2QUHA

Crystal structures of human tryptophanyl-trna synthetase in complex with trp
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
379
structure length
379
Chain Sequence
GIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Catalytic mechanism of the tryptophan activation reaction revealed by crystal structures of human tryptophanyl-tRNA synthetase in different enzymatic states
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Tryptophanyl-tRNA synthetase
total genus 146
structure length 379
sequence length 379
chains with identical sequence B
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2007-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00458 WHEP-TRS WHEP-TRS domain
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 2quhA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2quhA01
4JYZA 3CLRD 1BS2A 1M1ZA 1JIIA 3IOEA 3ZJVA 1Q19A 4MLPA 2QTNA 1M8KA 2AZXA 2HZ7A 1VLHA 4MVXA 3CLSC 3AG5A 5J5AA 1OWMA 3ZJUA 2DETA 2VTBB 2J5BA 1VBNA 1T6ZA 1JZQA 3HFJA 3IVXA 1QU3A 3AL0C 4L2IA 2QJOA 4K03A 1JGTA 1TYBE 1TQ8A 4UZEA 4F3RA 3L92A 1I6MA 4MUHA 4MW6A 2CSXA 4ZCQA 3L93A 1WXEA 1MB9A 2PXHA 3DV2A 5DB4A 4ZT4A 3VU8A 3FI0A 3ILVA 5LLTA 1WKBA 2Z08A 1EFVB 2DR2A 4DNXA 4L2IB 1TYAE 4MUFA 3PNYA 4EG7A 1OWLA 4R0NA 1M83A 2BTEA 1HYBA 4KPUA 1G8HA 3M5WA 2A1UB 1NUTA 3G5AA 4KR9A 4MUJA 3CVYA 4PBTA 1NUSA 1K97A 3ELBA 4J75A 3A05A 2A84A 2A86A 5H7XA 3H9BA 2TS1A 1X6VA 2VXOA 3CLRC 2G36A 1VL2A 1JECA 1GZUA 1JILA 1QRSA 1J1ZA 3TS1A 4F4HA 2CV0A 1PFWA 3QE4A 1N2BA 1XJQA 4DDKA 1IVSA 1KP3A 2Z3VA 3ZJTA 3GUZA 1KH3A 1JIJA 4OUDA 3CLSD 2R5WA 2XRZA 5DK4A 3NBKA 1QRTA 2PZBA 1N1DA 5KHAA 3TQIA 2CFOA 1DNPA 3DLAA 3IMGA 3TNJA 4R2MA 4P2BA 1H1TA 3UMVA 4CT0A 4ZCPA 3X1JA 4EG5A 3SZ3A 3HMQA 1WXHA 1GTRA 4FZJA 3P52A 4ZT6A 2QUJA 3FOCA 1H3EA 5K0SA 2DEUA 4MW7A 4EG8A 2H29A 1PG0A 1QQTA 4OUDB 4PBSA 3MMXA 4E1AA 4MUGA 4ZCSA 3CLTC 5HUJA 4X0EA 5FO1A 4DLPA 4MUNA 2ZP1A 5TEWA 3FH0A 3OP1A 5DASA 2QUKA 1WXFA 5IHXA 3IDFA 3NBAA 1V8FA 2A1UA 1I6LA 3HV0A 3KT3A 2A7XA 2QTRA 1WQ3A 4NZPA 2J09A 3RK0A 3UC5A 1Q77A 4NAUA 3JXEA 1TEZA 3H97A 3X1MA 4GRIA 3CA8A 2B7LA 4QRDA 2RE8A 3RK1A 2CT8A 2PG3A 1N2HA 3RHSA 4TS1A 3Q4GA 3FETA 1S4MA 3IODA 1Q11A 3CLUC 3CVXA 3S3TA 4DE5A 3MUEA 3DO8A 2QJFA 4MVWA 1IRXA 1EFPB 4XFJA 3A2KA 3P0HA 5TEVA 1OWOA 1K92A 2E89A 3ZXIA 1CT9A 3CR8A 1N2GA 2JA2A 2X1LA 3MLBA 3RBAA 1I2DA 1EUQA 1V47A 1U0BB 2J07A 3VRHA 3INNA 2VTBA 1MRZA 1G8GA 4MVCA 5H16A 1G59A 4NDAA 3IVCA 3ND6A 4MWDA 4YP6A 1J20A 1T6XA 3LOQA 1IQRA 1NSYA 4MW4A 1KORA 1FYDA 1NI5A 1YI8A 3K9WA 4MVYA 4ARCA 1KQPA 2J4DA 3CLTD 2H2AA 1KAQA 1F4LA 1A8HA 1MJHA 5JBNA 4MW5A 4WSOA 4MUIA 4CQNA 1N2IA 3COVA 3IUBA 1JHDA 4GU5A 3ZIUA 1OWNA 1MAWA 3CVVA 4MW2A 4JFAA 3IOCA 1YULA 1YUMA 3P0JA 3OTWA 1PFYA 1MB2A 1U3DA 2DERA 2A1TR 5IJXA 1PFUA 5KCMA 1H3FA 1OBCA 3PNVA 1YIAA 2CYBA 2EJCA 1JZSA 1GTSA 4CDNA 3FNRA 1ILEA 1FFYA 4I6GA 3KFLA 2PZAA 1VBMA 3ND5A 1N3LA 1EFPA 4AQ7A 2ZUEA 1ZH6A 4ND6A 2O8VA 2A88A 1JEDA 3IMCA 4PBRA 2PZ8A 5FO0A 3E27A 2O5RA 1N78A 1R6TA 4XSVA 1EJ2A 3MXTA 2ZUFA 4RPIA 5TS2A 3N8HA 4ZCTA 1VBKA 4A91A 1O97D 1I6KA 1U3CA 1WOYA 2DPLA 3F3MA 3TZEA 1O95C 2E0IA 1XNJA 1XNGA 1EUYA 1F9AA 2AG6A 4EFKA 4ND7A 3U1VA 2DUMA 2OQ2A 3DPIA 3LCJA 3ZGZA 1PG2A 1T9GS 3MLAA 4MULA 1NURA 3D6UA 3NV7A 4KKVA 3UK2A 3PNBA 3KT8A 3SYTA 3CVWA 1T6YA 4I6JA 1H3NA 4KR7A 4HK4A 1GPMA 1ULHA 1LI5A 2QJTA 4U63A 1LI7A 3IUEA 4WNYA 2I1LA 4U7JA 5KWVA 4NX2A 2PIDA 4HJXA 3QTTA 3QTBA 2A4MA 2JANA 1X8XA 4G5YA 4H3SA 4R2LA 3A4IA 3A04A 3COWA 4Q93A 4YBRA 5J59A 2X1MA 2C5SA 3GMIA 4DDMA 4I6EA 4EF6A 1JMVA 1M8FA 2J08A 2YXNA 2E21A 2Z09A 3ZUGA 3UY4A 1UFVA 3G6KA 1B6TA 3FY4A 4HPWA 1O94C 1OWPA 2HMAA 1COZA 3CLUD 3ND7A 3IMEA 1KH2A 3FWKA 4G5FA 4K0RA 1U7DA 2AKEA 1KKUA 3P0IA 1N2OA 4NATA 4KPUB 5K0TA 1N77A 3TQOA 1WXIA 5EKDA 5TGTA 3KT0A 1O97C 1KR2A 1J1UA 2WSIA 1WZ2A 1OD6A 1F7UA 4MW0A 1EE1A 2D54A 1P7PA 3N05A 1Q15A 1IH8A 2CYCA 3ISJA 4YP5A 1WJGA 2WQ7A 1ZJWA 1MC1A 1M8PA 3AIIA 4XFDA 1JIKA 1YUNA 1J09A 1O96B 3HL4A 2CV1A 1R6XA 1T9GR 5AHWA 4MW9A 3SEZA 2IP1A 5F23A 4ARIA 4EGAA 3AG6A 4MQ6A 1GN8A 1QU2A 4PY2A 1ZUNA 2X3FA 3HGMA 3Q10A 2CUZA 4ZT2A 4ZT5A 3IVGA 2GM3A 2QUIA 4HJRA 1KQNA 3FHJA 3GLVA 3ZXSA 3SZGA 3SEQA 2BYTA 1U7XA 3KT6A 2QUHA 3N9IA 1SURA 4OJMX 3UOWA 1IQ0A 1KH1A 1KP2A 2PFSA 4KR6A 4MWEA 1QJCA 1MOPA 3AFHA 4UZFA 2V0CA 4ZCRA 1Y42X 4YMIA 3SP1A 1YIDA 1O95D 2GKSA 1MBZA 2E18A 1O6BA 1N2EA 3FIUA 1O0BA 3K32A 5BNZA 1XNHA 1TYCA 2A1TS 3HZRA 1NUUA 1K4MA 3H9CA 1EXDA 3H99A 2EL7A 2CV2A 1K4KA 3AKZA 3RFFA 1O96A 4J76A 1KQOA 2OV4A 2JAXA 4DJAA 1EFVA 2WQ6A 1NUQA 4G6ZA 1KAMA 4MUKA 1QRUA 1O94D 3N2YA 2QTMA 1LW7A 4MUEA 3BL5A 2DXIA 1O5TA 1R6UA 1IQUA 1WY5A 2D13A 3CVUA 4JXZA 1MAUA 2WB2A 2DLCX 1D2RA 1IFXA 4ZT7A 4EG3A 2IJGX 3TZLA 3H05A 2X0KA 1J70A 5FNZA 1F7VA 3COZA 1IHOA 4DDHA 2YWBA 1QTQA 4NAHA 2RD2A 5DEOA 4QREA 1WXGA 4JZYA 3PXUA 1OBHA 2D5BA 2YY5A 4S1OA 5HUHA 1QNFA 2V0GA 3X1KA 5J58A 2NZ2A 3IH5A 3C8ZA 1M8GA 1NZJA 4EG1A 3FG9A 1GAXA 1JEEA 5LM3A 1WQ4A 4QBTA 1TFUA 1M8JA 4MW1A 4JXXA 3SDBA 4RUKA 1G8FA 4MWBA 2GOYA 2HGZA 2IELA 3FDXA 3IOBA 3PRHA 1TYDE 3I05A 3COYA 2CYAA 1NUPA 1PFVA 1RQGA 3G59A 1N2JA 4ZT3A 3VGJA 1GLNA 1NYLA 4Q16A 5HG0A 4MAFA 1J21A 2YWCA 4YP7A 4CDMA 2NSYA 4BWVA 1O0CA 4U8HA 4EG6A 2XRYA 1ZH0A 4EG4A 3RJZA 4MWCA 1N75A 1NP7A 3LE8A 3Q12A 5LFAA 3D6VA 4AS1A
