1L5SA

Human liver glycogen phosphorylase complexed with uric acid, n-acetyl-beta-d-glucopyranosylamine, and cp-403,700
Total Genus 336
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
336
sequence length
810
structure length
793
Chain Sequence
ENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPNDDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKASKFVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Glycogen phosphorylase, liver form
publication title Structure-activity analysis of the purine binding site of human liver glycogen phosphorylase.
pubmed doi rcsb
source organism Homo sapiens
total genus 336
structure length 793
sequence length 810
chains with identical sequence B
ec nomenclature ec 2.4.1.1: Glycogen phosphorylase.
pdb deposition date 2002-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00343 Phosphorylase Carbohydrate phosphorylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1l5sA02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1l5sA01
1XC7A 2G9UA 4HWGA 3DDWA 1L5QA 2QRMA 2R4TA 3ZCPA 5C1DA 4GYWA 1F0KA 3CUTA 1P2DA 1HLFA 4FKZA 4YUAA 2H1FA 3Q3EA 1XOIA 4N3AA 4MHOA 2OFFA 4GZ3A 3L7AA 1JIVA 3T3EA 2SKCA 3TAXA 4WHMA 3MS2A 1Z62A 3CEHA 1Z8DA 4RIIA 1JEJA 4RIFA 4N39A 2X0FA 2FFRA 1FTQA 1C3JA 3RT1A 5D01A 4QLBA 1IXYA 1WUYA 1GZ5A 3C48A 1JG7A 1NOIA 2GPNA 4F97A 2IEIA 3G2HA 4XIFA 3DDSA 3OKPA 1P2BA 4KQ1A 2G9RA 1Y6FA 1GPBA 3MRVA 1B4DA 3D0QA 4GZ6A 4CTOA 3S29A 1L5WA 1WW2A 3TOVA 4RIHA 2R60A 2XCIA 2ECPA 2X0EA 1AHPA 3MTBA 2P6PA 2SKDA 1SXQA 2GEJA 1C8KA 5BNWA 1GPAA 3MS7A 1RRVA 3MSCA 3H4IA 1YA6A 3CUUA 1NOKA 2GPBA 3MTAA 3FROA 2PQ6A 4NESA 1KTIA 2PRIA 2ACWA 4GYYA 4YI5A 3L7BA 3BD7A 1JIUA 2QN2A 2BGTA 3BCUA 2QNBA 1NVKA 2VCEA 3D0RA 3MRXA 1GFZA 2GEKA 2X6RA 2F3SA 3HBNA 3MT9A 1PYGA 3T7DA 1FU8A 3UYLA 2IV3A 3VDNB 3HBMA 5I45A 2FETA 2GT1A 2C1ZA 2F9FA 3S27A 3L7CA 3ZCQA 3RHZA 3Q3IA 3MT8A 2HY7A 1P4JA 1Y8ZA 4MHSA 3RSZA 1QKJA 2BGUA 3NPAA 5JTTA 3MQFA 2PRJA 1XV5A 4WACA 2Q6VA 3OY2A 1P29A 4EKYA 4BQIA 4CTMA 1L5SA 2IEGA 1J39A 4NC9A 3COPA 3G2KA 3G2IA 3BD8A 3E3NA 3ZCSA 3CEMA 4NEQA 2X6QA 3BEOA 4EL0A 3QHPA 2QLLA 3SYMA 2XCUA 4GZ5A 1H5UA 1E1YA 3PE3A 4M83A 4FZRA 2PYIA 4YI3A 5IKPA 3SYRA 1FTYA 1FU4A 4PQGA 4BQFA 3GUHA 4N9WA 2C1XA 3MS4A 4M60A 4X7PA 1JIXA 3HBJA 3H4TA 3S28A 4AMGA 4Z5XA 3EBPA 4L22A 2IV7A 2QLNA 2XA1A 3ZCVA 1FU7A 5TVGA 3C4VA 1XL1A 2QN8A 2R4UA 4X7MA 2QRQA 1E4OA 3BCSA 1RZVA 3PE4A 3CUWA 2F3QA 1PNVA 2F3UA 5DLDA 3GPBA 4BFCA 3DZCA 1K06A 2VSYA 1O6CA 3BD6A 4GPBA 5TMEA 1PSWA 3CV3A 4X6LA 4RBNA 1UQTA 1M5RA 3MT7A 2GPAA 4MI3A 4M7PA 2ATIA 4N3BA 1C8LA 1GGNA 2WTXA 5DXFA 2AMVA 4RELA 3OTHA 4MI6A 3BDAA 2QN3A 2XGOA 3T3DA 5IKOA 2VSNA 3VDMA 3VUFA 2FF5A 2ZB2A 1WV1A 1GG8A 2AV6A 3D1JA 2XGSA 4KQMA 3QKWA 2R66A 5GPBA 1WUTA 3CEJA 2AZDA 2IUYA 3T5TA 2BISA 2AW3A 1JG6A 1FA9A 1RZUA 1K08A 3RSCA 5HXAA 1L5VA 3OTGA 3IAAA 2KS6A 3BCRA 3O3CA 2IYFA 3G2LA 1SXPA 1FTWA 3WADA 4F96A 2QRHA 1FC0A 2XGMA 3MBOA 3G2NA 2QN1A 3T3HA 1L7XA 8GPBA 1V4VA 1P4HA 3S0JA 1NLMA 4MRAA 5ENZA 2YJNA 2F3PA 4CDRA 1AXRA 4XI9A 3C4QA 2JJMA 3NB0A 2QZSA 3S2UA 2X0DA 1UQUA 2BFWA 1GPYA 4REMA 2JLBA 4RENA 4WADA 3IA7A 1NZDA 3Q3HA 3T3GA 3NP9A 3ZCRA 4AY6A 1UZUA 3VUEA 2XA9A 4MI9A 2VG8A 2QN9A 4F9FA 4RIEA 4AMBA 4CTNA 4KQ2A 1EM6A 3L01A 5TMDA 1XL0A 2G9QA 2QRPA 5D00A 2C4MA 3CUYA 3E3OA 7GPBA 3AMVA 3NP7A 5JTUA 3CUVA 3G2JA 2H1HA 4LEIA 3EBOA 2XMPA 1LWNA 2IYAA 1IIRA 1L6IA 3ZCTA 1NZFA 3E3LA 1A8IA 1P4GA 2ASVA 3WC4A 2IW1A 3OTIA 1Z6PA 1NOJA 3T3IA 1WW3A 3L7DA 1QM5A 1WV0A 2QLMA 3OT5A 3ZCUA 3OY7A 2G9VA 4MICA 3WAGA 2VCHA 2QRGA 2PYDA 2GM9A 5DU2A 3TSAA 3L79A 1P2GA 4W6QA 1BX3A 6GPBA 4EL5A 5TMBA 2R68A 4BQEA 4RIGA 1ABBA 3DD1A 2ACVA 3OKCA 3NCHA 2JZCA 1Z6QA 9GPBA 1PN3A 1L5RA 1FS4A 4AN4A 1C50A 1F6DA 3CX4A 4AY5A 1Y6GA 2GJ4A 1LWOA 3MTDA 4LDPA 4HLNA 1YGPA 2XA2A 3HBFA 2C9ZA 4EKEA 5LQDA 3MRTA 4G2TA 2SKEA 3NC4A 3OKAA 1EXVA 4EJ2A 4N3CA 3NAZA 4X7RA 3UYKA 1VGVA 2QN7A 2O6LA 1XKXA
chains in the Genus database with same CATH superfamily
1X8LA 3C5HA 1D5WA 3DAGA 1GL7A 1X39A 3G2PA 2Q1UA 1S3SA 4PYQA 4PYKA 1KVQA 1F0PA 1UAYA 3VPCA 4EF6A 1Z0JA 4UD6A 2BFBB 5LL6P 2V7XA 2EERA 3P52A 2GO1A 1ADGA 2C8JA 3PXAA 1R8YA 2R5FA 4EY6A 3HE3A 1Q95A 2Q3MA 4JWTA 1YE3A 4O2BF 3WZMA 2VAMA 4HNQA 2ODPA 3E3MA 2WZBA 3LWZA 1TAGA 1IE3A 2PS9A 3UAYA 4FKZA 3G9UA 3R0VA 4KJZA 4TTRA 1YRHA 3KM0A 4IJUA 1G5RA 1E59A 3UFXA 3KU4A 2Q27A 4RZXA 2JLUA 1JE1A 4GZ3A 1ORDA 3IUYA 4F85A 4W5TA 2F1OA 1RWVA 3CEAA 5ALLA 2G3YA 1IK4A 1HSZA 4JSTA 3VMFA 5A4JA 5KOIA 4J6FA 5DF1A 3ZY4A 4YPFA 2Y8EA 4RKRA 1C3EA 1G8PA 4B7CA 3OZDA 1ZS9A 1ZQ1A 2GZRA 4I5FA 3U44A 1T6BY 5HDBB 1JHXA 2CNNA 1KI3A 5FAKA 2PGJA 1NR7A 2J5RA 4MW4A 3FDJA 3Q2OA 5FUBA 3AHIA 1RRMA 1P9WA 1YDHA 3VTFA 4Q6BA 3AB8A 1Q6ZA 3OPVA 1XVAA 1IXYA 3PVSA 5A9SB 2J3IA 1D2EA 4AMZA 2IZ1A 4XFDA 5JZ9A 1SK9A 2HX1A 2IC5A 1J0XO 1YE5A 4AFNA 4M99A 1YR3A 2QOEA 3WTCA 4F91B 1EFHA 1N0UA 1C5KA 3CLUC 5HZHA 4NENB 5CA0A 2EJBA 5DTMA 1FQJA 3FUWA 2JI9A 2CJPA 3MERA 3TLAA 2ZYRA 2XGGA 5E0KB 3WICA 4NV0A 3PC8C 3REQA 5I3CA 1H22A 2DRIA 3WSWA 2FCAA 3AW9A 4G0NA 3OEHD 1XJQA 3DR5A 3TAHA 2JATA 1I5EA 1EGAA 2FSSA 3FGZA 3V32A 3H1FA 3SCZA 3IIKA 4M1TA 2V1UA 4CTOA 4N49A 3LKBA 