1FCJA

Crystal structure of oass complexed with chloride and sulfate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
302
structure length
302
Chain Sequence
b'SKIYEDNSLTIGHTPLVRLNRIGNGRILAKVESRNPSFSVKCRIGANMIWDAEKRGVLKPGVELVEPTNGNTGIALAYVAAARGYKLTLTMPETMSIERRKLLKALGANLVLTEGAKGMKGAIQKAEEIVASDPQKYLLLQQFSNPANPEIHEKTTGPEIWEDTDGQVDVFISGVGTGGTLTGVTRYIKGTKGKTDLITVAVEPTDSPVIAQALAGEEIKPGPHKIQGIGAGFIPGNLDLKLIDKVVGITNEEAISTARRLMEEEGILAGISSGAAVAAALKLQEDESFTNKNIVVILPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O-ACETYLSERINE SULFHYDRYLASE
molecule tags Lyase
publication title Identification of an allosteric anion-binding site on O-acetylserine sulfhydrylase: structure of the enzyme with chloride bound.
pubmed doi rcsb
total genus 110
structure length 302
sequence length 302
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2000-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fcjA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fcjA02
3FCAA 3DWGA 5IWCA 4ZU6X 2Q3BA 1WKVA 1RQXA 2ZSJA 1TZMA 4KKXB 5DW0A 3RR2A 2CLHB 3R0XA 3V7NA 5J43A 1TYZA 5E0KB 4AECA 1O58A 3DWIA 1FUYB 4L28A 3FGPA 2BHSA 2DH6A 2GN2A 2O2JA 3AEXA 4I1YA 1KFBB 1K7FB 3BM5A 2PQMA 4D8TA 3DKIA 3PC3A 2GN0A 4HPJB 3SS7X 1CX9B 5DBHX 4LMBA 1C8VB 2DH5A 1FCJA 1QOQB 4HO1X 1A5BB 5DVZA 2WSYB 1Z7WA 4WX2B 1PWHA 4JBLA 3X43A 3SPXA 1UBSB 4D92A 2J9ZB 5B53A 2GN1A 2CLLB 5DBEX 4HN4B 1K3UB 4XUGB 1J0EA 1WTCA 3VSCA 2CLOB 1Y7LA 1TJPB 4F4FA 3AEYA 4L3VA 4D9FA 2C2GA 1KFJB 4IL5A 1BEUB 5T6MA 5B36A 4LMAA 1KFEB 4ZU1X 2CLIB 5I6DA 1JBQA 2C2BA 2TRSB 1OASA 1K8XB 5HBGA 3T4PA 5I7HA 3R0ZA 2BHTA 2D1FA 5B1IA 4D99A 3IQIX 1C9DB 3PC4A 4D8WA 2JC3A 5D87A 1VB3A 4NU8X 2CLEB 2RKBA 5CVCA 3X44A 1VE1A 1KL7A 4LI3X 4D97A 1K8YB 1TTQB 1QOPB 2O2EA 4ZQCB 1KFCB 1J0BA 4OFXA 5D84A 1K8ZB 3VBEA 3IQHX 3L6RA 5JJCA 1K7XB 3HMKA 4H27A 5I7WA 1J0AA 2RHGB 5I7RA 2CLMB 4JBNA 1WBJB 5IXJA 1WDWB 2ECOA 4D8UA 4PCUA 1CW2B 1M54A 1D6SA 2J9YB 3PC2A 4HT3B 3TBHA 1TTPB 1F2DA 3ZEIA 1P5JA 5I7OA 3IQGX 2ZPUA 2ECQA 2Q3CA 1A50B 1V8ZA 3VSAA 1TDJA 1VE5A 4Y6GB 4D9NA 4D9BA 2CLFB 5B55A 1UIMA 3CEPB 3VC3A 5BW6B 2ZR8A 1V7CA 1J0DA 1A5AB 3L6CA 4AIRA 4D9IA 1TZ2A 3IAUA 2EGUA 5IW8A 4D9EA 5JISA 5KINB 4D9KA 4D9CA 5EY5B 5C3UA 4L27A 5D85A 1KFKB 2EFYA 2CLKB 3L6BA 5KZMB 2Q3DA 4COOA 1A5SB 1UINA 2RH9B 5CGQB 1BKSB 1PWEA 1TZKA 5I7AA 4OREX 2TSYB 4NEGA 1J0CA 1X1QA 1TZJA 5J5VA 3SS9X 4QYSA 1Z7YA 5B3AA 2TYSB 3VSDA 4D96A 5DW3A 1E5XA 4D9GA 1V71A 4D9MA 5D86A 2ISQA 1C29B 2V03A 4L0DA 4HPXB 3PR2B 2J9XB 1K7EB 5B1HA
chains in the Genus database with same CATH superfamily
4LOHA 1K0FA 2VLIA 2W83A 2R8OA 4I3GA 3TLXA 4F3NA 4M0LA 4D3YA 1OSNA 5J43A 5BNTA 2NT4A 1G3MA 1ZI8A 4OHYA 4J8PA 4K8OA 1P1RA 4UPVA 1RAHA 3K9WA 3MBIA 4FTWA 4L8VA 4BKQA 2R7LA 1UJBA 1A7JA 3U1BA 1P17A 4PG4A 4BZQA 4B47A 3UOGA 3E7XA 2NSHA 3LYLA 3QNMA 2GYVA 2ORYA 4R2HA 2ISSD 4ND1A 3U4QA 4UARA 2GBCA 3A4MA 3Q7EA 4HGYA 3AJAA 2VNHA 3OEYA 1KMHA 1M6NA 5BWMA 3WLLA 3PFNA 4JXZA 1WDTA 3Q9NA 2FFBA 4P0PB 4CQMA 2HCRA 4AO7A 3B5EA 2DEUA 3KXKA 2OFXA 4E4TA 4NICA 4RZQA 5TS3A 5F1PA 4DNFA 1DJOA 2GPJA 3B6KA 4EB8A 2O06A 1O4WA 2P8SA 2IYNA 3BMQA 3TLJA 3GG2A 1M6HA 3L01A 2QZPA 4HUQB 4Q9DA 1FU8A 4LWZA 2PH5A 2PS3A 1GTSA 1JR2A 1J1UA 1F17A 1J0EA 4RTSA 4C08A 1IM8A 1SCKA 4KDEA 4RPHA 4BFLA 3EPKA 1E2IA 3GUVA 1YIDA 1PGJA 2QAGA 3Q0TA 4FGZA 3L8MA 3A9CA 4YN3A 3B1KA 5D6NA 2EGHA 4XQCA 3LVFO 4LSZA 2O2GA 1Y9EA 2VP9A 1GGEA 3PFGA 4LHEA 2BGIA 2YINC 5K3SA 1SUDA 4X6UA 4EFNA 4DCVA 4M49A 2OSBA 4KB5A 1AQUA 4C06A 1VI5A 1EGHA 1KL7A 4HWSA 2QV7A 5HA5A 2H1SA 2GD6A 2AEJA 1SQ6A 4WIAA 1I51A 1XL1A 1B6TA 2FRXA 1XRJA 2ZGVA 2FQYA 2IH4A 3G9UA 1P4AA 1GLGA 4TTRA 5IVKA 1E2PA 1IJBA 4O1HA 4PGFA 1JPVA 4Y0VA 3H4TA 1KJYA 4IH1A 1HYQA 5IS2A 4A92A 3T1YB 1UJ5A 1FVHA 4HAYA 5FT9A 2HRRA 4DTIA 2ALJA 2J9YB 4GKJB 3GDHA 1EAMA 3EPHA 1KS9A 1NF9A 1VLJA 2AD1A 3F6YA 3SYMA 1RZ3A 4H7HA 1CS4C 3FSEA 4Q1EA 3AVUA 2HDNB 3QITA 5C32A 4L4SA 4BGIA 1ENYA 5HDQA 4AN4A 1RLIA 5L8VA 4D9BA 2I5PO 3N8IA 2H3EA 1S8OA 2J4CA 3GJQA 3S27A 1UXKA 1TTTA 4LKOA 3A06A 4YA6A 1T0BA 1UPFA 4IXDA 2VXYA 3G82C 4F11A 3V1KA 2HV9A 5HGXA 1AZSC 4RMGA 2AJTA 3V8RA 3LPLA 2QN9A 5JAMA 1FUKA 5KTRA 4Q3BA 3VU9A 1MB4A 4HX2A 1SIBE 4Q4LA 2WNHA 3IULA 3JPYA 4XFDA 1Z5NA 1XVTA 4KDFA 4ABTA 5KOJB 1M8GA 1WABA 2YJNA 4O59O 4MGZR 4GZMA 4WTOA 2YVAA 4N3BA 3SN6A 4YUXA 3CLKA 5EZYF 2G5GX 1BWQA 4KFRA 1Q7CA 1BXZA 3UT5A 1Y8QA 2YFQA 1NNUA 3OOYA 1VKRA 3OQOA 3NIGB 4I1SA 1CJMA 3K92A 2ASEA 2QD3A 5EWMB 1KYZA 1G66A 2C2MA 3JQAB 4KAJA 1O9HA 4YJHB 4A26A 5JSHA 3I6YA 4HRXA 2HT6A 2YIVX 1QH1A 2BGMA 2Z6UA 5CXQA 3HB4X 4DLTA 4I1UA 4RCYA 3W1WA 2QTCA 3NDJA 2HK7A 4IJ5A 3O21A 4UUNA 5CDUA 3CVWA 6PFKA 4NCAA 1OIXA 4FCWA 4YCAA 1OJLA 3GZ4A 3ZY2A 2A0WA 3EZFA 3VBCA 2I4RA 1GFSA 4TL8A 4YRSA 4HRYA 1F38A 2OQIA 3LUPA 3RUIA 5HRAA 4M86A 3IYLW 1VSQA 2WJPA 2AHOA 3HVIA 3LFUA 1DOZA 4YRAA 1RC8A 2D2IA 1D8AA 3KLMX 2YQ5A 3LUDA 3IP3A 4LRYA 3ISVA 1G2PA 2O8CA 1IHXA 2RHRA 2CL7X 3KKLA 2J3MA 1AC5A 3A1DA 3BQNB 4GYWA 3FETA 4JJZA 3SYKA 4R1TA 4RF2A 2P91A 3NIFB 3RT7A 4YMLA 4CKZA 2O0MA 2KB0A 3TDNA 2D2FA 2HWXA 4EGJA 2BY4A 4PRKA 4C5CA 3LC1O 4BNKA 3UG6A 4TMTA 1P0QA 5JJ5A 4NP6A 4NS4A 3KZCA 3TAUA 