chains in the Genus database with same CATH superfamily
3L04A 2XIJA 3LU1A 1LBTA 1JR6A 4XWWA 3CLRD 2R8RA 3H2YA 3EOBI 4ZOQI 3VH3A 1INLA 4RZQA 1XMQB 2AQKA 2QM0A 3BYZA 3I8SA 2I2CA 2J9ZB 3AETA 3MWFA 2OQRA 1QIDA 3B1KA 4Q21A 4QSMA 5AW6A 1GPUA 1HZJA 1V11B 2BEUA 1AY0A 2G4CA 1N25A 1TUIA 4LDQA 2EGHA 3PXDA 4BTLA 1JW9B 5JI3E 2HCFA 4IFBA 2DETA 1SVWA 4ZRDA 2DU8A 2Q50A 3TBFA 3OSUA 2WWHA 4OXIA 5IJ0A 4FILA 1OGJA 4LYJA 4YJKA 2QJOA 2PVCA 2Q8PA 4GPIB 1CQJA 3QZUA 4QDOA 1TQDA 4Q7LA 1X1DA 2CC2A 5FWDA 4F3RA 1KYXA 3OICA 4PRYA 1QIJA 2JJ8A 2BCGY 4UARA 1QLWA 4CMIB 1LNQA 4GR9A 5LZ7A 2FG6C 3DCYA 3OJXA 1JEAA 1M2OB 3QVXA 2IYPA 4FR2A 1GKIA 1SZCA 3QWBA 3PJRA 2RBGA 5A71A 4QUBA 4AURA 1JZTA 1SD2A 3HU5A 2COEA 1Q22A 4L9WA 4GC5A 2H1CA 2OLJA 3RREA 3X2SA 3ZU5A 5GQSA 4Q9IA 3DJYA 1GQQA 4YPVA 5DI3A 5JXGA 2D3TA 3BK7A 2AN1A 5AW0A 3DAHA 3GWGA 4BBPA 2IK8A 3L6BA 4NE2A 3AERB 1EUCB 4GEGA 2NMVA 3WLQA 3LFUA 5TF4A 2ZKIA 1RQRA 4PSUA 2EFHB 4FN5A 1DAFA 2B1QA 4LHZA 5FA6A 1L5HB 4KBFA 2FEKA 1A8SA 4P80A 4MRMA 1SCKA 4N54A 16PKA 4A23A 3ZDBA 4QGFA 3NJRA 3EULA 4L3OA 5LB2A 3D3WB 1Y8RB 2AQHA 1EVEA 4Y9RA 3WQSB 2IH4A 5KDLA 3SR4A 1EP2B 5DHQA 2C4NA 1OFHA 2FHPA 3B3AA 2BH9A 3L0PA 5ECGC 3ZJ5A 4CIAA 4AKIA 3WISA 1MC5A 2O6LA 3LNCA 3IGFA 2IVZA 3VPCA 4Y9TA 3TLAA 5JLJA 2X0NA 2OGZA 2PZKA 8ATCA 1I32A 3T7SA 1ADBA 3I9KA 2LW7A 1DRKA 3ETJA 4MEJA 4ZYTA 5CYPA 2JS7A 1RKUA 3FUCA 4UE3S 5HNKA 3NHYA 3SVTA 3DMYA 3I58A 2H16A 3O7WA 3O1IC 3ORYA 1Z3IX 2G0TA 1KVRA 5EHIA 3LA6A 3TSWA 1TEVA 1Z0FA 3GEEA 1O8CA 1VQ1A 4JCOA 1LDBA 3T4XA 4XX0A 4X7RA 3RJ5A 3VR2D 3TDKA 1RHMA 3AUKA 2HPAA 2OBFA 4MTCA 3FOCA 2FSFA 1QPZA 3KOYA 3QKTA 4MVJE 4UVEA 4EX7A 4DYHA 5EWLA 5C35A 1VIVA 2RB5A 3O4VA 4HDAA 2ZBRA 4MUGA 2JK0A 2J3JA 2V1XA 2FZ4A 1UBTS 2HK6A 5FWYB 1D9XA 3AF6A 5EERA 5JQGA 5TEWA 1BE8A 2XZPA 1T9KA 2H07A 2AEFA 4JP2A 4RFLA 4AICA 4DT1A 4FJ1A 1E2PA 3S2IA 2CEKA 1Y9JA 3KO8A 1OREA 5DGCA 1H8ED 1T8TA 2XCQA 4NZPA 2YC2C 3UC5A 4M7WA 3FDIA 4F5WA 4L5JA 4F8EA 1WZEA 1JQDA 3KZCA 2AZMA 4W82A 1QFSA 2OBMA 1SHZA 4G1FA 4Q66C 4BQRA 5SYMA 1KMQA 1MDBA 1TD1A 1JI0A 1SY7A 1V6CA 1S8FA 1Y7LA 2EQAA 2MU1A 4GMXA 3JWJA 2FXIA 5TPZD 1M34B 1NYRA 3RVJA 3AB7A 1MX1A 3W5DA 1QORA 3LOPA 1L7QA 1CV2A 5JCZA 2B34A 3B2NA 4I19A 4X45A 1TT5A 2JAOA 2G6TA 2J45A 1TZ2A 4V0ME 1ZNQO 2O3SA 4BCDA 3E4CA 1QO7A 3GEBA 2IBSA 3WGTA 2OK8A 5DNVA 3LUFA 1P33A 1E98A 4DANA 2V0NA 4QJ5A 3U49A 2VN8A 3DMGA 1HDCA 1CT9A 1K8ZB 3MPUA 3ZBTA 4BS9A 2CXXA 1A1SA 1FVFA 4Z54A 2X1LA 3VDNB 5ELLA 4YIHA 4JYAB 4GWGA 3JQCA 5BRAA 3KAKA 3IEMA 1KZGB 2A3RA 5HKLA 5C1PA 1QRDA 2VWGA 2R6R1 4YEDA 4DIUA 4MVCA 3NO4A 5IEBA 2OXEA 2RGYA 2MIIA 5DM2A 5A5FA 1NDHA 1BXRA 2ZI6A 4M22A 4JDPA 4ENPA 2HPVA 2V7VA 3BT7A 3KPVA 1IXKA 3DE6X 1MXFA 2YZNA 3H9JA 1R8YA 3RU7A 3QF4B 3NEPX 3VMMA 2IUUA 3VM6A 4MVYA 1PKXA 2HTEA 1IVYA 1KEZA 3ES9A 3WIVA 4TSRA 3WTBA 4XIIA 3WWOA 2BDEA 2CMKA 2VSOA 4JSRA 1PR1A 1SKQA 2CVZA 4YMSA 1NF2A 3FVTA 3NYIA 1QP0A 3NC1C 3QX7A 2DUNA 1FMLA 4EA8A 1W1UA 5K51A 1N2IA 5KQGA 1PL8A 4EKIA 3EZ9A 3TBKA 3WB2A 1D4ZA 2FGKA 2F59A 3PVSA 1RQNA 2ODTX 2C5BA 4L28A 1TJNA 2WJ6A 1WTCA 1ZGHA 3VYWA 1UBFA 1MAAA 2GYYA 2ZSFA 4FUTA 5F78A 3ZU3A 4QTYA 1HR0B 1FU8A 1BXGA 1AMOA 2XHZA 1II8A 1RM0A 1RW4A 3DM9B 2K6GA 1SHUX 1QBKC 2CBZA 3QH4A 4LXUA 4NVRA 4PX5A 4HN4B 4RF4A 2VT6A 3RUDA 5CVEA 1YIAA 2NSLA 1P6UA 2PT9A 3D6JA 4C5AA 3PT9A 4IRUB 3ZW8A 2C78A 3GDOA 4UJ5A 2XEXA 4LXIA 2FR8A 1LPAB 1OT3A 1SCAA 3DBHA 1G60A 2B36A 3U6BA 2HTFA 3HNOA 2FRVA 1QFZA 2JL1A 1MVOA 3KFLA 3WGLA 1QX3A 1V5FA 1RPTA 1BC5A 5G4KB 1QYRA 1IK6A 4D0GA 3BFVA 4POOA 5MDHA 3COJA 4JLOA 1QVWA 4BYMA 1W4BA 5LP1A 2P9QA 5KJCA 3EZ6A 2G63A 3L1KA 4V1CI 1UMDA 1RRVA 2HQRA 3GLTA 1I3CA 2A78A 2NU7B 2R8ZA 3EE6A 4AX8A 2PYIA 4QFCA 2GFHA 2ZT7A 5AICA 3JQEA 3ZHUA 4L1KA 5JOQA 3RIHA 5IVHA 1IUOA 3ICVA 2J1LA 5LQUA 3GLFB 1QYXA 2CKDA 1KGSA 3H8WA 3I6MA 3K4QA 2YN4A 4PFKA 4GHWA 2QQFA 2BCEA 5CB4B 4ZZ0A 3GD7A 3O4RA 1QIKA 1DKPA 3C2QA 4YUYA 3FLMA 1XQVA 4LRYA 4C0BA 2DBQA 4MULA 3KQPA 1LLDA 2P7IA 3IV7A 1NURA 3D6UA 3MCAA 1NRJB 3Q1KA 3P0RA 10MHA 1K7YA 1GUFA 2WA1A 1RLMA 4C0XA 5A62A 2KE5A 1GG8A 3E8XA 1C0PA 5G53C 4AZSA 4KN8A 4YRRA 1P2VA 4Z1OA 2QLFA 4WNYA 5KVCA 4PO9A 2I1LA 3N0TA 4PPNA 3LZ6A 2FRDC 4IZOA 1NTOA 3QHQA 4CXMA 4HJXA 4JT2A 3RT9A 3VNQA 3THWB 4NE9A 2ZRIA 2A4MA 1XK7A 1PWEA 1UBOS 3FB1A 3F67A 3OJ0A 1UBUS 1QAQA 3NIGB 1KNQA 1TCUA 5JD3A 2XYRA 3QWFA 2G7MC 4PWYA 3PHIA 3G0OA 4J2OA 2R00A 4UD6A 3SZRA 2QMHA 2WYWA 4ZC8A 4A4DA 3GMIA 5I8WA 3C24A 1NW5A 4D80A 1E1QD 2HDWA 4R54A 5EIOA 4W5WA 1XTJA 3SKYA 4HGRA 3FPCA 1DIAA 2V7QA 4PNHA 4DTCA 1T3LA 1EE9A 1N8KA 4RJ2A 3Q3GE 1FSGA 1VHQA 3DL4A 3GJQA 2C5LA 4FS8A 1AKRA 3LHSA 4DIKA 2WV9A 1JSZA 4FXOA 1COZA 1DWQA 1SK8A 1LRLA 3CLUD 1TZCA 3R09A 2XB4A 4GDMA 4HB2A 4JHXA 2XE4A 2YZ7A 3EODA 4G5FA 4UHKA 1OCEA 4IFTA 2XDQA 1BVHA 821PA 3IP6A 2WVAA 3OT1A 4UUNA 2HSEA 4XXHA 4NATA 4HDSB 3STXA 3IXLA 3TQOA 1PBTA 3PGVA 6GPBA 3AY3A 3VZCA 1E77A 1L7VC 2H5LA 4ABYA 1PJLA 3KT0A 1O97C 3KEQA 1UPBA 4HAWA 2G5GX 4P86A 2ZUVA 1K7XB 3R4VA 4FR5A 4N3CA 3S8EA 4BWYA 1XEXB 2VJKA 2QP9X 