3BHJA

Crystal structure of human carbonyl reductase 1 in complex with glutathione
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
275
structure length
275
Chain Sequence
SGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human carbonyl reductase 1 is an s-nitrosoglutathione reductase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Carbonyl reductase [NADPH] 1
total genus 103
structure length 275
sequence length 275
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2007-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bhjA00
4YJDA 5JDIA 2ILTA 3D4OA 3GN1A 3LZ6A 1TXGA 4TRNA 1I32A 1QG6A 2WWRA 2XXBA 4PN3A 2E37A 1XHLA 2VZ9A 1VJ0A 4ZQEA 2H63A 4II3A 4NU6A 4TMFA 3SXPA 3EZLA 1NPTO 1P44A 2HJRA 2IXAA 3NV9A 4I08A 4I5EA 4NDNE 4RF4A 2B5VA 5EQFA 5JAMA 2TMGA 1G6KA 3STHA 1RYDA 3D5TA 4BB6A 2QHXA 4AFNA 1GFSA 3HB5X 3ICCA 3TDKA 2V7PA 3PJDA 3GVHA 2H9IA 5TRTA 3UF0A 2ZB3A 3KSDO 4FR5A 3I9LA 1BXZA 3R0IA 2NTNA 1WZEA 3CPSA 2WTBA 3HE3A 4D3DA 3E1KA 1VKOA 2JD0A 2NTVA 1MB4A 3UKOA 4XB2A 4OH1A 4H3VA 4L73A 4YJGA 1LSOA 4HFJA 1K6IA 3DOCA 5FF9A 4GQAA 3G79A 4CLDA 4MVJG 1WWKA 3AOGA 3GGOA 3HG7A 1ID1A 1R4NA 3DTTA 1GU7A 4FGSA 4HX5A 3RJ9A 5JDIC 2O7QA 4PLVA 3WFIA 1SB8A 3HZZA 4XGKA 3WXBA 4CLHA 5CEJA 1T25A 2W2KB 4DLLA 4E0BA 3DOOA 5G0SA 4E2XA 4NJMA 2E48A 3AUAA 4R1TA 4MVJM 4PLFA 3KYDA 3IKVA 1R66A 5L4LA 3PHGA 1HDZA 1UP7A 5C7LO 3Q1LA 1EQUA 1YJQA 2GN4A 4N5LA 4J3FA 3RKRA 5F3RA 1QV7A 5THKA 3H3JA 2J6IA 3I4FA 3L4SO 4Q39A 3SBOA 2RHCA 3D4PA 4WJZA 1IB6A 3HUDA 1HKUA 2CDAA 1H6DA 1U7TA 3TZCA 1CJCA 2J5RA 4JJIA 4QEDA 4WNCA 4YEDA 2GDZA 5KKCA 5JCXA 1MLDA 3WBBA 3PHHA 3D1LA 4PLHA 5KVVA 2G17A 1BVUA 4NI5A 1R0LA 3PDUA 4J43A 3TZQA 1JKIA 1H0KA 4WK6A 2E49A 3CZMA 4J1TA 1BW9B 2P4HX 1BRMA 3BMQA 4R3WA 4BGEA 1F8GA 5THQA 3RWBA 5JDCA 2IRWA 1C3VA 2EKQA 1PQWA 3L0DA 4GMGA 1XKQA 2YFHA 2BFMA 3ZU2A 1SO8A 3WG9A 2F1KA 2JKVA 3RCBA 4F6CA 3R3SA 3GDOA 3S2FA 4Z3KA 3AU8A 1HRDA 2GASA 2Q2VA 7MDHA 2A94A 3H6KA 4OSPA 4OQZA 1IL0A 5CAEA 5A3JA 4EJ0A 1UP6A 1J49A 2EF1A 1BXGB 4EDFA 4YRAA 1MGOA 1TVEA 3GAFA 4DPKA 5AYVA 1N9GA 4R54A 3LYLA 3OBBA 1PJBA 4IZIA 3GG9A 4MDHA 4CM6A 2VUSA 4CLXA 1HDXA 3D3WA 2YDYA 3QWHA 4YAJA 4AJPA 2V65A 