1FCJA

Crystal structure of oass complexed with chloride and sulfate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
302
structure length
302
Chain Sequence
SKIYEDNSLTIGHTPLVRLNRIGNGRILAKVESRNPSFSVKCRIGANMIWDAEKRGVLKPGVELVEPTNGNTGIALAYVAAARGYKLTLTMPETMSIERRKLLKALGANLVLTEGAKGMKGAIQKAEEIVASDPQKYLLLQQFSNPANPEIHEKTTGPEIWEDTDGQVDVFISGVGTGGTLTGVTRYIKGTKGKTDLITVAVEPTDSPVIAQALAGEEIKPGPHKIQGIGAGFIPGNLDLKLIDKVVGITNEEAISTARRLMEEEGILAGISSGAAVAAALKLQEDESFTNKNIVVILPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O-ACETYLSERINE SULFHYDRYLASE
publication title Identification of an allosteric anion-binding site on O-acetylserine sulfhydrylase: structure of the enzyme with chloride bound.
pubmed doi rcsb
molecule tags Lyase
total genus 110
structure length 302
sequence length 302
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2000-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fcjA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fcjA02
4WX2B 1J0EA 1V71A 4ZQCB 4OREX 5J5VA 4D8UA 2CLKB 2V03A 1WKVA 1K8XB 1UBSB 1WBJB 5I7RA 1KFJB 2J9YB 5KZMB 2CLHB 1UIMA 5I6DA 2ZPUA 4L28A 2ISQA 1J0CA 3X44A 2CLEB 4D8TA 1QOPB 1BKSB 4HPXB 4LMBA 4D92A 5IWCA 1FCJA 1K7EB 1V7CA 2D1FA 1J0DA 1Z7WA 5I7AA 5B1HA 4LMAA 2EFYA 2C2GA 4D97A 4D9NA 1C29B 1E5XA 1KFCB 1OASA 1WDWB 1Z7YA 1TZJA 4JBLA 3ZEIA 3SS9X 3PC2A 4HT3B 3R0XA 1CX9B 1TZ2A 5HBGA 1PWEA 1TDJA 1P5JA 2Q3CA 4D9MA 4D9EA 3BM5A 1WTCA 5T6MA 2J9XB 3X43A 5I7HA 2ZSJA 4L27A 1X1QA 4D96A 1TJPB 3L6CA 1PWHA 3PC3A 2ZR8A 4AIRA 3PR2B 2GN2A 3VBEA 2CLOB 3R0ZA 3RR2A 2DH5A 2GN1A 4L0DA 1VE5A 4D9CA 5I7WA 1KL7A 4D9IA 3VSCA 4ZU6X 3V7NA 5B55A 3VSDA 1C8VB 3T4PA 5B1IA 3HMKA 4L3VA 1D6SA 1F2DA 2TSYB 4D8WA 4F4FA 2BHSA 2DH6A 2Q3DA 2ECQA 2PQMA 2BHTA 4HPJB 5CGQB 1TTQB 2ECOA 4NEGA 4PCUA 4D9KA 1JBQA 5E0KB 4AECA 1J0AA 2RHGB 2EGUA 5IXJA 4XUGB 5D86A 5I7OA 1KFEB 4H27A 1BEUB 3DWGA 4IL5A 5D87A 4OFXA 4JBNA 1A5SB 5DW3A 4D9GA 5JJCA 1TTPB 1RQXA 5IW8A 1K7FB 5J43A 5D85A 3IQGX 4I1YA 3FCAA 1A5BB 2J9ZB 5B53A 3VSAA 4KKXB 1A50B 1K7XB 2O2JA 1FUYB 1Y7LA 1UINA 4LI3X 4NU8X 3DWIA 4COOA 1A5AB 2CLMB 1V8ZA 2TYSB 2RH9B 1VE1A 2GN0A 3VC3A 2O2EA 1CW2B 3IQHX 2Q3BA 3L6RA 5D84A 5CVCA 5DW0A 5KINB 1M54A 3AEYA 2CLFB 5EY5B 5BW6B 5C3UA 2RKBA 3SPXA 4D99A 3TBHA 4QYSA 1TZMA 1KFBB 3SS7X 5DBEX 3DKIA 1TYZA 3L6BA 5B3AA 1K8ZB 5DBHX 1K3UB 1O58A 5DVZA 2JC3A 1K8YB 1QOQB 1J0BA 4ZU1X 4D9FA 1VB3A 2CLIB 2TRSB 3PC4A 2CLLB 1C9DB 4Y6GB 4D9BA 3FGPA 5B36A 2WSYB 1KFKB 3IQIX 4HN4B 3IAUA 5JISA 2C2BA 3CEPB 1TZKA 4HO1X 3AEXA
chains in the Genus database with same CATH superfamily
4YA6A 5JFGA 1J8FA 3ZNQA 4EG7A 3UIEA 1M5RA 5CPFA 4EKIA 2PUJA 1KHTA 1U2PA 1O4WA 2V0CA 3CF2A 3PUHA 4MLPA 1HNZB 1XVAA 3PHGA 3T8YA 3ZWBA 2XTNA 1T34A 5C9ZA 1FCJA 1BO6A 3WYDA 4BFTA 3PBKA 5IABA 3CG4A 1DAGA 3U5TA 1X3LA 2QZSA 1ESMA 3B6MA 2BN4A 3P4XA 2IPNA 4GYWA 1GU1A 4F4JA 2JDID 4N6GA 5IVHA 3PK0A 3PKZA 2O0JA 2IK8A 2O1XA 1T8WA 4NJEA 4Y30A 4BVGA 4PC1A 3RJTA 4H1WA 1TZCA 3F3MA 5DBIA 2XKJE 4EBBA 3OCJA 1PFUA 2A5LA 1DO0A 1B26A 5AKYA 3GJZA 5K3FA 3D3KA 2AA3A 1FZQA 2I6SA 1F20A 4EFKA 2C9BA 3GCWA 3TLYA 4B8ZA 3ZLTA 4ZYLA 1CIJA 1NC3A 4NMLA 4RZ2A 2NTEA 5AKJA 521PA 1ZZGA 2XMCA 3A1DA 2D4HA 4EB3A 4LNUA 4NENB 4M8IA 1CR1A 1TJ4A 3BMQB 1SCQA 1ZOOA 4BX2A 1TB4A 3UKJA 1RNLA 4YONB 4DMHA 1DKLA 4PYMA 1Z6TA 3D6UA 3ER6A 2BMDA 1YZHA 1ZN9A 3PV0A 4J6FA 4V0NA 4DN6A 1RM0A 2H07A 4DL9A 2UZ0A 2YVLA 3IP7A 4PZZA 5BSRA 5DNCA 1ZAKA 4FNAA 5H9WA 2NZXA 4H6XA 4C2BA 4GR4A 5AH0A 3URMA 1XQWA 4IEIA 1MAUA 2CCGA 2NTYC 5JXIA 5I01A 2AJBA 1RQLA 9LDTA 3I5AA 3RTDA 3HJNA 4DV5B 4Q9NA 2WWIA 4WKGA 3WWZA 1ZRSA 2QLBA 6YASA 3HLTA 4CMEA 4DC0A 1FSPA 1PE0A 2PLNA 2PX8A 5IW8A 1KEWA 1KK0A 3IDQA 3V4SA 5KNBH 4WCDA 3CX6A 3OQIB 3P0FA 3L6UA 4FN4A 1EX7A 3CZ9A 2RB5A 4PLPA 4LEIA 4TRRA 3VC1A 4CL0A 3C4QA 3EZFA 4KODA 5ALGA 3G1TA 4MUMA 2W6ID 4X85A 2BGIA 4N5LA 4BC0A 5JXJA 5HTOA 4EZBA 4MV1A 1Y81A 5JI2E 1O87A 2YWDA 1DRVA 2WP0A 1XAJA 3RVLA 2AFHB 3W6OA 3PDCA 3FJ1A 4QA9A 4Y2JA 5IHXA 2DZDA 5KSPA 5F9FA 1IBRA 4Q1CA 1GTG1 3CN9A 2IXBA 3FCYA 3G5MA 1YJ5A 1CJBA 1QCZA 3PRJA 2LPMA 3R7LA 1CZOA 1FDRA 2ZAMA 4MVJE 2VF5X 2D5CA 4QFMA 3CRNA 4Q3EA 3V1KA 2JLWA 4JVOA 1PK9A 2W2LD 4EHLA 4G1UC 2GZ1A 2QD5A 1VKZA 5EJ9A 4KX3A 1IQRA 1Y1PA 4LY6A 1GA4A 4N40A 5JOQA 5FWXA 1L6RA 1HKHA 3OWXA 3MMSA 5CB0A 2R8RA 3EC2A 3AJRA 3ZHBA 3M3PA 3RVOA 1JTVA 3IOCA 4UAUA 3OEWA 4FR2A 1TMYA 1EUDA 3FGPA 1J25A 3AIIA 4OP3A 4KPGA 3Q6NA 3L9WA 1I3KA 1A7JA 4UARA 4HDMB 2OYCA 4CLRA 5JTTA 2YFQA 4BQEA 3WO0A 4N7JA 1A5ZA 3NCHA 2VT6A 2C4HA 1GJRA 1V71A 2VUHB 3NZEA 3D4OA 5TT1A 3CGWA 2XBMA 5DN6D 3EPPA 1UBMS 5J4LA 3ER9A 2FFJA 2RAFA 4K9OA 1N8KA 3QTBA 3CLRD 4BZZA 1IPFA 1J97A 2VT3A 4R2KA 3VU8A 2OCKA 3EA4A 1NUSA 5EJ8A 2IS6A 2PPLA 2PXCA 4GYKA 1GCOA 2G08A 3I28A 2ZANA 3PIIA 5TQ0B 3UENA 4DY6A 4K9MA 2X0NA 1JR6A 2P6OA 4DA8A 5DF1A 3HXMA 1UPUA 1KARA 1JBKA 1DJLA 1GYQA 1SIOA 1GNLA 2CVPA 2G40A 2VP0A 1JEJA 3L02A 3OPYB 1R0WA 3T0GA 5F3WB 1NRIA 1G8KA 1KYVA 2CNBA 2GPTA 3CSSA 3TJRA 1VLQA 1KKUA 4AY5A 4CT0A 5DTEA 3GPCA 2MYPA 1P4GA 2V7XA 4ND5A 5EMLA 1OA1A 3NIWA 5B3KA 1HA3A 1U98A 1V8DA 5CYGA 3CLHA 2G8LA 5F21A 1EP9A 3GLTA 5LQCA 1AKYA 1ZJ5A 3R3JA 4YT5A 3WGZA 