1PR2A 3PNMA 1UOPA 1WUKS 2I6GA 4U2KA 1ZY2A 2W8ZA 1V25A 1NSFA 4NR0A 4Q21A 4BN5A 1WDKA 2BR4A 1VCHA 4FFDA 1U4SA 1ZIYA 3IOBA 3I04M 3OIUA 4Z4QA 1W1IA 4KR3A 1I4EB 4I8DA 2PQ2A 1I3MA 1JHRA 2HREA 3PGXA 3FM9A 1G291 1DP4A 3FHLA 4ZEXA 4YMGA 2WD7A 4FMBB 4AQDA 4UHDA 1G8GA 3MS7A 3C3XA 3D5EA 1KYQA 3PYXA 4QUHA 4JAVC 4OQNA 2PSEA 2LP4Y 2ZIWB 4RNDB 5C4MA 3QKRB 1Z0SA 2FU5C 4NESA 1Z16A 1CKEA 1OFIA 2GBGA 1MIOA 1YFKA 5BMOA 1XXLA 4I8XA 4D0LB 3L7BA 3CKMA 4PXYA 3MGAA 4AQYB 2I62A 2Q6LA 2QY6A 2P2SA 3GCXA 2ZRDA 3UWSA 1YK0A 2GDZA 1XT6A 1ENOA 4QLAA 4QOSA 1S2OA 1NKSA 1M6WA 1EFRD 3G49A 2JB9A 4A8JC 3AOGA 4B3CA 2ZANA 2PFGA 5A3SA 1SVKA 3KQWA 1U1EA 1XKTA 4LG1A 4C03A 1FDTA 4ZYXA 1LD3A 1ZJZA 1EDDA 2RGWA 1Z18A 3N39C 3PL1A 4P5EA 3B70A 1RIIA 3JALB 1PLJA 3QG1A 5DN6D 1P4AA 5A6SA 4CV3A 2VVTA 3L6RA 2VQEB 1YQTA 4F1WA 5AP9A 1EUYA 1L7MA 1T3ZA 1NTRA 3E84A 4QO7A 3PHHA 3I2GA 1ZM9A 4WL0A 2PEYA 2PANA 3B8EA 1CP2A 1TZ2A 4TKVA 1GRCA 3R8CA 5AXDA 1U90A 4K6OA 4NFYA 4IEFB 2FX3A 2R1VA 2BMJA 4HX2A 1KE1A 1TK3A 4OQLA 2ZITA 4C7VA 4EJMA 3L6BA 2J8ZA 4OQQA 4WN3A 1RYFA 3R44A 4FP9A 1PZEA 3GR6A 4M1ZA 1PFUA 4NCJA 3IRVA 4IWNA 5EINA 3E2MA 3GW8A 1XJ0A 1JDZA 3AHEA 3EISA 1K8XB 3CRNA 4CDMA 2C2HA 2J67A 1PWEA 2ZT6A 3PQ6A 5TPZD 1GDTA 3R6TA 4B47A 1OYYA 2Q6VA 5BOSB 1M1UA 3KFVA 3L4KA 4GT1A 3ZQ4A 1ZCJA 1NRIA 4I5GA 2Q49A 2G09A 3AERB 2P11A 3DZBA 2VPYA 1SUEA 2W2QA 1P5RA 1CUXA 5JQWA 3K9GA 3PIDA 5EJMA 1IN6A 1QHIA 4ZHQB 4P0PB 1USGA 1RBMA 1Y7LA 5D7NA 4R1TA 3KEFA 3ZEAA 3ZJYA 5ALEA 3CVVA 4KIUA 4YAKA 3IL2A 3JVUA 1MB2A 4BP3A 3QMWA 2QGFA 1HYBA 3DAHA 4B87A 5IT5A 3ASVA 1ZYUA 5F21A 3TUIC 3CIOA 3DEJA 3ZKAA 2JIZA 3A1NA 2HV8A 1MC8A 1IXZA 1N8KA 3ISTA 5ALUA 4WK0B 4ZQFA 4TS9A 4A0RA 5BQFA 5JSQA 5KEIA 4TTJA 1Z7EA 3H2IA 4M53A 3TW4A 1GPJA 5GVRA 1CRZA 1G18A 1YRBA 1T3TA 3KT8A 3FHCB 3SYRA 3C7TA 2C31A 3SICE 3LKDA 3JTMA 3VFDA 2WKPA 1XHEA 3C97A 1I94B 2OFPA 1QZXA 3HVJA 2ZT5A 3L0CA 3Q85A 4LF7B 3NYWA 4HS9A 4XWOA 1U2QA 1L7DA 1Y42X 3ER6A 3PENA 4BMCA 4JI4B 1RPJA 2AOVA 2XUZA 1XCLA 3CB4A 3MVEA 3R3ZA 4UOZA 2J7KA 1T2AA 3DMGA 4H3VA 4W7SA 1KZ6A 2FZLA 5ADHA 3VR5D 5K05A 1XDWA 2PGNA 2PD6A 3O94A 3AB7A 3LKVA 3ZZMA 4CMGA 3D6JA 1OI2A 4GBED 1LVUA 3AJAA 4MAFA 5L3QA 4BRZA 1VRVA 4MKZA 1EAMA 1NVUQ 1IQRA 3NGMA 5AQ1A 5FD8A 1VPDA 2YUTA 3FY4A 4FIZA 2FPUA 3SC3A 1EQAA 2IYZA 3ZN2A 5I7HA 3JQPA 1Z74A 3ONEA 1RJFA 1FFDA 4HLCA 1M1NA 2XMZA 4R3UC 5DN9A 2C3MA 4BO6A 2B0CA 2P9GA 5I4KA 5HF8A 5AVSA 2DPHA 3BULA 4JLBA 4NOLA 3GPBA 1A9QA 1FVOA 2WC1A 3KQOA 2WF9A 2Z58A 4DSZA 5CH8A 1CEYA 3FMIA 2RC5A 5EMLA 2GS9A 4DRXA 2QBYA 1XLUA 1HEYA 1U2RA 4G0ZA 1J2RA 2QRJA 4GGMX 1KQFA 1CIPA 4MR9B 3Q1KA 1JDUA 2RIPA 1QIGA 3KQPA 4ZCMA 3E22B 3LHSA 2VYFA 4WT7A 3TI9A 3V8BA 4E12A 2ZRCA 1JDPA 1YR7A 2YVQA 4MQFA 4N82A 1F9EA 1E9FA 3L0DA 1FF9A 1KYVA 3PUKA 1NL3A 2AG6A 5T6BA 2PWPA 2PZGA 1FK8A 3STYA 5CYPA 1FYWA 4AIRA 1NRJB 2ZVPX 4BVHA 4CIWA 3OOJA 2H1WA 2FWPA 1HYQA 3LP8A 1O1YA 4M38A 3N07A 4YV1A 3MLBA 3QXJA 2SCUB 4UU7A 1G2QA 1J6UA 3C74A 2G71A 4QDTA 3FG9A 2QVCA 2VBIA 5JE8A 1Y34E 3D3WB 1F2VA 4TV9F 2E6UX 1CZHA 2QMQA 1KMNA 2GN8A 3D8NA 3OMLA 1ZPDA 3PI6A 4PSCA 4WCFA 4O6VA 5EPOA 3ST7A 4MR7A 3ZWMA 4CXMA 4A0QA 4AAYA 1DX4A 1PNRA 1BE6A 1JHDA 2IQIA 1NAIA 2R66A 3O90A 3SSOA 4EY3A 3RC1A 3IVMA 4CEJA 3OSZA 4GIBA 2HBZA 1Z0AA 3C6KA 4N1AA 1EX7A 3E6AA 2Y66A 1S9HA 2AMFA 2NTNA 3ZWKA 5E3IA 1L9XA 2XQVA 2BBSA 5LP6C 1E66A 1TFRA 3G1UA 3TNFA 4G86A 3TMAA 2OE2A 3LP5A 3QBEA 2NZ8A 5DNEA 3IAAA 4ZV7A 2RMKA 4O8ZA 4C5AA 3ZGVA 1W0KA 1CG6A 4YCSA 2IPAB 3BGVA 3KDAA 4QDXA 4C22A 2OOSA 4WXRA 4Y2JA 3P5BA 2D5LA 1VG0B 2QRHA 4P4SA 3JYLA 3KTFA 3MAAC 3VPGA 3PXCX 3N8IA 3ANYB 4WVFA 2W6IA 1PF7E 4Y8VA 1JZQA 3CFYA 1A97A 1DAHA 1O7JA 1K66A 1VSBA 1F51E 1V1RB 2VEDA 2OO5A 2PZLA 4Y2XA 5BV2P 3AKZA 2G08A 2WAXA 5MGNA 3OZCA 1ZMRA 4K9MA 4IJ6A 1VIAA 2V7PA 1D8TA 4OQMA 4BIIA 1Z5OA 3M1IA 3ROQA 3S2UA 1J70A 2WWRA 2YZMA 4MGYR 4F2GA 4TT3D 1GNSA 4REMA 1ABEA 2J0EA 3CLTD 5BUSA 1DKUA 3L7MA 3I45A 4MRMB 4CMKA 1DV1A 5CM2Z 4MSUA 2Y71A 2BM0A 4HJRA 3W8RA 1YDEA 4PR0A 5K3EA 2A5FA 1RXIA 3PC2A 4W8HA 1HM5A 4ZOCA 2DFVA 4AJJA 3ZTYA 3K8YA 1GSAA 2WJVA 1A5ZA 3GI1A 3KJNA 2MYPA 3P7MA 3L0YA 4UMEA 3K35A 3L0BA 2ADOA 3QLEA 3N53A 2A9FA 2HXGA 2COEA 1QIIA 2P3QA 1N7HA 4GG1A 3X2EA 4DR3B 3RS8A 2V0CA 3EGCA 5TC4A 4DWJA 3QMVA 3V97A 2YQZA 4AMBA 3GQVA 4H6PA 4WERA 1JWLA 2YOHA 5I8PA 4LYJA 4C01A 4H7FA 5LQSA 3U09A 1YR1A 4HS4A 3GD7A 4Z9BA 5B1DA 3UK7A 4PN3A 2C57A 3OLQA 3GAAA 4DJ5X 3I2HA 1XDUA 1RI5A 1YZFA 3F2VA 4LA4A 4QRIA 3LW8A 4EG0A 1B8PA 2A1IA 3M89A 4RULA 2J4DA 5L3RA 1PJBA 1R1DA 5M34A 3IKJA 1A98A 2ZGVA 3NEYA 4YUXA 5KDOA 2VYVD 1X94A 4QQFA 4X1IA 5KJ1A 3I9FA 4PG7A 4CLRB 1I8TA 3EZLA 4YROA 5IBRA 4EGCB 1Q0SA 3CZ5A 2QAJA 3FHJA 1OREA 1D6JA 3QX9A 3U4CA 3ABOB 2ZKIA 1IJEA 3MTGA 3WBBA 5IYZA 2WM3A 2OHXA 1OBCA 3HVKA 4GKJB 1Z13A 2QZJA 2ZQZA 3AR5A 1E32A 1K3UB 2ECOA 2W6QA 3W5IA 2GQ0A 1KI6B 3MG9A 2RHBA 4M89A 3JQ8A 4FHGA 3SJCA 4R5MA 5JAPA 2O8DB 1V16A 3AEUA 1JECA 4LZZA 2PMDA 1GA4A 4QKQA 3OEHA 1ULZA 4FWIB 4CPDA 1KMHB 1GTZA 2AWNA 3KYCB 1IVSA 2JJYA 4DIEA 1K0UA 3MB5A 5CAEB 1ZRHA 3PHGA 1MJGA 3WNCA 3ONVA 2YOFA 5FOUA 4O4IA 4DR5B 4KFUA 2JGLA 1E2FA 1UKYA 4LWOA 2ZIVB 1HZZC 4FNOA 4MTCA 4CMJA 4ZD6A 4UHEA 1U8ZA 1YB5A 3NIDB 3D6NB 