2QUHA

Crystal structures of human tryptophanyl-trna synthetase in complex with trp
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
379
structure length
379
Chain Sequence
GIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tryptophanyl-tRNA synthetase
publication title Catalytic mechanism of the tryptophan activation reaction revealed by crystal structures of human tryptophanyl-tRNA synthetase in different enzymatic states
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 146
structure length 379
sequence length 379
chains with identical sequence B
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2007-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00458 WHEP-TRS WHEP-TRS domain
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 2quhA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2quhA01
4HPWA 1COZA 4HJXA 3IOEA 1O94C 2QUKA 2VTBA 3NV7A 2CYBA 4AS1A 3C8ZA 2E21A 1MBZA 5KHAA 1T9GS 1KAMA 4DNXA 1N2BA 2XRZA 1WQ4A 1KKUA 2QUHA 3X1MA 2A88A 1ULHA 1MRZA 1NSYA 3ZJTA 3CA8A 5H16A 2DUMA 4MVWA 2Z3VA 4Q93A 4EG6A 1GN8A 4MWCA 2JA2A 4MW4A 4X0EA 1OBCA 4G5FA 4ZT3A 1GLNA 3RJZA 4ND7A 4TS1A 5LLTA 2A7XA 1GPMA 3IMGA 4UZEA 5LFAA 1O97D 3KT3A 3MUEA 1Q15A 3UY4A 1ZJWA 1KR2A 3ILVA 1TEZA 1Q19A 1JMVA 5FNZA 1T6XA 3CLTC 1NUTA 4YP6A 1MB2A 1I6KA 3U1VA 1N2OA 2PZBA 3PNYA 3TQOA 1EFPB 4RUKA 3TNJA 4HK4A 4JFAA 1I2DA 3ZXIA 1J1ZA 3L93A 3ND7A 5KCMA 1I6MA 2A86A 1OWLA 3N05A 2O5RA 5LM3A 2A1TR 3NBKA 2YXNA 2J09A 1YIAA 3FNRA 1EUYA 1MOPA 1FYDA 1PG0A 1KQOA 5TEWA 4JYZA 4ZCSA 1JEDA 1KP2A 3FH0A 3CLSD 1G8FA 1NYLA 4EG7A 4ZCQA 2IJGX 1N3LA 1J1UA 1BS2A 3IVCA 4MQ6A 2E89A 3UK2A 1YIDA 1IQUA 1WZ2A 1WXGA 3I05A 3PNBA 2D5BA 4MUHA 1OWPA 4MW1A 4MUIA 2QTRA 4MW9A 3SEQA 3Q4GA 1O6BA 4A91A 4DDHA 2JAXA 2WQ7A 3CVYA 3AFHA 3Q10A 4YP5A 3IVXA 1QRTA 3RK1A 2IELA 1N78A 3COZA 2E0IA 2JANA 1N2EA 3F3MA 2A1TS 2BYTA 2J08A 1QNFA 1IVSA 1EFPA 1T9GR 3COYA 4I6JA 4ZCPA 1WXIA 3HL4A 1LW7A 1WKBA 1PFYA 1NUQA 3RBAA 3RK0A 1K4MA 1QRUA 1WXHA 3ZXSA 3TS1A 1NZJA 1V8FA 2J4DA 3HFJA 1QRSA 3A2KA 4XFJA 1JHDA 2O8VA 1YI8A 2TS1A 1NURA 3RFFA 3KT0A 1O0BA 1R6TA 4GU5A 4ZT7A 1JILA 4YP7A 4BWVA 4CDNA 1GTSA 4MWEA 3JXEA 2PFSA 4MAFA 4MULA 3CLUD 1U7DA 1KQPA 2IP1A 4R2LA 2V0CA 3A4IA 2DEUA 1QU2A 1OD6A 1WXFA 3E27A 3H9CA 4XSVA 2AZXA 1P7PA 2I1LA 1Q77A 2X3FA 1SURA 2PZ8A 3PNVA 3P52A 5TS2A 4PY2A 4U8HA 4ARCA 1OWNA 3DV2A 1YULA 1J70A 2QUIA 1J21A 4EG4A 1V47A 1EXDA 3COWA 3VGJA 3HGMA 3DLAA 2CT8A 3AG6A 4MUGA 1QQTA 1F9AA 1O95C 1GAXA 2GKSA 4K0RA 3FDXA 1GZUA 1N2GA 1X6VA 2A84A 3LOQA 4P2BA 3N2YA 4NX2A 4CT0A 2DERA 1ILEA 1O94D 3QE4A 1O96B 1OWMA 2H2AA 2X0KA 1H1TA 1PG2A 2BTEA 4NDAA 4MUJA 3OTWA 1VBNA 3ZJVA 2PXHA 3IUBA 1KAQA 5EKDA 1M1ZA 1KH1A 1MB9A 5F23A 1QU3A 1T6YA 4KR7A 4KKVA 3A05A 1YUMA 2DXIA 1Y42X 1PFVA 4JXXA 3L92A 1D2RA 1M83A 1JIKA 1NP7A 4UZFA 3H97A 3ZJUA 4DLPA 4H3SA 1G8GA 1B6TA 3FIUA 2YWBA 4YBRA 3AG5A 4NZPA 5H7XA 1R6XA 5TEVA 1N75A 4EF6A 3INNA 3IMEA 4MVYA 4GRIA 5HG0A 3KT6A 4MUKA 3KT8A 2QJTA 4R0NA 3COVA 4QBTA 2CV2A 3IODA 1NI5A 3LCJA 3CVWA 1I6LA 4EGAA 2CV0A 4J75A 2DLCX 4G6ZA 1WY5A 4I6EA 3CLTD 4MWBA 4F4HA 2DETA 1TYAE 1H3EA 3H05A 2H29A 2D13A 2OQ2A 2DPLA 1IH8A 4DE5A 5JBNA 2CYAA 3IUEA 4KR6A 4MW5A 2YY5A 3FI0A 1J09A 5K0TA 3NBAA 2ZUFA 3G6KA 3ZUGA 1G59A 3D6VA 3SP1A 2CYCA 3K32A 3IMCA 1NUPA 2CFOA 3SZ3A 1O96A 4YMIA 1F4LA 4MUEA 4KPUB 2RE8A 1M8KA 1NUSA 4I6GA 4ZT2A 4ZT5A 3DO8A 4U63A 4MUNA 3VU8A 4JXZA 3CLRC 3G59A 3H9BA 3SEZA 2HMAA 4R2MA 4MW6A 4WSOA 1MC1A 4ARIA 3UC5A 1MAUA 3N9IA 3DPIA 4ZCTA 3OP1A 1M8JA 2QJOA 2Z08A 4EG1A 1K92A 1KH2A 1VLHA 2XRYA 4S1OA 3AL0C 1U0BB 4OUDA 1HYBA 1H3FA 2C5SA 5DEOA 4HJRA 1VL2A 3CVXA 4E1AA 5HUHA 3AIIA 2QUJA 4MW2A 1RQGA 3IOBA 2J5BA 3FETA 3ELBA 4EFKA 1QTQA 1N2IA 2B7LA 3HV0A 3H99A 1MJHA 2RD2A 4EG5A 2WQ6A 1O97C 3QTTA 1ZH6A 1JZQA 2VXOA 3IDFA 4XFDA 4EG3A 2Z09A 3ND5A 5TGTA 4KPUA 4PBTA 2NSYA 4AQ7A 1J20A 3MLBA 4QRDA 3CVUA 2J07A 4K03A 2R5WA 5J58A 4U7JA 4ZCRA 3PRHA 2A1UB 1K4KA 1CT9A 4MVCA 5KWVA 2GM3A 1N77A 1WJGA 3TZEA 2WSIA 2CV1A 3TQIA 4Q16A 3FG9A 4MUFA 1LI7A 2QJFA 2E18A 1N2HA 1M8FA 1WQ3A 4RPIA 3N8HA 1JEEA 4ZT6A 3ZGZA 1LI5A 5AHWA 4EG8A 1N1DA 1H3NA 1MAWA 3FHJA 3CLSC 1XJQA 4G5YA 4MW7A 5IHXA 2CUZA 2QTNA 3LE8A 1EFVB 3G5AA 1ZH0A 2YWCA 5FO0A 1TQ8A 4ZT4A 1EUQA 3IH5A 1KP3A 2DR2A 1VBMA 3TZLA 1M8GA 3KFLA 1KQNA 3QTBA 1FFYA 1F7UA 1KH3A 3MXTA 3CR8A 4CQNA 3Q12A 1TYBE 4NATA 1ZUNA 2X1MA 2G36A 1OWOA 1XNGA 3GMIA 1O95D 3UMVA 1K97A 3P0JA 1X8XA 2PIDA 4OUDB 1EE1A 3K9WA 4CDMA 1QJCA 1PFWA 4F3RA 5K0SA 4OJMX 1JZSA 2A4MA 1EJ2A 1IRXA 3HZRA 1G8HA 2A1UA 4MLPA 2NZ2A 4QREA 4KR9A 4WNYA 1KORA 3AKZA 1GTRA 3ZIUA 3UOWA 3SYTA 1WXEA 1Q11A 3ND6A 5J59A 2HZ7A 4L2IB 3MLAA 1NUUA 3HMQA 4MWDA 4DJAA 2D54A 4FZJA 1F7VA 1VBKA 2AKEA 3PXUA 1OBHA 3ISJA 3D6UA 4PBRA 2HGZA 1A8HA 1DNPA 2VTBB 3X1KA 4MVXA 4MW0A 5DB4A 3S3TA 5BNZA 1EFVA 3GUZA 2EJCA 4PBSA 3RHSA 1O5TA 5DK4A 3FY4A 1TYDE 1UFVA 1IFXA 4NAHA 5FO1A 3CLUC 1N2JA 3FOCA 1TFUA 1T6ZA 3SDBA 2WB2A 1JIJA 3P0IA 1PFUA 1IQRA 1TYCA 3SZGA 5DASA 3CVVA 2ZP1A 1IHOA 5HUJA 3FWKA 3VRHA 3MMXA 2AG6A 3P0HA 4DDKA 1JIIA 3M5WA 3X1JA 5J5AA 3IOCA 2X1LA 3IVGA 2V0GA 1U7XA 4DDMA 1YUNA 2CSXA 2GOYA 3BL5A 1XNHA 2PZAA 1O0CA 1JECA 4JZYA 1M8PA 2OV4A 2EL7A 4ND6A 1WOYA 2ZUEA 1IQ0A 2PG3A 1JGTA 4NAUA 3A04A 5IJXA 3CLRD 2QTMA 1R6UA 4L2IA 3GLVA 4J76A 1U3DA 1XNJA 1S4MA 1U3CA
