1FCJA

Crystal structure of oass complexed with chloride and sulfate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
302
structure length
302
Chain Sequence
SKIYEDNSLTIGHTPLVRLNRIGNGRILAKVESRNPSFSVKCRIGANMIWDAEKRGVLKPGVELVEPTNGNTGIALAYVAAARGYKLTLTMPETMSIERRKLLKALGANLVLTEGAKGMKGAIQKAEEIVASDPQKYLLLQQFSNPANPEIHEKTTGPEIWEDTDGQVDVFISGVGTGGTLTGVTRYIKGTKGKTDLITVAVEPTDSPVIAQALAGEEIKPGPHKIQGIGAGFIPGNLDLKLIDKVVGITNEEAISTARRLMEEEGILAGISSGAAVAAALKLQEDESFTNKNIVVILPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords O-ACETYLSERINE SULFHYDRYLASE
publication title Identification of an allosteric anion-binding site on O-acetylserine sulfhydrylase: structure of the enzyme with chloride bound.
pubmed doi rcsb
total genus 110
structure length 302
sequence length 302
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2000-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fcjA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fcjA02
5B1HA 2CLOB 2CLMB 4Y6GB 3IQIX 1VE5A 3X44A 4HO1X 1RQXA 2C2GA 1VE1A 4KKXB 5B53A 4D92A 3PR2B 2RH9B 1Z7YA 5CGQB 1TDJA 2ISQA 4D99A 2RHGB 2O2JA 1TTQB 2Q3DA 2CLEB 1J0CA 3L6RA 4QYSA 3SS9X 4D9MA 5KINB 1C29B 3SS7X 1BKSB 2CLIB 2PQMA 3L6BA 5IXJA 2GN2A 5DW3A 3ZEIA 2DH6A 2CLFB 2BHTA 1V8ZA 3IQHX 3IAUA 1VB3A 3DWIA 1C8VB 3HMKA 4HPJB 3RR2A 5I7WA 5B1IA 4NU8X 1V71A 5B3AA 2ECQA 1O58A 5DBEX 5C3UA 3PC2A 4L27A 3TBHA 3VSCA 4HT3B 2ZPUA 4I1YA 4IL5A 1PWHA 2CLHB 4AIRA 4LMBA 4XUGB 2J9XB 1A5AB 3FCAA 1K7EB 1UINA 3BM5A 1E5XA 4OFXA 1KFBB 4OREX 4D9FA 4L28A 4D8WA 4D9CA 3DWGA 5I7OA 5D87A 1K8XB 5IWCA 1V7CA 2O2EA 2CLLB 3PC4A 3VSAA 4D96A 1K8YB 2EGUA 4L0DA 5JISA 4WX2B 1Z7WA 4D8TA 1QOPB 5BW6B 4D9IA 5J5VA 1CX9B 2BHSA 5I7RA 2ZSJA 4JBNA 5EY5B 4D9KA 1K8ZB 3AEYA 1TZJA 1P5JA 1J0BA 1A5SB 4PCUA 1C9DB 5HBGA 1A5BB 1KFKB 1UBSB 3R0XA 5CVCA 5I6DA 2WSYB 3CEPB 3VBEA 1QOQB 1KFCB 2EFYA 5KZMB 1J0AA 3DKIA 2C2BA 1KL7A 1TJPB 1WBJB 1Y7LA 3V7NA 2GN1A 4NEGA 3R0ZA 5DW0A 4D9GA 4JBLA 2JC3A 5I7AA 4AECA 4D9EA 1M54A 3X43A 4D9BA 2ECOA 4D8UA 4D97A 2Q3BA 1K3UB 2RKBA 1JBQA 3AEXA 5DVZA 3VC3A 5D84A 1CW2B 2CLKB 1X1QA 3L6CA 1J0EA 1TZMA 5D85A 5IW8A 3IQGX 2TSYB 4LI3X 1KFEB 1BEUB 1TTPB 5JJCA 3T4PA 2TRSB 4COOA 3SPXA 1K7XB 1PWEA 1WTCA 3FGPA 4ZQCB 5T6MA 1D6SA 2DH5A 4H27A 5B55A 4LMAA 1TZ2A 2ZR8A 1OASA 1TYZA 1F2DA 3VSDA 1A50B 1TZKA 4ZU1X 2V03A 5E0KB 2GN0A 1WKVA 4D9NA 1J0DA 1K7FB 1WDWB 5DBHX 4ZU6X 2J9ZB 5D86A 1UIMA 4F4FA 2Q3CA 5B36A 1KFJB 3PC3A 2J9YB 2TYSB 2D1FA 4HPXB 4L3VA 4HN4B 5J43A 1FCJA 5I7HA 1FUYB
chains in the Genus database with same CATH superfamily
2GLXA 1NP7A 3CBGA 3UTDA 1P3JA 1JFLA 4FU0A 4Z4FA 4DSUA 3WQHA 2QV0A 5KWJA 2F9LA 3T3PB 5JE8A 2X5NA 3B53X 1KYZA 1QG2A 5LA6B 1FYFA 4J29A 4JMPA 2HIGA 2CLEB 3F5QA 1DAPA 3MGGA 3NORA 5TEVA 3ZH9B 1BHSA 4LRSB 1L7DA 1GPKA 3MTIA 1JDUA 3GD5A 3PICA 3DGFC 1H1LA 5ALLA 1QIIA 3F5SA 2G4LA 4UFNA 3RSHA 1WNFA 3KR0A 4E51A 5H02A 4IXTA 1I6LA 2KPOA 1RRVA 4XM1A 4Z9AA 3HO8A 4MRPA 2R8BA 3HN7A 4IRMA 5FI1B 1FDIA 1HLDA 1EDBA 2XDWA 5AJYA 1PEYA 1AKNA 1F1BA 1FFHA 1WEKA 1ZU4A 2ZETA 4EGAA 2GJ4A 4P38A 4R9UC 1FS6A 3GGPA 5TGTA 3S2IA 2COEA 4LJ4A 2JJQA 1NW4A 2ZYGA 5CLQA 1Z0IA 2ZT7A 1L4EA 1UFVA 3AY3A 4ZV7A 3FVRA 2P6MA 1BFUA 1MB9A 3ZNNA 4K9KA 4BAZA 4RK0A 3ZDRA 5JT1A 1GTG1 1KYVA 4X1YA 3O21A 2D0PB 2ECKA 2A9FA 1XJWA 4WW0A 1HMPA 3H5IA 2ZVQX 2O19A 3GLIE 4R1MA 1P7ZA 3CEPB 1Y1SA 4HG2A 2JGLA 4RGBA 1ZL0A 4GKJB 4RY0A 2WD7A 4HX9A 2QUJA 3GC6A 3S27A 4R3UC 5E6RA 4FQ5A 4NCXA 2IEBA 2NU7A 2EW2A 5EKDA 4UE2A 3LUBA 4OHUA 1T2CA 4R2KA 4ZQHA 3RB8A 3V1MA 5LQDA 1SQ6A 2VJYA 4BCDA 2OMKA 1E7MA 4WJZA 5I01A 4D3XA 4D46A 1C9YA 4KIUA 5AKYA 2PBRA 2BFBB 1Z4QA 3EXIA 3OIWA 2ONCA 3VR5A 1ECBA 121PA 2IYLD 5EWMA 3UC5A 4K6KA 3SBDA 3UUWA 3P9NA 1AQNA 2FDCA 2XUIA 2OHGA 1T6NA 1AJEA 2XMDA 3U4HA 4IG4A 1JLMA 3HDVA 1FU8A 3J7AC 3L93A 1FFWA 4UQOA 4FW9A 3PRJA 1NVUQ 3HVIA 3O84A 3WLKX 4DMCA 2YDYA 1Z36A 3OT4A 3QUBA 1OASA 2HD4A 5BN5A 2OGSA 3QA9A 4ZAWA 2JIPA 1D9XA 2OXFA 5F2NA 4O4IA 1ZEMA 2VZLA 1DAKA 2ZTVA 1FVHA 4EHHA 5J23A 1FU7A 1E2MA 2IWHA 3I9NA 1G17A 2BZ1A 3W8EA 5C8ZA 2PGDA 1OWOA 1Z7BA 2V55B 4GE0A 4KO4S 3BF8A 2RAUA 2K6GA 5J2TA 2ZI3A 5C1DA 3TSAA 3B3GA 3OCWA 2COUA 1FUUA 4RORA 5CFNA 2B1JA 3B7WA 3KV1A 4PYKA 3SEQA 3EZ6A 3LL7A 5EIBC 3N7UA 3I2HA 3SX4A 2AZXA 3K1JA 2XLBA 2XD4A 3E9MA 2I6QA 4TZTA 3U4DA 2O7NA 4RIEA 4QDOA 5EHGA 3WYAA 3D0QA 2XOEA 4IAOA 4X6UA 1Q15A 1E64A 5AJTA 5KSPA 2ZQYA 4G81A 2VDUE 2R8OA 1PUIA 3OZFA 5IRCD 1AN9A 1M66A 4LIPD 5F1YA 4YQYA 1KJQA 2I2CA 4NCIA 1O96A 4ZK6A 4L5CA 5SYMA 1F38A 2A7XA 3EBLA 3NRJA 2OKCA 4ND8B 5CYFA 3VZQA 3A7DA 4B0OA 1NI4A 2NM0A 4R8LA 4YRFA 1E2NA 1LVHA 2H48A 2NMVA 4G63A 4RVGA 3WY9A 2IXGA 2JIRA 1V8DA 4AYWA 1JSRA 5L3QB 1NQ5A 3P4UA 4RK5A 2UYCA 1ZSYA 2IYEA 4BGEA 2WNIA 1X9IA 5FUBA 1XFAA 4B75A 5CEFA 2VJMB 3QLUA 2PD4A 3IQXA 4XD7D 4BO2A 3K53A 3FPLA 3EGWA 1WHSB 3GCXA 4QQNA 4C4RA 1G5RA 2X7HA 5AK6A 5IKXA 2QY6A 2O23A 3QELA 1YRWA 1ZUNA 4NRDA 3LBFA 1RQPA 1QC5A 3LOQA 4W5OA 1TF5A 3V6LA 3IJEB 3ENNA 5C7LO 1ID1A 1MJFA 5T4BA 1M0WA 2FGJA 4L75A 3AB8A 4IIXA 3UXYA 3K96A 4P3OA 3UCXA 2IYNA 3LX8A 2IELA 1S7CA 5TRTA 5JAZA 5HKOA 2G7MC 1O0BA 2ATVA 3HLYA 1OXTA 1PX0A 3RJTA 3TR6A 2YFHA 1MIOA 