4YXFA 5JCOC 2GM9A 1Q6YA 2GJSA 2D5BA 3HR7A 3FPJA 4EVSA 2FN3A 3TX2A 1JJBA 3LDAA 4LK3A 3AQ4A 3AKYA 2YHIB 3R6DA 4FOLA 3GAFA 1EXWA 2EC5A 2HMVA 3FUUA 4OL9A 4REQB 1UMCB 3RLIA 2QVXX 5BMVA 4MR8A 3B13B 1SG9A 4RGQA 2WF5A 3FH0A 2A0FA 1U2GA 2W83A 4MUIA 5IJXA 1UPCA 3OZVA 4GUAA 1DXOA 1G17A 1TVMA 1QMPA 3JWHA 3RSHA 3TZBA 1ZW6A 5A4MS 3V8QA 3KTAB 3HVHA 1T4DA 5MN4A 3AEZA 4DCSA 5HPYB 1YF3A 2CL6X 3GPIA 1BJKA 3QP9A 2RAFA 4DBLE 1ZNXA 1XCOA 2JGNA 1GTJ1 4YAOA 1V8OA 3X1XA 1EMDA 2X42A 1EP3B 2KE5A 1ZMBA 3F49S 4FEYA 1EFTA 4OJMX 1FCJA 4D6XA 4CQMB 4IIJF 2YZGA 1QQAA 3BERA 2VAWA 3P2JA 3P0EA 4J4HA 4HATA 3CVWA 3FBGA 1O95C 1WVGA 3DG9A 5CM9C 3OQBA 3RU9A 3CE9A 4QQRA 4XLLA 2OQ2A 3JYHA 4AY5A 3JARB 2FSIA 3BRWD 2CUZA 3PA8A 1LUAA 5DN6A 4PS1A 3BSFA 5JLAA 3U4IA 1NDUA 4JUBA 3W5BA 2SICE 3PICA 2BJHA 5K4HA 1E3JA 1RYNA 2DWUA 3AWIA 3LUPA 5TS3A 4C4OA 1Z2PX 4YDHB 4DLWA 1W5AA 4CM4A 2OSVA 4L0CA 1FXWA 4I3GA 4HV4A 1R0LA 4R8LA 3TUZC 1MX1A 3EQ2A 1UWKA 5U1PA 4TXNA 3RFCA 5CT4A 3IMKA 2A2ZA 3E9DA 6Q21A 2EZ4A 1M1YA 5F5XA 3ZXUB 1PFYA 1VBKA 4M6WA 3QKUA 3TLJA 1F1BA 3ELWA 4Y67A 3SZRA 2QN7A 4F4UA 5JNRA 1P44A 3U80A 4EAAA 4J2OA 1TT5A 1HNXB 1AA9A 4L73A 3AY6A 3C16C 5C7LO 5DI9A 4PNHA 3RFVA 2AYXA 3TF5A 2ZM5A 3DDWA 1T9DA 4BCBA 4WBSA 2AI2A 2V7UA 4HDQB 3WI7A 1L4GA 2Z5VA 1WTCA 2VH1A 1QUFA 2W0SA 4IF4A 1GDHA 3R3UA 1QYCA 2V5UA 1CUZA 2MMGA 3IESA 3KJEA 1KS2A 4G1CA 3GELA 3PRHA 2HK6A 4CT0A 1P2DA 5JXGA 4JB2A 1F8GA 2EQBA 3FTQA 1LJLA 1YQWA 2GPTA 5IHPA 2R8ZA 3HEMA 4IPTA 4QL3A 1V71A 2V6FA 4IIDA 5TGZA 2C2BA 2Q0HA 4MUJA 2BHSA 2Z30A 3K6RA 1QOQB 5JZVA 4HVTA 1GRQA 1G9XA 1LBSA 3KO8A 4BFSA 1CDEA 4EJSB 1ZITA 1SVLA 2JBHA 4DEVA 4BJ3A 4EH1A 1NMSA 3W8FA 1DRUA 4EUKA 4KPFC 5JEEA 2P9JA 4YV0A 2JCVA 1FTQA 1TUBA 1A9SA 4C4ZA 5AVQA 3U3OA 2NTYC 4AO8A 4D46A 4BO2A 2X2PA 2II6A 2OCXA 4N5IX 1C9MA 3KXPA 1M7BA 1E3SA 3BRSA 1LS1A 4P3NA 1NLYA 1ZG3A 5JR3A 4P86A 1GZ5A 1WSAA 2CZCA 1H2FA 2B7CA 1DS6A 1E6WA 4ZHSA 3HWSA 3FWNA 1H85A 1NOIA 1WXDA 3QWIA 2GF9A 1N32B 3MGBA 3MZ0A 3GLIA 4XVUA 1T9HA 3EA5A 1OGJA 3NV9A 1MZVA 4QZVA 1L5GB 1JDNA 2C5FA 3OQ6A 4XIFA 1EFKA 4R8SA 3LHKA 1E5TA 1ODFA 4RHCA 2XBMA 4AF7A 2BGWA 4RTJA 1JTFA 4ISBA 1KTVA 3MRVA 1GJRA 3TGWA 2M6LA 3W5UA 4AMUA 3MIIA 3JQAD 2PJZA 4KC0A 4TKUB 1Z83A 3V1LA 5ALMA 1DBPA 3DE4X 2C8KA 3ZGLA 2B37A 1XRQA 4BIMA 3K0FA 4ZAZA 3UCEA 1LDGA 1E5XA 2VOEA 3AL3A 2QTVA 4Q9JA 3SS7X 1A95A 1V2GA 2RH9B 4BPBA 3GN2A 2NPOA 2CL7X 1Y6RA 4DCCA 4EZIA 5LC1A 1IBKB 4NJOA 2HSWA 4FU0A 3BYZA 5DK6A 1RHJA 4Q9IA 1OJ7A 1PVVA 1LPPA 2FPRA 1PP4A 2FG5A 1P1KA 2OR3A 2IIBA 1ECPA 2VDRB 2VYNA 2YHSA 1Q7GA 3AUUA 4S2UA 3VC7A 5B36A 4KNYA 1NXPA 5HSGA 2B4YA 4R2WA 4BVKA 1GQ2A 3H9UA 1M0TA 2AFIA 2R8OA 2CLCX 3B38A 3OPNA 1CUJA 5CXQA 1RBZA 1TEHA 2IFTA 3QYAA 3HHPA 4XDHA 4RSMA 2W6PA 3RO7A 5JADA 4YMUA 3QFSA 2D59A 2EARA 1WNFA 4EA9A 4FYMA 2W00A 3QPBA 1DC8A 3M2TA 1T9CA 2FRDC 3W90A 3OCCA 4EMUA 4BGDA 2QIPA 1F2DA 2JAXA 4RMJA 2PMEA 3WSVA 3V8MA 3JWEA 2QYHA 2VKQA 4ZAYA 1TO1E 3KELA 4FNMA 1ZJWA 5JIBA 5ICFA 2GEKA 1IHOA 4QUBA 1VJTA 5EIXA 2WYWA 5I51A 4LSZA 2ZRIA 1GUBA 4R4JA 3HBNA 2Q4BA 3OLCX 2BHRA 2F1RA 3TNLA 3RTCA 1J2YA 4PVDA 5CPBA 1FIUA 2GDJA 3LECA 3G13A 4CLHA 4G5YA 2DUJA 4PFKA 2CJXA 2VDKB 3DCYA 2JHGA 1OWMA 2Q2WA 1LLDA 3PUWA 5KYKA 5A3RA 2B36A 4EABA 4IFIA 3Q3IA 3IPLA 1WVIA 2AFVA 2D1QA 5G0WA 4OP2A 5IUKC 2GI4A 2ISCA 4D9MA 1ZX1A 4MHSA 2H52A 2LIVA 5CVEA 3IAM6 2UZ0A 3L7NA 2A84A 1XXHE 1FP7A 1KZHA 3WZLA 1N2CE 1KDOA 4K7JA 1PO7A 1U8FO 3C85A 3U37A 1DPFA 3TFWA 1ZP6A 1HQYE 3DHEA 1F20A 3P0FA 4Y6RA 4ZI2A 1BFKA 4CEIA 1NF2A 2V74B 5ICCA 1T9GS 1SA0B 1XV5A 2EJWA 2VF2A 3BMNB 3B3JA 1RLUA 4UUPA 4V0SA 2IPOA 3PG5A 4WLOA 1WKVA 1CT9A 1VIVA 2JAWA 3OY2A 1PX0A 4LI0A 4BQIA 2KW5A 2ZRGA 2FPGA 2GYYA 5DHUA 4X1OA 1B6SA 5G4KB 3TXAA 5ALIA 4KIWA 1DBVO 1YB6A 4TUYB 3COPA 1FMTA 1T15A 3G2QA 3QYPA 3VKGA 2RHDA 2VRWA 2OB2A 2YVLA 5AJXA 5E6RB 2H0RA 5K6RA 4NEQA 3CONA 3ZU4A 3EXEB 3EXIB 3TTWA 3DVSX 3GVCA 2ZB4A 4D9JA 2OAP1 3B1JA 3RJTA 5J1TB 4MIYA 3O74A 1M2GA 3AP3A 2NPIA 4JJ8A 1NFFA 1CJSA 2XVZA 5EE9A 1G9SA 1V6CA 3N5KA 2XW6A 1P6QA 1V7PC 4LY6A 2DPGA 1YHNA 4DQKA 4E5PA 2BTEA 3ZWDA 4FBGA 3MWDA 5KJEA 3VJMA 1U0LA 1M6VB 1YU6A 1C4OA 3GLUA 3K0BA 4U63A 5A03A 1D9ZA 1VXRA 3E58A 3U81A 3RAPR 4B85A 1M7GA 5I7FA 2VJQA 3D8SA 5IAKA 3URMA 3ABQB 4IRMA 3UT5B 3HBJA 1PJ3A 5JNVA 2QF7A 2V4MA 2VYVA 5AVYA 1DHTA 1Z2AA 3PXXA 4DYDA 1WE2A 3G0BA 3S28A 3GT7A 1EUQA 4Q7JB 5D2CA 2RBEA 2TECE 5HBRA 4LGYA 3A1DA 1EDBA 3R3HA 3PR1A 4XWWA 3FFAA 1S6YA 1U0EA 3OPYB 2Y1GA 3OQPA 1GKYA 5D3ZA 4YWHA 4EI2A 5AUNB 1GD1O 4JEUA 2HCJB 1BOOA 1HFJA 1WF3A 3I0MA 3O92A 4M9SA 3HCDA 6PFKA 3I30X 5HX7A 4GR4A 1WZIA 3TLMA 3VR6H 3IP3A 2PUGA 1WD5A 1ZOPA 1TZJA 1E4OA 4C5CA 3LXMA 3LY8A 4HD8A 3UZUA 2HN9A 4X8LA 2UYCA 4MX8A 3A0RB 3PE4A 4DA6A 5AR1A 2HD4A 3FDXA 1WEHA 3R6LA 3IEKA 2AEMA 1N1DA 2GBPA 2GAJA 3E7DA 5HIIA 3QVXA 2IXDA 1N25A 1U9ZA 1YO6A 3LT0A 2CGEA 3QY0A 1ZZGA 5E7JA 1DKPA 1P1JA 1KI2A 3PUVA 3V9PA 2WP8J 4F60A 1BHJA 1LF0A 2PZFA 3D8HA 3IE1A 3IQZA 5BYBA 3EZ6A 5KJ6A 2VAVA 4IDPA 4F46A 1SU6A 1FLAA 4Y6PA 2OXRA 4TXMA 5DYNA 3TRJA 4OQEA 1I80A 2C7GA 3SYLA 1Z4JA 1CFZA 3B85A 3S2IA 3USCS 2OM6A 2YH2A 3GWZA 4RDHA 3PD0A 3QVSA 5AXCA 1JFVA 1LLCA 2GM5A 3MELA 3I92A 3KPJA 3QENA 4QWWA 3U3MA 