5ES3A 2D2IA 5IF3A 2UUPA 1U8XX 4FFMA 5AXBA 5A02A 5TSDA 4A26A 1DC3A 2XXJA 2YV2A 3F46A 2BI8A 3QVSA 4HADA 2JHFA 3JQAB 4LSMA 1SEPA 4IQ0A 2W8ZA 1Q1NA 1VL8A 4WLVA 4CQMB 2C07A 1ZJZA 4JP3A 4J4BA 4W99A 3KEQA 2QRLA 3DMTC 3DQPA 3Q9NA 1LJ8A 3QW2A 3B6ZA 3JQAD 4R01A 4YT8A 1YS4A 1Z82A 3WGGA 3FTNA 1EK6A 1NWHA 3S2GA 3ETGA 1GDHA 3UHAA 1FDUA 3AI3A 3WICA 2I66A 3V2GA 1GD1O 4CMBA 1MFZA 3PHJA 3H8VA 5KCZA 2O7SA 2AQIA 4GPD1 3WTCA 3RROA 4J7UA 1ISHA 5ER6A 4ZGWA 5TC4A 2HMTA 1NHWA 2VWHA 1DSSG 2E4AA 3ZWBA 4HV4A 3LT4A 4DTIA 1CETA 4EW6A 4ONEA 3DBLB 5ENDA 2CF6A 3ORFA 1LSJA 4MVJE 1DIGA 3LDHA 3TWOA 4CPDA 3SJUA 3ZV4A 2VOEA 4ND2A 3ZWNA 2FN7A 2OOSA 4DMLA 3EYWA 5IZ4A 1F0YA 1IYZA 3CUKA 4MKZA 3VPXA 1JU9A 2ZYDA 4LMPA 4CMIA 5I7FA 4ZN6A 5B12A 3RUDA 4BNFA 5CG1A 4AJHA 4XJSA 5F5NA 4PG4A 1DC5A 4DIBA 1KETA 5T57A 2AHRA 3ZZNA 3RVDA 3JQ8B 3C1AA 4FCCA 1P1RA 3LC2O 2D1YA 1XG5A 4DBVO 1LUAA 1YOVB 3HDHA 5IFLA 3PK0A 4EJ6A 3ZHBA 3GDGA 5IG2A 4CM8B 3HDQA 4NBUA 3ASUA 2BD0A 3F4LA 1LC0A 1GL3A 3AY6A 3KETA 3V2UA 1R12A 1SPXA 3PYLA 1I5RA 3QRWA 2HCTA 1PSDA 2ZTMA 1BDMA 5TF4A 4BO1A 2IE0A 2VHVA 1NQ5A 2NV6A 3VDQA 3OEYA 5JAQA 3NAQA 1UDAA 5KTKA 2B4QA 2PFGA 3KSUA 5TJ9A 3WGOA 5DF1A 4BNHA 1C1XB 2RIRA 2EP5A 4A0SA 4I1IA 3OF2A 4CMJA 1A4UA 2Z95A 4IDCA 1XQ1A 2FOIA 4G5HA 3EUWA 5DCWA 3KYCA 4GGPA 4BNUA 4BNGA 4EUEA 4IDFA 4O63O 2HSDA 4CLRB 4NPCA 3OP4A 1H5QA 2XOXA 3DZHA 3WFJA 4RL6A 4D0RA 2EHDA 1P45A 3QVXA 1WMBA 1GZ6A 1I33A 5G0WA 1NYTA 1P9LA 1B14A 3BMNB 4BNYA 3HN2A 4GMFA 5CEEA 3JQEA 1KEPA 5B4VA 1UAGA 1N1GA 4DPMA 2O3UA 3ZWPA 1PIWA 4ALIA 3JSAA 1KY5A 1Y8QB 4J91A 4WOJA 4E2ZA 4GL4A 1J4AA 1H6AA 4GX1A 4HXYA 3F4BA 3E9NA 3AOEA 3S8MA 3DHEA 4ZQBA 3HJAA 4GWKA 1OAAA 1B15A 2EKPA 3JD4A 4UUNA 1R4MA 1GPJA 2PK3A 4RCVA 2X0IA 1DRWA 4GSLA 5C5IA 3FBGA 1AE1A 4Y67A 2WYWA 1IUKA 1MC4A 4OIMA 4PZEA 5G4KB 3OJEA 1DXYA 5COBA 2PA3A 1VKNA 1HLPA 4NHEA 4Q3BA 3FSRA 5T8KC 2HDHA 1NVTA 1FF9A 4OSOA 5JAIA 1Y8RA 3U49A 3IP1A 4TROA 4YXFA 3E5RA 6LDHA 4ZQGA 2DUWA 5G0UA 4R16A 5GZ6A 5DT9A 4NG5A 2JJYA 4WLOA 4CR7A 2IDZA 4UVEA 2FR0A 2FHSA 4DLAA 2VZ0A 4RV9A 5L4SA 1K5HA 2EJVA 5B1YA 2AG8A 1O8CA 2G5CA 2HRBA 1BVRA 3WGQA 3DZJA 2ZTVA 1T2EA 3CMCO 1JLLA 3QIVA 4LCJA 4NK4A 5FEUA 1HSZA 