3DLBA 3B6EA 2D0IA 4WCDA 5IM4A 1IOWA 4LCBA 1OC2A 4CF7A 4KCGA 4YH1A 5EXXA 4KK4A 1E6WA 4IH4A 3ISJA 3GCWA 4JKIA 4TL8A 4BNMA 5LKRA 1J0AA 2WQ7A 3GLGE 5K8LA 4IILA 4XVRA 4AECA 2WZQA 1R4MA 2GZRA 2ICAA 3DCNA 3ZD9A 4CM8B 5ED4A 4DR2B 2I71A 4GI3A 3RSSA 2NP6A 3PKJA 1FEZA 1XRJA 2PSJA 2VLBA 3NHZA 5IDYA 2PMEA 4E5MA 3MERA 1BMDA 4GMGA 4ARZA 1VE9A 4K9KA 1PDWA 2IPLA 2PPVA 2RIPA 4G1BA 1V25A 2FZVA 2GZAA 4Z8YA 3Q10A 1IBLB 3CF4A 4B44A 1KI8A 2ZT8A 3NXKA 2D8MA 3OQ6A 1LCIA 5B1EA 3OFKA 2BH2A 2I66A 1AGNA 4MKIA 1WHSA 4MYDA 3ZWMA 4RK7A 3FFXA 4OMCA 3DNPA 5CT4A 1R4ZA 3ICOA 2R4TA 3C7AA 3HDQA 2V7WA 4B8WA 3KT6A 2QG6A 3V9PA 4Y9DA 2FP3A 2QENA 4CLOB 2XZLA 3H84A 5E9AA 1CUZA 1PR9A 2O1SA 4M76B 4HHEA 4Q4AA 1SG9A 2P35A 4ECAA 3NWJA 5D8DA 4WESB 3UMSA 2R62A 1NX9A 4TQAA 5TJHA 3EASA 4X1KA 1UJNA 3DTTA 5EJ7A 5IDQA 2OKCA 4FWIB 1MC4A 2YV1A 4PNPA 4FC6A 4QOSA 1XTSA 3MWGA 4TLBA 1NUUA 1ATIA 2QL9A 3C7KA 3L2OB 4YGYA 4U8GA 2ORYA 1CUYA 1Y8AA 2VUSA 2I29A 4UU1A 2BFWA 4X91A 3PSHA 5EWMB 1Z4NA 1YB5A 1PK7A 4EKNB 1GZSA 1FZQA 2P6OA 4ML3A 3T4UA 5HIJA 2CMHA 5JNLA 1FW6A 1TT5B 3BDAA 3YASA 4MJ7A 1E1DA 2IQ5A 2PUFA 1GTL1 4LJKA 1JEJA 1UP4A 2W70A 2PU5A 2R00C 2GNAA 1XL0A 1I7LA 4HOYA 1RPNA 1CJMA 1JKMA 3T7CA 2O0LA 2Z6AA 3THOA 4R84A 2J5XA 4FBGA 3AM1A 2J9RA 5BRJA 3GD5A 4XCVA 2MSCB 4LJ7A 4TYQA 3P1JA 4PIMA 5C51B 2KI5A 2QR3A 2DWPA 3FNQA 4KUEA 2IYVA 2IPMA 2PT5A 3RHZA 2QI9C 5FNZA 1W96A 4C5BA 3FTEA 3W5SA 2WWXA 3TG2A 2HF9A 3FPLA 2ETVA 4KN6A 4NFLA 4NPCA 1IHOA 3H2HA 1IWOA 4IJQA 5DOVA 3GRVA 1TTHA 3G8AA 2WNSA 5HRUA 3OQHA 3EX7C 1X94A 4CWAA 4I66A 4OQFA 5DTMA 4I99A 1TK9A 4F4IA 1DADA 1IOZA 3AHCA 3CPSA 1G3IA 1DIOB 1L5MA 2XX3A 3BMQA 4LJ4A 3CNEA 4QUDA 1NASA 4CQLB 1VMAA 1QO0A 5EE1A 3W79A 1ORHA 4FSHA 3WWEA 2NM0A 1TEXA 2WB4A 4R9VA 1T6NA 2D8AA 5DCWA 3WGVA 1Y6ZA 4CR8A 1BMFD 2AX4A 5ECDA 4O29A 4BRZA 4B7CA 1XEWX 1SUCA 1Z7YA 3Q88A 2IYFA 3Q9NA 4OCZA 5SZIA 4B34A 2PRZA 1PRYA 2QL6A 5E6SB 3NUQA 2P4HX 5B37A 2BSXA 2VDQB 3DQPA 2FA9A 2CNBA 1KIMA 1AS3A 1G3MA 3CMCO 3I23A 5EP1A 1VKOA 5ITVA 2O8NA 1X13A 2FPXA 3BE4A 3M5CA 4NC9A 1QLHA 5I7AA 3RUEA 2O2EA 3K9FC 4WGFA 4BV8A 1GNRA 4MDEA 2PNFA 4EBFA 5CDFE 3PRHA 5F52A 1FNSA 4BMCA 1ZGCA 3W7VA 4YRKA 4LVUA 2AMLA 2H8KA 4MOWA 4OATA 5K4HA 1VTKA 2XQIA 4FNMA 2WKRA 4K1XA 4YP1A 4ZAXA 4G97A 4C1NA 5B36A 2DUWA 521PA 1NUPA 1E64A 1P61B 3E9MA 3NDIA 3DLTA 3E03A 3MCZA 4O0LA 4D9JA 3CNLA 4UULA 4UXJA 5HCUA 2GLXA 4BKRA 4F3YA 4ZN6A 5E0KB 1Q20A 1GOTA 2JIBA 4Q1BA 2ZEJA 1MCZA 3Q3CA 4RC9A 4WA7A 4BVEA 2BC9A 4Z6KA 5GINE 4RM2A 5B7GA 1E9BA 1FBNA 3KKNA 1PZHA 1KZ6A 3KU1A 4YV2A 4U8HA 1CF4A 1ZPDA 3L8DA 3B6MA 2CJXA 4WCFA 4IX1A 3ONEA 1I4OA 2I6QA 3RJZA 1NTRA 2JIZA 4WZAE 1BD3A 4MHTA 2HJVA 3HUEA 3SXJA 1E1CB 3S81A 5CXSA 2DECA 4M8SA 2R7LA 3JX9A 3CY6A 1N34B 2PQMA 2VJMA 2IU3A 5SZKB 3VZQA 4RTNA 621PA 1MAVA 5JPIA 1FRNA 5K6TA 3ZWAA 4OK6A 3FSRA 3WKEA 4NECA 1R88A 3KOZA 3OX4A 1YB4A 2YZGA 4MLPA 4A7PA 3ZJYA 1ILWA 3PEYA 4UEWA 4IKEA 5KOYA 1BDIA 3R0JA 2ORIA 4XW2A 1B42A 1N7IA 1Y7TA 2EFGA 2FW9A 3OIFA 3AZOA 2WAXA 5AVKA 3IAS6 5DHTA 1T8PA 3O1HB 4MNTA 4YDSA 3ZEAA 4EJ2A 1WKCA 5IYZF 1IXZA 1FSFA 1WU8A 3VPHA 3L0CA 4BGIA 3KEOA 4PPFA 1X0XA 5D1NA 3ZWNA 4II2A 4AJ4A 3M2PA 3ROXA 1OB2A 1W5TA 3QPWA 3AL0C 3HY6A 1F5NA 1RJGA 2WMNB 1TQ8A 4FC7A 1M1NA 3GLIB 4X20A 3G0BA 4UHEA 5HFJA 5BVGA 1EK5A 3M1YA 2G67A 4HZUA 1JMYA 3C7CB 4EHAA 1G98A 2P4SA 5C4MA 2H00A 2BKUA 1B26A 3D0QA 4FMBB 2GJAA 3HCDA 4O1MA 5CRIA 5GJVC 1DWUA 4B5KA 1S0UA 2HBRA 2X5XA 5AOCA 4DG9A 3VJMA 3AONB 2DHQA 4HQKA 3O95A 1HDEA 2C88A 3K0KA 4TMXA 4Z9YA 2PWYA 4JSYA 5FI3A 3VUFA 1KDPA 4CKYA 2GVZC 3SGLA 4B82A 3UPUA 3OTHA 2O5CA 2CJWA 3KZMA 4DY6A 4G0VA 2IDMA 5FBLB 2RHTA 2ZATA 4NMWA 1W0JD 2WW8A 3VR5D 1MABB 4O0MA 1NQAO 4NEHB 3H9BA 4DN6A 3TJZA 4DQVA 4LFAB 1SPBS 1X6VA 4D44A 4BV9A 3MFQA 4DCNA 3GV0A 1E4YA 7MDHA 1Y82A 3BTOA 2BFOA 1TLLA 3W2GA 5I4IA 1WZUA 1X9IA 2KBEA 3MCTA 3CX7A 1JILA 1EM8A 3C8HA 1NN3A 4WY2A 5JO9A 3RAGA 4F71A 4ZEVA 3A9VA 2ZE6A 3LT2A 2JFFA 2X9LA 4R2JA 2CXQA 3F46A 3MCUA 1TOAA 3EBPA 3KSMA 5ALLA 5IFKA 2AOXA 4P34A 1NPTO 1YMVA 2W2VA 3GUZA 5C5CA 3OHMA 3I2KA 3AR6A 1H0KA 2IXTA 4OUDA 2ZYRA 3G9ZA 4E11A 4G0WA 2EJUA 5J2UF 1BDMA 1F51E 5DTJA 3I9MA 4Z3DA 5TGDA 3FTFA 2VWQA 2VDVE 4MA5A 1QRTA 2PZBA 3QVGA 2BMDA 1ZD4A 3NM6B 4XRRA 4GMHA 5KWIA 1JEQB 3F78A 1AV7A 1DNPA 1LLFA 2H11A 2QDXA 5ALZA 4R2MA 5B1DA 3ZZMA 4A8PA 3X1JA 1P29A 2EIHA 2OM2A 3N2ZB 4Q15A 5MFZA 2IY9A 1L7BA 3JQAB 4FZJA 1U5BA 5AKKA 4IV8A 4DC0A 2YNMC 3HUFA 3LPLA 3DMNA 4JASB 4YAWA 3BMNB 4DLYA 3KSAC 2BLLA 3KUCA 4G26A 1PEYA 2O1XA 3ND8A 1SOMA 5AW4A 2HMWA 5BUSA 1QPBA 2ZBEA 4R9SA 5FV7A 1H8HA 1IY1A 1HETA 4JQYA 3AFIA 1BO6A 3CLTC 2G88A 2PX2A 2OXIA 2NQ2C 4TMFA 1LF0A 2B78A 5DNEA 3UCEA 5I3CA 1YRWA 5FPPA 3WY9A 3KU4A 2WJYA 1J22A 1PJQA 1XAGA 3C85A 1QQBA 4MVJH 4ALIA 4AW9A 3BPSA 1E8DA 1WCWA 1I8TA 3HA3A 2X23A 4AROA 2VCEA 1IE3A 1QIFA 1E2FA 3GEIA 1YUBA 2GKGA 3RSOA 1FDTA 3JXEA 1ZM7A 3HRKA 3O94A 3H97A 3REQB 1TF2A 4EPTA 4JXJA 2OFWA 4L27A 3ZGYA 2CLFB 3RK1A 2APJA 2VOJA 1EDOA 3ADOA 3M6MD 4IAOA 3DDZX 4UTPA 3U13A 1ND6A 2TSYB 3C98A 1IPFA 3RANA 1VG9B 2ZIUB 2NG1A 4DHEA 5IN4A 4R81A 4WN9A 1CQZA 4L8WB 3TLKA 1UC8A 1KJQA 1PNVA 3D1LA 1RYFA 2FZLA 4CLDA 5IC4A 4C7OA 2G5PA 3PLNA 