2QUHA

Crystal structures of human tryptophanyl-trna synthetase in complex with trp
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
379
structure length
379
Chain Sequence
GIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords Tryptophanyl-tRNA synthetase
publication title Catalytic mechanism of the tryptophan activation reaction revealed by crystal structures of human tryptophanyl-tRNA synthetase in different enzymatic states
pubmed doi rcsb
source organism Homo sapiens
total genus 146
structure length 379
sequence length 379
chains with identical sequence B
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2007-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00458 WHEP-TRS WHEP-TRS domain
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 2quhA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2quhA01
4ND7A 1WXGA 5BNZA 1H3FA 3D6VA 1K92A 1M8FA 2HMAA 4CDMA 4XFDA 4AS1A 1NZJA 1X6VA 3DPIA 3ZJTA 4GU5A 1WOYA 2NSYA 1O95C 4MVCA 4JXZA 1PFWA 1YUMA 3IMEA 2E0IA 1ZH0A 3CLRC 1T9GR 2X0KA 1JIKA 2WQ7A 2QJOA 1J20A 1WXFA 1NUTA 2YWCA 4ZCPA 1BS2A 4MUIA 4JXXA 4ARIA 2QTMA 4MUNA 4EG8A 2WSIA 3PNYA 3UOWA 3DV2A 1TYCA 1LW7A 1OWMA 3IUBA 3TNJA 4PY2A 1YIAA 4ZCSA 3PXUA 3P0JA 1WXHA 1H3NA 5FO1A 4MW4A 3HV0A 1K4MA 3H9BA 4ZCQA 2PZBA 5KCMA 3F3MA 3TZEA 4RUKA 1KQNA 2PXHA 1F4LA 1UFVA 3P52A 2C5SA 4YP6A 3S3TA 1ILEA 1N3LA 2PG3A 4DLPA 2J09A 1EFVA 2Z3VA 2AKEA 3MMXA 1B6TA 3MLBA 3QTTA 3ZUGA 2J4DA 2VTBA 4QBTA 3FI0A 4OUDA 1HYBA 1F7UA 2CV0A 2OV4A 2QUJA 1MAUA 2EL7A 1H1TA 1GAXA 3CR8A 4EG1A 1G59A 5J5AA 1M1ZA 3RK1A 3IOEA 3G59A 1IVSA 4HJXA 1J21A 3NBAA 1JHDA 3Q12A 4UZFA 2A88A 5IHXA 2DEUA 4MUGA 3CVUA 1IQRA 4RPIA 5LLTA 1JGTA 2V0GA 3A2KA 2H29A 4E1AA 3IH5A 3SDBA 2J07A 3CVXA 4XFJA 3UK2A 1NUSA 4EG6A 1KR2A 2JAXA 5J58A 1IFXA 1Y42X 1PG0A 1XJQA 2E18A 3JXEA 1J1ZA 1N2JA 1OBCA 3A05A 1M8JA 4R2LA 1KH1A 5DB4A 1NURA 3PRHA 5HG0A 4NATA 4EG4A 1O95D 1PFYA 1EFVB 3NV7A 2B7LA 1U3DA 4DDKA 1EXDA 1WQ3A 1FYDA 1M8PA 2E89A 4CQNA 3SEZA 1N2IA 3CLRD 2JANA 3IVGA 2VTBB 3P0IA 1DNPA 3IOBA 1GTRA 1GZUA 2XRYA 4OUDB 1N2GA 3H9CA 3N8HA 4MW0A 5TS2A 4EG7A 2TS1A 3E27A 1IRXA 5LFAA 1R6TA 4NAHA 3INNA 4DJAA 4MLPA 3TZLA 3MLAA 3PNBA 3P0HA 1M8KA 1M8GA 1OWOA 1YULA 2QTRA 3LOQA 4K03A 4NDAA 2QUHA 2YY5A 1JILA 1OBHA 4CDNA 4S1OA 3AG5A 2X3FA 5F23A 2PZAA 3AL0C 1JZQA 1T6YA 3ZJUA 1JECA 1O6BA 1P7PA 3I05A 3HL4A 1PFUA 1O94C 2CFOA 4OJMX 1QRUA 5DK4A 3QTBA 1J1UA 4MQ6A 1MJHA 5KWVA 2AG6A 3IVXA 1T6ZA 1QTQA 2CV2A 4MWBA 3KT3A 1F9AA 2DPLA 4ND6A 3COYA 4TS1A 2CYAA 3N2YA 1TFUA 1XNHA 4H3SA 4UZEA 2A84A 3U1VA 3COWA 3VGJA 2CUZA 1RQGA 1WKBA 1J70A 4MW9A 2QUKA 5TEWA 3NBKA 1VBMA 3X1JA 4NX2A 1SURA 2OQ2A 1ZJWA 2WQ6A 4U7JA 2CYBA 3Q10A 4MULA 4P2BA 2O5RA 1X8XA 1OWNA 2HGZA 4F4HA 1QU3A 2GKSA 4YBRA 2WB2A 1JEEA 4KPUA 3VU8A 3FIUA 1GLNA 3VRHA 4PBRA 3K9WA 1H3EA 5JBNA 4QREA 5KHAA 3KT6A 2ZP1A 5K0SA 2BTEA 4MWCA 5FNZA 2BYTA 4F3RA 4MUJA 2A1TS 1NUQA 2D54A 4MWEA 4ZT6A 3SZGA 4KR6A 2J5BA 1VL2A 2A4MA 4YMIA 4R0NA 1V8FA 1KP3A 2AZXA 3RJZA 3CVYA 1ZH6A 4J76A 1COZA 1I2DA 4PBTA 2PFSA 3ELBA 1MB2A 1F7VA 1LI7A 2NZ2A 2Z08A 3SYTA 1JEDA 1OWPA 1O94D 4G5YA 2A7XA 4DDHA 1JMVA 1NUUA 1GTSA 4KR7A 3RBAA 4YP7A 1EUQA 1MRZA 5DEOA 4CT0A 4ZCTA 1YUNA 4KPUB 4BWVA 1QNFA 1TYAE 1ULHA 3CLTD 3UY4A 4EFKA 1T6XA 3ILVA 3CLUC 5HUHA 4MW6A 3COZA 3D6UA 3OP1A 1KAQA 3GLVA 3MXTA 4FZJA 1GN8A 3LCJA 4GRIA 4MVYA 3SZ3A 1EUYA 1QRSA 3IUEA 4ZT3A 1VBKA 1K4KA 4NZPA 2CYCA 2DR2A 2D5BA 1IH8A 3CVWA 2CT8A 1KORA 1QU2A 2RE8A 2DXIA 1O0CA 3A4IA 1U3CA 1OD6A 4YP5A 4U63A 3KFLA 3TQIA 3K32A 1MB9A 3FWKA 4HJRA 3GMIA 4ZT2A 4DNXA 4Q16A 4I6GA 1N2OA 3ZJVA 2H2AA 1J09A 3AFHA 2CSXA 4L2IA 4MVWA 1NUPA 1WJGA 3H05A 1OWLA 3IODA 2IJGX 3ZIUA 3BL5A 3TS1A 2Z09A 3PNVA 1IQ0A 2DLCX 2D13A 2DERA 1Q15A 1EFPA 3CLSC 3IMGA 5K0TA 5TGTA 2PZ8A 3N05A 3AIIA 2ZUFA 1TYDE 3CLTC 1EJ2A 3ND6A 1WQ4A 2G36A 2YWBA 1JZSA 2V0CA 1U7DA 5AHWA 4JYZA 1N78A 4ZT5A 5H16A 5HUJA 5H7XA 1Q19A 3L92A 2CV1A 1K97A 2JA2A 5EKDA 2IP1A 1V47A 4I6JA 4MVXA 2A86A 1VBNA 3UC5A 3KT0A 3DLAA 3HMQA 1PG2A 2X1MA 1O5TA 1IHOA 3FG9A 1XNJA 3AKZA 1TEZA 1PFVA 3CA8A 4L2IB 2GM3A 1YI8A 4WNYA 3RK0A 3FHJA 4MUFA 4MWDA 3HZRA 4HPWA 4JFAA 4EG3A 4XSVA 3CLUD 1G8HA 1T9GS 2QJTA 3LE8A 4HK4A 4DE5A 1KAMA 1N77A 3IMCA 1R6UA 2X1LA 1EFPB 1N2HA 3N9IA 1VLHA 3C8ZA 5FO0A 4ZCRA 4QRDA 2A1TR 1WY5A 4K0RA 1KH2A 1WXEA 4KR9A 1FFYA 1KQOA 2QJFA 4EG5A 3SEQA 3ZXSA 3A04A 2IELA 1O96B 4U8HA 4PBSA 4EGAA 1N2EA 1M83A 3ND5A 1MAWA 4ARCA 1JIIA 1KKUA 2EJCA 3DO8A 1TYBE 3IOCA 1O97C 1D2RA 3M5WA 3AG6A 3RFFA 1R6XA 1N1DA 4MW2A 3G6KA 1Q77A 1G8FA 2RD2A 1S4MA 2VXOA 1IQUA 2DETA 3COVA 3TQOA 1NSYA 1U7XA 2R5WA 3CLSD 2A1UA 3OTWA 4MUEA 4MAFA 3QE4A 1MBZA 1QRTA 3ISJA 4ZT7A 1NI5A 3IVCA 1I6LA 3X1MA 4X0EA 1LI5A 1NYLA 1N75A 3CVVA 4G6ZA 2O8VA 1I6KA 2YXNA 4NAUA 1MOPA 1WXIA 4MW7A 3GUZA 4AQ7A 4WSOA 5DASA 3FH0A 3SP1A 1ZUNA 2QUIA 4MUHA 3IDFA 1QQTA 4A91A 1KQPA 3ND7A 2HZ7A 4Q93A 1EE1A 2E21A 4MW5A 3RHSA 4MW1A 1KP2A 2XRZA 3FNRA 1QJCA 1JIJA 2J08A 2PIDA 3G5AA 1YIDA 3MUEA 3X1KA 1CT9A 1XNGA 1U0BB 3ZXIA 4DDMA 1I6MA 4R2MA 3H99A 1NP7A 2I1LA 3Q4GA 2DUMA 1GPMA 2A1UB 3KT8A 5J59A 1Q11A 3HFJA 3ZGZA 1KH3A 4G5FA 4I6EA 1A8HA 4EF6A 3H97A 3FDXA 1WZ2A 1G8GA 4J75A 3FETA 4ZT4A 2GOYA 2QTNA 3UMVA 3L93A 1TQ8A 4MUKA 3FOCA 5TEVA 1O96A 4JZYA 2ZUEA 1MC1A 1N2BA 3HGMA 4KKVA 1O0BA 5IJXA 5LM3A 1O97D 3FY4A