3EMKA 1X13A 3B1JA 2H6EA 4TRRA 2I6TA 1O94A 1L7EA 3EY4A 4QXMA 4D0SA 4FOOA 2D59A 2LDXA 3ZHYA 3G1TA 1JN0A 4BIIA 1IPEA 1HE5A 1N92A 1Y5MA 3BMOB 4UVHA 3U4CA 3ZU4A 4QO7A 2WD7A 1MX3A 1Z73A 1F12A 1LDMA 1KEVA 1EUCA 2NU6A 3GRPA 4RPKA 1ZK4A 4XX0A 3ZNNA 3PRJA 1PJ2A 4BGUA 5KWEA 3I9KA 1HT0A 2RCYA 4M86A 4YRBA 3ROMA 2F00A 1EBUA 4WEQA 2O3QA 4L4RA 1U9JA 2CFCA 3UW3A 1YDWA 4QUKA 2VRCD 1B8PA 5JBIA 1W4ZA 2PV7A 4R5HA 1PJ4A 2DLDA 3FRJA 5DOVA 4HFMA 3G1UA 4DWVA 5KNLA 4FC6A 1ZEJA 1Y6JA 2NVUA 4MPDA 4YA6A 1PEDA 1C1XA 3TPCA 5A5EA 1JDJA 1XSEA 1V8BA 3E18A 3IP3A 4AJOA 2ZYGA 5JE8A 2JCYA 4JCOA 3UCEA 4YAKA 4R5MA 4E32A 2VQ3A 4CMEC 2UV8A 1ZSVA 1E1NA 4WUVA 1U5AA 1ADBA 3NRCA 2Z1NA 3E9QA 3K5PA 1JWBB 4BO9A 4KQWA 4R69A 4YTEA 5G0VA 3A1NA 4Z9XA 5BSHA 2GZ1A 1GZ3A 3F1KA 4FW8A 5A9RA 4CV1A 1XIVA 1X7GA 3ONFA 3QJ5A 1ZNQO 2FMUA 1YOVA 3IIEA 3K31A 3L9WA 4L74A 4YT5A 1MXHA 4FDAA 2PNFA 3VKVA 5DULA 1GTMA 1ZIDA 5T67A 5TJHA 2FPPA 4NBRA 4DL9A 4ALNA 4BNVA 2A92A 3RASA 1AN9A 4XQ9A 4IIUA 2GYYA 5FWNA 3AUSA 3RC7A 4J9VA 4FSHA 1CRWG 1UDCA 5IDQA 2NU7A 4FJ0A 1JW9B 1PU2A 3MTGA 4WE3A 3RD5A 2AQ8A 3A06A 4M1QA 4ZHSA 2NVBA 4J0EA 4E4YA 1QMGA 1YQXA 4GX0A 3G49A 2OXIA 2RH8A 2X8LA 4XGIA 5TGDA 5MDHA 1GUFA 4CM4A 1HE2A 2ZKLA 4BMSA 1I2ZA 3KSZO 2C7GA 4MIYA 5CPFA 1IE3A 4RPJA 5T8KA 1TT5B 5BSGA 4RF2A 2VNAA 2O2SA 1ZMOA 1E3JA 3ADPA 5HBRA 2HAEA 4E3ZA 3GNQA 4LVCA 1JTVA 2BFPA 4R1SA 5L40A 1QKIA 4DYDA 2BRUA 3HDJA 4ZRMA 3QE3A 2QYTA 1OOEA 3KZVA 3OMLA 2NM0A 5KJEA 2FP4A 3V1TC 4AJJA 2ZQYA 2Y1OA 5JO0A 1QLHA 1P1KA 1E5LA 5I9LA 2EG9A 4NQZA 1W0CA 1SOWA 3PWKA 4ND5A 1BMDA 3GVXA 3WGTA 4RF3A 1YB5A 1YXMA 4NU5A 3ZU3A 3IKTA 3ICPA 3P2OA 2ET6A 4IDEA 4OKIA 2FZEA 4TVBA 2GLXA 3DR3A 5B37A 2EERA 4RF5A 1EK5A 4FS3A 5A04A 2NADA 5EJ2A 1LTHR 3FF4A 3WLEA 1LC3A 2E6UX 4UEOA 2P9EA 2Q50A 3W6ZA 1E3SA 1YRLA 4K6FA 3OJOA 3NGXA 1FDTA 1ENYA 1X0VA 2OMEA 4NBVA 3W1VA 4GH5A 3BTUA 2VZ8A 4U7WA 2YV3A 2IYPA 2W2LD 5F1OA 3U4HA 4CUJA 2AXQA 1GADO 3ZNOA 4OGWA 4CODB 5HA5A 3AM3A 1GY8A 3LU1A 2I5PO 3S2EA 2Q1WA 1IULA 1IPFA 4P4LA 4YJHA 1ZH8A 5C3MA 3KO8A 4L0QA 2OO5A 3UGKA 1SB9A 5L7WA 5EQDA 4CJXA 2QYSA 4DXHA 3EVNA 3HWRA 1HDCA 4CM9A 4A5OA 2GNAA 4CV3A 4DRYA 5CDUA 1LNQA 2YW9A 1PZGA 1G1AA 2ZIZA 4ZQHA 