEUA 2YJ6A 3WNBA 3COPA 4OQXA 1T43A 3PTAA 4WDQA 2J6CA 4KV9A 5C35A 2IXTA 3KBOA 1M2EA 1Z68A 2WYIA 1EBBA 1NVTA 3RWMB 1EM6A 4BO5A 3TOZA 2HXSA 4AIRA 3A3YA 1I5EA 2BFAA 4HWTA 4LISA 5B3LA 2HMUA 3AZQA 2PMFA 4OQEA 2GCOA 5DIZA 1YMUA 2CC2A 2IUEA 3AKCA 4WSOA 4R2WA 5AK3A 3X1XA 4AULA 1CRLA 3TFOA 3OEEA 4FYJA 4L9SA 4MKIA 3GMIA 2Z9BA 3VJKA 3EXHC 4DLTA 4CRWB 1H05A 2R6CA 2W6NA 3P4XA 2F9LA 4XYMA 2AOTA 4CCYB 4GL4A 4BEWA 4JKOA 3B6ZA 3TMAA 4I3FA 5IUNC 1T4MA 1Q15A 2QZSA 2FFBA 3GJ7A 2V98A 1RI5A 2G0NA 5JZMA 4UVDA 5CA0A 1BOFA 3CCFA 3RTEA 1VJDA 1E2BA 2HJ9A 1NFQA 5EKTA 1F1JA 4L4XA 5AI8A 5DTRA 4MPDA 4FBGA 2H8KA 4G85A 1S6YA 3J7TA 2XVZA 1LZKA 4ZZ1A 1NXSA 4XWKA 1LX6A 3QPDA 4OGLA 5J2TF 5TQ0A 1OI3A 2XUFA 2Q1WA 4JN6B 1HOXA 4GPTA 1R6BX 3ST7A 1WM1A 1JKXA 2PO7A 3D81A 1LJLA 3FCEA 3I09A 1YFLA 3R7LA 1RJFA 4WCDA 4E5PA 5GGXA 3ZWBA 1XVTA 3ZTWA 1J42A 1V2GA 4IKEA 4MQMA 4EGAA 1FSGA 4R3WA 5CM9C 1IBSA 4PWZA 3OZUA 5A7FA 4PIMA 3GN2A 2JGIA 4REOA 2E4XA 3F8TA 2W6ID 4UTOA 5IJAA 2XKKA 3IALA 3O8CA 2NSHA 1MJGA 2ZSFA 5FQNA 3BOSA 2R8EA 3AR4A 2XSZD 4R3UC 3TR6A 4QDJA 1EFVA 1VM6A 2CUTA 3I12A 4R9VA 4UHHA 3F1LA 3UW3A 1YFJA 2WU8A 2QE7D 2PDAA 1ATIA 3KT0A 1MO5A 3C8UA 3LHSA 3MGBA 1VL1A 3NWOA 5FI0B 3HG7A 1KZ6A 3AR6A 3H9UA 3L77A 2O54A 1VG8A 1NUPA 3M9XA 1N2SA 4BEVA 5HJ5A 2FNAA 2DFVA 1A7JA 4MLZA 2VEDA 1XRPA 4L3VA 2PIDA 4OATA 4J94A 4MVYA 5FFFA 2R6FA 3QP9A 2BE7A 2A5LA 3QV1A 4HJXA 4YP1A 5G1OA 2O8EB 3PYXA 4JT9A 1KEWA 1WZNA 5T4HA 3TL6A 2V3VA 1MTOA 4O2AA 3GQBB 1R4ZA 4Q9JA 4MUIA 2WVGA 2XXJA 1LDGA 1NG1A 1L5GB 1UBKS 3CZ4A 3QMMA 4GMFA 5HRAA 2ECFA 2WJJA 4R7GA 4CETA 1HYBA 5KNDH 2JRCA 2XZOA 2JKZA 1RWPA 3AWDA 2CFIA 4MCJA 3DEYX 3KNZA 4C0BA 3ZHSA 1VYVA 3MPUA 4JLAA 4TV9A 3E7PA 4KNWA 4W63A 3RVOA 3WJ2A 3Q40A 5MDHA 1VSBA 2H1OA 1UH5A 4I4IA 1WZ2A 2BDUA 2GM5A 3RRNA 2O5CA 2X2FA 1PVDA 4BNZA 1NPYA 3BXHA 3M9WA 1N9GA 1NHGA 1K08A 1EHIA 1GZDA 2Q3DA 3MZ0A 1ECPA 1RT9A 5TLSA 1EA5A 3U44A 1UKVY 2ZRLA 4I8XA 4BLWA 4DMGA 1MPXA 1WDTA 1ZLXA 5HKKA 4RO0A 2AWNA 3E82A 1N4DA 4OI0A 2INGX 4AG3A 2GMWA 4QX6A 1X7XA 2Z83A 2XCOA 3HBLA 1FZTA 1AXEA 3PTZA 2Y1CA 3AQ4A 4LSGA 3L06A 3KL2A 3N86A 1HE3A 4Q0MA 1NW8A 1DMSA 3QOXA 1WXDA 3QVSA 3PNBA 4CMIA 2QUIA 2HDHA 2WFLA 4LKOA 3O2SB 3U3RA 4UKDA 3THYA 4HAXA 2Q3EA 3DZGA 4L5JA 4KFSA 3GH1A 4B74A 2Y9MB 3EZ2A 4J16A 1EK5A 4TXMA 4HX2A 2FUCA 2H2HA 4WZAA 2H29A 3RVPA 1ESEA 1CVRA 3H9EO 7REQB 4ND2A 2C00A 1RWBA 3IAUA 3K6JA 3RC1A 3RYFA 4AYWA 4C89A 5B1EA 