3BRCA 1SBZA 4LTDA 4QT0A 3IT3A 1KDTA 2R8EA 2I6XA 1EFAA 1R0RE 5CFPA 2R79A 3PQ5A 5ES4B 3BE8A 4K9NA 3ZLVA 1MEOA 4OM8A 1LPMA 1YL7A 1EWTA 1UKAA 2H1VA 3Q6IA 1P7ZA 5JWOA 1ILWA 2H29A 1KO8A 2H5IA 4HZUB 3ZBQA 2E0IA 3SR4A 3UG7A 5A3QA 3AUAA 2D2FA 4TMTA 2PX2A 3ROGA 4BNLA 5K99A 2VSNA 1Z35A 2OO5C 4KQJA 5J2TA 1YONA 1GAEO 4HC4A 5JS7A 1RI1A 4L27A 3BTUA 4PINA 3RVRA 3W3ZB 4K0RA 1A7AA 4RM2A 1CEEA 4LGMA 3VH1A 1P45A 4S1OA 1E2BA 5C4IA 4AVYA 3HDGA 4GMHA 4MB0A 3NHUA 3UGJA 1F2TB 3DTYA 4I55B 2PBZA 3V8PA 1A7KA 3P26A 1MC5A 3EIHA 4OXXA 4E2ZA 4D96A 4MHTA 3VU1A 2OUKA 5K1ZA 4E5MA 4P3XA 1CR2A 4HDKA 2P1RA 2BISA 1Y4UA 3EGDB 3S44A 2ORVA 1LDBA 3BB1A 4QG3A 2K2QB 3VO9A 1IY0A 4FB4A 1PV4A 1K08A 2H8GA 1UKBA 1Y7HA 3L18A 3C3DA 4F1JA 3OU6A 3RC9A 3CF4G 5LMUB 4CMAA 3JVDA 4G5QA 3BHJA 2V3VA 2O2HA 4TV8F 1Y3DE 2WJ6A 2GOYA 3G0HA 2IRWA 5TY0A 1BG6A 1U02A 1PTJA 5D5QA 3WGMA 3LCJA 5EZQA 3D81A 5D5PA 1G6Q1 3PD1A 4Q66C 5KNDH 2E4XA 1P1HA 4ZAXA 3TRFA 3IVCA 1WCWA 2EKBA 1BHQ1 2Z4TA 5JJKA 3RAJA 5EFOA 5LFAA 4NYMR 3R7WA 4PCLA 2CKMA 1T0BA 4QQNA 1FJGB 2YJ4A 2GARA 3HHEA 2ECKA 2JFFA 4GQIA 4YACA 3GD5A 4Z0PA 3WMWA 3CZ4A 2IWHA 3EW7A 4K9DA 4RTPA 1AKWA 3Q1LA 3URKA 2YY7A 4NNPA 4S1VA 4UQLA 5BN1A 3AEKA 3H7IA 3Q3HA 1VE1A 2Z8XA 2IH5A 4WLFA 4Q24A 4X63A 4FMCB 5K0ZA 2XA9A 3TW6A 3TTTA 4TQUS 2EW2A 3HUEA 4XR9A 3HR4A 4IDAA 1JFFB 3D7NA 3FNGA 5DASA 4MPJA 1ZK1A 2R65A 3V1TC 3ZDXB 4ALIA 1E2LA 3QPAA 1XD2A 2YS6A 3WGUA 4C89A 5IC5A 3IEVA 4ODIA 5FOXA 1DQSA 2AN4A 1DEAA 1N36B 2PH5A 3RAFC 1JHMA 1GAWA 1EM6A 2JGEA 1I9CA 2ZRQA 4RK5A 2FEWB 4EO9A 2I29A 1FJHA 4RD1A 3ADDA 3NP7A 2CLOB 5EIFA 3E9ZA 3OIVA 5JQGB 3G2JA 3H87A 2L19A 1W25A 1ZJYA 4LFBB 2P4SA 3RABA 3BB4A 1RYHA 4D4JA 2HA3A 5LQJA 4OREX 1AUXA 4IVPA 3K9FC 3QKSA 3ZU2A 3NAMA 1AHNA 1BAPA 5BRNA 3ROTA 3ZNPA 1N92A 5IEBA 3STUA 4YRZA 2IYNA 1AV7A 1JYSA 2R6FA 4GDMA 1Y4AE 2GVNA 2YRFA 3WDLA 1N77A 4NCAA 3BILA 2EGGA 2OCIA 3V2HA 4A2CA 1YCDA 2Q5LA 4KR6A 3L8YA 3UM9A 1GXSA 4CLOA 1UXJA 1P33A 3OJFA 1ZLXA 3JQAA 3WLJA 3ROKA 4IDHA 3VAAA 2O2IA 1PFKA 1U7DA 2XWBF 4IFBA 3IMCA 2EX1A 2J4FA 2VDJA 1R0YA 3WAGA 3LPMA 3N8DA 3V8RA 4DQUA 4NABA 3U9SA 4BJ5A 4XFKA 1P5FA 5K0SA 5CA1A 2QRGA 2QGNA 1PQ4A 1Y1SA 3AI2A 4DAOA 4F5ZA 3RHFA 2RJ3A 4HJXA 3ZXXA 5JG7A 4U7DA 2XMCA 1M6YA 1SQ5A 3QE9Y 2AFHE 4RVNA 2XTNA 3QVGA 2PD3A 5CYOA 1TAUA 4MIKA 4LRWA 4WLVA 1DRVA 4Z8XA 3KOOA 2PK3A 3H11B 3GUVA 3PXUA 1QORA 1OR8A 2NUAA 3ZD7A 2G07A 1HO3A 4F45A 2AVDA 3JXEA 3QUSA 2D5AA 2GK6A 1GPH1 5FFMA 4E2FA 1GTMA 4M9QA 3U62A 1OTHA 1YMVA 4YJHB 5GQSA 3RLFA 2DBQA 4YJ3A 1RNLA 3UF0A 5LQRA 3R3XA 5REQA 2P79A 4C6TB 4B3SB 4JI2B 5EJ7A 3F67A 5C80A 4CM1A 4MKFA 2QTBA 3RIXA 3QXXA 4JELA 4PONA 4ZAWA 5GM1A 2ZUUA 4KXLA 4RXUA 5ALRA 3U7QA 4B7UA 1VLQA 5LP6B 4J7XA 4OATA 3TO5A 4QG7A 3EG5A 4N47A 3DKPA 2CLHB 2R7NA 2X7XA 3Q3CA 4YBRA 5DV9A 5J43A 1ZHOA 3SXUB 2ZJYA 2WIFA 5J2UA 2VHEA 4C87A 2H57A 3K4QA 4QEZA 3UIEA 3CX4A 1BMFA 1OXXK 3QFHA 4JL5A 5KVCA 5GJCA 4HNTA 2QTWB 2OAGA 5CRIA 4B2LA 1IEQA 5KDDA 1SU7A 1E4EA 1MJHA 1RMYA 2X41A 4QX6A 4YRCA 3SHFA 4YAGA 1DG1G 3T4EA 3GMSA 5HRAA 3NZEA 2OYCA 4MVJI 3A37A 1RI4A 4MRRA 4JIGA 1FE8A 3O8BA 2QP3A 1WR8A 4OQPA 4D56A 1F7UA 5KHLB 2R2GA 2Z8YA 4MKXA 1YZHA 3I01M 2J33A 2PCJA 3GJ3A 4JQZA 3NAZA 1XDSA 4RD3A 1U63A 3LQFA 3QBJA 4OEHA 1NJ6A 1O6GA 1N2ZA 4HAWA 4DY6A 4DR2B 3GOHA 2D7CA 1DU4A 4YRRA 5FO1A 1IHDA 1DWQA 4TGLA 4FCWA 1TAHA 4K88A 1KERA 5CVTA 4KN8A 1V11A 4IH4A 1XQYA 2BCEA 3FPLA 3BICA 5G02A 5SY4A 5JXWA 1DCFA 1PJQA 2HRBA 3BJRA 2PT7A 1M3SA 1F8FA 3F6PA 5BNZA 3CUTA 5KCZA 1IUKA 3KJIA 3M49A 4RHEA 5BYAA 5GMOA 2ZR8A 4MQEA 4WBXC 2OV2A 4MS4A 1NM5A 4MAAA 5DGXA 2WINI 3GROA 5A04A 1XOIA 2EW1A 2QJWA 1L7VC 4N3AA 5CLIA 2HHHB 1R0CA 4BFYA 3OTQA 5IAAA 2YN0A 4WCVA 5GGYA 3UV3A 3TAXA 3Q0EA 3EVBA 1VCMA 1ZMOA 3ZTTA 5CNMA 5K09A 1LDMA 4EF5A 3A9UA 2A3NA 4BNXA 5TF0A 2YV5A 3OOWA 1JEJA 4B6GA 4C76A 1FXSA 1U3WA 1XGKA 4LRSB 2E37A 1C7RA 3WIEA 1SCQA 4N5MA 4C14A 5DNCA 3TOSA 2CNOA 3FVVA 4JP3A 1UEIA 2XKKA 1XQWA 4JB0A 3JR7A 4PM4A 1FBNA 1GYRA 3WB2A 4KSYA 4GI1A 1K9VF 4X00A 1NQOA 4BZQA 1SBTA 4P33A 1O8CA 1PTKA 4BB5A 4H7HA 2H1RA 1T2EA 3IAUA 3OFJA 1T3GA 1DT3A 4K3UA 1D8AA 5L7WA 3HCNA 3GHYA 4FR0A 3PFWO 5LPNA 4OI2A 1MC1A 3ESYA 1W36D 3QVVA 4M0EA 3SX0A 2L18A 4WJZA 4RSHA 1NRWA 2VOJA 2Y27A 1KQ3A 3O4HA 1UIMA 3HDJA 3V7UA 1P2BA 2H2DA 1MDFA 2M9MA 1C3OB 2PL3A 2VP6A 3HKBA 4FIDA 4TTIA 1IN5A 3QM1A 1H93A 2P9EA 1UM8A 1GFSA 3EGEA 3OIDA 4B7AA 1XAIA 2WFLB 4P5DA 4DIOA 2RJOA 1NBWB 4ROSA 3VKVA 1VL1A 4NEGA 3TWOA 3OCUA 2VHQA 4PAMA 1SQFA 1R4AA 1XDDA 3D0QA 2X3UA 2VH5R 3MBKA 3GLSA 1JEYB 1G1AA 4J8PA 3PGVA 2WT8A 2CB0A 2O7QA 3HWRA 1KYTA 1JA0A 3FPSA 2H6EA 3U17A 1QQBA 2X0EA 3LH5A 2AC2A 3PT9A 3FDZA 2VR1A 4PG4A 1N6NA 4IDGA 1HX7A 2BZGA 5KS2A 2D8MA 1VLHA 2EBFX 2RHCA 4PSAA 1WOMA 1OILA 3ZX4A 2FWIA 3SF8A 4F2WA 1SZCA 2EJCA 3IV6A 1I2AA 2WF8A 1DMSA 3KQLA 2H2IA 2VDNB 4XPIA 3WLKX 4MYRA 2H9AA 3QXGA 4L4YA 5FNVF 3N5CA 3WGIA 1W52X 3AJDA 2ZREA 1YR9A 4JSYA 2AZTA 4BXOB 3I9V1 3SKYA 2HV9A 2ZJ3A 1KQNA 4HG2A 2FPIB 1XO1A 5KNCD 4J76A 4Z4CA 2X19A 2OPBA 821PA 1AZSC 2QYTA 1SCNE 4R31A 4ZU1X 3G8DA 1OAAA 3MWEA 4IHJB 1HLDA 4TUYF 3CX6A 2IHTA 1YBAA 3GEBA 2X0IA 2QP4A 1Z63A 3RCBA 4CIXA 4UU0A 3D43A 3EPPA 1IC6A 3C5CA 1JLMA 4BTLA 2DJIA 3AVVA 