2A7QA 4F4DA 3Q3JB 1OLUB 1ZP6A 3PLAE 5G1PA 2IUYA 5J58A 3ZDZB 3WK8A 4JGIA 2NADA 3AR2A 3SK0A 2WDZA 5EQFA 3PR1A 4OA8A 3CNNA 1N7GA 2WHYA 4EF4A 1BGWA 2P9BA 3K6KA 3RC1A 1HZZA 2ODTX 2QLLA 4PFKA 3T5AA 3WXBA 1ZIXA 4W5JA 2OV8A 5JFTA 4IXWA 4DNOA 1ISMA 1K5PA 2OFXA 4LJ5A 2Q3BA 3LNTA 6NULA 1IN8A 2CXTA 1VI2A 1P2TA 4C20A 1VSVA 1GHTA 5EUCA 3R8CA 1QRDA 1XDWA 2F62A 4K9DA 2W58A 1TZMA 5LZ7A 2XNSA 1G1MA 3E3OA 2H4ZA 3ZWKA 1TCUA 5LQNA 4C5AA 3TRFA 4NYMQ 4RK1A 1A2QA 1GUBA 3BMXA 1HE1C 1DQPA 3PT9A 4W9NA 4C1BA 3RVOA 4QO7A 4UHEA 5BR8B 3DZDA 4UTZA 3SPXA 3SSOA 1CU1A 1YZVA 4S0XA 1ZN7A 2EYUA 2NTEA 3ZU3A 2V0NA 2VOEA 2SBTA 4GYWA 3JZFA 4ALMA 1K7SN 1CZOA 1OYOA 2FTKE 3F73A 4PHGA 4AKGA 1RXYA 2B3TA 1QKIA 2JDIA 4LY9A 3ZBPA 3SC2B 1KRXA 4Q1VA 1MQ8B 1UP6A 5B1SA 3R7AA 3H97A 4ZI7A 5A7HA 1VCHA 1K2VN 1E2UA 1M1NB 4K81B 4CKCA 5C8VA 2Z6AA 1NJSA 1Z13A 3OETA 5G4LA 2NSDA 2XVXA 4REQB 3WS7A 2O4CA 4OPMA 1EDZA 5AM0A 5F3DA 4JT9A 1VA4A 4YP5A 4E5MA 4A0QA 2IYXA 3EC7A 1RP7A 2I1VB 1E2LA 2GAJA 3KE9A 2IY9A 2Q7XA 3M70A 1REQA 1CSEE 4RKRA 4MVWA 4TKLA 5FUQA 1OFIA 2FZEA 1MT3A 2I66A 3KAKA 4AFNA 5C8YB 2HXGA 3T99A 4NBTA 1LLQA 3LP5A 1STOA 1PR9A 3S7ZA 3B9BA 4DCOA 2Q4OA 3ETEA 3KDSE 4AJOA 1T36B 4WY8A 3HA5A 4QULA 1GM5A 4W1PA 4FYYA 3QFFA 1I01A 5HIJA 1H6CA 4JR0A 5CJPA 3UAYA 5KKCA 2MSKA 3C8MA 5L7WA 4EUEA 4WLVA 1KE2A 3ROTA 1L9KA 1Y7PA 2HWXA 3M5WA 2JJYA 3F8TA 1GEGA 4OJYA 1CQJB 5ER9A 2B1QA 5DGXA 2IHTA 2GYYA 2OK7A 4XKJA 2WYIA 5B57C 2RHWA 3A9WA 1CRPA 4I99A 4MR7A 2RG1A 2PL1A 5EHXA 4K05A 3SJAA 1U9IC 2XXJA 2EV9A 3CKLA 3K0CA 4FS3A 3TLEA 3TQFA 4DMUB 1YRQA 4IL5A 1KVRA 3RYFA 2Q07A 5AJVB 4Z99A 1OKKA 3I6BA 2ZJOA 5FBLB 2II6A 4H4DA 4RD1A 3VQTA 2NWQA 3GUHA 2H9IA 4JOBA 1NMSA 3N7TA 5ALRA 3NZEA 5KYYA 2AYYA 4ZYVA 2XHZA 5I9LA 1SELA 2RMKA 2I99A 1PEKE 2YVQA 3ND5A 3DEJA 3KE8A 1QV6A 2ZIVB 4RIHA 1EUZA 2I3DA 5DN9A 3S5UA 1BC5A 3O9ZA 3DLPX 1GPUA 3OC6A 5EXDA 4QODA 5ALPA 4DBLC 5A2GA 5KSYA 2VHXA 3IDAA 4C5CA 5JC1A 5FOXA 3IE0A 3P0JA 3TZLA 3PC8A 2A0XA 1BH6A 2M6SA 1BQEA 2V7EA 3IBGA 3BXPA 4Q01A 2PKWA 1KYQA 1L5YA 2C98A 4QJ5A 5DLYA 4AKEA 3BGIA 1Z56C 3WV5A 4M9ZA 1JR3A 2IL1A 3UANA 2AC4A 4UNIA 1H1LB 4OQXA 4P83A 5IZ4A 5JVDB 4EG1A 4DNXA 1QQ7A 4GVXA 2VHQA 4MLPA 4FEEA 4QQ8A 4XIJA 4PYLA 4C0JA 4Q7KA 5T4FA 2OHHA 3FWPA 1DGQA 4GX1A 5GZ3A 2IWRA 3PXEA 3WDSA 4URXR 1ZSVA 1CY0A 3SYTA 3ZWWA 3GB9A 2PRKA 3QX7A 2WP8J 3UQYS 3TIIA 3KQQA 3KXKA 2WUGA 3ZCTA 1DMSA 1WLSA 3Q7PA 4REOA 2X3FA 1XMIA 3VR0A 1GYRA 2N75A 1RVV1 3FHLA 3HL4A 3QFRA 3UV3A 5BXQC 3MHPA 4JJEA 4HUQB 4CDGA 2P5TB 3F67A 3L0OA 2D2XA 3PX3A 4PWZA 4I5GA 2VN8A 2FR1A 2C77A 5JMPA 3AI3A 4Q21A 1N78A 4LMPA 1GGKA 3OCJA 1KNQA 1GCGA 1ESMA 1MRZA 1ZH6A 3ADOA 3R0JA 2XGMA 1HZJA 4FDLA 3ISTA 4XOUA 1I5RA 2SNIE 2ALJA 3O91A 5HYVA 1SC1A 4BFCA 1JW9B 5LYJB 1UIMA 2LDXA 1KETA 5K5EA 2W4MA 4MV7A 4RV5A 2LDBA 2R7KA 3IV7A 2WD7B 2GK3A 1A2BA 3IPXA 1R8JA 5E6RB 1DEXA 4YLYA 1N1EA 2XNHA 3LK7A 4KYUA 1SD1A 1KKUA 2YDXA 1UMKA 4KIGA 1TVEA 4LZPA 2IE0A 4K88A 1Y7TA 2CMHA 1G7TA 2BGJA 1JVSA 1XTIA 2MSWA 3GJ6A 3HSSA 5DX0A 2XE4A 2ZOSA 4HDSA 5KWSA 4JI8B 3F78A 3LWZA 1XLTC 1Z7YA 3CR8A 2X0RA 3R3SA 4KDRA 1N6PA 2EZUA 4I4TB 4NH4A 1QGUB 1N2JA 2PL9A 5EMMA 4DA4A 2QLJA 1I7DA 1YTUA 3AUFA 2RGDA 3DDUA 3UNXA 4XVQA 4U2BA 3E70C 4GMXA 5G0SA 5E1BA 3DL0A 1O6CA 4IOMA 5HRAA 2P2ZA 2PSSA 4HWGA 3HEAA 3IDZA 1FBTA 1TM1E 1FEZA 3L77A 4IJ5A 2FSHA 1IWBB 5T3UA 4QYTA 4HNVA 1JJAA 1PWYE 4QASA 4CMKA 4O4IB 4BVEA 5KDDA 5DWQA 1FDOA 2Z8YA 3AGQA 3HP7A 4C0LA 2B8NA 4WJKB 1A8QA 2QP9X 1ORTA 1RQGA 3CF2A 3NJRA 1DBSA 4HNGA 4S1PA 3B1XA 2WSLA 2WILA 2WM2A 3FSGA 3AKZA 3EC1A 2ZTMA 4IO0A 1V2GA 2A57A 4QX6A 3U09A 4DV0B 4JXXA 1QTRA 3PC4A 3E18A 2V3WA 4D42A 2E21A 4Q82A 3SYNA 4YS6A 3ZV5A 2WZCA 4LYAA 2QTAA 2QVBA 3OE7A 4BTLA 4ZCQA 2JLAA 2MHCA 2WTNA 3JRNA 3PLRA 3TFOA 1O6FA 2IA5A 2WHPB 5ITWA 2IOHA 1GR0A 3M7IA 4M0UA 4RSGA 2PUBA 2ONJA 1FTQA 3DWFA 4UTNA 1GRVA 5FPQA 5A04A 4NK4A 1BKDR 5FT9A 1KIMA 4LMRA 2BGWA 2FW6A 2PO7A 4JX9A 2GASA 3BG5A 4Q24A 2WICA 3WRWA 1B8UA 2EVWX 2I1LA 2MYTA 1CETA 4YJDA 1NR7A 4HDCA 4NDZA 4CKBB 4UM5A 5EMLA 4QRIA 3VU0A 1UPXA 4PBTA 3LKVA 3MQ4A 4S3MA 1HLGA 1OY1A 2MR6A 3I05A 3NBMA 4KXQA 1OPXA 3VHXA 2ZR9A 3A1TA 1ZUNB 1HK7A 3D8RA 1YI1A 2LPMA 3K2IA 5BSWA 5JAIA 2X1VA 4H9GA 1ETHA 3AHIA 4KDCA 1ZHHA 3SIWA 2QZPA 4IVRA 4ZKDA 3NJ4A 2DWOA 4EFLA 2AUMA 5B55A 1OX4A 1ISIA 2D2IA 3BE8A 2CUTA 4Z6KA 1Q20A 1R5JA 1II8A 4HH1A 3UCFA 2DTDA 2I80A 3BB1A 3IJRA 4Q1FA 1EVJA 2VUIB 1EP3B 2OESA 3BRSA 5K3AA 1XQYA 3O8BA 2WFMA 1MIOB 4D9NA 1IL0A 4KK4A 3V7WA 1Q17A 5FYQA 1ITZA 4MKFA 2XQFA 1TKRA 3RRFA 1JUDA 1Z0AA 4HY3A 5EZ5A 5ILQA 3RTEA 5H5JA 4ER3A 2AX4A 3TIVA 1WPQA 1SXJE 1OF1A 3AGPA 3MGKA 4PLVA 2JRLA 4BMVA 3QY9A 4MHOA 4X1KB 4YQEA 5FL3A 2XZTA 1MO6A 4ZVKA 4B6QA 3RVQA 1RZVA 1MC1A 3C6QA 4DIBA 1XPUA 3DH0A 5ELLA 1RD4A 3G6WA 2JAWA 4I8DA 3SOPA 2CFCA 4Z0TA 2WTEA 1RWXA 5E3IA 3ROQA 3U7IA 4RMIA 3V2GA 3ERCA 2P79A 3HJNA 2UU9B 4NU0A 1YRHA 4L9WA 4EPWA 1DCMA 2KJQA 2XYHA 3PXUA 4KH1A 2QRNA 4HGYA 3PGLA 3MB8A 1BGXT 4OG2A 5T8KA 3WIVA 1B6TA 3WGGA 1TZBA 2O2SA 1DV1A 2QKYA 4N3BA 8LDHA 5I9IA 3S2YA 4ZEOA 2C2KA 2P67A 3KLBA 3C97A 2WD8A 5EN4A 5BUZA 1E0DA 1SXHA 1ZC3A 2B78A 2X23A 1IE3A 5DTIA 1DXYA 2IGTA 2FPUA 1OI7A 1FJHA 1R6BX 2JBAB 