5H82A 1FQJA 1W1UA 3RUPA 2WP8J 2FF5A 2C99A 4TMFA 1C0LA 1RKXA 3MJVA 4MYRA 3RS8A 3T4UA 2O06A 3WLLA 1JPJA 4RH0A 3DZHA 2IOYA 3K73O 2OA0A 4LZLA 4ZARA 5KMGB 2Z1MA 2JLQA 5FHQA 1C0PA 1G7TA 1YR1A 2VTDA 2PWPA 3CUSA 5AUPB 3D02A 2FP4B 5B55A 1YE8A 4C7VA 3OCCA 5JS1A 2PRJA 3NHSA 2IGTA 3FWNA 5A03A 6Q21A 2ONKA 1XLWA 1Y7PA 2YV1A 4FONA 4XQEA 4A10A 2Q0HA 3DLPX 3EZLA 1GZVA 2WFZA 1QOPB 4HOYA 4OXRA 1MKYA 3UAOA 4LIPD 3BE6A 5IN4A 2I0FA 4RUKA 3TIVA 1ZGZA 3I0MA 2KM1A 3COWA 4RK6A 1ECLA 4S1PA 2HO5A 2C0QA 3G0BA 2QSZA 3W2IA 4GI2A 2B8TA 5AP9A 2LCQA 2IDJA 1K0FA 4XR4A 6AT1A 3HFRA 1CC1S 5HZHA 3M4XA 1TUBB 1XLUA 2VZEA 2YXDA 2YX1A 4MUKA 4RQTA 3VU8A 4BEJA 1PW7A 2O3TA 4FILA 3TB6A 2AVNA 1P62B 5A0FA 4BC1A 1N3LA 4PZDA 5B64A 4LJ4A 4MS4A 3EEYA 1TYZA 3VYSB 5F2KA 4C4TA 2IY7A 4DRXB 2P11A 5LM3A 4RTPA 1E7YA 2UYHA 1U98A 1TCUA 2YNMD 2DULA 2CXUA 3C6QA 3FB1A 4TYNA 4ZEVA 3LC1O 1V1RB 3O1IC 3QJYA 1XWFA 2C4KA 1FLVA 4WXPA 1XTVA 4PHHA 4XB1A 3UAXA 1HYHA 4OGGA 2WKRA 1FTQA 3UQYS 3M5CA 4QKQA 1LLDA 1N3IA 2I55A 5KJ6A 3MM4A 4JSYA 2XB2A 3TDNA 2D4AA 5E4JA 3I9LA 1AUQA 3STXA 1OBOA 1H0RA 3REFA 3NJRA 1KJNA 2YVUA 3DVSX 1SU6A 2BF4A 5A4FS 4TLCA 1RVDA 3KWMA 4MINA 4QHSA 3VU3A 1N34B 1T9BA 4HS9A 2C29D 4TKVB 4GNRA 4R8SA 4HQKA 4R6XA 1Z17A 3L49A 4EM6A 5KX5F 3H6GA 1EDBA 1APBA 3D4LA 3DJFA 3L6BA 1S2NA 4ESEA 1H42A 1TI7A 3ESDA 1M1YB 4PYJA 1O3YA 2CXSA 1U11A 1P0FA 2JG3A 3G3EA 1DRUA 4JT4A 2LDBA 1M2NA 1CZUA 1RJ9B 3EEFA 1R88A 3HSYA 1MEOA 4TUYB 3U7FB 5FTKA 5BYKA 1E94E 2FPGB 5CURA 4MJ7A 4FZJA 3CLHA 4HQNA 5BOVA 1T6XA 2PUWA 4W7SA 3E0QA 2G5TA 2HU7A 3E3MA 3CZ5A 4TL7A 1GRRA 4QLBA 1JFTA 3WB1A 4UHBA 1OI7A 2XVMA 4MVCA 3TW0A 3D6TB 3WQHA 1W2WB 2FPIA 2P75A 3G6KA 3MYRA 3DFKA 1CUFA 5CR9A 1FFYA 2H51A 1DPFA 1JQDA 1XRRA 2ZJBA 2VHVA 3DTVA 3HPRA 5HCIA 4CLXA 3RYIB 5E0OA 4FGSA 1XNJA 1DXHA 3ENNA 2A1UA 3EE6A 4W9MC 3ESZA 1IY1A 3C0KA 3RIXA 3IVGA 5KYYB 4EBFA 3PD1A 2UUCB 1TCCA 2J6HA 3NKFA 2D1SA 1E5XA 3BT7A 2PMCA 4CQMB 3IO3A 1SCDA 1FTNA 4KGXA 2YN4A 1WX1A 2DEUA 1Z82A 4WK2B 4Z1OA 2HX1A 3DCIA 3H99A 2A33A 3FFAA 1SQ0A 1VBMA 3MUOA 3Q7SA 5K0BA 1SUBA 3G2MA 2FWBA 4RVUA 3T4PA 4FFBB 4OHYA 4YI3A 1W0KD 4OVKA 1GVHA 3IP5A 1OAAA 3E8MA 1TIBA 5KNCH 1Q44A 3P2MA 5DNWA 4EGFA 3OMWA 4I81A 1SR8A 3P97A 4FFOA 1GAXA 4HUQA 2GPYA 3A28A 4S05A 3IAS1 1VLJA 3MWGA 4Q05A 5HE9A 5K3OA 2Q1SA 2BUAA 1AQLA 1KBOA 2GQ0A 5B37A 4EVRA 3EVZA 5LP1A 1WCIB 3NG1A 1XN1A 3FF1A 2QZ4A 3QE4A 4XIGS 1M1ZA 2PUFA 1RBZA 1Y9DA 2REQA 