2O2CA 1D7AA 2O50A 4ZVMA 3QEKA 3M34A 4EYQA 2REQA 3VNVA 4JLBA 2JA2A 5AI5A 1ZGGA 5DBOA 3B8EA 4S35A 2A0FA 3VAYA 2IWHA 4JBYA 3B70A 5K3FB 2HM7A 1C4OA 1T5HX 1G59A 1XVIA 5F73A 3BQMB 5A1TA 3OHSX 1D6JA 4IDAA 3IHTA 1NP3A 3ND6A 2PS1A 4CU5A 2F1IA 5FLEX 1XT6A 2GEDA 4LAFA 4D9MA 4DMHA 2NTNA 4J0FA 4EKDA 4YMUA 5CCXA 3CCBA 3VJRA 2DZDA 5AVYA 1W85B 4DXHA 3GLFE 2H2FA 1T1SA 4HFRA 3BHIA 5HM8A 2I33A 3K9HA 1W36D 1CUVA 4R3NA 3DEHA 1QKJA 2KJQA 3COVA 3H2BA 4EW1A 5JMTA 5KYWB 1C4WA 2X2EA 3CEMA 4ER6A 3OTGA 3H1PA 4RV9A 1P5ZB 4X3CA 4ZOEA 1TO1E 3P9NA 5CP8A 2OZVA 2XVMA 1L5GB 3IQXA 4BC1A 2DT8A 4Q9DA 5E7QA 3SKXA 4M46A 1GAQA 1RI4A 4I9HA 5BV0A 1PFUA 4X6YA 5KWSA 1LU9A 4OFXA 4DVJA 3HCRA 3MB8A 4YJGA 2HNKA 5FRDA 5K3BA 5CPFA 1EFTA 2V55B 3ZCRA 1KDYA 2H31A 3MTIA 2UZAA 1JT9A 1N2ZA 3TX6A 4RXMA 3TIVA 3E58A 3MT0A 1GZVA 3PLAE 1JE1A 1J0XO 3OTOB 1GGKA 1BRMA 1CR6A 2OBNA 3QVKA 3EZGA 2BGWA 2QY6A 4GKBA 3TI9A 2YN2A 1BROA 3GT3A 2O0MA 1BWRA 3K5IA 3QPCA 3R40A 2WU8A 4HUJA 1PNTA 4FOOA 1ADFA 4M1WA 1JL3A 3QVOA 4MRSA 2IYEA 3QELA 4HRXA 4P84A 4R1OA 1R6TA 4RZXA 3RFTA 3HK2A 3ICEA 1N78A 1NT2A 1O08A 4G4IA 1F2TA 4Q1VA 3NNNA 2R84A 1Q0ZA 3SFVA 2R8OA 4FMPA 3LUKA 1PJZA 1U0EA 3P19A 4GXTA 1O87A 1U7UA 2PU7A 2J3MA 1XKLA 2V7TA 3S2FA 3CWCA 3MJTA 3ZV3A 1YB7A 4B09A 1KFJB 1NN1A 4H18A 4BJ3A 2AZDA 1Y4UA 3O5AA 4UHCA 1F9AA 4RO0A 4JP3A 4KDCA 2XBMA 1MQSA 2DUMA 4F06A 4TTSA 5EESA 2WA2A 3ZGZA 3MN1A 1PG2A 3MQ4A 5F1YA 5FCDA 5JJIA 3QVTA 1WMSA 4H7IA 2HJRA 2QVYX 4QO7A 4E21A 4ZO8A 2W11A 2PRYA 4HK4A 2PXXA 5FPSA 3VPGA 5H83A 4BNDA 2E6KA 1EHCA 2FUCA 1LI7A 4TSFD 3CPHA 2V4MA 3WLIA 3BHNA 1O89A 3UYKA 2TYSB 3QPAA 4RD2A 3MS2A 3I6YA 2I0FA 2XUFA 2WD7B 1W9HA 3GVHA 3VDRA 4NXNB 1E7WA 4R2LA 3KQOA 1YHNA 3LYLA 3PIIA 3QEBZ 5F9HA 3IDZA 3DOJA 2R9VA 2CHUA 1R3UA 1D5CA 3FFAA 1V45E 4ONEA 3W9UA 5AJZA 2MMGA 1URPA 1BJKA 3HN2A 4D3SA 1OLOA 2NVOA 1N6PA 3SQDA 5TR9A 4K8OA 2W6ID 2J0UA 5LWHA 4C4XA 2P4UA 1UFVA 2ZKLA 4UTVA 4HS4A 3LVQE 1P2FA 2BRUA 1JWBB 5LZ5A 1DBIA 1OYVA 1HG1A 3IMEA 1XF9A 3AP1A 3BE5A 1MRSA 1N1GA 1XELA 3EGWA 4EHLA 4B4UA 4AX4A 2Y1KA 5IKXA 3VV3A 3WK6A 2RAUA 9ABPA 1TM4E 4Q3LA 2AG5A 5CM8B 1JB9A 3QOXA 5IVKA 2GQ0A 4OHKA 2QSYA 4CTMA 5TGTA 5AUPB 4A6XA 2QW1A 1OX5A 3VKFA 4FKBA 4ZOLA 3S5UA 5HK8A 1GG9A 5CR9A 2JA1A 5HIMA 1VFPA 1F7UA 1WZ2A 4N39A 4AJLA 2B25A 3IAAA 5B5SA 2C77A 2JEOA 2R751 2YV4A 3S29A 3ZLUA 3A3KA 1CUFA 1RD4A 1G17A 3FR7A 2JBHA 3N3AC 4GPAA 5AK4A 4EDHA 1KAOA 4ZJZA 4RU1A 2VT7A 3E9RA 3E9EA 1D2EA 1SXJE 3S7ZA 3S0JA 1Z0ZA 1N36B 4OHUA 4Y6OA 4HEHA 5DSTA 3W6OA 2ANBA 3WA6A 4E46A 4PLCA 3ENNA 1R66A 3V4ZA 1YL7A 1WZIA 4HSGA 4QGBA 3WMRA 4HI0E 3IELA 3ODGA 3J80A 1NONA 4Q9LA 8ADHA 1NI4A 5T8KA 1TPYA 1OXTA 3A0UA 3WMGA 2R6ZA 4Q37A 4ESHA 4WK0B 4UNSA 5F5XA 3AR9A 3T1OA 4BWFB 4KHPB 3PI7A 1WP9A 3IKLA 3D7RA 3HGMA 4CL2A 1ABEA 2V97A 2GBPA 4PXSA 3RS5A 4DV6B 1H2AS 3A9WA 3R2JA 3ZBPA 2VHCA 4PC6A 2PD4A 1DZIA 2RHHA 3EFEA 1Y34E 4R1NA 1FYFA 3ZLVA 1D0VA 2O0HA 1FBTA 4UEKA 4CCYA 2ATVA 2ZIXB 3DBRA 4FN4A 3V8RA 2BYTA 2VAPA 5DW3A 4WZ6A 1TTPB 2HDOA 3LT4A 3TCNA 2NSJA 2CHEA 4YMLA 5LC1A 4PZCA 5AOBA 1IQ0A 4XYBA 4PIVA 4F6RB 4AJKA 2JIPA 2W6NA 3FCYA 4CF6A 1QJCA 2FFAA 2EX0A 2GBGA 1SVUA 3KHKA 4M9UA 2R5NA 1FFAA 4PYQA 3FHOA 4TX1A 1Y42X 3DZBA 1K66A 1KGDA 4J1SA 4YMIA 3I92A 4OLFA 3LRXA 3P32A 3Q6NA 3UGTA 3WQQA 4BLPA 4Q9KA 4D9NA 4DUZB 1TTTA 1ZD5A 3QA9A 5EZYF 2QN8A 3O8OA 1HEUA 3PGA1 2FCAA 4WBXC 3VC7A 3D7NA 1P1FA 3P9PA 1RACA 4XYGA 5BNZA 3UJNA 4NZOA 1JKJA 4NQZA 1GD1O 1VZ3A 4AS3A 4HD8A 3SS9X 3KJEA 3L7IA 3UMFA 2XGOA 2O57A 1ZHFA 4NICA 5LYJB 3MF4A 1B00A 3Q7EA 4GIBA 4PGGA 1RXYA 1MJNA 1S8AA 3D4PA 1WBJB 1SUDA 4LE0A 4ND1A 1TX4B 2G9NA 2Z6UA 1CRPA 1UKCA 1H94A 3QMPA 2IYRA 3UB3A 2IS2A 4I8XA 1P75A 2F3PA 3AOGA 3PRYA 3PQDA 1P5FA 2E9SA 1O94D 3FCEA 1NVWQ 1CDEA 1TKAA 4MZDA 1U90A 4Y6GB 1OT5A 3ZWOA 2ONJA 3N2YA 1IZ7A 3B5IA 2AMVA 3I9V6 2VTEA 1AZSC 5JROA 2WP0A 2KX7A 3GLHE 2MR6A 1ESCA 4I46A 4AKEA 4X1YA 4HWOA 1AC5A 1FFGA 1HH4A 1PSWA 5EWMA 3CKMA 1ZNYA 2JEYA 1O6CA 2IEIA 4MEBA 3SEAA 1Y9DA 3TZLA 1XQXA 3JTMA 1BJTA 2VG8A 3ROTA 2C92A 3ZNPA 1APBA 2VTDA 3LGSA 4EARA 4UM9B 3IPCA 1SXGA 2OUKA 4DLUA 4HFNA 2PKCA 1A5TA 1T0HB 2K4MA 3L6DA 4HWKA 3A37A 3EEIA 2QRPA 2QRVA 2VJCA 4LNUA 4PLZA 1WXGA 4JZYA 5EZYA 1J42A 3PXUA 1UPXA 1P39A 2H17A 1AUPA 3DUWA 1JSCA 1V41E 2O52A 4DC9A 3K9BA 2QSJA 3D2AA 4JP8A 3L06A 3TFQA 4ZREA 4F5YA 4MV0A 4I9GA 1T2FA 2IC5A 3M82A 4TN1A 5AJHA 4UDXX 1P8AA 1XWWA 5DYNA 1KO8A 2H2IA 2I7TA 4ZZ1A 3MCVA 1RR6A 5F2EA 4A27A 4BVLA 4H77A 3JD1A 2HMTA 4C7VA 1KEWA 5FYDA 3OOEA 5GZ1A 2QRJA 2HWXA 4NYMQ 4D4MA 1NMYA 1Y4DE 1JQ3A 3PC2A 4X6UA 3I42A 6REQA 4OO3A 1WMBA 1R16A 1YAJA 2JFBA 2EFEB 1I4LD 3HA5A 3BS4A 3W6ZA 3KZXA 3PCRB 4KYTA 2ZUDA 4FWBA 1FS4A 1YCDA 3B12A 2Z2ZA 3FDXA 3A36A 2F1KA 2X15A 1MN6A 2XNSA 2JIDA 1ETUA 2OZKA 2YXDA 3IEPA 1CETA 4M9RA 3DEAA 4JC0A 3VX3A 3C1OA 3ZE0B 3PFFA 2A33A 3AFMA 1ZX1A 4A2CA 5F7OA 4F2GA 5MN6A 2J0QA 1FL9A 3E3MA 2H4ZA 4KYVA 4YUWA 3PC6A 1EU1A 1L2TA 3AILA 3BSYA 4ZT3A 3T12A 1DIGA 1DL5A 1HT0A 2RH8A 3Q0TA 1AKQA 3JZFA 1P6XA 1BOOA 1G20B 1AKTA 3NVMB 2QG9A 4QYIA 4HNSA 3NQ41 5I48A 3D1JA 1S1CA 1XEWY 5D5HA 2QQGA 3LSTA 1SAYA 1UC9A 3FAZA 3P2OA 5B6JA 1QCCA 4E1BA 1CXZA 1H1LB 1YGPA 2D2VA 2WJVA 