4D9FA 1TE2A 1NZJA 1DTSA 3UAGA 1SHKA 2Z5FA 1KY5A 4P34A 4YONB 5EIWA 1AA6A 3DMNA 4WKPA 4W6QA 2QTHA 2WFZA 2XNKA 3UENA 4UDOA 2PUVA 3C16C 2QT1A 2FP4A 4BCDA 2ZSEA 4RLHA 1C9DB 3PC4A 1CS0A 1NOJA 4HGPA 1WE2A 5EJEA 1RKVA 2FZ4A 1YASA 1V6CA 2XVZA 3L0IB 4R1OA 3ROTA 3RUEA 1M5TA 1PR9A 2VZ9A 3PFFA 3QMPA 1FTYA 1H3FA 4Y8VA 3U9TA 5HE9A 1RADA 5JJCA 1RRPA 1EESA 1TGYA 5B4UA 3BH7A 1K2WA 3NC1C 4KEAA 4K88A 1XAJA 1OU4A 5EIFA 4G07A 2CBZA 2IWRA 3SX0A 2QJRA 5AQEA 5C8XA 3HBLA 5HF9A 2CHVA 3OJEA 1VCNA 4DV4B 2H3HA 1ZISA 2RD2A 4UNNA 4GX5A 5B37A 3TRKA 4EW3A 4K26A 3V8PA 1S2MA 1B8PA 1LWNA 1B8NA 2EKZA 1FQJA 2ECFA 1R6TA 1TK3A 2J9RA 3KU1A 4U63A 5FBKA 1FVXA 2P5UA 3RQSA 2JIPA 1EWKA 3UJDA 1ZIOA 3EEOA 2R8EA 5FPHA 4ARUA 4YP1A 1GZHB 2PYIA 1O9BA 5CK5A 3RANA 3HGMA 1WSDA 4BRSA 5JASA 3OLXA 4JA0A 1L4EA 5DIFA 2PVCA 4PV7A 7AT1A 4JI5B 1BWRA 5IFLA 3K9FC 2NZ8A 4EUHA 4ILKA 4PYNA 2EX4A 2HPZA 1OV6A 1S5PA 1HE8B 1R4NA 2P3SA 2GZDA 3M4ZA 1LI5A 2GN9A 2MSKA 3Q9UA 4J7UA 5D7BA 3CKYA 5IJAA 3CVYA 5TR9A 2PKYX 5DASA 2DG2A 2Z2ZA 1WMFA 4YLYA 1IY8A 1E18A 1OAOA 2PBZA 3CH4B 3M70A 2HXYA 3IBGA 4WJLA 5BURA 2XRMA 1ZH8A 2YWJA 2C88A 3PWZA 1I5RA 2C61A 2AG1A 1QFYA 3HNOA 2GAFA 1JFRA 3KPWA 3B9PA 3MWEA 2WYIA 4LRSB 3ECSA 1I5OA 4FE4A 2HT1A 1RQ7A 2NO6A 5JAZA 2FPGB 1CVIA 4UE2A 2Q3BA 3AR5A 4CMIB 3C3DA 3RVNA 4GOXA 1GPUA 4BWVA 3S8YA 4DUZB 4L8WB 4BLOA 1PNOA 1YB2A 1CNEA 2M1ZA 4HLCA 1AUVA 1P62B 1XQVA 5SZKB 5BV7A 4KZPA 4AJEA 4YACA 2Q1TA 3OWHA 1SN7A 5BSTA 3LE8A 4M37A 3PNKA 4FZ5A 2PJRA 3GFTA 5A1TA 1Y63A 3HBFA 3X3HA 5KEIA 2FJ0A 3R3XA 2ZUCA 3CLSC 3LC0A 3OHSX 4FGKA 3OICA 1S9HA 5D3MB 4RZIA 1JDNA 4E1VA 3QGMA 1WVMA 1ODFA 1X80A 1JALA 1Z5ZA 3AF5A 5KMGA 5TVKA 2QUKA 1RMQA 2H08A 1AXRA 3BUSA 2GQ0A 4KH0A 4LA4A 5EKDA 2PMDA 3RH0A 2ZIZA 1A97A 2R8ZA 4A8JC 3IBFA 2IEIA 2RCNA 3UN1A 3WNVA 4C0QC 3WLRA 3GVXA 4P0QB 2YFHA 3FROA 3PL5A 4BV9A 3KOMA 1GFIA 2AF4C 2CKMA 3P9XA 2CXHA 3L77A 3JAMA 3NYIA 2BM9A 4IRUB 4MQFB 2GM4A 1G0NA 1E1QA 2XCLA 1O96B 3WP1B 4MUGA 4JL6A 1KU0A 3VDMA 3NVDA 1LD3A 1K08A 1Y7TA 3KFVA 3TG8A 1XEAA 4RGBA 1KEWA 1JJAA 2XQJA 1C14A 1Q7TA 5J4VA 3NB0A 4CTJA 5FI3A 3QMWA 4G0QA 2PIAA 2C9ZA 1JYSA 2FP4B 3O9MA 1E32A 1O95D 4QUJA 1ONBA 3SYLA 4EY6A 5BOSB 2QUIA 4JBGA 1MDBA 5JECA 4RO0A 5KSYA 4XGIA 3KZXA 1ZNXA 4N3AA 2Y2UA 1I2CA 5DB4A 2D7CA 3K6KA 2Y76A 5CJJA 2PL9A 4BLUA 4WGFA 4F4IA 1DLIA 2PX4A 3O8QA 4RTRA 1A98A 3VKHA 1TYCA 3GROA 3RKRA 3KKPA 3M6IA 2GJ9A 1W19A 5CXSA 2JGEA 4JB3A 4TTTS 1U1DA 1ZD8A 3BJEA 4EA8A 1WTAA 4FFWA 3FOBA 1HFEL 4PQEA 4IXWA 2P7HA 4WNAB 2GKGA 3H9JA 2O48X 2KW5A 3M6VA 4ALJA 4BGUA 1T3ZA 1ZJWA 5E2IA 1TJNA 3ZIUA 4QJIA 4IDNA 1LW6E 3CMCO 1E20A 3MG9A 4BC1A 1BDIA 3GLHA 1XQXA 4Q37A 5CA0A 1AKQA 3K9NA 3F5DA 3U0BA 1IC6A 4R83A 4P4LA 1P1KA 1QYDA 3NKLA 3ZVRA 2P9FA 1UINA 4FR0A 5DBGA 3R8CA 5G3ZA 1R0CA 4QOGA 1YDWA 1RLJA 1YUBA 4G4JA 3ZWCA 3G8DA 5DNDA 2Z95A 3GEMA 2Z30A 4O2BF 3RROA 5B6IA 1IQRA 4HXGA 2VWGA 4EKNB 4KAAA 1DBIA 3DCIA 3N59A 1YKGA 4CT0A 2OGZA 3FCOA 4G1CA 4G0WA 1KEPA 2EFJA 3ZUGA 4BPRA 4HWTA 5DYWA 2BBTA 1XCLA 2DMRA 4HHEA 3PEWA 3OZAA 3MFYA 2HM7A 2QL6A 3R7FA 3EZ9A 4KQ9A 2WTUA 3UT5B 1T36A 4RMIA 1V41E 4ZTUB 5IUKC 3KWLA 1SAYA 1KZ1A 5HIJA 1E6LA 1V7ZA 4CTNA 1AQNA 2DH6A 2C4KA 4KE9A 5B7QA 3TG2A 2YICA 3U3DA 4K1XA 1DHTA 1T5IA 3TGWA 2DX7A 2ZWPA 2EIXA 1NPTO 2KHZA 2GAJA 3PPXA 1HE4A 2DVMA 1FSZA 3QBDA 4GFDA 2XTJA 1I9CA 1Z26A 2ZI3A 3OOEA 4OXIA 4WA7A 4D0GA 1M3SA 1CDZA 4CMBA 5U9CA 4RLSA 4FBGA 3DLHA 4IKOA 4ZXFA 2NIPA 5H81A 4TYWA 5HZMA 3EVTA 5HKBA 2OC9A 1U98A 3OE4A 2FFJA 4TVKA 4N7MA 3Q98A 3VR2D 2H92A 3C43A 3TZBA 3LPMA 4PLVA 5GVRA 4DDUA 2XMZA 4MRVA 3F4LA 2QTVA 4DW8A 4DWOA 4WZBA 3EEYA 3H0KA 3UPDA 4CGZA 4IXMA 1U9ZA 1HQCA 1SZPA 2OCAA 3RSGA 1YDHA 2DHQA 1LBTA 3PK0A 4YH1A 4YJ2F 5FH9A 3L0YA 5M3BA 1QH8A 4DSNA 2C2XA 1SO8A 4E33A 3OLWA 1M5UA 4KZKA 3X1YA 2BHTA 4BS9A 5B1EA 4JHXA 1O0SA 1BFDA 1R6XA 3TMAA 1IXKA 4A5OA 1CFJA 2H9IA 3O4FA 2BWJA 1E92A 1VKOA 2C92A 4U7DA 4E1AA 4F91B 4F8JA 2JDIA 2B98A 2PAFA 4CU2A 4UJ3A 4N0EA 1E1MA 4JI7B 3VHLB 1K8ZB 1LQ2A 3DZDA 1K5DA 2QOEA 3CPSA 4HGQA 1MN6A 3OO1A 4H7JA 4R01A 1BE0A 3R7AA 3ZHBA 1GTRA 1TQ4A 1OW3B 2EJUA 4Y9DA 5CCDA 4MB2A 3CR3C 2X0NA 4YT4A 4RANA 1SQ0A 5C5CA 4GU5A 5A05A 5KVQA 4GI1A 4EO7A 3ODPA 3TBHA 2QVBA 1ZFNA 4UBJA 3WMEA 1ILEA 1QMGA 5D3ZA 2VWHA 1UPTA 1PUIA 4BQPA 2FMHA 2RHCA 2A9OA 3FZEA 3I6IA 1CY6A 1QVAA 3MS7A 3R6GA 5LWQA 1E7YA 1QV6A 2PUAA 3JRXA 3ZBTA 3V9AA 2SKEA 5A5EA 1GZ5A 1XAIA 2XAAA 3MGGA 5LLDA 2AK2A 1GGVA 1MC5A 4K6FA 4G1FA 1UMCB 3A6FA 2RONA 4IIJF 4LDRA 4XM2A 4RPCA 1OILA 3QYPA 3M3PA 2P9GA 3IH5A 3MLEA 1D4ZA 4OHVA 2P0EA 4CDMA 1CUCA 5K0FA 1YVDA 4AUMA 2JJ8A 1KFKB 4ETIA 1EDOA 2QVGA 3KU4A 1U11A 3H97A 3MCAA 5CGQB 2JLWA 1ZJJA 1KMQA 4MJXA 4MYRA 2NSJA 4FIDA 3TQHA 5J4LA 2J5RA 2GN8A 3LYUA 4FJ1A 5B1SA 2V96A 3VZBA 3W6OA 4NSNA 3DW3X 4EMBA 3K9CA 4MB6A 1TA9A 1N6NA 1WMDA 3TD2A 3UF0A 1I9GA 1HA3A 1PD0A 4C3UA 1OPRA 1IEXA 3O4JA 3ER6A 4ZEMA 3H1EA 1XVIA 3DZIA 4F1KA 1N34B 4IH9A 3BL8A 2QE6A 4B33A 2C95A 2H2WA 3I30X 4RSGA 1NY6A 1V1RB 1D0IA 2R2GA 2RKWA 2FEWB 4M8KA 2ZJ5A 1XP5A 4HGNA 1X2BA 1F6DA 3VX4A 1TIKA 1U7TA 3L5KA 2BMDA 2OXCA 3KLBA 2QMYA 1CUAA 1P2FA 3LOPA 3ONFA 3T7TA 1RVDA 3VH3A 3BZUA 3UGTA 4QUBA 3PPVA 4NZZA 5CU7A 3R7WA 1II8A 