1E3DA 3KG2A 4KRXA 3ZLVA 5JO0A 1PFUA 3U40A 1NBMA 2GM5A 2QMZA 3UKOA 2ZAIA 2RC6A 3FUTA 3BUSA 5C3UA 5BOVA 4HVLA 1SC6A 3PYXA 5ICGA 1R27A 2WR8A 2A6PA 1V11B 3L6UA 3MLEA 3ON5A 2ES4A 2E85A 1SZCA 3C6KA 3V4VB 1Z83A 1U9ZA 4K6MA 3A32A 2QUBA 4HGZA 2ZXUA 1G64A 3H7AA 3LX4A 3HBFA 1T10A 2OCKA 3FRIA 3ZI0A 4H15A 2IHUA 2WE7A 3DDWA 5FWXB 1SOMA 3D2BA 3QRWA 2P9GA 2PKQP 3OLYA 1JXAA 4Y1RA 2GXQA 5THQA 1M7HA 2QN3A 5EPEA 3U49A 3V4ZA 3C2QA 4E21A 2QP3A 2VR1A 2D7DA 4I50B 2JA1A 3I9KA 4REMA 1WXHA 2D54A 4GF5A 1CQXA 2KHZA 2V7UA 3HZRA 5TC4A 1QHIA 1W2HA 5KYWA 4FDMA 4N8EA 2YW2A 3PEEA 1JHMA 1GKLA 1T9DA 3OZUA 3FYUB 4QBGB 3RROA 3SHOA 3KJQA 4E6EA 4L50A 7REQB 1Z4LA 1KARA 3JV7A 1B26A 3BFXA 3VZBA 1OI3A 3X43A 1DG1G 1TGVA 1R5OA 4XYLA 2FEMA 4HEQA 3TBKA 2NAPA 1EFTA 4MR7B 1OC2A 1R0LA 3F9CA 1W5TA 1O5IA 3IUJA 4KQ1A 3M5CA 4LSGA 5ALDA 1P4SA 4OOEA 5DT9A 3RYFB 1O89A 3IFSA 1K0UA 1F8FA 2GK6A 2JLRA 1FMLA 4GVPA 2W22A 4MGHA 3CRMA 2X58A 2YZKA 2FPXA 4D81A 3NHWA 1KH3A 3ND7A 5D3MA 3TLKA 5JW6A 1NNI1 1XG5A 5CG1A 1HL7A 2QJRA 5KYYB 1VJGA 5JHHB 3CLKA 1GLVA 2QRHA 2FW0A 1MFZA 2JHCA 1COZA 3V9AA 5FI5A 3RSGA 1K66A 4L2IA 3PKJA 3BGSA 1ZJ5A 5AM5A 2XVZA 2VUUA 4HEA1 1HV8A 3GX1A 3KYDA 2EQAA 3ZD8A 5KCZA 1ORHA 2UZIR 1I4LD 3P94A 2VYVD 3IIJA 2C95A 3S7TA 3INGA 3TRJA 2RGCA 1GZ3A 1N2CA 3RU2A 4V0KA 3DFZA 4N0EA 2VDKB 3FPFA 4DRXA 5IEJA 5LVAA 4WERA 3BTOA 2RHBA 4CR8A 3G02A 3QV1A 1LBSA 3VH2A 3ZV6A 4DPLA 1NI5A 3GLHA 4EVSA 3ANTA 3P9YA 4D2IA 3L06A 2QYOA 2FMUA 4HI0E 1UK7A 2XMQA 4OIMA 4TMYA 3BHJA 2I9KA 1F9EA 2AZMA 2BE7A 3F4BA 4JASB 1FOEB 5AW3A 2H16A 3RDPA 3L7IA 3TKYA 5CDHA 5F12A 5CGQB 1YMUA 3NT5A 1GZ7A 5J4HA 2JGEA 5AW1A 1SKQA 2GRAA 4P80A 4QYSA 2UZ4A 2DWQA 3I9V6 5BV7A 1KYTA 2XQVA 2FETA 3FUVA 1YRYE 4KOAA 4CIAA 3WQBA 5KB3A 3HXOA 2HYDA 2FK7A 4ZT2A 2PUGA 1S6YA 4KYVA 2BN4A 5CFLA 1NTOA 4IJWA 5AKIA 3ZK7A 3BWBA 4B09A 4RHUA 2FN7A 4GRAA 1JBEA 4CM7A 1SHJA 3GDWA 4IXNA 4BJHB 1YVEI 4WA8A 1RE0A 5K0ZA 2H65A 3HC7A 2X2EA 2OORC 3IIKA 3QVGB 5DTQA 1R2QA 1YE5A 2P2NA 2QD5A 3KPJA 1L4BA 1Q7TA 3AI1A 1O94D 3DAOA 1G8HA 3CJQA 4KB5A 3VTAA 2AKEA 1E5TA 2IDMA 2DT8A 1IIBA 2C2ZA 4YJFA 1LFDB 4D8WA 3KB8A 1X1DA 3C3EA 2R00A 3ZDFA 2FK8A 4S1TA 4UDXX 3ZQ6A 2RFLA 3ZU4A 4A9AA 3GCZA 1KMIY 1DLJA 4ZRMA 1M5RA 4C2UA 4JROA 1XQ1A 2WF5A 3KOZA 3MHTA 3OPNA 3ZH2A 3HB9A 3TSCA 2GAFA 1EM8A 1C7IA 5AWFC 1NBAA 2G5CA 5LB2A 4HDSB 3AM5A 5DYWA 3LLUA 3HUTA 2HZBA 4RVUA 1OI4A 2W71A 2I1WA 2HEIA 3NHYA 2CXQA 3OJEA 1A9PA 1Z4PX 4HLQB 3IUBA 2CXXA 2WKQA 4MI6A 4E5DA 4EUFA 2YVLA 5DBGA 1SBTA 2W42A 3JS5A 4BY9E 3CRRA 1IATA 2OC4A 5DCLA 4AECA 1Z8HA 3NGLA 5ECWA 4D82A 1B15A 2NYVA 2R1VA 5BNTA 4F8EA 4Z5XA 2UYHA 3UJHA 1Z29A 1A7KA 2OZLA 1MVOA 1JHAA 2GHRA 2JJ2D 3OIVA 4MGYR 4FW8A 1U2GA 1CERA 2ENWA 4OGGA 4G3XA 5HG0A 1JFRA 1JVNA 1QAMA 2K87A 2AJTA 2VAVA 4LDJA 3CUWA 2DCUA 3K9HA 3MLAA 2CD7A 1Z18A 3L0CA 4P86A 1HQDA 2QPAA 2TSYB 3VGJA 4A6PA 4K3VA 3DLBA 1USIA 1JA1A 4FPXA 3NTOA 4URYR 3V7YA 4DWJA 3HU2A 1QTNA 4Z2AA 5KWIA 2ZM6B 1EZ1A 1UKVY 3WSWA 2XA9A 3BQ9A 3NIBA 1TMYA 3W5IA 1OPRA 3O1HB 4B80A 4H6XA 4BWFB 2W2KA 3DEKA 1QG4A 3DF7A 2ZT8A 4TV8A 4JC5A 1D2HA 1ONPA 1UXKA 1YKGA 1P5HA 3JWGA 5ARCA 5FNZA 3ZI7A 3VYUB 4EO7A 1TUEA 3FX2A 4H17A 3NC1C 4MVXA 5LXTA 1FJXA 1ZNYA 4KG7A 2L19A 4AX8A 1FTWA 2ZULA 3A0UA 3ZIAA 1NQUA 2IQ5A 3GG2A 2XOKD 4NFHA 2F43A 1UKYA 5A3QA 3BTUA 1H2AS 4RSMA 4YJ3A 3EPHA 3BMOB 2PSHA 4JI6B 2AFHE 1QHSA 1U1FA 1G8JA 3R5XA 4K0KB 1PAUA 4I5DA 4U6NA 2F7SA 1NWCA 3VR4D 5A6SA 5TQJA 1VI6A 3NVAA 4YN3A 3Q8WA 3K6RA 3PGVA 1VHJA 1N92A 1FRVA 5L40A 3ADBA 1GDTA 1ZRSA 4LGCA 1LVUA 3R9KA 2AUTA 1BN7A 4BNKA 3EUFA 1E79A 1PEDA 1JQDA 2N42A 1JXMA 4A0HA 4BNLA 4NEQA 4WVLA 4XQGA 3VHXB 1CJTC 4OBXA 1ZCFA 2UZ0A 4NFLA 5LD2C 1BA2A 2PYDA 4Q05A 1E5DA 2GHTA 3G2QA 4DEVA 1VB3A 1R3UA 4W99A 1XZIA 3HDYA 3MA0A 1OFHA 5DYIA 4BMYA 4WOPA 2GCIA 1E32A 2V6MA 1PNOA 2FMXA 3KT3A 1NASA 4K9LA 2LXNA 3QMMA 3SZLA 2Z2XA 4MGZR 4MB6A 3D3JA 3ZLUA 4E88A 1XCMA 1L7OA 1UWVA 3VPCA 5ICEA 1TJ3A 1QH9A 3FH0A 1XFDA 4IHKA 4JKYA 2Q0SA 3O0TA 4P98A 4A15A 4ZTZB 1X1EA 2GAIA 3H16A 2GNOA 1DAGA 1OXUA 2XMZA 2QY9A 4QRDA 2IQIA 3TZEA 3BSSA 4FSHA 1D07A 5HZKA 1E20A 2FZWA 2KLHA 3ZU2A 2QVLA 4ZCMA 3L8MA 4OYYA 1VFPA 4J8PA 4ZZ2A 1ESCA 3QVWA 4EO4A 1UBEA 3BXOA 3GQBA 2G1PA 1D1TA 5CA1F 1XIVA 2B82A 1AB5A 1SU4A 2Q27A 4I46A 3STHA 4RL4A 5HW0A 4R7GA 2G9ZA 1KVUA 2FH5B 1ZKMA 4LNUB 4MIEA 3S3TA 4N5MA 1A71A 1KEVA 1SKYE 4JH0A 1ORWA 8GPBA 3U6KA 1G19A 2Z0MA 4FFBB 5FPTA 1GYPA 3JTEA 4MRVA 621PA 4FHEA 5J2UB 5A1JA 1E4EA 4PAMA 4B32A 1DDGA 1H3NA 3KIPA 3O2NA 3H75A 3WYDA 1ODLA 3QUQA 1GDDA 1MEOA 3CXRA 3E2IA 3JX9A 4CM9D 4DDMA 4QREA 2QRMA 1HDIA 1LZKA 4LNHA 4XOIA 2YH2A 1V3UA 1XMXA 4XCXA 1U6IA 2ZATA 4OHPA 5EXPA 1YB7A 1A4RA 1JWBB 2ZCJA 1OTXA 3NDPA 4FUQA 3KQLA 3NIFB 4J94A 4NULA 4AY6A 4FZVA 1ZIOA 3TQCA 3QE0A 4TL6A 1R6DA 5FR2A 3T8YA 1AURA 1Z4IA 1RNLA 4G41A 4KL8S 3D9QX 1L7PA 3ZJ5A 4FCTA 2RK4A 5BVGA 1QV9A 2AXEA 2JD0A 3W9SA 2CNDA 2V03A 4G0ZA 3DZJA 3ZX5A 4WJLA 3RJ5A 4RK4A 3F1KA 2F1OA 4LZNA 1PJBA 4YDSA 3SYKA 5IZCC 3KDAA 3IXLA 1YHYA 4CLRA 4C3VA 3IERA 2FJUA 1JAYA 2ZUVA 3MS4A 3VR6H 4LXGA 3N8GA 5AK3A 2XZPA 3RS0A 3MUFA 2J87A 4B83A 4KEAA 1JEYB 2E89A 2FZKA 1KPGA 1SIUA 3PQ4A 3G9XA 5IT4A 3RVKA 3AVPA 5K8TA 2Z9CA 