5ALFA 1U0LA 4RFSA 5B1EA 2ZCJA 4NIMA 3K0FA 4ZEOA 1P1CA 1SOVA 3PQ5A 1RKVA 1VMDA 2SBTA 1AJEA 2AHRA 2QW8A 5T8KC 4I1SA 2PMBA 2JCSA 3DQQA 3QOWA 3ELUA 4HQOA 4H17A 4ZA2A 1JHMA 3AR9A 5C4IA 1D1TA 4U6QA 4F7WA 4OQMA 3WK4A 1U0GA 2BEUA 4GC5A 2FE4A 2HCBA 2XMGA 1D8TA 3OZAA 3OEYA 1UDRA 3W4KA 1FMFA 2BGNA 3ELDA 4CW7A 1XDUA 1PQYA 3E53A 3KLOA 1XJWA 3PDHA 3RLIA 5A4KA 4W63A 3ZCTA 2R47A 1QAOA 3LVBA 5DX8A 1UKEA 2Q5IA 3SBEA 3G59A 1WXXA 2BY4A 5CNIA 4TS3A 4X3PA 4ZAWA 4AY6A 4GE3A 1A72A 1CUJA 1FSFA 1LZKA 3MW8A 5DCYA 1UMCB 4JP3A 2B4RO 2ZI6A 5HK8A 1N2HA 1VSTA 4EI9A 3EXAA 5CIYA 5CX1B 1JSRA 5T6BA 5JSHA 4EHAA 2HT1A 2EKBA 3FR8A 1JA1A 2GCIA 1Q7EA 2FSVA 3L0YA 3S81A 4B47A 1SULA 3FVQA 4M7WA 5ALSA 3QELA 3TLXA 3A1NA 3KLBA 1AA9A 4L51A 1O89A 4AI6A 1C3XA 3ZUGA 4BKUA 2IYXA 3KZCA 5DYYA 3RYFA 5BUZA 3HACA 1PS9A 3WVNA 5EWMA 2F1JA 1Z34A 4AMVA 2ZJ3A 1TRHA 2G9NA 1K86A 4GO1A 4WNCA 1P1HA 1VPLA 4IDBA 1QRTA 4CIAA 1P4RA 5BMOA 1KEZA 2V7QA 5LZ2A 4PWYA 2PQ2A 4IH9A 2QU8A 1E5DA 1GGNA 1DAFA 3JRXA 4BV9A 1OX4A 2DSTA 3CZ5A 1G3UA 3FPBA 4RPKA 1SQ0A 1UXIA 4U9HS 3K6SA 3WK7A 1SG9A 3NP7A 3CX7A 4B6EA 4PZ0A 3TNJA 1U7UA 1RFLA 2DB3A 1UBRS 3TW4A 5GZ1A 2IH5A 2QMYA 3P9QA 1TK9A 5C34B 2O3RA 1TADA 2J5RA 5IJAA 4E12A 3IJPA 4N8EA 4PC6A 4ATNA 4EJ2A 2C07A 4BCDA 2CJPA 2QLMA 2VKQA 5EIBD 4FEYA 1SQ6A 3PYXA 3EXG2 1AHIA 1F0PA 4C0WA 5B58C 1RBYA 2P2LA 3I0NA 2FPSA 1TLFA 1VL6A 3PVCA 3BJMA 2CBXA 2G63A 2QENA 3D0KA 3W5CA 4UOEA 3KQUA 1QFZA 3MINA 2P9QA 2PLRA 3DE0X 2KBEA 3A4MA 3DFKA 3SJUA 4RGQA 3ZE6A 3LBYA 1C7RA 2E5WA 1XIVA 5LUAA 1S1MA 1U4SA 2PT6A 4IV5A 3SLKA 4D44A 3SYTA 3ZI4A 1K2VN 2Z0MA 4AN4A 3NKVA 1ILEA 3D0OA 4WWHA 1MJGA 1MRZA 3OZCA 4QHSA 4KO2S 4HUTA 5JCXA 4NR0A 1Z6AA 4B3RB 3IO3A 4FI3C 2MINB 3I9JA 3N1UA 4C87A 4KV9A 4U39A 4UFOA 5EYPA 4JQZA 5HZMA 3UW3A 3WIUA 5IWAB 2CEAA 3KQKA 3FX2A 1M2VA 2FVYA 1TAQA 3LHDA 3WNBA 3FSGD 4CMIA 2VZEA 1EM8B 3I1IA 4DCMA 5LIPA 1QKIA 1Z5WA 3F73A 1GPNA 2GCPA 1W0CA 4KUHA 2FKNA 4M1WA 4QKQA 5ADWA 5IFKA 1NN5A 1SO8A 1GY8A 2RHWA 3QTTA 4EJSA 6REQB 9MHTA 4A8PA 3LYHA 3LGAA 3R9IA 1ZC4A 4DWJA 5C5CA 1BD4A 4AP6A 1TM4E 5JMWA 4YRBA 1F2DA 3BBLA 1DX9A 3S1SA 1W47A 2QRKA 4GPIB 2ZIGA 4XEUA 2OBBA 3VGJA 1T8TA 3O9MA 5B7QA 2GEUA 3GFBA 3H5IA 3S5UA 3BIXA 1DBIA 3ZI0A 1E18A 2AR0A 3MJCA 1NVBA 1EB8A 1UCFA 2XF8A 1KYXA 1Q2UA 1BDBA 2UZ1B 3JD1A 3RSLA 4F97A 5AVQA 3B6KA 2JPDA 5ITVA 1N78A 3K9QO 1FB5A 4OJNA 1M6WA 1W93A 2NYUA 3LRPA 4X8MA 2XEXA 3PUJA 4RA9A 5L4NA 4FZ5A 3DW3X 1G4UR 2GAFA 1QWSA 1ESNA 3OE7D 4C7XA 1UJ5A 5A4AA 2F62A 4LI3X 1Z6XA 1RQGA 2G07A 3Q0IA 4OV6B 4OAQA 4YXWD 1GN9A 2BFCB 4H08A 2FEOA 2GK7A 1O96B 2H2HA 5KQLA 3U7QB 3IUNA 1Y9AA 3WFIA 2X8JB 2FWRA 2FRXA 3I0ZA 2HBQA 4YAJA 2H57A 3NTXA 3O3OB 4LCEA 4U8HA 4HK4A 3S8EA 3DTTA 8ABPA 5THKA 4DMFA 1KMMA 1IG0A 1DQZA 1QV6A 2CL0X 3N2YA 3ZE9A 3UMYA 2P8JA 3DKRA 3TRJA 3QVVA 4BV8A 5ESWA 4PWZA 5CH3A 1AUPA 2PZMA 3H2YA 1WD5A 1YO6A 2B20A 2GM9A 2QAGA 2VTKA 4JUIA 2G5PA 4UM9D 3MT8A 5FR2A 1ENOA 2CZGA 3K0SA 2V6MA 2W8BA 2BFWA 2CLLB 3EZYA 1HOXA 4FGLA 4AYTA 4CM7A 1Z15A 5LOVA 2HRRA 1V6CA 1SGWA 3ZCQA 1JA9A 1FDUA 1GGFA 2IZ5A 2YWEA 3F8WA 5AJTA 3V4LA 2R79A 2AEFA 4UM8B 4X6LA 4HB3A 3EUFA 4DLKA 2B99A 2JB9A 2OL4A 4DSUA 5C81A 2X5NA 3HB1A 1S0UA 2O2DA 1ATIA 5IZ4A 1MB0A 1UM9B 2HXGA 2P6UA 3G9XA 2HK7A 1IY9A 5JS8A 3THYA 3OOJA 1C9EA 4EPWA 5J1SB 4KOEC 2C5GA 1FA9A 1SBHA 4MYRA 1WL8A 1EGVB 2Z5VA 4OIFA 3ENKA 1OLSA 4CN8A 1ZCFA 2YHIB 1UZNA 2C42A 3EPKA 4X62B 1D0SA 1FQWA 1QO0A 1YBFA 3VOBA 1RQ7A 4F8EA 4DRYA 1FL9A 5I48A 2L17A 3SR0A 1PZHA 4IIGA 4MR8A 1D4AA 4IZ6A 1DT5A 3ORFA 2CUNA 3ZDYB 1OI4A 1PNOA 1W30A 1W76A 3QA9A 4BNZA 5JYDA 3ON5A 2GF0A 3ZK9A 2R1ZA 3SC2B 1Z5UA 2VSYA 5F9MA 4O5AA 3IPYA 2FPMA 4LKRA 5FBKA 1NMQA 1TFRA 3KAJA 3A9CA 1TDJA 1VKJA 3L1UA 4J1SA 5CLQA 5I9SA 2VQFB 4EDHA 3ERCA 1BU8A 4KYVA 2GUGA 3BXOA 2X15A 3Q0EA 2V4MA 4H60A 2OO7A 2LCIA 4M1QA 5DM1A 4F3KA 1L4GA 2CXHA 5CAEA 1NQAO 1FUIA 3PC3A 3VV3A 4CG1A 4ZRMA 1NZFA 1UPXA 2CLOB 2ETVA 1V37A 4CMAA 3IILA 3JWHA 1WABA 3L93A 5LDGA 5C1OA 3JASA 1NSTA 3KJIA 3EVBA 3OTIA 3W7VA 4YX9A 3V7NA 2BZSA 2Q45A 1PG5A 7ABPA 2FPIB 1CUDA 2AZ4A 4Q15A 3ZUPA 5BN1A 9LDBA 1YZNA 4EY8A 4LDAA 1FXWA 1NT4A 3MTQA 3KYCA 4BMOB 4TKVA 4YDQA 5CDHA 3RKRA 1PL6A 2HF8A 1TM1E 1V1JA 3MOSA 2YN4A 1CY8A 1L5ZA 2VNHA 1SKYE 4MWCA 2HIMA 1HQKA 1Z13A 3U0BA 4ALIA 3A6FA 2FQXA 1AGNA 5JPCA 1XELA 1JQKA 2O3TA 3DQZA 3ANYB 3EUWA 3GT3A 3BMNA 1RBQA 3AVPA 3GJ4A 4KRXA 1B43A 3VHQA 1LK7A 1U1FA 1XZIA 1YJAA 3DE5X 1A2OA 1N5LA 3ETJA 4IIBA 4N0EA 3UMJA 4CWAA 2NQ8A 1XZNA 2ZS7A 3PQDA 4FHEA 3AHEA 1A9RA 3CPJB 3NDIA 2FW1A 3JW8A 2GCOA 4HUQA 4QBHA 4NCAA 3MELA 3H9UA 1X80B 1L8AA 2YJ6A 5EJ7A 1BAPA 1OYYA 3O47A 1SVMA 2QT1A 3C74A 3L7MA 2AEMA 4LQ4A 3KUDA 1IZ9A 1FSSA 2HMAA 4WSOA 2AFIA 3T5CA 2QT9A 2G4CA 4CM6A 2QA5A 2NV6A 4Z4HA 1I0ZA 3TQRA 4QREA 4V0QA 4B5LA 4DE5A 4YRMA 1B6TA 3I2KA 2O0LA 4IGFA 1YULA 2D13A 4MUHA 4C4AA 2HGZA 1TIPA 4W9NA 4OBWA 3HPRA 1J1ZA 4YMLA 4US1R 1Y42X 2ETXA 2HSEA 2TECE 2YW2A 3NHUA 2BSQA 2D2XA 2FN3A 4J9VA 2JK1A 3BX1A 3IUBA 2V55B 3IOEA 4Z86A 1VHJA 1WCWA 5AXBA 5C8ZA 1ZXBA 2DT8A 3MCTA 1C4XA 2BI8A 1UIMA 1I1OA 2GD1O 2HUNA 3UB2A 1KOGA 4PZ9A 1DFGA 4EGQA 4U5QA 2HU8A 2GBLC 4MQBA 3WXBA 5KDDA 3HCAA 3B5JA 1LVHA 1IHXA 3JQ8B 4M0PA 