chains in the Genus database with same CATH superfamily
1PYDA 3G2NA 4KN8A 2YBDA 5TMDA 3S2EA 1OW3B 5K8CA 2EX4A 1W4CA 4OGFA 3ZWMA 1M8FA 5HR5A 1XTJA 6LDHA 2C78A 1XTKA 2M6LA 1R00A 4D9NA 5HCUA 4N7BA 5BVHA 1YMVA 4AZWA 3PL1A 4OXRA 2PJRA 4FOTA 5EQFA 1VKJA 4UHCA 4TLCA 4NH0A 4YBZA 3AOEA 1OYOA 5B2FA 4CLEA 4MS4A 4CQLB 2GM5A 4GOJA 1ZD5A 3A25A 3MVEA 4N0QA 5FV4A 1B4DA 4OI2A 2JCYA 3EXHC 1HPLA 2WHYA 4PXSA 4GM1A 4EHJA 4P4NA 5FX2A 5I47A 3R5SA 1SG9A 5KTPA 1I7QB 4BV2A 2H59A 1BS2A 2CMGA 2O5CA 4N8EA 1HG1A 1OX5A 1XTBA 4IZHA 5E2BA 2A59A 3W5HA 1F4PA 4EYSA 1CEQA 4JQSA 4DVGA 2OXRA 3GXOA 2GZ2A 5I4IA 3PNYA 1K66A 3BXGA 2NGRA 4QYIB 1L7OA 3JVEA 2GN9A 3NIDB 1YC5A 2JH9A 1II9A 3C1OA 2CXTA 3FKSA 4N5HX 1W30A 3Q7PA 1E8NA 3OPYI 4URUR 2FVYA 3ELWA 2OYSA 4JQOA 3WSWA 4D3DA 4CMJA 4JC4A 1V3UA 4JY7A 1A5ZA 4RV4A 4BQOA 4M0UA 1IRIA 2PXHA 1XZ8A 3D3KA 3M8KA 3TRJA 1N0HA 4I81A 1A8SA 4WZAB 4TSFA 4YRQA 3H5LA 2PPVA 1MX1A 3E7PA 2BCJQ 3PXBA 2FMTA 2GN8A 3TLKA 2WP8J 4BNKA 3GLGA 3TAUA 4L4YA 4H15A 1SKQA 1E20A 1PBNA 5DHTA 1EK1A 1FYVA 2Q8QA 3E2MA 1B74A 2H5JA 1KSHA 2QL6A 2C58A 3ZTTA 4B6PA 1ETHA 1Z7BA 2QRVA 3SE0A 4BN5A 1OFIA 2DTEA 2XE6A 2FUKA 3FW1A 1VKOA 3ENVA 3AVYA 1NMQA 4LZNA 4L73A 1EIWA 3C87A 3BT7A 4XRRA 1H85A 4JJKA 1MHPA 3RKRA 2WF8A 4BU0A 3ETNA 3WWCA 2VT6A 2XQFA 1WMFA 5JLJA 4Y0AA 3ESBA 2ZYVX 2IXEA 1E92A 2FZ5A 4IRMA 2OECA 3MJ4A 1CZRA 3IR7A 1JWLA 1P0FA 2QQEA 2RAFA 3NBZC 3EF0A 2PL1A 1OILA 1AURA 4QXMA 2BWJA 5FYDA 2AF3C 3NTVA 3EBOA 1MB0A 3AF4A 4KQCA 1GCAA 5JUWA 4DMUB 5TX7A 3ZBTA 1XCMA 4B7XA 1YHZA 3BJMA 2REQB 2XDQB 4RPIA 2XW6A 4URYR 1GKIA 4UBKA 4A6XA 2F1JA 3K0FA 2OXCA 2R1VA 4KWHA 3WLMA 1G3RA 1NNLA 1RKQA 2PKEA 4HDSB 4B3TB 5LCXA 5ICSA 4MUBA 4NDZA 1SUWA 1P19A 2VNAA 2ZSIA 4WXHA 5REQB 3V9PA 1II0A 1KPIA 2P4HX 3FB1A 3H2YA 4RPCA 4O4HF 1O3YA 2Q8PA 2QMZA 2TMGA 1L7VC 5BOSB 3B52X 3HUTA 4NMWA 1HMPA 2OBMA 2FMUA 1PAUA 4HLUC 4RTOA 1K86A 2UYHA 1WZIA 4RETA 4LY0A 4DZTA 5JAOA 1VG1A 4EJ2A 3I5AA 4QFDA 3N1UA 4BQQA 3IVGA 2RH9B 4U0JA 4MO9A 3H75A 1P4JA 4FZ5A 2WJGA 2VUTA 1GYRA 4GQAA 2J6HA 2JGLA 3H9CA 3N8HA 4MW0A 3WKBA 3ZHUA 4B74A 2XBMA 1E7SA 3OPNA 3JR3A 2WDZA 3TNFA 2QWXA 2XRMA 3DLIA 1KI3A 2FZVA 4LMPA 3B70A 5FFFA 4IM7A 3T1QA 3TLAA 4YRZA 2X5XA 3FYDA 1LK0A 4D1YA 3O7WA 1DJMA 1XCBA 1IEQA 1WDWB 4AAYA 2Z58A 2V3VA 1G20A 1RM0A 1SVIA 2W22A 3ZW9A 4N76A 4K03A 1Y5LA 2I6QA 4GKBA 4BO2A 4CGZA 1INLA 1GAWA 2X40A 3PQ8A 1D7AA 1XN4A 3RF7A 1DEXA 1GV1A 3R24A 1JHPA 1HT2E 3EG5A 3IHTA 3NBUA 4HZUB 3NWBA 5ERYA 3NVKI 2JIZA 4QDKA 5A4IS 1ZP6A 1YRQA 3DL4A 2V7BA 4IF6A 1JDBB 4ND4A 4V0QA 3QJ5A 4LZPA 3ZGOA 4DNFA 2V6JA 5BNIA 1N0WA 2MYPA 5LLSA 1QFSA 2YR0A 4RCYA 2CFOA 3HKEB 5KNCH 1UK7A 1YAHA 2YN2A 3IUYA 1QP8A 2ZS7A 1LV8A 1OLSA 3PPXA 3AQIA 4W4TA 4W8GA 3GAFA 3GUVA 1RXWA 4Q7QA 1GNPA 3BREA 2OVFA 1D6JA 3CQ9A 5BYBA 1L6IA 4QHSA 4NJEB 4Q9AA 1OREA 1RQNA 1F5SA 3LP8A 5FJIA 2Q3EA 3RRZA 5KYYB 2F43B 5AVTA 3IPRA 1OASA 1YMQA 2VBFA 3V1KA 5LLDA 3I28A 1K2VN 4KPEC 3N2YA 1XNHA 2I3ZA 2G0AA 3L7JA 4N82A 3ESZA 1VRCA 1OXMA 2QRQA 5KOYA 1D0SA 4PZCA 1E9EA 2PXCA 3KKKA 4XD2A 4BIMA 3ZW8A 2AE1A 2Q3CA 4XDGA 3BQMB 1TPYA 2JBAA 2ZRGA 2YIDA 4KE7A 3WKEA 1J70A 4H1VA 2XUPA 4O4IA 2AN3A 2ST1A 4LBWA 3WSTA 3T1YB 1IUKA 3OF3A 4EEXA 5KNBD 1K06A 4ZXFA 1XCJA 3VC3A 4LPSA 3SJZA 1JQLB 1N9GB 1HL7A 1T8SA 3IVRA 3Q10A 4U7JA 3P19A 1VYTA 3ADOA 3MTDA 2IL1A 3GRPA 3NHWA 4DUYB 3EXIA 5IBRA 4F4HA 1M0TA 1Z4NA 5T64A 1C7EA 2RHJA 4LNAA 4I8IA 2CHEA 3BHIA 3ZUPA 2I1VB 3WL7A 5JOQA 4M76B 3V48A 1D09A 4HMOA 4QO7A 2I2DA 1T15A 1ODJA 1YJCA 2OUKA 2VTVA 3AHGA 1C7IA 4I4TF 4ZQFA 4DARA 1E5QA 2NYUA 3KV3O 3QVKA 2EZ9A 5T8KA 4E5YA 4HEJA 5BV7A 2UVDA 1Q16A 2W8ZA 3ECSA 4V3BA 1DKUA 3KT6A 2FR1A 3DDOA 2QSUA 1JWAB 5FKJA 2Y05A 2J31A 5GJBA 4S1VA 4PLYA 1TKCA 4CIWA 2TYSB 3FZNA 3HV2A 4DV0B 4NCBA 4ATNA 2R6R1 3IGFA 2WYUA 3DMTA 1JXQA 3CRRA 2QRUA 4C2TA 1G18A 2J8ZA 3MEQA 4MWEA 4NQRA 3DMFA 4ZT6A 1KFCB 3EXFB 3LLMA 2PE5A 4C7OA 3AQ4A 3U19A 1YBAA 3H5OA 2BBOA 2J5BA 3EGDB 3I1JA 3ABIA 3FPSA 4LWOA 4MVJM 5AYVA 4EY7A 4LV5B 1J9EA 5EJGA 2B5VA 1JLSA 1VKNA 1U0FA 3A9VA 1LF5A 3RJZA 1ISFA 1WUKS 1XJCA 1QG4A 4HVAA 4KZKA 4Y6PA 3S1AA 5U4XA 1XEXB 2Q5LA 3DCNA 4O4JB 3VMMA 2VHWA 3BL8A 3L8ZA 3LDUA 5TPZD 3EFEA 4P4SA 3ZBQA 2R2GA 1OWPA 3JQ6A 2M1XA 5TB5A 4BQEA 5LNK1 3EPHA 4R8RA 1ID8A 1G60A 2FG5A 1CQIA 5J5VA 3DGFC 1FOEB 4TTTS 4L3VA 3FN4A 2PSSA 4QTYA 1YCDA 1DX9A 1O1YA 2CZCA 3CEJA 3TNLA 3PQ6A 3FTPA 1N32B 3BWCA 3NM4A 2R8PA 4FU0A 3ILVA 3ZLJA 1NC1A 3CLHA 3QVUA 4GDMA 5JSFA 1OLXA 4MW6A 4TMXA 3KYDB 1WVMA 3WK7A 3DCIA 2ZI5A 1RAEA 3LY5A 1LVGA 1OZHA 3CX3A 5CVUA 2A57A 3ANNA 3RC9A 4CKEB 3W4KA 1FBNA 2ZRMA 4GRIA 1JUDA 5JANA 1NF9A 1F0YA 5BSUA 4EM6A 2X1HA 3WIVA 5BV0A 2BFOA 4HVLA 4C7BA 1Q0PA 4RGBA 1QMPA 4O4HA 3D1JA 4UHKA 4XQ9A 2A9QA 1GFSA 3ZE0B 3PSHA 4GP7A 5DMXA 4BZXA 1CFZA 3I73A 3HXLA 1GLVA 1OTXA 1KDYA 3A70A 2BN4A 3KSRA 4DNXA 1DT3A 3B1XA 3RASA 5D7NA 1U1DA 2BZ0A 3K20A 1KMIY 3L6UA 4J0DA 4H4EA 5CLFA 1F38A 1OXUA 2REOA 2VTDA 2E7ZA 1CUZA 1NHWA 4IGIA 5D00A 3DSRA 1YZYA 3U9SA 1IOWA 3WIUA 2G9UA 3LNTA 3BDVA 3RTBA 