1T8SA 3ENKA 4C0KA 2FJPA 1CRZA 1L5SA 4D0NA 3N70A 3SHTA 4AY4A 3W04A 1YR9A 1VFNA 4JQSA 2Y1WA 3K1TA 4EA8A 2VBCA 2RHCA 2VJKA 1Q22A 2AKAB 1GRNA 3Q5GA 2ISQA 5AI0A 2FSSA 1ZKDA 3C3CA 3A1VA 3IAM1 3NNSA 4X6LA 2VCHA 1AOXA 1CDEA 1MUUA 2EKDA 1UBFA 1N5KA 2CVZA 2QRQA 5EZYF 3UQZA 1CDZA 3W6ZA 5CD9A 3D5EA 1Z5WA 1XK7A 2QX4A 2QL9A 5ENDA 3NHSA 4HUTA 3MLBA 2BY4A 2ZWVA 2BAGA 5D3MB 5EHIA 3DT9A 3WDKA 1ENPA 1NXXA 3A4VA 4BE7B 2WM8A 3I2YX 2QN8A 3GXBA 5D00A 5AVQA 4IDCA 4QNNA 3TDKA 1O4VA 3O4VA 5B58C 4UMDA 1QCDA 3H4IA 4LY3A 4G1EB 4G2TA 3UWKA 1KZ9A 2JFYA 1WSDA 3JSAA 2Q9CA 4ISBA 2DLNA 4GR4A 3DG9A 4UVHA 4YRMA 8ABPA 3U7HB 1JKIA 1EBBA 1G3MA 1WCYA 3O8CA 2ZZNA 4DJ5X 3G6KA 4UKDA 4TUYB 2VNAA 4IMPA 2QD1A 1EA7A 1SJ9A 4ZODA 1M2JA 5DMXA 1ZJYA 1JI3A 1R5BA 4KTTE 4N76A 3GFPA 3OO0A 2Q50A 1FLAA 2ZRDA 2V7GA 4Q9HA 4J3JA 2AFIA 4RH1A 3GLHB 4URVR 2X15A 5ENZA 3UAGA 2J9FA 3QXJA 1TVKB 2R65A 4IW3B 1A76A 1BE8A 3MXOA 3DYIA 3ULKA 1G7SA 2IODA 4EITA 4BFTA 5FNVA 1J8QA 3QHAA 1QP0A 4I3HA 1KAEA 2IEYA 4PC2A 2HK7A 4TKUA 3NVDA 5HBGA 4QDXA 1DEOA 3OOEA 1ADBA 2XGJA 5LIRA 2CVOA 3IV9A 4S05A 3E9DA 4RNDB 4F21A 3ABQB 3F46A 3KB2A 4NYIQ 3W2EA 2LCFA 2MTBA 5JZVA 1ZMXA 4TWAA 2YXPX 3VR4H 1FSZA 4YX9A 3K6SB 1OILA 4WK0B 1KMMA 1XQ6A 1HNZB 3USCS 6Q21A 3RVJA 3LUPA 1JJIA 4RO0A 3U0VA 2Z2ZA 1QVRA 4EB6B 2LR0A 3PTAA 4MP8A 2HKIA 1RC1A 3OECA 4M8SA 1BDJA 2DUNA 3I45A 1B93A 3NNDA 4Z0NA 4E11A 4WZAA 1CR6A 3NANA 3VVMA 5DB4A 5LOVB 3VDRA 4UEWA 4LA4A 4JA2A 4JVMA 4B3IA 3PIRA 2P0EA 1I51A 2Q5JA 4P3PA 1WTCA 1LSJA 3CNHA 4XQCA 2PKYX 3EEIA 5EKUA 2HHCA 1NHWA 2NUBA 2X5XA 2H8KA 1RI4A 2JARA 1LDMA 2H1SA 2VT7A 3FCUB 3GH3A 4LWZA 2OQIA 2IHBA 4OJKA 4C0BA 3LHFA 4YMSA 3UAOA 5G0WA 3V4PB 5KTMA 1F2UA 3SQXA 1WKVA 3FXAA 4ZYYA 5BYAA 1YBMA 5E7JA 1Q21A 1KDPA 2XUZA 3M4ZA 4DXDA 2BVNA 3DBHA 2HWKA 2FU5C 2YOHA 3O7MA 3VHLB 2Q3CA 3D6FA 1WZNA 3PC3A 1OFVA 1CB7A 1BDHA 1QVWA 2SICE 2BEKA 1HG1A 4L8WB 4A5OA 5L53A 5SY4A 1FCJA 4QICA 4Z86A 2WUEA 4GP7A 1H6DA 3IBFA 3C4VA 5B5SA 4RDHA 3UV6A 5H82A 3AMVA 1KI6A 1NXOA 4IHAA 2OZLB 1SXGA 3QU5A 5ICMA 1WLYA 2QL5A 2C4MA 1WULS 2VJNA 1VJTA 3I42A 4D5EA 4QLBA 3MQ2A 3SJZA 2V6GA 4EY6A 1E9FA 4EATA 4ZIRA 5K0TA 1Z68A 1KJJA 3O3CA 1IM5A 1PYOA 4PLGA 4WPGA 4K86A 2NVUB 4D9MA 3T3OA 1NVGA 4DGQA 1C0IA 1Y6JA 1U2DA 4RZ3A 4OI1A 4BNJA 3W5CA 5AVOA 4K6CA 4YBRA 4I1RA 1D5WA 2JFQA 5IH3A 4IF6A 3WMEA 2WTUA 1ZCAA 2RHLA 3G7NA 1GAXA 2BHTA 4ETMA 1I0ZA 3ZE0B 4FBMA 1VHDA 5JXGA 3M4XA 2BGRA 3QPAA 4OJNA 3FTQA 1CLEA 2C3UA 4R0NA 2W2KB 4YP7A 4F91B 4HEJA 4TLCA 5HTOA 1I8TA 4IY1A 1RAAA 3M9WA 5DHQA 3TBFA 4ZMRA 4N01A 3IMEA 5JC8A 1C0LA 1SHLA 4W7IA 2F1IA 2YRXA 4FFRA 3TLAA 3WMXA 1J42A 3DZHA 2JGAA 1E5XA 4I4NA 3IAEA 4EG0A 3AYZB 4BLUA 1P9OA 2E3JA 4C30A 2IS2A 3FOBA 1ABBA 3FGNA 4CM3A 1XA0A 4YQFA 4GOKA 4HZIA 4G8DA 1NUUA 2NYUA 3PTLA 4TMZA 1ZZEA 5ESXA 3G0DA 3IX7A 1UXGA 5P8WA 3R5FA 5TSDA 1CUWA 2XH8A 4JB3A 4B47A 4BX3A 5C51B 4ZTUB 1KDRA 3OKCA 1CRQA 1XU9A 4P08A 2EWVA 1YONA 3HPQA 2A4KA 4V02A 4YREA 1XOIA 3FZYA 4MMXB 4OV6B 1DRUA 1TFRA 1PNTA 5EJIA 4BP3A 3CG0A 1P0IA 1M6NA 1WX1A 4WLEA 1J4AA 2O07A 4RS4A 4PR0A 4X94A 5HVNA 3IMFA 4MVJA 4X6XA 1N2XA 3UWDA 2ZRBA 3WI7A 4ZGBA 4ZZIA 5F7XA 4OQDA 1M8FA 2L17A 5LMUB 3GLRA 4AZWA 2EGGA 4KACA 3UATA 4AJ1A 5JSFA 4F4UA 2A5DA 2XKAA 3L5OA 5DX8A 4JVNA 2J3DA 1OTHA 3BC1A 4IEEA 1JSLA 3W78A 4JJ8A 3N2GB 4I55B 4L5AA 1XTBA 4MSUA 4RHTA 5EFZA 3U1VA 5FBVB 1X7YA 4O3MA 5AUNB 1CD5A 1D0VA 4QSHA 2H9YA 1UK6A 1AKTA 1YC2A 5FEMA 4YRAA 3O8DA 4GOMD 4PYJA 2RKOA 1N3YA 1YDEA 3FDJA 3C4JA 3LPNA 4JMLA 5FADA 3TD6A 3VM6A 5TX7A 1OH7A 4DTCA 1P1CA 1M2OA 2QXYA 3ZLTA 4BO8A 1G6HA 4DCCA 4RGQA 4YA6A 5TT0A 1HE4A 4F9TA 1OX5A 1KEPA 4OHKA 9ABPA 2ZS8A 1A82A 4XQ0A 1U7PA 5LZ5A 3ZWMA 2ZTHA 3I32A 4YJHB 5FBRB 1KRWA 3RHTA 1V1MA 3ZLJA 1XHEA 4ZCPA 3CLVA 4KHZA 4ETWA 1T1RA 1KJ8A 4RGVA 1XQ9A 1YL6A 2DF8A 3V8RA 1ZH4A 3RUFA 3FUXA 4G1CA 1EVYA 1D0SA 5HCUA 1NVMB 3H5OA 3U48A 3PUJA 3N6VA 4HNAA 3CA8A 2PAAA 3AI7A 3GQBB 1MO3A 1XYGA 1X7WA 2I4NA 1BG6A 4TXMA 2DVMA 4J0KA 4JSYA 1AM4D 5I8WA 1RPAA 2HV8A 4ZVNA 2VA8A 4MV8A 4ENPA 4PXSA 4ID9A 1FF9A 2O05A 3WICA 2X0JA 4DPKA 2QVYX 5ALNA 4WBNF 4KO8A 1VIVA 2ZT5A 1NKVA 3VYWA 1E4EB 2I6SA 5A5GA 2LE0A 2OGZA 1PVVA 3NGMA 3H13A 4HSGA 2W0SA 2TMDA 5I5EA 4PU0A 3M3DA 5DBIA 4QHYA 3SU8A 1OBVA 1G6OA 2DP4E 4ENUA 4ZOQI 4OJTA 1UBNA 2VHUA 1C0EA 1VE3A 2V59A 1BXGA 3CPSA 5KNBD 3L7LA 4QEDA 3KWJA 5F2OA 2OSBA 2P62A 3B6ZA 3HU1A 4LWPA 1XDZA 3OPVA 5L3SA 1CUCA 2AX3A 1QSGA 4PG7A 4KSCA 2X42A 4BIIA 3CUSA 4FHZA 1E58A 4ETIA 2N3ZA 2Q3FA 4H31A 5KI6A 4TKZA 4V0OA 2EJCA 5IJ0B 4I1YA 4GDFA 1D1SA 3UKJA 4KTVE 1W19A 1GSOA 4KN6A 4B5LA 3KQKA 2HU8A 3D7NA 1J2RA 1QFYA 4LDRA 2FV8A 3T9EA 3FNBA 5IYZB 1IM8A 1PS0A 1PFKA 1KOFA 3AESA 3CKMA 3SZMA 2WU8A 1LBIA 1DI0A 2Q2OA 3A27A 4ZYXA 4OHRA 3KQHA 3NC0C 1VRWA 2QU7A 4QTXA 4BDTA 3HM9A 2BSQA 2YWCA 2O6HA 2R87A 3Q1LA 3Q2IA 3PIIA 4HC4A 3IP8A 2C2OA 2MU1A 4ZZ0A 3O31A 4P7JA 2XI4A 4ZEWA 2IPAB 3T5CA 4PRZA 2MIIA 4D8TA 4E0BA 4EG7A 2AQKA 2PMKA 4KQIA 3W79A 1VMIA 4D9KA 3Q85A 3G89A 2NPIA 3KJZA 4EMTA 4WGFA 1E1LA 2FQXA 4QXPA 4XX0B 1RXUA 2C99A 4EK9A 1LZLA 1Z4NA 3D3QA 2MSNA 3QF4A 5CB4F 3O2JA 4G5HA 2Q0QA 1EGMB 2ZB7A 3LRTA 3KC2A 5DV9A 5DW0A 5FTNA 4NBVA 3K70D 4WRRA 1Z5GA 1W5BA 2HU5A 