3HDTA 4R1PA 4UMFA 3U60B 1WP4A 4DYVA 1FOEB 3C7KA 1QIJA 3H1PA 2FETA 4RJ2A 3CUYA 5FOWA 4BVLA 3MAAC 1P2DA 2XGJA 2G0TA 3KTAB 3L7KA 4KGVA 1P19A 4UEOA 4YUYA 4AIIA 1G21A 3KBOA 4CFYA 1GG2A 2CL6X 4R6WA 4BQSA 1RI2A 1M6VA 2ZATA 3AM3A 3JYQA 2C42A 4IDHA 3D54D 2AZXA 5TEWA 1EUDA 2F3UA 1TKCA 1PTJA 3MB5A 4JKYA 1H6DA 2O57A 2X0KA 3AHDA 2R2AA 3FZQA 4EF6A 2WT4A 4IVQA 1IG3A 1NUPA 1LRKA 1RYBA 2BTQB 1P5FA 3MJRA 4N1AA 4Q66C 4ZOBA 4Y3UA 3COVA 2IZ6A 9GPBA 4BLQA 4L50A 2BGWA 4OHWA 4E3WA 3W5BA 1Q6ZA 2O9JA 2ZXFA 2OZEA 2VCEA 2MOKA 3QPWA 2FR1A 2WIBA 1BRMA 3F49S 1NVDA 4I4NA 5T41A 4ZAZA 1GSHA 3LW8A 5JNRA 3K70D 2QUZA 1IJFA 4KX3A 3OQIB 4UQOA 5EIOA 4AVYA 4UOZA 3PEFA 4HDSA 4B6GA 1ND6A 1US8A 2E3JA 4XB1A 1JRLA 1W25A 2CZGA 1ULBA 2OBMA 3UH0A 3WLPA 4ND7A 2WZCA 1W49A 3OLQA 1QRUA 1GAQA 1SRQA 1M1NB 1E4EB 3F90A 3LDHA 2JFYA 1D07A 2P68A 3DDSA 1MCZA 3SKVA 4MICA 3AEUA 3AR8A 1OU0A 5BORA 3PNPA 3MT8A 3RV3A 1WNTA 3H1FA 3ANTA 4WVLA 3IXMA 3LIPA 3P45A 4ZA2A 5KC8A 3ANLA 4OMCA 3VSAA 3W3AD 3OJLA 4PO3X 2R48A 4QU5A 3WMXA 3WK8A 1E96A 2QRPA 3ILYA 4IKEA 5K8CA 3VDXA 4G1MB 3D5EA 1M7HA 4L5BA 3DE2X 5KYUA 5KQPA 3W5DA 3AKYA 3Q3VA 4EJSC 3GY0A 4EJ2A 2GEVA 1Q1ZA 2FZKA 3M2PA 3VVCA 2B83A 1P39A 1VJRA 2E4ZA 5DYNA 4P22A 1IUPA 4F2PA 5E4YA 2V0CA 3PQ6A 5LSAA 3ISJA 3H6HA 2C5FA 3OCWA 3MWYW 4M9QA 1I4OA 1U7XA 2VQ3A 2VPTA 1M2KA 2HRCA 3F6RA 1AG9A 4WFKA 2COEA 4W4TA 5TMBA 4TKVA 1U0SY 3TLKA 4BMVA 4PAQA 1DIHA 4D96A 3FYUA 4HR7A 1RJEA 1V26A 4CM9A 1W52X 2B1RA 2FX3A 3ECCA 1DPGA 1IAVA 2AG0A 1VGVA 5WRFA 1J1ZA 4FYIA 3SF8B 1N4DA 1JEQA 3UNXA 4DIBA 4DCGA 2YMQA 1E9BA 4FSHA 4JB0A 3ZWKA 3E9ZA 1LVUA 3KAQA 2CJWA 3EPJA 3LWBA 1X7XB 5KPDA 2CMGA 2CYAA 3BJMA 3M5PA 4IOLA 3A9VA 2Z83A 4Y2JA 5BVHB 1UXGA 3IAFA 2JIMA 3BRWD 2HRQA 4E3ZA 5LZ9A 1Q11A 1WMEA 4N0MA 2V4ZA 1UBNA 1CY2A 1S8FA 1TKRA 1RW4A 1WMAA 3HGTA 4PEVA 3I76A 3T1VA 5AW8A 2JIZD 4KLRA 4OBEA 2VDWB 3PYMA 3TS1A 3PTZA 4HJRA 3INTA 1ZUIA 4DGQA 3PXEA 2XIQA 1T15A 4KL8S 5AOBA 2QMHA 1O89A 5ITWA 5AXAA 4FFSA 1E6MA 1BG6A 1QFZA 1WUTA 4KRGA 4QUHA 5UKDA 3T1HB 5LZ8A 4QQRA 4YAIA 3GOQA 4LK3A 1L4FA 1PR6A 3DDZX 3WGHA 2DWPA 3FBWA 3K73O 2H5LA 1BHSA 4BHTA 3NRJA 2VNKA 2R96A 3IDOA 4EI2A 5LQNA 1KRXA 3TVDA 1V16A 4TYMA 2DRIA 5HGJA 4MMYB 3TRHA 2EL9A 1IG0A 3GGSA 4E14A 3R5SA 2FPSA 3HHPA 4AQDA 4CM1A 2FG5A 4JOCA 1FMLA 3SGLA 2GSWA 1U7OA 3MJDA 4QQKA 5AKYA 2KLBA 1Q17A 1IXSB 2ENWA 4ZXPA 3TX6A 1VMDA 2KSQA 3NHPA 3ZQ4A 3KZNA 4PAGA 5CJ2A 2PT7A 2IELA 4RV9A 3LQYA 3I34X 4LQCA 1D2NA 1CUDA 5EY5B 4I1IA 5NULA 3CVXA 1M2HA 1O1YA 4IVPA 1H23A 1TO2E 1CRQA 4MPPA 3TLZA 1IPEA 1Z0JA 1M8JA 3BH6A 4PIMA 4G0YA 4F71A 1T3GA 3GVPA 4P58A 4D8YA 5DU2A 2GZRA 1GTL1 4DR2B 3ESDA 5LPNA 1L7BA 3LX5A 4CHTA 3FB4A 4URUR 4CEHA 2XB2A 1NFFA 4V02A 1I4DD 2JK0A 1SKAA 4CN9A 4DKJA 2QM7A 5IP5A 4GL4A 3C7DB 3H7IA 3KUXA 4DM7A 5F23A 2QTMA 5IF3A 3LD9A 1FU4A 1NFRA 2WHQA 3H5IA 1SURA 2HCFA 4OI4A 4RFSA 3RPEA 4B44A 2A9QA 3G13A 4S1PA 1U0OC 1ENPA 1TDJA 2V6GA 5GJWC 2FZEA 2FF7A 4ZT5A 3VJRA 5K9ZA 4FYYA 2JG3A 1VB5A 2PBFA 4AIRA 1AK1A 5FX2A 4ANFA 5EMMA 4MWSA 3LGXA 2ZJ6A 1EG7A 3EUFA 4HDKA 5FUBA 4PLCA 3HYLA 4UNPA 5THXA 2HPAA 4B5LA 2EFYA 5BQFA 2BELA 5I7EA 2ZUFA 2PE5A 2WTBA 1SIOA 1RRKA 5H02A 2LTAA 1L7QA 2OHIA 5A0TA 3M6XA 3EWIA 4M1ZA 5DYGA 2VTBA 2Z8ZA 4GQBA 3HO6A 3R0VA 4NMWA 2NTYC 1A8PA 3I9OA 4IJMA 5DHUA 4ER0A 2C4UA 1JVNA 1BIFA 2VTEA 3NXKA 2NV2B 1XIVA 1BO6A 4FFPA 5IVDA 5JPIA 4LZLA 3M4YA 3ZWMA 3C5EA 1YQEA 4DLZA 2HJSA 1EWQA 3LPNA 4EATA 1I10A 1JFLA 2WP8J 4PF1A 4QYWA 4CM4B 3P9QA 4CM7A 1NLUA 2NZVG 3E61A 5EJ7A 5JSUA 4B3XA 3I01M 3QXSA 1ZWLA 2QD5A 3GRAA 5DM1A 1VCHA 5FL3A 2VQ6A 4QDZA 4BQNA 3O03A 2E87A 1RXEA 1MV5A 5K3CA 4CF3A 3P5BA 4I46A 1ZICA 3NGMA 3WB0A 2ZJ4A 2GCGA 3HDJA 4YUVA 1UPBA 2IPOA 4WJZA 1Z33A 2JFWA 3DMTA 1TMOA 3EZ6A 1MLDA 4QYXA 2AN1A 2C78A 5ALFA 6ADHA 4IMRA 5TDHA 1CZHA 4JI6B 3MTQA 3DKIA 4C03A 2QLBA 1WKCA 2BEWA 2WTNA 1JW9B 1SVWA 5HUJA 4OG2A 4YJFB 3EEIA 3TECE 1VE7A 4ZVMA 1K6MA 3LXRA 2SICE 5EN4A 4XE5A 1CQJB 5E9WA 3KT8A 3NPMA 4H15A 4ER6A 3LFTA 5FUYA 2LGJA 5L3QB 3L93A 1JQLB 3HKBB 1ISRA 1F06A 3EC7A 4NBSA 4F8EA 3D0QA 4ZVSA 1J7KA 1VIMA 3MXTA 5DXJA 4AMGA 1G291 3N28A 1SK8A 1JSXA 1MEJA 2G0AA 2E5FA 2O3JA 4M0EA 3RFTA 2FRDC 3L7LA 3ZXXA 2I03A 1JILA 1FNBA 2ORWA 3LBHA 4MYCA 2NO7A 4XIJA 4CUKA 3FJYA 1P3Y1 4KXFB 1JDBB 1XZIA 4EPXA 4MW9A 5FTKA 2IUYA 2XYPA 4HLUC 3C39A 4PSDA 3RSOA 1TYBE 2C4NA 1JJ7A 2G83A 3RC2A 1WB9A 5B3JC 4BNWA 2UDPA 3LMKA 3SI7A 1BGWA 5IH3A 4FYJA 1FNCA 3ZIAA 2V0NA 4F6LA 5IJZA 4YRCA 2J46A 2JPDA 4OQNA 4FLFA 2POCA 3EJ6A 1N7JA 2F3RA 3UM9A 1FX0B 5I7WA 2E5WA 3O1LA 4TTPA 4B75A 2IPMA 1QQ6A 4E5MA 2LCFA 3KETA 1CB0A 2WAXA 1IN6A 5K0JA 1YMQA 1ISJA 3A6GA 1W6UA 2JEZA 2WFLA 2CZQA 4LXQA 3IP9A 1T1JA 4MIKA 5KOHA 3W90A 4HUQA 5LQAA 1TYAE 3P9YA 1P9WA 2Q99A 3OMWA 3R7DA 3NHLA 2FUNB 1FMJA 4G09A 4CXMA 1M2VB 4YTEA 1NMZA 1P8JA 1ZC4A 2YUIA 3AP1A 1ZA2A 3GLRA 1K63A 2P0YA 3KUKA 4FYXA 4RE6A 5K99A 3QVVA 3WIOA 3E7DA 4CQMB 2K6GA 1ORDA 3RKSA 4ZV4A 4I5EA 4QO7A 5K3FB 2J9FB 4DF3A 5B2EA 4IHQA 2F55A 4EYEA 1NXPA 2HIHA 2B7BA 1NJ8A 5JCOA 1Y8ZA 1GDTA 2FSSA 2Y0CA 3P4XA 2XF8A 1VL1A 1W34A 1OZFA 4Q7JB 2GEUA 2P6PA 2QJFA 2XNSA 3GMDA 3W6PA 5HPYB 5LP1A 3ZCRA 4JUCA 3VJLA 5JY6A 2OENG 1UH5A 4B81A 2W4QA 1NBMA 