2X6QA 1LSSA 2WNSA 1A2BA 3FDJA 3MJRA 1VDMA 2X0IA 5DE3A 2HCJB 3HEAA 2DLCX 1PGNA 4JI0B 2Y1FA 2AJ8A 3ZDDA 2ERXA 2WMYA 2Q0XA 3FGOA 2ONYA 4MMYB 3D3WA 1HT1E 4D4JA 2GVNA 2OMKA 1OTYA 2CFSA 5F1YA 3UKJA 2NUTA 3K1AB 1A7JA 2ZUUA 2OUIA 3MWLA 4N40A 3ROKA 4GOXA 3W3AD 1DIBA 4H31A 1XO1A 4Q1DA 3IEPA 1E9DA 3PFWO 3RV4A 5LQAA 4KGVA 2LKCA 1VOTA 5CRIA 3EIOA 3KD3A 4PHTA 2AFVA 2VBCA 5AKGA 3HO8A 1LPBB 3L92A 4HLUA 1OH7A 3UGTA 2G28A 2J7PA 3M34A 1G5FA 2JGRA 3NJRA 3OF5A 4NCHA 3STYA 3U13A 3CN9A 5JTTA 1TQ2A 3V4PB 9GPBA 4MVXA 3DFZA 4F71A 3MJCA 5I4KA 4GE3A 3STWA 5ER9A 1JSLA 3QJGA 1JG1A 1DWOA 3WNCA 5TIIA 1IPFA 4FS3A 1NATA 2EKQA 1X1TA 2YZGA 3FTDA 5I5GA 3UQYS 4GL4A 2H1IA 4Q48A 1JU4A 1TECE 4TRRA 4WNYA 3JQFC 3RK0A 3RVOA 2B98A 4TKMA 1R74A 5HS4A 5ED4A 4KO4S 4HPWA 3DAYA 1RI1A 3BMNA 4R71A 2QSYA 3ZHYA 1C14A 1WB5A 1T9GS 3LDGA 3STUA 5JDIC 1DGQA 4LHXA 2PMWB 2XT0A 3LE8A 1JE1A 4LXTA 3JQ7A 2ZXEA 2GXQA 3LQ1A 1Q84A 1JZTA 2AG8A 1R1DA 4HN2A 2QN2A 3KYCA 4MS3B 5HDQA 1BGXT 4Q7JB 3FYSA 3MJSA 1I2BA 4IJUA 4J03A 3GJYA 1QCYA 2EGUA 1WXEA 3GT3A 4Y2JA 3HYSA 4BE4A 3K9BA 4NV0A 1CUYA 4BX8A 3Q0TA 1HFJA 2YCBA 4IDQA 5EN4A 1FNSA 2ONCA 3ZXSA 5IJWA 4OAOA 4A8JB 2FSIA 5LD2B 4HAVA 2NADA 1BMFA 4P84A 1XD8A 4OXXA 1Q6ZA 1XZAA 3GPBA 2CJFA 4Y2HA 3SYLA 4AYTA 2E4ZA 2PRYA 1KKUA 1ZMBA 4BP8A 5HCNA 3WJ1A 4D81A 5BMOA 3UHFA 3BD9A 1I10A 4TMKA 3C74A 3MAGA 1UJBA 1UBHS 2JGIA 3F2VA 4RLQA 1RCFA 4EZIA 4ML3A 5CG1A 3ZCTA 2BF4A 3R6GA 3JYOA 3UCEA 4QOEA 1N8NA 2HM7A 1F2TB 1BDJA 1R4NB 1R5NA 2FK8A 3B51X 5AHKA 3TLCA 1AM4D 5EUCA 3O8BA 1RHRA 2HO5A 4MR7A 3C6ZA 1JAIA 2VRNA 4IKOA 5KOHA 4FFWA 1ULZA 1YC2A 1WB4A 5B55A 1OFVA 4KXQA 1N5MA 3PQ2A 1D1QA 4NFHA 4QPCA 4YC7A 3F7TA 2FX3A 4RXUA 3A2MA 2RK3A 1TM1E 1W46A 1UMDB 2YDXA 3KZNA 1T29A 3K94A 4HZIA 4TTAA 2HXGA 2P9GA 3KZKA 4EJ6A 3LT2A 4LVOA 1FUUA 4ASUD 1RM4A 2NZWA 1A7AA 2AXNA 5CNMA 2GDZA 2J6CA 5EUBA 1JEQB 4NC9A 1PR5A 4MW7A 3VU9A 4QJBA 4LX8A 3U3RA 3RVLA 4BVAA 7REQB 4ACAA 1QP0A 3MQFA 3E1KA 1N1MA 2WZBA 1NVEA 2QENA 1YUBA 1RAHA 2ZU6A 1CHDA 4DDVA 3KQPA 1POWA 2GT1A 2IYSA 5CM9C 3BRSA 4PSDA 3T12A 5IWAB 1YJQA 1FVHA 1GG9A 3NOQA 3O8LA 4HDAA 4H6PA 4R5HA 3EQ9A 2HZ7A 4WVLA 5HIJA 3RHSA 3F6PA 4G97A 2GF0A 5C34B 3RU3A 3WTBA 3UB4A 2FFHA 1SC3A 4ZYTA 3L4JA 2C0CA 1DKLA 2B99A 1QJCA 2DFLA 3CR7A 3FKJA 3K5WA 4JP5A 5CEEA 1JR6A 2D5AA 5K8LA 3KVNA 2OY0A 3R41A 2PIDA 3ELUA 1IC6A 2TRSB 3H13A 3NXSA 4FUQA 1HL3A 2HCFA 1JFFB 1CT9A 3ESDA 4HLDA 2O50A 1A5TA 1DMRA 5KYXB 4X1YB 3WR5A 4WEQA 3UWSA 1GPDG 2CN1A 1PL8A 2IZ5A 4J9UE 1I6MA 4BE7B 5AM3A 1MF7A 3BWEA 3Q4GA 2BZGA 3GFQA 3LQKA 5K0JA 1Q11A 2XMSA 3DLPX 2EP7A 1S4QA 3R5JA 4I6EA 5JHGB 3SR4A 4D82A 5LC1A 3CC8A 4GLOA 2JAOA 4TSKA 2OSBA 2QYOA 2BL4A 1CS4C 2BHLA 4I46A 1PJQA 2AC7A 4HUQB 3NIFB 2DKNA 1Z34A 3BERA 3C16C 4ZT4A 1DBVO 3M1IA 2GPTA 4N9QA 5HF8A 1WHSA 1PNTA 3ZWCA 1EFHA 2O1XA 2C20A 4F1JA 3KRTA 3E53A 3KWFA 1Z73A 5KTKA 3FCAA 3ZCPA 4AJOA 4Z7NB 1O97D 2JI7A 4HS9A 4RK6A 1SXGA 1GPWB 4QYWA 5JPCA 3CJRA 4TWAA 4BFLA 3T3OA 4AKHA 4CKYA 1WUIS 4XGRA 3I34X 4FHFA 1IUNA 5JEEA 4LZJA 1A8UA 3HVUA 2XZTA 3WV4A 4R31A 1T91A 2HJSA 2ON6A 4HNSA 2ERCA 2NSYA 2ZR0A 5ICMA 2Q6IA 3CONA 3VA7A 5J4KA 1SBZA 5B58T 2OZLA 1YCGA 3KWMA 1SZJG 3FSGD 4D4IA 1NZDA 5A5DA 5JNRA 1BVHA 1H1LA 2LD4A 3F97A 1H6AA 3JX9A 3K0AA 3PJEA 4TYYA 1E6EA 1WUTA 3JQGB 4MHSA 3OE4A 4CM1A 3O1IC 2AHRA 3DC2A 2OLKA 3AY6A 3ZQ4A 4AG5A 1D8AA 1KJQA 4BQFA 4FQ8A 1LNZA 2QTMA 1KIAA 5DI9A 5KYUA 1Y33E 3QBEA 2K7FA 1I4OA 3NR2A 2DWOA 1NXPA 3PGKA 3PYLA 2O2YA 4YVFA 1U7WA 1B6SA 1Z3IX 3U7QB 2SNIE 3IUBA 3U44B 2I9PA 2X0EA 5EFOA 3P0JA 5JXWA 1XI2A 1ND6A 2ZSUA 5TQ0B 4JBHA 1VE7A 3GFOA 4RW0A 2OBYA 4HQKA 2IPNA 4P3PA 2QE6A 4J0JA 3CJQA 4ZPJA 1L7NA 3SJCA 4BNTA 4U0KA 3FTCA 2VP4A 4K9MA 5HS6A 4D96A 3NTOA 1ZD4A 4ZO7A 2L42A 5H59A 2RH8A 1XDZA 3A1SA 1LQ2A 1GNRA 2YHIB 4FT2A 4HFJA 4I9FA 2QRZA 3IQXA 2ZROA 4UCXA 5CGZA 4RELA 2X14A 1UXOA 1J39A 2VP0A 1JDJA 3GL9A 3O95A 1E66A 1U8AA 3E3NA 4E2XA 5E95A 2ZIGA 2WJ3A 3NH9A 3NONA 2A3NA 4G07A 3SOPA 4ZGGA 1SRRA 3SBEA 1RYMA 2QE7D 4Q5IA 7AT1A 4EG1A 2ZBPA 5DNVA 1OR8A 2NO7A 3N3AC 4QM6A 1E0AA 3KHKA 1UBNA 3DB2A 4UUBA 2R00C 2IPXA 3NASA 3B6MA 4ISCA 1NN3A 4RKRA 5J23A 1DBRA 3EG9A 1ZAKA 5AW8A 4JLAA 4UZFA 2VDUE 1RYBA 4DR5B 4BFSA 3DPUA 1M2OA 1V3VA 4A0FA 1E9FA 3FOFC 5J1SB 1QIDA 4FILA 1Z0KA 4UXHA 1KK2A 2CLIB 2XF8A 1FCJA 3IH5A 3SZUA 2VP3A 5ESXA 2ID4A 3CF6R 1G8SA 3IT3A 4GRAA 4KQHA 4WUVA 4YPFA 3H0CA 3QKWA 5AHXA 1Q1BA 3UAYA 3UK2A 3W06A 1EFDN 2HPHA 2YVUA 4BDSA 2UUPA 3FUUA 3JQFA 3OOSA 4QNMA 5ITSA 3ZDAA 4EO9A 2FP3A 2PEYA 1I13A 4NYMR 1RLIA 2M32A 2W6PA 3RSHA 2JFQA 2VNKA 1EWKA 2PS0A 4ALMA 1Y3BE 1MXFA 4JEIA 2YUTA 1YCFA 3HCNA 4QIHA 1P9OA 2Z4RA 4GQIA 3MMSA 2C2XA 5J9FA 1SB8A 4P82A 4TV9B 2NO6A 1ZGZA 1EVKA 1EFVB 2R6ZA 2X6TA 1BWRA 2X9LA 2Z1NA 1V37A 3QWIA 2BOVA 4MCIA 3VR6H 1LSJA 2ZIUB 5JH7B 4UASA 1WPGA 3KQUA 2WF9A 1LJLA 2QTAA 3I30X 1CSEE 2VP6A 5FPTA 1NPDA 4RNDB 3VU3A 4RCZA 1VECA 3K0HA 4L8YA 4NFSA 3ISTA 3EDYA 3QSYA 3C3MA 3RLIA 3EJ6A 4MTCA 3MUFA 4UCWA 2I4TA 2G83A 2GBIA 4PXAA 1GDHA 1HDYA 1N5RA 2O1SA 3D6HA 3JQEA 3OOHA 4GQBA 4Z86A 1Z5GA 2BVNA 4PZUA 4D9HA 1SHKA 3JRWA 4S05A 2IFTA 4M87A 4C1NA 2YNMC 4JBWA 2V55B 3EDQA 3Q88A 2NO9A 1EXMA 3GX1A 2UUCB 4EI7A 1A69A 