3QENA 1Y8AA 4OGKA 1HX7A 1CF2O 1CVLA 1HYHA 4YWHA 1YZHA 3K0CC 3ESYA 1Z22A 1JBQA 3PXAA 4M9QA 5KOIA 2E4ZA 2HQSA 3TIXB 4WLNA 3ZGXA 2FFRA 1GQQA 1XV5A 3UFXA 4DF3A 1TLFA 3GGOA 3AUSA 5DF1A 1V9LA 3BQNB 3WGTA 4A7PA 2QTWB 3ND6A 1VKRA 2FZVA 2PUVA 4FC7A 7ADHA 2IU6A 1NN0A 5G1NA 5TPWB 5CJJA 2TMGA 1QK5A 4UATA 5F2EA 4PZAA 4Y6SA 2PX5A 1VMEA 2O1WA 3EMBA 2I62A 4J90A 4JYBA 2KBEA 3PBKA 2HR1A 5FLXA 1W1WA 1GT6A 1VECA 2CD9A 1SU7A 2IVZA 4IX9A 2GRJA 4OQNA 1UBGA 3A36A 4Y2GA 1W581 2BKUA 3T4EA 3TZ6A 2Q8NA 2I2BA 4CIXA 2CJWA 2EP8A 3PC8C 5FNVB 4ZO4A 5IXSA 2CHEA 1QHNA 5LKAA 1NW6A 1V96A 5AD1A 5K0EA 2GVNA 1E62A 3U7EB 1JIVA 2G1KA 2QE6A 3GEBA 4X85A 5AJWA 5DNYB 1ODCA 3F1LA 2GYVA 2ZRGA 2LP4Y 1VDZA 3AHDA 5I48A 4CEIB 1WU8A 1JEQA 4ZJZA 4IZOA 3GUZA 3V8QA 2LIPA 2V4MA 4JL8A 3NI2A 4Q4AA 1FPMA 4HTFB 4IQGA 1I3MA 4KGZA 1T29A 3WRVA 4PO8A 4PSKA 5DM60 5KHOC 2IS6A 4P8RA 3IPLA 1T1JA 5B53A 1P3DA 1T3SA 4L76A 1QH8A 1JHOA 1JI0A 4XVRA 1K6XA 4TMWA 4TL9A 4AZ0A 3WR5A 1WDTA 1LK5A 2WTBA 1MB4A 4II3A 4WZAB 3E22A 2ZU0C 4IYRA 2PCJA 1M6VB 4MA4A 2XY4A 4LOJA 1EQUA 4NBWA 1F2TB 4RABA 4COKA 4BRSA 1MX3A 3R75A 5J5AA 2CHFA 2AN9A 2OZKA 4OHVA 4UBLA 4LYJA 1JEEA 1YCHA 1H66A 1TC2A 3NYIA 1NDQA 3W9UA 4ES6A 4JAVC 2INGX 2V6BA 4LJ6A 3VC1A 2YV5A 1Y1PA 1P2GA 3HJBA 3R5KA 5NLLA 1E6CA 1ZD9A 2H08A 2V7BA 2YR0A 1GNPA 4C7OA 4H35A 2JH3A 1QTIA 5FI0B 4HT3B 3BH7A 1OZFA 1SXIA 1R16A 2Z8XA 4UM7A 4J07A 3EC2A 3ASZA 1NT2A 1NVVR 2W8BB 5DHFA 5CH5A 5K3FA 3CKYA 2PJDA 1XZJA 3ZZTA 2R8RA 1DIBA 3WGOA 4WCVA 1BWRA 3SBXA 3F6CA 3E7WA 3P97A 4BVFA 1X80A 3LDGA 1ISSA 2VXOA 4IOLA 1EFRA 3LC0A 1A4UA 3PQ8A 3ETLA 3JZAA 2KQUA 2QMUA 2H8GA 1NE2A 4JX8A 3WMWA 2VQFB 5ILOA 4ON9A 3EXEB 1IXSB 2W2MA 3BE6A 3LY5A 4GMGA 4ZWNA 2PRYA 3PNMA 4CTMA 3FYHA 1J9GA 1M1YB 1LV7A 3DTVB 3PGKA 5CH8A 2UXBB 2ADMA 2GB4A 2WKRA 3BL8A 1PSWA 1UJ6A 1YS9A 3MSCA 4E2ZA 3LT0A 5BR7A 3GLGE 4MV3A 2Y4OA 4KFCA 3OESA 4P36A 3R0XA 3PD1A 4IJVA 4KXNA 1C1XB 4IIHA 4BV3A 4EI2A 3L4JA 1RXSA 3SM9A 4HEHA 2H4FA 1H2XA 1L5OA 4QYXA 3EZLA 5JS1A 3GFBA 3NXKA 4QUIA 2J5KA 2AI3A 4M38A 2WU3A 3NT2A 3RM3A 2CL6X 2QLFA 1IOWA 3FTEA 4DCUA 1LTKA 5DYTA 1XVUA 1PF7E 5CM9C 2WKPA 2X0DA 2P2LA 1BMFD 1DFHA 4E6PA 1L8QA 2VDNB 1VZ3A 3N39C 4KLRA 1H8HD 3U3JA 3OPXA 2ZJ8A 2J85A 1MX9A 4LI3X 4PQGA 1FLNA 4P4TA 2J67A 1CZRA 1GOTA 3PNOA 5KNBH 2HT1A 4AKSA 4URUR 1F0NA 4GL4A 1BE1A 3P0EA 3QXHA 4EPTA 3R76A 3KCNA 1XF1A 5LWQA 4RCYA 5LQRA 1JYEA 1HF3A 5C80A 1G8FA 1P5FA 2YY5A 3K72B 1WM1A 5TGZA 2X0FA 2MDTA 1YA6A 1U3FA 1KK3A 1XLUA 5HRCA 4N49A 4ML3A 2H54A 2Q62A 4FBLA 4NF2A 3AQ4A 2HYIC 4MRMB 2WPNA 2FNAA 1VMAA 2QT1A 4R40A 1EKXA 5DTMA 3I62A 5BSKA 3VH1A 3TLCA 3ANLA 4F56A 3U80A 5CDYA 3G2KA 4Q3CA 3DEAA 3LP8A 4EG3A 1T9AA 1Y34E 2Z6VA 3WRYC 5CA0B 3RD5A 1GAWA 4I0WB 5JRJA 3T3MB 5LNK1 1N5RA 1T9GS 1T8WA 4TQAA 1IBMB 3EDCA 3JY6A 3VDXA 3OMLA 3QYJA 4TLMB 3DD1A 1NXVA 1R0CA 3BE4A 2AJ8A 2QW0X 1ABEA 3KPWA 5AP9A 2NG1A 3KQMA 4U7JA 4D3SA 5AVUA 1Q7GA 3B5JA 4G0WA 4YGXB 4GPAA 4NAHA 1M8PA 3G13A 1W4AA 1XTKA 2B4KA 2PLFA 4IV0A 3WNCA 1GGVA 4MWBA 3R6DA 1B43A 4RD3A 4BMXA 5K8CA 3TJZA 1H5NA 1Y82A 1ZK2A 5KYUA 4C06A 2RHRA 3CZRA 4OM8A 4IIUA 3LUHA 4UBNA 3TX6A 3KQSA 1KPIA 3NFYA 1NBEA 1E2QA 2W11A 1CWUA 3L1KA 4Y30A 4IGKA 3EEOA 2JCBA 2XZLA 2ZVJA 1T0UA 4KUEA 3FROA 4QTYA 4EG5A 1UMBB 3BTVA 4AO6A 5GADl 3WIEA 1ZNZA 5KOJA 4P53A 2VTBA 1LLCA 2HLPA 2IXTA 3OE5A 1U0LA 4OD0A 4XFDA 4D96A 2Q5OA 2QD2A 2VXCA 3C8HA 2OO3A 4B4KA 1NE7A 3IBSA 2X5JO 3EIUA 4O4LF 5DGCA 5F5XA 1LKZA 1M5UA 1N6IA 2QS9A 4IV5A 4W5HA 3UZUA 3WAKA 1H69A 1N5DA 1E1KA 3F8WA 2OXEA 1GPDG 1V5EA 3UICA 4F2WA 2V8OA 4RHFA 3ICOA 5IT0A 4Q18A 4LE1A 5EWJB 2FPPA 1QK4A 3WV4A 1VKNA 1UDBA 4HTAA 5T8KC 2DLDA 3KEQA 1GIAA 2PANA 4NHOA 5DASA 3TEJA 5K4AA 5K01A 2OCAA 2R8PA 4X7RA 1D4OA 3PQEA 3GV0A 4LE0A 4BQEA 2ZYTX 4YECA 4EQ6A 4OTZA 1PP4A 1BXKA 1DUVG 3KSZO 2VYVA 4M7WA 4OP3A 3MBOA 3AI2A 3JD0A 3OTQA 1EVEA 4P1ZA 2IYZA 3AHFA 3L7DA 1G291 1Y1LA 2C2WA 3MT8A 2BSAA 2PWYA 2QXUA 2R1TA 4JDUA 1AVTA 1ZD2P 3N2YA 4HS9A 3TH5A 3KNZA 4N54A 4S1WA 4R8KA 4HGQA 2J6CA 1X3SA 1AD2A 1AZTA 1YQ9A 2WJIA 2PQ0A 3S8MA 2CFOA 1KFEB 1GV1A 1PYGA 4X84A 3KP1A 2IYUA 1KTIA 3ZV3A 3AESB 4Y9DA 1OU0A 5CRIA 5A06A 6ADHA 5HF8A 3C3JA 1QWOA 1MDBA 3NBQA 4QU5A 1F9AA 1O9BA 1ONBA 3E9EA 1NBHA 1PFVA 1YCFA 3N2IA 3OJFA 4FNGA 4MGIR 3RAJA 1NJ8A 4HVAA 4QM7A 3N58A 1F2DA 4RK6A 3MFYA 3LF1A 5BNWA 4FC6A 3NOVA 2X19A 3V8VA 2WJJA 1KVQA 1ODKA 5BWCA 1H65A 3NHUA 4Y6PA 3AJ9A 4JT4A 5DHRA 3C3DA 4QA9A 1NM5C 4KWCA 1KXJA 4ZT4A 4C87A 4F4FA 4OGFA 2GPTA 1Z34A 1YR1A 3NGXA 2YINC 2J41A 4UXJA 2DFKB 4O5OA 1EVIA 3GMDA 4WCFB 3R0IA 3X1YA 1GGFA 1KERA 1RWOA 3AO0B 3O93A 2EG9A 3D6HA 4IXMA 5A5VA 3DQZA 2AEMA 2B0JA 2WF8A 1LV8A 4BN4A 2XSZD 4YBZA 3IQIX 4DJFC 3I5XA 2ENUA 3EEYA 3A8TA 1PJCA 1Z16A 2BTEA 4HB4A 2HTFA 1T3HA 3OZAA 1KI9A 2J0UA 4R2JA 4BMOB 5ITSA 2O2HA 3ICPA 3OHPA 5LN1A 1P7VA 3A6LA 1YE3A 1VLHA 4L7VA 4LBYA 3RTGA 5B7NA 1R1DA 3UFXB 5AUOB 4JDPA 1X7DA 2LWIA 3S44A 2HQBA 5KSWB 2HAEA 5KINB 1R10A 1VTKA 3DHYA 3IBTA 3KR2A 4K9QA 1YGYA 5DNVA 5H80A 2CDAA 4CMEC 4DWVA 4MW6A 2PUDA 1JE0A 4TYYA 2FFAA 1CEQA 4UZEA 3CU5A 2WJ6A 4ZVVA 1RJ9A 1IJBA 3VUEA 4E5VA 1JH8A 2VF8A 4H0CA 5DCUA 1GUFA 3E5NA 2CBGA 1AUOA 1QAOA 2QM3A 3DXYA 1IG0A 4LX8A 2W2TA 