2HYDA 3OQHA 2HHAA 3OOSA 3ZWMA 5FBVB 2PS9A 1R4NA 5LFAA 3RK0A 3UPTA 1JSLA 4DABA 1GA6A 4X1KB 2EKBA 1NW4A 2IWHA 5J2UA 4F1KA 2QMYA 4KI0A 2NUAA 5GZ6A 2JAXA 1XVUA 4HYTA 3UH0A 3QJGA 1Q7TA 4F2GA 5DCWA 5GPBA 3DPSA 2FPRA 3C5VA 4AWXA 2QD2A 3DXXA 2B21A 1REQA 4S24A 3EW9A 2BT4A 3LX6A 4Z8YA 3U7GA 2Q5CA 3DMPA 4V39A 5I9BA 3ZS8A 1GPUA 4WPGA 3KQHA 2VXBA 2J3HA 4IQ0A 4MUEA 2HV8A 2Y4NA 4BKMA 4CNQA 1OX4B 5B6JA 1KSFX 1JEJA 4X5OA 4LJ7A 2JJ1D 3I1IA 1UP7A 3OQNA 3GPDG 2I91A 4CEIA 1YL5A 2I67A 4J0EA 4D9FA 2AX4A 1O0CA 2GLUA 1G5IA 4P7FA 4BKPA 2O8BB 1QX4A 1QIIA 3MTIA 1RXYA 5BWNA 4C4OA 1FXWA 1N5MA 3CJRA 2VHEA 1W5EA 5EMMA 1G3MA 5GOZA 2NSLA 2J3JA 2FEAA 3H1BA 4QAJA 3WGIA 1FS6A 1ULSA 4A2WA 1JFLA 1SCKA 1VKHA 5I5EA 3VDXA 4UBKA 3F4BA 2PMWB 1JX6A 1I6KA 4M9SA 1SVSA 1OOEA 3BRWD 2GZMA 1TIPA 4RD3A 4RWEA 1KWGA 2H4WA 2QXTA 4L75A 4GX2A 1DLIA 1US8B 2GNOA 1SUWA 2JVJA 2NUPA 2XRYA 1IHUA 3EHEA 3I34X 4K26A 1I3MA 1QHXA 2O3SA 1MV5A 1Y1QA 1OX6A 2QOEA 1CDDA 1EGMB 3C3JA 3DB2A 4R0VA 1KP9A 3GZNB 3C6ZA 4FSXA 1N7IA 4PANA 2QSYA 4Y18A 5DCLA 3WNCA 1SXJD 1J2JA 2DR2A 3AY0A 4K88A 5IJ9A 4PSCA 4P31A 3TNFA 1WXQA 1JNYA 4GGPA 2PNJA 1OR8A 4YRPA 1A9YA 1DB3A 4ZALA 4YT2A 5LYJF 4D0RA 3ELYA 1OX5A 1C4XA 4DPLA 2WI8A 3K1AA 4TV8F 2CJYA 5EFOA 3WI7A 4EVQA 4JC0A 5JO9A 3U7QB 1G66A 1A98A 4EKIA 3HUUA 1EFCA 1UOQA 3BCUA 3OMLA 4YXWD 1LA2A 1T29A 4UU0A 1Q19A 3EG9B 3EZXA 1C4WA 4GW3A 3RVKA 1DKLA 2BCJQ 2VTBA 1NSFA 1RCFA 1XJ5A 2H63A 1CRQA 3QXJA 5TPWA 2H92A 4ETIA 3E5MA 2IOFK 4BE7B 1E2HA 3DDHA 3M70A 1UR5A 4BO6A 1ADJA 2J3KA 3MW8A 2C61A 5DTMA 4UHKA 1TB4A 2WF6A 2OXEA 2XUIA 4EL0A 3HKDB 5HRCA 2WG2A 1DL5A 5EIXA 4PZPA 2AFHB 4WZAE 1JSZA 3HDTA 4IWNA 1L4BA 3TIIA 2WFMA 3CPSA 5A5FA 5JXHA 3E22A 4BTLA 3WS7A 2Q1TA 2ZW9A 1K7FB 3OU6A 4AF7A 1FNSA 2YRWA 5G2OA 4JJ8A 2Q5HA 3P5SA 3C5WP 3RQIA 3R5XA 1XKLA 4KR6A 3A2LA 3M8KA 4KIGA 3RQSA 2CNWD 3M2PA 3TZEA 2IH5A 1ZSYA 5KX5B 4DIBA 4CKCA 2CY0A 4KMOA 3AVPA 3NDPA 3L7KA 1Y82A 1YMQA 4I50A 4QUAA 2H1WA 4K2HA 1X8KA 4ZU6X 3ZCXA 4ND8B 2X8JA 4MR9A 3G9QA 3K16A 1XF9A 5IFLA 1E92A 5THXA 3DBLB 3R5JA 1VE5A 3LKDA 4RSRA 4UHFA 1PFKA 3C14C 4QOHA 1AUPA 2I3ZA 4LHYA 2V9CA 4C3VA 1BOOA 2HK6A 1NFFA 3I9NA 3OECA 3PDJA 3VTFA 3EQ7A 1V48A 5L3SA 4JLSA 4RE5A 4RFLA 1NP7A 2AMFA 2LZ0A 3RFFA 2PM8A 3NOVA 1YDEA 4AX4A 1G19A 1N5OX 3WOVA 5HP4A 5I47A 2ZRGA 4RANA 1WDMA 2A67A 2D13A 4IDNA 3L0BA 2HHLA 2NVBA 2FWJA 4P8RA 3QNMA 2QORA 5AMXA 4V1CI 1C8BA 3C3PA 3OX2A 4E46A 5BW8A 1KSJA 