3TLCA 1IYZA 5B7PA 2MIIA 5EESA 1DLIA 2IF2A 4WNAB 4OU4A 3TK1A 3N9IA 4L85A 4UHHA 3W2EA 2DUUA 3C98A 1XZGA 4R16A 5G2OA 1DUIA 3ZLBA 5LM3A 1L8AA 5B7QA 1EHCA 1P3DA 3BXFA 2Q46A 3H0CA 3OEED 3IHKA 5DLYA 3VSCA 2MR5A 3GXBA 2D06A 3UTDA 5CIQA 2NZJA 1GPWB 2E49A 1I6WA 2RGCA 2Z2XA 3IPXA 4IZ6A 2QW8A 4WUTA 2O7RA 4D3XA 2OQVA 2VK1A 4PZCA 1PKXA 3FGOA 5H02A 4K9PA 2VPZA 4TQAA 3SHOA 3NG1A 5E9JA 3OO1A 2EG9A 2B34A 3BWVA 2H4YA 3AM3A 3PJRA 2IUTA 1UMDA 3CO0S 4CF7A 2BMWA 1QR2A 2N3ZA 1DC7A 4RF3A 4FOTA 2W2KB 4V1CI 1NPTO 1Z4OA 3Q0IA 4HNVA 1C7IA 3TGLA 4F9TA 2WTNA 4ZC8A 1LDEA 2MSWA 4L4ZA 4L9AA 3AYXB 1KS9A 3KHSA 5CIYA 4I5IA 3DLHA 3BMQA 1Q1AA 3F6BX 4FDTA 4M9XA 3RM3A 5HG0A 1QE0A 1CE8B 4QAJA 4ZOEA 5JD5A 3M6VA 1VA5A 1QZZA 2IEBA 2JIOA 4LHVA 4QHYA 5EQDA 4N7RA 2QV7A 1N9ZA 4PLZA 5K4AA 3O4GA 3TR0A 5AKZA 3IP5A 2C7VA 3RW9A 5FWDA 4RQTA 4V0MA 4NG4A 2X23A 3LUFA 1D1TA 2BMAA 2WHRA 4EJ0A 3BEOA 2O1SA 4AIIA 4BWVA 1MW8X 5EYPA 2ZJOA 1FSFA 2AOTA 3HN6A 1JFSA 3VOAA 2IXGA 1VTKA 2VTBA 3C7CB 1SUAA 1GN9A 4RTOA 4Q4CA 1P73A 4MQBA 3V6MA 4GKKB 1E0DA 1L7RA 2ZDHA 2JFXA 2FSGA 4H60A 3QVOA 5HBGA 4O2AB 3EPLA 4IVQA 3EOAI 2X8LA 2PG3A 3I9JA 1OOEA 3FNFA 2HT1A 2Z5FA 1ZVMA 4ER0A 5DEOA 3HA5A 3D7SA 3QOXA 4BNVA 3EQ7A 2WQ7A 3WWOA 2MR6A 3A6EA 1T9GR 1EUDB 3MLAA 3OZTA 1V95A 4G85A 5J1SB 4CEHB 3P20A 3EBPA 5ESWA 4XXHA 1U94A 3U0VA 5IJ0B 1KI1A 2G7ZA 2WYIA 2DH5A 4YCLA 3A31A 1FU7A 1QCZA 5JMWA 1NI4A 3EXFA 1W85B 1V9LA 3GK3A 4V2UA 5EEGA 4E07A 4BP8A 1ADJA 5C35A 5AHXA 2VZ9A 3REOA 1OWPA 3NGLA 4BVEA 4JJKA 3ZHQA 4I50B 1OLXA 1U8UA 3RYIA 3KR9A 4I55F 2B7BA 4C88A 4YAUA 3M6XA 3ECSA 1N5RA 3QUQA 1FQOA 4I6EA 1QVVA 3RRYA 4L9SA 3G9XA 4QEDA 1AQ6A 1N6HA 5BWCA 4CIBA 1FP4A 1OFUA 3KOUA 3V1NA 2IYPA 2FSUA 3AF3A 1QFYA 4DRYA 1B8VA 1CB0A 5IW8A 2HUNA 3AJRA 4WGGA 1G55A 1IPEA 2FY8A 4CFZA 4Z4IA 4B3XA 3SJ7A 1OBOA 5SZKB 4CCSA 3WLNA 3CVYA 1JHVA 3GA7A 5EC8A 3LA8A 4U3JB 5EJAA 5TMEA 2E55A 4ARVA 3P94A 4JP8A 1NVAA 5DT2A 3FIJA 3KT3A 2Y68A 3BHNA 4MW1A 1U9YA 3P9QA 3R23A 4L0QA 3CF6R 2EBUA 5JAQA 3T15A 3DTVD 3RVJA 10MHA 3WR5A 3LC2O 1XJ5A 3SVTA 3ERCA 2ZS8A 3E53A 3X1JA 4HT3B 3EPRA 1SCBA 5CYGA 1Y8RB 1C8LA 3NHRA 5JYEA 3VJKA 4MLDA 2GCOB 3WGLA 4OHYA 1CIVA 2ATVA 4X20B 5FFFA 4XOIA 1OHHD 3FX2A 4HBGA 1DAIA 1OV4A 5K3SA 4YAIA 4FINA 1KAGA 1R27A 2AKYA 1ZNQO 3T3DA 3IMFA 5LU8A 4ALNA 2GD6A 3LA6A 3IOMA 4ZOLF 1WV1A 4O1IA 5A9TA 5I47A 1WHSA 3GCZA 4NCIA 2CFOA 1JHZA 2OCDA 4HRVA 2B2NA 1CS0B 1AKTA 2M2IA 4E5KA 5LB4A 3RHSA 4AK9A 5HFAA 2EX0A 1QGZA 4HEA1 2WWTA 1L7OA 5DIFA 2BW0A 2VTVA 1NJFA 1BWSA 4PYOA 3NRJA 4BN4A 3CEJA 3RS0A 4DCNA 2PKQO 3E82A 4R2KA 1YB1A 3A6DA 4PZYA 5G0TA 3PXGA 1S1CA 3VDXA 2REQB 3DL0A 4I6JA 2B1JA 1HG0A 1AG9A 4GM1A 5AI0A 4RDXA 3ZGZA 2P62A 1G20B 1W29A 2HHJA 2Z3ZA 5D3MB 3TR5A 4DLYA 5C9ZA 5LQMA 3HJFA 1QGED 1V3TA 4I4IA 1H8HD 4XLZA 1MO4A 1I3NA 2IYFA 2PSHA 4DJTA 4RVDA 3FAZA 4X54A 1DGQA 1KPHA 1X80B 4R6WA 1QHHB 3AP1A 3MBOA 1LZLA 1U3DA 4TM8A 3G2NA 2RONA 4KLNA 1L7XA 4I7EA 4PSKA 1NXOA 4P3YA 3R8XA 3G5MA 4CV2A 1KC1A 1ZOLA 2CFTA 1Y9AA 2V6MA 1NUPA 2WTMA 1UBEA 1SURA 2CWWA 2HT6A 3U48A 5DCYA 1YSCA 5A0FA 5KTRA 2J85A 4Q48A 5F4ZA 1KVSA 1H6CA 4OUDA 3ZH9B 1X8KA 4GP6A 1NFQA 3KQMA 2FXIA 4MPDA 1Z15A 3ECCA 1R0KA 2ZIEA 3MOIA 1TUEA 2WSIA 1O94A 1UZLA 4HFRA 5KYYB 5FBWB 2DUMA 3U0BA 5CH3A 4EQ6A 3EAGA 2GILA 1EK0A 4XASA 3VOSA 3UMMA 2DULA 1AO3A 3UWMA 1XZMA 4QWMA 3G7UA 4JIMA 3LLSA 4BDTA 3VC1A 3CPEA 3MMSA 4B3RB 4FEEA 4Q9AA 5TRTA 2DC1A 1KMCA 3ETDA 3WFIA 4WOPA 4IJMA 1OMOA 3LIPA 4EB0A 2V03A 3G0OA 2B98A 3O26A 2DLNA 4IQGA 4KFRA 2JARA 2JZOA 4FS3A 3FI9A 3SJAA 5AYVA 2IHNA 1V6AA 3GDWA 2UYYA 3L01A 2GMWA 3CNNA 1QOZA 4NY1A 4KUHA 2BBOA 3CB2A 5JSKA 1EH5A 2JAHA 2RG7A 1K5HA 5BSGA 7GPBA 4HKTA 4LDQA 4PHTA 3AY3A 3WXBA 2NT3A 4YK7A 3G1TA 1RXYA 4RNCA 1OA1A 3I28A 5ECYA 3QKTA 4LEIA 1U1CA 2HQBA 5A2GA 3FA2A 3TJZA 2ZUVA 3FAKA 5LDDC 2K7FA 3F6CA 1RQXA 3BFVA 2MTBA 2O8EA 3EN0A 1RKBA 4AP9A 5LP6F 3OWHA 3VM6A 4R5HA 1P9NA 3AZOA 2G8NA 4JGGA 4K6HA 4W6ZA 3JD2A 3HACA 2O2XA 1C8VB 3OETA 5CTAA 4C21A 5HS6A 5IFLA 4PC2A 2WEKA 4YJ2B 4IJ5A 1YKGA 2RHTA 3NAGA 3GT3A 2W6JD 3O9MA 5AJZA 3ESRA 4A15A 2BIFA 2J3LA 4IDNA 2F9LA 4C3VA 5JZBA 3FVWA 2AQKA 1UFKA 2WY2D 1ID8A 5BQOA 5MN5A 5EJGA 5GOZA 4MDFA 1HGXA 1VI6A 1LY1A 5H82A 1W6RA 3THRA 3R5KA 1TJYA 2GHTA 3G1WA 4JJIA 3R7AA 2ZYUX 3PUYA 4LJ7A 1RVDA 3WV5A 3PDUA 4A9AA 2E4WA 2IE0A 8LDHA 5T41A 2XDQB 1T2DA 4WKCA 1UH5A 4PVCA 2GN6A 4N0QA 5DNAA 5SZJA 1J20A 2QTHA 1Y3CE 3CWQA 3M2PA 5LNK1 1R3UA 1KF0A 3U4GA 3WS7A 2XIQA 2XGJA 2ZYVX 4J94A 1A88A 3TW8B 1NW3A 1QVWA 1RQGA 2DG2A 1UBGA 2PAFA 3EBLA 4RCYA 5A7GA 1QPGA 3AR3A 1R18A 1CV2A 4XGIA 1T3HA 1L5NA 4W1QA 3V4FA 4B4VA 1KJ9A 2WMNB 4EB6B 1WXHA 4EYQA 5JNWA 1DAEA 521PA 2VK4A 4RIGA 4GMXA 2ZM6B 4K6MA 2CCJA 3S7ZA 3G9TA 3EK2A 4LF4B 3WB0A 2HMSA 3AESA 3GNQA 4KO8A 5FFNA 2ZYSA 4GLFA 3ANLA 5I9LA 3DNPA 1BWRA 4JEHA 4R1QA 5EFZA 4XFJA 3VTKA 3OKCA 2ABWA 4I6GA 1JT2A 5KNCA 4Z86A 3THYB 3VU0A 3DC2A 5EPUA 1S4QA 1KR2A 4QHTA 3V46A 1SK8A 3WLMA 1W19A 1AZTA 1NJ1A 4BTVA 3Q9SA 3H18A 1EEXB 2I1VB 1HH4A 3V33A 4EENA 2QTMA 1YZGA 3S81A 2OD9A 2A7QA 4KW7A 4U2GA 5COQA 1BH6A 3EUFA 1NJGA 1Q21A 2OZEA 1DARA 1C50A 1ARZA 1OBFO 2Q3JA 3AIMA 4FFWA 4LBWA 2GERA 1ONNA 5CDFA 1DIGA 2GFQA 1BVUA 3KV1A 1Y6GA 3RV4A 