chains in the Genus database with same CATH superfamily
2Z83A 1R88A 2YS7A 3BZWA 2IHUA 3TTXA 2IP2A 4LSMA 4X8MA 1OLUB 3QX7A 3SCZA 1RC0A 1SCAA 3I4LA 4WESA 2YW9A 3FYUB 1Q74A 2CYBA 4HKTA 1JG7A 3WP0A 1TAHA 5DBGA 4D3ZA 2PRKA 2NUPA 4M9ZA 4YJKA 3B12A 3K8ZA 3EUWA 1KAMA 1S3IA 4GM4A 1G5FA 5KHAA 2VNKA 4YR7A 1KKUA 2OCGA 2VK4A 2WUEA 5F2NA 4U00A 2I8CA 2HCBA 2OCKA 1PO7A 2FUCA 3A3NA 3KB2A 4WOCA 3V1NA 4ES6A 1X9HA 3FMPB 1SG6A 1XB2A 2XB4A 4H16A 2P4EA 4Q93A 1U7OA 3F2IA 5BSTA 1W36B 4RACA 4FS8A 3FCEA 2BR3A 3LM8A 1QOPB 1QCDA 4EX6A 2POCA 2X42A 2UUBB 4G5FA 5JCZA 1GO2A 4QTYA 3U09A 4CEJA 1RXCA 5AKJA 3T54A 5LLTA 4JSTA 1EWVA 4PFJA 5M34A 2PRJA 3ERCA 4M76B 1UC9A 4UZEA 4ZO4A 2IX9A 4KFCA 3N2NA 3ENVA 2O8FB 2VYVD 1PVVA 3PFNA 3IBTA 2FZEA 2VAVA 4IDNA 4RH3A 2PMEA 5LVAA 5J2UF 3O9ZA 1TUEA 2OESA 3RABA 1QM5A 1BN7A 4E4TA 1U11A 1ONSA 5ER6A 1NX6A 1DLIA 3CLTC 3DE4X 3JQRA 5BVGB 4XDZA 1I6KA 2G1JA 4TUYB 3GT4A 2HDNB 4R7ZA 2YASA 1I2DA 3OEHD 4N6OA 1LKZA 3BTSA 3HYNA 2HK6A 1ZOLA 3C6ZA 1OH7A 2HNBA 3LP8A 4LDQA 2G06A 1WABA 4K1XA 3KTAB 4GO1A 3WLAA 1MW9X 1NAIA 3AB8A 2D4AA 4MP6A 1NUAA 3UMSA 5DRTA 3NBKA 2HA2A 4YJHB 3ZK9A 2F9LA 4ENQA 1M7BA 3OX3A 2FZGA 2MSLA 3SE7A 3GEBA 2WKRA 3T7DA 3RV4A 3IPYA 5CB4F 5ISMA 4ENRA 5HFNA 3JAMA 3MHTA 1EK0A 4DUYB 3NO4A 5F9HA 1J8MF 5FV7A 4PC2A 4CUZA 2CD7A 2ZVDA 4EKNB 1VYTA 1JMKC 5D86A 4E32A 1BXKA 1BS2A 5BOSA 1GYRA 1V7ZA 3F46A 4PVDA 3OIDA 1ESDA 3L8ZA 5FQNA 3OM9A 5EHNA 3FDZB 1C0PA 4RO0A 4IF4A 2PGJA 3EGCA 3DHNA 4UBLA 3MBOA 4NJEA 4LRWA 4ZO9A 2QTRA 2Y1XA 5E7MA 3H2KA 3EW7A 1SZJG 1ARZA 4BFLA 2CDNA 3B51X 2FYTA 2B5VA 1I3MA 4Q15A 4YJ3F 3GP5A 2JJ2D 2XNDA 3MTDA 2DUWA 3OKPA 2ZJAA 2RBGA 3T94A 4YRGA 4C3VA 2R4TA 1U7PA 1V8PA 3OAAA 2UYCA 1OOEA 2VJLA 2C7QA 3COZA 5T3UA 1UJCA 4LF6B 1WETA 2Y2UA 2H54A 2XJ4A 3O2JA 3QYFA 3PZBA 4YVFA 3KOWA 2PTHA 1TQHA 2J3IA 1XSEA 1QNFA 3EY4A 3K0EA 2H31A 4CQMA 1B8PA 4FYWA 2QLBA 3VC2A 4DIMA 2H0RA 4MSUA 4EABA 5IMSA 1X80B 3FCSB 4YALA 3H3XA 5J5CA 3RVQA 1KEVA 3HL4A 4Q47A 3T4XA 3TQFA 3IT2A 1OYWA 2FPSA 4K88A 1I3CA 3H42B 3IXMA 5F2OA 3PJEA 3B6MA 3HJTA 1CJKC 4NMHA 4EAAA 4R71A 1JQ5A 3N8NA 4JP5A 5KQGA 1Q1ZA 2DTXA 1EGMB 4U2BA 4PGAA 4Q34A 2VAMA 4QDXA 3ZDEA 1BSVA 3DBVO 3MUNA 3G1WA 2QRLA 3K9HA 1FBTA 2PFGA 1L4EA 1SPBS 2F90A 1USKA 4QPDA 5CCXA 3DLHA 1Q7RA 3M70A 1E79A 4MI9A 1LNSA 1DE0A 1EZ1A 1E9VA 1NW6A 2CNWD 2QYOA 3BB4A 3IHWA 3DYBA 3RC2A 1I4OA 3KT0A 4AD8A 4F1JA 3EVBA 5CFLA 1JILA 1OJ7A 1RKVA 1ZK2A 2J33A 3ZR4B 1EE9A 3U6BA 2QRJA 3JXEA 3V8EA 1JYSA 3DMDA 5FBVB 3Q5DA 4MAFA 2W5UA 3L9XA 1SIWA 1KDYA 3IS3A 2HK9A 1UEXC 4UEJA 4B75A 3NM5A 4PG7A 1Z34A 3K1JA 3LFTA 4YTEA 3O1LA 2ZBGA 5D51S 1I94B 1WU7A 2XQVA 3W1VA 5KNDD 2ES4A 1QHGA 1G5IA 1Q83A 1S2GA 3NHRA 4QOSA 5FCDA 1BVHA 2R0QC 1OD6A 4WFIA 1E6UA 2Z8YM 5AYVA 1ISMA 2AW5A 4YASA 2YXEA 4W6QA 4K9RA 5KSPA 5CA0F 3F6BX 3AV0B 3HBMA 4P92A 4AJJA 1SURA 1UANA 1WW2A 5ALPA 5FWYA 2WWYA 4LXYA 3TLCA 5IHPA 1Y3AA 4KPGA 1OLSB 4PY2A 1RNLA 2WIDA 4KQGA 5A5EA 5F76A 5KOYA 2W83A 1CU1A 2GD0A 2BHSA 3E7XA 3EXG1 4BO5A 2NZYA 4FKBA 4M6WA 2J5KA 1RJEA 4DQVA 2XKBA 3ZH2A 5EJ4A 5DSTA 3O4FA 4BPBA 1KC3A 3HGMA 1E1QA 3GLIE 4JI6B 1FUEA 1NP6A 2DR3A 3C7DB 3GVCA 2GCPA 3IDSA 4H7KA 5AVQA 4HDSA 4AMVA 1MJFA 2UYGA 4JLOA 5DW3A 4BCBA 5FUMA 3P20A 2C2YA 2SKEA 3E5MA 3L5OA 3DQPA 5AVRA 1C8VB 3L7OA 4UHCA 1ZVVA 1UQRA 1DZ3A 1U0EA 3LOQA 4XFKA 4P4SA 3SQXA 4LRTB 2OXIA 3OTOB 2J3MA 4LE1A 2YV2A 1Z5WA 1G4HA 4Q7KA 3NT5A 2BTEA 2A5FA 2ZBDA 3AYZB 4KVZA 3USES 3ZNOA 1M1ZA 4DC0A 4QD3A 2BR5A 2I7VA 2A67A 2OB1A 1NI3A 4TKUB 1QDUA 5IJ9B 4E7OA 1KEEA 4C9BA 1YUMA 2HTFA 3AR4A 2ODBA 2R44A 3WJ7A 2D0OB 3O4RA 3IIJA 3HKBB 4WZAE 5ILQA 3EIFA 2MR5A 4HYEA 5HCUA 5EMHA 3H97A 1HQCA 2R5NA 1KYVA 1QFYA 3AESA 3GRZA 3BHMA 1X42A 2J8ZA 3GNLA 4O2BB 1RPNA 3TIXB 2Q5HA 1IAVA 2OP0A 4UVHA 3H5AA 1WIWA 3HCCA 4YBRA 1VL5A 5TGDA 1RC1A 2OQIA 4ZHQB 4J1TA 3IALA 1TA4A 3LPMA 4JP3A 4FD3A 3RGGA 3PR1A 4R1LA 4TMFA 3MD0A 3DLBA 2O5VA 3GELA 4XD7A 5CT9A 4BX8A 2IEDA 4YHHB 2YJGA 4NDZA 1YR6A 1VSQA 4J75A 3L5KA 3WR5A 4YAKA 5AI6A 5CDTA 1DAIA 2PUDA 3K5WA 1UH5A 3I04M 3R9XA 2EDAA 2ZI9A 2NUAB 1OH5A 2G1AA 3GDWA 3I9V1 2I34A 4RVSA 4X92A 4XXHA 5TPZD 1ZOIA 2DTDA 5JXIA 1E2GA 1UKZA 2CXQA 4J0KA 5G0WA 3TRKA 4HH1A 1B8VA 1J00A 3H13A 2YY5A 1X1EA 1N2XA 3OTHA 1XRQA 3SP1A 1NV8A 1JH8A 2J7PD 1NUPA 5KTKA 3ZE0B 3NIBA 3BBPA 3EDYA 4EY7A 1NUSA 3D8NA 5D7NA 5CD9A 1G4UR 1TO2E 1JKMA 4V2IA 8MHTA 2BR4A 3OX1A 3WGIA 3A7EA 3RODA 2FQXA 5DX8A 5ERXA 2RIPA 3HCPA 4JJ4A 4EQ6A 3L1UA 1VLLA 1NPDA 2SBTA 5I8ZA 1SELA 4ZVOA 3LY9A 4YLEA 2AK2A 3MM4A 3SQLA 4C22A 1CUIA 3CLVA 4QT0A 5ANRB 1JN0A 3DOFA 1YCFA 1FXWF 4FJ0A 3UQZA 4EHNA 4X9XA 3I23A 4GWGA 3R76A 1E9FA 5JJLA 1ZIPA 4P34A 5EJ2A 1B16A 4KXXA 1UKAA 2QVCA 3UYKA 1LD3A 4FSXA 3ZU3A 1U5BA 1FE8A 5I7HA 2D4HA 2WTMA 2XRYA 4KQKA 1KE1A 2RK6A 2EBUA 3WWZA 2I4IA 4URUR 1UJNA 4A5OA 4YRFA 2YINC 3RUIA 3K1YA 5IFLA 1GL7A 3Q9NA 1FRNA 4RTRA 4OG2A 1WPQA 3F98A 2FUG1 1DTWB 4C0XA 2OHGA 3IEPA 3CMMA 1S8NA 1QUEA 1U9CA 2TYSB 3D0QA 4F5DA 3EEYA 2AEEA 2Y0BA 4OGGA 1UDRA 1T5SA 4ON9A 3TNLA 5E38A 3VYTB 3E2IA 