1GDTA 1DWPA 3GFRA 3ICOA 4DCGA 4WJZA 4KQJA 4NXMB 1KOFA 2AT1A 5B7NA 4HTAA 2JBWA 5K4GA 3PPVA 4MUKA 1NN3A 1ZMBA 5AIAA 3SIPA 2CMFA 4JR1A 1YKGA 3K9NA 1CUHA 2GBGA 3SOZA 1NJ8A 1OTYA 4B6FA 4JODA 1T8SA 4MKFA 5AI5A 1E7RA 3GGGA 1TZ2A 3N6VA 2JI4A 3NPMA 3R23A 4M9UA 4O2BF 4NENA 4X0EA 3BMQA 5I8ZA 1PIWA 2PGAA 1P8JA 1IH8A 2WKPA 3D0RA 3PTZA 5DLPA 3T9BA 3T3HA 5JAUA 4BE7B 3T5PA 1RC1A 3EYAA 1BDHA 4TWRA 4UBMA 3VKWA 1F0NA 2NAPA 2OLKA 3QVKA 4KI0A 1PS0A 3WNZA 4UQOA 5CG2A 4F5ZA 3JQBA 5FBWB 3U7HB 4XDHA 2VHWA 2C4UA 4P2BA 3W06A 1C14A 3IYLW 2PANA 4IWYA 2UAGA 3G2IA 4BAGA 1WU8A 2Q5HA 4JI2B 1I8TA 2B4KA 1G0NA 1PS8A 3JVUA 1R0ZA 5G0TA 3NYQA 4MKZA 4BQRA 2IYQA 3CX8A 4N47A 3QFTA 2HWYA 3PXXA 4XJSA 4V0KA 3RSGA 3KX2A 6GPBA 4JIGA 4M9CA 4MUYA 4NDZA 2ODQA 3RUDA 4DFDA 5J4HA 1FUKA 2R6DA 1UBFA 4Q16A 4TLBA 2GK4A 3OQIA 5DYNA 5HE8A 3U37A 3UJDA 2Z6UA 3U7GA 2RHGB 4HDOB 3WP0A 5CA0B 1KZ1A 4GM4A 5JC8A 1FIUA 3TLEA 1X1RA 4B7UA 4LK2A 2BM0A 3LDUA 4LBWA 5CEEA 3COWA 4CMHA 1N6LA 1N32B 2CFIA 3V3TA 2J5BA 1T3ZA 1EUCB 4WLVA 3EEYA 3KOYA 2BH2A 1E94E 3MNFA 5A4IS 4X66B 5KYVA 3WLMA 5BWNA 1CZLA 1II9A 2AE1A 2PKEA 3VYRB 4BO1A 1ZK2A 4TYQA 5B57C 3PNLA 4L4RA 5GY7A 2ZTHA 4AJ2A 1F4VA 3HXPA 4OX9Y 2ERXA 2GN4A 4GNRA 2PUAA 1BWPA 4Q7MB 4ND2A 4ECEA 3CUWA 2WYOA 2HDOA 3WISA 3O1IC 4QYSA 1PK7A 5D01A 2GETA 2ZJ4A 3AR6A 4LJ4A 4PS1A 1VIDA 2ODWA 3DO6A 4K3UA 2FRDA 1ZGCA 3NBKA 2JKYA 4LRSB 2GSDA 4MB6A 4G4SP 1G3IA 5ICFA 1OWPA 1P2BA 3FIUA 3AI7A 1I36A 4HDMA 9ATCA 1JBEA 4KMSA 4PQFA 1U02A 2DM6A 4TL7A 5L7TA 1GSIA 3LZCA 1PW5A 2HSJA 2FHPA 3MYYA 4D9BA 3DAPA 3VH3A 5LSAA 5CA0F 2AJTA 3EGEA 5C1IA 2CGEA 4NYJQ 4ZKEA 1PGPA 3R6DA 2XLBA 3JYOA 3HSKA 1ZOIA 3JQPA 3R41A 4PINA 5JNWA 4EH1A 1G8AA 2PJUA 5TQ0A 4ZO4A 1DUIA 2QUBA 3R6GA 2CLKB 3BZWA 3HXTA 3KWMA 3FZYA 3CKYA 3OUZA 1L4LA 2WFLB 2ECKA 3MUEA 1ZA1A 3V8VA 3OPYA 4B6SA 5EE3A 2WU8A 1VBMA 1X0XA 4GEGA 3I3SR 4URUR 4W8HA 4UPVA 3KDAA 4H77A 4K81B 2I6UA 3AKZA 2X6RA 1D5WA 3KB6A 1P4AA 4CIXA 4QDZA 1ZR2A 3KU1A 3ECCA 3M33A 4JB8A 3KXDA 1NNUA 3HXLA 1GU0A 3CRQA 1MUUA 4UU1A 5FKJA 1L7XA 2MT9A 2H7VA 3H8JA 2IU4A 4QM6A 3EZ6A 4TL8A 4KMOA 4JN6B 1YB1A 1ZH4A 4QJ4A 4L5IA 5IC6A 2EFDB 1B16A 2O2XA 3D6JA 4OLFA 5TEVA 3LV8A 1A76A 3QHQA 1R8JA 1FW8A 2BKLA 3K7EA 4QSHA 5CFRA 3HV2A 4Q9LA 1EFRD 5K7SA 3O8NA 1T0UA 3OZEA 3ZIAD 1X7XB 2ONKA 1Z73A 4HDQB 3G13A 2FMIA 4ZAVA 2M6KA 3RUCA 3UK0A 3WMFA 4IIUA 4QYMA 1H8HD 2HMSA 4JBYA 3SK0A 2XWBF 2A0UA 4X20A 5ALJA 5DSZA 1MO4A 4PX2A 4J76A 3ZZ0A 5F98A 5IH3A 3B7WA 2A0FA 2D8AA 4NHOA 1S8FA 4LV8B 2B8WA 1KAHA 3LQFA 4TXHA 4DMUB 3OFNA 4RS3A 1UMCA 5AVXA 4BLPA 4E1BA 3C1AA 1T8PA 5ILOA 1P9NA 1RXVA 5CX1A 2BR5A 3BTUA 3FPHA 4DDVA 4CPDA 4QTXA 5KBYA 3DPUA 4OHYA 4LMRA 2VZ9A 4DPKA 3OUTA 1F0KA 5HUHA 2PSSA 4LSZA 1PV4A 1QVZA 3HQ4O 4FCCA 4LX8A 4YUVA 3VVLA 4F92B 2F8MA 3HSSA 3EGCA 2WJJA 3CEMA 5SYNA 3BOSA 1YUMA 1SXQA 3DNMA 1M8PA 4LJ6A 2YUTA 1M7BA 1V4BA 2ZJ6A 3H5AA 3EH2A 3DKKA 3KVNA 4I1YA 4U2EA 1E98A 2B4QA 4UZEA 4YCSA 2XUKA 4ZFNA 4MV9A 2YHUA 1IBMB 3NG1A 3G8YA 2XZLA 2WQZA 1U3GA 4ONEA 3Q9LA 1E0SA 4P4UA 4JJGA 2CL7X 3QE9Y 1LU9A 2GD6A 5M5BA 3ZLBA 3CH7A 2HDWA 3FMIA 1MJNA 1TF7A 3M4JA 3R44A 5LXTF 2FU5C 4UHBA 1N2ZA 2VHQA 4BYMA 1YHYA 2PG3A 2VJQA 2O4UX 4IIHA 4LZLA 1M72A 4R81A 2A0YA 1AKRA 1KP9A 3QRWA 5GZ6A 5CT9A 3P9SA 1WW8A 3I61A 2RHBA 5AI0A 5FULA 1VHLA 1O9BA 3L05A 3ZTTA 4U6NA 3I3OA 5D3ZA 4D9FA 3U4DA 3E9YA 2PJRA 4Z54A 4FYWA 3BC1A 1C41A 4N1AA 2F9FA 5F78A 3PC7A 2OO5A 4IDDA 2VJDA 3JD2A 1MAVA 1UK7A 1J70A 1M0SA 2G3YA 3JSXA 4GG1A 5JATA 4UUBA 2QIOA 3RG2A 1VTKA 3TTVA 2J33A 4HXYA 4FGZA 1JHPA 4NEQA 2G0NA 2QY9A 5F77A 5CK4A 3ZWAA 1ETUA 1GSHA 2P6MA 1NMYA 3AB7A 3EGWA 3R3ZA 4RK4A 4XM1A 1EDDA 2BFFB 1SKBA 3RSHA 1C8BA 4FWTA 2PUGA 3H2SA 2A67A 2WUGA 4D57A 5EMKA 2Y77A 1XXLA 1K89A 2O2GA 4JP5A 5CB4B 1N1GA 5KVCA 4YJ2F 3BFKA 5EQFA 1NBHA 1BOOA 4QOHA 2FETA 2AMJA 3RK1A 4GOND 4CCWA 4G5SA 4DLSA 5ALEA 1UQRA 2MINA 2PH7A 1Z83A 1KJ9A 2NO1A 1E3LA 4E11A 1GZHB 4JC8A 1SJ9A 3QSYA 1QGED 3SS8A 2XVYA 5MHTA 4GMGA 1QK4A 2HC9A 1KI9A 3WGJA 1EGQA 1EM8A 3DBIA 2N0SA 1YI1A 1R9JA 4BQQA 2QXTA 3IE1A 5CUQA 5BOSB 3DMFA 3AUYA 4BO2A 2VYQA 5GJCA 2IOHA 2QTLA 4LPKA 2VK2A 5BYKA 3C3PA 2YJ3A 3CLKA 3ZE7A 3OZRA 1O97C 1WZNA 4H31A 3UAOA 1YZKA 2I8AA 2QRQA 5JMOA 2QN9A 1LZLA 1WO8A 3IXMA 5EUQB 2HAEA 5EUBA 4DLBA 4KIWA 1UJCA 4GLLA 4UZFA 2HQ1A 1CUIA 2UZ1A 1LNZA 4KFTA 5CM2Z 1U7ZA 3BYZA 3R2JA 2TSYB 1G20E 4ROSA 5JCOC 2B83A 3HC7A 4JJFA 2NNWB 2WT9A 3I39X 5KB3A 5HDBB 3HB5X 1KJNA 4KWEA 5ECDA 4XRGA 3U49A 3RNOA 4BNVA 2YXPX 1U28C 3U4HA 1CHDA 4IIEA 2IZZA 2J30A 4U0KA 3SDBA 4CF4A 5L40A 1TYEB 4F91B 2Q6OA 4LF8B 1WSWA 1RMQA 2BFCA 3X2FA 1O96A 3U7QA 3D64A 3DHVA 4GICA 3H0KA 4N9WA 2K2QB 5KU7A 1U1CA 4EBFA 2BV3A 3IALA 2O2JA 3K2IA 2IE8A 2DAPA 2FX5A 1OPXA 1GGHA 1UINA 2RCNA 3PGVA 4MP3A 4TTVA 2J6CA 4RVCA 2C4KA 2JGJA 1QSGA 2EKLA 2QKYA 1POXA 4I9GA 4UEQA 4L73A 4X90A 3NJ8A 5AICA 1G1AA 3SJBA 3B5IA 3ECSA 1UJBA 2BCGY 2JJQA 1FRFS 2YVUA 3FKSA 4RZ3A 3NGLA 1R6AA 1YVRA 3OEHD 4FI3F 3K9FC 1U8AA 3NEAA 4DB2A 4NQZA 2X2OA 2EJWA 4P86A 1GG8A 1EG2A 1EWTA 2J6BA 1JJBA 2PT9A 1G6KA 4NNPA 1P29A 5ALZA 2R6JA 1M10A 1KFBB 3PB3A 2OXEA 1D1SA 3CPEA 4BBPA 1Y3FE 2KE5A 3N2KB 2OK7A 1XK7A 2IA5A 2XE4A 5D1NA 1NW6A 1RAHA 4CDGA 4YLYA 