3WG9A 4OMFG 2ZIUB 4L7QA 3QE4A 4ZGGA 1EUCB 3CG0A 3HU5A 4L5BA 1EVYA 3G5TA 3T7TA 2CHUA 3IR5A 4FGZA 3TLEA 5BR8B 2C2ZA 1RYMA 2ZU6A 4Q3DA 1UPAA 1TQDA 3G82C 3TDNA 3AVWA 3DDUA 4QTTB 4AKTA 4MEAA 1BDBA 3WK7A 3KJXA 4I1VA 1X0XA 2XQFA 4KV7A 1SZDA 4Q6WA 5COAA 5F5LA 4QNNA 2O7SA 3U31A 1B3BA 4KH0A 2GESA 4BV2A 2PKRA 5WRFA 5HCNA 1PS8A 3DL2A 1JG2A 4D9IA 3RANA 1UXOA 2YIMA 3WNBA 2FR1A 3E48A 4R0VA 3EY9A 4JKYA 1R0ZA 3EVCA 2J59A 1OUMA 1PNTA 5I7WA 3JV7A 4RC9A 4NYJR 3MXTA 5LYJF 3BXGA 4OHMA 1XC7A 2ES4A 2X9VA 3BWCA 3UMRA 4Z4GA 4Z6KA 2VRNA 1ZEMA 2Q9UA 5JBNA 1D2AA 4ZO4A 2BFCB 3X0DA 4OAPA 4U02A 5I5EA 2ZE6A 2B82A 3X2FA 3DXFA 5IAGA 3R7FA 1C30A 1VGRA 2ZT8A 4LZOA 2WJAA 4BNTA 5A5GA 3W9SA 2EW8A 1UBOS 3PLNA 3ZI4A 3BM5A 4AYXA 1AHHA 1XVLA 2CMFA 2CDNA 5E7QA 3SDBA 5AW1A 1B43A 3D54D 2DR3A 2H1FA 3LZCA 3DV0B 1ZD1A 1OU4A 2WUGA 4DMLA 3FLMA 1DCMA 1SG0A 1Z2OX 4DCTA 3C5VA 3KYDA 5K3FB 4A73A 2NIPA 2AWOA 1XDBA 1PV2A 4QOEA 8ADHA 1E18A 2IXTA 4GXQA 3EGXB 4ZI7A 3O5AA 2HQ1A 3QU9A 2E9SA 3MS2A 2F4VB 1G5IA 2ZTMA 5FUWA 4DDWA 2H0AA 1CZOA 3A1WA 4NU0A 3UKJA 2ONZA 3Q3GE 5DSXA 1YVEI 2YS7A 5BSFA 1SKMA 5FUYA 2F3RA 2BKUA 4M49A 5FP0A 4MVJP 2KI5A 3EHEA 4JLVA 3GFVA 4Q3NA 1PCXA 2G72A 1PU2A 1RYBA 5EJ8A 4JROA 3C6QA 3KXLA 4TQGA 4ZEWA 1UODA 3Q6NA 1KJJA 1CJVC 2HSZA 2CK3D 4GMKA 2X1MA 2D7DA 3DTNA 2CBZA 3H97A 4DHEA 3RTEA 4DV5B 1CRWG 5KIAA 2I3DA 4DDTA 3CH6A 1KYZA 4ND5A 4DZTA 5A5VA 4HDMA 5H8WA 1Y1LA 4RMGA 5BSWA 5JFOA 4LDNA 2QM7A 5AM0A 4AG3A 4B4OA 3HY4A 3B1VA 4KRXA 3TAUA 3PXDA 4UREA 5HCUA 4F6CA 4MKRA 4YV2A 3NCTA 3T5PA 3OKPA 5IULC 3P45A 1NQTA 4IMJB 1XN4A 1PJLA 3NOOA 2I7CA 3O95A 4PHGA 4LMAA 3TW0A 2DXIA 4MP8A 3OUTA 3C3KA 3MQ2A 4US0R 1KEKA 3EZ7A 3RREA 2GVDC 4XLTA 3JATB 1U99A 1SVMA 3RVQA 3TQOA 2PUDA 4Z1MD 2V8OA 3ABZA 4GZ6A 3WQSB 4EHIA 1CF4A 3EUWA 3LU1A 3UMYA 2I7XA 1XVIA 3KUUA 3QNWA 4IGAA 1MU0A 1KRWA 2I3BA 2JDIA 4NEHB 1US8B 4XD2A 3UUFA 1V26A 3JTEA 1W76A 1Z4KA 4TLAA 5KYUA 2AT1A 3BTVA 3O4FA 2EBWA 4MMZB 4ZICA 3H8SA 2GNAA 1D4OA 3S55A 5HTOA 1HQCA 1SG6A 2ZRNA 1X2EA 2PL5A 2WR8A 5EAIA 1L4HA 4PAQA 4URUR 5CA0F 5I01A 1ZCBA 4FT2A 1L4FA 3A2KA 1TI7A 2P1DA 4GGPA 4U2DA 4HTFB 2H31A 4Q4DA 4EPYA 1ZKDA 1K5PA 1W2WB 3KKQA 1DVRA 1O08A 1RRGA 4IWXA 3DTVA 4EBFA 1YA6A 3A05A 4TYYA 1O0SA 2GXQA 2QQ0A 5DZSA 5C37A 2ISQA 5AM5A 7YASA 6YASA 3R9XB 1AMUA 2XNDA 4YN3A 3OWXA 3UJ8A 1USWA 1YI0A 4GVPA 5JYBA 2NACA 3DPUA 1LFAA 4TXHA 2DR2A 2E4UA 1HLPA 1EJ0A 2PVCA 2QN2A 2DTDA 1GSHA 3JQFA 3S2FA 3EEQA 5EP3A 2QN6A 3OIYA 4HXEB 2DY1A 3B6EA 5FL3A 3GU3A 2OBFA 2AR9A 2ZAIA 1GEGA 2ZULA 3LVBA 4NBUA 1F2UA 2OHIA 3IDZA 5BOVA 4ZJPA 2QVZX 3BZUA 4MQUA 4BLPA 4GMGA 4UKDA 2NU9B 5CT8A 1K97A 1WMFA 2QQFA 2C54A 1OX6A 3GLHE 3BXHA 4YP5A 4PHCA 5E4TA 5EZYB 1G7CA 5J5CA 5BN5A 5A05A 4DXDA 2O48X 3KUCA 1KJNA 1UDCA 4PY2A 4MW6A 5LB2A 1IWBB 3SVZA 1FOEB 5J3JA 2XB2A 1BMQA 1VLMA 2HA7A 4BP1A 1HLGA 4ND6A 4A8PA 1T8YA 4URHA 3HUUA 2IV3A 1U9CA 2PZ8A 1P0MA 3M6UA 2HJHA 3L8DA 5ESDA 1TC2A 4FYJA 4Z51A 3BF7A 1K5DA 1H3FA 3TKLA 3WSTA 4X1YB 3HLKA 2YXDA 3GX1A 1ZO8A 1OIWA 5AKKA 3V5NA 1NW4A 1YB2A 3TMKA 3LHDA 1IXRC 3U40A 2PX4A 3CLRD 3DEIA 4G1MB 2M1ZA 3FKSA 4QXPA 4UE2A 5TV2A 3TLZA 5KWEA 2OGSA 1ZWLA 5BT8A 2OFXA 1H8HA 4PZEA 1QKJA 1M6HA 2QZZA 2XVYA 3Q5EA 1KWKA 2OLJA 4I36A 2LBPA 2FWRA 5HMLA 3MQFA 3I1FA 3K1ZA 3PC4A 1SCJA 2W98A 4BNIA 3GJZA 1U0GA 4YT4A 3LHFA 2YN2A 2FZGA 4F12A 3IR7A 1T26A 2VBGA 4UEWA 4FDVA 3E4DA 4NH4A 4OJKA 1JVNA 2FPSA 3PUJA 4MEBA 1P2VA 2V98A 3LD9A 4W99A 2DFTA 4Q9KA 5FL7D 5K0NA 4UPDA 2C7RA 1TEVA 3ZR4B 1F9AA 2EGUA 2QDKA 3NOVA 2Q3FA 1S7CA 2WF6A 1Z08A 3BWMA 3LCMA 4N0EA 4DIUA 1DWOA 2GEBA 421PA 1KMMA 2VWHA 2WWFA 3FSEA 5EI5A 4CQNA 3L0ZA 3LFHA 1O03A 1JE0A 4EX7A 2JS7A 2A92A 2YNMD 4TVKA 5DPMA 3AKDA 2AC7A 1JEQA 2X14A 4B6PA 1ZEJA 1X1QA 3MNFA 3TD2A 2BM9A 3SYMA 4TXLA 4IHQA 3TQTA 4RZUA 5CBPA 1T6YA 2GKSA 3BMOB 3P96A 4A03A 2NO1A 7AT1A 1U7PA 2J9ZB 2V96A 1JW9B 1N3YA 2PUWA 2PYIA 3E18A 5GWXA 5A4IS 2VKTA 1GZVA 1LX6A 3PR2B 3GRZA 4CODB 5JZSA 3HUTA 3P9CA 3GEIA 1OKKD 4IIGA 4YMLA 4G36A 3GZ4A 1OB2A 3GUHA 2XXBA 4NG5A 2WPDD 2M6SA 3HFSA 5EHQA 5T5QA 1Q91A 4IS3A 1Z0KA 4AUKA 3LOQA 1E92A 5CDGA 1QQ5A 3SQDA 2I6TA 4P6VF 3BX1A 3L8FA 3WGYA 2XODA 3IIMA 1JLKA 1MRNA 3IELA 2R1UA 4YDQA 5AW6A 1VCOA 1SPXA 4Y7CA 1X8JA 5IK2D 5DRTA 4OM7A 5DSZA 1CRLA 4MYSA 2J4CA 3DFZA 3X1ZA 1X0VA 2MSCB 4OFBA 2QLNA 3DSRA 4I4TA 4U6NA 5FA5A 2GZDA 5IVDA 1UMBB 4JS0A 1KA9H 3ZE6A 1PZHA 1QLJA 1RLOA 2GZMA 1LJUA 1D1SA 2HPZA 1BXKA 1MEEA 2QW1A 2ZR7A 4MMYB 3MMNA 4NIMA 5AVWA 3SYTA 5INTA 1XYYA 3PDCA 1U5BA 2MINB 2RGEA 4O4LF 4UHKA 3CISA 1OLSA 5BN3A 3BIJA 2OCGA 3GLGE 3IQDB 1PNVA 2IYQA 2G7MC 1C4WA 2JD1A 4DMUB 1K6MA 4HDCA 5JSHA 3H8JA 4NOKA 4QC2A 3F6EX 1ZN8A 5D1HA 2WIJA 2IOQA 4H4EA 4XGKA 4CDNA 1PR6A 1W4RA 1P9LA 2QSJA 1Q0QA 3AU9A 1E58A 4KMOA 3C8DA 1Y8CA 3F4LA 3OUUA 1JPVA 4ZAVA 3TOZA 1L3CA 3R9WA 3GC6A 1O6CA 2P0AA 2R751 2ZIXB 2Z56A 2IKSA 4HGNA 4DLNA 2WMDA 3QUCA 1FSPA 4AI6A 3CV3A 3OCYA 2BM8A 4U5QA 1RE0A 3HO1A 2A3RA 2M6RA 4GZMA 2VT7A 4Q39A 3MT7A 4BAZA 5C5EA 4UBNA 4H18A 2O2YA 1TMYA 3ZHZA 2XRFA 1OASA 3JAWB 3PPXA 1U1FA 4MWTA 4TMZA 2GJ9A 4GI3A 4WZZA 3F4KA 4WZAA 1MAVA 4ZT2A 3W7BA 5A7HA 2IGTA 2IWRA 2XI4A 4CCWA 3OM8A 1JIIA 3A1TA 1CZLA 5CT9A 1A5TA 4YMWA 2C0CA 4EFNA 4ER7A 