1LNQA 1ZKMA 5KOHA 5FUWA 4LRYA 3TPCA 4P82A 1B8UA 1FUIA 1PJZA 1P4JA 4XRGA 1L2TA 2BRUA 3OIVA 3BA1A 3LPAA 5EIFA 2BEUA 1TQ2A 2VUTA 4XAQA 4Q9KA 4JLWA 2F6RA 1E9BA 3FWHA 3ZQ4A 2IF0A 2R5FA 3MTGA 3CC8A 3ECAA 4E08A 3G8AA 5DW0A 3BXZA 1KVUA 1RMYA 5E4TA 1CJBA 4CE6A 4F60A 1YVEI 5ALUA 1WCYA 5BMVF 5JROA 1I3KA 3C3YA 4A82A 3E9QA 2XBMA 1ZSNA 5DX8A 1SXHA 2B8JA 2PNFA 4IUYA 1EX6A 1Z6XA 4XB6B 4DILA 5HRUA 1Z5OA 3RTAA 1M34E 3NC1C 2IC5A 3S2ZA 2J3QA 5FV7A 4TVBA 2ZZNA 4DLPA 2GZDA 4JJGA 2JIRA 3KHTA 2Z04A 5E1OA 3L6UA 2E89A 3RGWS 5I48A 5JWOA 9GPBA 4LC1A 5A04A 1LDYA 2ACVA 4LV8B 1GV1A 1EZ1A 3TI9A 4D82A 5TVGA 1LNZA 3K6KA 3T7RA 4ZVUA 2DC1A 3JASB 2RG1A 2OD2A 1X77A 5H59A 3UHPA 3UJCA 4TS3A 3ROKA 4BUJA 4ZQCB 1VE3A 4BWFB 4CJXA 2CDNA 2XXAA 4DYDA 4B79A 4EA8A 5A4DA 1W35A 4ZOCA 4Q4CA 2IP1A 3P52A 2ZAGA 1OFGA 3EJWA 3C6KA 2IX3A 4BMNA 1L8OA 4PV7A 2YHIA 1ORVA 1QQAA 3OPQA 4FZRA 1ZD8A 5CAEB 1OLXA 2RIRA 1SRRA 4GG1A 3WDLA 5TF0A 3HDJA 2EIHA 5LP6C 4ND6A 3DDZX 5FXMA 3RVMA 1D2NA 5A1JA 2ZJZA 4PAQA 3DDOA 5KDLA 4CIAA 3ZIAD 3WGKA 1OB5A 5CYFA 2PQ6A 2QTCA 2P0EA 1T5TA 4R8RA 4EJSA 1RTKA 3K2IA 1U8XX 4XJXA 3RSGA 5B2EA 4X93A 4Z7JA 3F8SA 4GFDA 4JI7B 7MHTA 3GT4A 1BQEA 1U8ZA 2D5AA 4DC1A 3G59A 1P1CA 3ZWDA 1P74A 2GLXA 3C39A 1E59A 1KYZA 2HA0A 4FFMA 4KO3S 2NT3A 4IHAA 4L50A 2CCGA 4UTPA 2Z56A 4NFSA 3IODA 4X65B 3MPOA 3FN4A 1FLAA 2PCLA 1NLYA 4MOWA 3T5TA 3G88A 2XI4A 3QKRA 1YOVB 5DWQA 7ABPA 4ZO8A 4CTJA 2MDTA 3FVRA 3LXXA 2GPNA 5LDGA 1WCWA 3FCOA 2D1TA 4YIKA 3RTBA 4ZAVA 2BFBB 3ZJYA 2CMGA 1K7YA 1MRSA 2VOEA 3K09A 1QVAA 3OT1A 4MUBA 4RIHA 2QDXA 4OA5A 3SLGA 3KQKA 3OQOA 4HX9A 4GKJB 3DE7X 4E5DA 3R8CA 3E27A 5EERA 3UOAB 2QSJA 3HUDA 3FWPA 3H13A 2D7CA 4YPVA 4H1HA 3MLAA 4NBTA 1UODA 2FXIA 2RMKA 4BBAA 5JXGA 3A4NA 1C3JA 1GTL1 1IAQA 2XIQA 4EABA 2VRCD 3IQDB 4YLGA 3ACBA 2V7QD 2V1UA 4HAOA 2D5LA 4HADA 2GM4A 3HB0A 1W59A 1Y0BA 3K35A 3UJDA 2PRZA 3N87A 5ALPA 3KZOA 3IT3A 4HATA 1L7XA 2JJMA 3ZEIA 3JYHA 1MB4A 2AZDA 1AURA 1GRQA 1XDSA 4L08A 5CDFA 4FR0A 3WBKA 4GR4A 1AV7A 2I4LA 1YF3A 2HN9A 4OG2A 1X7WA 2W70A 5EZSA 3WWZA 1SHZA 1B8PA 3BIOA 3PDIB 5SZIA 1B3RA 3PG5A 1G3QA 2OG2A 3O9ZA 1GA4A 1DEHA 2GESA 2W98A 3OZTA 4L9WA 5FBHA 3VKFA 3NW9A 2OFFA 1ZINA 4PZ9A 5IPFA 1PTJA 2AJLI 2I7XA 2JFVA 1FJXA 4YJ3F 5DK6A 1BS2A 4ABYA 3JYOA 3F2IA 5BYBA 2VPPA 3ELUA 4RLHA 4CKWB 1UADA 3JQFA 4D9MA 2QF7A 4AJNA 1U02A 2NXEA 2WIFA 3BSWA 3QX8A 4LVNA 3ER9A 4FFRA 2F43A 3N0TA 2CT8A 3HJGA 4BMDA 4AB1A 1W5BA 