1K2WA 4ES6A 1Q3TA 2J3KA 1BNCA 3UZUA 4PLZA 3TVYA 1RYDA 1B26A 5F23A 3L02A 1GL3A 3I32A 1MJNA 3TB6A 1PV4A 4OBXA 1P7YA 4TZ0A 1LDBA 4HXFB 4PZPA 5M29A 3ZJUA 5LOVB 6GPBA 1JH9A 2OA0A 4K46A 3LHKA 4IAOA 4WGGA 4PYMA 1PU2A 5KTYA 3GDFA 2J0QA 4CCYA 1PJCA 3AFMA 1ZIOA 5L4LA 2V8OA 4OF4A 5DM0A 1I0ZA 2AI1A 2OFFA 3I72A 4BO1A 2UUAB 1D0VA 3KT3A 1F9AA 3BK1A 4LECA 3K8OE 4Y6OA 1MRSA 3E7DA 3RT9A 4LIPD 3W6ZA 3SK0A 1JDSA 2BC9A 3KTFA 5H4GA 4P81A 3FMGA 4PZAA 1YJ8A 4K9OA 3OPYB 4JA0A 1PK9A 3A1EA 2BJHA 2ZW9A 4QNNA 1D2MA 1UFOA 3A4YA 3FDZA 5D86A 5E3JA 3WK9A 1ORDA 4QGAA 2UDPA 4A8HA 4BMYA 5CJ2A 2OXEA 2BGGA 2HU8A 1OGJA 3URMA 2H07A 1XZFA 2Q1YA 2X7HA 4KGZA 5TEWA 4XQEA 5IT9A 3LG2A 2AX3A 2WTEA 1UC8A 3P20A 3UT5A 1Z2CA 3O6VA 2DQZA 2ZJ6A 4FQ5A 3UXMA 4W5RA 5G0TA 2OQ2A 3GYBA 3RSFA 1S6YA 1M1NA 4OA8A 3KC2A 2WG2A 5F33A 5H80A 2CLDX 2IOYA 1QYRA 3P2MA 1PGJA 3UEOA 4URFA 1G7RA 4X94A 2GKSA 5BSTA 3OTHA 5FTWA 5I6DA 1BDHA 4LXUA 4YXWA 5M04A 3CUYA 1FNMA 3KOMA 3NBXX 4WK0B 4A23A 2XOKA 2NO4A 3ECCA 3NDRA 4GT1A 4QSMA 4BASA 4PBRA 2GZAA 4JITA 2EWVA 3AVQA 2OORC 3TPZA 1HE4A 5I8PA 3T8YA 3OTOB 4E88A 4LJLA 1W88B 3QVMA 4PNHA 3RC3A 1QH1A 2RH4A 2ZUWA 4QPNA 1OVMA 1AO3A 2VPZA 4E31A 3AI1A 4EUHA 3CGWA 1H65A 2ZUCA 5FBLB 2QTVB 1D1PA 1KNQA 3A28A 1LQTA 2A1TS 3FYUB 2WWGA 1US8B 2VRCD 1E1QD 3G8YA 3N0XA 3MRTA 4KB5A 4QQRA 4RK7A 3ZGYA 5I7HA 5E9QA 3ADBA 4KR6A 3CE9A 3VZSA 4DBLE 3PNPA 1ZI6A 2I0FA 4QXPA 4TUYF 3AIKA 3UATA 4D4GA 4H3KB 3GLFE 4JJFA 1KP3A 4HKTA 4BP3A 1EB9A 1RVV1 2P9QA 4B7UA 4AZ0A 5DMHA 5FOQA 1PJ2A 1QONA 1L8XA 3MWDA 4UPDA 1FUIA 4G67A 4ETMA 1IG0A 1SAYA 3AM4A 4AJEA 3HXMA 4MCHA 1Z36A 4WASA 2GPBA 4FLFA 2MSDB 2WJYA 4G5YA 1YSCA 4DDHA 2Q45A 4L22A 4QAQA 3NDJA 1DAIA 3EIUA 4YALA 1JL3A 1MRZA 2EV9A 3MJEA 3B82A 5DEOA 3RAJA 3RYFB 4IS2A 4A73A 2OBNA 3AO0B 4AT1A 2WMDA 3PF8A 3TR6A 3O82A 1WEHA 3RC2A 1TYAE 2WK1A 1FVOA 4Q3KA 1ZMTA 4P0QB 2ZJ5A 3KEOA 1GQ2A 2Z2YA 3UT6A 2O2XA 1DAFA 1ST2A 2I8AA 2GLXA 1RYFA 3QG1A 4BNIA 3FZEA 5CIQA 4DXHA 3LNCA 4WD3A 4YHHB 1HYEA 3FHLA 2P35A 4UTPA 5IASA 1K4KA 3GC6A 1DCFA 4S3MA 3ZVLA 3ANTA 3KQLA 5BQ3A 3DDSA 4IX1A 4QYTA 5FH9A 3DE1X 3A4IA 4KNYA 3RRNA 1Q21A 1U2DC 1BTOA 4DCTA 4CM6A 4F7WA 5IEBA 3TW6A 2BFFB 1C2TA 3C6QA 3L0DA 1OAAA 5EIOA 5AM5A 1USUA 2QR5A 3PJDA 3MW8A 5CA0B 1Y3DE 4BRZA 3CT6A 3CVJA 3EGWA 4B9EA 3JQ9C 1IJEA 2R00A 2QM0A 4TL8A 2OOSA 1FBTA 3T7SA 3LMKA 4FFNA 1T9DA 1A04A 1LLFA 4C4XA 3UHJA 2JFGA 3DW3X 4QEZA 2I3GA 1IQ0A 1Z4OA 3UW1A 1Q0TA 2GBGA 3PDCA 3VR3D 4E22A 3WZ2A 1VSUA 3QE3A 4AF8A 4Q39A 4ARVA 2DWCA 2QMQA 3ND6A 1WQ4A 4LZWA 5K6AC 1CETA 2R8YA 3UJPA 1T34A 1VP9A 1ZITA 2XIQA 3I2KA 3C5CA 3FYCA 1FFXA 2WD7A 4D9MA 1DTWB 4OHRA 4C2UA 1CY7A 5B30A 5IEJA 1TKRA 1KYYA 2OZPA 4PLCA 4OP3A 1GAQA 5CAEB 4JYZA 3WZLA 1N78A 3QEMA 4JJ4A 5HUJA 3EPKA 3G8DA 5HILA 3UG7A 1TUIA 3K0SA 1VIYA 4QJ5A 1C80A 1S2IA 3FVWA 2CNOA 1OLUB 5DN6A 4Z0PA 5IH7A 1VMKA 1NC3A 3WVNA 3A4NA 3QE0A 2EG5A 3T94A 1V47A 1XB2A 4YT5A 5BNWA 1AG9A 3CNHA 3BS4A 1VJDA 4D98A 1RRKA 1QUEA 4JJIA 3ZBPA 3IPCA 2GHQA 1IHOA 2X5KO 3HDHA 4LF9B 3E8XA 1M6VB 1HE3A 2BMVA 3HCAA 3UVEA 4IFEA 1WCV1 4K9NA 3ZCSA 5L40A 5DM4A 4I8XA 4CF5A 2ZJBA 3W7AA 3WSVA 1IBMB 2CJWA 2I6TA 2V7QA 4OP2A 3JVUA 5JI3E 4LZLA 3WRYC 2QJTA 3IILA 2Z6QA 1G6HA 4X3OA 4B3BA 4AYXA 3VM6A 2YNMA 4UATA 1E3JA 5CT4A 2AJBA 4ZMRA 1O9HA 1ZC3A 4UU8A 4GI5A 1YF3A 1KY3A 4TMYA 2Q1TA 3UNXA 1DOHA 2X5OA 2ZVDA 2VDJA 4M0LA 1R15A 1FFYA 1PW7A 4LJ7A 4JR2A 5CDSA 1WU8A 2ZFUA 4DOMA 4AP5A 1TADA 3JRNA 2QVBA 3MTQA 4GX5A 1GQYA 2FSSA 1DU4A 2C4NA 3BYZA 3G7NA 5JDCC 3JARB 3SR0A 4E4TA 2F8MA 2AQIA 2WBLC 3KUDA 5GZ6A 2OV3A 1GKLA 1UMCA 2H2WA 4CMIA 1N6PA 2B61A 4DJ5X 1R66A 4ARZB 2FV8A 1M74A 1AQNA 3HCBA 2ERYA 1HSZA 2A9KA 4MS1B 5F4BA 4CCSA 3TYXA 5BV2P 1QM5A 2Q7XA 3ZHQA 4L4UA 4KYUA 4A5OA 3MB5A 5CURA 2NVUA 3ON5A 1QQ5A 3ZU4A 4BC1A 4M0EA 2O3JA 4M7OA 1YRWA 1KKMA 3PQ7A 5JJ5A 2IYRA 3WFIA 1P44A 3MAAC 4BN0A 1E2DA 2FEKA 1MIOB 4J91A 3RS4A 1U2PA 4UMEA 3NHAA 1OYWA 1QRTA 3RUEA 3QW4B 2HRRA 4UCQA 1FFAA 1S7GA 1NT4A 3TR0A 2WVHA 1EIZA 4TUYA 2FDCA 1GZ3A 1ZSNA 2WIAA 5DPMA 1ZJYA 2XWBF 1V26A 3BIFA 3AZQA 4QG3A 3KXDA 3CVVA 3U3JA 3F90A 4RTKA 1JLHA 1I6KA 4OQLA 3FNHA 3R76A 3OLQA 3QHQA 3KR9A 3QPWA 4IXDA 3L07A 4OBEA 4QOGA 1NQTA 4KI0A 3UKDA 3V4LA 1NSTA 4B3DA 1W5EA 3AGPA 2ZR7A 1Z5OA 3FH0A 3LO8A 4KQXA 4WIAA 4UHFA 1KJYA 4KFUA 4OJQA 2OO3A 1MO3A 2PYDA 2C03A 2BEJA 3C43A 4XGKA 3ZDYB 2X2PA 1EFRA 1P2VA 5I9TA 3ZEAA 1MG5A 2OORA 3OJCA 5TC4A 3P0FA 1PL6A 2WF6A 3AKYA 3VH4A 3U5ZB 3DFUA 3T4PA 4G26A 2BGNA 3IQHX 3QFHA 1NVMB 3QY9A 3HADA 1Z17A 2QPTA 1FMFA 1NYQA 1SR8A 1H6BA 4KR2A 2MOKA 2VDWA 4FPXA 3OURA 2EFJA 4YUAA 4I9HA 4WKPA 1A72A 1ZGAA 3QX3A 4Z1OA 2P68A 4EEKA 4JASB 3GT0A 2M6KA 1OKKA 5DHQA 2RIPA 4EABA 2QNIA 4XJVA 3JATB 1CEYA 3U4GA 3OZXA 4X1OA 4EG0A 1Y1SA 2XOXA 5KOJA 2VAXA 4FGLA 1WW2A 5DNDA 3FFBA 4UOEA 2J9FA 5K8UA 4PLGA 3JQ8B 4CI9A 4ZK6A 2I71A 4F8JA 4NOMA 1JSCA 1C3EA 1N5KA 1FDTA 3ADPA 2WICA 4OHBA 5DCLA 5TVGA 2NTJA 3UMVA 1XCGB 2FPRA 1SGWA 2FN7A 3AR8A 4LNHA 1JJVA 2HHLA 1Y4SA 3H1EA 4HDQB 4MZDA 1EVEA 2GERA 3T38A 3WK4A 1GNSA 5KSOA 4ZC8A 1Y5RA 1SC9A 5ICEA 4DIOA 3WNVA 1DBPA 4PFQA 4ZQGA 2D06A 2C5EA 1J2JA 1BJKA 1ZUNB 3B3FA 4FIDA 1WXXA 4M9UA 3K9NA 4P3KA 2GO7A 4BNJA 