4HZIA 4ZAFA 3UV3A 1TGVA 4V24A 3HEAA 4D5GA 4RTOA 4E4RA 3Q3HA 5J2UB 3L7DA 4U00A 2H7CA 2F2TA 5CIYA 1RP1A 3LDHA 2I4OA 2J46A 2W4IA 2Z98A 1XVAA 2F1RA 1ZESA 2OCLA 2JI7A 1ZKDA 2FR8C 3D1VA 1QQ6A 4HCJA 1VLHA 2VHZA 4DQUA 3M8KA 4LJ5A 4CM3A 4ZKDA 5BSGA 2NXWA 1TYEB 4L78A 5ERGB 1NPYA 3D8TA 1ODFA 1S02A 3DJFA 3VU0A 1W5FA 1OH6A 4TOIA 1WEKA 2G5CA 5H9WA 4D0NA 1TU4A 4W7HA 4DV3B 4B6QA 1YJ8A 2VZ0A 2LXNA 3U37A 3WLSA 4CLHA 2IV3A 4XQCA 2CGEA 1GGEA 3GW8A 1GTMA 4RV4A 4A0RA 1U3UA 4AF8A 1N3YA 1D9ZA 1RRMA 3MWJA 3ECAA 3CKLA 5HHTA 1IBRA 2JJ2D 3OETA 1XTPA 1JDUA 1Y98A 1W29A 3HXKA 3V8BA 2GM4A 2VA9A 4CMGA 4EYOA 4YV7A 1NLUA 1YA6A 3JALB 2Q5QA 2CSXA 4N5LA 1ZDMA 3V1MA 4E2YA 4ZYYA 4P22A 1MT3A 3RVSA 4L0DA 4BB9A 2PJUA 4IIVA 3RRXA 1PEDA 2C2WA 3GBPA 2LTAA 3DDWA 4V3CA 4TQUS 3G0GA 1WKBA 5ICFA 1PGNA 1ADGA 1VBFA 4CMHA 3JVDA 5ALXA 2VYVA 4BB6A 3V7UA 4YRGA 1GU0A 3K0CA 4EYSA 3PC4A 3QY9A 4KJZA 1UMCB 5C1OA 1W36B 2CUNA 3KOOA 2M98A 3WWPA 5KYKA 3WL8A 4AYWA 5IPFA 1FP6A 3T3NA 4ZICA 5FTJA 4F11A 1QZTA 1L7OA 2EKBA 1ZCJA 1C8KA 2F3RA 2GVDC 2OCYC 2W2XA 3PX3A 3JARA 3AUSA 1E9VA 2P62A 2QWXA 4MIKA 2OECA 3SF8B 1U4SA 3E18A 4ZOAA 1KEKA 4KXFB 2BGKA 3HBLA 2QEQA 4ESVA 3G8CA 1XTVA 2HQBA 3DL2A 1N33B 2MR5A 2XQVA 1YS1X 1E2GA 2Y3IA 4DV5B 3MUNA 4JI7B 2VPPA 2HIHA 4F60A 1IVSA 3IILA 2H7XA 3K1AB 1M72A 3QKUA 1RZ3A 3RC3A 1X2BA 1Z7GA 1P6QA 1RXCA 4U2KA 3WA7A 1K8YB 2IXGA 5JDIA 5IEJA 5L3SB 4EVQA 2FPRA 1KK0A 3SX0A 1N92A 2DQYA 2WJGA 1BDHA 5IZ4A 2QTWB 4NSNA 4DNOA 3THYB 3VJLA 3TW8A 5HKBA 2I7CA 5ITWA 2BGRA 3LF1A 4ZCPA 8MHTA 2PE5A 2FMKA 4V2UA 5B58T 1OX4A 2KS6A 1PVVA 2MSDB 2XR1A 3P52A 4IJVA 1W94A 1HNXB 1S2GA 4K86A 1DIRA 4UDNA 5CA0B 2IUFA 3I1FA 2DEUA 4TPKA 3NDRA 1P0FA 4OUDB 1I6WA 1PQUA 3T3DA 1O58A 2BE7A 2HJGA 1X7GA 3C0KA 2ASEA 1EWRA 2QRHA 4GLOA 5MGBA 3TKAA 3HJFA 1U8AA 4NZYA 3F6EX 5B6IA 5K6RA 3GRFA 2DBRA 5GONB 3L6RA 5KYYA 4DR4B 2ZQYA 1OLUB 3CEHA 4EKEA 2I03A 2QTRA 3JQAA 2OG2A 4N12A 1BVRA 4FWTA 1RMYA 1C0EA 2XOEA 1MH9A 3HQ4O 3DE2X 2FZWA 4OJKA 4NG5A 1D2NA 4P38A 1UF9A 1XZ8A 2KWIA 3BWEA 2CVHA 3FGZA 5MN4A 1GEEA 5T57A 3VSDA 4BX0A 2ERCA 3L4JA 2FPUA 4OP3A 4ZYXA 2PUBA 3D3JA 4H1TA 1D7OA 1Q91A 3SNHA 1PZEA 3D0RA 1XO1A 1FPMA 2QTZA 2GM5A 5K3DA 4DE5A 1KERA 3CUTA 3TOVA 4NBNA 1RABA 4LXQA 1EFPB 4I55A 4JELA 3EGCA 2ZTVA 5COAA 3SICE 1DZ3A 3A1FA 1DBPA 2BBOA 3IS3A 4IDHA 2ZB3A 3SFZA 1W36C 1RHUA 5H4GA 1YQ9A 1K8RA 1VIMA 3HVUA 1TUBA 4OXYA 5KYUB 3R0QA 1FVOA 3FDZB 2WPDD 4HTAA 2XTMA 3ZLJA 2RH5A 1CKEA 3WR5A 1YVUA 2H1RA 3QUBA 1QSGA 5KEIA 4MR7B 3QLJA 4F72A 2J33A 3H9EO 5DCUA 2GN1A 1W6RA 4NDAA 2DLDA 1E0SA 3GX1A 1W4RA 4O4HF 2DHRA 2XYVA 2BZ1A 3LUDA 4FFDA 1XD2A 3GFGA 4M60A 1BQ3A 2VP9A 1S01A 2QGZA 3E3AA 1QHYA 1ZMTA 1U1CA 4K9RA 1E2JA 1L9KA 3ANXA 1KEEB 2RKOA 4XSHA 1CQIA 2Z43A 1U11A 1ZM9A 3CG4A 4RX1A 5CIWA 4E2ZA 3ER8A 5C1IA 4H7PA 4CL3A 2IOHA 2QRKA 4DLXA 3L05A 3JZAA 2VF5X 2FWJA 3ZIUA 1TUEA 3A4MA 3FKSA 3HSSA 4JX8A 3EVAA 1EIZA 5EXPA 5KTTA 3GK3A 4C5CA 5AVSA 4R0MA 5CH3A 5CDSA 1ZFNA 3W1EA 5HZKA 1EZ4A 1MEEA 4KV9A 2FFJA 1OROA 1PFYA 2R6HA 1GN9A 3GPCA 1MA0A 2X4DA 4M83A 4I81A 4LQLA 4QRIA 4WNAA 3RC9A 1AV6A 3ZIAD 2OQIA 2BR3A 4QPDA 1D2HA 2PH5A 3DTVB 1CY1A 1VFNA 5DW0A 4F3KA 1NC3A 2WTAA 1UEJA 1P5JA 3HB5X 2EFJA 2B1JA 3P5BA 4YALA 4QM6A 4XZ3A 2NTYC 5EE3A 2DFDA 2W2KA 4MRRA 4DLKA 5JG7A 4WECA 4CLXA 3BK1A 3F8WA 2ZSHA 3H17A 3I4LA 1DRJA 1SVKA 2A35A 2HUNA 2XTAA 2XITA 4LYEA 2XNKA 4CIWA 1NXSA 5INTA 1E6LA 2A88A 3IPAA 4YRMA 1PGOA 2IXBA 3RUIA 4PBRA 2O8DA 1F6WA 3DE7X 4JJZA 3TTXA 2BWJA 4UUBA 4CF4A 4K6OA 2C4MA 3U80A 1U1DA 1DUSA 2D0PB 4HUQA 2Z8ZA 3ZYZA 1GLVA 5I4KA 2XPCA 5IFLA 4CGZA 2CJYA 4ZARA 1QOPB 1QH1B 5I7HA 1NVTA 3STVA 3VGPA 2GCOB 4J4TA 2QV0A 4Z4QA 4F7DA 3G2HA 3PQCA 3NHJA 5I45A 3I8XA 2IOFK 2AG6A 2YS6A 3ED1A 3LS2A 2I3ZA 2IYLD 3JWGA 3RYIA 4HUTA 1L4FA 2RAPA 2QI9F 3DPIA 1T9GS 3MLAA 4CLRB 3WKDA 4UM9D 2BW0A 5HJ5A 3LDGA 1GCGA 3V8MA 1I10A 2FFQA 1Z16A 2Z4TA 2W7TA 3ZE2B 4DW8A 4EZEA 2YXPX 3OZFA 4U63A 5FOQA 2OZLB 9LDBA 2PH1A 3LJKA 3R9XB 1AF7A 4FFBB 3BD7A 1EK0A 1GQYA 1BHQ1 2G5TA 1XAIA 2PEZA 1ELOA 2REOA 4INOA 4RMJA 4DCJA 2W6JA 5IKPA 2O07A 3U3MA 1NU6A 1NWHA 4H3HB 5JMOA 1JBKA 2ZJ0A 5LYJF 1KA9H 2X9GA 1Q83A 3LBHA 1WQ1R 5CYOA 4YBRA 4UJ3A 4EAQA 5MN5A 1Z4KA 2K7ZA 1L5ZA 3IP1A 3B6IA 1NYTA 3SR0A 5HGXA 4A92A 1CIVA 4Y1RA 2PUDA 2EWVA 1J9ZA 1XE3A 1D1TA 4ABTA 4RELA 3GL9A 5ALDA 2E21A 3HL0A 1OU0A 4JR0A 1YS6A 1LWOA 4YI3A 1JEOA 4LGCA 3GJ0A 3LPMA 4X71A 1TA4A 3ZBQA 1DQSA 3V7WA 3NLLA 4YRBA 5BUZA 4KQFA 2C7RA 2IKQA 2KBFA 1EWYA 4M9XA 3VR1A 1CUJA 3DFUA 2PJZA 3OU6A 1E5LA 1ADYA 5EIFA 3CONA 1QIIA 5BQ3A 3G79A 1ODLA 3NRCA 1U2GC 2WRZA 3PUXA 4PE5B 4UPDA 2IEAA 3F5SA 3REGA 1NQUA 4RZIA 2W2LA 3DB2A 1KR2A 1XZGA 4L5CA 1Z17A 2LCIA 3K1ZA 2ZJ6A 1EE1A 2WWGA 3DD5A 2W83A 2GI4A 2WICA 5HBGA 2Q2VA 2X4GA 2VZ8A 3PKIA 3EDOA 1Z74A 2P6PA 3TSYA 5I7FA 2SKDA 1WBDA 1DRWA 1WJGA 1DARA 3LPNA 4AU1A 1IB0A 1YXMA 4RVFA 4ZIRB 4MXDA 1M8PA 1FJXA 4UEQA 4I8IA 2XRFA 3AKDA 1CC1S 1ONBA 3THRA 2WHEA 1PS9A 2AC4A 1XLVA 3GGDA 4GOXA 4P1ZA 3AG6A 1Z4PX 4IIJF 3E81A 3VR6H 4EYGA 1CS0A 1B43A 1WD7A 2WUWE 1G6HA 4C2TA 2I2WA 4ZZ3A 2C7GA 4RSHA 2EEZA 4ZT2A 1OZGA 2VQEB 4Z1MA 2VRWA 3EUEA 3MJHA 4L15A 2IA5A 1WW8A 4DSZA 2W4MA 3A4NA 1JDNA 1R0CA 2PKQP 