4UXIA 1JIUA 3VR0A 4FYPA 2YHBA 3H5VA 3PEYA 1NBWB 1KDTA 4KYIB 2JCYA 3PEEA 1RZVA 4IRUB 4KQFA 4CEJB 4DARA 3OICA 2PHZA 1IBMB 2SKEA 1SXQA 2PUVA 1TCVA 4N01A 1EWTA 3EISA 1EGHA 1U2EA 3IVXA 4IJVA 4XJTA 5LZ7A 3QUTA 4F92B 1QHFA 5JNLA 3AFGA 1B2RA 3ZY3A 2YY6A 2YWFA 1P1BA 3MBKA 4KFRA 4XEUA 1LLUA 5H83A 3L0OA 2VDWA 3GEPA 3HE3A 3P2EA 4RYLA 1Y34E 1P4GA 2YZ2A 2N9UA 1PNOA 4ZAFA 5E7QA 4BV3A 2XNJA 2HZBA 3BDVA 2R68A 2UYQA 1EXMA 4KVGA 2DLNA 4MS3A 1DO2A 4I3HA 1CJUC 1YA8A 2FN9A 3AM5A 4TPKA 3SGLA 3T15A 2K5UA 4ZI3A 4JC8A 3V4PB 4HZUB 4Q21A 1F5NA 4ZP1A 3FKSD 4HCJA 5ILQA 4G0QA 4E30A 3OMXA 3AHGA 1Y9JA 4UUBA 3FSEA 5AW5A 4E5KA 3A1NA 5LR6A 2XNDA 3H9QA 3BHNA 2WNIA 4KJXA 4M53A 3NKVA 2GTPA 2B1JA 4MRPA 5CA1A 4B09A 4NK5A 1J0XO 2CXHA 4YCDA 3TDMA 2PWBA 3B5IA 3OOHA 1MIOA 5LB4A 1LVUA 2XTNA 3I4CA 3W6NA 3WFZA 4DA6A 5BW5A 1DMRA 1JDBB 3BXOA 4CLHA 1XQWA 3L5KA 2GHIA 3ZHOA 4E3WA 3OESA 3D7MA 2UZ4A 3PLAE 3VYWA 1QBKC 1NLFA 1QANA 2CWDA 2FMFA 4NYJR 1ZIXA 5DK4A 3TRIA 1RZ3A 2OFXA 4DTIA 4P3YA 1QHEA 1NE2A 1P39A 2YR0A 3FPLA 4WCFA 3M6MD 5FAKA 1XZQA 4TOIA 3TRKA 4CI0B 1OH7A 1YKFA 5IBPA 3LU1A 5JC8A 1HL3A 1K7CA 5CU7A 3ED5A 3JSXA 4XB2A 3DCJA 2QUZA 4IJKA 1I5RA 3R5HA 3AEKB 2Q3BA 3NDRA 4R05A 3AF5A 5AQEA 3I2KA 5HE8A 5ESXA 1DPGA 3CUWA 2I6SA 4RD1A 4MIKA 1U5BA 4JMLA 1PIWA 2QM3A 2Z8ZA 4PX5A 4DNOA 3TG8A 2PEZA 1E4OA 2LKDA 2B1IA 3ND9A 1DBSA 2O3QA 2X3FA 4IMIB 2IITA 4B7CA 4LDNA 1DCKA 1FFXB 5FL7A 1DO0A 5JAQA 2BBTA 4Z4CA 1G8AA 2EDCA 2EBFX 3O0DA 5G1PA 4AAYA 3RUAA 5C1DA 1T91A 3A10A 3GVXA 4Z4QA 3HFSA 3W3AA 1AH2A 4NG5A 3ETHA 4WLNA 3MTQA 1H2XA 1E69A 1JJIA 1MAUA 2IUTA 1RXEA 1LD3A 1ENZA 4NR0A 4RV4A 5IKOA 5CDGA 4Q3AA 2BDEA 4ZI7F 4A23A 1TM2A 3F5DA 1TLFA 3CSSA 4UVGA 1FDRA 2Q2OA 4ZQEA 1JQEA 2QXYA 3EN0A 5A0TA 4Q3OA 1E3MA 4F5WA 5DYNA 1Z2NX 4JHXA 3SVZA 5FI5A 3DT9A 2X19A 3VGJA 5FTWA 4OU5A 4QOJA 1WHTB 3D8BA 4H0FA 1H2HA 4IXMA 4MO2A 4PE5B 4S1OA 4PLPA 5LKAA 3FNIA 1KAMA 3H5OA 3P0JA 5HK9A 4A15A 1XRNA 3QYJA 5BN3B 2PKXA 2W0SA 3K3PA 1EJ2A 3TTUA 5EXEA 4MI1A 4Q16A 5H3HA 2UZ3A 1YE3A 4KXWA 1IWOA 1JXMA 1CUXA 1KO5A 2YXLA 2Z58A 1UIMA 1ZN7A 3GBSA 1ZN8A 3SMVA 2CLDX 2E9SA 3OWHA 1GL9B 2PA0A 3A6EA 4MUHA 2HC9A 4RHXA 4BMSA 3WGGA 2MOKA 3I3SR 2OESA 1CEXA 4D4MA 2YW9A 3IR6A 5FO1A 4L76A 5G3YA 3JWEA 4BFYA 5D7BA 4IV0A 1R00A 2YY7A 1KEZA 1PQ4A 3TKLA 1QRRA 1QIEA 3ZIDA 1GZ7A 3HM9A 5JDIA 1M2HA 1QRDA 3P45A 1G41A 1QO0D 3OM8A 1DIAA 4A4DA 3Q4GA 3NM5A 3X1JA 3K9FC 4TT3D 1L9XA 2I8CA 