3SQXA 3AP2A 4EKEA 1QHXA 4X20B 1KOLA 2NXWA 4IICA 4E0BA 1T36A 4AWXA 4CDMA 1K92A 2GKOA 1NZJA 2JI8A 2YXBA 3GJ4A 3CMCO 3GRYA 1GGHA 2HPZA 3LUBA 1TYZA 3OQ1A 2NYAA 3DL2A 5EHZA 1NR7A 4JXZA 3GV0A 2F3QA 5WRFA 1EM8B 2E0IA 2VJKA 3VPSA 3WB1A 4I3FA 4ZVRA 1K5DA 3S2IA 3DCJA 4H6VA 5E6SB 3EZ2A 3CPSA 2XH8A 2IXAA 1RCTE 1E2JA 3DWGA 3L0BA 2XT9A 3ZCVA 2EFYA 4D3FA 5K3EA 3SZOA 5E8JA 1U2DA 3QMWA 4N3NA 1IUPA 4MRMB 5I7AA 3UOWA 5EY5B 1LW7A 2J9RA 1FJ2A 4KWIA 3TNJA 3UWOA 2NZYA 3P0EA 3ZCXA 3BFXA 1H3NA 4X93A 1TZ2A 4FGWA 3ZE6A 1SPXA 1JE0A 4TQ9A 4CTOA 1YQXA 3W5AA 2JJ8A 1G2QA 4FFBA 2WRZA 3UBTA 2VAVA 1U6JA 3JQ9A 2IEYA 4TLMB 5BYJA 4A8TA 1QRSA 5U4QA 2ES4A 3IUQA 2PQ0A 5C0OE 5KBYA 4EGCB 5AI4A 4WKGA 5DYTA 1O54A 3DKKA 2PWAA 5K45A 2J09A 4IRXA 3GLRA 3EPRA 3N8DA 4W5QA 5DM1A 2C3YA 1XOIA 4U7DA 2NG1A 4AG3A 4A3SA 2J4DA 5FT9A 4Z4GA 1J56A 4HO1X 2J4FA 3DLBA 2B4YA 1ML4A 2A5FA 4BFYA 5K6AA 1F7UA 3HE3A 3AF6A 1ILWA 3ID6C 1PS8A 1E1RD 2PZJA 4H2DA 1BXRB 2EL7A 4HWOA 3HSKA 1Q7BA 1IZ8A 2NV6A 4I55B 4IW3B 1CJCA 4BNDA 4XUDA 5LDHA 1QUFA 1ORWA 2KLHA 2Q1WA 2CLFB 2Q4BA 3DE0X 3FUXA 4NBVA 1X80A 2HC9A 4ZAGA 5FR2A 3RWBA 3SJBA 3VVCA 4FR0A 4EF5A 2EX0A 1H2RS 3TTXA 2GNPA 1RWXA 4MUAA 3EIXA 1DIRA 1Z0ZA 4OI1A 4B1FA 3FYTA 1JLLB 2WYVA 5ICGA 3FNBA 4AX8A 3LCUA 4RIFA 3S1SA 1KI1A 1Z2AA 3R40A 1ZUWA 4PC2A 2PIAA 2V0GA 2ZU0C 3OETA 3WLPA 5KX5B 5F35A 4UBJA 4DMKA 2H54A 2A92A 3K1JA 1AKYA 4AUKA 1PZNA 4UEOA 2RBKA 4EG6A 1J00A 3E05A 4JI2B 1EE9A 2AFHA 1Y8RB 2BEWA 2R5NA 3RAGA 5EIFA 1GA4A 2NUAA 5AW3A 1JPUA 2FF5A 2QPOA 1Y42X 2ZTMA 4R41A 5FLXA 4IDEA 2O2DA 4PLTA 3UCXA 4L74A 3EY4A 3BGDA 4L5BA 4LEIA 3RFXA 3WRYA 3R5HA 2DZDA 1NURA 1Y7TA 2BHRA 4I9UA 1GHTA 2RGEA 3QIAA 5FPPA 3ZDBA 4MARA 2OAP1 3E61A 3I9NA 4NOLA 2C54A 2B7LA 5LMZA 4Y1RA 4C88A 2NU9A 4FKZA 1W8DA 2VTBB 2FYTA 4DPKA 4W7HA 4CKBA 3DEHA 1GZUA 2UVPA 1YQEA 4YIKA 1AGXA 3C7CB 1GSHA 1L4LA 1FS6A 3A6DA 5E2IA 3K53A 1AGYA 4W5HA 4Y6QA 5HK8A 1IRXA 2BI7A 1Z68A 5JDCA 3GJTA 5CB8A 4C5CA 3ZZTA 5CFOA 2YWHA 4NMXB 4TMZA 2B69A 1LV7A 3C98A 3F74A 4R9SA 3DWEX 3LC2O 5FBWB 5IW8A 3P0HA 4MVJE 1J90A 1ZU5A 2Q5FA 4HB0A 1A5AB 1JMKC 3D8TA 1F0NA 3PFGA 2UZIR 5HF9A 1I7LA 3UH1A 3LCMA 2EWMA 2ZYGA 4RSMA 5A4FS 2VH1A 2VPXA 1VMEA 5JD5A 4RSGA 1AS0A 4KKXB 4D4HA 2ILVA 3IBFA 3K6SA 1S2DA 2W83A 2MR6A 1XZMA 1NLFA 4FYVA 4JWTA 4Y2XA 2JASA 4YJFA 4MVJP 1AE1A 2VJQA 1O94C 1ZD9A 4OJMX 1JLKA 3BWXA 4KVFA 5EYPA 2O3SA 3FMPB 1KS9A 2GCEA 3KYIB 4LYEA 4XI9A 4EUEA 4UQLA 4GVPA 1YVRA 5JAMA 1VM6A 4JQZA 3HUFA 5IAEA 4QFCA 3JASA 4AFNA 5K8IA 1QPZA 1U1FA 2ZT7A 2O2JA 1NXSA 2IYFA 2C82A 2XD9A 3GH3A 4LNUB 2R1UA 4IWYA 3CUVA 3PRJA 5BN4A 4A82A 5UKDA 2C5HA 2HNAA 2YIJA 3FBWA 4WESB 4BVGA 4AQDA 2O0KA 5DGTA 1CCWA 4BDTA 1DAPA 1EZ1A 1MU0A 4CF6A 4OI4A 4JT4A 5U1PA 4YJHA 2Y4NA 3CF2A 4IX9A 1XR3A 4MGKR 4TZTA 1YR1A 2IU4A 4JJGA 4CKCA 1JEAA 4YRAA 5AKHA 5HQTA 5HYVA 4DLRA 3ZZ1A 4BY9E 3NBQA 5B3JA 4Z99A 4MV3A 2RDMA 3OQHA 3DAOA 4IIJB 3OHPA 2EGGA 5HW0A 4MVJI 1QE0A 2P3SA 3LCRA 1LW6E 1DIGA 2VEDA 2PMCA 3OO1A 4G5GA 3DTVD 2Q4TA 3WNBA 1N36B 3PHIA 1OVGA 2R5FA 5LYJF 1P2UA 3V6MA 3HJFA 3MF4A 2ID7A 4GMDA 3B6KA 3L05A 3HCEA 1CUDA 1V4BA 5HRUA 1DXHA 1E2NA 2D8MA 2I2BA 1XRJA 4UDXX 3OIWA 5CFPA 1W1IA 1DWQA 3K9CA 4BBPA 4G0OA 3KVOA 4NJOA 4IDNA 4REQB 4LK3A 4KXVA 1K8QA 4G0PA 3B48A 4XGNA 4KDEA 4B8ZA 1AA6A 5ADVA 4CQMA 1XMJA 3K9WA 1CV2A 5BVGA 4C3ZA 4HAXA 4KQ1A 3LW7A 4PGMA 4U7GA 3E9MA 2X8WA 1LPNA 1SNYA 4EHNA 5A4JA 2NN3C 2C57A 2BTEA 2C9ZA 2GA9A 1TB4A 4P3NA 4DMMA 4DMRA 3THWB 4OLHA 5K3BA 2RGRA 2PTHA 4N7RA 3KXIA 1BHJA 1U3VA 1ODCA 2W6CX 3PUJA 1KRWA 3PVCA 1NVAA 1T8WA 1OBFO 4TKUA 3LKVA 5ALKA 1LBTA 1XZJA 3QLVC 2WYHA 1R0CA 5AK5A 2A4MA 1VFNA 2GJ9A 1DJQA 2H5LA 4GGMX 3ZS8A 3DC7A 4XYBA 4DLZA 1T1IA 4DB2A 2DLNA 5D1HA 3UXHA 2R47A 5JW6A 2DFDA 3V8NA 1CULC 1YKGA 2J3QA 1JT9A 2OGZA 4D8WA 4XIYA 4PU0A 2QRKA 5AUOB 3KQNA 3KZ1E 2GRJA 5ES3A 1DKOA 4C7VA 3I6BA 3DBLA 4CEIA 2A7XA 4P3XA 2LPMA 4ZN6A 1GTSA 4JK3A 1NG1A 4KR7A 2HA5A 5CTAA 2P11A 4QLAA 5LA6F 3QTLA 4S12A 2QB5A 4EHAA 4CT0A 1GFIA 3AKEA 4BXOA 1SC6A 4I9GA 3ZGVA 1VJ1A 5JQGB 1MO2A 3GIWA 4FGUA 3ZZ0A 2WHPA 3NOOA 4IJQA 2CKMA 3NALA 2WJZB 1K6IA 1O08A 3PS9A 4G0VA 2R8RA 2FMHA 1YNOA 3UO8B 4DADA 2ONKA 1SELA 5F7OA 4FZJA 1CP2A 1EP3B 3WNQA 2HMYB 4MVYA 5FPHA 1R4ZA 4RJLA 2VCEA 3IUEA 4FCTA 4ZT3A 5AXCA 5F1PA 3CFYA 1RPAA 1UAYA 3L01A 1J8VA 3BAZA 1LC3A 3G5UA 3QYAA 1JJIA 3QPCA 4HB2A 2DB3A 4GXTA 4KFTA 3H2BA 1U8FO 2JA1A 3GFTA 2P78A 2RE8A 3AVUA 2B9EA 2PN1A 3V8VA 3OT4A 4I5GA 3VOSA 2G71A 2IY7A 5JSHA 3HTXA 3TQIA 5GONA 4EUKA 4EYOA 3GRCA 4ZT2A 4K6OA 5J2TB 4RQUA 3GA7A 4MRRA 2QT9A 1YK0A 1LUAA 4Y9TA 4TL6A 2X9NA 4EELA 1XQWA 1CRPA 1JR3A 1KMMA 1XLWA 1HURA 3H05A 1YI0A 3N07A 5C9ZA 2V5AA 1CB7A 2DTXA 3H7IA 1XD2B 2W6ZA 4RNCA 3S27A 8MHTA 1CQWA 2EL9A 2CMDA 2Z09A 3NC4A 1XVTA 2OV1A 2VJAA 1ZDMA 3SIRA 1MO5A 4JZKA 3N2KB 2BFWA 2GESA 2V6MA 1L8QA 4ENWA 5CLIA 2W2KA 4B6GA 1VB3A 1M66A 3EZ6A 3H8JA 2WJVA 2RKBA 3CISA 4MKHA 3AEUB 4H7JA 4Q3AA 4UUPA 3T4XA 1B1CA 3T06B 4MPRA 3TR5A 1E5XA 3R7NA 1B41A 4JBGA 3RU9A 2YRFA 4I7EA 3G68A 4O2RA 3G17A 4PGFA 3ZQKA 2IXBA 2GTPA 3WLKX 2VJLA 3IEIA 4FLEA 3DAGA 1YA4A 4J8PA 1M0WA 3QHPA 4I9NA 2VJBA 4AMBA 1PEKE 1Y1KE 3ZKAA 4F60A 2D0PB 2JGEA 3GEDA 1AA9A 1ZVQA 