1C4XA 3OJXA 4YMIA 2ZW9A 3OPMA 3HKCA 4OI1A 1G2IA 2HK8A 4HXGA 1V4NA 4CIYA 4I4NA 4DB2A 1VPWA 3NBMA 4U2EA 4KLAA 3UJAA 3FOZA 4NOMA 3ZY6A 4EGAA 3VA7A 2QPOA 2PXCA 4XX0A 1DWUA 2O6HA 5MFZA 4GRIA 3IIJA 2DU8A 4GF5A 4OHXA 1RP7A 3T5TA 4ZCQA 3ZV5A 4EHNA 4ZYTA 2NYRA 1TADA 3A9CA 1YJ8A 4LNUB 5HOQA 1E6KA 4B4WA 1M8JA 4CLEA 3VZPA 2WVGA 4GLOA 2VXOA 1ZHFA 2WDPA 4X3CA 4AJ1A 3G88A 4DMCA 3EFEA 4E3WA 4F21A 5IX8A 4UOEA 1JKFA 4U2CA 1P61B 5EEHA 1QF9A 2ZBRA 2RGAA 4HP8A 2P77A 4MS3B 3FNBA 3TEFA 3W3AD 2HF8A 1E6EA 1N5LA 3WAKA 1AHIA 3GMTA 1A5AB 4J1NA 4MV5A 4QNRA 5BWLA 1CZNA 3OJLA 3A4VA 5AI8A 1E79D 3ME5A 4BWGA 1FFXB 2QEQA 1O58A 4PGMA 4ZT6A 721PA 5JJ5A 5L6LB 4FONA 1I3OA 4MGKR 5ALTA 5EKXA 4E1BA 4L4SA 3NR2A 2BE7A 3HFJA 1W36C 2BLNA 3B9RA 5E95A 1TM7E 1X6VA 3V3TA 2UVQA 4O4JB 1PDVA 1EGVB 1D4ZA 1ML4A 1E96A 1YAHA 3K2EA 3MJFA 3BPSA 5AOCA 2IDMA 2IYEA 1GVNB 2ZTUA 4CQLA 4CM5A 1UJ5A 5AHRA 5LOVF 1N2XA 1N2SA 3AHHA 3NP9A 4NRDA 1UZUA 4ETIA 4R0MA 4HOYA 5F7ZA 3ZH2A 4AY6A 5HMMA 2ORED 2ZSDA 3OQIA 4NZZA 1IY1A 1NU6A 4NV1A 4EARA 3A6KA 4MMXB 5KREA 3RRMA 2HJGA 1H1LA 4YRTA 3ZDQA 3KQTA 2HIGA 3AG6A 4E4TA 4PFJA 2V6BA 3PJDA 1RZ3A 1ULBA 5F2OA 3W8DA 3ZHUA 3QU2A 2C96A 4DABA 2BFDB 4Z1OA 1ICEA 1VKZA 4R41A 1S1MA 5LR6A 4WDQA 1EFCA 4FT4A 5DGHA 5D00A 2NZXA 5AKEA 4CKBB 4CM7A 4NDZA 3UCXA 4FCTA 3HM2A 1QTRA 1A50B 4LKOA 2X4DA 1W0CA 4G0XA 3VXKA 3WISA 1EWKA 3RV3A 1IWOA 5LMZA 1LA2A 1DFIA 3I61A 3BAZA 1A9TA 2W4IA 3KUKA 2FMHA 5HA5A 1MT3A 1KJIA 3D8UA 3JD1A 2D62A 3PGKA 3QVWA 3UT6A 1RI2A 4PNZA 3QX3A 1MAAA 1O4VA 3U3KA 2O06A 2JGDA 4F6RB 1IIRA 2YVAA 4HFMA 4Y2UA 4MA0A 1VJCA 4JBXA 4B9EA 1PVOA 4QBIA 1LTKA 1J9ZA 5P8WA 4HSGA 1GTG1 4HLQB 3LBNA 5CW1A 1ZGZA 2J9XB 3EXG2 3JZMA 4WY5A 2QL7A 2QLMA 4PU0A 1MH9A 2ZI4A 1FXUA 2A4KA 2J3KA 2BEVA 4Z1MA 3OY7A 3TDMA 3VZCA 4ZYZA 4XSGA 4NDAA 4EPVA 2BFEA 4ZQCB 4LDZA 1OT5A 5D6OA 4DT1B 3A1EA 3E27A 1QKKA 4WDRA 2OD2A 4D45A 4FK8A 5JH7B 3WLPA 1DC6A 1NDQA 4KPUB 4AS1A 5IYZF 2WAYA 3L79A 2BGJA 2DM6A 1B7GO 3DMHA 4ACAA 5KOJA 1YQ9A 4FPXA 1Z5NA 5LVAA 1NBEA 1C0IA 3ONWA 1YBFA 1X7ZB 2ORIA 3OQOA 5TMBA 1GZUA 4PLYA 4X8HA 2O8CB 1CR1A 1P7PA 3DMDA 1YRQA 3HYSA 4BQEA 2EYUA 1XZQA 4U7TB 2DCMA 5EWLB 1Z0IA 2Y6UA 4HF7A 1ABBA 2C2OA 4Q4AB 4HADA 4WBNB 1K6EA 4O4IF 1M72A 3IUBA 1VIDA 4IDBA 2H11A 4MVJE 2QM8A 3BJMA 2QZ4A 3THOA 4TWJA 1J2JA 2VK2A 3CS3A 2ZAGA 2Z95A 4KAXA 3EEYA 4JLKA 1AGXA 3O93A 4LRTB 5IDQA 1TIKA 1YUBA 3T3PB 3UMGA 1REQA 1INLA 1PN3A 3FFBA 1FS4A 3N0VA 4MWSA 4ERNA 2RBKA 2JAPA 3O8QA 1NSTA 1EYZA 1VE7A 5BMVF 2XB4A 1CCWA 3TB6A 3F1KA 2RI6A 2BFPA 3HDVA 3LYHA 4TS1A 3WGKA 4LRYA 4Q7QA 1PQPA 3EFBA 2B78A 2XB6A 3F3MA 4N03A 5H7XA 1XTQA 1DEOA 2I3ZA 2ALJA 5I7AA 1DBIA 3TVTA 5KYXB 5EE0A 2YWJA 3R4VA 4A92A 1Q0UA 3QUBA 5B58C 2VF4X 2X1LA 3OPXA 3SDZA 3F6SA 1VFNA 3EGOA 5FWAA 3VPAA 4YUZA 5LQDA 1E1KA 3L7JA 1DTWA 4RHTA 1HOXA 2Q29A 1KZ7B 1MTOA 1SUCA 2G0AA 2AEJA 2VPIA 3KHUA 4A0FA 1RAAA 2C77A 2FSVA 5DI3A 3RSOA 2XNCA 3S1AA 2ZJ1A 1TIBA 2G28A 4M1SA 2OD7A 3L82B 1TCUA 2I99A 4ENPA 2ZXUA 3N3BC 3DMTA 1U2DA 4JY7A 4QAQA 3AUKA 2W6ID 1NNSA 4QPDA 1N6RA 1ZVJA 4ZCTA 4C4RA 1C7FA 3ZY2A 5AI9A 3E9CA 3U61B 1PHRA 5AQEA 5FUXA 3CIFA 4QBKA 1I7LA 5M3BA 3UPDA 3AGPA 5FL7A 4RL4A 3ACCA 5LKAA 4P93A 4G67A 4Y98A 4DV3B 3L0PA 1FXWF 2HLNA 2YZ7A 3H8VA 3K9HA 4FE3A 1PG2A 2NU8B 3ZV4A 2HDNB 1OBHA 2PU7A 2QJTA 3F6YA 3K5HA 3KKKA 1I14A 2HA4A 3DB1A 3A25A 5FIUA 2YNMA 1Y80A 1E7MA 1NVEA 4YAWA 3TM4A 3BWYA 3ZHCA 3R0XA 1PDOA 1ADFA 3AETA 1NVFA 2IW3A 4F4JA 2GBLA 4HAUA 3PQDA 4DG8A 4O8CA 4Q9DA 1V8FA 1J90A 4RIFA 2VDWA 4COKA 1O96A 2JG3A 4M8IA 4RSRA 3TBHA 3HADA 3SEAA 2OWEA 2Q1XA 4W5HA 3RJ5A 2FFRA 1OKKA 1X1RA 2JBAB 3UVEA 3VVMA 4A36A 4XR4A 3MB8A 1YJ5A 2WPDA 2CNWD 3RT1A 3B5IA 3LF2A 3A28A 5AW3A 1MZPA 3T5DA 5M2QA 2IF0A 4UU8A 3WGHA 3OTOB 1W30A 2PQMA 1Q1ZA 2F00A 2BAGA 1M34E 1Q14A 5J63A 2N1BA 4TMYA 5U4XA 4AJOA 5IK2A 3C7DB 5FBZA 1TF5A 2NV0A 1ONPA 1SOUA 1Y7IA 4HWTA 3ZOKA 3M6AA 4YJFA 4B1FA 4ARCA 5FXMA 1DO0A 3S8MA 2Q4TA 1BXRA 2EAUA 2ZUDA 2XMDA 3OE4A 1JHOA 1BROA 1XZJA 4XQ9A 4EG7A 2BH9A 4LXHA 3IPCA 1UDAA 3NU1A 1EVQA 2XQIA 1SOAA 4E30A 3L0IB 4JOSA 2WM9B 3JQFC 1KK3A 5KBYA 1RABA 1G4HA 3L2OB 3N2GB 3QYFA 4RFVA 4RK6A 4TMVA 4KXMA 4W7HA 4WESB 5GONB 1ULTA 2PN1A 3J80A 3C70A 3ICPA 5FX2A 1VG9B 4U7JA 1UK8A 2R1TB 3HCAA 1EIWA 1PJ4A 2Y4NA 2HRDA 3ZOZA 2EP8A 3S29A 4H7EA 2IY7A 4FQ8A 3IC5A 2NLOA 2KQUA 2GJ8A 5EUBA 2BI4A 2H51A 3K20A 3H17A 3LNCA 2O4CA 4I08A 4OTZA 3VU8A 3VI4B 1IHYA 3UHJA 3P19A 1T35A 2WZQA 4ZQIA 3P97A 4WN9A 4GPZA 1H66A 4EIWA 5JZMA 4LKRA 1KO1A 2UVPB 2CHGA 4EHKA 3A04A 2QDXA 4M36A 1T3LA 4HLUA 4TV9A 4GNRA 4Q9HA 3H8WA 1NBMD 1JNXX 5B7GA 3WLEA 2O2GA 1J21A 2GPBA 2QTZA 3PRJA 1JYEA 3B1FA 3FROA 1QK4A 4WKBA 3L5KA 3LDHA 3HB7A 1F6WA 2VCYA 3FYUB 4RESA 1ZUNB 5NLLA 1JIUA 1VI5A 3RFXA 4AKGA 3D4NA 1WO8A 1QF6A 4CMCA 4OYHA 3JYPA 1I2DA 1XLWA 2FWBA 1V3QE 3SD7A 3HVRA 1G3IA 5KSOA 2G1AA 3DEYX 1L3IA 2ZFUA 4YRMA 1NXQA 1CERA 4DVJA 1B8NA 2EL9A 2X5NA 3KL2A 5FR2A 5KWJA 2ZUEA 3GT0A 4C7BA 1VSTA 3IP7A 3SQOA 3KKOA 1K8YB 3EVDA 1S5PA 3H5IA 3L0SA 1XXHB 1GSIA 2JRCA 1N2CB 4B3MB 2QRVB 1SUFA 2PBFA 2WIGA 3MT9A 2O8VA 3QW2A 1KEVA 4N18A 1XWIA 3NC0C 1XVVA 1N3LA 1VL8A 1AF4A 3Q7RA 3U4AA 1E5DA 5IMSA 3T9DA 1U11A 3TH5A 1FFYA 2AS0A 3DL7A 3DUWA 