5HR5A 3YASA 1OZHA 4ACBA 1NKTA 3SN6A 5LWQA 5JJIA 1EU1A 4IMRA 4TTSA 2HA3A 3QUBA 4P92A 1KAOA 3EFOA 1GU7A 1ZESA 3PFKA 5FNVB 3FA2A 3TQQA 3FMOB 4Q3CA 1FB5A 1SCIA 3ZNPA 3SD7A 5KDDA 1G6KA 2GK3A 2WAAA 1VIDA 3IEVA 5K09A 4ITVA 3U26A 1EFPB 2UUAB 4LZJA 1AU9A 7YASA 2HMTA 2G83A 4BVLA 3P96A 4IF6A 4DJDC 2QM0A 3BMQB 2B30A 4MVJM 3ZKAA 4EUSA 3NEPX 4FX2A 1PSDA 1D1QA 1D2RA 2Y66A 1XXHB 3BF8A 4JGBA 1PJLA 3ONFA 1SY7A 4OHKA 4C43A 1CF2O 1ZIOA 3R8XA 2IH4A 4JLPA 1GAJA 3UHFA 1LBQA 1ZXLA 1GAWA 3OZIA 1U0JA 3PUVA 1MDBA 3ML1A 3GNTA 4QPDA 3RM3A 1P3DA 4NOLA 2EX1A 3SIPA 3VPFA 4AY4A 4BNKA 4B3GA 1DEXA 1KXJA 2GXUA 4W9NA 2C04A 2AYXA 2HK8A 4K6HA 1DADA 6NULA 4CM4B 2RKBA 2ZS8A 1FYEA 3QLUC 3ZCSA 2MR6A 4QDTA 2JC3A 1UEIA 3WB0A 3KT8A 5F2NA 3N8GA 4EHAA 4LXTA 4IJMA 3ZQKA 5AJVB 4JI8B 2NV0A 1NVUQ 1N75A 4HRYA 2ON6A 1A9OA 2JARA 2GJAA 1PLJA 2RGEA 1RM4A 1P7CA 2O2GA 2PSFA 3E9EA 1B14A 1KYIA 2W6MA 3GRCA 4BCCA 1I3NA 1PUXA 2FRDC 2B2NA 2R2AA 3I73A 3KKZA 2RBEA 2G88A 1NX6A 1K4MA 2GUGA 2WQZA 4QM6A 5F1YA 4YLEA 1QU2A 1E2NA 2HBZA 2VBCA 3LPLA 4E1AA 4EW1A 4CGZA 1GZ5A 4YBRA 4C5BA 4UOEA 1MZPA 4FOOA 2JEOA 3CE9A 4EG0A 4X85A 3C98A 4R0MA 4DQUA 3GBPA 1RKBA 4KR0A 1BDIA 1N36B 4NJMB 2JH3A 1HNXB 3M5WA 3T8YA 4BQQA 4LOHA 4XEHA 4Q7KA 4F4UA 3QJ5A 1OF1A 1VYUA 5EFZA 3RD5A 2GVNA 4YRGA 3KYIB 3ZHTA 1D2MA 3CZMA 3R41A 5CDFE 4CLDA 3GLFA 1V8PA 4OQYA 4F8YA 1VGQA 4UUMA 3PQ5A 1EFRD 4RQAA 1V8BA 3V1LA 4YJGB 1H8HA 3S5JA 1N0WA 2ZT5A 2VRBA 2V97A 1K89A 3U4MA 2H2AA 2DUMA 3II6X 1I2BA 2PSDA 2BKVA 3DE3X 4YK7A 2JIBA 3JAKB 4QZVA 1L3IA 2YQ5A 4EW3A 1HV8A 1UK8A 2ZIUB 3N7TA 1TUBA 2PT6A 3U37A 4M6WB 3VM6A 3BFVA 4KXLA 3NPMA 1KFEB 4EHJA 2X77A 2VYVA 4ZJUA 4Q03A 1PF7E 4YDSA 1M2VA 1QJ4A 5LNK1 4HH0A 4P5DA 4P5EA 2QVXX 1MAVA 1E1RA 3AJ8A 4I5EA 3CW2A 4M9CA 3UXMA 3LQ2A 1V1RA 1LK0A 1UWVA 1XZAA 1YBVA 3RIGA 1XQ9A 4HEQA 3QY9A 4K1XA 3UPUA 2GPSA 4RXMA 4P35A 3UV6A 1JG2A 1P0QA 3O8QB 3LUGA 4L7QA 4URZR 2CD7A 3LCMA 3R0XA 3TD2A 3EVGA 2DXIA 1GSHA 4Q4AA 5CDSA 3ABSB 2PSJA 4XFKA 1I6MA 1FMTA 2K2QB 3FDIA 4FT4A 3CV3A 2HSGA 3OUZA 3R3HA 1GA1A 3E1KA 3WFIA 5EYPA 1T4CA 1VMIA 1SC3A 2BFOA 3R3XA 3FLAA 3A4MA 4IEIA 4DV0B 4NKRA 1J0BA 2OORC 2OXCA 3JQRA 2XH8A 5F3RA 3TLGB 4C3ZA 1PKXA 3QPVA 2KB0A 5DBHX 5EP2A 2SECE 4FHEA 4DOMA 4P4UA 4O3MA 1NF8A 1ZD9A 1GZ6A 2RJ3A 1UXJA 2YWXA 3KCNA 1M1XB 2CFTA 3FZGA 3IOMA 2VP0A 2WZDA 4Q7EA 2P68A 3FMPB 3G79A 4HDAA 3K9QO 2BFDA 4YMUA 1A9QA 1GU1A 1U0EA 2FPGA 2H18A 4WLVA 1VYTA 5FORA 