4FDVA 2A6PA 4AXXA 1SY7A 5BNTA 4XQ0A 1U5AA 4FI3C 2XVYA 3WWPA 4O2AB 4D92A 3TDMA 3EFHA 3BWMA 1E3IA 1QGUB 2MSWA 3VH1A 1XEWY 1M9NA 2DECA 4XB6B 4YECA 3V8PA 2EW2A 3HKDA 5K0EA 4URVR 4TM8A 3PWKA 4M98A 4WK2B 5JXGA 4QDOA 5AVYA 1AHPA 3I58A 1O6FA 3ZU6A 4HZGA 4RFVA 4XM1A 5K51A 3DFMA 1OMOA 3G8BA 5FF9A 5JQWA 2E4YA 2DKFA 1E1CA 4B0PA 2D1TA 5LU8A 3G2HA 4MITA 1GPYA 3N59A 1NQXA 1V1MB 4H0NA 4JB0A 1R3UA 2FF7A 4KCGA 2FRXA 5F64A 3TKAA 1U9YA 2V03A 2YZMA 3TQRA 1KI6B 4HK4A 2BEKA 3EA0A 3M81A 4F5ZA 1ECGA 3BJIC 4C4ZA 1GNQA 2X1LA 3PUXA 2J3EA 3D8NA 3LP6A 4J43A 3DO5A 3WLNA 3ZU5A 2RK6A 1W4AA 3DZJA 4ZJPA 1H2ZA 2W71A 3WYEA 4N9WA 2YV5A 4K0RA 4Q4JA 5K8VA 3I83A 1GGEA 3QW2A 2YIVX 3O8OB 4Q0MA 1MV8A 1VPLA 2G4VA 4CU5A 1UBSB 1UBJS 1SOUA 3BF8A 3TW8B 1T4MA 2CVQA 2LV8A 4FI3F 4DQXA 4G81A 1O94A 1T9AA 2BFCB 2FUNB 2L82A 1P77A 2EYUA 4RCVA 5B3JC 1QPGA 3OKCA 3PT5A 1MAWA 3C6MA 1L7BA 2GQ0A 3EEIA 2CFTA 3DO8A 4MYCA 1Z4KA 1HE8B 2WZQA 3IOCA 4KO8A 4N5IX 4CJXA 4Z7OB 4QPPA 4YJ2B 1YU9A 1MJGA 3CT4A 3RFFA 1R6XA 2R6FA 1I32A 3E22B 2YJ3A 1ABFA 3TE7A 3PPWA 3R3XA 4KACA 1KEPA 1IM2A 1DO2A 3ZHCA 2EF0A 2W2OA 3WXMA 1PF7E 3EPJA 1B15A 3GNLA 3O73A 1CVIA 1KI4A 5JV5A 3KUXA 1TJ4A 3BMQA 3OE7A 3TSCA 5A04A 4ZQCB 2GKGA 5LQCA 1U7XA 1CYEA 4W9RA 2ANBA 3H5RA 1Q1EA 4LI0A 3PR1A 2OCGA 2E4WA 3PL5A 3ITKA 1OH6A 4M88A 1QHGA 5IKOA 5I01A 5C8DA 2ZEJA 1NVUQ 4BO5A 4A16A 4RJJA 5IG2A 4LF7B 4CCWA 1LI5A 1USKA 1W85A 3NHBA 3U3DA 5AXBA 3KJQA 3LVQE 2IA5A 1LZLA 5KSWB 1I1QB 4KQFA 5F73A 2D1SA 3TTUA 2YDYA 4I2NA 5A2GA 3GLFB 1ISGA 2Y1CA 4R2IA 4FFPA 4G0YA 4WLNA 1L5KA 1XTIA 3PQ4A 1B8OA 1ULUA 1PV1A 5H83A 4C4AA 1CQJA 2QQGA 2NV0A 3LQYA 3QXHA 4LRSB 3ILXA 4MLZA 3ESQA 4URHA 3S99A 3UFXA 3TLMA 3ZZNA 4E11A 4B85A 3THSA 1DQPA 2F3UA 4RVCA 5ESWA 3GZNB 4P4TA 1WDLA 4QO8A 1KQPA 2CF5A 4PRYA 3CO5A 5G40A 1E2BA 1UWKA 3CUTA 4CXMA 1L3CA 4MW5A 5CCXA 2QVYX 2VPIA 1X7WB 3C8HA 1KP2A 4MCJA 3PX3A 5FWYA 4US0R 4UC0A 5GADl 3LF1A 3LUKA 4LJ9A 3EGXB 4RDXA 3TSZA 5CA1F 2WU0A 1SB9A 4CMKA 1WXWA 4MRPA 4Q4AA 4DLNA 3FUCA 4WLFA 4BJ3A 1RJFA 2ZBFA 4EBBA 1IXZA 3Q85A 1U0BB 5IFLA 4WKNA 2BHNA 1EDZA 4AIIA 3P5BA 1BCSB 2HU7A 5EL0A 2PZLA 2QQFA 3N2LA 4Q4HB 2C1EA 1P1BA 2AVNA 2C7GA 1LK7A 2N1MA 2VVTA 2HR1A 3IPYA 3ASVA 4H35A 3TTYA 4CKWA 5IAJA 4B5LA 1F06A 3LC7O 4F6RA 5FQNA 4ZIRB 1RHQA 3R3VA 1YI1A 4ZVNA 1KJZA 4FLMA 1C0IA 2VIIA 3DA8A 1YQ9A 4ZTBA 5AW5A 1KFBB 3UAWA 2UZ4A 1N5DA 3P71T 2CHVA 4M8NE 4PQFA 4MUKA 5I7VA 4Z0NA 1PHPA 3FOCA 4GFDA 3I6IA 1X70A 1GUDA 5TY0A 2WWFA 1QRAA 2W2VA 2GILA 2Q2OA 4IINA 3VISA 2JAUA 4XWGA 4J6FA 3ZNOA 3DMPA 3WGJA 4L51A 4LXIA 2Q2WA 3OT1A 4AX4A 5CB4F 2M2IA 2CDBA 2YFYA 5BWNA 4YJ3B 4UUOA 3ZEIA 4RU1A 1PFKA 3MQ4A 4R84A 4QD3A 5KVVA 3ZHTA 1SHLA 3RYCB 1Z47A 4Q15A 2UZ1B 2V3CC 2DH5A 4PAWA 4RDHA 4LCBA 1TAQA 2FNAA 3Q7SA 3OZRA 2R4QA 1GCOA 2H06A 4IIXA 5FA6A 3IMEA 5JNVA 3GBPA 1JSZA 3ZDFA 2YYZA 2HSJA 1AKWA 1Z83A 1ZJ5A 2JEOA 4MQUA 5COAA 1YTUA 4HDNA 4OX9Y 3THXA 3PCXA 4FT4A 1L4FA 3QPBA 4PHHA 5A71A 4RVSA 1R9NA 5A9SB 1Y3FE 1FRVA 3O4FA 1K3FA 2ZJ2A 5KYWA 4XPIA 1TYCA 2YQ5A 3PKJA 5KDDA 3VMFA 2I78A 4C01A 5ALFA 2A7QA 1IIRA 1E2GA 1UBLS 2HWYA 3SX2A 4YMGA 1RT9A 4UNSA 4C4RA 1TF2A 1N7JA 3QRWA 5I7SA 4BFTA 3F3YA 2BR4A 2Q5HA 4IDPA 4RUKA 5LBUA 5JO0A 1VGQA 2OBXA 4Y9UA 4YH1A 3VPFA 4CLRB 1GGNA 1W0KD 1YWGO 4M1QA 1QVWA 3CZAA 4MR9A 1U28C 4BNXA 2JATA 1ILEA 1PNOA 2O1WA 3VYSB 2VYNA 2J4CA 2Z3VA 4HBGA 3B6ZA 5F9FA 4EQZA 4CKZA 3D8HA 4KREA 1DG1G 1DXOA 2FEMA 3K0BA 5A7GA 5FOSA 4ENSA 4E51A 2JFPA 2V4ZA 4LDQA 4MB0A 3TLGA 2Q6KA 3GOQA 3HVJA 1U7TA 4MYDA 5C7IO 1QIHA 1Q3HA 5ABPA 3J81k 5BSHA 2Q5EA 4AF6A 3W34A 1NLMA 2QD5A 3AF0A 3JWPA 1HG0A 1IN7A 3RK1A 4M9ZA 3UYKA 4EHIA 2J0UB 5HDBB 1E2IA 3RK4A 2CL6X 5A6SA 4KUHA 4YRLA 1DI0A 1AQYA 2ZYRA 3HN2A 4PIMA 2QXYA 1JLMA 3OEYA 4MUGA 4QPZA 5DYYA 5EVJA 3PUWA 2PGDA 3O4VA 3L06A 1E9RA 5EJ7A 2XCSB 5IN5A 3OAAD 3TLBA 3TCKA 3V00A 3A1UA 2QI9F 1ODLA 4M8IA 2J07A 2CNNA 2ZRCA 1DAKA 2DT8A 2C2MA 4FYJA 4HGYA 1Z3CA 2VAPA 4CLHA 2FTKE 3NDBB 3DFFA 5DNAA 4X7PA 1P39A 1Z8HA 5LDGA 5IUNC 3CKMA 3KETA 2A5GA 3BXHA 4F97A 1JIXA 2XHEA 2J9YB 3G23A 3JXEA 4S24A 5AOVA 4N5DA 2EHDA 4D8XA 1CNEA 2J3LA 4RFSB 2RGNC 3UJ7A 1V45E 3CPHA 4ZEMA 4QA9A 4DT1B 3VX4A 5CH5A 2NTYC 4S35A 3I5YA 1J9ZA 1TAUA 3RUDA 2OAEA 4DDKA 2AOVA 4H4DA 3WA7A 1EU1A 1UKEA 4QICA 1HF3A 4MDYA 2ZYAA 5FPKA 5L3QB 3P0IA 2PGOA 4A2QA 2WTMA 1KEEA 3JAWA 3RLFA 2SCUB 2VJOA 3AVPA 1MW9X 1N2CB 5A3VA 3LRTA 5B7QA 1PJAA 3HCOA 1JIVA 1NVXQ 5GJWC 5TS2A 1XU7A 1UWCA 2OZEA 3ZGLA 2G5GX 3UPUA 1EEHA 4AKSA 1T5BA 2Q5IA 2ZWMA 1VYVA 1TVKB 2EW8A 2GPNA 2X8BA 1VIAA 4XIGS 1ZM9A 2JK0A 3N2ZB 1X0VA 1X39A 2PH1A 4XZ3A 1HNWB 3AILA 5LXTF 3RJ9A 4DA4A 4HR7A 1LNQA 4PQYA 2Y8EA 3QITA 4MLPA 2G09A 1XXHA 2AFIE 1OWOA 3ENZA 4K7JA 3WGYA 5ITZA 1MW8X 2X9GA 4NDAA 3LLCA 3O2JA 5P21A 5HQ3A 2QUHA 1TPZA 3ZWVA 6REQB 3E8SA 2RHBA 4F5YA 4U7PB 5JWHA 3GJZA 2XYHA 4OJTA 2PZAA 1FP2A 2ZIAA 3K9HA 5EPUA 4NZOA 3LOPA 5CA1A 5CBPA 1XLUA 1MABB 4LJ4A 3HCRA 5D6NA 2H2GA 4B4KA 3HDGA 3NRCA 1XQVA 1PNQA 4AJIA 1ODIA 3LV8A 4A2WA 5C3MA 1RKXA 1BEEA 2BJVA 2IVFA 1Q2XA 1FW8A 1H1DA 1GZ4A 1VBFA 1YQUA 4GXQA 4MV9A 3WWDA 1ARZA 5C32A 4YAIA 2W37A 2G9ZA 1MJHA 3Q87B 2JFXA 1JKXA 1K6JA 1L4KA 3B1WA 3O74A 4FN5A 4H77A 4M4SA 2GK7A 