2RFLA 2RKBA 1XDGA 3DBOB 4JLKA 5IZCA 3N2GB 3UMMA 1FDVA 1ZK3A 5GVSA 4JP2A 4DR1B 1QTQA 3G0CA 2OORA 3O4VA 4JLMA 2Z4SA 4BZXA 3X1ZA 3AFNA 4BCCA 4ZYYA 5I9LA 5B1HA 1I14A 4EG5A 5K3EA 1HNWB 1T91A 3TW4A 3QTTA 5T6BA 1HZJA 2WC1A 2O8NA 1ZH6A 1I3KA 2HA7A 4QUJA 4W9NA 4XFDA 5FUQA 1TCUA 3OLXA 4I50B 3LZDA 1L5GB 3V8MA 4L0CA 4WUVA 2UZ3A 4C2BA 3JARA 1NI4A 3FYUC 3AV3A 5CG2A 3FTQA 4ER7A 5TGZA 1ZMXA 1VLMA 2I6FA 3JQGB 2C4HA 2ZRQA 3V7YA 1WHSA 2WHEA 3AZPA 3H5OA 1YKSA 2OKGA 3GQVA 3TK1A 1D4ZA 3NANA 3ZWDA 2XAAA 1SXJB 1N77A 1IUPA 1GIAA 1XUOA 1KDZA 3PFWO 1PNVA 1ODFA 4AKEA 2JFOA 1LI7A 4W82A 1WV1A 3R7FA 3G17A 1ZGHA 1SCBA 3A37A 4IX9A 3O8BA 1P45A 2JVKA 1KAGA 1Z5NA 1TI7A 3C8UA 1XTJA 4B44A 5AHWA 3B6KA 3EJWA 2JFQA 3KLBA 4V24A 4WVLA 4YRBA 5AD1A 5CM9C 3EZNA 3KKEA 3I1JA 1OKKA 3ECAA 5G3YA 2CUZA 2UZ0A 3GJ0A 2BIFA 3JSXA 1F4VA 5F5NA 4GQBA 4N9QA 4MP8A 3UAXA 3KZCA 5B55A 5TSDA 3RF6A 3QVLA 4GQIA 2GLXA 2ZE8A 3OI7A 1BE6A 5CJ2A 1ZUHA 3IMKA 4J9VA 5K1ZA 5C9ZA 4MDEA 1JKIA 1M8GA 1KFJB 4L02A 1YJ8A 2J3LA 2G07A 3RIYA 2VF2A 4GD3Q 3ZWVA 3PNPA 1JG6A 2GEKA 2HSEA 1X7YB 2RK3A 4PYLA 1E7MA 2IK8A 3V5NA 3E9CA 4BWFB 3EH2A 3TB4A 3TG2A 4YMTA 2ONZA 2IC5A 5B1DA 4DPLA 1V5FA 2H2WA 5AW5A 1NDUA 4C21A 2XZLA 2C92A 3PGXA 3WO1A 2XB6A 5ELXA 2PIDA 2C5AA 3I4CA 1EE1A 4HC4A 3HKDA 2M2IA 2PAAA 3KJGA 2AF3C 3WLOA 3KOYA 1WBBA 4L0QA 1RBQA 5FL3A 3USCS 3A6ZA 1V5EA 3A8TA 3PTZA 1CUFA 4MWOA 2VXBA 4MRNA 3B1KA 1H6BA 4ITVA 4QU8A 5SZIA 1DPFA 1GRNA 4QREA 1ADYA 2WOJA 4WNYA 1VCNA 4H7EA 1JDNA 4I46A 5DNWA 3K73O 4E94A 5TPWA 2DQKA 3O21A 4TSFD 4IVNA 1HFEL 3QWBA 3REQB 3WNCA 2ZS8A 3WWPA 4DKJA 1M72A 2XBUA 2YWXA 4F7DA 1Y6JA 5EHGA 2XOKA 3D2AA 5IYZA 3HMQA 3FTFA 5F12A 3FGPA 5I8PA 3LPNA 3ZQ4A 4QQRA 2CL0X 4JUFA 1BGVA 5BR4A 2ZK7A 3PD0A 4ITRC 4OB6A 4LJKA 5HUQA 3INYA 2BEVA 3OQ1A 1ZMOA 2V4MA 5IVKA 3HJBA 5EIAA 1X1QA 3AR3A 4AWXA 1UT8A 1S01A 3MMSA 5AJWA 1ONNA 1YH3A 4ID9A 4YROA 1E8NA 1T4DA 2VP2A 5PNTA 2GXUA 3V1TC 4IVRA 2VNHA 3N74A 3L6OO 4MH0R 1U1EA 1FDTA 1IHDA 1WUTA 2PLWA 4M1MA 3WA7A 3FF4A 4TRRA 1Y1QA 5CTAA 2B25A 3I6YA 5JCXA 1KI7A 2D3WA 2B8WA 1PUJA 2H7CA 3OCWA 5JCOA 3ZHSA 3P0IA 1ECFA 3HCOA 4BHTA 3EXHB 5H3HA 1LBTA 4M9QA 5P8WA 3OOEA 1XZLA 4RDXA 1SHZA 2GHQA 4S0ZA 4BKUA 4B2PA 3C98A 2HWWA 1BMFD 2QT0A 1YRHA 1Z4KA 2DWUA 4B2IA 3ASUA 3ZLUA 1YACA 2ECQA 4G26A 3LBIA 2JFGA 3CSUA 3TF5A 5A05A 3NBFA 4FW9A 2CSXA 2WUGA 4ZD6A 1ISGA 2IDJA 4KWHA 1F6DA 1JE1A 4MGYR 3OIUA 3NCHA 4HV4A 1VC2A 2PPLA 4EECA 1UBJS 3QLEA 4QO7A 1J6UA 3DMNA 1GZ5A 2C1XA 5DK6A 4ZEOA 3GT0A 2V58A 4KK3A 4F56A 2VJPA 1CRLA 3ADBA 1QF6A 1U0HC 2HSZA 3B1ZA 3GZTB 3IVRA 4BBZA 3D6FA 4E70A 1HL3A 4Y2VA 3ZC3A 3BE4A 1I3LA 2GEBA 4FK8A 2X8WA 4D02A 4B74A 3OU2A 2J9XB 4DF3A 2ZDHA 5LQSA 1VA4A 1W0KD 3LQQA 3W5CA 4I4NA 1SBCA 1UPAA 2F43B 2PLFA 3UBTA 3C3EA 4QGSA 3KTOA 3UWDA 4DCTA 3NV7A 4TRMA 1C3JA 5CH8A 1DI0A 1TVCA 2H4JA 4L8FA 3QU9A 4DDVA 1DPGA 3JQCA 3C8ZA 2I80A 3K71B 3FZEA 1T9GS 4DCCA 2O3QA 2ODNA 4AJEA 4QUEA 3BWXA 2NVUB 1OR8A 1YD7A 2TMYA 3BHJA 4KE8A 4O2LA 3DVAA 4J91A 1MG0A 2H16A 5EHZA 2QN8A 5DGDA 1DT3A 3FTEA 2W6IA 5KB3A 1M2VB 2VDQB 3K0AA 3DH0A 1V11B 4A82A 4HX9A 1Z2DA 3VR3A 3WZMA 3ZVLA 5K6AA 2PWBA 3JQBA 3P9IA 4Q1EA 3Q6MA 4MK4A 2QL9A 1KHHA 5A6SB 5BSRA 2FP3A 3SGLA 4BAUA 1KQFA 2BFCB 2QMQA 3KAKA 4IILA 1MAVA 1O77A 1RHUA 2EBWA 2HRBA 3GLRA 3KE9A 4G4SP 3WLNA 4ARAA 3VKFA 1KR2A 1YOVB 3QEOA 4P0PB 4JQOA 4CKXA 3PWZA 3G89A 2PYDA 3BK2A 2PQ6A 1L7BA 1SN7A 4JX9A 2XCSB 1A4IA 3WLHA 1Y9AA 1AY0A 1CPYA 1RI1A 2W2KB 3AHDA 1DC3A 4A8JB 1MX5A 1B43A 2JFBA 2VL7A 5CMLA 1RQXA 5DGXA 3KWJA 5P21A 3TWOA 2RGDA 4O0LA 2A1TR 1P73A 5FOQA 4QUBA 1MOPA 3GLFB 5K51A 1BA3A 1PP4A 5CBPA 1YZVA 2HDOA 2RGWA 2YOGA 5ALQA 3VU9A 3NRJA 4G1UC 3VNAA 2G88A 2HSGA 1SZPA 3BKWA 4JYZA 1EWQA 1JHUA 1P5RA 1M34B 3CLSD 3L84A 2YXPX 4B85A 5B57C 2ZWVA 3C6QA 4GPZA 5AMXA 2W42A 3PRYA 1VHWA 4D74A 2O2GA 3UJ7A 9LDBA 4LOIA 1Y34E 4B80A 1PW5A 4ZARA 5GV7A 2P6OA 3KKMA 2O3JA 1ECJA 2LCQA 1KRXA 4K28A 4KIFA 4BZZA 4EJFA 5LYJF 5D3ZA 1JEYB 2NV2B 1N6LA 3AX6A 3LWBA 2GA8A 3L7KA 2G3YA 4LJ5A 4GOND 1JIUA 2JAOA 2TECE 2QV0A 1SA0B 3QA3E 3RO7A 4CTKA 3C6MA 1MIOA 1Y5LA 2G4CA 2YWFA 3B60A 3Q10A 3PQ6A 3OU6A 4KV9A 1SHKA 3KZXA 2IXAA 3PC7A 4YP5A 3WDKA 4XX1A 4I19A 4X65B 1GYPA 2N0SA 4GXTA 3LECA 4H17A 4Y2XA 1NAHA 3RK1A 4M3NA 3R6DA 4A03A 2PBLA 4REMA 3UJ3X 1HPLA 2D06A 4Q3AA 4ICIA 3VVLA 3JVEA 2VF5X 3O3OB 3MJ4A 2C84A 3UXYA 1NVXQ 2JZNA 1L4UA 1M5UA 3LNTA 3BILA 5CYOA 4I6JA 5HFJA 3WMFA 1OH6A 4AL4A 1EVQA 4NWIA 1LW7A 1WKBA 3O94A 4H3KB 1AXRA 4JEHA 2C59A 3VSEA 3PPVA 3SZMA 2IPLA 1N8SA 2V3VA 1ZNZA 1X9GA 2J1LA 1QPZA 1Z5UA 3HO8A 5F5LA 1MJ5A 1HH4A 1X3LA 4FFBA 3MUOA 4LHWA 5BN4A 5I7WA 4XJTA 3JQ7A 4JJZA 1C29B 4IGKA 4L1KA 1Y1RA 2NM0A 2G83A 3NT2A 5FOXA 4HFRA 3PC8A 4HLQB 2ZI3A 4W5HA 1FMJA 3PUYA 4L85A 3WXMA 7MDHA 1TX4B 3PTAA 2TS1A 2OB2A 1SUCA 1UZAA 1W4LA 1YS4A 2P8SA 4GYYA 4QDTA 1S0UA 1S9HA 3VAYA 4IS2A 1VYVA 1Q3HA 1T35A 1GAWA 2P69A 4MWEA 1G2QA 1OXVA 5AOAA 4IS3A 2P6MA 1P7ZA 4U7HA 2BFEA 2FR1A 1YA8A 1AOXA 1RMTA 3DUWA 1FP7A 3CLUD 4FEGA 4HDQB 4P3PA 4XX0B 3HP1A 4J4HA 3RUPA 4R2LA 1RLUA 1UJMA 4N03A 4ARUA 1NMSA 3SBEA 2PJDA 2AFRA 1I1OA 1Z6GA 2XXJA 4BQEA 3F6YA 4R3NA 4AMGA 3H9CA 3IPAA 3F3KA 3G88A 2G9QA 2ID9A 2CZCA 2PGLA 