1COWA 1UC5B 3NTUA 1EK0A 3PZBA 5K09A 1N5JA 1NQXA 3PXDA 2B6NA 3I2FA 1Y5LA 3L7DA 3NYRA 4FPXA 4X1KB 1SY7A 2AMLA 1BH6A 1NASA 1V3TA 1X1TA 4YRFA 3O3CA 2HPHA 4HZUA 5G1NA 1UKZA 3M1YA 3F71A 4Q1VA 3DV0B 5ECGC 1RLUA 1G18A 3G59A 1C29B 1K7YA 1SA0A 4QBKA 3VV2A 2VP2A 3TOZA 4L9AA 4WCFC 1K7EB 4MVJA 3QA3E 3QKSB 4N5HX 4UVDA 4NOJA 3DE0X 3CGWA 3T7DA 4JGGA 5HJEA 1H6CA 2WPDD 3QU5A 4EY8A 3CGGA 5TC4A 5TXGA 1CEQA 2H16A 1LS1A 5BXQC 3GA7A 5AM4A 3EUWA 4BFTA 3IEUA 1CUYA 4XCQA 3ZOKA 3TMKA 2GILA 3L9WA 2G06A 4HLUA 1SCJA 4DA9A 2VAPA 3F6SA 2YQ4A 4TOIA 3EXG1 1CUGA 4CI0B 2JFVA 2W2KB 1L8QA 1ZD9A 3EXHC 3E0XA 4GP7A 4NK4A 5FLXA 1I7LA 1L0BA 3OZFA 1BFUA 1MPXA 3O8OB 1PWHA 3I39X 4UCXA 2JFZA 3X43A 1MX3A 2IYAA 3JATB 1H1TA 1G4AE 2C0QA 2I1VB 4HB3A 5F21A 1E63A 3ABIA 4D5EA 1W0KA 3I4LA 3Q9SA 5F1YA 2ZJ7A 3T1OA 2JI4A 4RSMA 3OJCA 1OZ0A 1GTMA 3ZHSA 4AAYA 2EFDB 4RDXA 3U7FB 3V46A 5DX0A 2IP4A 3UUGA 1HL3A 2C3OA 2WM8A 3ZDEA 2KLHA 3L0DA 5FAXA 4F3YA 4RQAA 3G5AA 4HWKA 4DZZA 2O8EA 2A0XA 2EDAA 1N2CE 4UQPA 3GU3A 1HH4A 3UJCA 1BMQA 2G72A 1EM8A 1LNQA 5DP2A 2IYZA 3ZXYA 2PCLA 3VUFA 3HVHA 4MRSA 1GGFA 2FMXA 4MPJA 5FNVA 5KYVA 1UKVY 3FCCA 2XKAA 3HABA 1R4MB 2XF2A 5G4KA 3IPCA 5CFOA 5FUVA 1XHFA 3JWJA 2FFQA 3QSYA 4EHIA 4J2HA 1I1QB 2FUG6 3OX4A 4GT1A 2GA8A 4UNQA 2BP7A 3TZHA 1QHEA 5A4MS 4JBNA 2NUTA 4LZOA 3QJGA 4LZWA 4ER3A 2AUTA 2LRHA 2YRXA 4F2WA 1V2HE 3ZX5A 1XTSA 3DKVA 3LQ1A 4GI3A 2IOHA 3ILVA 5IEBA 3RK1A 4LCBA 1F9AA 4YRRA 1UZAA 4Q4JA 2YW2A 1GOTA 1XCJA 5CLGA 5HZHA 1O6GA 4ZT7A 4FDAA 3FUCA 1G9SA 4DDTA 4C7KA 5IAGA 2O8DB 3NW9A 2VPWA 1XU7A 2OVBA 4LXYA 3MIIA 1Z8FA 1NBEA 4NZOA 3JALA 3T5BA 1ONSA 4O2LA 1Y42X 4B87A 4B31A 4IZOA 5KOHB 2HEGA 3VR0A 3NRBA 2CLDX 3VPDA 1FFCA 4WBXC 3ML1A 3P2KA 1O94D 3JX9A 2VH5R 2WHEA 1YGPA 4BRUA 2HLDA 3N7AA 1QE3A 2NU7B 1BKSB 1PWEA 1PJAA 1JMKC 3G85A 1W4ZA 5AM0A 3UJ9A 3CLVA 1GQRA 4F2HA 4ZHQB 5LMCA 5F98A 2Q1YA 3ASYA 1OIVA 3EIEA 4MQBA 3GC6A 2IV3A 1M83A 1NOIA 3K71B 2QIOA 3V5NA 4Y1FA 1MKYA 1RP1A 3CXUA 5KTTA 1G6OA 3QKWA 3DOIA 3QLTA 4LW8A 5HKLA 1GL3A 2PTHA 3ZYZA 3HPRA 1QYIA 4YV2A 3WLNA 4B6RA 2G6BA 4K9NA 4KWTA 1NVXQ 3D43A 5LBIA 3HWSA 1ZUNA 4XIGS 5K03A 5JSFA 3VZPA 2ZQZA 3V7NA 4QUDA 3H6KA 2PZGA 3MJVA 1KIMA 1U3FA 4C76A 5BRAA 2AXQA 2OGUA 3F46A 3NOQA 3P5SA 3WNBA 5DYTA 4FDMA 4PPGA 1BXKA 3QFFA 5AK3A 4WOKA 3EGIA 3HKBA 4AYXA 1N8KA 5IBQA 4IJ6A 1TCCA 1BXGB 2G07A 2FPWA 2QRQA 2Q7OE 1HDOA 2DH5A 4HDRA 2RHHA 4DV0B 4N3GA 3PXGA 3EDOA 5EJIA 3ZCTA 1JR4A 1W5EA 1SKBA 4TMVA 3O4VA 3ZBQA 4DR7B 4POAA 3D6FA 5ALJA 1MW9X 3W7VA 1BJRE 2J41A 5B53A 4JU9A 4DV3B 1EMDA 5JE8A 1CJTC 3SQXA 4X1OA 2W7TA 4D3DA 1CWUA 2GLXA 1GFWA 1RU3A 1LQUA 1X7WB 2LV8A 2QQFA 2RAUA 2XPCA 4KQ6A 1Z5OA 3DFFA 2BRUA 1J2TA 1UFQA 3VSCA 1QE5A 1F1JA 1G5TA 2IRWA 1ANKA 2YHSA 2VHJA 4TV8F 4CPDA 1Z22A 4D9JA 5K8UA 1IBLB 1HDIA 4R2JA 1RI1A 2UUBB 1I2MA 4JZKA 3S2EA 5BN1A 2HHJA 2VNIA 1F20A 3MYRA 1V6SA 2CHFA 4TKZA 2D1FA 3EPRA 4WFQA 1BA3A 2A67A 2YWBA 4GX1A 4BFSA 2C7BA 2JJ1A 1T8YA 4XGRA 2DFLA 4LC9A 1EQ2A 2VDNB 2PZAA 2EV9A 4M9UA 4Q48A 1RRVA 4ZGBA 2F8MA 2Q4EA 3MWDB 4G0PA 4RM3A 4RKFA 4WZAA 5E4TA 4TMZA 3WIUA 1Y0BA 5JJIA 3HMKA 4M9ZA 2JI7A 1T2EA 3S5JA 1SFRA 2V8BA 1W8IA 4C2AA 2YJ4A 3AINA 3GLGA 4EITA 1SUPA 3OMXA 3QUTA 1Q19A 1P3JA 3OZXA 4H3HB 1TKBA 4UFOA 3BBPA 4F97A 3E22B 5AH0A 2QP3A 2X0FA 5DNCA 1GUDA 2XMBA 5HWSA 3KB1A 1OXBB 2BBWA 1FDUA 3ABQB 2XBUA 3OJOA 3KZKA 4JGBA 4BMZA 1GLVA 4MUAA 1EE1A 1E62A 3N6VA 4MW2A 3UQZA 2GCOB 4MVJG 3MQ4A 5T4HA 3H04A 2QSZA 3JARB 2AMVA 2PV7A 1JAYA 4B71A 1DQPA 3THWA 2HRZA 1GGJA 3UK0A 4YAKA 2B4RO 1QF7A 3B3GA 1IN8A 1OXUA 4Q1AA 1UBOS 5LQSA 2CXQA 2I7TA 3E22A 5ELMA 4XM1A 4H1HA 4KRYA 2GXSA 1AVTA 1J8QA 4L27A 1B1CA 1XNGA 2GYWA 4MKRA 3NBKA 1ZCJA 2C00A 4U39A 2CFTA 4HEQA 3WLIA 4DARA 1EZZA 3ADPA 1ZXXA 4OYYA 5COBA 1PT8A 1I7QB 1Q77A 1DXQA 4WLUA 5ETJA 2GNOA 4X24A 3KPUA 2I3DA 2VRWA 4IQ8A 5F9MA 4PFQA 2BZ0A 1VJ1A 2YYZA 1K27A 1KEEB 1ZH4A 3LHFA 4NQZA 1GPAA 4BGEA 2CJPA 2ZRGA 2Q9BA 2H1WA 1HT3A 3AF2A 3UH1A 4UM5A 4ZICA 3PNYA 3THRA 3G0HA 2VP6A 5JVDF 5GV8A 3VJKA 2ZJ2A 2IZ0A 3VZSA 1FMTA 2EERA 2RGYA 2HIGA 3DE3X 4R9UC 4E6PA 2DFKB 2X23A 5CVUA 2I62A 5FBZA 1NRWA 3AQIA 1DBVO 4FUQA 4RA6A 2Q6OA 4IYRA 4WXRA 4YAFA 5A6SB 4CMCA 5DW0A 4EJMA 4P31A 4KLZA 4A15A 1OXMA 1L3IA 4UUMA 1FBNA 3KJQA 1YVEI 3NUZA 5CM2Z 3K0FB 2QD4A 1N9KA 3OZSA 4IX9A 3QXGA 4U9IS 3GD5A 1XROA 2JFHA 2ZT6A 3KHTA 4M0DA 5EINA 5AOAA 2PRSA 1L5RA 2VCYA 3GPLA 1GO2A 2IYLD 4YCLA 4TXHA 1PJ8A 1KNQA 1CEYA 1IHOA 1NURA 3GNLA 4OQYA 4MVJP 1Y8RA 3G23A 5DVZA 3E5HA 5AW6A 3A05A 2I7XA 1H2EA 1QGDA 1Z7WA 4WX2B 1I2AA 1NQWA 4X90A 3LQQA 3M8KA 1DRJA 1PQ4A 3B2NA 3SPXA 3N2YA 4GC9A 5CIQA 3ZK7A 3VR5A 5KO2A 3MWGA 5C1DA 5J9FA 3CYFA 1D7OA 4G86A 2C77A 3R41A 1P77A 1E2DA 1R00A 1ZGAA 4ZVKA 4ZOLB 3C0KA 4CL0A 4YRDA 2RHMA 1V1MA 5JNLA 4CKBB 2D2VA 5JXJA 4IH4A 3THXA 4YMSA 4TLMB 4WJKB 1S8NA 1Z07A 1K4YA 4IXTA 7YASA 3BTSA 4K3VA 3ZX4A 4OMDA 2IF2A 4R4JA 3IT0A 4MV6A 1JEQB 2FWJA 2PWPA 3LK6A 2CXOA 4WINA 4JEUA 1CUHA 2ISCA 4CCAA 1YCHA 3TIFA 4BKUA 1CP3A 3FYUB 4QPPA 1YBHA 2XI4A 2V5VA 2Q2NA 1ODKA 4HQ0A 3WGUA 2O8BB 1S3FA 4UREA 1M34A 2XEXA 1GAWA 1VKJA 2B3TA 4N7JA 3LUFA 3PUJA 1UMKA 2A0UA 4E46A 1B0AA 2GPNA 3TQOA 4B79A 2BE7A 4US1R 1FDWA 2PSEA 3FDJA 4QTUB 2PKXA 