1GUBA 1SU7A 2EYQA 3AW8A 4MZDA 3WZ2A 2B1QA 1BJTA 1SUSA 3GX1A 4UEJA 5EJ7A 5J2TA 2HW8A 4FWBA 3RT9A 3ZY4A 4HGPA 5C4GB 5GGYA 3Q5GA 3WBJA 4U02A 1JVNA 4QASA 1N6NA 5CVTA 3TOVA 2XZPA 5CT9A 1X9HA 4RADA 5ALZA 3E9DA 3RLFA 1PR4A 4QFBA 3QXXA 2RHOA 1BXGA 3R0JA 5AUOB 3HKBB 2P90A 2RHCA 4ZZ0A 3IQHX 4ZPJA 1UUFA 4Z9YA 2VRNA 3AJRA 4GWGA 3AGPA 1PT7A 3EEIA 5ARCA 4BPBA 1GFWA 5EQTA 2PPLA 5HTOA 3PUJA 2PLWA 1H94A 1QCDA 5F78A 4TLLB 3V4FA 1JPUA 4M21A 1U3CA 1P5JA 5I3ZA 5IMBA 2ZAMA 1NHWA 2VTEA 1QGZA 3GJ0A 5A9TA 2HJSA 2HCJB 2VXYA 2NAFA 4DQLA 5CH8A 1BGVA 4CQMA 1Y6QA 5ALSA 5HIJA 3WL4A 3SEFA 4ZCLA 2DHEA 1MFPA 3AV0B 3EZ6A 2W2QA 1OUMA 4BZQA 3ORRA 2F62A 4EEKA 1A8QA 1P2FA 5HGXA 1X1AA 2RGNA 3JX9A 5ERGB 3U48A 2ODQA 3CLRD 5CB4F 4FFBA 4AZ0B 5KZMB 3V46A 1QAOA 5K3CA 1L5RA 2J9XB 3PIIA 1A69A 4IIYA 4PZUA 5BSGA 3MINA 1N77A 4LTNA 4YQEA 2GD2A 1T9ZA 4UQOA 3P94A 4BNFA 4PSUA 1ZXBA 3HEMA 5IABA 1PVOA 3MCZA 2C59A 3H3JA 4O25A 2F8MA 3OZRA 5IHXA 1CR0A 4GP6A 4NU6A 4M8KA 4DVJA 3H5AA 4BNWA 3L8CA 3K9GA 2NM0A 1AB6A 2L19A 3DG9A 1L8AA 4Y1FA 5GTDA 3A05A 1LPSA 1QH8B 2CE7A 3OCYA 2XCRB 1CZLA 2X7XA 2E4WA 5HS6A 1QIGA 3B3GA 3H4IA 3BMOB 4HNQA 5JNSA 2XA1A 1EEHA 1WOMA 5JVDA 3AOEA 1R0XA 3UWKA 3U3MA 5A4MS 2OPHA 3MFYA 2X2EA 4GWKA 5IAOA 1F38A 2VDVE 5IK2D 4ER3A 1ZM4A 1KH2A 1TM7E 2DSNA 4FOTA 1JJFA 4J07A 3QXCA 5KTPA 1L7NA 3A6JA 1Y6FA 2PMBA 1GU0A 2J67A 1SK8A 2V58A 1G8SA 4I1IA 4N8EA 3ROXA 4AZSA 1F8GA 4JP1A 5K05A 4G8BA 5JT1A 1YS4A 1V5WA 1TYBE 3FROA 4N7MA 2C7OA 3MD9A 4UVIA 3HUTA 1I01A 4RNDB 4O0LA 5KJFA 2BKAA 3NORA 5F77A 2X6RA 1YRYE 5T8KA 2ZWPA 4BLVA 2EX0A 3Q85A 4Z9BA 1FDWA 2YJ3A 3OUUA 4TTPA 2MMGA 3OE7A 4CMEA 4DLUA 1E58A 3R0ZA 5KTTA 2QG6A 3T7KA 1HDCA 5IRCD 1J9EA 1PT6A 3LOUA 5F3WB 1Q6ZA 3N2LA 3Q0IA 1FUEA 1NKVA 4Q24A 2F64A 5SZKB 1HO3A 3L6OO 2ZIXB 1TD1A 2CYAA 4FHFA 3JQ9C 3TI7A 1H8EA 1TO2E 1YK0A 3KQSA 3VKUA 4XD2A 1L3BA 4H7JA 3OFVA 2OHOA 2DMRA 3V1MA 4Z7QB 4D56A 2XODA 2BKLA 4Q1CA 4W7IA 1H9AA 2FZ5A 3RV4A 1DHRA 2E5WA 2N46A 3GZNA 2XB4A 4I1YA 3TQIA 3KJGA 5E8RA 2AJDA 1A77A 2F3TA 2JAUA 5T6BA 4B3RB 4CQNA 3DDCA 4RA9B 5J4KA 3ME5A 3O1LA 2XCUA 3KVVA 2TMDA 4JFAA 2B4TO 3EZGA 3OG9A 1G3IA 1VHJA 4A6EA 1Z4OA 2H1FA 2R751 2Q7XA 3O26A 3K15A 5BSKA 1QORA 2HTEA 1XZIA 1STOA 1L4GA 4PN7A 5KHOC 2Y0EA 1R3DA 2Y1EA 2FW0A 3EGXB 4QYSA 3W6PA 3TB4A 4E03A 1DSSG 4PYNA 5IARA 2QBYA 4C2TA 1JQJC 1RHJA 2G80A 4ZT4A 2OM2A 1GPMA 8LDHA 2OQVA 1M8PA 3EW7A 3JWPA 3K0HA 3OD5A 3JD4A 3LUBA 4HG2A 