2IU3A 3W6ZA 4P0TA 4Y6LA 1XPRA 1SHUX 1IZ0A 1OX6A 4KCGA 3AVUA 1QVAA 2AFHB 2Q3BA 1BE0A 3HKEA 3UJHA 3ZWKA 5A0FA 3P52A 4RV4A 5DI3B 1AHNA 3C16C 4L0MA 3ZLVA 2AD1A 1R3DA 3IB3A 3SZOA 1RYDA 4FT2A 3TDKA 3VNRA 5HOQA 1DXQA 1XLTA 2QTLA 3FVVA 1YULA 1J70A 4UATA 5IBRA 3VHRA 4KO1S 4A92A 5K8TA 1M3SA 2G8NA 4D8XA 1YR8A 5IBQA 2CKMA 5DOZA 3CVOA 4BZWA 1L5RA 4DJ5X 3LC2O 4B32A 2YHIB 4GWKA 3RC7A 1O95C 2PD6A 3CNNA 4F93B 3PEYA 2GKSA 5B6IA 4X1IB 2UUCB 2OGSA 1EG2A 1P29A 2OUIA 3IAUA 2N1BA 3PGLA 4PIVA 4Y1GA 1PLJA 2FPUA 1QV9A 5BRNA 3VH4A 4JSYA 4DNFA 1U63A 1PGOA 4KUHA 2IZOA 5B6PA 2HJGA 3N7UA 4GOKA 3H5IA 4FE3A 3DEAA 1O96B 2ZE5A 4MI3A 2FW1A 1RRMA 4JVNA 1NT2A 2V7VA 4I1IA 2WJWA 1CBUA 5EZYA 3GP3A 1DHTA 13PKA 2NVWA 2ZR0A 3AJ9A 1IONA 1D6JA 1LFAA 4GEKA 4B6JA 2O48X 1AK9A 5EIEA 1Z37A 1F60A 4AY6A 3QEBZ 3C7AA 2DXIA 2IHVA 4Q6WA 1D2RA 3OX4A 1CJTC 4JA2A 4F38A 1NP7A 4I5EA 5LQJA 1AK2A 3PTLA 4CFYA 3WS7A 1VB5A 2EFGA 1XU9A 2V5UA 2X8JB 1B6RA 3VR6D 5KWIA 4NBUA 3R75A 1R6XA 3WAKA 4UCFA 5HRUA 2VPPA 1UAGA 2OBMA 2GPSA 2IY7A 2FFJA 3N7AA 5CNJA 3IQIX 5ENVA 1EH5A 4E21A 3OMLA 5KTSA 1LDMA 5KX5A 3E5NA 4Q24A 4EJ6A 1UEJA 3LU1A 1C1HA 3ZHVA 3F4LA 5TLSA 3GEGA 3RASA 1DCTA 3ZGNA 1XMPA 1F2DA 1GNRA 2HO4A 2HX1A 2KI5A 3FNBA 2ZRFA 1MO6A 2PEZA 3GA7A 1WVMA 4TV8B 3SLGA 3G9ZA 2WFLB 1I5EA 1W34A 4U0JA 1CHDA 3AIKA 3H19A 5IJWA 5F3DA 3SWWA 1N2ZA 1U3GA 3RH0A 2P30A 3G8BA 1WMDA 3K05A 2G1UA 2R2GA 2O07A 2V7PA 4U02A 1DXHA 1OGJA 1N9GA 1JHYA 2XUIA 5IK2D 4L4SA 2HQSA 4I99A 4CMGA 1W75A 4MUEA 3UNXA 4BNDB 1HM5A 1P0QA 5E4JA 1JAXA 1XA3A 4KXQA 4CUJA 3V3TA 1QXSA 4F2GA 2X6RA 1ES9A 3JWJA 4HWSA 2QRMA 4G0VA 2FWRA 4GZLA 1NG1A 2PDAA 4U63A 4W4TA 3UKOA 1PQ4A 3IBGA 4P3NA 2XVAA 3WK5A 1K2VN 3PIIA 2ISQA 4C20A 2QMUA 3CCFA 2W6OA 3G2IA 1E2JA 2C9OA 1BDBA 2CBZA 3KL2A 3PDJA 4TQGA 1YE8A 1UOEA 3N9IA 4JOBA 3DVLA 3QGMA 1HFJA 4BUZA 1RAFA 2OK7A 2PU5A 4G89A 4KODA 4QLOA 4TQAA 5EKXA 5JMWA 1TW2A 2GXQA 1TPZA 4URWR 5D00A 1FP4A 2EW2A 2KE5A 5CITA 4O1IA 4BGUA 4L9AA 1N5IA 1IG0A 4Q37A 1WRBA 4Y6RA 4OHBA 1OFTA 3PWTA 3PVSA 1N1MA 5AW2A 2IGTA 3F47A 1TJPB 2YZ7A 1JEJA 1SQGA 3F7MA 3AM5A 1A9ZA 4P7JA 5E1OA 3WQBA 1VKZA 4U9UA 5LDHA 3VA7A 2XZOA 1KOGA 2ZWIA 3PU6A 4OIFA 4PYRA 3DE3X 4R51A 3TZKA 2P2CA 2XUOA 2RAVA 4RMJA 1BRTA 1RQGA 3JASA 3W1EA 3IOBA 2UZ1B 2GUWA 3SZUA 1C9MA 4EHBA 3NAZA 4XDGA 3OFSA 3T41A 3QY0A 3Q2KA 3D9QX 3WRYA 4E5SA 1EVIA 2WQ6A 3S2EA 3QX3A 2BI8A 2VHVA 1FYXA 2P4UA 2DR0A 1DEKA 4MTLA 4E5PA 3VNUA 5LP1A 3NAGA 4LWOA 4ZHSA 3ENWA 1OZ0A 3RT7A 2WG0A 3VI3B 4H6VA 1E9RA 4G84A 3NKFA 3VO2A 3CVUA 3D4NA 1U2EA 4G0UA 1NHWA 2FRDC 3IRVA 4DMUB 2PBFA 4GSLA 2G6BA 1PFKA 4FN4A 5KWVA 3IIEA 2VSFA 2JGFA 2NYVA 5FJJA 2CW5A 3I61A 2H2HA 1JDPA 2QRPA 1Z33A 2CLKB 4NYJQ 2CVZA 3W5SA 5B1EA 3PPIA 1MZPA 2WKPA 4FE4A 4N7RA 3ZOKA 4IRXA 1JJ7A 2XXAB 5CHEA 5EWJB 3OQVA 1CETA 4PGFA 5AKIA 4D7AA 1VE1A 1XNQB 2GF9A 2OCAA 3LPLA 5JYEA 4DLNA 3C3JA 4K9LA 2HA3A 1T8TA 4PANA 2FPXA 2V5AA 5T64A 3SX0A 5JNLA 1E7WA 3R9WA 2A57A 3QEJA 3EHDA 4BKPA 1W1UA 5FEUA 1T9CA 1E9BA 3E22B 3U7GA 3C4QA 2ETXA 3H5TA 4MW7A 4PGHA 1ZD4A 3V4RA 3ZGXA 3OZTA 3PKZA 3AY0A 1R8XA 4L4XA 2Y1DA 2Q9UA 4JNCA 2IHTA 4US0R 2N46A 2O0MA 2Q6IA 3Q3VA 2EQBA 4W7IA 2FZVA 5F73A 3ZU6A 3ZOZA 5BN5A 2LRHA 1F2UA 1FL9A 3ADCA 4EELA 3HN7A 1ZMTA 1TIKA 4UNSA 4XJVA 4AIRA 1M2GA 2HWXA 1Z45A 4FEYA 4Q12A 4Q9KA 1NM5C 1NHGA 3PQFA 3LUDA 3L79A 5KWSA 3IEIA 3FGNA 5I9BA 4G1MB 1R0BA 2VNSA 3AOEA 5TMEA 1Z25A 5ALYA 3VZPA 1PZGA 3CTPA 1QIEA 2O1EA 2EP7A 1BX3A 4Q03A 3PUZA 1ILWA 5EOVA 5T4BA 4B09A 3MSXA 4LY3A 1AKYA 1G5HA 2A3NA 3ZDZB 3IKTA 4ZVLA 4LS3A 4RTSA 3Q3EA 3O93A 2GBLA 3GNQA 2HMWA 4FQ8A 1OASA 4K0KB 4TV9F 2LCIA 1YE3A 4NEHB 4EYSA 4LZAA 1JSLA 1QGUB 1GTRA 4AQYB 3ZIUA 1D6SA 2LR0A 1M1UA 3NTRA 4TLCA 3V42A 1M1YA 2BW0A 3T3NA 1YZYA 3NKLA 4DV1B 2I6QA 3ZCQA 4P8RA 4CQLB 4OYRA 4F21A 1OH8A 4JA0A 1CR4A 1NUUA 1WA5A 1CRZA 2EZ9A 1Z0ZA 1OZFA 2D54A 2FLWA 4BPRA 5AJXA 1GQRA 1A88A 3VX3A 2HSWA 3C5VA 5B3JA 3SHQA 1OBHA 1AO0A 3KSBC 3WYAA 2FI1A 2PMKA 4MVXA 3TTYA 4C05A 3CX8A 4D1YA 4D5EA 3JQ9A 2Q3LA 1UKBA 3L8MA 1QHYA 1ZL2A 4MQEB 3B1WA 4PRZA 5I5EA 5CVDA 1Y5IA 3K1AB 4I4CA 3TUZC 1NQXA 3TBFA 2OO5C 5EJGA 4YHBA 4KC0A 5C8DA 2CMGA 2OZLB 2QG6A 3NCTA 2F2TA 4PCVA 5CLIA 1NXTA 5HGXA 1E18A 4YV7A 2NO1A 1ZIDA 2G17A 5CCEA 3T8YA 4OIMA 1WXXA 4ZPXA 4HB3A 4NK4A 4MVJP 4CFSA 2CGEA 3U7JA 2AR0A 1IQRA 2GBFA 1W4ZA 2GWRA 2R6HA 4X1YB 3EUAA 4OSEA 2BLNA 3BX1A 3EXFB 2Q3FA 3TN7A 4RCVA 1NBMA 2ZP1A 2NU7B 4LF5B 1Z07A 1KZ1A 1OT3A 2YFQA 3WSVA 3U4DA 4IDGA 4PG6A 1TL7C 4ZREA 2GZ3A 3X1JA 2D2IA 2QBYB 4X1KA 3IVGA 4BCDA 4E5VA 3IV6A 1AZTA 1PJ4A 2ZSUA 3NG1A 1QV6A 4LYHA 1DAPA 1PEDA 2Q8PA 2FLVA 3NNSA 1WUJS 4JS0A 1KSFX 5DYWA 2QQGA 4HDRB 5TT1A 2O6HA 3K6JA 1MNQA 3UKJA 3IPLA 4PLYA 1CSEE 2H06A 1KBOA 2MYTA 3C1AA 3GK3A 3KDPA 4FR0A 2QR2A 1D07A 5HBRA 3RIEA 3T7IA 3V2UA 4V1CB 3A32A 4OQFA 4L9RA 3T9CA 4G8JA 1T8YA 3BULA 5HIKA 1JB9A 5FUYA 3K15A 2OZEA 4JELA 4GVPA 2ACKA 1JFSA 3STHA 1RZUA 2RGXA 3UHAA 1GCAA 4PLTA 3TCXB 3KJIA 1S96A 3OZBA 1VJTA 4URHA 1XVIA 2DM6A 2HJSA 2QSUA 4IG4A 3W8RA 4BUCA 2R47A 4FHCA 4MRMB 3TI7A 3DO6A 1O94C 1BO6A 3TVTA 3DAFA 1PHPA 5AM2A 1LF5A 3GDFA 4R16A 3HZOA 1O54A 1YQGA 4MRVA 3L6UA 3ZLJA 1IXSB 2JLAA 3L4BA 2IZ5A 5C8VA 