4Q3CA 1H6CA 1GGJA 2Q1WA 4LYDA 3AK4A 5AK5A 3T7RA 4W5JA 2Q1YA 1TLLA 3K0HA 5CH8A 1PJAA 1DT3A 5JBQA 5DLYA 1UM9A 3OHSX 3KE9A 3TZ6A 2QTVA 1OV6A 1USKA 2G36A 2WQ7A 3IR6A 3LQQA 1E6EA 3IPXA 3VZRA 2FSFA 4FFPA 3WK9A 1Q91A 1UFQA 2G9RA 4AMUA 5A7FA 4YCNA 1FFAA 2KSQA 2YHIA 5BO5A 3OJLA 3I12A 5LUBA 1H1DA 4DLPA 4J7AA 3OZGA 5NLLA 1NJ2A 2Q2NA 1R12A 4EEXA 5DYTA 3SHQA 2CD9A 1BX1A 2BDUA 3C3KA 3SZRA 1R3UA 4KRFA 1Z3IX 2UVPB 2WMOB 2JIRA 1E4YA 3TSWA 3IB3A 1KAGA 4RSRA 5E95A 4E7PA 2HQBA 1E1KA 1ZZEA 4AMYA 1ZJ6A 1KSGA 3SNHA 3ZQ6A 4H0NA 1VMAA 2XQGA 2BGRA 4F8JA 2WA1A 3BDAA 3NPAA 5DBOA 1DO2A 2CFRA 2ZJOA 4PX9A 3ZV3A 4DABA 2XOKD 3RU2A 2F8TA 1S3GA 1KBOA 2JI7A 2A5FA 2C4MA 2IF2A 3O1JC 2I4MA 3QF4A 3U26A 4H16A 4CF5A 2YV5A 2QM3A 4ZALA 3ABIA 4NU0A 1S9DA 4XDZA 3VISA 1QFSA 1CV2A 1AZSC 2WDPA 5HF9A 4DNPA 4ZVOA 1S01A 3SM9A 2C9OA 2YQ4A 1JJ7A 1RPNA 3HDQA 3BGIA 3JAWB 3PFBA 4F3CA 1KJJA 1EAYA 1FP4B 3ZY2A 5FUWA 5I4CA 4LKOA 2FPIA 2MSEB 2O8FB 4GPTA 5A6SB 1GD1O 3WWPA 3C3MA 4DSOA 1FRQA 1U0HC 3H2GA 2VJKA 3NHLA 3D3EA 3UJHA 4G0ZA 3VOTA 3EH1A 2J32A 3KXLA 5LD2C 1RWNA 3OO1A 1DQSA 1T5OA 4OU5A 5HEKA 4IXNA 2OA0A 3DOEA 4HGOA 4OMCA 5JVDB 4L57A 1XQ6A 2WTUA 5BV0A 4WK4B 1AF7A 1FFBA 3OMXA 3SVTA 1NRWA 4RKQA 4LOHA 5JE8A 3V6LA 5HZKA 3RC2A 1IJEA 2FW8A 2YMLA 1DX6A 1DDGA 1OA0A 1Y4ZA 2FQWA 1Y8QB 5U4XA 5D7BA 2E87A 3UAWA 4JLMA 4FGWA 4PVCA 3FCAA 3M5DA 5EKDA 5EMHA 1JQ5A 1U9ZA 1KJ8A 3WB2A 1M1YB 1QMPA 4XCVA 3KKMA 2VH2A 3NEJA 3QVGB 3BS4A 1V7ZA 3INRA 4NS1A 4OYHA 1NUHA 2A30A 2BKAA 3W9BA 1WDKA 1Z0UA 3WNQA 4OI0A 3RBXA 3F8TA 4ME6A 5JAZA 4JOSA 3DTVD 4CT5A 1XTQA 1JT2A 5KVQA 1T9ZA 3B1ZA 1XLWA 3O7WA 3V1TC 4Q3AA 4UCQA 4YRNA 1PJTA 4MH0R 4H3VA 1JMYA 2VI5A 5K6AA 5L7WA 1H93A 5GPBA 4N7MA 1R0SA 3RO7A 4ER6A 4KR3A 4FE4A 2O0MA 5BQPA 3GD7A 3NVMB 3SKYA 4LRTB 1MGOA 2VS1A 3P97A 3N3AC 4QEKA 1BVHA 3E03A 2J3HA 3CY6A 4BRWA 3LECA 4RKYA 4OQPA 4J3NA 1XDDA 4F5WA 5I9LA 4Z1OA 3MLEA 3ZVLA 4JR2A 1UXJA 3SC4A 4G0OA 3WRXA 4Z9FA 3DQPA 3HS3A 2PIDA 3PRKE 2PMWB 1YVDA 2ZB3A 2D2VA 3KLNA 4QQ8A 1DBQA 1EJ2A 4YRJA 4XQ9A 4I4CA 1GQ2A 2PGOA 3FFAA 4EM6A 2P5UA 4HWOA 1E6LA 1GAWA 3FOCA 3I73A 4HQ0A 5KOIA 1N1MA 3O3CA 5DGDA 3ZGVA 3AY7A 1FK8A 2H2DA 4JFRA 5JSZA 3T15A 3U39A 3CYFA 2AWOA 5IBQA 2IP2A 3VR4A 3O84A 5HUJA 2V5VA 4RA6B 1PTKA 1B0PA 4QARA 1TTTA 3DBVO 1ZD8A 1E79A 2JJ1D 2QRPA 4XIIA 1BMDA 3JRNA 2NSYA 1XMVA 6Q21A 4AQYB 3LOPA 3QMVA 2JFZA 3NIFB 3AC0A 3BXFA 4KXMA 4OHXA 2DTDA 2HKIA 1AX9A 3EQ8A 1QP7A 2ZUUA 3MCZA 3WJ2A 1JHAA 1JKJB 4BVEA 3ICVA 4DA9A 2QTZA 2PLAA 4GBED 4M7OA 5IKPA 3K20A 3SIWA 4WLOA 4QT0A 4YJKA 5LLDA 1D9XA 4WKCA 1CT9A 4M53A 3VR6A 2QLTA 1ICEA 3PC8C 2NUAB 3EN0A 5KJEA 4ZOAA 2HRQA 4K03A 3BWEA 2VDKB 3ZLUA 5JV5A 3EZ9A 4QICA 1KERA 3C8HA 4E2YA 4CKCB 3BB1A 5FEUA 3F7TA 3L4KA 4MA4A 4LI0A 2H0RA 4DJJA 3ACCA 1NU8A 1P5FA 1ZGGA 5EINA 5A0FA 4BMZA 4N7BA 1NP3A 1SBQA 4YROA 1XCOA 3H05A 4FC6A 1JP7A 2FFHA 2Q41A 4XGIA 1NIJA 4MITA 5CXSA 5AMXA 1J2EA 2D2EA 2YV4A 4JT8A 1DC8A 1ISIA 5B6PA 2CDCA 1SKUA 3AKCA 2OGZA 3GAMA 5GAJA 1YOVB 3FXAA 1NBMA 4N6NA 4R16A 1T8RA 2BLLA 2OV1A 1XNQB 2OBYA 4JXKA 5TGTA 1C80A 1EUCA 4Q5IA 2H29A 5LPNA 1CEQA 1UBOS 2EQ5A 1TAUA 2J3EA 1CG6A 4QJBA 4M99A 3RJ5A 3VUEA 4EY6A 1J8VA 3DWGA 1U8FO 4O0MA 4EJ0A 4MDEA 3T5DA 3L43A 1L5NA 4B75A 3Q9SA 3N2LA 3ZCXA 1GYPA 3T3IA 3C48A 1YE3A 3DZGA 1ZD4A 4X8HA 1NATA 3OP4A 5P8WA 2A0XA 3UMMA 5B53A 3VV2A 2R8PA 1DKOA 4LDZA 4E32A 1FYEA 2ZAYA 4B4KA 3EBPA 2QTMA 4G0XA 4LZWA 4M83A 4MGEA 3F96A 2VBGA 4O1MA 2OCAA 4V1CB 3OQVA 4DZZA 2GTPA 3J7AC 2J6IA 4C0JA 2ZYRA 3EULA 4LJAA 3OWHA 4POAA 3WXMA 1OILA 5JD4A 4DV6B 4X5OA 5C7OO 2YZMA 2O54A 2H1RA 5U4QA 2W37A 1KDRA 4ZYTA 1V6SA 3KKEA 3N8GA 3JD0A 2UYYA 1OZGA 4XPZA 2XZPA 2JRCA 3CGGA 5CBKA 3G8BA 3MA0A 1E66A 1UQUA 2GYYA 4BMSA 1L7AA 1N8NA 2BHLA 4JYCA 4OMUA 1Z16A 1WCXA 2HCFA 4R8LA 1ENZA 2VAPA 4CQMB 2BR3A 4MAMA 4UVEA 2FSIA 2YV2A 1XZGA 3MWDA 4Q7JB 4RQBA 1YR1A 1P9WA 1ML4A 1PFKA 1A4IA 1WZUA 2I7VA 2P41A 4H3KB 5ECWA 2QTWB 1WTAA 2HZBA 2DLDA 2B1GA 3MFYA 4G5QA 3RFTA 4NBSA 4BNXA 3T7DA 4A73A 4O25A 2AQKA 3IAS1 3UB3A 1YACA 2L18A 3G85A 1EDZA 3VH1A 4EHIA 3ET5A 2IUYA 4RQTA 2I67A 4MKIA 4G9EA 1K63A 5D2CA 3MBKA 5E3IA 3RRMA 4C3UA 3KQYA 4TLAA 5CG1A 1BE8A 4QVGA 2QLFA 3OJ0A 4AS2A 3COYA 2O5VA 1SU6A 2J3MA 4KXWA 4BX3A 2WB2A 4RHYA 1RRMA 2GHQA 3IBGA 5I7UA 2XCSB 3PUXA 2PEZA 5AKKA 4A2WA 2UUPA 3OU6A 3OZSA 4KTTE 2Q2VA 1JFSA 5KSZA 1ZO8A 2Q21A 3N59A 5JWOA 4IHJF 3GYGA 1KEUA 4EL5A 3K9GA 3TM5A 1KYQA 3C3BA 1X7XA 2Y1DA 4HFJA 4UUOA 3WQBA 1XDGA 1XMOB 4LY3A 3IUPA 1FE8A 2CFOA 4I5IA 1ZG3A 3E35A 3TGPA 1VDMA 3ACBA 2FMFA 1QJCA 2ZGVA 2YASA 2ZBUA 4MICA 1KQ3A 4L1KA 3DVQX 1MABB 4JJZA 1DRUA 4KNVA 1S3IA 2HPVA 5KKCA 3D9QX 1NPTO 1SG6A 4I4IA 4S2UA 2I76A 4FMCB 1F7VA 1GO2A 1X13A 4BECA 3CISA 1M2JA 1C1HA 4GPAA 2HY7A 1E1RA 1E0KA 3ZBQA 2R6R1 5EKUA 2VKTA 3CO5A 2ZTSA 1KI6A 1JAXA 2FF7A 1RLTA 2J87A 3HMKA 3LXXA 4GX1A 4PBTA 5FPQA 3ODPA 3UJ6A 3JD3A 1KGDA 3LUPA 3JAMA 3AO0B 3GUYA 3FFXA 4HWKA 5EKXA 4BU0A 2EHDA 5F23A 5IM5A 5ADHA 2NZ2A 3T1YB 4QOEA 2R60A 4L9SA 5G4KA 2NOAA 3MQFA 1SXIA 1NM5A 3K32A 3O21A 3OCXA 2CMGA 2Y3IA 3HFGA 4FGUA 4KIUA 5DYWA 4QU9A 1N7IA 1PGOA 2Z09A 2P3SA 4PRKA 1WHSB 2CK3A 4FSHA 4KMRA 3Q8MA 2J9ZB 4ZICA 4RJJA 4X1IB 2B1JA 2JJ2D 3K0CC 