3UHOA 2CV1A 1MVLA 2JAOA 1DBRA 3O84A 1DHRA 1E2LA 2LKDA 4G63A 5HIMA 2HNAA 1RZRA 2WSBA 3PD1A 1OYYA 4PGGA 3RLFA 3PQ8A 1IHDA 1IHYA 1PN3A 4KE8A 2Q7DA 2WHPB 2PM8A 2ZI5A 2ZRLA 3DBVO 3LC2O 3IPXA 4IMJB 3ZBUA 3C3WA 3ADCA 1UP6A 4DCNA 3RNLA 3X1MA 1LJ8A 4ZTZB 5KYWB 4ZRNA 5IYZF 2P3OA 5JJKA 3SF0A 1V11A 3R5TA 5J40A 1BEEA 1WCIB 1OKKD 2WU8A 1X3SA 3ND5A 3DL4A 1M7GA 3GHHA 4FHZA 4JLKA 4JVNA 4YJ3A 5AKIA 3TXXA 4I08A 3CEHA 2G9UA 1GIAA 5DGTA 4F7DA 4GVLA 3I01A 3A9TA 4P3PA 1G2IA 4LOLA 2B25A 4POOA 1T1EA 1JFVA 1ZMTA 5TPWB 4DBLE 1ZK0A 4PVDA 2Q4BA 4MRRA 1YK0A 4BP8A 5L9AA 1O6FA 3TOCA 2FCAA 2G9RA 5AW5A 1O94C 5A4FS 3SVLA 4DG8A 3E27A 2HU8A 3TR5A 1PZGA 1F9EA 1HE2A 2Q62A 4CIDA 4ENRA 5LR6A 1LDBA 1NXTA 4XSVA 2QRVA 3C87A 4TT3A 3RRBA 4CF4A 2BTQA 2EJCA 2ZYRA 4LXUA 4Y1GA 3BJIC 4X64B 3D3JA 2H5EA 4QNNA 2B8WA 1W36D 2NVOA 1PZEA 1GUZA 2BEUA 3U4MA 2Q3FA 3N8GA 1HPLA 2YWGA 3BM5A 4V0KA 1G3RA 4O4HA 2VYNA 4AJ4A 2O2IA 2PEYA 2VSYA 3GLSA 4XWOA 4BTLA 2BGLA 4CMEC 4AX4A 4CDRA 2FWAA 4HFMA 3RGGA 3ZNQA 1TCVA 2I1LA 2XUDA 3KWFA 3OTIA 4JYAB 3K30A 4TYPA 1GZ6A 1E1QD 3ENKA 3F5MA 1GKUB 3GUHA 3IQFA 3QJYA 3WYFA 4QYIB 1QH9A 3C24A 5AKHA 1UL1X 4O2RA 1KBZA 3ZQKA 3H75A 2JGFA 1Z88A 2YH2A 4PVCA 4BP9A 5E2BA 1LCIA 1TT5B 5JXGA 2FRVA 4LJ6A 3FSJX 3TJRA 5I51A 3K0AB 2CVOA 1ATIA 2EX0A 4D0SA 1VIDA 5J2UA 4HNGA 1G59A 3U09A 2Q07A 3QVSA 1R0ZA 5L51A 3FWZA 1DEHA 1NV9A 5KIAA 1YB5A 1X1BA 4FBMA 2VK8A 4OP2A 3EVAA 1E94E 3F7MA 3I8SA 3N7TA 2WVAA 1G1MA 5DGIA 4K9SA 4V1CI 1OH8A 1IQUA 5FPPA 1QPGA 5ADHA 3K31A 3PQEA 1PR3A 5B36A 3IDZA 4YS6A 2UZ1B 3DZ8A 4EZIA 3RAJA 2WMNB 3GUYA 3TZLA 3GAMA 3BFXA 1BKYA 4C7JA 4MOWA 1FEZA 3GVHA 4RZXA 1PEKE 2E37A 2ONYA 3C85A 3NV7A 3W1VA 4TLDA 3DAFA 1J1IA 5E2AA 1W59A 2V7XA 2Y1XA 2IY7A 4WZAE 3W9BA 2WYHA 3KKMA 1KI6B 2CCJA 3B3FA 5C7IO 2UXCB 1MEOA 4PAWA 3OMLA 2XCTB 1YDEA 2GO1A 1XDGA 1A69A 2QIPA 3LCVB 1K89A 2NVWA 3VTKA 3G2LA 2H2FA 2FEAA 5JV5A 1Z0IA 1EX7A 1XKTA 4TLCA 2AOTB 1KYYA 1PDVA 4XR4A 1QGAA 2JATA 3DVQX 3EFOA 3L04A 2NVBA 3ZC3A 4INOA 3OC6A 1JQJC 2XZDA 4QREA 5FOXA 1Q16A 2HB6A 2J09A 1HGXA 2N0SA 1UFKA 3JYOA 4HVAA 5AI9A 3OT4A 1RRGA 3UMFA 2XNHA 2JZNA 4Q7EA 1SBYA 1J5PA 1XMXA 5GONA 3VC3A 3GL9A 4IHJA 4B46A 4CMGA 1YVUA 2OHHA 4JBXA 5FTMA 1IMJA 5LJIA 4KN5A 4D80A 1NL3A 3A36A 2VDLB 1NZDA 3GZJA 2E4YA 2OT3B 2NXCA 3D6VA 2ZTVA 1PLJA 4ZVUA 4Q93A 1EK2A 2J0SA 4E7OA 4JC5A 1J8YF 2BGNA 1B6RA 3M0EA 2YW9A 3JXEA 2NSYA 2CJYA 4IWNA 1SCQA 4PE5B 3QLEA 2VT6A 3C74A 3K72B 1Q50A 3KNZA 4PTLA 3WLJA 1WPXA 1QBGA 5B1DA 4PZZA 1KF0A 1II0A 3MWLA 1XQ1A 3NKFA 5FQNA 2I1WA 1F6BA 3OQPA 3UXEA 4CM5A 3UK6A 4XSHA 1DIRA 2HV8A 1RXWA 2D0PB 3HO8A 2C7RA 3BE5A 4P33A 4CF6A 4F5WA 4FYMA 2DERA 4P32A 1WSBA 1YR9A 1MC1A 3TEFA 1C8KA 1QH8B 4NFYA 3SYRA 5FWYA 1GYRA 4UC0A 3Q15C 1WW8A 1QVWA 2FWBA 1DCKA 3BXFA 3HXQA 1NT4A 3VU0A 1ZN7A 3E05A 3HU3A 3F8WA 1SOUA 2OA0A 3AWIA 1CZNA 1MQ8B 4PSAA 2QUHA 2GBPA 3K53A 1TVKB 3EXG2 3HI4A 2D00A 1VE9A 3GN1A 2ERYA 2PSSA 3EXIB 1XVLA 1PUXA 5DBHX 3MSXA 4MDEA 4GEGA 5TIIA 3QNUA 4EYSA 2ZUSA 1T2VA 5DN6A 5I4BA 4M8SA 4MAFA 3HFRA 1ML4A 4MGKR 4F9GA 4RTQA 3D3NA 9LDBA 3L92A 3EXIA 2VDRB 2FSVA 1EXMA 2GB4A 2FKAA 4LYJA 1C2TA 4D79A 4CKWB 2A33A 2O07A 4ZI7A 1YS9A 5JD4A 2VCHA 4FN4A 1D3AA 2YCBA 3ED5A 1BSVA 2R47A 2UYOA 1BN6A 2VJCA 3JQ9A 3O4RA 3JQ8B 3ZKWA 1N3IA 4Z3KA 5B3KA 2XADA 4EQ6B 1YIAA 3HJBA 5EIBC 2ETXA 2JI8A 1P1HA 2RH8A 1MX5A 1U2ZA 3EMKA 1IM2A 1FFXA 3MBOA 3X0DA 5GP1A 4U2KA 1X8KA 4N76A 4JT2A 2FDXA 1P1FA 5K0GA 4V0ME 1APBA 3RI3A 2A78A 4DMLA 3WL5A 1NAHA 2Y71A 4MMXB 1ZNWA 1FRQA 5TQJA 1NJ1A 1BE1A 2PD3A 4W99A 1S4MA 3SFTA 4C20A 2VNSA 3QKIA 1B14A 3KYDB 5LB4A 1OXTA 1B6GA 3N86A 2LCIA 3H65A 4AMYA 4L9SA 4NOKA 1XMPA 5IH7A 5JCJD 1XEXB 4RK1A 1W85B 3JZMA 3R3YA 4DLLA 1HDYA 2DHDA 1CXZA 2FMIA 4JB2A 1F8YA 1QLHA 1DAMA 1RHKA 3KKEA 5ICSA 3ZVNA 5AXCA 1ENZA 1AHIA 2HLHA 1EGAA 1GPH1 1CPYA 3LWZA 4ND4A 3ZEIA 3GRRA 2DLDA 2OEPA 3V4VB 2D5BA 2O52A 1PT7A 3QKUA 4RDHA 2O3SA 3STHA 4CMAA 3HC7A 1ZK4A 2PXHA 3NIDB 1BROA 2IOFA 1X7GA 4LGYA 3AXTA 1TM2A 2R5NA 3N8KA 1ZIYA 3EFOB 2Q8PA 3IAUA 1IUKA 4RACA 3ZGOA 2PZLA 2CD9A 4Q1FA 4L5AA 4BE9A 1EUCB 3BK1A 2QBYA 3I5UA 4UMVA 3DDHA 4RKQA 4GBMA 4CDNA 4TKMA 2Y6UA 2AKEA 3Q1LA 3SIRA 1NVKA 2GVNA 3OPNA 2IITA 1NBIA 3BFJA 4QDOA 3L40A 5F12A 2D74A 4P5DA 3MHTA 4FUTA 3DDWA 4DKXA 1TF7A 4HH3C 4YPFA 5JLJA 1QR6A 1OJ7A 1MFZA 3RTGA 3MJHA 1GU0A 2QN1A 1HE5A 3KVRA 3NH9A 4PO9A 2ISQA 1J2YA 1AZTA 3CM0A 4J4BA 3F6CA 1RIFA 4JITA 2PGJA 3P1JA 5G0SA 3TQSA 3T1TA 3HA5A 2ECKA 2D3WA 1UOOA 2MR5A 4JFAA 4ICIA 1QC5A 3LGSA 3P2YA 3OKPA 4M9CA 5FYQA 2GARA 2IEGA 2WICA 3KJGA 1ABBA 2HFJA 1KS2A 2FE4A 5EUBA 3U48A 4I50B 3NAZA 3AR6A 1PR5A 2WWXA 3M4NA 4IOKA 4UEWA 1T1SA 4YJ2B 1VL8A 3VHXB 3V4ZA 4TUYF 1VHWA 3GMIA 1EQUA 2NUAA 2QPAA 2V7BA 1LNZA 3CPJB 2VYVA 2MHCA 4NBRA 4GS5A 2BGUA 4C2UA 5KSOA 1F4LA 1C1HA 3UMSA 5KHLB 5BOSA 5JAOA 2WDPA 1TK2A 5C4IA 1PQYA 2QTRA 3D4OA 1F2UA 5T67A 5A1JA 4PCVA 3ZI4A 5AW1A 2HBZA 4OHCA 1AX9A 4N5NA 2JLVA 1YK1A 3I9FA 1TMGE 4RPIA 5DWQA 2VRCD 2NZXA 3F9CA 3QVOA 5T6BA 2IS6A 4F1JA 4X1YA 2WZDA 1RWMA 1Z0ZA 1JQEA 1IRIA 2HSEA 4G81A 2OYCA 2IXBA 5GMOA 1C1DA 2ZWVA 4PLTA 2AF3C 2R68A 4ZI5A 5EJ9A 3A2LA 4K81B 1NKTA 5HMMA 1F8UA 1M33A 1SIUA 1TF5A 4RYDA 1RCUA 2WJJA 4YAEA 