1M6HA 1BW9A 2GR9A 3RBXA 3GMSA 2FSSA 4XIJA 4CMKA 3CXRA 5G2OA 4FFOA 3DZIA 4D45A 2WSBA 3JD0A 4PLCA 1VE9A 4H16A 4J0FA 3Q6IA 5AXDA 5IXYA 2AE1A 1DAOA 1F14A 1HWYA 4OMUA 3VPHA 5EPOA 2YZ7A 1AXGA 3B20A 5I7VA 1P0CA 2DPGA 1YL6A 3GR6A 1B3BA 1CWUA 1EQ2A 3H5AA 1ULUA 3NDJA 5EMHA 5IDWA 1JVBA 3WJAA 2I9PA 5A05A 1X0XA 3WX0A 3SC4A 2C2YA 5JAZA 1JKFA 1M66A 2CVQA 4JBIA 1ZMTA 3BAZA 4KDFA 1L1FA 3L4BC 4Y8VA 4BO4A 1VC2A 4NJMB 4CUKA 3I9MA 3WYCA 1U4SA 2W2KA 5EINA 1AGNA 1EVYA 2YQ5A 3COSA 3L6OO 2AMFA 4E5MA 2CMDA 3DBHB 2D3TA 3H3FA 1XEAA 4W7HA 2WM3A 2C54A 5J23A 3TQHA 1T26A 4JX8A 1M75A 2XF8A 2PH5A 3BHIA 3S2IA 3HHPA 3WIDA 1T2FA 4PRKA 1A71A 1HYHA 3KLMX 5ITWA 3OIFA 5DBIA 4NR0A 3ETEA 3MOGA 4RVDA 4CM4B 4NIMA 5F5LA 4CMHA 1JQBA 1PZFA 4JGBA 1XGKA 4ZQFA 4J7CA 3FD8A 3F47A 3RUCA 3WQRA 4XDZA 4BO2A 3GOHA 2O2YA 3LK7A 2JAHA 4YCAA 5DP2A 2J3HA 3JQGA 1ADCA 4XD2A 1Q0QA 3AI2A 3JQFA 3NKLA 4LK3A 2AQHA 3VVCA 2WD8A 4GI2A 5HM8A 2ZTLA 4E13A 2NWQA 2X86A 3D3EA 1K0UA 2EWMA 4L8VA 1PGQA 4BNXA 2PLAA 4PCVA 3DZBA 3E5MA 2UVDA 4AJ4A 4S1VA 4EYEA 4MVJI 2VHWA 4R1UA 3ZN2A 1DB3A 2YV1A 4GLOA 4D7AA 4Q3AA 4R9RA 1E1KA 3RUEA 4BB5A 3F6YA 4U5QA 3GPDG 1I3NA 3PYMA 1GQ2A 2HUNA 3HSKA 4ZRNA 4YAIA 2EIHA 2PH3A 3K9QO 4P8RA 4O1MA 3H9QA 4KZPA 1YQDA 3B1KA 2CY0A 3BXXA 4TKLA 6ADHA 2EJWA 2YFQA 1SAYA 4J6FA 1N1EA 2DT5A 2FRDA 3B70A 9LDTA 1BDBA 5DDIP 2B4RO 4W4TA 3RBVA 4N7RA 1TT7A 2JD2A 1P1JA 4ID9A 2VUUA 5JFOA 4FFNA 4R51A 3DBVO 5U4QA 3VPSA 4BO7A 3IS3A 1UJMA 2HO5A 4HKTA 1E3WA 3DBRB 3ULKA 5EN4A 3F5QA 3EAGA 2DFVA 4Z9FA 1WAMA 3V2HA 2C2XA 1QYWA 4AICA 2QRKA 1SNYA 4IDBA 4GX2A 4YACA 3JQ9C 3I6QA 3VH4A 1Z45A 4S3MA 1P0FA 3H9JA 4U6QA 3TF5A 1GUYA 1E7RA 5TT1A 1EFLA 4XWYA 1M67A 4J1QA 5FI5A 2UUOA 3HNPA 4IY1A 2I65A 3JCZA 4WNIA 5I8ZA 4BQRA 1M76A 1NXQA 4DREA 3A28A 2PZMA 4IXTA 4W9NC 1HZZA 2FPIA 2YYYA 4TZKA 1EBFA 2PR2A 5IDXA 5K6AA 3DAGA 3RIHA 1BG6A 3P19A 2NTJA 2RAFA 3ETDA 1VSUA 2V6FA 3R6DA 4FB5A 3I3OA 4N5NA 3Q11A 1UR5A 1NX6A 5TLSA 2HMVA 1P77A 1Y8RB 4JP2A 3ZWOA 1YQGA 1LLUA 1E3WB 3DBRA 1PTJA 2PTGA 3WWYA 1Q7BA 2GPTA 1R15A 3V5NA 4EEZA 3GUCA 4PG6A 4KUHA 3K2BA 1RJWA 3FR7A 5F1KA 1DFIA 2OHXA 2VYND 1PR3A 2CDCA 3ZWXA 3W4IA 3GK3A 5KJFA 4LGVA 3QVOA 4KMSA 2QW8A 3AOEC 3MJCA 