4P3NA 5EAIA 3CIFA 4PTYA 2QE7D 1E3WB 2VF2A 3U61B 2QN8A 3OY7A 2AOWA 1V8ZA 4JL5A 1UK9A 4E5NA 5JNVA 2C0PA 3NP9A 5HJ5A 5BMVF 1YVEI 4GGMX 4Q00A 2VUUA 2P2SA 2WJ3A 4H7HA 4IQ0A 3A58B 3TMYA 4DDMA 1LV7A 3ROGA 3ZW9A 1DJQA 2YDYA 2XUHA 1E9AA 2OE2A 2QZPA 1ITZA 1GNPA 4A6XA 5BQ5A 3SYNA 2J85A 1ZM9A 1FNDA 2O07A 3TSCA 3U17A 4YRLA 2P0AA 4XAQA 3N9IA 3GEDA 3V5NA 4LCJA 4K7JA 5BPFA 3HZHA 1R5OA 2AH5A 4ZREA 1Y5IA 2OBNA 3RAJA 2TRSB 3CVVA 4EKNB 3D4LA 5DLDA 2UZ4A 1AQLA 3SJCA 1E1CB 4ECAA 2BFFA 4NYMQ 3W2HA 4F56A 3WP1B 4YUZA 2H5JA 1JVNA 3UXYA 2V9CA 3L9XA 2A9FA 2XXAB 1XK6A 2B9EA 1QRAA 3KAQA 2J41A 4ZCSA 4HGNA 4X3OA 3SDSA 5E2AA 2CMDA 1HT3A 4GGPA 3GZNB 3LCCA 3OCWA 4YV1A 3TL2A 5DASA 5FPTA 3JYHA 3TRIA 2ZCVA 2GARA 2QDXA 3E7FA 1RCTE 3I5MA 1Q16A 1PTJC 4J0KA 1ULBA 4AULA 1P2VA 5HKKD 3PFIA 3W3ZB 4WI1A 4N82A 4CR6A 4E08A 5JXGA 4QUEA 4FMBB 3QMPA 2Q9CA 3ZD9A 4TX1A 4BDSA 4DEVA 4YUXA 3UCFA 5BYAA 2QUZA 1J5XA 1W34A 3GV0A 2GTIA 2ST1A 3B2EA 3I1JA 4LC9A 4O1IA 4WD3A 5BOSA 1YOBA 3EGIA 2EU8A 2YX1A 3VZQA 4CMCA 1T2DA 2QTRA 4PLWA 2H4YA 2R7AA 1DAHA 3E84A 4V0ME 3FUXA 5AJXA 5B2FA 2IP1A 1UP4A 4Y9RA 1PJ2A 2EERA 2O2SA 3B9QA 1Z88A 3NH6A 5H3LA 1I3CA 2D5IA 2ZKIA 2A9JA 4ZOBA 3OVMA 2OD2A 3JQAD 3LA8A 1XCMA 3LF2A 2J9RA 4L3OA 3GBPA 1RMYA 2TMYA 4TSRA 4KYUA 2ADOA 1KIFA 1VSUA 4Q39A 4NV0A 1P1BA 5CB8A 3ADCA 3GPBA 3NHRA 2GDZA 3E8SA 1KMCA 1JR4A 3GMSA 3LUBA 4FD2A 3RV4A 2ZSAA 5G0VA 4C2AA 4BUJA 3VSCA 5F35A 5B55A 1A97A 1Z4NA 3W2IA 4IXWA 1L1RA 1N9GB 4JZKA 4Z1MA 3SICE 2WF7A 3P0IA 4AIIA 4K5QA 2Y1GA 2WSSD 3LPLA 2WTXA 3BAZA 5A0TA 2ZI3A 1SVLA 3HFRA 4R4JA 4DQDA 4HI0E 3B20A 1P39A 2ZUSA 3QEMB 1M0EA 2YYZA 5L3QB 2HHJA 1WDMA 2NWQA 4L85A 4M8NE 4RYDA 1GG2A 5ICMA 3BIOA 5MFZA 3RREA 4DLTA 2CJWB 3LP5A 1W0JA 1A7AA 3DWFA 3R40A 4NCKA 3ZHCA 5FI5A 5H3HA 1DKQA 1YR3A 2I2BA 3SAJA 5BPHA 1HX7A 3B52X 3WR5A 4CKBB 1M2GA 3KHSA 4XIYA 1ISGA 3RS5A 4AUNA 3A05A 3AB3A 3DFZA 3GFPA 3K8YA 3SQOA 3NVDA 4J16C 1SVNA 4J0CA 1PP4A 4FX5A 3ITNA 2YWJA 3OCZA 4CTJA 4ERNA 3AF1A 3K73O 3WE7A 3EGDB 5J2TF 5HIAA 4C7OB 2NU6B 3N2KA 1RI1A 4LTDA 2XECA 3U4MA 3CRW1 2GNAA 3DMPA 3LUGA 2PZBA 4OI4A 2D0IA 2QRGA 4MW1A 1MAAA 4BXOB 1DOAA 2ACWA 2J7PD 1G0OA 4HY3A 5ITWA 4XB1A 4B34A 3PVZA 1VPTA 3JYPA 3WTCA 1OFGA 1IVSA 1AUVA 3P9RA 3KQQA 4PQYA 2OBXA 1U63A 2BUBA 2IHYA 3UV3A 4HNHA 5DO9A 3S2IA 3K0AB 3KZMA 3ANTA 2WUVA 1D4FA 3MJTA 4KG7A 4KWHA 1H3EA 2OB2A 1MJHA 2VQ6A 3RV3A 1I2AA 5E7MA 4BMDA 4D42A 1MO3A 1Z5NA 5G40A 3GRAA 1RAIA 1RKXA 2DYKA 2UVPA 4CGYA 1COWD 5CDUA 5I4BA 4QNNA 5CYPA 3SKVA 1OX5A 3MILA 4OXQA 5J58A 1N5MA 4DM3A 5C7LO 4XQ0A 1C7JA 1UK8A 3GUHA 2CL5A 5U9CA 3UJ9A 4B48A 3EVDA 4C6RA 1YS9A 1CUUA 1RYNA 4DGSA 4YMTA 4YMUA 5ESRA 2GCGA 3U9TA 4PSAA 2XUZA 1RAFA 2Q6KA 4NHEA 5CFLA 3AHHA 3E5RA 4HDAA 4NSNA 2Q9BA 1N6PA 3PEUA 4UVIA 2AOXA 2EG9A 1TW3A 5C4MA 3JQGB 3JAWA 1H2RS 2EDCA 5I4KA 1YASA 4KB5A 2BZ0A 1D1QA 2C3YA 2WE7A 3MN1A 1JQDA 1T9CA 5ER9A 1KO4A 2B1RA 3GJXC 3UA3A 1W19A 5FBHA 4IIXA 4HQRA 5A6SA 3KLMX 2W2OA 2B8EA 1VPWA 3LW7A 2PMEA 3KPWA 1HSZA 2W43A 3TEFA 2AFRA 2WVGA 2CN1A 3OOSA 4LHEA 4RV5A 4BNUA 3QEKA 3W5BA 1TJNA 2OAGA 4MVJF 1OBVA 3HLKA 3JWIA 1EFTA 4ESHA 1JE1A 1CUZA 1BGWA 1N7HA 3NASA 3GDOA 4ZVQA 1SXJE 4DIUA 2FB9A 4QG7A 1I4LD 4MCJA 1DJOA 5E4YA 2V8OA 5JVDA 1V25A 2AN9A 3CLVA 3H0CA 4IVRA 1DEXA 1N7JA 2B0JA 1WZCA 3M6VA 4TVBA 5YASA 3H11B 3U3XA 4B3HA 2G1PA 2W90A 4K0RA 5KTNA 3F9CA 1I7PA 4I1RA 4UFNA 5A03A 2NSHA 3D4NA 1R50A 3PX3A 1PSWA 3ENZA 4B7ZA 3INNA 1Y8QA 1LTHR 5IBCA 2EKZA 1G9XA 2HGSA 3R24A 2E6UX 5ALUA 1CB7A 3M82A 4HMQA 3QXJA 1GA6A 1XPOA 5LD2B 1VL2A 1IK4A 1XN1A 1M1YA 3OM9A 5JS7A 1PI3A 1LUAA 1ZVVA 2PR7A 4MV3A 3QVGA 4LYFA 3R5FA 3AHCA 5FTNA 3EA0A 4KVZA 4FWIB 1QBGA 5GIOE 3R5TA 2OHVA 3HFJA 3U7IA 5LQUA 4IF4A 2C4NA 1Y7TA 1PNTA 2VAMA 1M34E 2XX3A 1VFPA 1CUYA 4PTZA 1RQPA 5TE9A 4COOA 1R6TA 3IMFA 1V5IA 2ZYWX 1OHHA 3G6KA 1JQEA 4QJ5A 5DDIP 5FUXA 3OFJA 3OIYA 4LRUA 2WABA 4MPPA 5DXFA 2JI6A 4BIIA 1E58A 3DCIA 3A1EA 2C88A 2ONYA 3EY9A 3RBAA 1R9GA 2IELA 3QOXA 4LQCA 4FHCA 3SQNA 1EUYA 2I9KA 2R1VB 2HYIC 4WXPA 3RVQA 4Q1DA 1X1DA 3OE4A 3GEHA 1TMKA 3UICA 1DAIA 2GPSA 3F98A 4ZD6A 4E0BA 3QWBA 5ENDA 2LGJA 4X97A 4AKSA 3O4HA 5BR1A 3STHA 4R2MA 1FUUA 2CLIB 5BQFA 1TD1A 1WDTA 2JIZA 4D3DA 3GH1A 1TF5A 1PKXA 3DUWA 2ZTMA 5K0JA 1L5HA 2YWXA 5B30A 1LPNA 2EAUA 1R7RA 4W6QA 4K9RA 3NOVA 4B46A 5IVIA 3RS3A 4MLDA 4HTFB 1RHUA 3JRWA 4QGGA 2MSKA 4RHTA 4IDEA 3LBHA 3VM6A 6LDHA 3E4DA 1KJZA 3BCUA 1NMEA 4RA6A 2JIDA 2X2PA 1BMQA 3DL4A 2K4MA 4CUZA 3E9EA 4QT4A 4JJ6A 4L4ZA 2B6HA 2ESRA 1A2KC 1Q1NA 2D4AA 5AVOA 4D8TA 4MUIA 4LMBA 1XDBA 5KCZA 1JKJA 1QFYA 5AVRA 2JGMA 1JLLB 4M1EA 3GZTB 3JQQA 5F2EA 4EGJA 1KFCB 1CDZA 3L6DA 4DKXA 4TSFA 2E5FA 2C95A 1S1CA 4G3XA 1N3BA 2NUAA 4L8GA 3W7BA 4M22A 5K4HA 3KQNA 4CHTA 1SIBE 3RSFA 4CKCA 3U6KA 4H7FA 3J81A 2JLXA 1GNRA 5KO2A 3P5BA 4OHZA 4QJIA 4ZI2A 2QJRA 1ONSA 1CDDA 5TMEA 2X14A 4BFXA 4XJTA 2D7CA 3HJBA 3BB3A 4EL0A 5JT1A 1LFAA 4JELA 5K0GA 2RG7A 1PBNA 4ZZ2A 5FL7A 1CQPA 3HEMA 1Q77A 1QTRA 3SFTA 9ABPA 3WGNA 5HR5A 2JCGA 2H3HA 1W7AA 1M67A 1T1EA 2FFQA 3HY6A 3DFUA 3HB9A 3EG5A 1JYSA 2JEZA 2A94A 3A1VA 2WJVA 1GPWB 4PQGA 1FXSA 3QUQA 1EVEA 3HSYA 2VJCA 4NYIR 5B2ZA 1XPUA 1JI3A 1X14A 1LTKA 3DE7X 1FFGA 3OTOB 3ENNA 4H7EA 