2P5SA 2P2LA 2VOEA 4FFBB 4B5KA 3IMKA 2JFUA 1YR2A 1RWQA 2NUBA 3HYCA 4Q9JA 1XZHA 3HBNA 1NJFA 2QRVB 4KQMA 3IILA 4OQMA 4DBZA 1R4ZA 1AK9A 4MS1B 4MYUA 3L0PA 2AOUB 3KKOA 1ZAYA 2O8FA 4GX2A 3UKDA 3AVOA 5K3AA 1TEVA 1N0WA 2H8GA 1WQ1R 4OKSA 4P7JA 3ZBPA 3X44A 2XB6A 3IUQA 1GAJA 4I3HA 7MDHA 2FMUA 1G5QA 1YZNA 1DMSA 3WGNA 4K9DA 2N46A 3U44A 1PL8A 1WZNA 3FPCA 5BR1A 4CR6A 2A30A 3TVYA 2F6RA 1OBVA 4L2IB 3HLYA 5E6UA 1WPGA 4QXOA 5H83A 1RWPA 3TM5A 1X7ZA 3D31A 4DCTA 1X15A 2EXXA 2PRZA 2OFFA 3BX1A 3BRSA 1IRXA 4YGXB 4AC9A 2RK3A 4P9NA 4GQIA 1FL9A 3OIFA 3NETA 3RAPR 3CLRC 3B3QA 2IGTA 3D8SA 2FPXA 2GFHA 2N3ZA 2YXBA 4I1OA 4V0OA 3CRW1 4BX2A 5JFOA 4GE0A 2QWXA 1XWIA 2ADOA 3PA6A 1CK4A 5EKXA 2ZXUA 3ONWA 4EGFA 1LDGA 2OR3A 4B80A 5BPHA 3I5YA 3FPLA 1TAHA 3HSSA 4L2IA 2EW1A 4MR8A 4ARAA 2WM9B 3C3BA 3K1YA 3N8HA 4KX5A 3DF9A 1MAUA 4OCZA 1A88A 3UICA 3WMRA 2VQEB 2PGXA 3RS5A 3U44B 1T8PA 4MIYA 2HA7A 3G1TA 1TJ5A 3FYUC 3KJIA 1IZ8A 3CONA 1F8FA 3BGIA 1IB6A 1G5FA 2C99A 2WIFA 4OHMA 1ISMA 4Z9FA 2RFLA 3IV6A 3NC4A 2YNMA 5G40A 5DJ5A 2PGOA 3CZQA 4M4SA 5BW4A 1FP7A 1O0CA 1CHDA 1N5IA 5EQTA 1CUVA 2O2ZA 3G0GA 5DMHA 1HE3A 3S99A 3CCCA 3ZDYB 2CE2X 3HR8A 2H1VA 3PGVA 4W9NA 2GCNA 1C30B 1PO7A 1RWNA 4FBLA 3BQMB 3FKJA 1CCWA 4TVSA 2NV6A 1KQFA 2GN2A 2GBLA 3CNHA 3KYBA 2F59A 1MORA 4FGSA 4PBRA 1ZGCA 3R76A 2GBFA 2JI9A 1CEXA 2XZPA 3A0RB 4R1UA 3BREA 3KE8A 4RD0A 2Q8QA 3R3WA 3KELA 1FRFS 4JP5A 3G0CA 2QVYX 4TVBA 5NLLA 3CCFA 3KQPA 4ARBA 1MH1A 5MFPA 4Q21A 2NV0A 1SH7A 3FTFA 1H4SA 4NDZA 4HI0E 4M21A 4P93A 4JGIA 2BDEA 3F1KA 4ISCA 3IDFA 1XRSB 3M5DA 4UTNA 3VKWA 1BOOA 1E5DA 4P92A 4YAOA 3DQZA 3AUAA 3IELA 1HYEA 4JJGA 1KOFA 1QZXA 4XQ0A 3I2YX 2X5NA 2A9RA 3STUA 3G6KA 2CLOB 1R1DA 1SGWA 2AKYA 1GQYA 3LT4A 3ORHA 1L5GB 1A71A 4BFVA 2PUTA 1JI0A 1L8LA 2XT6A 4DEYA 1MGPA 1JLLA 1TOAA 3LM8A 3P4UA 4N0DA 3SR0A 3URKA 3VRHA 1R8SA 5LMUB 3OX1A 1CJKC 2HA3A 3NHFA 4BEJA 1WXFA 1AO3A 1P3DA 3VTFA 1V45E 4S1OA 4KR9A 4PHGA 3N58A 3F7TA 4OH7A 2Y1FA 1L8AA 4HYTA 3N6XA 1CJCA 3A37A 3ACCA 3GYGA 1SUCA 3I4FA 3S8MA 4ZQEA 2RCYA 1BZYA 2Q3HA 5ITZB 3BL5A 5HZGA 2JLRA 2EWWA 1L4UA 1T8RA 4M0FA 4Q6WA 3T7EA 3RUDA 4UTRA 1Y4SA 4OK6A 5K6TA 4U7PB 5BV8A 2YDXA 2VH1A 4I4TB 1FXWF 3VTZA 4ZALA 5FAKA 2ZRJA 3TUZC 2ZYTX 7REQA 2H63A 3HUUA 1Z56C 5CHEA 4EWLA 3FM9A 3JD3A 2GA9A 4AY4A 1RAFA 5CFQA 1CZUA 3O94A 1A50B 1SJ9A 2HD4A 4F3TA 3BF8A 2MINB 1N78A 3A6JA 3QPCA 4WN9B 2YOFA 2K87A 3ROXA 1U99A 3HP1A 4NX2A 3EISA 4H59A 3NBMA 2H17A 4PX9A 3JVEA 5F2KA 4B3BA 2XMGA 4UTVA 1TUIA 2PHZA 1LBSA 3AYXB 3OT1B 3CVVA 3AJEA 1QVZA 4YDRA 5KPJA 4ZVVA 1U8ZA 1PEAA 5ILQA 2B1IA 3LS2A 1J8MF 4OF4A 3CRMA 3JQ6A 3IBYA 4F5DA 5EXTA 1ESMA 2H00A 4XW2A 5JWRA 2O2DA 4LE2A 5DKFA 7GPBA 2HMWA 2W2NA 3G49A 4Y0NA 2N47A 2XE6A 4B3DA 1JIQA 2ODTX 2Y0BA 3FHCB 1YZTA 3HDVA 1SG0A 3INRA 4A0GA 1U1EA 4JT9A 1NHWA 1C5KA 1ZJZA 1VGQA 2ZI6A 4JXXA 1L7MA 1ZVQA 1Z13A 1DARA 1T2NA 1VKHA 3U7EB 1ULHA 2BGTA 2VT2A 2XITA 3AVQA 3KEOA 3MVEA 2PH1A 4G5FA 4QUEA 5D1HA 1P7WA 3WC4A 3DEIA 4KPYA 3IXQA 2JD0A 4FFOA 2FCRA 1JDBC 1S3GA 1WSAA 2G9ZA 3DZFA 3WQHA 1ZGGA 1VSBA 3WICA 3A6DA 1Z68A 1TUBA 3AEXA 3HL0A 1KDVA 1JHPA 2Q1SA 3M6AA 2W2PA 3OQ1A 3RIEA 3LLCA 4HVCA 2OYRA 3OTOB 1LDNA 1PZHA 4XX0A 4HN9A 5K0EA 1GZ4A 2R4UA 1C9EA 1TW3A 1W93A 4NR0A 2QMQA 4BNNA 3CHYA 3E9NA 4CEIA 4HDMB 13PKA 3ZEAA 4A0RA 3OT1A 3GH3A 2G9QA 2OK8A 2VJLA 2R6CA 1TQ8A 5F1OA 1WO8A 2A3RA 1S02A 4FW9A 3DZKA 2R00A 5EFOA 3HCOA 4PU0A 1DEAA 1UM9A 3R40A 2GJAA 4I7EA 5SZJA 3LTNC 4KXMA 5K8LA 1LLCA 3DTVD 1IN5A 5FFFA 2QRLA 2I3GA 2V1XA 4Z1MD 3FNEA 1NJ6A 1JA9A 3RRFA 2WQ6A 4QRDA 1WG8A 3KDSE 2IIBA 3UXMA 5F77A 4FT4A 4LGVA 4G5YA 2ID7A 1DMRA 2OLEA 1E79A 4H9GA 3C4JA 4MDHA 5ALMA 2IEAA 1ZUNB 2IXAA 2DKFA 2JLXA 1YJ5A 2HIAA 3WKEA 2Q28A 1GAXA 1H9AA 4P38A 2G7MC 1O95C 2CFSA 1K6IA 3UHFA 3WFIA 4FHFA 4MXDA 3T06B 1KBQA 1Z6AA 4X8HA 3T3PB 1PNQA 221PA 1LRLA 5AUQA 2A9JA 1Y1LA 5G0VA 1ORIA 2GS9A 4KREA 4RQTA 1OLXB 3GARA 4TRMA 2CXRA 3WWCA 3CVUA 2DCMA 1T8UA 2ZTUA 3IAM6 3GK3A 5F3RA 2QA5A 4X9XA 3L4BC 1YL5A 1WV0A 2Y1KA 4Z3DA 1GRVA 4YQFA 2C58A 2ADFA 3O6VA 1MB9A 3CWCA 4XVHA 3VR4A 3QEBZ 1ZW6A 3AZOA 4W6ZA 2PSJA 3IDQA 2PVPA 4PHHA 1PJTA 2FN3A 4W5WA 1AT1A 2OYSA 1P8AA 1VZ2A 2ZRBA 3RAEC 2BKVA 3DPUA 4OJQA 1ZVKA 3CS3A 2ZM5A 1WZCA 4CWAA 3PVSA 1X1CA 4PG7A 4JLUA 1A8UA 2CDBA 3FCXA 5FBRB 1WCYA 4QVGA 3QV1A 3X2SA 3K05A 1Y3AA 1B3BA 1Y5MA 3AETB 3MUOA 4Q4JB 2ODPA 2ZRNA 3GGDA 3CXRA 1E6CA 2DUNA 4N12A 4ZQBA 2JGJA 1WIWA 2PS1A 1BX1A 2GUWA 4W8OA 4GM1A 1SVKA 2IUTA 1NBAA 3ZCSA 2HFKA 3W78A 1YNSA 1CRZA 2A1TR 5KJCA 1E3SA 2WIDA 2FW9A 1K0UA 3H5RA 3IP7A 5KU1A 4HZGA 3WK6A 3EVDA 5D51S 4RF5A 3AB3A 2ESRA 4P3OA 3CNLA 5C5IA 3EW7A 4ML3A 6GPBA 3DBLB 5BO5A 3TAXA 4GMGA 4B2PA 3LLUA 3SZGA 3W4JA 2IS1A 3B2EA 1CR0A 2D5IA 3R3ZA 2F64A 1KOLA 2WJ4A 1YS1X 4HPWA 2E2WA 1W73A 5TJHA 2MR6A 3LO8A 3F6BX 1KVTA 2OHOA 3FTQA 4V3BA 3I73A 3L0ZA 3HXLA 4XDYA 1YE3A 2OV2A 3P71T 5DOVA 1BEZA 1ABEA 3K1JA 1PWZA 5C9ZA 4TS9A 3WFZA 1G0OA 3PCXA 5TE9A 4GH5A 1TJYA 2IEYA 2P4EA 2QRJA 2GEKA 3ENZA 1XUOA 1JAHA 2VJBA 4D56A 3L1HA 1I1NA 2DJIA 4E30A 3FX2A 1DEKA 3KDPA 3R3UA 4EYKA 3LPCA 3PRHA 5CR9A 4LY0A 3OFVA 4YRKA 4B45A 4QEDA 4HS9A 3ZD6A 3WYBA 1Y6JA 3IVCA 2X8JB 3R2JA 5DHPA 4HD8A 3O74A 2W4IA 4B0OA 4ARVA 