2CXTA 1C1YA 1CR1A 2H4YA 2OHIA 5BVHA 4G36A 5JXHA 5KUTA 3U1BA 4KNYA 1LRLA 4HAWA 3A6HA 4QOFA 4O6VA 5IZ4A 4XA8A 4AZ0A 5F3WB 4KVAA 4R5MA 2JKVA 2BZ0A 4FFMA 1V71A 2KHZA 2DUMA 4UUBA 1L4LA 2HM7A 4HDKA 1G3UA 2OBFA 1CRPA 1N2SA 1ZIXA 2KBEA 2O8CB 1CUSA 2P9GA 4RD4A 4YQZA 5DLDA 4B3RB 2D5CA 3SNHA 4K6OA 2FEOA 4M0DA 2JEZA 1TUBB 4OP2A 3BIFA 4WACA 3LDHA 4ND7A 2OZKA 4HGZA 2J0SA 4AT1A 2OA0A 1CVRA 2QEQA 1RW4A 4BLOA 3ILHA 2VCYA 3IMGA 3OKFA 1M2OA 3C8MA 3KYDB 3LC7O 4OGWA 2B30A 1AQLA 1LV8A 3ICVA 3AJRA 2OBYA 1R00A 3QMVA 5AKXA 1EWKA 4D8TA 2Q41A 3EGOA 4GW3A 2PT7A 1XCOA 5JV5A 1M0TA 1L7MA 3FKQA 2ZDGA 3OLVA 1WS6A 4NBKA 1WKCA 1ZNQO 3L0BA 5AK5A 3PL1A 1US8A 1R0LA 2B2CA 2E2WA 3M6WA 4QTZA 4P33A 3DFIA 1Z63A 2NNLD 2Y05A 4HNVA 4DA4A 3CT6A 4OFBA 4G4SO 3HWX1 1Y9ZA 4LRXA 1X7XA 4UCWA 3TTSA 2C0CA 4N1AA 7ADHA 3DZFA 4F3TA 3OQNA 3T3DA 3U3RA 4EO7A 5KYGA 4HUJA 2ZWPA 4IIVA 3TKAA 3HHEA 1J2EA 4H7DA 5GONB 4JDUA 3T4EA 4FXPA 5E7IA 3THXA 1RVV1 1PS0A 3DBLA 4L8WB 3UB2A 2J09A 1Q84A 3DXZA 5KOJA 4Y9SA 1WSWA 3UGTA 4JB2A 4O5OA 3UH1A 1VKOA 1RDFA 4RTMA 4BNXA 3H1FA 5J2TB 2CDRA 4KDEA 3U4HA 3NNNA 2WYHA 3JQPA 4FWIB 1EK2A 3EOZA 4GZ5A 4F2HA 1EESA 4GI7A 3PC3A 1L5QA 1VLJA 1EP2B 2XW6A 4ZCQA 2FW0A 2JGKA 4EG7A 2NG1A 3D7MA 4JMPA 1XYVA 4EPTA 1Y5RA 2A0XA 1JR3E 2QX9A 1A82A 4LMAA 3CLKA 4BMXA 3PNBA 1E1LA 1EP1B 4H1TA 4DIDA 5A0TA 4HRXA 1KK1A 1H0SA 2GVNA 3G0BA 4RADA 1UBOS 4G63A 1GKYA 3CF6R 2IV2X 5AW6A 5D3KA 4EZEA 3ZI4A 4OXNA 3SEQA 5L3QA 3COSA 1JSCA 4NYJR 3B3GA 1DAOA 2NZUG 1QQ5A 3AEKB 2F1KA 2OHXA 4J0EA 3GRRA 1JDZA 3N2KA 5IJZA 3T1VA 1K3UB 4LI3X 1F0NA 1XTUA 2DKNA 3KUKA 3R7LA 1HRKA 3H84A 3EIEA 2REOA 4U2FA 2E0IA 4WKNA 3K3PA 4GP6A 3ZY4A 2PGIA 4RPJA 1MFPA 1ZY2A 4A8HA 2O7RA 4G8BA 3I9V6 3F3MA 2BEKA 4L73A 2VBIA 1SRRA 1OREA 1W6UA 1OXBB 2KMLA 3SHTA 1R37A 4M1YA 1NU6A 3Q9LA 4D9KA 3SEFA 2RB5A 2VUHB 5KNBA 2I78A 2VR1A 3OZRA 1UWCA 1XMJA 3VDQA 3K92A 1KYQA 1VIYA 1JBEA 2RHBA 3I9KA 4JBYA 3NWJA 4F06A 4XD2A 3NHUA 1MRNA 2RI0A 1ZVKA 3N86A 2QZSA 3U4AA 3ZWYA 5BSWA 1HDYA 1O6ZA 4L51A 1Z4MA 3P4XA 2IIVA 3N58A 2C4VA 4IICA 4YNBA 3TEJA 2O2HA 4FNAA 3EN0A 1PNOA 1KERA 4IDCA 1ZNYA 4EY5A 4RESA 2BGTA 2XUDA 3UUGA 4C4TA 1Y48E 3DOEA 3A4TA 2RCNA 1C14A 2O8VA 1YI8A 1XAGA 2P2YA 5ALDA 4AY3A 4CF6A 4PHTA 1O0BA 1YDGA 1LVUA 2BD0A 3DUFA 4FCWA 2X8LA 5EWLB 2O8EB 4P4LA 1ODSA 4I4TF 3UT5B 4MHTA 4RK4A 5A4AA 5DE3A 3EYAA 1BGXT 1DKQA 4LVNA 4XLZA 3QVGA 5EMLA 2R00A 3JRNA 2YWRA 3BVPA 1NBME 4G97A 4MI1A 1QVWA 2WIFA 4TLMB 3KJZA 4EATA 3S40A 1S7GA 1TAUA 2HCJB 2ZW9A 2Z4TA 3EPRA 1SVNA 4CLOB 5IM4A 1EVEA 1U0JA 3C6XA 4WAUA 2W2XA 2VBCA 4DYVA 1FPMA 2G9ZA 3NZEA 4G1VA 2AYXA 5TJ9A 3X1XA 2FUG6 2RONA 2QPAA 2EG9A 2X0NA 4TT3D 2B82A 3DZBA 5DYIA 3JYQA 1C3VA 3FRJA 1ZRSA 2X3FA 1L5YA 1VPVA 2MWMA 3E81A 1EX1A 1PW7A 2QRVB 1EX6A 2QV7A 2VRCD 4KQJA 2QAGC 3WMXA 2JD2A 5F3RA 3WKAA 3S27A 5FULA 2EP5A 2I22A 3MTJA 2CXXA 2KB0A 3DDWA 3KXLA 2CNLA 1M1XB 5C3MA 4MMXB 1Y6GA 5JVDA 4EG4A 4CNQA 3E1KA 1JIVA 4P81A 5A9SB 1YV9A 4PS1A 5BSFA 1QTRA 3VC3A 3BUSA 3P32A 4HCJA 3SSNA 3E61A 1LWNA 4W5OA 3TR6A 5DLYA 2ZYHA 3B85A 3OWOA 2B8NA 4KVFA 4RTLA 3K6SA 4NS4A 4XOUA 3GGDA 3SFZA 4Y30A 5CDFA 1N0HA 1E2KA 4NX2A 2LPMA 1SU7A 3B3FA 4PICA 1QQBA 1Q95A 3S2YA 3RVLA 2IBMA 4CG2A 1C9NA 1FFDA 2ON6A 5AHRA 3G2KA 1IHPA 1P1IA 2R84A 3HU1A 5ITVA 5GJCA 1U2QA 2P3LA 2IZ0A 5EKDA 2V98A 4OOFA 1YNOA 4S24A 2FU5C 5D2CA 1KBZA 2HF9A 1Q0RA 3SQNA 3WLLA 4WBNB 3QLVC 3IEKA 5EUQB 3RLIA 2UXCB 2ZJZA 5ALHA 3SAJA 4BP9A 3WGGA 2NZ8A 4QO8A 2G9NA 4LBZA 3PQCA 4AF8A 2ZGVA 8LDHA 4LDAA 1EX9A 1JWBB 5A4FS 3T9FA 4DLPA 3FTPA 5KDDA 4F46A 1VSVA 6Q21A 1OZHA 1G8GA 1XJWA 2BCJQ 3TRHA 1AU9A 1DXYA 3FWYA 4Y7DA 3HXPA 1NY5A 4N5DA 3W2EA 1UK9A 1UKVY 1B6SA 1EGQA 1Z35A 4AMBA 3G0OA 1WBJB 2YMMA 3MQFA 4U39A 3CH6A 3ETLA 3KALA 1Q16A 1M5RA 1EXWA 2V6FA 3IO3A 1H4SA 2VXCA 3OUTA 2WJJA 1J1IA 3CJQA 3VOTA 5EP4A 4BNUA 1NQAO 2JZCA 2IOQA 2O0KA 4R2HA 5KNCA 2Q1YA 1TYAE 1V95A 4IH4A 4RL4A 3A6JA 1NP3A 3U3JA 4BVKA 1PDOA 3QE3A 4D9BA 3VSDA 4F86A 1HG0A 3ZDFA 1PEAA 3FI0A 3EEQA 4OBXA 2ET6A 3ZUGA 4UTVA 3AP3A 1QK3A 2GBCA 4L4ZA 3HQ4O 2BEUA 1DRJA 2ZSBA 2BM0A 4L76A 1PN3A 2I29A 3W6OA 3B9QA 4P98A 4CVNA 1T6BY 5F1KA 1ZGJA 3N8DA 4YMHA 5LR6A 1QNLA 1X7WB 5FQOA 5AWFC 1YMUA 1VJ5A 2A5GA 3HFGA 3RTEA 4QPZA 4DG5A 1CQJB 1YVRA 4JVLA 2DUNA 3BGOS 3G59A 1UP4A 3DVQX 3RG2A 1SC1A 3SEZA 4DCPA 1IPEA 1G5QA 3U44B 1IN6A 4UM5A 8GPBA 3LBHA 3LCCA 5CFQA 2B94A 3VPAA 1NN0A 2I7CA 4A8TA 4CLDA 3NNDA 4MV9A 5ALWA 3HADA 4LXTA 3EIWA 4LCJA 3BWDD 2AC4A 2VLIA 2CK3D 3GLUA 4XCVA 3VDRA 1KYZA 3OZEA 2CC2A 3V1YA 4C5CA 5F1PA 4LOLA 5HKOA 3OLWA 3JZIA 3CEHA 2G63A 3TSCA 3PDHA 3TPCA 3G8YA 1W4BA 1GCIA 1PU2A 3DHEA 1YHNA 2I9KA 1JKJA 1QP0A 3ACBA 5KWEA 1E2HA 4J0FA 4OREX 4MVJH 1U0BB 2Y1WA 3DXXA 3RYCB 1KSHA 4OUDA 2XVZA 4FHFA 2R85A 1U1DA 1SUFA 1VKJA 2F3TA 3Q5EA 4BMNA 3CVXA 2ZCJA 3GBVA 4C76A 2HBZA 5A4DA 1QRDA 1R4MA 5FWXB 1IBSA 5HF8A 2WHRA 2PXAA 2GR9A 3NXKA 4XGKA 5CA1A 1QS0B 3AHIA 4GAEA 1R4ZA 2E4UA 5FRDA 3S68A 2WD8A 5JI2E 3C14C 1KMMA 2NTNA 3ANSA 3T12A 1N2IA 2X41A 4ANFA 1VYHA 7REQA 3AM3A 3HV0A 3R5KA 3H99A 2VJYA 2Y92A 4Y2SA 3L18A 1ZUNB 4MJ7A 4CM4A 5L4LA 1BAPA 4FLEA 2XMZA 5EPEA 4YXWA 4B17A 2GQ0A 1BX0A 3B52X 3M82A 5LP6C 1JDUA 2COKA 3MF4A 