2ID7A 3K2QA 3BHNA 1DCMA 4I3GA 2F4NA 5LC1A 2Q46A 3SD7A 3L04A 3HXQA 3TXYA 1ZGAA 4V1CA 5DHPA 1NZDA 2FVXA 1XHFA 2QRMA 1VGVA 1BJKA 4RX1A 4PRYA 2YXNA 3WC4A 3WYGA 3WJ7A 3AF4A 4BN5A 3OY2A 4DIBA 4D4GA 2O19A 2C4WA 2NQTA 1ZESA 2CCKA 4BCBA 4CNBA 5K8CA 1NLYA 4RXUA 4KGVA 4WBNB 5KUTA 2IHUA 4L0CA 1ORVA 1UJMA 1K9VF 2W6OA 4JXJA 1JDSA 3BD7A 1RI5A 1B23P 3PNMA 3GXBA 4KREA 4CQMA 3SFVA 2QQEA 5FAKA 3RFVA 2PU5A 1RS0A 3WLKX 1QAQA 2DPMA 3T1HB 3Q7SA 4IG9A 5IXYA 4RU1A 1MA0A 4NVRA 4WVLA 2PFKA 1JTFA 3R7SA 3QU5A 4HJXA 2B34A 4F4DA 4GZ5A 4FFNA 3TDNA 1MC1A 3O0TA 3RRXA 1ODSA 3UWKA 2JFUA 3LY7A 4EABA 1RI4A 2WPNA 3V7UA 4ZKDA 3CURA 4HFNA 4Y2PA 1KKMA 1H0KA 4DHEA 2IX9A 1CY7A 1QDUA 2YDXA 3IULA 3S70A 3W9YA 4DV2B 5ELXA 4C43A 2FFRA 4PPFA 1QCDA 2ALJA 3RVNA 1ULZA 3I6YA 3JXEA 3L2OB 3EZ7A 3L5KA 4BRSA 3IIEA 2Z8XA 4X44A 5HZHA 4BKRA 3FWPA 1Z5VA 3FHCB 1SZJG 3KEMA 4IS2A 4L8FA 5ABPA 1AHPA 1U80A 3BT7A 2B78A 4O4HB 2V03A 3DE2X 1MXFA 1BYUA 1E1YA 3TL3A 2ZWOA 2X9QA 2ZU0C 3EF3A 3RH0A 1JQBA 5EXPA 3UH1A 3C6ZA 3ABRB 1B8PA 4ZOQI 4NFYA 4I8DA 1OZHA 3C1OA 4GVPA 1FQKA 4FFWA 3OQPA 2FMUA 3K96A 5EJGA 2R00C 4ASUA 4YRGA 3PWTA 4EG0A 5JXHA 2QX4A 4TMYA 3ZIDA 4KN6A 2VQSA 5JAQA 4J0FA 4NNOA 1T5IA 3G1WA 4JI6B 5AVVA 2AC7A 1RYDA 1PJLA 1IBLB 3WRYC 2YS6A 1M6NA 5BNIA 1F2UB 2P5SA 1MABA 2WZBA 4JIMA 2VUSA 4LHZA 3G2NA 1JG2A 1E1QA 3GC6A 2B5WA 3EARA 3NBUA 3F2IA 3MG9A 5AKIA 3RTCA 5BMVA 3U3ZA 3VZCA 1ZICA 4PLCA 5KQGA 2PS0A 1GARA 2ZUWA 5D3KA 5LDHA 2AZMA 4P0TA 4UVHA 4KPYA 1D2HA 4MDHA 5EMNA 3S1AB 1RCFA 4DDHA 3BJRA 1O9HA 2ODEA 3GEEA 3IDZA 1EXDA 2ZEJA 3GFGA 2D7DA 5SZJA 3KZXA 3VNQA 4K9LA 4JKYA 4NONA 5E4TA 4LRWA 1Q83A 2MR6A 2BTEA 1PJBA 2C5AA 3AL0C 4KO3S 4HLDA 4JSYA 1O95D 4E1VA 2BTQB 4GGOA 1Y9ZA 3JYNA 3F3SA 3LUFA 4IVPA 3UN1A 3GMTA 3OE1A 1QUFA 1USUA 2R44A 3R3YA 1NHGA 3EJ6A 1G8SA 3LNCA 1WF6A 1OJ7A 4JEMA 4W9MC 1VHQA 1GRNA 3FCUB 2QD2A 2YOGA 2ZJ5A 3MRTA 3PHCA 2ZUEA 1WHSA 3GIDA 5K3CA 2VDNB 4MWSA 4X1IA 2QTFA 4BLRA 1KDYA 2V4UA 1E3WA 3F6PA 3KOZA 2MOKA 4DLWA 3GDWA 3QW4B 2BJHA 421PA 3GP8A 4D5GA 2EZ8A 4GOMD 3U7JA 3ULKA 2QSJA 3L82B 4MQUA 1Q7RA 4R2LA 2B8JA 1N6IA 1THTA 2B6NA 1B6SA 3AHFA 4TM7A 3E3MA 1FP1D 2DQSA 2QRLA 1CQWA 3COSA 1THGA 4CLEA 2Q5FA 4D4IA 1ZW1A 1GZDA 2CHQA 2EEPA 2P7IA 5HCIA 2VWGA 2BFOA 1SKYB 4YRFA 2I6GA 2RGAA 4E4YA 4ENUA 1SUIA 2LV8A 3CX4A 4U6SA 4RO0A 3M1LA 4X1YB 5BURA 3SPXA 1H0HA 4AXXA 3A1TA 4Q34A 5JQGB 1E1CA 1XZJA 4EA8A 3L4JA 1IBSA 1VCIA 2C61A 1Q0PA 1CFZA 2EHJA 3ND9A 3R3XA 4PG4A 4IQGA 1DIHA 1N0WA 1NNSA 1J0BA 3B3GA 1K7SN 2CF6A 3NWEA 4H6VA 1QRDA 2QJTA 2FZLA 3O93A 4XI9A 1XTVA 4NTZA 2V7QD 4D4HA 3CZ4A 3QU2A 3GZNA 4ID9A 1U81A 3ESYA 4G1EB 3GPLA 4KH0A 3ZU4A 1UXKA 1MR3F 1NTOA 4P35A 4XVUA 2DR0A 1T8UA 5EC8A 3LUKA 3LMKA 1AGYA 3GRRA 2VF4X 1X19A 3GG2A 3L7NA 4Q4LA 5DNEA 1DE0A 4R7ZA 3TAXA 4DIKA 4WX2B 5KREA 2CC2A 2PUCA 4Q9DA 4NV3A 1P7VA 4DNXA 4W7HA 2ODNA 1T1RA 1XZCA 3SX0A 5C52B 2PXXA 1VMKA 2R11A 1IEVA 2ZT8A 2E21A 3MB5A 3FDFA 1RTTA 4ZVNA 3SOPA 1YBVA 4EFLA 4J90A 4HVCA 2MWMA 4H35A 3E5NA 5EE9A 5FA8A 3ET4A 1U2GC 1OBOA 4V0LA 1SB8A 3HU1A 4MIKA 3LQKA 3AT1A 3FD8A 5B1HA 5JQGF 1AV6A 3TRFA 3OLXA 3O1LA 4N03A 3TINA 2PZAA 1OZFA 3KDPA 2JKVA 2ON6A 3GGJA 3EFOB 1F0YA 2HO5A 1H8EA 2GZSA 3K05A 5E8RA 5J2TA 3N58A 2VTBA 2QVYX 4B8WA 1VIVA 3EVGA 3KYIB 2F64A 3CEHA 3HYTA 1UZLA 2ZLBA 4UEJA 1Z2AA 2CXTA 1KQOA 1L1FA 4KXUA 1SUWA 3CR7A 4GM1A 5EIEA 2PGDA 4FM9A 1QP8A 2BIFA 1N9GA 1P17A 4GI1A 4WUVA 3R4VA 2RHCA 2QTAA 2W2VA 4BRUA 2E0IA 4WESA 3SR3A 1YA4A 2J5KA 1XVVA 4TTPA 4UEKA 4YQEA 1PK8A 3JX9A 3UKOA 1O7JA 3GR6A 4HQFA 4I36A 3ZWKA 5L3QA 1YB6A 3NX4A 1SHUX 2YV1A 4H9GA 4KR0A 5SY6A 1NLFA 2AXPA 2PX6A 5FLYA 5BW4A 5JCOA 5TQJA 4F2DA 2WUFA 5C1PA 1UANA 2CJWA 2J7KA 3UCXA 1DKRA 1CU1A 1O2DA 3O91A 1SPBS 5CA0A 2JAWA 3HU2A 4PLHA 3QUTA 4RPHA 1KYYA 5DE3A 4DEXA 2QGFA 5JWHA 1VSBA 1U28A 1I7LA 2E89A 2BEVB 1X1TA 3D31A 4L72A 4QBFA 3KV1A 1QHEA 5IXJA 2XGJA 1ECCA 4JLSA 4DIEA 1O8BA 3GT7A 5FV4A 4OXKA 3EGDA 4U2CA 2VH1A 1T4DA 2NU6A 2BFBB 3TNYA 5LQAA 3W77A 4X65B 1NR5A 4HRVA 4P7BA 1ZIOA 2R5FA 2V7EA 2HV9A 4WZZA 4BXOA 4GM0A 1WVGA 4BLVA 5CW1A 4MGHA 5NULA 4OHFA 3GEMA 1U1GA 1LDBA 3HCCA 4QTYA 1U0RA 4E46A 1PNQA 5ITSA 2ZR0A 2GI4A 4DQUA 4JCOA 5ARBA 1D3AA 4JLKA 3K0AA 1V1MA 5TNXA 1E6CA 4MK4A 3EPJA 4ZOLB 5A1TA 4UUNA 1EIWA 3D7MA 3ZTWA 2OCDA 4YDSA 2HB6A 4C4TA 3NWBA 4DRZA 2X0IA 2I03A 1XTSA 1H6AA 3HY3A 3QP9A 3ZWCA 4MVJA 2JDIA 4BX9A 1QOQB 4D7AA 1KRHA 3AESB 2C9YA 3CE9A 4Z3KA 4KFSA 1JDUA 3K6KA 3N28A 2ZBGA 3CS3A 5AVSA 3NNNA 3R3SA 1CZRA 1R8YA 3HNOA 4HNAA 1F8UA 3FVWA 1KDOA 5DXJA 1D2CA 4BKOA 4YFYA 4ZVVA 4RZIA 1HSOA 1Z06A 3MWGA 1WW3A 3EISA 2DC1A 4ML3A 1KA9H 2FXVA 1FTSA 2RH4A 1P0MA 5D6NA 4YALA 4KR7A 5HE9A 3FOZA 1Z4QA 3ESZA 1V9SA 3JQGA 4J2OA 4WGFA 1NVGA 4I1OA 2O8BB 1BDJA 2ZPUA 4L0MA 3RNLA 1DIBA 4TYYA 3B9BA 3PNSA 3BGDA 5JZ9A 2FQ1A 1NRJB 3QOYA 4LE0A 4DR5B 4M0DA 5LQKA 2OZLB 4N48A 4UHFA 2GNOA 2IGTA 1R4NB 2Y4NA 1A2QA 1RHRA 3L8MA 2XTMA 3OC6A 3UYKA 4DDUA 4M6WA 1J8MF 2LIVA 3EVFA 1DFHA 1LX6A 2NT4A 2CXOA 1HE8B 4Y1RB 4GRDA 4GP9A 4TWZA 4PYQA 2C7VA 3JPWA 4IOJA 1Q0TA 4K9QA 3VVBA 3B2NA 2W48A 3IXLA 2GZHA 1YZTA 4AG3A 4AY4A 3R0VA 1GM5A 1XQ1A 1W36D 4DHWA 1GKYA 4KPUB 4M21A 3H11A 4QOJA 3PFNA 1R15A 2DWCA 3UV7A 3NHJA 