4ZJUA 4UUPA 4AJ2A 3X2FA 1A5ZA 2GUGA 4L4XA 4PFJA 2PGLA 4EI2A 1CQIA 1U3UA 1GYQA 4KDEA 2W90A 3FNHA 5A9SA 4OM8A 1PS0A 4OJNA 1D7OA 3BTSA 3LC1O 3GDFA 4DC1A 4AG3A 2VRCA 1TA4A 1Y8QA 4EBFA 1T1RA 1Z7EA 3I9JA 4W9NA 4IMPA 4MVJH 3AU9A 3WS7A 2B69A 3TFQA 3MJEA 3LVFO 4FD3A 3GUYA 2NNLD 3KV3O 4YJFB 4CR8A 2BFOA 3TFOA 4XGNA 5DBGA 2IZ1A 2X0JA 1DDOA 4U0JA 3ZWWA 5L9AA 2J3JA 3GZNB 3O03A 4XYMA 2EV9A 1PJCA 5KVCA 2GO1A 1GPDG 2GN8A 3JQGB 1K6XA 1Z6ZA 3KXDA 1CQJA 3O4RA 1NP3A 2PZKA 4B3JA 3JQ7B 3AM4A 2FR8A 2IZZA 2LDBA 4CQMD 5COAA 3TN7A 1KY4A 1ZXBA 3RC2A 1KEWA 4IDGA 5BSFA 5BNTA 1DFGA 1N8KA 4AJ1A 4MVJP 1X1EA 3R1IA 1IHYA 4RVGA 2FR1A 2JFHA 1O6ZA 3EHEA 4MIOA 1GUZA 3TRIA 5CDGA 5H83A 3I6IA 1HF3A 3RJ5A 4BNZA 5JMWA 4M89A 2H5LA 5ILOA 1DOHA 3ON5A 4BNNA 3V1YA 2G0TA 1H9AA 4QECA 5G0TA 3TZKA 3DBHA 2CVOA 1ORRA 1JA9A 4U8GA 2OORA 4CMCA 3GVPA 3KB6A 3K30A 4PGFA 4JK3A 4J90A 4BNLA 2P91A 2P5YA 3BIOA 1KIFA 1DPGA 4RGBA 4DYVA 3H9UA 3P7MA 2YHIB 4G81A 5F21A 1T4BA 4KTTE 1Y5RA 1ZUD1 3VH2A 1DJQA 4D3FA 1Q7CA 1ADGA 2AG5A 1B16A 1ENOA 2GSDA 1YBMA 5CDSA 1JAXA 3JQCA 1UXHA 3MZ0A 4LCEA 3VPFA 4J4TA 2C0CA 1SOVA 3ASVA 3F1LA 4I9HA 5EIOA 3PWZA 1QLJA 4ALJA 4EGFA 1C0IA 1E6EA 1P1FA 3EZYA 3NTRA 1JWAB 3OA0A 2HK7A 3ABIA 1SMKA 4XIYA 3GZ4A 1ULSA 4BNKA 1H9BA 2YJZA 3PYXA 3PGXA 1KVTA 1KVQA 2X58A 3KM0A 3RU9A 1YONA 3T7CA 1UP4A 3RKUA 1RKXA 2O4CA 1BGVA 1LQUA 4QQRA 4PZDA 5LDHA 3JQBA 4I9NA 2DVMA 2B35A 1PL7A 3O38A 3I83A 1UZNA 4MJLA 1EMDA 1E3IA 4YB8A 3WR5A 1YL5A 4BMNA 3ZV3A 1UZMA 3FWNA 3ZCXA 2IEDA 3SJ7A 4OHUA 4NFYA 3OQ6A 1UUFA 1DRUA 3T7EA 3INGA 3CSDA 3NYWA 4B7CA 2Q4EA 3MEQA 4YJHB 1N7HA 4E30A 3GH3A 3ZWCA 3HB4X 1RPNA 3C7DB 3DMTA 3PJFA 5JDCC 4AJEA 3OH8A 4BGVA 3PEFA 1ZFNA 4DLBA 3EDMA 5JPIA 2GZ2A 1S7CA 3GFBA 3JQAA 4TVOA 1V3TA 1HE4A 1KC1A 2HLPA 3GVCA 3U9LA 1YBVA 3JYQA 4RZIA 1PZEA 4HBGA 2Q45A 3WMWA 1AHIA 4BV9A 1ZXLA 2FSVA 1XCBA 2NUAA 4MKXA 3T4XA 2CZCA 2AQKA 1IOLA 2Y68A 2Y05A 2PD4A 3D7LA 2PKRA 4TSKA 2EEZA 1HXHA 1F06A 3E9MA 3RI3A 2ZATA 4CM7A 1T2CA 3IDSA 4BO3A 1NQTA 2X0RA 3N7UA 4P22A 5EESA 2I3AA 4Y9DA 5CEFA 5AVOA 4RPHA 2VN8A 3F3SA 3I4CA 4L4SA 3RFVA 2GN6A 3ROPA 3W8FA 1BXGA 1Q0HA 2RHRA 3LT1A 4FFLA 1S6YA 4RO0A 2VT2A 4X54A 1I3KA 3VTFA 1L7DA 1XYGA 