2QX4A 2WD9A 2W7TA 4QRDA 2DMRA 2BMWA 2VDNB 2ZETA 3OZGA 5K0NA 1IJFA 3MBIA 5KTOA 3RYIA 1M76A 2AG1A 1ACMA 2ZT7A 4RCZA 1FLNA 4WCFA 4KGZA 4BAGA 1WV0A 2OWEA 3I2HA 1KZYC 2QM7A 2R8EA 3HHPA 3V55A 5JZ9A 1SQ0A 1HY3A 3DFZA 4ER3A 3TQIA 4HZIA 2O05A 4XIIA 2ZSEA 3Q8XB 4M9UA 5GWXA 2NADA 3UPUA 1GPKA 3FG9A 5AHOA 2J4FA 2G70A 3AJDA 3RS3A 1O5OA 1XP5A 3LOPA 4KGVA 4HB2A 1AUPA 3O8OA 3EOBI 1D2HA 3K0HA 2AC2A 2WBLC 2BY4A 1DG9A 2ZCUA 1I2AA 3L6BA 3LFUA 2QTGA 1II8B 3IDZA 1BWRA 1XCGB 5LA6A 4X20A 2PZMA 4QQFA 2D74A 1IBRA 5JHHB 1DO2A 3AJAA 1MX1A 4PPGA 3GZNA 3G82C 2GPAA 3WBFA 2B1IA 1BG6A 2CCGA 3OT1A 3TFQA 4D8WA 3WO0A 4ZT4A 3BSWA 3FLBA 4G0OA 2DWQA 1QH1A 1KP3A 2IS6A 1GDHA 4LPKA 3TBKA 2IH5A 1NC3A 5AVZA 2I87A 1CG6A 1XGKA 5DNVA 1JLHA 1KH3A 3QKUA 2Z56A 3WK4A 3P9CA 2YZNA 2DWOA 4B4OA 4NPHA 1HA3A 3CR8A 4F7WA 621PA 5IEJA 4RD2A 3L6RA 1LTQA 5CDFE 3JCZA 5BURA 3HC7A 1U81A 4GZ3A 4KAXA 4IIHA 2IBSA 3E5HA 2VDOB 5CYPA 2VSOA 3RJMA 1UDBA 4YCSA 2ZBPA 2OY0A 1X8XA 3S1SA 1Y3FE 5F78A 2IPNA 1GV0A 4G0QA 5E8RA 3TKLA 4F3RA 2FSHA 5JC1A 4HMQA 4BLRA 4UAGA 1TJNA 3IHTA 4GPEA 4I1RA 1KNXA 5GQSA 3BTVA 3AF2A 4RJJA 2UXBB 1VPDA 4RABA 1BW9B 2FFBA 2NZ2A 4P5EA 1XZIA 4BV9A 5G02A 5CB4B 2R6FA 1EP9A 1NE2A 3ZHRA 2EV9A 4EUHA 3U26A 2IITA 4JLPA 2IEGA 3UV3A 2JCGA 4DJAA 4Q39A 1E0SA 1ZW6A 1EFRD 3M6IA 3OAAD 4UVIA 4D41A 2AKEA 4RHEA 4RTJA 3RTCA 4YPFA 3KS9A 4GOXA 1AURA 3QFSA 2WTXA 1DNPA 5DTRA 4CQMD 4EVRA 1SC3A 3ROMA 4FEAA 4WIAA 4X6LA 4Z9FA 1CYDA 5CDHA 3H2BA 4EJSC 2CLOB 5EUMA 3GUZA 3QEMB 3FNIA 3THWB 4PBSA 2JBAA 4YJ3B 1SBTA 4GDMA 2QUBA 3IL2A 2KW5A 4XQCA 1MXFA 1AGXA 4NBLA 3CUYA 1HDRA 4FILA 4DLRA 4EMTA 1MF7A 4C29A 3QI7A 1J5XA 1N5DA 1KKMA 3E4DA 3K4PA 1YZNA 3O38A 4P82A 4ZXPA 1W46A 1KIFA 1EHYA 1MFZA 3DHVA 4HG2A 3VNQA 2V7TA 1K4YA 4MR9B 1ZOOA 3A4NA 4DT1A 1A9YA 2WD7B 5TS3A 1IK6A 1YJAA 3QIVA 1E79D 5COQA 4UU7A 1TB4A 4HPJB 3FWKA 3BJMA 4JBHA 4KRGA 1ZJ5A 2Z6AA 1L4KA 4Y9UA 4CHTA 1NVTA 3OF2A 3SBDA 5B2FA 1NXVA 5IS2A 3HXMA 5EJFA 4P4UA 1D6NA 2H1RA 1OYVA 4DR6B 4TRJA 3A28A 1EDDA 4KO3S 3BL5A 2QI9F 4RZUA 4IMRA 1SVMA 3HCDA 1U1GA 4JENA 1TO6A 3EISA 2PX5A 1Q0QA 3D7LA 4RV9A 4PAOA 3U81A 2IT1A 4B3BA 4F5EA 5CUQA 2OAQ1 3CONA 4YMVA 5KC8A 1Y1KE 1Y6RA 4RQAA 4R4JA 1LEHA 1Y7PA 4XJXA 2M6SA 4B3IA 3IC5A 5LQMA 1MX3A 5IJXA 3GGCA 4YUXA 4XRGA 3ZHZA 3GRKA 2H2FA 3ZBPA 1QV7A 4MV7A 5LKRA 3WDLA 2PSSA 3MJCA 5FHQA 3ETCA 4N0MA 1COZA 4HJXA 1M0WA 4X8LA 3AHGA 4COOA 1K3TA 5JJ5A 4QULA 1N0UA 4AFNA 4JLSA 3V1LA 4DN6A 4F45A 1VG8A 1E5LA 5BR1A 3F7TA 1G38A 1WB5A 1YBFA 4DLLA 3I62A 4LYYA 1R0RE 3L43A 4LY0A 3DMYA 2WIJA 2YJ6A 1E1QD 2A5JA 2PX2A 3PHCA 4RW0A 4CU2A 4QASA 3LT4A 4YRPA 4BVJA 4C0LA 4YUWA 1C9YA 3R44A 2II6A 5NULA 2RHJA 1LGYA 1O89A 4XZ3A 1YASA 2JLQA 3GMSA 1P0MA 3PF9A 5JISA 2V65A 3IXLA 5H16A 4WZBA 3FPFA 1E5QA 1P17A 3U2QA 3QU5A 1Z7WA 4O8ZA 2XMPA 3NIFB 5FLEX 3NGLA 3ZTYA 1LZLA 3KHTA 3EGDA 2AJLI 1GPUA 1QZ3A 1B6GA 1CF9A 1GUFA 1TCCA 2CL7X 3BK1A 3EWSA 4K2HA 4RZQA 3TOXA 3U3ZA 3MS7A 4C6TB 5E6RB 4AZ3A 4G0XA 2XT9A 3FROA 1LPMA 1YJ5A 4IOLA 2BTQA 2EFHB 3PPXA 4GBED 3KLMX 5BV2P 5K0EA 4Q6BA 3U7QB 4EYEA 4X7BA 1T0PA 3TLGB 3CRQA 1A2BA 1L5HB 1Q15A 3GUYA 2WSLA 1USUA 4INPA 4Y67A 4W5RA 1CJSA 3RBXA 2PGAA 3DMHA 2GDJA 3JD2A 5AJZA 1WB6A 4B5LA 1EUCA 1DIAA 4D6PA 5FDFA 4EB6B 1IN4A 2B1RA 2WF8A 2PQ2A 2WDZA 2ZDQA 1XK7A 4JASB 4OSOA 4P58A 1IXRC 5JATA 4QG3A 4YJGA 3WFIA 2Q0XA 3KM0A 1ZR2A 5K0GA 4LV6A 4L5IA 1YRBA 3TEFA 2FSGA 1Q3KA 4J90A 2Y27A 3A6FA 4OJTA 2QE7A 5BNTA 2JK1A 2QTHA 4HVLA 4R7TA 4P32A 5HKLA 2A86A 1KA9H 4CW7A 1NQUA 1JV2B 3NHJA 1OWLA 3FYDA 5SZHB 5ARBA 4M46A 2O5RA 4XD7D 3MLEA 1OMOA 2HRQA 4H0FA 4TN5A 4F12A 3L4EA 1FIUA 4DQKA 1S1CA 1DBVO 5JXJA 1QP7A 1PT8A 3SC2B 2JIRA 4K46A 4D26A 3IEXA 3TKYA 1TZCA 2R11A 5HIAA 1E3TA 4ZCSA 1UMDB 4HEA1 1I4DD 3UXHA 2DE0X 5LL6P 1G8FA 2Q49A 3IP7A 3UAYA 3IVCA 4JVMA 4QU5A 4F8YA 2G7MC 3AUTA 1SCKA 2WJVA 1OLSA 4TZTA 4RK0A 1LXCA 5JD4A 1XC7A 2GD6A 4OBEA 2JHAA 4X91A 5EKTA 1JEQA 2VC2B 1RYBA 4IAOA 5K3FB 1FUKA 1RLIA 1MOQA 1YR2A 4M0KA 2ZTLA 4LOHA 4MKXA 4XUDA 2GN2A 4CMEA 5BQPA 2AOVA 1T5LA 5HZHA 4QT4A 5EIXA 3T9AA 4X85A 1F6WA 2CLLB 1E61A 4HY3A 1W2HA 3MMPA 1XTQA 2Q4EA 2BFNA 1UXKA 5CH5A 1FXUA 4QDZA 1KQ3A 2HPHA 2FWPA 3MMNA 3RREA 1QRTA 1MP0A 5EA2A 4M8IA 5FOWA 1Z39A 2GPBA 3E9MA 1DBQA 1UC5B 4MRSA 4F6RB 1IUNA 3LCUA 5C3UA 3C74A 4W1QA 2EQ5A 2C98A 3P9KA 2W37A 5FXMA 3MB8A 1QGAA 3TE6A 1Q7CA 3OZVA 4IH9A 5K3CA 1RAHA 4MINA 1G6HA 2R7MA 1NUQA 1M6VA 2WYIA 3GV0A 2VHCA 2F17A 3KJXA 4EP1A 3RBAA 2RAUA 1W7AA 5LZ7A 1K4MA 3PRKE 2ZXFA 1B4DA 3V7UA 1JDBC 3WLSA 3PV0A 4PQRA 5KBYA 4GKJB 5LN1A 3I6MA 4HLUC 2P75A 1U8AA 3IAM1 4L5YA 1F2TA 4CEHB 2YVAA 2ZRIA 4DABA 1FTSA 1J24A 3GW8A 4MS4B 1E59A 1G3RA 4O2BA 1L5ZA 5AVXA 4GPIB 1ICEA 1QMGA 3C70A 4MUXA 2FDCA 1H93A 3UEOA 1CDOA 3AR5A 1TKAA 2YYYA 5AUPB 1G42A 2XA1A 3LK6A 5E1DA 4Y0AA 4UQPA 2HD4A 4FMPA 1GTVA 3VPGA 4C0AC 1PUIA 4B71A 1HE1C 3EBOA 1YI0A 3UWMA 3L4KA 4IDOA 5L9AA 2OUKA 4CTMA 1ATZA 3HCWA 1LK5A 4EGFA 4MYRA 3TTTA 1WZEA 4IOKA 4DXHA 3GD5A 1NF2A 1YB1A 2ZJ1A 4TMYA 4O08A 2K2QB 4C6RA 4EGJA 4H08A 3BB1A 3E27A 1EFKA 2J0VA 3LLCA 3RUEA 4C30A 2FN7A 4TVKA 5JCPA 3H6KA 5EZ6B 3T9BA 4EI9A 2ZZMA 4C7JA 1BKDR 4CM9D 4ILKA 4X97A 2PZ8A 3QWIA 1KGDA 1HLGA 2CVHA 4WOBA 