4O4LB 1ONNA 2P78A 1FNNA 1X7GA 4GT1A 3AYXB 1SCDA 2VK8A 2LP4Y 3K94A 1P6XA 2ATIA 3ND8A 5FUMA 4RTJA 4PLGA 4FDUA 4KSCA 4A6EA 3NS7A 3OTWA 1P7YA 3IKVA 3RC8A 1AK2A 1U8TA 1ZPDA 4ZVLA 1RJGA 1T4GA 4FYXA 4ABYA 3RFXA 2JLRA 4RJLA 4TXLA 3VSDA 5JD6A 3TLGB 2MSNA 2VHXA 3V2GA 3WLTA 3A37A 4HNGA 5DHRA 3GU3A 3D4PA 4BFWA 3JARB 2EZ4A 4PVDA 1KO7A 5EZ6B 3V2HA 1GQRA 4DC1A 3O94A 5CGQB 3MWEB 1F6WA 4W1SA 1H2EA 1XCGB 2DVMA 1NF9A 4L95C 3GAAA 3CW9A 1AQYA 2JF0A 2FYTA 1KZHA 3O5AA 3T5BA 4GI5A 4I50F 4O6VA 1C2TA 2C0QA 3MF4A 4BFVA 1E0JA 1CUXA 5CCBA 5E2BA 1KZ6A 2IYEA 5FRDA 2FZWA 2X22A 1BWRA 4WLEA 2D1QA 2R7KA 1ZCBA 2R85A 4HEA1 3I8XA 4JJIA 1U2EA 4RW0A 2XB9A 5EWJB 1JLSA 1NV8A 2ZRPA 1VB5A 4TS9A 5JCJD 2PT5A 1EB9A 4AJNA 2DF8A 3SZGA 3CB4A 1JA0A 1WUJS 2QG9A 1BHO1 3C4JA 5DN6A 2RGEA 2R1VA 4JMPA 4JC4A 4BPBA 3TQIA 1E1DA 4C0AC 1QVRA 2WHQA 1N8SA 3B12A 3RHTA 1CW2B 3IT1A 2UXBB 2B9VA 3MJFA 2IEBA 1J2TA 4GPZA 1YS4A 5L3RA 5TGZA 2JAPA 3BXPA 2LZ0A 1ZMOA 2RHHA 3SIRA 1AM4D 4M88A 3AEQB 4Y1GA 4E21A 1GSAA 3G2QA 3ED5A 1TL7C 4C3OB 4MS3B 4DR2B 3TKLA 5JG7A 4ZHSA 2NAFA 2Z6AA 2EGGA 1BC5A 2M6RA 4MYSA 4HTFA 2QYTA 1Z5OA 3KBBA 1P80A 2BBOA 2GVNA 3UXHA 3CF4G 3DV0B 3Q3JB 1R37A 4UUQA 2RGWA 1P33A 4JLNA 1O54A 2PH5A 1KAOA 3GN2A 2REBA 4FC7A 5LP6C 2HLHA 5B1SA 2CKMA 5AVJA 3RWBA 3LFHA 2UKDA 2OCBA 4X6YA 4IR7A 3RYHA 4Z5XA 2DETA 2AXQA 2W58A 2C29D 1AQIA 4UDYX 5JARA 2HK8A 3AP1A 2O57A 4ZVUA 2X3YA 3HJTA 3NV7A 3HCEA 1YBHA 2PRKA 3E1SA 2R3SA 2ZWAA 1VCNA 4FDTA 1DELA 4OO3A 3CJRA 4OHOA 1VHDA 2JLCA 3DBHB 3G2OA 4YMSA 1EJ6A 5F51A 4OQQA 2V58A 3RDPA 3DHEA 1JLLA 3ETLA 3REFA 5B2EA 5DKFA 4BP3A 1C0LA 4JMLA 1W0KA 2QMZA 4Y6SA 3K4PA 2VTEA 4ETNA 4IXDA 3K6RA 2C2YA 2BFAA 3W1VA 8ADHA 4ZTZB 2W70A 2PNJA 2HREA 4OHRA 2IIQA 3FZEA 3TI9A 3HCRA 4BQFA 4TV8F 2B7LA 3K0BA 1ZM2A 1R2QA 3DT9A 5FLKA 4BLQA 1H4TA 3OT5A 3OQ1A 1M9NA 3W8NA 4LPSA 3R3HA 2BUAA 4KQIA 3F67A 3H04A 4LFCB 3HR8A 4U9IS 4UHCA 3WWOA 1GKLA 3GJ3A 4ER3A 3NTRA 3PC8A 5DK6A 3OJEA 1JYFA 3BE8A 5CFPA 1B15A 3IERA 4FILA 4KDRA 1M75A 3DAHA 4K6MA 4ON9A 5AXAA 4F2PA 1DX4A 1SY7A 4D3XA 2BE7A 4MS1A 3CLUD 1HT1E 2ZI7A 2AFVA 1N9ZA 1PYDA 1OLXB 3O83A 4NBRA 2EKQA 4NDAA 3SBXA 2QUJA 1JH8A 4HEHA 4IFIA 1AKWA 1L4MA 4LNAA 2X0DA 4RDHA 1WBDA 3D3WB 4XWOA 4UEWA 4YRRA 1XMSA 2B5VA 3O4RA 4B79A 1U6IA 1YKSA 3NBZC 4NNJA 4IDAA 2ZIXB 3FPCA 1J8YF 1GDDA 2ODTX 2PUVA 2Q3FA 4CTOA 1T13A 4UPEA 1MOSA 2PL9A 1V39A 3JQ6A 3SYLA 2I7TA 2P2NA 3OETA 3UMCA 1UC9A 3I04M 1I2CA 4FHGA 5GQSA 4D4MA 2AFIE 3FAKA 1JB1A 4P7GA 2V7VA 1U7TA 3LS2A 4FQ5A 4KZKA 1B7GO 4RGBA 5F3RA 5G53C 4WBNA 1RIIA 1G20B 4JGBA 2CCJA 3S0JA 4ARSA 1MOQA 4ZO7A 4EI8A 1SR8A 3PC6A 4TZKA 1TEHA 1HFJA 2BEKA 4HAIA 4M54A 2Y1WA 4RKWA 4H1UA 2QI9F 1ODLA 2IYWA 1S2IA 3UC9A 2TYSB 3GLSA 1X77A 1EFPB 3E9NA 3ZR4B 5KYWB 2PWZA 2R4UA 3GJQA 4WFKA 4F2WA 4WK2B 3UJ7A 3KTDA 4IOKA 1ODKA 4RPIA 4INOA 3DC2A 4GMKA 1H1TA 1OZAA 1REQB 4DQ0A 3BHMA 2AX3A 3CWCA 3IA7A 2ZATA 1U31A 1ZNQO 10MHA 1FDOA 1YGYA 1B00A 3P0JA 3IAFA 4QD3A 1PR9A 4AKTA 1ABBA 3FNRA 5TMDA 2W4MA 3ZWXA 4J3FA 4LY9A 2H4HA 3STXA 3ASYA 2ZJYA 2GVDC 4O4HA 4F46A 1A96A 4Y6QA 1N2BA 3QVJA 2QQGA 4KNWA 4IYJA 4YJHB 3I9KA 4CQLB 5THQA 1BJRE 4JVLA 5U1PA 1XJ5A 1B42A 5MFPA 1LXCA 5A2GA 2WC1A 5AKHA 1UF9A 1C30B 1SXHA 2HPAA 1UEXC 2H2FA 1LDEA 3CPSA 5LB2A 5L6MB 3VU1A 5K0EA 1JHRA 4HPWA 1PZGA 2Z83A 1FLVA 3ZV6A 4EY3A 2GBCA 4ZOCA 1BW9A 3FJYA 2RMKA 1HLGA 5GVRA 2HQRA 1YC5A 1F2UA 1DI0A 1XZQA 1Y89A 2O8VA 2GWHA 2PR2A 2QX9A 2ZVQX 3G9QA 2QPTA 4H59A 5T4EA 1GPMA 4PLYA 4BL5A 2O59A 1FNMA 5IWCA 5DFAA 2CSUA 3P19A 4P82A 2HI0A 2DGDA 2N3ZA 4M1TA 2COKA 2NPFA 1WULS 4F45A 4RTLA 5CDYA 4XWGA 2VHVA 1C3OB 4TRMA 1NWHA 1VA5A 1FRNA 3EWAA 5EHGA 3AOGA 3BBPA 1MZVA 3VH4A 4AL4A 2V9ZA 2AD1A 5HIJA 3OCCA 4PSDA 3OLZA 2KI5A 4LK3A 4DQLA 4CXMA 4BBJA 2QW0X 2P9JA 4URZR 5EP3A 5C5EA 1TKBA 3O82A 1AN9A 1H9AA 3I9OA 4Q03A 4YAKA 1XU4A 3CVXA 5CTJA 2XE7A 1NVXQ 4JA2A 1C4KA 1FTWA 3KTAA 2B61A 2DWUA 2YN0A 3LXRA 2VZ0A 2X1MA 1U0FA 1ZKDA 2BTQA 3OE7A 1LBQA 2QK4A 3FF4A 2DFPA 2PKWA 3OKPA 3QA3E 1CRLA 4FGSA 4IGEA 5BSTA 5C1DA 2B7BA 1IWOA 2AE2A 2R25B 2B2NA 1FS6A 4FVTA 2QL6A 5KPJA 1YR2A 1QVVA 2HMUA 1E2QA 1WV0A 4I81A 4FYHA 3HN2A 4G97A 1SXJC 2FSPA 1KSJA 3OICA 1P31A 2Q4TA 5AM0A 1D09A 4Z0TA 5I7WA 4ICIA 3ZGXA 4GLJA 2WHPB 4MJ7A 1AXRA 3QU9A 1R00A 2DBRA 1SEVA 4RIEA 3TLKA 5A5FA 4A8TA 1ATZA 4EF4A 5IDXA 3N8NA 3FOAA 1PZFA 4OIMA 4U4AA 3UHAA 4KQGA 5INTA 5LKAA 2P9CA 2BBWA 5LNK6 2P35A 2WKRA 4L76A 2V96A 4HFMA 3OFND 4WADA 4XUGB 5ESXA 3O03A 5LR6A 1BHJA 2Q0XA 1R0LA 4M9XA 2IEDA 4QRIA 4U7WA 1LSOA 2XTAA 2FUKA 4FUTA 3DDZX 4U7JA 3W6NA 4FHFA 5B5SA 4HLUC 1ZH0A 2PX5A 3NM4A 2DKNA 3QF7A 4RHXA 1XL0A 4DLVA 5AQ1A 4F4UA 1LGYA 5KVSA 1KS2A 1L5YA 4X1YA 3K0CA 1HYBA 3LUCA 1LD3A 1XTBA 3EMBA 2QP9X 4Y6LA 4YRSA 4KDCA 1E69A 4I5FA 1AU9A 4Q24A 2DLCX 3V80A 1OF1A 5JQGA 1VRCA 1YR8A 3CLTC 1R0KA 4DMRA 3NYRA 2VJLA 3QVXA 4UW9A 5CDFE 2JA2A 3GF4A 3K2EA 1J9EA 5D00A 4CIWA 3P8ZA 6PFKA 3CCFA 4OSOA 1U1IA 1WQ4A 1RQ2A 3A2LA 2OHFA 4MV8A 3TBHA 3L0IB 4MKGA 3LLSA 3TS1A 1HLPA 2CYCA 1YS2X 3T5MA 5CVTA 2GNPA 3HFSA 2PU7A 4DMGA 3AMVA 1JHYA 1LDGA 3PL5A 1T1IA 3HCPA 4ZQHA 5T7BA 2CFCA 3WHPA 1Y98A 3KVYA 1OREA 1BRTA 2C31A 4IAOA 4XIGS 5COAA 3QXHA 1QQBA 2FDCA 2A58A 4PSCA 2DEUA 2GBFA 