1JAXA 1T5LA 3PIRA 2BR4A 3LL7A 4D6PA 5KQMA 5C1PA 1XN4A 2OWDA 3AIIA 1I4WA 3AHEA 3P9ZA 4IIXA 4D3XA 4EG6A 2XMCA 4Q3EA 1HM5A 3TNDA 1UKYA 3JQPA 4GD3Q 4J0FA 4PNPA 4Y9RA 3RTAA 3TQFA 4WCFB 1SD2A 3AL3A 4OXRA 1BEUB 1NXWA 4EEXA 1JUDA 4N5MA 3E7WA 4ZU1X 2CLIB 4WV3A 5IZCC 3NS7A 4FS8A 1NF3A 4RHYA 2B1GA 1DUIA 2PGNA 5KNCH 4IJVA 2I34A 3Q6IA 2W6ZA 4RGQA 4YMWA 3EZGA 2NOAA 1T9BA 2WJYA 1G6Q1 1GA4A 1SCUB 1X7HA 2IWHA 4LC0A 1UK7A 4ESVA 3HXKA 4X1KA 5GIPE 3SHQA 5GPBA 1XD8A 3EIWA 1J39A 3LSYA 5CCXA 3E3MA 2V6JA 4MWGA 2BBOA 2HSJA 4G24A 4KLAA 4EF5A 2PMWB 4GECA 3U3JA 1BCRA 5AICA 5HZKA 3GLGE 2PXAA 2WAMA 4LZJA 4QODA 4C0HA 4RPGA 2BZ1A 5F2EA 1JJVA 4KPGA 4GICA 2RBGA 4YJ3B 5DIZA 5ILGA 1YS4A 3BXZA 4O29A 1KY4A 3CNEA 5FWXA 3G2OA 1BMFD 4D3SA 4LF7B 1IBSA 4PHCA 2OXTA 2VK1A 1FW8A 1E7MA 1NUUA 3EGCA 3G0IA 5C3MA 5FWAA 2X19A 2FG7C 4D9IA 2WYOA 2H0RA 2P2DA 3C8UA 4G3XA 4H0FA 2ZBGA 4ON9A 3SS8A 1B73A 3UHAA 3UTCA 1MIOB 4LDZA 4GSYA 4JT8A 4TMXA 1V5IA 3NG1A 3PIIA 5AHRA 1HT1E 1Y81A 2REQA 1QG0A 1QTNA 3F47A 3AM1A 1DKLA 1KYVA 2QG6A 2H2AA 4M7WA 4BV2A 2GEDA 4RIFA 5EYPB 2QD1A 4B4WA 3ESRA 2A4MA 2RJOA 3OIDA 3ZLVA 4C5BA 2FDRA 1JWAB 3AM5A 3M33A 2JCSA 1K75A 3JWGA 1JXMA 4KTVE 3VGJA 1Z5PA 3UGKA 2P1ZA 1O87A 2R0QC 3RDPA 2RG1A 4V2IA 1X2EA 3STTA 4DZTA 1HOTA 1E7SA 4IHAA 1KQOA 1XAHA 1Q1QA 2CK3D 2R1VB 3FGOA 1E4YA 3E8MA 3I0MA 3QU2A 5B1HA 1CJVC 1U0JA 3V3KA 4C7OB 1KZ6A 1Z2EA 3IUBA 4AM8A 4A5SA 1P0CA 3TB4A 5K6AA 2OCGA 1LC3A 3OFJA 1FDSA 4F45A 4ENQA 4GLBA 1IULA 2GX6A 2IUUA 1DO2A 4KHPB 2YJ5A 5JH7B 2LZ0A 3JWHA 2QTLA 2UUAB 4R5MA 5A06A 4XI9A 1HKUA 1W96A 1I0IA 4OH1A 1CF9A 2Z5VA 2X40A 3EGXA 3D4PA 3LH5A 3ZLBA 4DT1B 5L3QA 2O8CB 2PT6A 1ZS9A 4N0PA 1QG6A 1VM6A 2F67A 2HUNA 3P96A 1R64A 1U4OA 1UOPA 1FTSA 1DC3A 2IU4A 2UV8A 4B3TB 2L0XA 2X9NA 3HJFA 1K06A 4U2DA 1WZEA 3OM0A 5KVVA 4LOAA 2HGSA 4PZAA 3PJFA 3BIFA 1H42A 4IJUA 2VHUA 4CZ2A 5B7NA 5FRDA 1ZNZA 4CQMD 1RAIA 3GEHA 3I8XA 2DLCX 2FH5B 3AHIA 1NU8A 5F9HA 3ETDA 3L9XA 2MCFA 1J5EB 4MZDA 5BSMA 1GV0A 5AK0A 5DDIP 3ZVKA 1PEDA 5ERXA 3RG2A 1WULS 4ZO4A 1WXGA 4F60A 5HILA 4BBZA 3M3DA 4YRMA 3N39C 4EENA 2NTNA 3ZV7A 4JH0A 4HN2A 2JH9A 5EEGA 1SQFA 4EG8A 1B7GO 4AUNA 5LN1A 2ROQA 4UW9A 2XTNA 1S4QA 4L02A 3CE6A 3G6WA 3W2HA 2XT9A 3G0DA 3GR6A 1B1AA 4C7VA 1SXQA 1AQYA 1FP4B 1RE0A 4YRNA 3I5MA 2O5VA 4KQHA 2D5LA 2VEOA 4EUSA 3DEHA 1GY8A 3DOOA 1PS0A 3KSMA 4AS3A 4Z0HO 3D6NB 1U0GA 2FQXA 4RVDA 5FP0A 4H1WA 3VMMA 3QYJA 1HZZA 1JKJB 4QL3A 4Q9KA 1MZVA 1WR8A 4XDZA 2D0OB 3SJCA 2Q5OA 4EQ6A 1VDZA 3G68A 4QARA 2ZM6B 5L40A 2FSIA 2K2WA 1NW6A 5A3SA 3IQGX 4KSCA 4BLSA 1O3YA 4JQOA 3ZTYA 4WXMA 1LSUA 2W43A 4IZHA 3ZD8A 2A14A 4P35A 1RWVA 5A5FA 1DQSA 2GCOA 3GJ4A 5TPZD 1U3TA 3IKLA 4ARSA 4TMYA 3O8DA 2PKRA 2IE0A 2R25B 1OE0A 1QMPA 4NY1A 5BNZA 2C0CA 2XB9A 4OV6B 2WZQA 4GKBA 5DI3A 3W0LB 2GEJA 3KQOA 1R3DA 1QYRA 1W0JD 4YMTA 2GPBA 4XX0B 2NZUG 3HB7A 3G9ZA 1KO5A 4GQAA 2J67A 2WTEA 3KEMA 1Y1TA 1LF0A 5EUMA 3ORRA 4JI1B 1RKXA 2GPYA 3FTNA 1GT6A 1R9GA 2VK4A 2E18A 3IUMA 2I65A 3L0BA 1QONA 2J6CA 1J2RA 3CF0A 3FWYA 2VEDA 3P0IA 1K8QA 4IGEA 5F5XA 3FZYA 3PDIB 2ZUDA 3AR4A 2PL5A 4MI9A 3HDHA 4O5AA 2R7KA 1EP1B 2G5PA 4R31A 1UBEA 3I2IA 3TJZA 3FPJA 3O83A 1E2MA 1CDDA 1E6KA 1SBTA 3N9IA 3O95A 3FCAA 3M49A 3KKQA 3AF3A 1A4RA 5JPDA 1MRNA 1Y7PA 1G7SA 1HUQA 4N7BA 2HJGA 5EKSA 1NBME 5KVCA 3JWEA 1ICEA 1PT9A 1W9HA 1OGIA 2GOYA 1F1BA 4IFTA 5M34A 3WNZA 1Z0FA 1ZM3A 2IYVA 3DAPA 3OHMA 3PX2A 5C2JB 4IIBA 4KXUA 2DR0A 2WM3A 5LDHA 3WLQA 3QEAZ 2EOAA 1U0LA 1Z4NA 4K2AA 1YB6A 4RVOA 3BEOA 1C0LA 3OEED 4G01B 2C5GA 3R7BA 4A8TA 4F21A 3K16A 3BD8A 1Z39A 4IZIA 1G63A 3WLMA 2Z2YA 4HY3A 1E9EA 1YKFA 2WIGA 4D81A 3WNQA 1RI4A 5HX7A 3L7OA 1H69A 4ZYVA 2OBNA 4IX1A 4KLNA 2YJTD 2DQYA 2F1HA 4Z86A 3T38A 3GJ3A 5C31A 4BEVA 4DV7B 1QYWA 4GXQA 4JIMA 3EVNA 3AHCA 4BBPA 1N5KA 3LHSA 2E1PA 2I2FA 5JHHB 3FNHA 2O6HA 5KX5B 2NMVA 3I58A 1EBBA 5I8PA 2EKLA 1ZMBA 2QZ9A 2E21A 3KYCA 3DOJA 3LF1A 4LBZA 1KZ7B 2C1ZA 1K8XB 4Q18A 4C4ZA 5CB4A 1PBTA 2FN7A 2WYWA 1XN1A 2TMKA 2W9XA 3KB6A 5EZQA 1OGYA 1JDPA 2J0EA 3BN3A 3ZK8A 1IYZA 3KBBA 4XIFA 4QXAA 4XIYA 3LTEA 5EIAA 4YVFA 4QA9A 2H4XA 1REQB 4LJ5A 2IW3A 4P4NA 4U2BA 4A2PA 4Q01A 1UZMA 3A0UA 1CQXA 2PN1A 2AJBA 1SOVA 3O2QB 4JI0B 5IULC 4PZ9A 5I01A 3VR3A 1KKUA 2GH1A 1C2YA 3L4BA 4DE5A 3NIBA 5JCPA 2JARA 4DR4B 1NF8A 2OMKA 3FB1A 3OZWA 4PXYA 3HY6A 4ER5A 2YJ3A 2ZIEA 4DWJA 1M6YA 1ZOPA 4WBNF 5BMVA 4EKEA 2HMYB 3A4TA 1XVAA 2HK9A 4QPNA 3TSWA 4BMYA 1O03A 4M7RA 1NQAO 4JUFA 2O14A 5CVDA 2B36A 4F4UA 4TV8A 5IVPA 4HFNA 2B5WA 3GNSA 4TLLB 4DR3B 3OZ7A 3OE7A 1UT8A 2P75A 4IM7A 4MJ7A 1A5AB 4V0NA 5DT9A 5KNLA 1UEXC 3IXLA 4JS0A 1YHNA 1XDZA 2XMQA 3Q3JB 4MGYR 3BSYA 5E3JA 4HQOA 1G64A 3O8LA 5EOVA 1M1NA 3MD0A 4PQFA 3TR6A 3VH2A 3L6BA 3ZNOA 3ZHOA 3GYBA 3P97A 3A9RA 3MXOA 4FFNA 4AJ2A 3ET4A 4X71A 5IHPA 5IT4A 3IPRA 5F3WB 1BDBA 2DE0X 4LYEA 4IIEA 3WDMA 5IJWA 3FNBA 2V5UA 3S3TA 4D0LB 5BSWA 1WCXA 4BJHB 4P83A 3WSWA 3FIJA 2LIPA 1EE2A 2HEIA 1G2QA 5FUXA 3CU5A 1PT6A 3MELA 1E61A 3HXMA 2OV6A 4BN4A 4D4LA 1JG4A 2H0QA 4P4SA 3ZI7A 4OPMA 2AGVA 4BNTA 1EM8B 1IAQA 1NSFA 2RKOA 4WEOA 1QNFA 4XWWA 4PYKA 4ZPJA 1DAKA 4MLDA 1RCFA 3SFZA 4DLWA 5BW5A 5FPYA 1R37A 2WWIA 3T9FA 4LF5B 1X86B 4NAUA 5DCYA 2RI0A 2X6TA 3LUGA 2F48A 4ESOA 1GCIA 