3TMKA 2GCPA 5KQLA 2E49A 3KL2A 2VKQA 2X0FA 1XVAA 8LDHA 1QTQA 3U5TA 4LRWA 3CEMA 4UMFA 4E5UA 1RBZA 1A9YA 4DNPA 1WHTB 2Z1DA 5JJKA 2FY8A 2WEKA 4JT2A 2F1KA 2C3MA 1EGAA 3ER9A 2IYWA 5ARDA 2Q46A 1JXMA 3OCUA 2JBWA 1V7QA 5AVUA 4HXEB 2B34A 4JVNA 3BFJA 4RF3A 4B3XA 4EHKA 3T5AA 4F4CA 1M2NA 5E8RA 2DCMA 1ZH2A 3EC2A 1K8YB 5ILQA 3ZHVA 4DYDA 4JGGA 5CB4A 1L7RA 1NMZA 1U31A 4DA8A 1CJVC 1SIUA 3Q0EA 1WZNA 5IDVA 1HORA 1YDWA 2AG0A 1TEHA 2WU4A 5B1HA 4OFXA 2BZ1A 1C41A 1M1XB 1GPLA 1HFWA 2DR3A 2H11A 4P2BA 1BYIA 5GM2A 4CIAA 2VDPB 3M9XA 4Q21A 4WFQA 2AEFA 1KAGA 3M9LA 1BH2A 2AMJA 1UDRA 4WFKA 3KP1A 1SBQA 5K3DA 3HEBA 2WYOA 3FPJA 5FPQA 1RAFA 1Y8QA 2WT4A 4FNOA 4NU6A 4H7KA 4GM0A 4J0CA 1BN6A 2HHHB 1H8ED 1TD1A 1H3EA 1DV2A 2GZSA 3ZHZA 2JHAA 1QS0B 5KHAA 1ZICA 2C8KA 4OAQA 2B20A 4HS4A 4EH1A 2DSNA 4Z9XA 3WRXC 4PANA 1L1RA 4KXYA 5CYPA 5JAIA 1KXJA 2B6HA 1JBEA 3B6IA 3DLCA 3RVPA 3OZUA 3G2KA 3L0PA 4O33A 3W1WA 3D4NA 2F1RA 1C81A 5H68A 3F6EX 5GGXA 1F1JA 1UKCA 1NW6A 2GRUA 4QOIA 3SZGA 2ZAOA 2GVDC 3OZ7A 1YR6A 3GBSA 4OQPA 2GEVA 4QTZA 4UFNA 4C14A 1AU9A 3GLIA 5EIBD 2WLTA 3MTEA 4E12A 4TWRA 3WHPA 4DR6B 3IBGA 3ER8A 2HRDA 4UNNA 2IV3A 821PA 2ZIWB 5IBCA 3RUCA 3L7DA 1RIIA 4HXGA 5IJAA 1RC8A 1WP9A 3L0SA 4RJ2A 3MS7A 3E23A 9LDBA 1W36B 4P5PA 1CDOA 3LYUA 4QUJA 2RC6A 5TQJA 1GM5A 3C3PA 1J49A 4UHDA 1JEDA 1NBOA 2HSEA 2C2WA 2XTNA 4L8WB 2UXDB 1JYFA 4MCAA 1M3SA 2DPMA 4K2AA 2QW0X 3MWKA 2HTFA 4FK8A 5ANRB 1Q3KA 1QP7A 1D6NA 2FI1A 4AZVA 3WS7A 1AKNA 1AQIA 3O0TA 3KOUA 1W19A 4E70A 3CLTD 2IBTA 4GWGA 1M1YB 3D9QX 3IAS1 5AUPB 3LGAA 1KWKA 1CR4A 3CH5A 4RKFA 4F4IA 3COZA 1LPAB 1JF8A 2IYQA 1DP4A 4MKZA 4YMUA 1TAGA 3V8MA 3KDPA 1VCOA 2RHHA 3TIXB 3VTAA 1C30B 1Z5ZA 2R2AA 3HQ4O 3K0CC 4JP2A 4EY5A 1G9SA 3BK7A 3TN7A 4EBFA 4KGDA 2J3IA 5TQ2A 2CXPA 4TLAA 5CD9A 2PV0A 1JQBA 4TQGA 3QA9A 3BJRA 4OGWA 1U28A 3ZH2A 2JZOA 3NP9A 2R1ZA 1N7GA 4WUTA 3JCZA 5L3RA 3WP0A 1P0CA 4M9XA 4PICA 3P9QA 4TQAA 1RQXA 1F8UA 3TSOA 4EJ0A 3K32A 1N8SA 3AWIA 1V16B 1MVNA 2PT6A 2AK3A 3EZGA 1QPBA 2BFMA 4I6GA 2YJGA 3FGZA 2OWDA 1L4EA 1E0KA 4UARA 5IP5A 3FOZA 1BWQA 4G01B 4FGZA 1ZSVA 4PNEA 4PX5A 1I01A 3JSAA 3OD5A 1IWBB 1RJWA 3GGSA 1SKAA 4UU7A 2B8WA 1Z16A 3UJBA 5LZ7A 3L0CA 3T7EA 3ABRB 1Z07A 1L7EA 2XI4A 4CV3A 3I9FA 5K3AA 4DZZA 4BLQA 4F2PA 2A33A 4V1CB 5KUTA 3SC2A 3LAWA 1S3SA 2ZYIA 4D41A 5LXTA 1YR7A 2CVOA 4CPDA 3FZGA 2N3ZA 4W82A 2BLLA 5AVVA 2PMFA 3AJAA 2GYYA 2A9OA 3MCZA 4NZZA 4AM8A 3JQQA 5FDFA 4RXTA 1DEKA 4G9BA 2H31A 3IHLA 3ZLTA 1DRUA 3FTQA 4B7ZA 2P4QA 3DHVA 4WTOA 1ONPA 3UUWA 1DRWA 3W77A 2EJVA 4P6VF 1QHYA 3NVDA 4CDGA 3CRW1 4LFBB 5AHWA 3ETHA 4L4XA 1HQKA 2E5FA 3VAYA 5TMBA 1HO3A 1TQDA 4L1KA 2RGNA 1FMLA 5KVSA 1O6CA 2ECFA 3JWGA 1QWSA 2X7XA 5CX4A 3BE8A 4I6JA 1JQ5A 5I48A 3LVFO 3B38A 4AKTA 2WP0A 3DLAA 1BW9A 5I45A 2XUZA 3IV9A 4P4GA 3H4IA 1PG2A 2YZ7A 3PIIA 2VA9A 4V3CA 3EDRA 2IU0A 3WDMA 1HDZA 1N5JA 1DKNA 4BJ6A 3VPCA 4AP6A 1I6WA 4WEOA 1WL8A 3V46A 1QV6A 1U2QA 3I4LA 1RABA 1MJGM 1AXEA 5IJ0A 1ZGGA 2QR2A 3WQQA 1DEAA 4FS8A 1P9LA 3C70A 1DTEA 4M9SA 5KQSA 1SBYA 1YOVA 1IK4A 1TI7A 2JKZA 1WEKA 4XSVA 3VV3A 4AQYB 4ER5A 1SC1A 2ZJFA 4NULA 2XXAB 3OFND 1BKSB 3GLHA 2PKXA 2BGWA 4DE5A 2P69A 2CLSA 2H00A 1L7AA 1Z0FA 4L7QA 4TWBA 4PF1A 4TXHA 1TC2A 3UB3A 5ES4B 3GCDA 3I9V1 3C8ZA 5CB0A 2I8CA 2NSHA 1WY5A 4OVKA 3WWEA 1N5IA 1B0UA 3GQVA 4OMDA 4YGXB 3W2HA 3BE6A 3QH4A 1ZONA 5A4MS 1XTQA 1T9ZA 4RS3A 4CUKA 1KRHA 2EOAA 1SU8A 3H2GA 4YROA 1VJ0A 3P45A 4PV7A 3LFHA 4QUBA 4WLVA 3RSQA 1SQFA 3OJEA 3A3YA 3VO1A 3BDIA 3KQMA 2O2CA 3TNYA 1A9ZA 1X2EA 4M0KA 3TZBA 4D6PA 1VLZA 4MQBA 1D2RA 1TF5A 3WIDA 1W49A 1K89A 1JS1X 5E1MA 5L3ZA 4E21A 2QM7A 5AXAA 3SX0A 1U2SA 2O6LA 1KJ8A 1YBMA 2YOGA 3WGHA 3ZHOA 4EI8A 4YAWA 3MUOA 4BTVA 3BRQA 3IAM1 2QZZA 1DL5A 4ZANA 1G21A 4FC7A 5F1KA 1DC6A 2GJ4A 1KO1A 3BK2A 4H7HA 1TFRA 5DIFA 2X22A 4ICIA 3GN1A 2FMFA 1F17A 4FINA 1ADFA 5FLEX 4DLWA 4RZ3A 3TCNA 4FYPA 3RS0A 1I6LA 4FUTA 1H9BA 2H1FA 2RC5A 4NZYA 3SLGA 4BQRA 5BV1A 1HDEA 4LZZA 2HRQA 3FDFA 1R10A 5JCOC 3F47A 1UBTS 3FD8A 4F04A 2HV9A 3GFFA 1JAXA 4DUGA 2XITA 3CG0A 1VIVA 2QP9X 4QUEA 3R44A 1QQTA 1YJ5A 2J59A 5FORA 4GYJA 1NBMA 1MH1A 4R9NA 1YZLA 2CEAA 2QG9A 3CG4A 4FYKA 4PCVA 1SIOA 1EE1A 5KHLB 4REOA 2ZSJA 1OGYA 3IAFA 4IS3A 2EHJA 5A0VA 2Z43A 2R4TA 2YRWA 3E5RA 4X8MA 1RRCA 2X4GA 1DQYA 3HKCA 3L0ZA 3QX8A 3E9YA 4UVEA 1Q83A 2Q5JA 3BMCB 3NTQA 5FAKA 4E5DA 5EZ5A 1P2BA 3EGVA 3Q11A 3DEKA 2JLQA 4LRTB 4WBXC 4Z54A 1L5WA 4AJ9A 1XNGA 1WMEA 1Q0LA 3ZVRA 4EPVA 5I7UA 2OC9A 1NI3A 4JBIA 1KK3A 3W9BA 4PTYA 1EI9A 3RRMA 2A1UB 2C84A 2CXNA 2ECPA 3KEFA 1VDZA 3AHIA 4HLQB 3ZGZA 3OMWA 4TTRA 5BYAA 1MFPA 2XMGA 1QR2A 2Q6LA 4US1R 3ITNA 2NMVA 3ZWQA 2L69A 5IXJA 2LGJA 1TX4B 1DKQA 1D2AA 2WUVA 1KOFA 4OREX 3RUHA 1NOJA 2BFBB 1P1JA 2XKBA 1CY8A 1W35A 2PRKA 5KPJA 5TMPA 3W90A 4UBIA 3UJHA 3PFHA 3ROXA 4B2LA 1MC1A 3A4TA 1P72A 3Q8WA 3N58A 5TPWB 3X2SA 1IMJA 1CTQA 1FU4A 1KVRA 3NXKA 5CFQA 4CGYA 4QDZA 3LLVA 2O8DA 4P98A 3JD0A 4ND7A 1SUFA 2W7TA 2G17A 3QVXA 4JLOA 4W8OA 2VZLA 4GE0A 4KQMA 3OY2A 2ZB2A 1N6OA 2D4HA 4PZEA 3UJ8A 4CM7A 4RGYA 1D5WA 3EXG1 4B09A 3X3HA 4FOSA 4XFDA 3L1VA 2C4UA 2ZIEA 2QQ5A 3FPLA 4DY6A 3ZJTA 5HZGA 5DW0A 1ZN9A 3K0CA 2AOUA 3RUPA 4F5DA 5AVQA 2D5LA 2VZEA 2EFEB 2YYAA 