4MYDA 1O0CA 3NM6B 2KLHA 2PGIA 2BFEB 4F85A 4BNDB 3TQHA 1C7ZA 2CWWA 5JMPA 3SMVA 5AW6A 1C3EA 4DDKA 5A9RA 3MCAA 4Q4DA 5HP4A 1SOUA 2OR3A 1PTJA 1NXPA 3A1FA 4HDKB 2VOEA 1J24A 1YCGA 1OIVA 4FJ1A 4UAVA 1JIQA 1LSJA 1FVFA 5DHFA 5ENZA 3AXTA 1ZW6A 3UHFA 3HDTA 3P2OA 4P53A 3SHFA 1SVKA 2V7WA 2FEPA 2WUEA 3EFOA 2IV2X 3WGGA 4YPOA 5I9NA 2QG6A 3DFFA 4EI2A 4Q7KA 3EASA 3DV2A 1NF2A 1ZRHA 5C8XA 3OX4A 4CDNA 3GJRA 3H17A 2R96A 4UATA 4Z8XA 1GT91 3O1HB 1J2JA 3PUIA 4HAZA 3OQNA 1QTQA 4C9BA 1E2LA 2ZWPA 3BWBA 4J3JA 5EEGA 5UKDA 1OAAA 3USES 4GRIA 2DFKB 2QR2A 2B36A 3Q3HA 3QKSA 4G65A 3ER8A 1MZPA 3QPUA 3DXZA 5JANA 1BIFA 1FZTA 3C5CA 5BYJA 2AHOA 4GPD1 2IQ5A 4MMYB 1WZIA 5G1OA 5DU2A 3VZDA 5JYCA 1MKYA 5C51B 1ZFNA 1ZK4A 1OYWA 2QQ0A 1DHTA 5SZHB 2VJYA 2JGDB 3PNKA 1K4KA 3S5JA 3KL2A 3LLVA 2CXUA 3KTFA 3RROA 3ROEA 1DCTA 1EXWA 2JH3A 2C2ZA 3C3DA 3D8TA 2ZRGA 1VP9A 5DM2A 5LCXA 3QK7A 4DG8A 2H3EA 1ZI6A 2BEVA 4R7GA 4BFCA 4BRZA 4DSNA 4LWQA 3CT4A 1JDJA 3MTIA 1USGA 5A4FS 2XEDA 2NU8B 1RAAA 1TU3A 3R4CA 1FUEA 1L5MA 1Q0QA 3HZRA 3NXSA 3L8FA 1J0AA 2OCLA 4GKJB 1R74A 4R2IA 4QLOA 5DGTA 3E8MA 3DGFC 3GFFA 3KKKA 3LU1A 2XB8A 2NTJA 3LUAA 3RD5A 3TMAA 1N3IA 3HH8A 3KHKA 1EIZA 2X5KO 1EP2B 5KTRA 4F6LA 1U9CA 3GFQA 4XUDA 4IX1A 1QKKA 3V1YA 3KFXA 1SELA 2YRFA 3V34A 1I4OA 2LCFA 2E4AA 3TLMA 3RFFA 4J16A 4ZOLA 5JLJA 1E0AA 1P2UA 2B37A 2FMHA 2ZE8A 3K5IA 2XUIA 3ZGLA 1H23A 5FHRA 1U9JA 1ZK0A 2PL1A 1P6UA 4UBIA 2EXXA 3PENA 3MMNA 5C31A 3JU3A 2K7ZA 2R1TB 3OFKA 3VZBA 3F4BA 5KINB 3ZDDA 4B2YA 4G84A 4EMBA 4ZDIA 4GQAA 3LHFA 5DM60 1CS4C 1QH1B 1G42A 5J4YA 4NLLA 3NM5A 3LO5A 3FKSD 1E2NA 3UYLA 2VDPB 4BNLA 1FDWA 2EJUA 3LRXA 2G4LA 4YJ3B 3FYUC 4Y3UA 3UA4A 2P6RA 3ZBTA 1AV7A 2G28A 1IOZA 4L4SA 1JG6A 1M1NB 1QVWA 3CX3A 4NICA 5FOQA 1GL3A 1K66A 3CRRA 4YAOA 4TS4A 2B8TA 4UPDA 1OFIA 4QPCA 4JQCA 4TWAA 4A1OA 2RCYA 4DBZA 2HHAA 4UHKA 2O8BA 2ZE7A 2AJ8A 1QTNA 4KQ9A 1OXTA 2XADA 2HH9A 3X1XA 2JI8A 1ECJA 2H5IA 3BL5A 4DUGA 3IC5A 2XW6A 4UREA 1J0EA 5EHQA 6NULA 1YS1X 2BZ1A 5HPYB 2QXYA 2OZLA 3I32A 3RRFA 3SJ7A 1UBSB 5DM70 2C5SA 2CVQA 1R4NA 1W35A 4EAQA 1W4BA 4QUGA 3P2MA 1YL5A 3U62A 1ADYA 1C4WA 1GPUA 1ORIA 2ACEA 1A9XB 1TYBE 2DBVO 4Y1RA 4YCMA 1U8UA 3ENQA 4NATA 4WGGA 3AKDA 3LX6A 2V0GA 3BCRA 3HGMA 4K86A 3SSAA 4BMVA 4C1BA 4AJ4A 4X54A 3RE1A 2QF7A 5JJLA 4J4BA 1XRSB 1ZHOA 3QHAA 1UKCA 1UT6A 3FZQA 2HA5A 1OGYA 1P72A 3GJTA 2HBYA 4BZXA 4FQ8A 3UANA 4O4LA 1WDWB 2DBZA 2JFYA 4LYJA 3THWB 2BONA 1J00A 4F1KA 3NTQA 1DJNA 4KRYA 3NJ4A 1G6Q1 2AXEA 1UUFA 1XTKA 1V47A 1TZBA 2C03A 2J5XA 2QG4A 3EDOA 1PWEA 2C99A 3BRQA 1K1EA 3GLFE 3DBLB 4AZ3B 4WESB 4MPTA 3GLIB 1RSZA 1TAHA 2FPUA 1BWSA 2A9PA 2C4VA 3ILYA 4FHZA 4HJRA 4FUQA 2XPCA 4LWZA 3V55A 5IUJC 3DWEX 3VVCA 1T9BA 3HLYA 3TLGA 4AICA 2GPAA 1G5IA 3HBAA 1K3FA 3DDCA 3FDZB 4F38A 1SC6A 3JARA 4EPXA 3IDFA 4IZOA 2RHMA 1QZZA 2C7OA 1NLMA 5FL3A 4C2UA 2CLDX 2GH1A 5KDLA 1LDYA 4PE5B 1Q5PA 4EYKA 2ICAA 1EGHA 2VQDA 2W0SA 2O05A 3PZRA 4N3GA 1T6YA 4RCYA 4X84A 4ZCRA 3JTEA 5JSKA 1A9QA 3K15A 4CF3A 5F1YA 1MVNA 1ZN7A 2A4MA 3VNVA 2JHPA 3H1EA 1SK8A 3D1LA 4E07A 4RXMA 4NJMA 5EWJA 3OZXA 3M1YA 5DNWA 5CFMA 2W2XA 1T3GA 3HWRA 2AN4A 2QL7A 3ITDA 3KXPA 4G0PA 4ARVA 4D5EA 1X8KA 3QX9A 4OEHA 4EECA 5K6RA 4ARAA 4WA8A 1UBGA 2XNDA 1PRYA 3LQYA 5BSUA 2AOUB 3B3JA 4JC0A 2CNDA 4X6UA 2G09A 1YB2A 2XDYA 3S99A 4YASA 1MIOB 3OF3A 1Z75A 4QEZA 1MO2A 4PHGA 3I01M 3Q41A 1L1QA 5BW5A 4S1TA 3AEQA 1Z68A 4G5YA 2FI1A 1TMOA 1P3JA 4GLOA 2OM6A 4A16A 4MS3A 4BO6A 3CUVA 4MROA 3PEEA 4POOA 1SPXA 2BGMA 3EPLA 3L3BA 2WF9A 5DP1A 4PRZA 3EWNA 5KJCA 4JAVC 2Y4OA 3HB7A 4LDNA 2ZJ1A 1UOOA 3DV0A 3KVVA 3U3MA 3P96A 1Z4IA 4KX5A 3D7NA 4KXXA 4WOJA 1VC2A 2ZJ2A 4B7AA 1JLMA 1VKOA 2FSHA 3W8FA 3RF7A 3UT0A 5IPFA 4RCZA 1O58A 5H9VA 4MIEA 2ANBA 2HA4A 4HWTA 2PX4A 2FG7C 1T1SA 3A04A 4M0UA 4MKHA 2PO5A 4D9HA 1C9DB 1MV5A 2IKSA 3UQYS 5A3SA 1OSNA 5BSHA 3P9NA 4XPIB 3KU4A 1CRWG 3DBHA 3LG2A 2ZT5A 4RMNA 3IT2A 1ACMA 1F3OA 3ESXA 1CJVC 1WPGA 1WETA 1P0FA 1PR5A 1Y4UA 1LWOA 1P18A 3RAPR 1XP5A 4P84A 2WJ6A 4IO0A 3HN6A 1BROA 3DONA 3IV6A 1NT2A 5EZ5A 4A2QA 2II6A 4RJKA 3VBCA 2AMYA 3AUUA 5CEFA 1YU6A 2FZCA 3TW0A 5I7RA 4YACA 3Q3VA 3H1TA 3SEZA 1G2PA 3GJSA 4G4IA 3GGOA 2IXFA 5DLEA 3W6UA 4U2GA 2ZDQA 3DF9A 3X44A 2UXDB 3A3NA 1QOPB 3CJTA 3KUCA 1B0ZA 3EUAA 1YMUA 3K4QA 2GBPA 4GWKA 4JBHA 1MJFA 5DMXA 1YC2A 2VAXA 1NF3A 3C6XA 3II6X 4CCSA 1NFQA 1E9SA 1CR0A 3PFGA 4BVAA 4NKRA 1RPAA 3WBJA 4A5SA 1X2BA 5HJ2A 2F3RA 3VR4D 1JHDA 1KVUA 1SKAA 5HS4A 4RULA 2E2WA 1E6UA 5BRAA 2Y6UA 2DUWA 4MQEB 5BNFA 4OKSA 1P77A 4BUZA 2F1RA 3KZ1E 2BFMA 3GNTA 1OLXA 1C4OA 4Y6RA 4BNGA 4H2DA 5TLSA 2O8EA 3HBMA 1E5TA 3M0EA 4ODIA 1CEXA 2UYHA 3D3WA 5AO9A 3G0HA 3ESRA 3ICQB 2XYHA 4HNTA 1SD2A 4YRDA 4B33A 2RGRA 1QANA 2C84A 2V98A 3KPJA 3D3NA 5FA6A 1KZ7B 1IAVA 2ZIXA 1X15A 3FMPB 3I9NA 1OY1A 1QHFA 4BNWA 2OHJA 2P4EA 3RT1A 3VR6D 4NMHA 4CU5A 3QNMA 3LCVB 4CIDA 4D9IA 1IZ0A 2VJPA 1IHUA 1RXWA 3ITKA 3V8QA 3ZGYA 2FPLA 3B8EA 4RL6A 4Y18A 4R0NA 3TSOA 4L3VA 3DOCA 4WKOA 2QUKA 1O6FA 3BGOS 2DCUA 1ZUWA 3H99A 2J4CA 3TOSA 1G20A 4D9KA 3B7GA 1I2DA 1N2XA 1NYTA 3DH0A 3FRIA 3WKAA 2ZUFA 1S7CA 2XNKA 1T0IA 2FUNB 3SSNA 3VAZA 4D0SA 2BM8A 5IVKA 2VZLA 5FCDA 4D25A 1NBMD 4WQMA 3PFHA 5AW3A 2X0RA 3LGXA 3K8ZA 1A9OA 1EFPA