2JZCA 4BXOA 1DDOA 2I76A 4GKKB 1FNNA 2BKAA 2G25A 3M4XA 1F8GA 1H1DA 4HS4A 4QPZA 3SC3A 4KTTE 4BIIA 4DM4A 1XHLA 1YZ3A 2OXEA 2Q1WA 3F1LA 3HKEB 5HF5A 4MQMA 5DLDA 1NVTA 1X1EA 1UT5A 1NQVA 3IQZA 3N5KA 5AD1A 1O6ZA 1N6OA 3CZAA 1CQZA 2WVJA 3JATA 2JJ2D 3HJCA 3Q3CA 2GZ2A 4UHJA 4BKOA 4RY8A 1J70A 2C4TA 4I6EA 4INJA 4KSYA 1XMOB 2WU0A 1Q0PA 1VJDA 3IT3A 3OE1A 5JNTA 2X2FA 2PH3A 1FPQA 3HY4A 4KITB 2I1QA 4CEJB 2VAWA 2EQAA 1LKZA 1SVNA 3FI0A 3FKQA 3OCUA 3E2PA 3PGMA 2XQVA 1QG2A 2EP8A 1SWVA 4JOSA 2R8YA 5L3SB 2VWQA 1Y5RA 3A2KA 2FSUA 3T54A 4QOJA 3MF4A 5D2CA 2BFWA 4FW8A 4RVNA 1AY0A 3I5AA 3PGKA 2OAP1 2PTGA 3KR2A 1A1VA 1U0NA 3WJ1A 1DCFA 2OBFA 4GOOD 5TF0A 4AY6A 1RAEA 3GQVA 1CTQA 2XCIA 4RZ2A 4B7AA 3OFNA 4CT5A 3H9BA 3LCCA 5AHKA 4KYVA 1S9DA 2V55B 1M0EA 1ETHA 1QGED 3SZOA 4PM4A 3SLKA 1L4YA 2B9VA 3S55A 4B35A 3G2MA 4P53A 1JBEA 4FZ3A 5HQ3B 2FW6A 3ICWA 1KXJA 4N5IX 2QMOA 2CB0A 4C22A 5JYBA 4Q82A 3I52A 2HQBA 3E2MA 4E1BA 3EPLA 4IGAA 1GN8A 3T8YA 5JQWA 4MWDA 2WWGA 1D5CA 1FNSA 2J30A 2KMLA 3DVRX 4RQBA 2OV8A 2WG2A 3IMFA 1ST3A 4GR4A 4MGIR 5KX5A 3W8DA 3WMGA 3RUAA 2KM1A 2BMVA 2M1XA 3F6EX 4JJ8A 4ZHSA 1E58A 1EFPB 2HMUA 4ZOLA 3SHWA 1AS2A 2AZ4A 2MSEB 3IVAA 2QRHA 5EP3A 1I01A 1Q92A 2V9PA 16PKA 2AQKA 3MTGA 1GR1A 3M5CA 4FC6A 4L0MA 2ODQA 2SNIE 2Y4OA 1QIIA 1O4VA 1EVLA 1ZD3A 1X9GA 4MTLA 1L4NA 5LOVA 5JS6A 1YZHA 1XF1A 1YFLA 3GP5A 3A6PC 4FHCA 2EVWX 4L51A 2ANBA 3HCAA 1Z2AA 1E1CB 1E2HA 5A7HA 3RT1A 1CSEE 2EFHB 4IO0A 3GZNB 4JR2A 2OV1A 3FYSA 5IW8A 3F3MA 4NPCA 2R62A 3WRXC 1SPXA 3GAFA 5IK2A 5FJJA 1FDOA 4BO9A 3RASA 4IDGA 1U6JA 4LCJA 4B3SB 4CV1A 1W5TA 3KJHA 1XLWA 2G9NA 3QVJA 4A23A 3B6IA 2P5YA 2NUAB 1XCOA 4XOUA 1B0PA 2P62A 3QNWA 4NZ9A 1N0UA 3FPSA 1DBPA 1Q0SA 1WOMA 4X62B 5JADA 4Q7KA 4EB6B 1TADA 1QKIA 3OF5A 1S1CA 4Q5IA 5DM2A 2I2BA 1C0KA 5LA6B 2FFRA 4QVKA 3UAVA 4MHTA 3A25A 4JX9A 4MW5A 4NV3A 2CZCA 2VZLA 4TMKA 1E3QA 4L0DA 4S24A 5KUTA 1LW7A 1E4VA 3OKCA 1N0IA 4C0LA 1PYDA 1WLYA 5JNSA 2GBIA 2C96A 4OLAA 3DFKA 3KQLA 2AFRA 3AI2A 3Q87B 5AWFC 4Q7QA 3IHWA 1U80A 1FQWA 4D6YA 3TQQA 1E3IA 2DOKA 4JLJA 5IKEA 3H5NA 4J49A 4XZ3A 5CX4A 1L4LA 2WBLC 1AKYA 4I66A 1N2XA 3NVMB 2ZIVB 1N3YA 4JVOA 2A1TS 4TLEA 4DCSA 1DAFA 5ENDA 5JSZA 2HO5A 4LJAA 4ZC8A 3E8SA 4C3ZA 5LNK6 2P30A 1GZSA 3GP3A 4KUEA 5EP4A 3GD7A 4ZC1A 1ESNA 1R12A 1RBZA 3W7AA 3T7IA 4DLUA 4PTZA 1QIMA 1I1OA 5ALIA 4EUEA 1A4XA 2VP3A 1P2GA 3EBLA 5ERYA 4LYYA 3SHOA 5FUQA 2A5DA 3K5WA 2FLKA 4QFMA 1KE1A 3BGVA 4EGSA 3BDAA 1K5PA 4N8SA 1ZC3A 1BHQ1 4GPTA 1VGRA 5GM2A 2D4AA 4NZMA 2RGCA 2ZRQA 5A7GA 3ZGLA 2FLWA 4EHAA 1NR7A 1EHCA 3KALA 1JJBA 4M1OA 4QECA 1RYZA 1RE1A 3K7EA 1SCBA 2PG3A 4BMXA 1H85A 4OGFA 5C52B 3E53A 4IL5A 2YIJA 4J0GA 3N6RA 3AWDA 1Z15A 4AF8A 1VSUA 3I8OA 3V80A 4U1RA 2Z6VA 1K88A 2DBZA 1UXIA 3RU2A 4DR1B 4RHEA 4RBNA 3RB8A 3U4GA 3J80A 2ZU0C 2Q2WA 5ENVA 1L5VA 1QVRA 2WWVD 1IEVA 3MWDA 4Q4DA 3FKSD 4PFSA 2P6OA 2P90A 3HZOA 5BR4A 3HR7A 1YL7A 3LHIA 4L15A 1CUUA 2CXUA 2XMDA 2HCBA 2WG1A 4OB8A 4B74A 3C6KA 2WSMA 3EIQA 4WKCA 5J3JA 4IEEA 1OFVA 1C7FA 2BFEA 3DKKA 3KVNA 3VBEA 1DV2A 2YV3A 5DFAA 5AM2A 2XOKA 5DT2A 1FFXB 1H4TA 4ZCRA 2Z09A 2FG6C 3NAMA 4BVEA 5B6PA 1SD1A 4QG3A 1CULC 2XDYA 2ZUWA 5CLFA 1IQPA 4QLOA 3M6MD 1ZI6A 3C1AA 3FMVA 4UVEA 4DLYA 3S2IA 5JXHA 1WZ2A 1C1XB 2INGX 4IQGA 2C2ZA 4J16C 3QG5A 1N5LA 3E23A 5ENZA 3RFUA 5GINE 1J4AA 3AUSA 4OHOA 1XMJA 2IY9A 4K28A 1GZ7A 4MUNA 1XWFA 5ESXA 4K0RA 3RFCA 4AXXA 1AMNA 1F0PA 5I5EA 1R0YA 1L4GA 4Z4EA 5CB0A 2G71A 1PW7A 3CJRA 3DE7X 3PE6A 1T4GA 2HUPA 3K5IA 2JKZA 4IDBA 3QW2A 4EO4A 1A2BA 2PKQP 3IRUA 1LWOA 2YKGA 3HO1A 4QDTA 1BXGA 5FBWB 5KZMB 2YWEA 2ZLBA 5IBPA 4M76B 3KOOA 4A9AA 1UJNA 4Q0MA 3MMPA 5IU6A 1H5QA 2BH9A 5HFAA 5ABPA 4ECEA 4FN5A 3FCYA 3OKAA 2I78A 3UJBA 4F1WA 3ADBA 1YQGA 2FN4A 5AXBA 4DIUA 3GJSA 5INTA 4Z4FA 4C0WA 2GZ1A 5FTLA 2AG6A 3AL0C 5K8TA 1Q3TA 1RACA 3CZRA 4DAOA 4DMHA 4IV5A 2RB5A 3D2LA 3LHKA 5EHXA 2GERA 5E9JA 3DBOB 1O96A 3PUVA 4FCTA 1XTZA 2B78A 2BFNA 2J5BA 3K0CA 1XCGB 3AOEC 1U7ZA 4ZU6X 5IMBA 2XDQB 3T3NA 3BAFA 2VPPA 1RCTE 2ZIUB 4WXHA 2CXPA 2FMFA 3K1TA 1LV7A 5IPFA 4PSCA 4KE6A 3FGPA 4EARA 2ZROA 3BXXA 4LVOA 2FHSA 3LBFA 4OSPA 2IIVA 3NKVA 4ZTBA 1VKNA 4R2MA 5H4HA 3X1KA 2I2WA 3NDIA 3B7PA 4MQLA 4A1FA 2H51A 2OB1A 1CBUA 2ZAIA 3MWJA 5LU9A 3HYTA 2JS7A 4DLKA 1EP3B 3HRHA 1C8VB 2CDRA 1T2CA 2C2WA 4U7TB 3J81A 3NFYA 5AHWA 1Y1QA 3WDSA 4XPIA 3FVVA 2QX7A 2VFAA 1G8PA 4PHFA 5J4KA 3KQWA 2FWMX 1T9DA 3NDRA 4UXJA 3RCBA 1OBCA 1XQ9A 2VJMB 4AB1A 4DC1A 1R6BX 4EGCB 5BUQA 3L0SA 2E89A 3IUYA 1U9CA 4M7PA 5LOVF 3DM5A 3I1IA 4TRNA 3OCZA 3ZJ5A 2ODEA 4LOKA 1Q0LA 1DC6A 3P2IA 4JLOA 4NFHA 3OZGA 4TPKA 3RRXA 3VDNB 1JWBB 1N8NA 2BKEA 5TY0A 3W2FA 5K3BA 4J16A 1RXVA 1IIRA 2ZBQA 2ZB2A 3CX6A 2FPGA 4L72A 3Q3HA 4FDVA 5EZYB 4QJBA 4YP0A 2YJZA 3HB5X 1KI6A 4LFBB 5A4JA 1LJUA 3H2HA 4WOBA 3LT2A 5GV7A 2V3VA 1DAHA 4Z1OA 1NN3A 1Q22A 4OHBA 4V0QA 3HN2A 2GUGA 1X3LA 1PGPA 2OK7A 2XQIA 4KAFA 1XRQA 2IHTA 2DTDA 3CPHA 2RAPA 4FYPA 3T4EA 3ADKA 2J0UB 4RAQA 2W6NA 4UAUA 1CDEA 1V37A 3OWOA 3AHJA 4GMDA 4J90A 2I2DA 3CRRA 1VKZA 1GGKA 4ZVOA 1VPWA 2VJQA 2XCRB 4X7PA 4ND8A 1Z45A 4X8OA 1N2BA 4PAMA 3SJUA 2G5CA 2Q9AA 3H11A 4JP8A 2AJLI 4EI9A 5K7SA 1G41A 2BGRA 4PS0A 1D6SA 2GYUA 3RFXA 3RVKA 3WO0A 1JR3D 5IJ0B 3PRKE