1T2DA 1CZRA 4JI0B 1Z88A 5KJCA 1BTOA 4PZEA 2QPTA 3RYTC 4EA8A 3KFVA 1T0JB 2RHOA 2YWHA 3SG0A 3TIIA 2QUIA 1YSCA 2CHVA 3H5LA 3VGJA 3PB3A 3T7CA 4ER5A 5T67A 2I6UA 1RAAA 2Y9MB 3UB3A 3LYAA 3LT1A 3HGQA 4M1TA 4X8OA 2FRXA 4M38A 1OKKD 3S8MA 3R4VA 4OQNA 1PJCA 5CLHA 3SVZA 2COUA 4B3XA 1NMZA 2H52A 1B76A 1TT7A 4KOAA 5ALKA 1E3JA 3JALB 5ITZA 2AJDA 1YCHA 5B3KA 3OE4A 1EUDB 2WF5A 4YJ2A 1N1GA 3B2QA 3QE4A 2G77B 2WU3A 4YI3A 2YJ3A 3LUBA 1DWQA 4WVFA 2LWIA 4MGIR 4EW3A 2QVLA 2Q1XA 3VKVA 3OTWA 4WZBE 1ORDA 3KDAA 4UFOA 2GEDA 4F6LA 1UAYA 1YQQA 2D1SA 5DBIA 4QKQA 1IXYA 2UUOA 1MORA 1LTKA 1RU3A 2F1HA 4IGEA 10MHA 1C1XA 1U1CA 1Q21A 1UXJA 1DTWA 1ZKMA 3JZMA 3PI6A 4B6GA 4C7VA 5EJ5A 2IZ6A 5KMGA 5AK6A 2FW9A 4RLHA 4KOEC 3H1TA 4H3SA 1NLMA 2Q5QA 3SS9X 4JJFA 4LQLA 5BMVF 2HQOA 1SC9A 1XRNA 1F5NA 1ZG3A 1B6TA 2ODWA 3ODPA 2QN3A 4A2CA 1NTOA 2WLSA 3P9XA 2WVAA 4P83A 4BO0A 4GOLD 1C8KA 3LX5A 3SHVA 3ZJTA 3HKCB 1IN8A 3IMEA 1HDOA 1UK8A 3FPEA 1Q1GA 1JTEA 4M22A 5BRJA 2XYPA 4HAOA 2ZYWX 2NSDA 2XOKD 4QBTA 1GNSA 4FFWA 5BR7A 3LF2A 4RD1A 1NI5A 3DOOA 3LCJA 2OPHA 3T0IA 2VI5A 4YP1A 3PCTA 1XTVA 2XR1A 2BFDB 2DUJA 3V2IA 2DETA 4NXMB 5I4BA 2VBGA 1ZRNA 1KMCA 1JJIA 1UIRA 4N65A 4XOIA 2BTOA 1EGVB 1QP4A 1JQAA 2YZ2A 4RSRA 1NR5A 4TOIA 3DZDA 3VH2A 4UKDA 4E15A 5H4HA 5TQ0A 5K0TA 1P61B 2JFWA 3OCUA 3SFVA 1SCQA 4J4BA 1NBAA 1IPFA 1D2EA 3HE3A 3JYHA 3UCEA 3UPTA 3TE7A 1VYUA 4KPYA 2E5WA 2HU5A 3UK6A 3IESA 5ICGA 3K1TA 2YV5A 1DKOA 1LK0A 3OCCA 3MGCA 4C0WA 1VL8A 3FNFA 3UTCA 1P7YA 4A1OA 4EMBA 1U6JA 4MVJF 4V3CA 1V1RB 4BN5A 4B5KA 5K6TA 4Z4EA 2BUCA 4QPJC 3GI1A 2FPWA 1YGYA 3P2IA 4IFIA 3VI4B 2ZUVA 2AQHA 3RNLA 4X3PA 3C1OA 1BS9A 4KUGA 3SVLA 4QPPA 4H31A 3M3DA 2RI6A 3EIXA 5A5VA 2DY1A 1M6NA 1F4PA 3K8QA 4FDVA 4FKZA 3JATB 1OLXB 2MHCA 1AMNA 2RGNC 3OE7D 3KOMA 3GVIA 1NX9A 1W6RA 3FD8A 3K31A 3KQOA 3DWFA 1UJ4A 3KZMA 4LZPA 5TR9A 1PZEA 3WRXC 2XV1A 2ZZKA 4RQUA 1REQB 4L3OA 4UM9D 4R83A 5E2AA 4TT8A 4JJEA 5D8DA 4TQUS 4EZIA 1OYOA 1RWVA 5L6MB 2FMXA 1WXQA 3KXDA 3NYRA 1U2GC 5ESDA 1FUUA 5M3BA 3SF8B 3INTA 4E1AA 3S2ZA 3UWOA 1ZMRA 2P65A 4DGQA 1U28C 3RAJA 4QRIA 3GUHA 1QYIA 4G4JA 3WLPA 1UFKA 2Q1WA 3SC6A 1PE0A 1Y3IA 4N39A 5A7HA 3K5HA 4TKMA 1TAGA 1ETUA 3HBJA 1DJOA 4HWKA 2OFPA 3MWDB 3DDNA 3LXXA 3AR7A 5KJFA 3DPUA 4M21A 5IVHA 3SJ7A 4CMIA 2ETVA 2QD1A 2M98A 2QI9C 2W6ID 1AV6A 1UPCA 3GBSA 4GYKA 3BWCA 3H6GA 4P08A 2GJ9A 2R5WA 3KVYA 3R8XA 3IQZA 5BV1A 2JGMA 2BJHA 3NOQA 1DO8A 2XZTA 3N2ZB 3DKVA 4MR8B 3VR3D 5HQ3A 1ZISA 3B48A 5LDDC 5DNYB 2R6ZA 3UJDA 1TE2A 2B21A 1LRJA 2ZQYA 1SCIA 2VJKA 4N18A 4FS3A 1SVUA 3ONDA 4WGFA 3O91A 4OQDA 1FS4A 1VL6A 3NONA 2P9FA 3OPYI 3W8NA 4CLRB 1ZIOA 2XYHA 5GOTA 1WQ3A 3H3JA 1CULC 3N8HA 4NI5A 3D4IA 3JYNA 3OU7A 4OO3A 2ZR9A 4HDMA 1LI5A 3P2JA 4BMOB 4QTXA 2DSTA 1EK1A 4Z8YA 3TNFA 3HWWA 1G7CA 2O1SA 4RCYA 5H9WA 3C8DA 4ZIRB 3M81A 4J2HA 1FMTA 4F9EA 2XAUA 3UO8B 2G09A 4Q4JB 3G5AA 3VPDA 3G3EA 3DKRA 2H1OA 4RIGA 4WN9A 1DUIA 1RXYA 3HFRA 3JAWB 4KREA 3SR4A 2W93A 3LT0A 2VJOA 1BEEA 4PR3A 4N3AA 2WFMA 3TUJC 1U0OC 4QEDA 3ZKAA 4JLUA 4ZK6A 1MVOA 4GYWA 1F7UA 4FFNA 3ABRB 1GVNB 1E9SA 3D8HA 1RRFA 4QLBA 3I34X 4N82A 2X2OA 1MO5A 2JDIA 5FIUA 4CQNA 1PJ3A 3RRJA 1TYBE 4QHSA 3BTOA 3ITNA 2SKDA 4NNPA 2B7CA 2EW1A 4LWQA 1CLUA 3F9RA 3GMIA 1BCSA 1Z5PA 1XEXB 3ISVA 2P2NA 3K53A 5KVQA 1NC1A 1RZ3A 1PFWA 1D4OA 4KEAA 3BE8A 5D87A 3U7IA 3IAXA 4RJLA 1OIVA 3ZCXA 1G19A 3E2MA 5EKUA 1KOFA 2A9JA 4MWTA 3PHIA 3R0VA 4YXFA 1QAOA 1ZINA 2A1UA 3U80A 1SBIA 3C3AA 3T5AA 1JQBA 1U8YA 2W0MA 3BTUA 2H6EA 4CKEB 2CHEA 1K0UA 5DLEA 4C01A 3V34A 4G8DA 5T4HA 1UQUA 3VR5H 4L2IB 5AK0A 1VJ0A 1NJ6A 2AKYA 2I62A 3K72B 5FI1B 1U5AA 4A9AA 3NLLA 2GCNA 3TIVA 3GLIB 4MLCA 2HIAA 5DO9A 3ZY6A 4BQIA 3KQUA 2O2JA 4AX8A 3DZKA 5KZMB 5TE9A 2H9YA 2WMYA 2B36A 3H2HA 2Y0DA 1KGSA 4MWGA 4MIEA 1TECE 4DIEA 3GZ4A 3WWCA 1H5UA 2BGMA 1MH9A 1TD9A 2CXHA 2P1DA 2CUNA 2G5PA 1HYGA 2XE7A 2QZ9A 2R8ZA 3NORA 3PJFA 4FFOA 1SCUB 3FNQA 5HF6A 5E3HA 5KQLA 1NG9A 2NUPB 4EWLA 1Q6YA 5HCNA 2R4UA 4Y9RA 3DVSX 1FUIA 3KBOA 2OTCA 2Y8EA 5IVIA 3TD9A 4ND8A 1TYDE 1PTKA 3PYXA 2IYSA 4WINA 3EGWA 3CEAA 4QAQA 4MTCA 5TRTA 3HYTA 2WUVA 4I9NA 1DV1A 1N2JA 3PGJA 2VIIA 1GNTA 1T9DA 3K09A 1NVUQ 2PUEA 3KK0A 4U4AA 2WMDA 3JD0A 1E98A 1PT9A 3I45A 4LYAA 3N0TA 1JVBA 2YZGA 1FMCA 3HYRA 4I55F 4RWEA 2ZE6A 3ZU5A 1ABBA 1A2OA 3NGXA 3RVJA 1CDEA 3U17A 2DAPA 1NE7A 3CN9A 5K3SA 3VNSA 4RDCA 4IQ0A 5IKOA 3MMXA 4WZZA 4K9SA 3WGHA 4F1KA 3PR2B 4CEJB 2C2MA 1NXSA 3LMKA 2W98A 2C2KA 1P2BA 5F7OA 1WUIS 2FK7A 1UJ5A 1CY8A 4NZZA 3CRW1 3LX6A 4FYKA 3M6FA 2AMVA 1FQWA 3WP1B 3SKYA 4AJ1A 1YDMA 3CURA 2V0GA 1M8PA 2FE1A 2VDKB 5AI0A 3ML1A 2XF2A 3HYSA 4IYRA 4BX0A 1Z6PA 4XLLA 1VP9A 1AKRA 3ZQJA 1L9KA 4CR6A 3IDQA 5L7WA 2ZBFA 1HO3A 5I9SA 3H0EA 2G71A 3E0XA 2B6HA 4J76A 1KWKA 1KFBB 5SYMA 4HGQA 4XDYA 2ORED 2Z5LA 4OAQA 3AIOA 5HBGA 1I5OA 1SZCA 2AZDA 2X2PA 4JL8A 8OHMA 4KGXA 2IPAB 2D1TA 2J9GA 1JEYA 1UL1X 7GPBA 3OOWA 4D9MA 2Z04A 1NNUA 5I7FA 3O4JA 1HNNA 4BEVA 1BQ4A 3OE1A 4QUIA 2G0TA 3F9CA 1IHUA 1XVUA 3Q9UA 4R8RA 4GL2A 2A88A 4A2WA 1Q44A 4KZPA 2VDPB 1XROA 4P38A 4IO0A 1L7DA 3OQPA 3TOCA 4BC1A 5AT1A 1JEAA 4CDRA 5BOSB 4MVWA 2CMFA 3VH1A 4GMXA 4V03A 2PHZA 1A3CA 4Q9NA 1NYTA 2E9SA 4S3MA 2ZJOA 1N4DA 2Z6VA 4NJEB 3DMTA 