3QHAA 4ROSA 4AJLA 4D79A 4C7KA 1BHSA 2FY8A 1P31A 1P33A 2QQ5A 3OM9A 5H81A 2DFDA 3IAHA 3U3XA 3CIFA 3O26A 2P9CA 3E82A 5L51A 4UUMA 5IZCA 3PLNA 1R0KA 4MOWA 3TJRA 1E6UA 4E21A 1NTOA 4E31A 4PG8A 1OMOA 3UVEA 4A03A 2Y1EA 1QYVA 2O3SA 5JCJA 2CVZA 3M2TA 3IC5A 3OQ1A 1GCUA 4FOSA 4EEXA 2BKAA 2EXXA 2HK9A 2HU2A 4HNGA 3OJ0A 4RPGA 4D43A 2JFFA 3OHSX 1JAYA 5L4NA 4WLUA 1V35A 1OI7A 2DTXA 1WPQA 3L9XA 3KHUA 1R6DA 3GRKA 1X1TA 1W6UA 1TT5A 4WKGA 3RFXA 2VCYA 1LU9A 4U0KA 2WEKA 1VRWA 1Y7TA 4DA9A 5ITVA 2Y1GA 5KJCA 1JKJA 2WMDA 3GHHA 3SVTA 1XA0A 3WGZA 2X5KO 3KYBA 1XU7A 1PL8A 3H5RA 3SEFA 3KBOA 3H5NA 1DC4A 2XPCA 4WEOA 5TX7A 2EP7A 1J6UA 1YH3A 1HZJA 4W82A 2OZPA 3DZKA 3RUAA 4KWIA 1RM5A 4KUEA 4PLTA 1ML3A 2HMUA 1XQ6A 4PLYA 1Y9EA 4WGGA 1DIBA 3SLKA 3NUGA 4IJWA 1W73A 2O4UX 2YHIA 3ZDFA 2DUUA 3I9OA 4R3NA 4UVDA 4UVIA 4KOAA 1BWSA 1DRVA 2C82A 1LRJA 2JFGA 1R4NB 3VVBA 4QSMA 2BF7A 2BGMA 2B36A 1QXSA 3M2PA 1GYPA 1DEHA 3UAGA 4IUYA 2JL1A 4OKNA 1GV0A 1NR7A 2Q99A 2VWGA 1LDBA 2GRAA 3FCOA 3I23A 4XQCA 5TS3A 2Q2WA 1G0OA 3V1UA 4B4VA 4FFPA 2Y93A 4YYZA 1AXEA 3ZGYA 3EVTA 4LRSB 1IZ0A 1RWBA 3E8XA 2SCUA 4ZA2A 1R16A 5LC1A 3ROKA 3OIDA 1DIHA 1U3VA 3PFWO 1Z75A 4I5FA 1M2WA 3NTQA 5DP1A 2Y99A 3TOXA 1LLCA 3Q0EA 3H65A 4EZBA 5ILGA 1QV6A 3JQ7A 3KLPX 2R00C 4UEJA 5FI3A 3NTOA 4Z0TA 4LRTB 3TZ6A 4BNTA 1OC2A 5JS6A 3FHLA 2GD1O 3GT0A 1QYDA 1A72A 3DOJA 3F5SA 5IN4A 5K6AC 4B4WA 3DDNA 3E03A 1U7HA 1D4FA 2OL4A 1KC3A 2Q46A 1EE9A 3ZI0A 3BMOA 1KVSA 4N54A 1DLJA 2ZCVA 3PJEA 4XDYA 5JO9A 2BMAA 3O8QA 1TB4A 5BQFA 3ZWAA 5TNXA 3VZPA 4J49A 1XWFA 4I5DA 1KEUA 3DONA 1VJTA 2Q1SA 1LRKA 2QZZA 3GAZA 1VLLA 1OZAA 4B79A 4XA8A 5A9SB 3OA2A 2AE2A 4WLNA 4PVDA 4XR4A 3GN2A 3INRA 3OJLA 4NMHA 3MJSA 3H2ZA 4BGIA 2J8ZA 4RZHA 3H9GA 2NU8A 3TL3A 1DO8A 1A27A 3MTJA 1FDSA 3ONDA 2D4AA 4FIZA 1YE3A 1VI2A 1A9ZA 4R9SA 1E6WA 2ZTUA 4E2YA 2VHYA 3L07A 3UCXA 4LMRA 5JLAA 4BKUA 3K2EA 3K73O 4ZU3A 2GCGA 3RUIA 5TIIA 2C5AA 2C20A 4OXNA 5ENVA 5G4KA 4BMVA 5I7SA 2DBZA 4FGWA 3Q2KA 4RDHA 4AJIA 2X9NA 1J0XO 1P1IA 2V6BA 2J5KA 4FPXA 3AUTA 4R68A 1WVGA 2YQ4A 3D5QA 3GQVA 1U5CA 2Y0DA 1H2HA 1KBZA 4HFNA 2WDZA 2NLOA 4BS9A 2W4QA 2PKQP 4QO8A 4BQPA 1HDGO 3NT5A 3O9ZA 4ESOA 1CEQA 1OC4A 1FJHA 1LA2A 1B26A 