4QEZA 5GZ6A 4M8KA 4LC0A 4URFA 4J16A 2CDBA 4UBIA 3ZE8A 2O8CB 1WU7A 3DBOB 3H1AA 3IP6A 3RS7A 1L5RA 2CJWB 4JLUA 1N36B 3F98A 5EJ6A 3DEHA 3Q6IA 4FGLA 5AHWA 1GO2A 1EJ6A 2E1PA 4RXTA 2ACWA 2JJ2A 3P2EA 5DT2A 1W9MA 3E6AA 1B7GO 1R8QA 1CUZA 3LXUX 3ZDCA 3NTQA 2O2EA 1T1SA 2NYRA 3EXHA 5C5IA 1JEQB 1WDKA 3RUAA 1M2HA 2OXCA 4GRIA 4QYIA 3U9SA 1VL5A 1U3GA 1YXMA 4QGHA 2K2WA 4Q4AB 4Z9BA 3GY0A 5HZMA 1HRDA 2O2YA 1O87A 3HCBA 1JBKA 1U1EA 5BQOA 4XPIB 3WB2A 1NBOA 2LBPA 2P6NA 1V1RB 4GU5A 4Q6WA 3RLIA 4A36A 5HSGA 1QH8B 4AZ0B 1X92A 3ZD6A 3COZA 3GJ4A 4YRDA 5DOVA 1DBPA 1HNXB 2YNMD 2OTCA 3G2HA 4CT4B 3W8RA 5LKRA 3GP8A 2FR8A 2XE6A 3NR2A 5EZQA 4FCVA 3M1AA 3MWKA 4YC7A 2X9VA 1FFXA 3O92A 1P2SA 4GXRA 4WD3A 4JOCA 2BBSA 3JWEA 4UCWA 3KLNA 1Z3CA 5C4MA 1C7ZA 3LCUA 2Y1FA 4FR0A 3G5TA 8OHMA 3UC9A 4YMVA 1M0EA 2WY2D 1GQFA 2WSMA 1FSFA 1PJLA 1TIPA 5IUKC 2H1WA 3WK6A 4DSNA 2XOKA 2F4VB 3O82A 4BV9A 1X8KA 5EG5A 4CCWA 3B1ZA 2FQWA 2H4HA 3GDOA 5BQFA 4LJKA 3ZHYA 4ZYTA 5HXAA 2ATIA 2IS4A 2GQ0A 1YQQA 2JZOA 3ZG6A 2R00C 2VNIA 3D81A 4JQYA 3C6YA 1ZGCA 3GJTA 4B6GA 2I78A 1YS2X 5A4DA 3IDOA 4GM0A 1JMYA 3KKZA 3VNAA 4AUEA 2CJFA 2DY0A 4QTTB 2O0KA 1N8SA 1RIFA 4UBKA 3T9AA 3VU9B 2F17A 4EJSA 5ERGB 4RETA 2IPMA 3CUYA 3WYNA 2C2MA 4AZSA 3O8QA 1QANA 1LGYA 1EUDA 1CJMA 2JI6A 1JJFA 3JQAB 4IIJB 1BOOA 5AI6A 2NYAA 3V8BA 5AW9A 1G4HA 3LECA 2L18A 4WXEA 1E3EA 1HTWA 3G9UA 3JWHA 4D41A 1A0OA 1PQYA 2O1SA 5B6JA 3DJFA 3CYFA 4OL0A 5CYPA 4Q1DA 1O9HA 3IMGA 3RFUA 2YYYA 3RTAA 3ZY3A 1EIWA 5BWMA 1UJNA 1RI1A 2IDZA 1YK0A 4H6VA 4NCHA 3CH6A 1PZFA 3FDZB 2BCEA 3PRHA 5BNFA 3JRXA 1E3TA 4RVDA 1AMUA 1P0QA 4JBIA 2QVGA 3C3KA 4YV7A 1ACMA 4C29A 1JTVA 3TVDA 2VYNA 4Z9YA 1M8JA 1QR6A 1SG6A 2FW1A 3GJ8A 3NTVA 2CXSA 1IUNA 3IILA 3OQPA 4N3CA 4DHWA 5K0BA 1XNQB 4C6HA 4K1LA 1OA1A 1T0BA 1XCLA 4MCHA 1KZ7B 1IXKA 1IEQA 2XWSA 3ZVKA 3EGEA 3ISJA 1KEEA 1P1IA 2V0GA 4KLAA 5JJIA 1I2ZA 5AQEA 4UOZA 1JIJA 4JP3A 4DS3A 2BELA 2A33A 1NR5A 3MJDA 4LV6A 2A9JA 4RLSA 1Z4JA 3NHAA 4RPJA 3I58A 2XNJA 3SE7A 5ADWA 5LU8A 2F00A 2YHBA 3KB6A 5LQKA 1UXHA 1I1NA 4YMLA 1A7UA 3I23A 4AY3A 4XR4A 4BNMA 3KJEA 1AKWA 2YWEA 3K4PA 3NNNA 2GN9A 5EESA 1IDOA 3OPQA 2X2FA 4HWSA 1K6JA 4CM9A 1AO3A 4HBZA 2FMKA 4FGSA 3EFOA 1NC1A 4KDFA 4JLWA 2QL6A 2XUHA 2I3ZA 4M0LA 1T5DX 5MFZA 5A4KA 5F7OA 1XD8A 2X22A 5HZGA 5JXWA 2YVUA 1DCTA 2P90A 2QZ4A 4I1VA 3IH5A 4QWWA 4II2A 3JZDA 1ZUWA 4ONEA 2G82A 1GRCA 3FCYA 1MEEA 1IPFA 4B3JA 1KJNA 1GTL1 3RC8A 2ZIXB 1P29A 4AL4A 5GQSA 1UODA 2Q29A 4XCQA 2BEVB 3PC6A 4YWJA 5A0VA 1A9YA 1CIVA 3OZSA 3G49A 3I2JA 2SECE 1KE1A 3LG2A 2HA2A 3ZE6A 1QGED 2R85A 2C4TA 3BGWA 1EX1A 1V3TA 3MJEA 1UJBA 4JQZA 3ONDA 3VZRA 4DDVA 3SWWA 3AERA 5DTRA 4GXTA 1SM4A 5FLEX 3RANA 4QWMA 1KU0A 3MK31 3SX2A 2QAGC 3GLTA 2VHTA 3SP1A 5KYUB 1BD4A 4MVJI 2WAXA 1HETA 3S6JA 2XUDA 2J8ZA 2HNAA 1GZUA 3A31A 1KQ3A 3R3XA 2ZJAA 3E81A 3MINA 1EFVA 2CZCA 4NBLA 3IQZA 4DWWA 3DT8A 4BLSA 3HABA 3VOAA 5CBKA 4U6QA 1BCRA 2GTHA 5FRDA 5FV4A 2VTBB 3L6DA 2I2WA 4LDAA 3W05A 3GLSA 4M7RA 5CCDA 3DLHA 1YHZA 2I2DA 1U4OA 5FBKA 5JS2A 4W9MC 2VHZA 2C9ZA 5T64A 5KDLA 3OZ7A 1I2AA 3D3KA 3K8QA 5I4CA 1C41A 1KK1A 4TXJA 2NACA 1NYRA 1MABA 3W2HA 3EG9B 2GPJA 5IM5A 3WWDA 4FEAA 4G5OA 2J9ZB 3AZPA 1LRJA 3AW8A 3H19A 4MQ4A 1QHGA 4MK4A 4JBHA 4Q39A 5H3CA 3UJAA 5EE3A 4DQVA 4EFNA 3I12A 3V00A 1KFJB 2GNAA 1BSVA 1Z6YA 4E4RA 4TKVA 3BMCB 1QBGA 3GEDA 1T6YA 5JECA 1YV9A 2PM8A 2WJWA 5B37A 3MJHA 3R2JA 4DANA 4UTOA 5K7SA 2WIAA 2Z3WA 3K2EA 1RXIA 4LYHA 4AO8A 1KP3A 1V39A 4I1IA 3FWKA 3NBUA 1M2KA 4LRYA 4F2GA 4GG1A 2HN9A 1E9SA 4GPBA 3O8OA 2PGAA 4OU4A 1U7WA 2RI1A 3PJGA 3QEMB 2YICA 1LSUA 3WJ2A 5GJBA 3LHDA 5FTMA 2DCMA 4E3WA 4YUYA 1CZNA 2XVAA 1NRIA 3V2IA 4WEQA 3C3PA 4ZAXA 4LDQA 2C5GA 1L5QA 1XJ5A 3CB2A 3G8BA 3QUTA 4MPTA 1TZCA 5DXJA 1S3GA 3RT9A 1BEZA 3RUPA 3TK1A 2XT0A 2K5UA 2ET6A 3H9QA 4LF6B 3U16A 2X14A 3ZDEA 1B3RA 1H94A 2J48A 1WF6A 1U7TA 5BRNA 5DPMA 5DLPA 1GVHA 1XMSA 2Q2NA 4IQFA 4LVCA 4DLZA 3KSUA 3THXB 1EFAA 2FVXA 2RH4A 1DMRA 4OFXA 5B3LA 4N39A 5GIOE 1B6GA 1JHVA 3Q9LA 1S7GA 1DIOB 2D0OB 3QXGA 1FK8A 1NUPA 2NXCA 4KXMA 2QK4A 3WNDA 3OFVA 4EY4A 2G6TA 2Y92A 1GXSA 3FCSB 5L45A 2RJOA 2OV3A 2Y0CA 3S1AA 2OKGA 1BIFA 4NJMB 4E70A 1Z7WA 3U4CA 2P2GA 2WAAA 3ACCA 2HSWA 2Z30A 2HO4A 1NUHA 2IJGX 4LJLA 1TD9A 4ZJUA 1IEXA 2ISSD 1UZUA 4HLCA 1A5BB 1KY2A 4V39A 1EAMA 5HPYB 3HDGA 3AFIA 4C43A 1RC8A 1NWHA 5KZMB 1YS6A 3GLIB 4CM1A 1COWD 3TZBA 1JQ5A 4RTJA 3TZCA 1ZIPA 3RKRA 5DM70 1ZI9A 4S0ZA 4A91A 1RJ9B 1LK7A 3EVDA 4DIKA 1AX9A 1QFJA 3EUEA 2GM3A 4EMBA 5IVDA 1W8IA 2ZYIA 3C45A 4OXYA 2CZQA 4TXHA 3ZCPA 2C5BA 1LNZA 5KTPA 3AILA 3P8ZA 5C0OE 3OLCX 1KEWA 1QU2A 3E61A 1C1DB 1DLIA 1EUCB 3EZ9A 5CU7A 3JAMA 3PD0A 2LVBA 1DAHA 1KHTA 3BWDD 3FWZA 3PNSA 3P0FA 4I4LA 2BMFA 3LSTA 3VPGA 1J8FA 1Q3TA 1NYTA 3T3IA 4IVNA 3HDQA 1CNMA 3HVJA 5CB6A 1WOMA 1Y5IA 1CF9A 1JEJA 1YFLA 2BPOA 2K4MA 4FMCB 4I4CA 5LQCA 3HK2A 3R3UA 4RD4A 3P2KA 3U44B 1C9KA 3EFEA 1VHQA 4YFYA 2R6CA 3GFFA 3I1YA 1E6LA 4R7TA 3Q3VA 3RS8A 5BY2A 3ECSA 1BHQ1 1JV2B 3TI7A 2WU0A 3WJAA 4GSLA 1NN1A 3ROPA 4CM8A 2XAUA 3DDZX 3IAAA 4FGKA 1JHQA 1R88A 1GFIA 2RHOA 3KQNA 3BXFA 3IHLA 3A05A 1CIPA 2Z04A 4GYJA 4D02A 4CEJA 2TYSB 4M83A 1FY2A 3Q0EA 1DJPA 1NUQA 1RKXA 4G09A 4IDDA 4KAXA 5JFGA 4R31A 