2R11A 4KXXA 2D0DA 4YCBA 4IPTA 4IOJA 2QLTA 5KQRA 1N5JA 3MINA 4Z7JA 1JFLA 1Z5NA 1E4OA 5JDCA 1HL3A 3WTCA 1JHXA 4Q03A 3OAAD 4DJ5X 2VHWA 5LOVB 3HA7A 5JVDA 5EMKA 2BDUA 3VR4A 3VBEA 3FHTA 4QTZA 4XASA 1XV5A 4GEKA 1PGJA 1LPBB 2A14A 4K7JA 4LNAA 2FZKA 1L7RA 3HKDB 3E5HA 5BSKA 2GKSA 2AQ8A 2WU4A 2FLWA 1O6BA 1GFSA 5EJ6A 3E8SA 3H8VA 4C6HA 3TVYA 4L73A 1JDVA 2OD9A 2MDTA 1P91A 1XRMA 2JI6A 2WF8A 3KIPA 1WB6A 5ESWA 2QYHA 3F7NA 3TWOA 1M2OA 5PGMA 2Z8XA 1AIPA 1RYZA 2A5JA 4EYKA 3ZOKA 4EF4A 1PV1A 3AV0B 4YPFA 4N0QA 3OZTA 2XVXA 5DHUA 2Y0DA 4D8WA 1QV7A 4Q4HA 2BE9A 3HCPA 2ZJFA 2PX4A 2ZZKA 4G6ZA 4GGOA 5TS3A 4XWOA 1EGHA 3ZEIA 3K5HA 1Q1AA 1Y7PA 3NMUF 1GAWA 3Q5DA 3CZMA 4ZU6X 4Z49A 5EJMA 4ZZIA 2CHQA 1O7JA 1WZNA 2HLHA 2QZ9A 4BMYA 4BPRA 5K01A 1Z0SA 4L95C 4MPPA 1WMEA 2C2GA 4JL8A 2FWPA 4GYKA 1W9MA 2IZ5A 1Q7EA 3L5OA 2RHBA 5KYUA 4E2XA 4EG3A 4NBSA 4PX2A 5CX1A 1MV5A 2Z58A 1EAYA 2Q3CA 1LPSA 1T8WA 1VDMA 3RLIA 3ZZ0A 3W1VA 5EA2A 1G19A 4XR9A 9ATCA 3A0RB 3GG2A 5KC9A 3D3QA 2FJ0A 2ACEA 3JVUA 4J0IA 1QAMA 1IWPB 3HCWA 5AW7A 3T0GA 3GNLA 3TB6A 2ZGVA 2NTJA 3OOJA 1DQRA 2HA7A 2YVLA 4FBLA 4FXPA 1J7JA 1H0SA 5LXTF 2I3DA 2ETXA 3MT7A 1L8XA 2IYXA 4MGEA 5JANA 3UICA 4WKCA 3IBGA 3JD4A 1CDZA 3R9WA 4FDMA 4LBZA 2XCOA 1E6UA 2DUJA 1SCUA 3F6RA 4HLNA 3K8ZA 3NP7A 4WZBB 5EN4A 4D4JA 2EWWA 1KI1A 2CVOA 2ZRMA 2YY7A 3FDZA 4I1UA 4BASA 4R2HA 3QSYA 4TUYF 3TJMA 3N0XA 1U2PA 3FNEA 3HCFA 1UJCA 3SYLA 2FMHA 1LLCA 4YJ3A 3JWIA 1I3KA 5J1TB 5BW4A 3EPJA 3SDBA 2VPYA 3WMXA 4GSYA 3V33A 3WYAA 4B3GA 1U7TA 2JKYA 1K8QA 4J0CA 2OORC 3TUJC 3WGIA 1HT2E 4RCZA 3O9ZA 5ALHA 3G9QA 1O95A 3DH0A 5JADA 1AHHA 2BTOA 4BC0A 1KWKA 2O06A 1H0HA 2BN4A 4X3PA 1T34A 4O33A 3P2YA 3HBJA 4O6VA 1COWD 4JYMA 4N0PA 1DEAA 3ZHBA 3E2MA 4FR0A 4N0DA 4N6OA 5ALKA 4E88A 5LMCA 1RWPA 2YFHA 1AKNA 1WRBA 1ZOLA 3UUGA 4BVAA 1W35A 1NJGA 1NMQA 2O3RA 2XCLA 2OLEA 4B3TB 2OXCA 2O8BB 3ZVLA 4DQLA 2QSZA 1J21A 5EKXA 2WTBA 4RIIA 5G40A 4C0WA 4P7BA 5LJIA 2W2OA 3MGBA 3VKHA 2ID7A 4NYJQ 2AF3C 3M70A 4GPTA 1NVKA 2FU5C 4LS3A 1ZH0A 4UW9A 5BOSB 1I2AA 1M7HA 4MWCA 2JBWA 3PR2B 1X7WB 3FZGA 2PGAA 4Q3KA 2QN6A 2UKDA 1VOTA 3N2GB 4X00A 3ZC3A 2CUKA 2X1HA 5BQ5A 4DBLE 2R3SA 5FPHA 3OKPA 5KAMA 3RS0A 3SWWA 2G3YA 2CJWB 4L72A 1UDAA 3G0HA 2FW1A 2WFZA 2Y1WA 5DCLA 3W2HA 2V54A 4B3XA 1EVLA 1C9MA 2EEPA 2FK8A 2OCKA 3MRSA 4LDJA 2F8MA 3ISTA 4V0OA 5J4HA 3GEHA 1TL7C 4X9XA 5LQKA 5J5AA 3O74A 2QVGA 2C00A 1P1JA 2GZHA 1ZISA 2HNBA 3LQRA 3Q5GA 2I87A 4ZD6A 2BGIA 3OG9A 4BCBA 1H1LA 2PGJA 2IZ1A 3E82A 2N46A 3R3JA 4PYRA 5K4AA 4G5RA 1JVSA 5J2UA 1NDQA 1WCIB 1UPUA 3D4IA 2VA8A 4GO1A 3QVSA 4C0KA 3QKSB 3USCS 1YBAA 1KSGA 2F9FA 1PJ2A 3E35A 1M33A 2H0QA 2B83A 4RKRA 4YREA 4B6PA 4Q34A 5LA6B 2EKPA 1ODTC 2VPWA 5ALEA 1HTTA 4O8ZA 2BGMA 3DV9A 3PTZA 3AVXA 3ZGXA 3JQGA 3FI9A 5DF1A 4AG5A 1QP8A 4C3OB 3M89A 2Z5LA 2NZYA 3G2NA 1QDUA 1QHSA 4G0ZA 3S55A 3FFWA 4C14A 3EVEA 1SPXA 3QEMB 4TWIA 1R0YA 3FI0A 2PTHA 3EQ8A 4D96A 3ILVA 3QPVA 5G4LA 3LHKA 1DDGA 1R6AA 1JF8A 1J8QA 2FQQA 1U5BB 5ADUS 5I7VA 4NV3A 4D4HA 4TVBA 5EPEA 3TSAA 3D7MA 1UWKA 4JY7A 4MMXB 4PLTA 1ZH4A 2E49A 5GJWC 4JIGA 4HVLA 1PNRA 1LSOA 2Y1OA 3DO6A 1H5UA 4U6QA 4YS6A 3RC8A 3QMVA 4WASA 5ALNA 4RENA 3IQHX 1KL7A 2JGNA 3BJEA 4PBTA 1JMKC 3DSRA 3SMVA 1E6CA 2A86A 1C1YA 1JB1A 3SYMA 3CLRC 2HKIA 2Q27A 5FOTA 3CRMA 4GRDA 5C5IA 2C82A 1HNNA 4KTVE 3SBEA 4V1CB 3CGWA 5L4SA 2RGRA 2FEXA 2IXAA 5KZMB 1G55A 5EI5A 4LQDA 2EFCB 2CXNA 2PSDA 2WIBA 1A5BB 1HLFA 1JQ5A 4AUMA 4R2XA 1BX3A 5C9ZA 3Q2OA 1P2SA 3OCUA 4ZOCA 3AF4A 3SHVA 5LN1A 2O2JA 3ZI0A 1JG4A 1NBMA 1Z2EA 5EQFA 5GVRA 4GX1A 5BUCA 1J4AA 3KM0A 3J81k 2O05A 2O2YA 3R3XA 4AWBA 1DI0A 4GL4A 4S24A 4DLSA 2I2BA 3BXPA 3HY4A 4OQNA 2EZ4A 2IHYA 3HHEA 1PWHA 1M0SA 1UUFA 2XQGA 3MTGA 1Z0KA 3BL6A 3C74A 2OFPA 1TJ3A 5EJ9A 1M10A 3KB2A 4NH0A 4JQOA 3ZHOA 1KTIA 3SXPA 5CPBA 2D59A 4CEHA 1IWBB 2NN3C 1XZPA 4OQZA 4HWPA 5CNIA 3EW9A 4OEHA 1B2RA 2VQDA 4KBGA 4EG5A 4HDMA 4NR0A 5FXMA 3V1YA 1GG2A 1TQHA 2CE2X 1TD9A 2HUPA 2PH7A 4MS4B 4YLYA 2JGKA 2VP2A 4XIGS 3VV2A 2EBFX 4MR8B 3U62A 3ENZA 5J23A 3V32A 1YQGA 1UAGA 3TH5A 4D56A 3P96A 4TWJA 5ALJA 1B73A 3GFPA 4EEZA 2YTZA 1RI1A 3I0NA 4BLUA 3OZXA 2R1TB 1RAFA 2IHZA 5JEDA 1SCJA 2F3UA 3VJKA 5EMNA 4F84A 3WGKA 5HOEA 3KXPA 2VPTA 2BGNA 3W3AA 4ZQEA 2QUKA 3L8GA 4XGIA 1YVRA 5FORA 3FBWA 4C2AA 4RLHA 3B1ZA 4IYJA 2IPNA 3M9XA 2A7XA 4JKYA 3AOEA 1EVZA 1Z12A 2JCVA 5KTYA 2IQIA 5LA6F 4QFMA 4DFDA 3WAJA 2IU0A 3RGGA 1UZLA 3OM8A 1W48A 1PQWA 2A9OA 2WSYB 3JAWB 1W0KA 1GR0A 4HYYA 1J6UA 3A3YA 4EB3A 4MTLA 1Q95A 2VKTA 3G2OA 1THMA 2P9ZA 1Y4SA 2P91A 3IAM1 4BQQA 1QGUB 3IPRA 1VE3A 1I0ZA 2P5YA 1F0PA 4U7GA 1SG6A 3S3TA 2EXXA 1DC7A 2IDJA 3MWEB 5K8IA 5LQAA 3MTJA 5FLKA 1UXKA 2GEBA 2G17A 1NFQA 3B53X 4X6XA 3ZV4A 2B4TO 3A32A 3AUTA 3EB9A 4I1OA 1XEXA 1VLVA 5F1PA 3UWPA 3QWIA 4OYHA 3JVIA 3K30A 4BP8A 5FOXA 1AS0A 4UMFA 2OM6A 3Q7SA 5D85A 3V2UA 1K98A 1X38A 1MUUA 3BULA 1TCBA 3QYAA 1KETA 1ZU4A 3AUYA 3AC0A 5FOWA 4QWMA 1XD8A 2Z83A 4MVJI 1Z0AA 3N6VA 4LSZA 1PR4A 1SEVA 4MVJP 5JZBA 3CNHA 1ZUWA 1Z5PA 1ST3A 1E63A 1N6LA 2H1SA 1QWSA 3IVCA 1OIWA 1SUWA 1VM6A 3OCCA 4HZGA 3TIXB 6ABPA 2WKPA 4J7AA 3PXEA 4BTEA 4CL8A 5BQOA 2CVFA 3I12A 3VNUA 2BM1A 4BLRA 1KQPA 5EIAA 1U7HA 4IWNA 1LZLA 3EYAA 1K5GA 