5B4UA 1M6WA 1N2SA 3WMXA 3ZWVA 1E1MA 2DAPA 1X7HA 4PIVA 4W7IA 3S1LA 5IJZA 2CSUA 5AXCA 1VSVA 4RQUA 1P1HA 3VH1A 3CEAA 4Y6SA 3PHIA 4GKBA 3W4KA 2BELA 2G76A 2DPHA 2BGKA 4XRRA 2J5QA 3AUUA 3WSVA 1K6JA 3BMCA 1E3EA 1HDRA 3JQFC 1C0PA 4IINA 3DFZA 4XEHA 1OBFO 4EITA 3ANLA 3SX2A 2QZ9A 3AY7A 5L3ZA 4F6LA 4CV2A 1ZO8A 5BT9A 3WNQA 3PPIA 3VH3A 4CLRA 4RQTA 3PJGA 1YDEA 2O23A 4BUCA 5DBFA 1RYEA 3ZWMA 3IL2A 2POQX 1B3RA 3G3EA 3QLJA 4FC7A 2D5CA 1E7MA 1X7DA 2UYYA 5KIAA 2IYOA 4TRMA 1EVJA 3JYPA 1YO6A 3VC7A 4MVJF 3U09A 3WTBA 3K6JA 1NAIA 4MVJA 3C7CB 4YAGA 1MC5A 3JD1A 1J5PA 4J2HA 4C4OA 3PLRA 4IQGA 1TLTA 4FN4A 4HY3A 4N18A 1RM4A 2A35A 2ZB8A 2C7VA 3PIIA 4ILKA 4F45A 2VOJA 1I0ZA 1YVEI 4N5MA 3RFTA 2VYVA 1E7WA 2O48X 1DJNA 1PJLA 3MWDB 4E6PA 2X9VA 4JJFA 4PLPA 1V6AA 3BHMA 5CDTA 1FDWA 4CR6A 1GYRA 3JQ8A 4XCVA 5ADHA 1N5DA 1PWXA 1Q7GA 3K96A 4FQ8A 1C0KA 1DFHA 4UULA 1U3WA 1NPYA 1WDKA 3PWSA 2G1UA 1C0LA 3QSGA 1LRLA 3CINA 3PVZA 3L77A 5A3VA 3R3JA 2B0JA 1UDBA 1R0SA 3JYNA 4XQEA 3H9EO 2VWQA 4MP6A 3VKUA 2VTDA 4E5PA 2BHLA 1VPDA 1OFGA 2OP0A 4DGSA 4BV8A 2VT3A 3AW9A 2P9GA 3GEMA 1I36A 1LDEA 2Y1CA 2VNSA 1GEGA 2FZWA 1PS9A 4RJTA 5K0ZA 3INTA 1WMAA 4LN1A 3QVTA 3DBLA 2B4TO 3NT2A 4AJNA 2X1HA 4Y6RA 5A1TA 3C1OA 3WYEA 4BKPA 1NQAO 1YB1A 1K2WA 4J7XA 4W6ZA 4WOKA 5C37A 4A2CA 3ADOA 4XB1A 2A9FA 3V8BA 2DBVO 4ND4A 2IXBA 2O3RA 2NQ8A 4IM7A 4DVJA 4Q3CA 3W4JA 4M49A 1D8AA 1VJ1A 4LSWA 3UH1A 5BSEA 3RC9A 4IJUA 1GCOA 2X5JO 4ND3A 4NZ9A 1ZK3A 3F9IA 4O59O 2AEMA 4WCFA 4QFDA 1Z74A 1KOLA 1IZ9A 1MA0A 4MINA 4DQXA 1K89A 1DAPA 1ISFA 1WDLA 1SZJG 2PKQO 3JQBC 3BHJA 4IDAA 1YGYA 3DAPA 4J16A 1F17A 1KYQA 4JN6B 4IQ8A 1T2DA 2BGLA 3OECA 2HKIA 2O3JA 3QY9A 3GNTA 3DTYA 3AWDA 5U9CA 4XJTA 4XYGA 4TZTA 1SC6A 4NNJA 4P4NA 2R6JA 5JW6A 1FDVA 4EJMA 3M1LA 4BVAA 3DXFA 2UAGA 2D0IA 5HRUA 1V0JA 3GGPA 5LCXA 3L6DA 4PLWA 4D46A 3HADA 1BSVA 1N9GB 3E48A 1Q2XA 3IOYA 1NHGA 1NR1A 4PG5A 5DCYA 4YPOA 4CUZA 4DMMA 2OFPA 4PVCA 3ITKA 3GEDA 3H2SA 1CYDA 3WB9A 3DC2A 1P3DA 3KEOA 3SLGA 3PHLA 3ZWYA 4E2WA 4CLEA 1EUDA 3ZV5A 5JC1A 4OOFA 1WNTA 4MIEA 1NFRA 2Z5LA 1ZK2A 5KOIA 3U62A 1DHRA 2P5UA 1QORA 3JD2A 3PZBA 2EGHA 3MWEB 2CUKA 3OETA 3CZRA 3LF2A 4CQLA 4XRGA 4DPLA 1I10A 3PP8A 5T5QA 1E7YA 2EGGA 