3QVKA 1V16A 1OAOC 4YRTA 5D3MB 5H0IA 1XL0A 1TRKA 6CHYA 5LMZA 2A7XA 1GPMA 5TQ2A 5JPDA 4E7PA 4MEJA 1TO1E 3PG5A 2UDPA 4BRZA 1FPQA 1QE3A 1XU7A 1QIFA 1O9BA 1G4AE 1U0SY 4JN6B 4CU5A 6ABPA 1JFFA 1A2QA 4X00A 3RS0A 1RPZA 4AVYA 3KDSE 5E1BA 2BHNA 2C83A 4RYLA 1KJNA 2Q6LA 4B6PA 1PR3A 2IKQA 4CWAA 2P5YA 4C0QC 1XEWX 3AUJB 5H82A 1K66A 5JALA 4CQMB 1DDOA 3BWVA 3CE6A 2P3QA 3GCDA 2BKXA 2WG1A 3TNJA 4JFAA 1UC8A 2EX0A 1YFZA 1TDJA 1V9LA 4IKOA 3WWOA 3O7MA 3OEYA 4BVFA 1N6IA 4ERNA 3E1GA 5JS1A 1G20A 1GCGA 3O26A 4O4JA 4X44A 2OWDA 4OMCA 2QHXA 3ECSA 3PICA 1M66A 4RZIA 1J8FA 4G24A 4IJ5A 3RQIA 1G6Q1 3P96A 1T2CA 1M73E 4PC3A 4CIBA 4BFYA 1YIAA 1S3FA 1DFIA 4BFVA 2ZRJA 3ON5A 2F3QA 3FMIA 2ZOSA 1HRDA 1L7NA 1U6KA 2QDKA 1KO8A 4QIHA 2W71A 1EDEA 1TMOA 4JDPA 4XQEA 5EIOA 3UT6A 5TEWA 5CLJA 3QX9A 2NO9A 3PHBE 1QO7A 3TINA 4F92B 1GGHA 2JI4A 3B78A 3VPSA 2Q62A 4OJQA 2YXDA 3GGSA 1ZD9A 1G9XA 2UZIR 3JVDA 5JAOA 5F7JA 2I2AA 1P80A 1CS0A 3LCMA 1T10A 2B2NA 1G98A 4PLHA 3VZSA 4YQFA 1M2WA 3ELWA 4F9TA 2C1ZA 4X24A 1ULUA 1T3LA 2K4MA 2IE0A 4N6GA 3N5CA 4MW1A 4DMGA 4YRNA 4ALJA 1RMQA 1CZHA 3GJRA 3QBVA 3UPDA 3ZHQA 3N3AC 5FI5A 4UVEA 5FR2A 4NFHA 1QZTA 3QTLA 3FZNA 1Z2AA 4KJXA 1E3IA 3AFHA 4D4GA 1N5OX 3W3AH 4X1IA 1GFSA 1INLA 1H4QA 1CZOA 3LHKA 2FG6C 3AEYA 5ESRA 4Q01A 5EHIA 1MDBA 2XPCA 3CXUA 5JY6A 3AUXA 5FWYB 3AERA 3FPGA 3OJEA 3GGOA 2CXNA 5IULC 4M8LA 1XELA 5U4XA 5K05A 4PYQA 5ALGA 1M6EX 1WUKS 5C37A 2VCEA 4RSMA 3TCKA 4Y6OA 1L5WA 4IINA 4M6WB 1WY7A 1QK5A 4E31A 1WXIA 2PKYX 1QSGA 2JJ2A 1WCIA 4D98A 5I4CA 2Q5CA 1TM2A 4DTIA 5B12A 4EYGA 5BUSA 1BC5A 2C5GA 4HDSB 1EFHA 1K7SN 2Z95A 5BWNA 4DV4B 1EPUA 2QU8A 1N2CA 3P2EA 4UOQA 4IIGA 2B7BA 2HF8A 1NZJA 2ZPAA 4JCCA 4P4SB 3V2HA 5GY7A 1E3WA 4K3VA 1SB8A 3GRCA 3DEZA 2CFCA 5LLDA 1WCYA 1FQJA 2X8JA 5JQWA 4XFJA 1GNLA 1X1SA 3DD1A 3MAGA 4ZOBA 2EFEB 1ECBA 1J0DA 2I65A 1VKHA 3H1BA 2WTBA 2ZZNA 2QRNA 5LQNA 2EHDA 2XMDA 4RXUA 1KEEB 4RKRA 4IWNA 3STWA 4R9NA 2VA9A 4E5NA 2BI7A 1SUEA 3WGJA 1RWKA 1R27A 3W1WA 2E4YA 4JLNA 1RIIA 3I6QA 3JPYA 4HAUA 2F8TA 4CL3A 5JARA 1WMBA 4HRAA 2GSDA 1XZQA 2YIMA 5B7NA 1QB8A 3TAHA 2V0CA 3IERA 1N0VC 5ALMA 3OFNA 3ZWBA 1PNTA 1N5KA 4H4DA 5B2EA 1SNYA 2JPDA 2ZB2A 3K8OE 5JH7F 4MV3A 1TGYA 3QJ5A 3H11A 4I5IA 3U7EB 5DHSA 5I7EA 2OR3A 1LPNA 2QE6A 3NTUA 5FTKA 5LCXA 4COKA 2ZYGA 2WYWA 3EWIA 4FBMA 2IXFA 3QITA 4QARA 1Y6FA 1GPWB 3LUAA 2VF7A 4MCAA 5K0JA 5CIWA 1HZZC 4MEBA 4BMZA 5AUOB 1F0YA 2JGEA 1U2TA 2FDXA 2C2ZA 4LRQA 1UBHS 2WU8A 5KNDA 1BQEA 2PKCA 2EF1A 4DXDA 4D99A 2KM1A 1T5IA 4ENWA 2R6GA 5L53A 1G2OA 4L6CA 3AG6A 3AL3A 4YAGA 3R9XB 2OHHA 4RK5A 4EMUA 4PQEA 5IVDA 2EYQA 4GVXA 1QKIA 1N8TA 2C29D 1U2DC 2QG4A 5CH3A 1FVFA 4YAWA 4ZAWA 5EPUA 5DCUA 3SF0A 3V7NA 2WMNB 4CT0A 2DERA 1IN1A 2QRQA 1D5CA 1KTIA 1JBKA 2J87A 2ONYA 4IF6A 4XDHA 5B4UA 3DDSA 1XYGA 2ZAYA 1T3GA 1XP8A 1Z7EA 4QGGA 2NZXA 3A14A 1EWYA 3P4UA 4LWPA 3T3IA 5HMMA 4FIDA 4H7JA 2QRZA 3G9XA 1RBZA 3JQAA 3KC2A 4BB9A 4EQ6B 5F23A 3PIRA 1J5EB 3JD4A 2G5TA 5I5GA 2QD5A 4MITA 1O1YA 2X5JO 3DBRA 4O4LF 5IJAA 5AM1A 2E6KA 4KLNA 3ST7A 5JJIA 1W29A 4TKZA 4MWZA 2PA0A 3D54D 5A03A 5LMCA 2FN8A 2UZ1A 4FDLA 2HFKA 3WSTA 4AJ9A 1FLDA 1QG0A 1SKAA 1Y9JA 2QQ0A 4FUQA 2FZCA 3G2OA 2BGJA 4TWBA 5HZKA 1IOWA 2ZVQX 1G21E 1TMYA 1XXHA 1SU6A 1JU3A 1T1JA 1Z74A 2J6BA 1U5BB 3G68A 4Q9AA 3MCAA 4Q1FA 3QVMA 4I14A 4EF6A 3ZD8A 4MVYA 1UOOA 1FUYB 2ODQA 2J6HA 3F9IA 4CFZA 1A9XA 1JSRA 2O3TA 3IEUA 4FB4A 1BH2A 3LSTA 4LA4A 4FB5A 1T3TA 5DM70 2RHCA 3RR2A 5IAKA 5JFGA 3W5HA 1EJ6A 2DLCX 1WZUA 3DCNA 1JDTA 4UJ5A 3C24A 3CPJB 5KYVA 1G20E 4B47A 2IX3A 1L1QA 4G23A 2Z8ZA 1IY2A 4AY5A 4TV9B 1D0VA 1XQXA 1D1SA 2ZI5A 3MK31 4Q9JA 1XX6A 2QN9A 3RS4A 1HBJA 3VPBA 4RIFA 1PR5A 4ZAZA 1SUWA 3ILSA 3W5JA 1UK6A 2N1MA 4CMBA 2XXAA 3FUXA 2KSQA 4FYPA 5EWJA 4LDPA 4YDQA 5NLLA 5JDIA 1GAJA 3PK0A 2V9CA 3B8EA 4Q0MA 3IO5A 2SKCA 4EHFA 4KHPB 2JS7A 3JARB 3W5BA 1NI4B 2M9MA 1UBFA 2P9HA 2WIKA 5FHRA 3HS3A 3M7IA 4NYMQ 3NHMA 4KBGA 1O7JA 1UWLA 3DO8A 3E22A 3RFTA 5JSZA 1WHSB 4TTJA 1NBMD 2Q3HA 4ZCLA 3VU8A 2O5CA 1KRHA 1U94A 2B98A 3OQBA 1RADA 2C4NA 3HK2A 4HLNA 5DCWA 1NMXA 4GSKA 1OFUA 3D7KA 4ZRMA 4RE6A 3WL7A 4NBSA 1MAUA 2I2XB 4CXMA 2GARA 2XCTB 1M8JA 1L4YA 3V1UA 1Y1TA 4AYWA 3M1YA 4HB4A 2OQVA 5IKEA 1ZA1A 3AI3A 1PGJA 3O31A 4R1MA 3C15C 3C3PA 1KS9A 3TQCA 3HJHA 4LGYA 4D4LA 3AW9A 3LDFA 3HCAA 2C77A 1ZA2A 4P22A 3NYIA 4OBWA 4R9SA 2P2GA 4Z0HO 5IDYA 4DIFA 2CFSA 4C2AA 3R5TA 4L4UA 4OU5A 4ISBA 5E6UA 1HEUA 3D8TA 5DEOA 1J0XO 1IC6A 1MQSA 2X13A 1V8DA 2N9UA 3FBWA 3VPCA 3L8FA 3EPPA 4IDHA 2I71A 3CF4G 4OHWA 1OV4A 3E58A 1SHJA 1W76A 2WICA 1R3UA 2GAFA 2PLAA 3MD9A 2HDWA 1DWUA 5CLQA 3TVDA 2FFQA 1PAUA 5G3ZA 1GVHA 2PV7A 4B83A 4NCXA 5GINE 1DC5A 1RMYA 3KX2A 4D97A 3RWMB 4EFKA 4W5QA 1EDBA 2QGNA 3GLHE 3IP6A 1N2CE 1CB7A 4HMOA 2BBOA 5H9VA 2N75A 2DJ5A 1ZW1A 4V3BA 4UUNA 3WBKA 1PLKA 3ZBTA 4UC0A 3D6AA 4MQ4A 3C5CA 2HR1A 3PHLA 2BPOA 3O4IA 3ND5A 2BHTA 2G7ZA 2ZI4A 3FPAA 2WZDA 2ZRDA 4PBTA 2JRLA 3CT4A 3KWLA 4I36A 3HKDB 4WCDA 1BMTA 1GL9B 1NSTA 3GRUA 1J5PA 4O59O 3H75A 3L0OA 4UCXA 2R2AA 2P68A 3PWKA 4OGKA 3TGWA 1TMGE 2Q0QA 3TPZA 1U1IA 4ZCRA 4HNQA 4M0CA 3PRHA 1RHRA 2A0YA 3A27A 2GUGA 4R8SA 3ZWAA 3L6DA 5TPWB 2XRMA 2OO3A 3U4QA 4WOKA 4GYJA 2V45A 1LSJA 5SZJA 3K4HA