2RGWA 1C2YA 4IDOA 4CV1A 4BB0A 2IHBA 5EIWA 3OKAA 3IUBA 4I0WB 1VIYA 5IK2D 5JBIA 1RHKA 5I7WA 1J25A 1JV2B 2ZBQA 3PBKA 4XA8A 1FLAA 3W9YA 4MRNA 5I7UA 1GSOA 3OTWA 2VSYA 1LTQA 3JQPA 2QVZX 4QEDA 4FI3F 5M5BA 1KOLA 2E4UA 1H8EA 2OGTA 3M4JA 2W58A 3K31A 2ZANA 2WOOA 13PKA 4JJFA 2P11A 3Q40A 5FBVB 4FFRA 3EYWA 1J24A 4H7EA 1T36A 2DBVO 3SF0A 5G1NA 5JSZB 4NABA 5FKJA 4E32A 3HI6A 1Y1KE 3RFUA 5DN9A 2PWAA 5IDWA 1GPH1 3HVKA 1ZI6A 3Q6IA 2ZUEA 2EG5A 4PSCA 2QX6A 4DKXA 4ENUA 1E9EA 1TQ6A 2G08A 3HVIA 3C6QA 4TZKA 1YZUA 4XIFA 3T3IA 5H3HA 1E0AA 2OYCA 1NT4A 2WE7A 2GEUA 5H82A 3FJOA 3PQ4A 2G70A 2BEVA 4B3DA 4CIYA 3RSQA 3JRXA 2QZSA 3UK7A 4G0PA 3RVPA 2FKAA 4IUYA 1Y63A 6ADHA 1QXSA 4HTFB 1B6SA 3I2JA 5T64A 1MPTA 4ZCTA 1GADO 2QR2A 1R8QA 4D9CA 5L3QB 1LSUA 1PWXA 3LO5A 1GP2A 4X95A 3TM5A 2RH4A 1HO3A 4R7GA 1UZUA 3DKKA 1V71A 2A3NA 2OQ2A 2M2IA 2ZT5A 3GRYA 4RJJA 4GC9A 3UK2A 3W6PA 2G8LA 4INAA 5CUQA 1IATA 1J2JA 4CPDA 1VL6A 1Z83A 1ACMA 3L6EA 4MS3A 4ARAA 4YT4A 2PLAA 1YIOA 1Z56C 2Q5EA 2WABA 2XDAA 3KPUA 1VMIA 2NXEA 2ZWVA 3LDAA 4LQ4A 4NFSA 4PZLA 3UVEA 2BFBA 4V2IA 3LCMA 4ZGGA 2HIGA 4L08A 3X44A 4N48A 2OO5A 1OFTA 1SELA 1K9VF 4G5OA 3CTPA 1U1EA 3PUVA 2W43A 1Q1ZA 1RI2A 1AG9A 3JQRA 4TWBA 4YHBA 4AZ0A 4ETNA 5KO2A 2C5SA 5IAJA 4PRLA 3HYNA 3NIDB 2VYVD 1EEHA 2KM1A 4L9SA 1K6MA 2N1MA 4Z4CA 2IYOA 4Q6BA 3FTQA 4E7PA 5BSFA 2O5VA 1ULBA 4FFBA 1GY8A 2NU6A 3ZQUA 1XCPA 4RQAA 5E4TA 3ZWYA 1T5SA 3PXGA 1IZZA 3JVVA 3FYUA 2M1ZA 4KQ6A 2B7BA 4BZQA 2C3YA 3VC3A 4MV6A 4A8JB 1AXRA 2NQTA 2QAIA 2QD3A 5JFOA 4MWTA 5EJ2A 4XLLA 1TXGA 3G5UA 3AHFA 4QUHA 5BSRA 5K0TA 4OLBA 1XPRA 5I4BA 4DR1B 1TQ4A 2ZB7A 5IMBA 4EMTA 1NRXA 2FEPA 3BXFA 4EY7A 1Y5IA 4FZ3A 2JLQA 1AGYA 3T38A 3G3EA 1HOXA 2ODAA 1LZKA 1J1UA 3HCOA 4XDZA 2WSIA 3HB9A 3GA5A 1B23P 2CL5A 3HWWA 3G7UA 3QW4B 1QGAA 1QJ4A 1XROA 2NU6B 4QYMA 3W6UA 3VTAA 1IZ9A 3T35A 1Q15A 4A1FA 3T0FA 1IXSB 3DBOB 3GRUA 1F3OA 3GA7A 3S27A 1JKJB 4F4DA 5ABPA 2IW1A 4G8DA 4JK3A 4JODA 2RAFA 3PFHA 5E6UB 1AKVA 5EEGA 5DNCA 2C61A 2PLNA 4AS2A 4R2WA 1IULA 1O96B 3BDVA 1X7ZA 4ZV4A 2VYQA 1TMYA 4YP0A 1H42A 1RZUA 3RS3A 3EY9A 5AO9A 1U8XX 4CTJA 1T43A 4F1WA 4ZMRA 3L77A 4HH4A 1E7SA 5D51S 2NYAA 4Q3CA 3I09A 5H02A 1NLZA 1V4VA 1ZA1A 4UHHA 4Y7CA 4PQYA 1KSFX 2BL4A 3FYCA 2CUZA 3RG2A 2GCIA 2P3LA 4MYCA 1PJ4A 3BA1A 2IPOA 4KWEA 4O4IB 2QUIA 1EVIA 2NO9A 4CN8A 3TUZC 3U7QB 3KX2A 4D43A 3UB4A 1DXOA 5J43A 2RC5A 2CXSA 1V11A 1SURA 2AFIB 2GZ1A 1MB0A 2OZEA 1KJZA 3ANSA 3C7DB 3SJ7A 3DNFA 2OQVA 1VLMA 3G82C 5KWJA 1T25A 4Q6WA 4B6GA 4H0CA 3KL4A 3U4QA 2W6MA 3EIXA 2V0CA 3QGMA 1UBJS 3ET5A 2AT1A 4G0NA 5BSVA 4LJ6A 1SK9A 2WIGA 3BRQA 3O9VA 2G1KA 4DT1B 4DUPA 4RXTA 4MB0A 1HDOA 1TYCA 1UIRA 1VRVA 4H9GA 5ETJA 4UTNA 1OGIA 1GFZA 3SG0A 3MM4A 3S2GA 1AU9A 4R83A 3WICA 1F06A 2UZ0A 5H3CA 3TMAA 2CNWD 1LTHR 2FPIB 3GGCA 4E7OA 3M4NA 1K5DA 2OV4A 1IIBA 4O4HA 5CNMA 4ZQIA 3V42A 5IMSA 1EFVA 4MR8A 3DL0A 3TIGA 1K68A 4BP3A 3KQSA 4C0JA 1MJGM 3DAFA 1SC9A 1M34A 2QZJA 3DP9A 4HQNA 5AR1A 5H1YA 1GNQA 4MSUA 1VL1A 1QHNA 5L40A 1A9SA 4H27A 4KYIB 1IC6A 1XA4A 1UBEA 2QMQA 3P4YA 4HDKB 3C3AA 3OZUA 2IPAB 4IS3A 5EJAA 3U9SA 1YQUA 2HJ9A 4QTUB 4IDCA 4AG6A 4KL8S 5B2FA 3C8DA 4FIZA 4AZ3B 1UDXA 4I4IA 4M1TA 4LW8A 5F35A 2D0OB 5F23A 1Z2AA 4Y9SA 3NPAA 3VSCA 4Z8XA 3D54D 3I9JA 4ALNA 2H5JA 4Q7QA 2XTJA 6Q21A 1JA1A 4ZT7A 5CLLA 5CURA 1IN5A 2IHNA 2IJGX 5CCDA 5A2QA 5J2TA 3Q98A 4C1BA 2OBLA 1BHJA 2R8PA 3G8DA 4IVRA 4Q4HB 1P74A 2X0KA 1VJRA 4GDFA 1TIPA 2EAUA 3SQMA 1N6HA 3HV2A 3OTQA 4C76A 4DDHA 4OIMA 3HB1A 4OSOA 3P2EA 1QTQA 1KI2A 2ZXUA 3M49A 4D6XA 4DQXA 1D04A 3VH1A 1BN6A 2HC9A 3ZWQA 4L5IA 2W9XA 3U17A 3RS8A 3B1VA 3R77A 4BLQA 4TKVA 1OLSA 4S1OA 2VF4X 4RESA 2QD4A 1O94A 1U0SY 4WKBA 1SHKA 3IX7A 1NVFA 4FEEA 4H31A 3VHLB 5KPJA 4CF3A 3TZKA 1M2VB 1S8NA 1FB5A 2Z6VA 3H5IA 2IS6A 3RIXA 3RVNA 4LUCA 3DDSA 3A4VA 3V4RA 2DH6A 2R6AA 2VATA 1OPXA 3CCFA 3N2IA 1JEYB 1WVMA 2VAVA 2E1RA 4CF5A 1Z6YA 3IUMA 4MW1A 1NJ1A 4AY2A 4OMFG 2IXFA 2ZYHA 1UWLA 4J94A 3KUUA 3TEFA 4QJ3A 4WWHA 1ZSNA 2EX1A 4PPYA 3RTBA 5E3IA 2CFTA 3PHGA 2NZVG 4N9QA 3L8FA 4Q9NA 4BFLA 4ZP1A 1T29A 1U0GA 3EF0A 1Z73A 2D06A 4B3JA 1LBSA 2YIVX 3BC1A 3COYA 4JH0A 2CYAA 3ZU6A 1JEYA 1B0PA 1ESEA 3O6VA 1Y8QA 4PINA 3T5MA 1XSEA 5B1IA 1KKLA 4DXAA 3P9KA 3QJYA 4V0LA 3KQYA 4MAFA 4QEZA 5IKOA 2NU8A 2ZAMA 4YP7A 4F6LA 3MRVA 3DVAA 2PA0A 3JWEA 4MMZB 1E2DA 2G9UA 3QJ5A 3VU9B 4EG6A 1GA4A 1Q1QA 2X7JA 1SKYE 2OP0A 3L9XA 4J0DA 5AI0A 1DJPA 3G0CA 4P6VF 2QT9A 4AJOA 4HAZA 1Q16A 3F4KA 5BQFA 4O3MA 4GNKA 5IUJC 1JR3A 4MKXA 2MCFA 1B7GO 3AHEA 2WTUA 4WLFA 4BRUA 2J9GA 3BSFA 2UVPB 2W0MA 5KYXA 3IJ5A 2ST1A 4JYZA 3V97A 3VVBA 1UZNA 2HWUA 5F1OA 1MQAA 2JBAB 1SHTX 3IOEA 1AUOA 4DPMA 2XKJE 3ZJVA 3OLQA 1DX4A 4FFVA 4ZAGA 1K7SN 4DR7B 4GPZA 2XXAA 3FPKA 4W8HA 4KG7A 4P4GA 3JYHA 3SU8A 4Z9XA 4B71A 3KQUA 2AUTA 5JJBA 3K3PA 2LE0A 4NU5A 3KJIA 1P4HA 3FWYA 4WDRA 3N2GA 4L8YA 2GETA 3KWFA 2JD1A 4OHMA 4AT1A 3GH3A 4NFHA 1JZQA 3F6CA 4B4OA 4BVKA 5JNVA 1EYZA 5JZMA 1G7SA 2SKEA 4F45A 3TI7A 3C3XA 1E3DA 3WLPA 4P3KA 1TYBE 3QUSA 4K9MA 4OVKA 5FNVB 1ESDA 4ACBA 4DHWA 3GF4A 4ZHQF 1ULUA 2Z8YA 3G0DA 2I6TA 3L40A 2QU7A 3MPOA 5A9SB 4PN3A 2I7VA 1AURA 5IT0A 2VO1A 3FTPA 4PVDA 2O3QA 1NSFA 2ZS8A 3U9LA 5T3YA 4B2IA 1WXEA 1B8PA 