5E7IA 1OIXA 3AONB 1T2NA 1HA3A 3DW1X 3ZHUA 4IICA 1UKYA 1KOGA 1NP3A 1NQ5A 2G40A 4HGYA 4ARIA 5FBRB 2WSMA 3R76A 2IKQA 3SK0A 5LLTA 2PVPA 2XHEA 1SZCA 2RGXA 3GLHB 4Y6QA 2NU6B 3HKDA 4J0QA 3X3HA 4GLFA 1PS8A 3GUUA 3Q0TA 5KWSA 1DNPA 1KFBB 2AFHA 3CH5A 2V7VA 4PINA 1GYQA 2ZJ2A 1RZRD 2W6ZA 3ZLUA 4F3CA 5DMXA 1PV4A 1TUGA 3HCFA 4MIYA 5AIAA 2HQOA 2O2XA 4KPUB 3BXXA 1MP0A 4JP2A 3WIUA 3P0RA 4B6EA 5EEGA 2GAIA 1UBCA 2DE0X 3UC5A 4GE3A 2WDZA 5BQ3A 4D41A 3TVDA 4ZIRA 3RYHB 5JR3A 5KX5A 4ZEWA 4BCDA 1IIBA 3EVBA 2WWIA 1P0MA 4GI7A 2CDCA 4BYMA 3BIXA 1UC5B 1VBKA 4PTLA 4CTMA 3EPJA 1B42A 1CFJA 5LIRA 1JLHA 2W4QA 1O96B 2WSYB 1RRGA 4H7EA 5HKOA 3GIWA 4KO4S 3U1TA 4BIIA 3K71B 2GJSA 3M6AA 4RTQA 1GYPA 3GLFE 2GGSA 3RTGA 1PX2A 5H0IA 1ESCA 4RK7A 4QBKA 3TIFA 2HXGA 2YUTA 2Z2IA 1SRQA 3N76A 4TS1A 1U28A 1OFIA 4XX1A 3LSTA 4X84A 4YFYA 4BFCA 4KO2S 3P26A 2RJNA 5BNWA 1YS6A 5K0EA 1G291 5ENVA 1DARA 3HUFA 1Z6GA 3L9WA 1X14A 4IYRA 5HKAA 1O4VA 3Q9NA 3KQOA 3PVSA 5IJ0B 2CL0X 3H2KA 2HFKA 1ACJA 1YR9A 5FHRA 2Z2ZA 3VSAA 4B48A 5J43A 2P4UA 2GN8A 1B00A 1R9GA 3ZD6A 1W52X 3KK0A 1E2GA 3PC8A 4FHDA 5FOQA 4P3XA 1LZLA 4CQLA 2AYZA 4XFDA 1WSAA 1W87A 3IRUA 2WHEA 4KLAA 2FWRA 2YWCA 1F9EA 4H7PA 2O2CA 4QXAA 3OTWA 4LGYA 4Q18A 1UBUS 1LLCA 3VOTA 2P7HA 4DBZA 4DCCA 5TXGA 2TYSB 4LPSA 3E7WA 5FLXA 1OJLA 4PW0A 4DUZB 1S02A 4XQGA 4X1YB 3GI1A 1F2UB 1C3LA 4KLZA 4TSFD 4UD6A 1E2PA 1WUTA 4LRQA 3JQ8A 2GFHA 3GXBA 5CTAA 821PA 1TGVA 1EQ2A 3HKCA 4L1KA 3AVYA 5DT9A 3ZE8A 2Z4SA 4F84A 1CJCA 1I9CA 2PMKA 2E2WA 2ZI5A 1H2YA 3CKLA 5IWAB 3SM9A 3D8NA 1QMPA 1VB5A 3G5AA 5BVGB 1BAPA 3WY9A 1HTBA 5BSMA 4DM3A 3HLYA 4C3OB 2WIDA 3BWEA 2BTEA 3C41J 2ZPTX 3AG5A 4XFJA 1MFZA 7MDHA 3OLQA 3JATA 3PX7A 3FLBA 1OAOC 3BVPA 3TK1A 4UFOA 4UULA 1NJ8A 4X95A 1YXMA 3CVUA 2FPXA 5D7NA 4C2UA 3SEQA 3PF9A 3J81A 3RC3A 5CAEA 5EE9A 5ES4B 5BWBA 3I9MA 1TTTA 3D0KA 4ECAA 1CJTC 4U2CA 3Q72A 2A2ZA 4C0KA 4NV1A 3TQOA 1AMNA 4RY9A 1SG9A 4RULA 3BE4A 3DEIA 5BO5A 1HGXA 1PUIA 2I7TA 2WB4A 2EARA 4FCWA 1LDMA 2IE8A 4L28A 2OAP1 2C2OA 5IVHA 2QRGA 2C03A 1KYYA 4Y9RA 4FNOA 3JQ7B 4CMKA 4N6OA 2YQZA 2I54A 3LKBA 2V9ZA 5JLJA 4Z8XA 5LQCA 5JNWA 3ZWKA 2G7MC 3CUYA 3GEEA 5SZHB 1YWGO 2GAOA 1JR2A 2ZWVA 3QUAA 5IC4A 2ZRNA 1HMPA 2VHYA 3WSVA 2Y71A 4UEQA 5DKFA 3SAJA 1DFHA 1L6RA 4D42A 2AHOA 1EXDA 3RYCA 1XQYA 4QYIB 1QLHA 4E1VA 4PBRA 3T1YB 1Z3IX 2GLTA 1CQJA 1CJKC 1H0SA 1VI6A 1YOVA 3EXEA 5D3MB 1ZJJA 2CLFB 3AUSA 3O8BA 4ND1A 1E4EA 3INGA 4UVHA 3G5LA