1F7UA 5ED0A 3UPTA 5ALJA 1E6WA 4DDTA 5B1HA 4U39A 1WZIA 3IT0A 5KAMA 2VAMA 1W30A 3EVFA 3KR1A 2CMDA 1C1HA 2RHTA 3LT5A 4DTIA 3T7AA 1M6WA 2N0SA 1ZI6A 2ZAOA 2OGUA 1J99A 3T7TA 3AR9A 3EAQA 3GZ4A 3SS9X 3FKSD 5DGHA 4DCJA 3P9IA 5EXTA 5JS7A 2C78A 1R4ZA 3PFWO 1AA9A 2PBZA 4R3NA 4EY5A 1MCZA 1XDGA 2Q5FA 3E8MA 1GFSA 3O2SB 4H6WA 3OZDA 1WY5A 4PIPA 3PXDA 2VKQA 4JLAA 2FX5A 2CMFA 5EZSA 1V8FA 4YDRA 3HI4A 3ZW7A 2GJSA 2D5IA 1QLHA 2GXUA 3H11B 1WP4A 3O8QB 1QVZA 2GJAA 1EUDB 3H5WA 3I01M 2DWCA 5H70A 3VTZA 1UINA 4M1ZA 4WKCA 5CA1A 2FEPA 3QVUA 4GIBA 3KJFA 3OH8A 1DKPA 4A92A 3GPDG 2GYWA 2Q5LA 4KZPA 1ADJA 2WZBA 4F5WA 1XA3A 4GHWA 2ZBQA 4D44A 3SQDA 3H6GA 1E3WA 1OHHA 1NW7A 3N0VA 1GR1A 1XDBA 1BN6A 1QMGA 5EJGA 1ZCZA 2XXBA 1MC5A 1OR8A 3LDHA 1W5AA 2GVDC 2QI9F 5TF0A 1E89A 2F8LA 2FPLA 3MD9A 1XKQA 4YAUA 2V65A 4TTSA 2O3UA 3GJ0A 1RRPA 3KS9A 4MYHA 2OP0A 4N3AA 1AF7A 3LQ2A 3S2EA 4AWXA 1DIAA 2DG2A 2UZAA 2ERCA 1I2BA 2QRJA 4X8MA 4ZU3A 2VPWA 3PUYA 1GQSA 1SEVA 1TCVA 2YWXA 3UXEA 5LA6F 1G2QA 4G0UA 1JR4A 4EY8A 1BE0A 2FWNA 1I0LA 1JRLA 1KEEB 1ODJA 1UK9A 2IXFA 2JH9A 2YBEA 3WKDA 4CJXA 4EFDA 3MIZA 3I8SA 1MOSA 3EDQA 1H8EA 2GEUA 1P72A 3NU1A 2FSVA 4R1QA 5H16A 1Y1QA 3UAXA 1VSTA 4ARIA 1SUIA 2P4QA 5CK4A 4P3NA 3AR6A 4C2TA 2NZ8A 1Z6QA 2AMLA 1E1QA 4QBKA 4QBFA 5K0JA 1WXEA 1KMCA 4FUTA 4XWWA 1VM6A 2EFHB 2GZRA 3AFOA 1MGOA 4QJIA 4OYHA 4YAIA 1BX0A 4IFIA 5ICCA 2C07A 3DOHA 3EFOB 4Z8YA 3W2IA 3L0DA 4U7DA 1TZ2A 3M6UA 2OXIA 4J4HA 1DOZA 3W77A 3K4HA 1D3AA 1EK0A 1E9VA 1L1FA 5JWRA 421PA 4I08A 3CX4A 4E32A 3VVBA 1YULA 3VX3A 4R9VA 3CNEA 3D7KA 3TSYA 3G2LA 3VYRB 3L7BA 1J00A 1V26A 1TEHA 5DNEA 2WTAA 3HZHA 5EZYA 5DSZA 1TM2A 1JFSA 4PG6A 3CX7A 4NNJA 4ZEMA 5KREA 1TADA 3Q15C 3SC6A 1H6AA 4RTSA 1MT0A 4F12A 1EDEA 1T1EA 3IHKA 3AERB 1W49A 3BWYA 2DBRA 1E6UA 3JPWA 3ANNA 3RS9A 3H9UA 1OTYA 3WAGA 3FHOA 4MQBA 1A4XA 1KYYA 2B1IA 4ZAFA 1DZ3A 3MINB 5CVEA 5E6UB 3CONA 3EWIA 2RI0A 3H2BA 4XIYA 1GA4A 1SHUX 4BLTA 4C6TA 2AFRA 4EHBA 1J49A 1EG2A 1QGZA 2MINA 5IJXA 1E5LA 4Y18A 4UAVA 3D6NB 4X71A 4ZXPA 1MOQA 4B82A 1OREA 2B9EA 3O95A 2UXDB 2PCLA 3T15A 3FJ1A 4LQDA 1BO6A 4EW3A 2YHUA 1YDGA 4X1OA 4F6CA 1D5CA 4Q02A 2JKZA 1EGHA 2D13A 4XZ3A 5AW0A 4JKIA 3QKRA 2EQBA 4FHGA 2GT1A 3PJDA 2I7VA 4XJSA 4MLZA 4AJKA 3UT5A 2A5YB 3ENQA 1RAGA 4GLBA 3L0ZA 1TA9A 5IAJA 1R6AA 2H1HA 1ZAYA 2ZJYA 3E23A 3OOHA 3GFRA 2GDZA 4JJ4A 5LQAA 3L9WA 2HJVA 4CKWB 3M6AA 3RUCA 4TKVB 2GCOB 4X20A 1V7PC 2WKSA 4PG5A 4U4AA 5F9FA 4YAJA 4E03A 2OAGA 1Z9BA 1QRSA 3GAZA 2FUG1 3EJWA 4MKHA 4DA8A 1Z5UA 2WVAA 2ZU6A 4HF7A 1U2SA 4JLJA 4YMTA 1ECLA 2MOKA 5FLYA 3UMMA 3QU4A 1SVSA 2DJIA 4TV9A 5KTSA 3ZDYB 4CIVA 1IFXA 1RCFA 1EAYA 3LVQE 4RA6A 3BAFA 3VAAA 3PDIA 2ODPA 4KR7A 3V7NA 4MS1B 1PQPA 5BMVF 4WI1A 4YMWA 1PSZA 2YVAA 1TECE 4KQJA 3G0HA 1TL7C 1UT6A 2GILA 3ESRA 4ZO7A 1B16A 2BFOA 2YTZA 4G56A 4KIFA 2AR7A 2AF3C 1B41A 1NLFA 1Z0SA 3ELBA 3FGOA 5E4TA 5IHPA 1P0CA 16PKA 1YA4A 2EF1A 3OFND 3P5SA 3CIFA 4K6GA 2AWNA 1WPXA 2V7XA 5JASA 2C5SA 4QM6A 2WYWA 1W1IA 1Z2OX 3AETB 3R23A 2D5LA 3IVXA 1D2RA 1PQUA 3H17A 4B7UA 4BAUA 4B3CA 1GLNA 3H4VA 3D5TA 4BKQA 5I4IA 4R0VA 3WK7A 3BS4A 5HP4A 3JD2A 3EGXB 4H27A 2IV2X 1YQGA 1T5TA 3MRTA 3GZJA 5K6TA 1RMYA 2Q5CA 3X2FA 721PA 3H18A 3DKKA 4I19A 5JDCA 1JFFA 5IC4A 1SVIA 3EE6A 2YV1A 2PMFA 2ID9A 1LTHR 2ASEA 4BXOA 3K0HA 4G4GA 1N6KA 2PRJA 1LI7A 1WB6A 4KFUA 4LJSA 5DBHX 2XT9A 4BMDA 2FPGB 2PKEA 2HXSA 1AKYA 1WE2A 2KI5A 3AFMA 3C7KA 1U8XX 2NSLA 3PF8A 3VZDA 2B2NA 4IFEA 2QT0A 2BM0A 4RKYA 1XZKA 4BNFA 2I6GA 4UE6A 5AH0A 4W1RA 3PL1A 3L01A 4ESVA 3RU7A 1ZD4A 3HR7A 3OX1A 3ZI4A 1CR0A 3SS8A 2EIXA 2XMRA 1QXSA 1THZA 2C2GA 3OM8A 3K9QO 4V03A 3BSWA 3I2KA 2Z2YA 4QVKA 1E9AA 1Z37A 2GERA 2I71A 1T9CA 1UAYA 1W4ZA 2ZKLA 3CLSD 1JT9A 4I1SA 2VTVA 1XN4A 1QPGA 2NUAA 1JSZA 2XXAA 3HA3A 3LX5A 2B4AA 1TKCA 1K3TA 1EZ4A 5CX1A 2DKNA 3QXSA 1D4ZA 3N6RA 4NVRA 4WGGA 1N5JA 5L6LB 1ZUHA 3CGGA 4J9VA 3EAFA 1KJYA 3D3WA 5CNJA 3PZRA 3NP9A 4TRJA 3HMKA 3X0DA 3AL2A 2UUPA 1V71A 4YV0A 1N4DA 2HDWA 4JP5A 2YFQA 3IUSA 1J90A 4EHNA 1T5OA 3DUFB 4XUGB 2XNDD 1UBOS 2TECE 4CM8B 1K88A 1YVDA 1Y6ZA 2NVOA 1PZXA 5BW4A 2QJTA 2F2TA 3INRA 2XNCA 1ZRHA 5I9TA 1GNQA 3VPFA 2MJLA 3MTEA 5D87A 3VXKA 4B17A 4ZMSA 5AXBA 4GKKB 1Z7GA 3Q9UA 1W29A 5JH7B 1BMFA 4JWTA 4X45A 4HWRA 2EL7A 3NASA 4MWCA 1DC4A 4ZAZA 3ZWYA 4EGJA 3AEZA 3IAM6 1ICEA 1E69A 1H8HA 3DE2X 5CW1A 3DR5A 5MHTA 1NVEA 1RP1A 4HATA 4F5YA 1I6MA 1ZXXA 2YXBA 3PFGA 3U3OA 1Y6GA 2R48A 1SQGA 2ZSJA 2G6BA 3WE7A 4BX0A 2B92A 2ZR7A 4XYBA 4DL9A 2HSJA 1PR2A 2ZXFA 1C9DB 4X3PA 3ZDXB 1FC0A 1TAQA 4TYMA 5C8YF 4R8RA 4XLLA 4YCMA 3RQSA 4ASUD 3BXEA 3GGDA 3DKIA 2VSOA 1EE1A 4IYJA 2IZ0A 1PVDA 3V8PA 4TMKA 1TM3E 2I7CA 1VHTA 1XB2A 2M2IA 4J0JA 3GHYA 4RFSB 3A2KA 2PT6A 5FPHA 1RIIA 2EZ9A 2ICAA 1I4TD 3DHVA 1H4QA 1KI2A 1TU4A 3U17A 5KYNA 1RXVA 1K9SA 2WVGA 1VRCA 3TD2A 5E4YA 2X1MA 5MN5A 2IZOA 1U8YA 1U8TA 4HWPA 2HJ9A 1FYVA 3F6YA 5TB5A 2DQSA 1POXA 3OA2A 4Q9AA 1QFZA 2C4UA 1R4NA 4HNQA 3UY4A 2F90A 4GX5A 3SDZA 1R6XA 3CEMA 1SA0A 3ZV7A 1XJQA 4LECA 3G2IA 1XRSB 3L4EA 1SU8A 3QJGA 1U3VA 3LLCA 1NW5A 5HOEA 1GNSA 1QIGA 3PF9A 4AI6A 4HRXA 3EW9A 1E3WB 1DOAA 1UDXA 4ABTA 4KH0A 4RDIA 3UK1A 4WBNA 1QE5A 3F4KA 4OBWA 1XL1A 3GFSA 3KJXA 4RH3A 3BRCA 4OB6A 1IBKB 2DPYA 