1QC5A 3UJBA 4JU9A 1AE1A 5BUQA 5JYEA 3FAKA 1V7QA 3BSWA 3O2QB 4IDDA 1EFVB 4Q0MA 1UIMA 2GJKA 3E15A 4EX6A 4IFIA 3UIEA 3PNYA 3R7NA 1P9LA 5JU6A 2FW0A 4DEYA 2MSWA 5AW9A 4E30A 3BCHA 1L0BA 3IJRA 2YRFA 1N2CA 4IWXA 3ZVKA 3ZE8A 2DP4E 2RCNA 3C97A 1N8TA 3F5FA 4HKTA 5A7HA 3TQRA 3WGYA 5BSWA 3DMHA 1E5VA 3HO8A 1NUSA 3GARA 1JLHA 3CRVA 3A05A 2A84A 5FUXA 4A5OA 1OTXA 4P0QB 1X92A 3DZ8A 2YBEA 3FNIA 4W63A 5EP4A 4CCSA 5IYZB 2G36A 4DMGA 3F3KA 5HUQA 2YW9A 1E7YA 1GFIA 4H1UA 5FBKA 3B85A 2QDKA 1B0ZA 1NQ5A 3AK4A 2FCRA 1VI6A 5KYVA 3E84A 1R8XA 1SR8A 2FV8A 1XJQA 1N2BA 6REQB 1A9XB 3LBAA 1PTKA 1AQUA 1Q3HA 3ENKA 3IP3A 1GEGA 4ZQBA 2ZYTX 1OXUA 5HFAA 4FDUA 3PDJA 1QMGA 2E37A 4WK4B 2WSSD 3R3SA 5FEMA 1WABA 3TAUA 3SYRA 5L53A 3KEGA 1KP9A 4TYWA 1N9GB 1AK9A 1J90A 2WD9A 5DRYA 1JJIA 4X8MA 5CFOA 4P98A 3UJ7A 1CS4C 1O4VA 1TW2A 1Z5WA 3MG9A 3NBKA 2CLCX 1JHOA 2HI0A 5HIKA 4AMVA 4B73A 3G2KA 3OIYA 4MH0R 5JTTA 3C5HA 5ERXA 2O3UA 1VG1A 5ALWA 2Q6TA 1LQUA 4R69A 1KBOA 2Q1TA 1U0TA 4LY9A 4K3UA 1FFHA 3GUYA 3NIBA 5I9BA 2H65A 4W5OA 4MV3A 2IYTA 2P30A 4B2LA 2SCUA 3FMIA 5IDXA 4LGVA 5H81A 5TMDA 3GPIA 2HZBA 4QU9A 3PPXA 3NDJA 2Z2IA 1YC5A 3CNNA 3KXDA 1H5QA 1KU0A 2JJ1A 4HWGA 3I9OA 3TL3A 5LPNA 4MGZR 4C05A 1T8YA 4LDNA 4RJLA 3AR8A 2DJ5A 4HGPA 1K27A 2GCNA 1PR5A 4UDOA 2JGFA 3DLCA 3JQBA 1RDFA 4KYUA 4MS1B 2C7QA 3LQQA 4N8EA 3VKUA 3QRWA 4P4UA 5IHPA 3DQZA 4DLBA 3KT3A 1DTSA 1RRKA 2DJIA 3DHYA 3RK0A 1QE5A 2BHLA 2Q2QA 1T2EA 3H5TA 1Z7BA 3BGVA 4NZZA 4DR6B 1MX9A 2JFXA 4QAJA 2B7LA 1CP2A 1OI7A 3B51X 4G8JA 1K3FA 3FDFA 5IK2A 3B9PA 3UHAA 3RADC 1NFFA 1UEIA 2H7YA 4GZLA 4OBBA 4B5LA 5LSAA 2M32A 5ENZA 5F2KA 5F5LA 4D8UA 3OT1B 4ENSA 3IODA 1DEHA 4LISA 5FTWA 5EE5B 3UWKA 5E2IA 1SD1A 3MUEA 1E32A 5EVCA 5BMVB 4XPZA 2ZW9A 3EGXB 1IRXA 2P67A 1HLGA 2AEJA 2XY4A 2EDCA 3FSJX 4O4LB 3TSCA 4A6EA 3GJ5A 5CG1A 5TEVA 3QLTA 1R6DA 2C58A 4PG5A 4IDNA 4V0MA 3GGSA 1HRKA 2E89A 3QNUA 4Q47A 4ATNA 5KYXB 4XLZA 2ZWPA 4LMBA 4PYJA 3OU2A 1J5XA 1PJ8A 4ADSG 3CR3C 4HDNA 4WH0A 4KAJA 3ABRB 3GBVA 4HQ0A 4JA0A 1DINA 2A7QA 1UOQA 3AGQA 3BN3A 4OHPA 4WBNB 3EUFA 4MWSA 2PKEA 3DKIA 1ZIDA 4XAQA 1DTWB 2X0FA 3TNLA 4P93A 5LOVF 4JB3A 3NT2A 3D81A 4CG1A 1RLIA 2IHTA 1C0KA 3Q3IA 3M6AA 2XGGA 5D86A 5ALOA 2I6SA 3T61A 3VMFA 2HEGA 3BXHA 4P08A 3DDNA 2XGJA 3TEJA 1USVA 4RZHA 4KPEC 3OQMA 5KYYB 2WYUA 1QVZA 2XAAA 4YNBA 3SHFA 2NOAA 4BIIA 2PX3A 4MKFA 3WLFA 2H2AA 3SHWA 3UAOA 3TMKA 4O4IF 3WRWA 2ET6A 2PWBA 2RGEA 2WWWA 1J49A 2X5OA 3OKFA 4L4RA 3ZZUA 3O0DA 3QU4A 4NWIA 5ITZB 3IQGX 3Q7IA 4K05A 4UAVA 1OLUA 4QAQA 4MVJA 3TZ6A 3B1YA 1DCKA 4MICA 2PWZA 3VR5H 5AMXA 3C4JA 4OFZA 4G37A 1T3TA 4OHYA 1DB3A 1EDZA 2EP7A 4CKWB 4U0JA 1O3YA 2ERYA 4XWTA 2I76A 1RC8A 3L7AA 3A6LA 2YHIB 5TSDA 4WLOA 3UMRA 5CB6A 5B4UA 1M5UA 2FLVA 5JFTA 1Z63A 3F5QA 2X42A 1FW8A 2ZM5A 2FPGA 1Z15A 1KO5A 3WYDA 4ACAA 3CWQA 4GR4A 4OQXA 4W6ZA 5A4JA 2Y99A 3T7EA 4P4SB 3IIEA 3PXCX 2E2WA 1H8HD 4UBJA 3QLEA 3BTSA 4DDWA 2BUCA 4ND6A 1C8VB 2R65A 4AY4A 3ZPXA 2FQ1A 1Y1SA 2J6HA 2W98A 3GEPA 1FLVA 2Q1WA 1SZJG 5BSEA 3RRYA 3MJVA 3EA5A 3COSA 4KDRA 3ESYA 4I1SA 2FDRA 1SUEA 2DQ4A 3AVVA 1OFUA 2BJVA 4TM7A 4RPIA 3VHXB 1JALA 1SRRA 3VSEA 1L7PA 1P0IA 4AJNA 9GPBA 5LYYA 2IH2A 1QGZA 2Z0MA 1LF5A 4WKNA 3NT4A 4JX9A 1RFLA 4B3HA 4RBNA 2VBFA 4WMLA 3E5MA 3S68A 3PYMA 2E0IA 4NK5A 5BYBA 3UWSA 5I3ZA 4IXWA 1E5XA 2UVPA 4X63A 4GQBA 2Y9PB 5HW0A 5EL0A 1E6MA 5CFPA 1H6CA 1QDLB 4ND7A 4TYNA 2IP2A 3SC6A 4F46A 4X66B 4W1PA 1KDOA 5JUWA 1NNLA 2YJZA 5CT9A 3UJ9A 1MDFA 1WPRA 5CW1A 4C6RA 3T3GA 2OO3A 3FCAA 5F7ZA 3BIFA 3EXEA 1Y4ZA 4TUYB 1GU7A 3PPWA 3UJ8A 2Y1DA 4KH0A 1LI5A 2Q7OE 4KRYA 2IU6A 4XGQA 3TLZA 1Y8ZA 4KMOA 1Z7WA 3ITNA 1CUDA 4ALLA 3AM5A 3HFSA 2FN9A 3CO5A 4XGNA 3CGGA 3VU1A 5DX8A 1ZCZA 4HC4A 1M2WA 5GV7A 3TLGA 4EZIA 2Q0HA 3OZDA 1EP3B 2FSGA 3FD8A 2V6JA 2OB1A 3Q15C 1V5EA 3K8YA 4UU7A 3DVRX 2BFEA 3F74A 4KZPA 4XB2A 3VO2A 4RVHA 4JZKA 3NBFA 2IUYA 3E4DA 4W1RA 3V2GA 2WAMA 4B32A 1YZVA 2NV2B 2OHVA 2PYZA 2ZR8A 5F2NA 1XC7A 3AUXA 3FKQA 3JALA 3RT7A 3TO5A 1JMVA 3N8NA 3ESRA 4NJEA 2XF8A 1X9HA 1QGDA 2WF5A 3HCBA 5AJXA 3TRIA 3CNOA 5C46F 1QBGA 4U9IS 5DPMA 4OGKA 4TVKA 4ZI7F 3K6JA 1LVUA 2BEUB 3F3YA 1BMQA 3AJ9A 3OZRA 4R2IA 4OI0A 2DFLA 5T7BA 5BWNA 3FF1A 1XYYA 2RHOA 4K9DA 1I3LA 4U5QA 5DNUA 1KKUA 3KSBC 2WAOA 3K16A 3WLOA 4KQ2A 4U02A 3C5WP 3MAAC 2CWWA 2H52A 2Z57A 1HORA 5JVDB 1N2CE 5JYBA 1RKVA 3IAFA 4KGVA 1TM5E 3IT3A 3KPWA 3V7YA 4CCWA 1C1DA 2G1JA 1A0OA 2A1IA 2Q1YA 1FP4A 2V5VA 2ZYAA 4N8SA 4JJGA 1UDWA 3ZQKA 3JQ9C 1N0VC 3BFKA 1A3CA 2D2FA 3ON5A 4I1VA 1U2TA 2RGNA 3I9V1 3KXIA 3RVBA 1U99A 1JUDA 2H8GA 1Z2OX 1GG5A 2II6A 2VYNA 3ZX5A 5L4NA 3ITDA 4ZQCB 1DOZA 1YZNA 4DQKA 5KMGA 1QWOA 2OGSA 4DR5B 1CUUA 1YUNA 3H3XA 4G5HA 4R4JA 4H7KA 2X58A 3H2ZA 2OCIA 3F49S 1OXKB 3DMTA 2X6QA 3LLUA 3PGLA 4C7XA 2RONA 2GB4A 3BG5A 3JZMA 3JR7A 3OEYA 1C0IA 3UMGA 2OV3A 4CTKA 4EJ6A 4EO7A 3REFA 1U2DA 3K1JA 3LFHA 4Q1CA 2XWJI 2L42A 3NHRA 4WOBA 3KE9A 3NBYC 5JCOA 4DV1B 4KWHA 5CXQA 5JAZA 2Q3HA 2R0QC 2QZZA 3RSZA 4Q48A 1E18A 2GFIA 3D02A 1G7RA 3D3WA 1H4VB 3LXXA 3QF7A 3PGJA 1A69A 4TLMB 1Q0TA 1C9YA 3EMBA 2A58A 3EAGA 4ZAVA 5C3MA 1N5IA 2G1PA 1HYEA 1AGPA 3ZXUB 2JGAA 5HKOA 5DRTA 4YPOA 1VG0B 2VFAA 2WHXA 3E7FA 3FOZA 2CHVA 5KI6A 4M37A 4ARZB 3PD1A