3DZCA 4FSXA 4FOPA 5CW1A 5ULLA 1J0CA 3MT8A 1KNXA 1G6Q1 3PI6A 4R2XA 4RD2A 1RHJA 4J0IA 5EJMA 4ZCPA 3S55A 3CUEF 3WGTA 1PBTA 2YHBA 3AY7A 1SJ9A 3ETJA 1E69A 3W6OA 2XOEA 2P8SA 2WVAA 4MUNA 4QGFA 3SQLA 2ZKIA 1P4RA 5H1YA 3ME5A 1HSOA 4N6NA 1NVTA 3OEED 3AHHA 3C2QA 5FPSA 1ICEA 4E1BA 4X7MA 4BS9A 2Q4OA 5CFNA 4C3UA 3VR5H 1MOSA 2Z3ZA 3JVDA 5JE8A 3HUDA 4DYHA 5HKAA 3QLEA 3VPXA 3KCQA 3PU6A 5KCMA 4GBJA 2CBZA 1GR1A 2ALJA 1OC2A 3QMPA 3VZQA 4QODA 4XDZA 5IKMA 1L6RA 2BEUA 2KS6A 4GPZA 3RH0A 2GPYA 3BB1A 2QX9A 1FTSA 1EQ2A 1RNLA 1UT5A 3ND8A 1C3LA 4FCCA 3PUHA 4B76A 1W36D 2GEFA 5GOTA 4DLPA 1YDMA 3H42B 2WVGA 1G2OA 1HEYA 1I4LD 3N2EA 2X2FA 4NK5A 2CL5A 1V2GA 3U48A 2Y0PA 3EZFA 2J87A 1SHUX 5DXAA 3MGAA 2GXUA 4ROTA 4QX6A 2WA2A 2OHFA 1JHMA 2AA3A 4GLFA 4KRFA 4FYHA 1V1RA 5BVHB 3DDWA 4DM3A 4CIYA 4F72A 3WV5A 3CNBA 4PSKA 4WMLA 2IGTA 5KQMA 2OYCA 4XX1A 5EE0A 3SN6A 1FVFA 1A7UA 4MS4B 4N7JA 1FRQA 2IEGA 3ZOZA 1HFKA 2FAXA 2EJWA 3TH5A 3G59A 5A06A 4WDRA 4CDRA 2P9JA 1BGVA 4HEHA 2FR0A 4DR1B 2AMYA 1XMXA 2FE4A 2BKUA 2C7OA 1HLFA 1TLTA 2WWIA 3I2HA 3V4RA 2YVKA 1Z26A 3QOYA 3OZVA 1O8CA 1SCKA 2XVXA 4AJNA 4FB4A 3V8EA 4DUZB 3NBFA 2H7VA 5SZIA 3U0VA 4E1AA 2WY2D 5G4LA 4UNQA 2DHEA 2Y76A 3AJ8A 1ECJA 2E48A 2WG0A 1P0IA 3KAQA 4K6MA 5CK4A 2ROQA 1FS5A 4URXR 2I66A 3CBQA 4YRCA 1ELOA 1TCCA 2Y99A 3EY9A 4G4SP 4YJKA 1E5TA 4IDGA 4NE9A 2PEZA 3FAZA 3S28A 1MAAA 1C4OA 3A05A 3DXYA 5ERGB 4Z3OA 3QENA 1M2JA 1NW5A 2R48A 2W6JD 3OQBA 3UJAA 2CK3D 1FX0A 2XMRA 1O95D 1GZVA 3GLGB 2ZI6A 1BQ3A 3LLSA 1XZHA 2V9PA 3GAMA 1NXVA 3S4YA 2A2ZA 1PTJC 1KPGA 1M8PA 1A97A 2CHGA 2ECQA 5DEIA 4ER6A 4O2LA 1R64A 5LQKA 2QRVB 4J6EA 1IB0A 4JGIA 2FMXA 4R7TA 1W48A 1GQRA 4XLLA 4XXHA 1E3SA 3CPJB 3TQQA 1QU2A 3ZHBA 4QULA 4BLOA 1RWOA 1KFKB 3U61B 3HBNA 3B78A 1QE5A 3HJCA 2HBZA 3TXXA 4W5JA 5BW8A 2QXTA 2AD1A 1BE6A 3BMXA 3VHXA 1P3DA 3PITA 2JFNA 3ZQJA 4PZDA 5FWXA 5IZ4A 2QTRA 4C05A 3GNQA 4NV1A 4MVJD 5CLHA 5EWJA 4KTTE 3TXYA 4CF7A 1UEJA 1MD9A 2EXXA 2FQ1A 2G9NA 4ZZIA 3K0FB 2D2EA 2R1VB 2X7JA 4P80A 4BQPA 1HX7A 2VP2A 4MI6A 4ZARA 4YONB 4K9LA 4KDFA 4ZZ0A 2QY6A 5EQJB 3AL0C 1BAPA 1NRJB 1Y3HA 4J16C 1JPJA 1T6YA 2A0WA 2IZZA 2GWHA 2X0JA 3F67A 4FD2A 4KIWA 3Q7EA 4P33A 4OQ4A 1W5AA 2WIJA 5DK4A 2QIOA 3C6YA 1QGZA 2VKTA 2WAAA 3AU9A 4LC9A 4K0KB 4HATA 2ZVQX 5AHRA 5JS6A 1G17A 1EMDA 4LQDA 4KLZA 1MIHA 4N01A 3C7TA 3TEMA 2C04A 2V96A 2CZGA 2OHIA 2O2ZA 1K5HA 1XE3A 3WO1A 4YASA 4JS0A 1Z7YA 3IE1A 4FCWA 4J7CA 1QVVA 1GT91 4UE2A 3ACBA 4P9NA 3UKOA 4D9CA 4OLAA 3I2YX 1UPCA 2DR0A 1ZOSA 2WU1A 5C8ZA 5IN4A 3I5XA 3LD9A 3JD1A 2HADA 2AEEA 4QLOA 1I1HA 2HJRA 4O63O 1IN5A 1IM8A 2FZ4A 1PZHA 2AQHA 3ETCA 4TKLA 1HA3A 2I91A 3EZNA 5HUQA 3U1VA 1Q14A 1FSSA 2OKGA 1LBQA 2ZBRA 4MW9A 1IHPA 2GEJA 2YWJA 2NIPA 5AKLA 3STHA 3VR1A 3UMYA 4UOQA 1ZLXA 1GQQA 2FUG1 4OHOA 1NVBA 3NBKA 4IO1A 5B53A 4ZFNA 1G20B 4IKPA 1FP7A 1JIQA 2DUNA 2W00A 5DP1A 3TE6A 3PLRA 1YR8A 2RB4A 1X0XA 3OIUA 5KEIA 5ALZA 4WK4B 3OPQA 1H0RA 4MB6A 4P4LA 2GXSA 5CDGA 4MWTA 3QMVA 1RXIA 1ESCA 1Y4ZA 3H4MA 1QU3A 1TCBA 2O8EA 5KNDD 1DDOA 3VKUA 1QO9A 1E1LA 4MGZR 3W4JA 1L5QA 4G2TA 2QL5A 1KE2A 4K81B 4ZEXA 1QFZA 2QU7A 3KHSA 1LTHR 2B9VA 4P22A 1QORA 2FFQA 2X5NA 3E2PA 1KEVA 4UOZA 5DHPA 3ABQB 4QREA 1Z6ZA 4C07A 4FP9A 5TE9A 3GROA 4FOOA 4TTQA 1EX1A 3JQPA 3LUHA 4JN6B 1XRRA 3T1VA 4E5SA 5I51A 3PPYA 2JLZA 2X2EA 2WT9A 8ABPA 4WOPA 1J06A 3FXAA 5C3UA 3Q9SA 4XB2A 2UYQA 4BNUA 2BIFA 2D54A 2SHKA 2ZRFA 4IQ0A 4EO4A 1CD5A 1O6ZA 5HTOA 1HNZB 3U4MA 1LH0A 5K0BA 2FSPA 2QRPA 3HFRA 4QL3A 1FTGA 1U02A 4AJLA 1L4GA 1D1TA 2C4KA 4R81A 2JBAB 3D6NB 4UVDA 1BFUA 5DZSA 3SNHA 4LHVA 3QU4A 4O4IB 1QSGA 3U1BA 1N1EA 4KU4A 1I36A 5BUZA 3ITEA 3RBXA 1RI5A 1ZS9A 4QDTA 5CH3A 4Z51A 3NOXA 1LFAA 3AUJB 3NGLA 1I8TA 1HV8A 5KTMA 5D87A 1EJBA 2R1TA 1EX9A 1NWHA 1V8PA 3ELYA 1HXHA 4KMRA 1H6CA 3TRIA 3CIOA 3WBKA 3WRVA 4X64B 4DV4B 5DSZA 1A71A 1I4TD 1YZQA 1SVSA 1Z2OX 3EXIB 4FOLA 1AO0A 1M34A 3GVPA 1HI9A 2ZSKA 1L9KA 3U3XA 2VPQA 3KHUA 3QWBA 5L4SA 2VDQB 3IT0A 2DM6A 4WACA 3ZHSA 2XB9A 1U2ZA 2L18A 1PQWA 1QIJA 3ZX5A 5C37A 4H3VA 2IYLD 3P2OA 3DAPA 5AICA 4M7WA 4WAUA 2O8BA 1PJ8A 3W6PA 5AVRA 2QJRA 4R9UC 1WLYA 5B3KA 1ZUIA 1C9NA 3OEWA 1R9GA 4UTXA 4ZCMA 3NIWA 3AH8A 1QIEA 2DY0A 3KAJA 5KTSA 2HMSA 1TMKA 4C7OB 3ZY4A 1U8TA 1RAIA 1AQLA 2I2AA 5LPNA 3M3HA 3PEFA 1P1RA 2XQIA 3KQTA 4HG2A 4QT4A 1J2YA 4PX3A 1J5XA 4OM7A 4RTNA 2RAVA 3S1AB 1E3QA 3LQ4A 5D2CA 2V1UA 4DG5A 1XTPA 3C4VA 4P4SB 3ADDA 2AXEA 3SPXA 3GEEA 3FJYA 3VZPA 3RARA 4GLLA 3D7NA 3OQJA 4L5IA 3RU7A 4B79A 1CQIB 2GZRA 4RE5A 1W0JD 2OFXA 2NU8A 5BR4A 2OXTA 1YZFA 3GMDA 5T3YA 1I4DD 3G5MA 5I7EA 3DVLA 3QPDA 2B5WA 1OAKA 1V5FA 2R6CA 3LBNA 3HABA 4D9FA 5KQGA 1XTZA 3AIIA 1JYSA 1OLXB 3LJKA 3PQEA 1UXJA 1PK8A 2HYDA 4KUGA 4D8TA 5CXXA 4OEHA 3HK2A 1UOQA 1VLQA 2CBGA 2IYXA 4FMCF 2D2XA 3V34A 2QX8A 3QVOA 1FUKA 2Z04A 2ASEA 3CZ9A 1NNUA 4EVIA 1AH2A 1GZ5A 3AFIA 1NI4A 3RVJA 3H1BA 1UT6A 2P67A 2OV8A 3RF6A 4AY2A 2WU3A 1Q2UA 1M10A 2AYZA 2I29A 4FDMA 4L08A 4M2LA 4O4HB 3ESAA 2XWJI 2H48A 3ACDA 1TW3A 3A0UA 3C8MA 5HGJA 2PGLA 4X8HA 1VBNA 1PTJA 3WMFA 4AD8A 1TT5A 3K2EA 1IBSA 3DTYA 2JLUA 3JYNA 4KG7A 2VHYA 1ISRA 1XNJA 3OU7A 5KNCA 1ORTA 4KVGA 4LJ6A 2D7JA 2GM3A 2ODNA 1Z5VA 3L5KA 5JD4A 3DDNA 4HD8A 2BMWA 3WRWA