1RTKA 1XALA 4AYTA 3JASA 3W4IA 3QLVA 2GGSA 1VJ1A 1NOJA 1Z2PX 4CMIA 5JBQA 1FP1D 4P3YA 3H6KA 1E2HA 1YFZA 2EARA 4D4LA 4DB4A 4XGQA 1LDEA 2AG8A 3AL3A 1A5ZA 3WLMA 1MG0A 4KPUA 4JR2A 4CIDA 4HDMB 3RVDA 4K6FA 3DD5A 4FFWA 4YPVA 3LHKA 5JCOA 1SXJB 3CRW1 4UW9A 5LYYA 4TX1A 1XTJA 2CNWA 2XDQA 1TU3A 2C20A 3QG1A 3M1IA 4NS4A 3OUTA 3BL6A 5ALZA 3U4GA 5HQ3B 4UOEA 1UBCA 2CLSA 3IAFA 2PXHA 3HU5A 4I1PA 3L4SO 2QV7A 3D0RA 4TS1A 1FP4A 4N41A 4WDQA 2ZBFA 3I5MA 1L4MA 1MZPA 4TZ0A 5JVDF 4G8CA 2HEGA 1DC8A 1XDDA 2CXHA 4LVOA 1TW3A 4JELA 4NONA 1R0WA 4QL3A 5TR9A 3RVMA 2WIFA 2Z83A 4LBZA 4CTOA 3S4YA 1AZLA 1NBWB 2OSVA 4KFTA 3WGZA 4FHDA 3UJ8A 1KZ1A 4G2NA 4X65B 4DVGA 3K5PA 3RGWS 1SCAA 4C0QC 3NO4A 3NVMB 4YCCA 2WWYA 4Q1AA 1R4MA 2D4AA 1ZCJA 2V7VA 1PKXA 2VF5X 2PWAA 5G41A 3K0SA 2HHJA 3MRXA 5JUWA 3R77A 3PNVA 3K1YA 4NMWA 3U9LA 3L5KA 4S1OA 1YKFA 2F67A 5EZYB 4DARA 2P2DA 3BRWD 3IOEA 2OCIA 4U1RA 5CB4A 4AUKA 3A6DA 4LVNA 3WGLA 4RKQA 4KREA 5E95A 5LYJF 5HE9A 5CDFA 3DMHA 1C0KA 5L3RA 5SV2A 3GWZA 4KDEA 4KE9A 5IAOA 3IPAA 2W0MA 3PHGA 3PQDA 1Y3DE 4B79A 1CUIA 5BSUA 2DHQA 3M2PA 1UADA 3VC2A 4S12A 4DLKA 3S1SA 5KS2A 3DOJA 3D8BA 3KPUA 3RAGA 3UMSA 4RD6A 1IHUA 4G1VA 4ZAVA 1XRLA 3RUEA 5EKXA 3RWMB 3JATA 1NR1A 3E9YA 4MW4A 2Y99A 4DQXA 1L4YA 2VQ6A 4ARBA 1AK9A 3SLGA 4YMGA 2MINB 3DBVO 2JC3A 4KQ2A 2C29D 4PPFA 3R5TA 4PAWA 4I4TF 3HYCA 1FFGA 4B48A 3FDFA 5FA5A 3KOOA 1IN6A 1T2DA 3FB1A 1SUPA 2XBMA 2GVZC 1PV4A 3U4IA 2AWOA 5DO9A 2HMUA 5D3QA 2H06A 4I9NA 5BSTA 3JQ7A 3UF0A 2G72A 3U3KA 4C0AC 1OI2A 3EDYA 4ENWA 2GN6A 2HCJB 4ZC8A 3TNDA 4IIDA 5IVKA 2AR0A 2XSZA 2VJLA 4E33A 3G2MA 1XLWA 5JWOA 1I3NA 3LH5A 4S35A 3I61A 2XZDA 3PGA1 4UE3S 1CULC 1I2CA 3SR3A 5FEUA 4M99A 5K0CA 1TF2A 2HBYA 4LHZA 4P4NA 4UNNA 1N7JA 3KBOA 2I29A 2XKKA 3L8HA 3GAMA 3M34A 4DMKA 5JANA 1RS0A 1L4HA 2OD2A 3LW8A 4GPIB 4Y8VA 3THOA 4QKQA 3OQJA 3NHJA 1T34A 2R96A 4FD2A 2P2YA 2BKVA 4QATA 4XDZA 5G4KA 1WMFA 4BIMA 4TV9B 4WA7A 5TMPA 3VNQA 4RA6B 2JGDA 2PUWA 1Q2UA 3CNBA 4M9SA 3EIWA 5DTJA 2FMHA 3ROGA 1JG2A 1FQJA 5D1HA 4WN3A 3ZDQA 1G0NA 4BTEA 3YASA 1GV0A 4R4JA 2Z57A 4LOAA 1MNAA 4OQPA 4Q9KA 1KOLA 4GMKA 2IY8A 3O2QB 3H9BA 4R6WA 3RIMA 2P4SA 3HKBB 2OPHA 5CCXA 3MUNA 3CUTA 2VOJA 1J0XO 1G3RA 2IE8A 2QX6A 4TWIA 1Y9AA 5DCWA 2C88A 2YYZA 1AXEA 4DR2B 1OXXK 1GUDA 2A1UA 3GDGA 3H65A 4IDPA 3T54A 1CTQA 3W5VA 3OOSA 3KXPA 2CLIB 2FWRA 2FFBA 4RE6A 3W06A 1YVUA 1GRQA 3SDSA 1XD2A 3KYIB 1G7CA 5DM1A 3KQUA 5FBZA 3ICWA 3V1LA 4BV2A 3DE6X 3FW1A 5FTJA 5GJWC 3H83A 3UMYA 5B4TA 5DSXA 1PJAA 2X8LA 4G0PA 4XWYA 3HP4A 4BMCA 4FP9A 3JR7A 5ICSA 2YNMA 1SWVA 3M9XA 3RIXA 1N2EA 3WWOA 4DQUA 4WNCA 4Q4JA 1I9CA 5EJEA 3LKBA 2EKQA 3C15C 1EWTA 5E4JA 2C83A 4GE3A 1IRIA 4DJDC 4LMBA 4BXOB 1VRVA 4MICA 5U4QA 4DG5A 3VKHA 3JYLA 3J81A 1ECPA 3I04M 3F2VA 3V48A 3A9UA 2FQQA 1ZJ4A 4ARCA 4KNYA 2GBIA 2SCUB 5BWOA 3TLXA 3W6UA 4NP6A 1KBOA 4YH1A 3HDTA 3QBTA 4L4XA 1O94C 5BYKA 1XPOA 1ACJA 1ZVMA 4BQFA 1AKVA 2H52A 1RZUA 1XZCA 4ZOLA 2FW8A 1TEZA 1I10A 1N6NA 2P0YA 1A2OA 3WYFA 2X7JA 3QLJA 5A71A 1FP7A 2BGMA 1MJGA 2ZI9A 1ZXLA 2YIDA 5EC8A 1X3LA 2J3LA 4KK3A 5TDHA 1E4OA 1Y7LA 2CUKA 4KXXA 3ZE9A 2AJLI 2PZJA 2AEFA 4OJQA 5I7AA 1J2TA 2CXOA 2JGRA 3AP2A 1YOVA 2FCRA 1EINA 2WWRA 2J4CA 5IVPA 4R8VA 4RIGA 2Y76A 4XFJA 3G7UA 4YRGA 2WUVA 3VSEA 4J16C 1WSWA 1X1RA 1YR6A 1VXRA 4DYHA 2PR7A 1HQCA 2BEJA 2IP4A 2P27A 3EYWA 2AG5A 1OB5A 3I53A 2I54A 2GESA 4ZKEA 4ED9A 4MR8B 2GSDA 2C2XA 3SJBA 4X1IA 5F9MA 4HJXA 2B5WA 1IYZA 1PFYA 2NSHA 3T1QA 3Q7QA 4EHLA 1B0ZA 1T5SA 3EXHC 3OT1A 4LGMA 1Y3IA 2X8JB 3TM4A 3H0CA 4FLMA 1NNUA 3KVYA 1W5SA 2G1JA 4ZO9A 5JJ5A 2PS9A 4ZOCA 4PWYA 2FYTA 5B4VA 821PA 3GJRA 1NI3A 1CEEA 2PXCA 5CDUA 4V1CA 1T3LA 3QHQA 1TUBA 2LW7A 2XT6A 3MZ0A 1ZBQA 4R69A 2OV2A 2J45A 5E1MA 3JXEA 5EVJA 4LJRA 4BO7A 3GU3A 1IK6A 4HZUA 3KL2A 3HLTA 3EIXA 2UZ3A 5IJAA 5KC9A 3T0FA 4XGIA 2LKDA 1Q92A 4I50F 5BRAA 2BEWA 4TRMA 4MWEA 3WX0A 5H9WA 1ML3A 1Z7EA 1JB9A 2O2IA 2WV7A 3DFFA 3FRHA 3V46A 1OFTA 2G9VA 4QJ3A 2BUCA 1ZHFA 1QVVA 2AFHB 2ZRKA 3EOZA 4S2EA 3K32A 4UD2A 1C3OB 1LU9A 2G8NA 5GJCA 3UAWA 3W34A 4DMHA 5B3JC 1ST2A 1SWWA 1JFTA 1ZK0A 2XCRB 5A0TA 3GO4A 4PTYA 4CF5A 1QONA 2ZB4A 2ZRFA 1D7OA 1T4BA 3OD5A 4IIVA 3WNZA 1W4CA 5G40A 2JJMA 5BYBA 2QTMA 1YAHA 2QENA 1PR1A 3GPCA 1W36B 1R4NB 4V0LA 4D9JA 2ORED 1WAMA 1SA0B 3EA4A 4LCJA 4HRAA 1R8SA 5D6OA 1NHGA 2ZIFA 3GA0A 4KLNA 4CL8A 3EA5A 4OBEA 4U00A 4AU1A 5HK9A 1CYEA 3HE3A 1NURA 1ZGBA 2VVTA 2O0JA 3OTHA 3OZEA 1JDVA 4RV9A 4N7BA 3S70A 2B8WA 2LIVA 1EK1A 3ZCVA 4EJSC 4O4LA 2F48A 2XITA 3NUGA 5DBEX 5F7ZA 4DT1B 4WBNB 5BW5A 1T8UA 2IW3A 4JBGA 3WK9A 5H0IA 4P5DA 2V45A 3D1JA 4RY9A 4QG3A 2GNPA 3CC8A 3E4DA 4KXYA 1R66A 4KX5A 5JFOA 3ABRB 2PZ8A 1WDMA 2GLUA 1CZKA 3GRRA 2VH5R 3LT1A 3OTGA 1JDBB 2VDMB 4NTZA 4TMFA 1O8CA 4JVOA 1M34E 4RESA 4ZTBA 3SC4A 3MF4A 3BXZA 2PVCA 2JPDA 4FFMA 1SUWA 1PWXA 1QQ5A 2FSPA 3W4KA 2F1JA 2IHKA 2O8NA 1B76A 4G5QA 1S2GA 4RACA 5BV8A 1DG9A 4RA9B 2J9GA 4IMJB 1IUOA 4EJ2A 1EFHA 2C2HA 1V9SA 3A1EA 3OJXA 2XDQB 4Q4HA 2YHIA 1VIDA 1VLLA 2GRUA 1DX4A 1SVLA 3ORHA 4NDNE 2AXNA 3SSMA 4IOJA 3T06B 2XEDA 1ULAA 2P2SA 3K0BA 4TTVA 3KVNA 4FTWA 1J6UA 1QYDA 2W6ZA 1YL7A 5AK4A 2CJPA 2A4MA 1J2JA 1Y33E 3D31A 3HV0A 3HYLA 4MQLA 5CAEA 3OSZA 1UOQA 3B7PA 4IIBA 5C34<