1I13A 2FNAA 2PY6A 2YWXA 2ZRKA 3BWXA 2H18A 4MQ4A 4AX4A 4U7WA 5BW8A 3PF9A 2HGSA 2XBLA 4PIMA 3QV2A 3D9QX 1CR0A 3UJ9A 3QEOA 1KIAA 1WABA 2CW5A 4ENVA 4RZ2A 5CT5A 3L4EA 1SXHA 3OFND 1N0VC 2IXBA 2SECE 3LY5A 4PQRA 1X7DA 3E5RA 4DCMA 1X13A 4LZJA 4CMIA 4INJA 4PLPA 3W3AA 3DCIA 1SUSA 4K6GA 4BBPA 4M87A 2A33A 4G65A 1XMXA 3REGA 1DXHA 2VBFA 2Y67A 2O1WA 3A6JA 2HBRA 5FHQA 1YL6A 3UMCA 4L72A 4DIMA 1A76A 1OE0A 4DL9A 5DNUA 1E7RA 4OH1A 2HQOA 1KYWA 4WOJA 4CTMA 4G8BA 1UBUS 1GUAA 5JHGB 3EXG1 1VL6A 2JIPA 3AV3A 1DBSA 2OWDA 4GL2A 3GLFA 3WIUA 3NOQA 3RIMA 3TE7A 1RTKA 1W34A 3ZCSA 3N8GA 3EZ9A 3NDJA 4GO1A 5EIOA 2I4OA 5FTNA 3X1YA 5IM4F 1QH1A 3O75A 4BO0A 4EL0A 3BQMB 3OJWA 1J1IA 3RKSA 5K8TA 1J25A 3BK1A 4LY9A 1ND6A 1OZGA 1UJ2A 2BTOA 1NKVA 4OYYA 4N8DA 4DW8A 3KR0A 5EP1A 1VHJA 1B26A 1TD9A 4LYEA 3C6ZA 5BVHB 2FP4B 2B8WA 4YI3A 2C97A 4FYXA 2B9VA 4BYGA 3P2MA 4MUMA 1P91A 1SB8A 4YJDA 5JV5A 1V6SA 1NVBA 2F7SA 2X2FA 5CXSA 4BASA 1UOQA 2F43A 1JKMA 3ZHSA 4BV3A 1U2PA 4KGZA 2JI7A 3ZCXA 4O4HB 4YPVA 4M60A 5KO2A 1TUGA 2W2NA 3U4HA 3W5HA 3SZOA 4ARZA 4AKIA 4QXOA 4Z4FA 2P69A 5TXGA 4FUQA 5LCXA 5CD9A 4ZT5A 1P39A 1L8QA 3BUSA 1R12A 1I7PA 2XMQA 3FUXA 1CUHA 2XA1A 1EWVA 2J7PD 2GTIA 2XUKA 2R8XA 3WB1A 3V80A 3NUQA 2WQ6A 4DANA 1G8SA 5FWYB 1RXEA 5ELLA 3GXOA 3SWWA 3UT0A 3V4RA 2I71A 1GGEA 4KBYA 3A32A 4ZDWA 1P17A 5J40A 1QYRA 2W2XA 5HKAA 1GAXA 3ETCA 2F3QA 2C7OA 3F90A 5EWMA 3KVOA 1VZ2A 3B89A 2DUNA 4MUFA 3CLSC 4ZCIA 3T5AA 4PYMA 2D54A 4Y9RA 1SXGA 2Y93A 4UTOA 2C2YA 4HBZA 1U0FA 4QVGA 3OZBA 1MVLA 4LJSA 5ALOA 5IJWA 1AMOA 4B82A 1IOWA 1FLDA 1QH0A 2E3JA 1KMQA 1PS9A 4IIUA 5ALKA 3QI2A 3HXTA 3FW1A 3IXQA 4DLPA 3I34X 3P9KA 3WGNA 3QEMB 3WK6A 2O3JA 1EE9A 3HA2A 4XYLA 8ATCA 1G60A 5SZHB 4CM8B 3OAAA 2CVOA 2VUHB 2FJPA 3O3OB 2ZYIA 1BWPA 1N1GA 2ATIA 4XVCA 1J23A 4GBGA 4E15A 4XB6B 1NWHA 2FCRA 4NS4A 3KAJA 3R7DA 5B4UA 4AZSA 1C1DA 4IKOA 1PFVA 4PPFA 2R86A 1E2IA 1DUVG 2NYAA 3WP0A 1BN6A 2O2CA 2FPOA 2BFOA 3HPRA 1EBBA 1GGMA 2EFJA 3DO6A 1T5TA 3H1GA 5AOVA 1OFGA 4NAUA 3VUFA 1GZDA 4R8MA 4DQVA 2QRUA 3H5VA 2X9GA 1R5NA 3TRIA 4ZIRB 2EDAA 1Z6XA 1XD8A 5EWJB 1CUVA 2B2CA 5AUQA 1IJBA 3QVTA 3VKWA 1Y9EA 2F17A 1IIBA 1KZ1A 2R8BA 2Y1XA 1UQRA 4HMOA 4PFQA 5A9SA 2B21A 4NFSA 1YFJA 4D3SA 5BSKA 3LYLA 3N0XA 2ZSFA 4B43A 1OZAA 3A1FA 3FRHA 3MFQA 2G88A 5DOVA 1XTZA 3E7PA 5LN1A 4KVFA 1B0AA 2BMDA 3EOBI 3PKJA 1YD7A 1GPUA 1JBKA 3IR6A 1IY8A 1VLVA 2OV3A 3LIIA 4JSRA 4NENA 1AN0A 4QXAA 5HCIA 1Z0ZA 2N46A 4M8SA 1U6IA 4PIPA 4BU0A 4EOGA 4NK4A 2Q8NA 5G3YA 5FRDA 4ALMA 1VGQA 1Y9DA 2E21A 3U4MA 2C78A 1CQZA 2ASEA 3BCRA 4QJ3A 5J2TF 1M2OB 1JIKA 3MWYW 1S9DA 2ZYHA 4M1EA 4M0UA 1TQ6A 3DF9A 3HY6A 5AUOB 2JLZA 3ORSA 2FPXA 1SXJE 2WYVA 3EHDA 1JU3A 3HJUA 2XZOA 5J5VA 4I1IA 2W6CX 2F1JA 4YQFA 5B30A 3V3KA 4NU5A 5ENZA 2WA2A 4HDSB 4IUBS 4O59O 4OX9B 5JJIA 5JFGA 1R6TA 2J32A 1KJZA 4XI9A 2CV1A 3BBPA 4KJXA 4JI7B 1BHSA 2ZQYA 1PZGA 4B73A 2C59A 3KLNA 3CNHA 5DVZA 2IYLD 5F1PA 4YONB 3C3PA 4PLWA 3ZU5A 1ZJ4A 1KFEB 3PVCA 3G9QA 4RENA 5CX1B 1NBIA 3NLLA 4YUWA 3WDSA 5KOHB 4G41A 1IPFA 1BJTA 3WP1B 4TZTA 2A86A 5T4BA 1IQUA 2H8KA 3MCUA 3QKRA 4MLCA 3TLKA 3Q7QA 4P53A 3U26A 1XAGA 1XB2A 3FMFA 2PR7A 5HW0A 4AJ4A 1O89A 2DHEA 4K9KA 4AX8A 1DBWA 5LLSA 1PFGA 1XU7A 4B7XA 1DAPA 4YLYA 1UFOA 1NXTA 3ADPA 1Q0PA 4Z3KA 4UXJA 3EH2A 2JJ1A 1LLFA 1WMSA 2AN3A 3GZTB 5T4EA 3A9SA 3TQIA 2D2IA 3BSYA 3USES 2OMKA 3C1AA 4JDUA 3U7IA 4CTNA 4DV2B 2WD9A 3HWWA 2Q41A 5GZ1A 4CQMD 3MINB 4WXHA 1U65A 2KPOA 5LQKA 4L28A 1I6LA 1SXJD 1POXA 2H4XA 1QSGA 3E9MA 3EZGA 1J99A 2WJ4A 3WNDA 3ZHXA 3K72B 1KI7A 3JALA 4RE5A 4QODA 3WYFA 1YS1X 1QE5A 3RFUA 4G0WA 1K4YA 1DSSG 5ED4A 4EY8A 1AU9A 1KSFX 2Z8YM 2IYTA 2BD0A 1JAIA 2XMPA 3F6RA 4Q3KA 5JS8A 5IBCA 2KWIA 3JAKA 3PXEA 3RVLA 2BGGA 4GVXA 1LWNA 3K09C 4Q4LA 2IYAA 5K3OA 2XAUA 1Q1BA 3EPKA 1X1BA 2JLSA 2FEXA 1AKYA 1HF3A 2GR9A 2ASVA 2LTAA 3MSXA 5AK5A 4ZMBA 4P7BA 2D1FA 3L5OA 2A5GA 3EG9A 2AFHB 1MNAA 3EDYA 2FW6A 1JHAA 1S8FA 1H2RS 1CULC 1Z07A 1ZD4A 3G0GA 1EP9A 3NASA 4NYIR 4IZHA 4DDVA 1E6CA 1KU0A 5B37A 2A0YA 2NG1A 3AWDA 1XRPA 1G4AE 3VJLA 4PPGA 5ECWA 2CNDA 5C8ZA 3CRW1 4AG6A 2VA9A 2F48A 1GRVA 3KWJA 5TGTA 5I6DA 2PX8A 3G8BA 4MVJM 5CX4A 1KBQA 5BOSA 2P9TA 1LPSA 4JJ6A 3S70A 4A16A 1CSEE 3AERA 4F92B 5GOTA 4E88A 1Y6QA 4Z7OB 5J23A 1Z0UA 4ZHQA 3BORA 1EPUA 2O23A 2QZ9A 3CLRC 3ZBPA 1BYUA 4P58A 5C7IO 1M2WA 1C14A 1NBMA 2Z1NA 1RHMA 4MPPA 4ZVOA 4E32A 3AHCA 2YVKA 3U1VA 4KR0A 4EFLA 4E5VA 3DMTC 2ZWAA 2MSNA 1U2DC 1N0IA 1UK6A 4GSKA 3TR6A 2QU8A 1EM8A 3N74A 4ZJZA 1IN8A 2BI8A 1TYBE 3Q15C 1VRWA 2C3OA 4O0MA 5JDIA 2W2MA 3OCJA 4HQNA 3TZ6A 1J33A 2AI1A 1S0UA 3HXOA 2ZVDA 4DTCA 4RS3A 5DM2A 3U60B 5DXAA 1Z6YA 1Z6QA 3LM8A 4NF2A 1EDEA 3AKEA 3B3QA 1DJPA 1N75A 1RXWA 1Q1EA 3AV0B 2H16A 1XMIA 3DM9B 1PVDA 4RTMA 1R0WA 1FDUA 2NADA 3MOSA 4GKVA 3UK6A 4GEKA 1C7JA 1IG3A 1FP1D 5JRJA 2GYVA 2K7ZA 5K20A 1WY5A 2XH8A 3QLUA 4Z49A 4E22A 1ORWA 3ZXIA 1KOFA 1A7JA 3MK31 1KP3A 2ID7A 4N8EA 4QPCA 4MVJH 5HM6A 2I4NA 5A3JA 4YJ3F 3T5CA 1YGPA 4DPMA 4LPKA 3R40A 3Q41A 2RB4A 1LPAB 1VCNA 1B1CA 1YA8A 4UBLA 5ERGB 3ZIAA 2NP6A 4Q3OA 5AKXA 4D25A 3GZJA 3SZLA 1EWYA 3WKEA 4F3KA 2J0SA 2A5JA 3HRKA 2WIBA 3A4NA 3KYIB 4INPA 3ESQA 3NC4A 2P27A 4IIXA 2WG0A 2OORA 1A2OA 3OFNA 2HJSA 3ZW8A 2C2KA 2CVHA 121PA