4GAEA 4C7JA 3L4BA 1NVGA 2UDPA 3ZHZA 4DIOA 4GVXA 1R37A 2D8AA 4KTVE 3WDSA 2GZ3A 4ZICA 1EDOA 1O9BA 1F8FA 1ARZA 2WE8A 2VHXA 3ENKA 5GZ3A 4M55A 4E12A 4NJOA 1MP0A 3OQBA 4K26A 4BKOA 5KJ6A 3HFGA 2JCVA 4R1NA 2I99A 4HWKA 5U1PA 5ER9A 2Z1MA 1YWGO 1YB4A 1NBOA 5I8WA 1UZLA 3HFSA 3EW7A 2Q1UA 4Y98A 5CPBA 1LBEA 1W8DA 3EK2A 3NGLA 3A14A 2DTEA 1HSOA 1PQPA 3BYZA 3PQFA 4M8SA 5JCJD 3U5TA 1D3AA 4UREA 3UCFA 4P38A 4PLZA 3QWBA 4RVUA 4EUHA 3I5MA 1PQUA 3PTZA 1B8VA 5DZSA 1O5IA 4WASA 3WNVA 1GZ4A 1MG0A 5JSFA 2WYUA 1PGNA 2OGUA 4AL4A 3S55A 2QG4A 3JQ9A 5AQ1A 3LQFA 3DZFA 4D42A 4L75A 3NDIA 3WIEA 3C24A 1ZJYA 1B0AA 3G17A 3WBFA 3AY3A 8LDHA 5JY6A 2R00A 1O89A 4YJGB 1EDZA 3BA1A 4WCDA 5DOZA 3AM5A 3IJPA 3BTVA 4BKQA 1U4OA 3RSHA 1FK8A 3MOIA 3GG2A 2BFAA 4INAA 1SCUA 3PIDA 2AA3A 5JYEA 2P2SA 3MJ4A 4U6SA 3DHYA 1HYGA 3JQ6A 2X0NA 3JD3A 3LSYA 5FYDA 3UN1A 4I9UA 1DHTA 1HL3A 2BH9A 1NAHA 4H15A 4XR9A 4BHTA 4RVFA 1U2DA 3H4VA 5COQA 4B7UA 3RUFA 4TQGA 4BO8A 4IJVA 5GMOA 3WGYA 1QRRA 4B3HA 1HEUA 4OO3A 3RC1A 4OL9A 2YY7A 3RAJA 3VZQA 3LLSA 3WJ7A 4M87A 5I7EA 1T2AA 4JJGA 4A10A 1X14A 4YDRA 1LXCA 4ZVVA 1GQYA 1T1SA 3AFMA 3ZHXA 5BNIA 2VYNA 3QA9A 4Q3EA 4QX6A 5TQVA 4DIFA 3FNGA 3GGGA 2DBQA 3GA0A 4XYBA 3C7AA 3ITDA 1DC6A 3VZRA 2I3GA 1UXKA 1Z7BA 3KRTA 3N58A 3C3XA 1ZW1A 1PJ3A 3P2YA 4XYLA 1LSUA 2HRZA 4NK5A 4IGFA 1PS8A 4TWRA 1ENPA 1EE2A 3LT2A 1Q0LA 3TOZA 4GBJA 4NFSA 1HYEA 3SC6A 5JY1A 1E7QA 5I9NA 2OBYA 1LLQA 3VZSA 2E82A 5DNAA 3GC6A 1LDYA 4DQUA 4L9RA 3Q2IA 2O50A 3NX4A 3HQ4O 5MGBA 2VYVD 5A4DA 3FNEA 2NVUB 1C1DB 1QR6A 5A5FA 5IDYA 2ZJ0A 2ZYAA 5JXWA 4J2OA 1EUZA 1XU9A 1MG5A 4JQCA 5G4LA 2V6GA 1E5QA 4JIGA 1XR3A 2NSDA 5HS4A 3NJ8A 3JTMA 3FBTA 2VUTA 4FBGA 2VHZA 3IMFA 3VTZA 1GV1A 3QP9A 4JLWA 4OYRA 4BO6A 3GVIA 4DBZA 4JXKA 3C8MA 4FFRA 2PGJA 3CMMA 3ROQA 4PG7A 1I8TA 4JROA 4M54A 2WD7B 4IIVA 3AI1A 3WSWA 2BI7A 4E5YA 3GPIA 4IS2A 4D44A 3VPGA 3CKYA 4Z0HO 1QYXA 2DBRA 4B3IA 4AJKA 1PJSA 4GWGA 4YWJA 3KVOA 3DO5A 3VDRA 2X5OA 3DB2A 5AOVA 4BO5A 3AK4A 4OQYA 4KWHA 4LVUA 4K9DA 4KP7A 1MXFA 2ZCUA 2NQTA 4FJ2A 3DZGA 4A73A 3QV1A 4O5OA 3DMYA 4UUOA 1NFFA 1VM6A 3RQSA 1EZ4A 4GSKA 1CF2O 1KS9A 4OXYA 2AEFA 1LLDA 1YL7A 4K6CA 1UXIA 5A03A 4BKRA 3RU7A 3AJRA 2TMDA 4UEKA 2IEBA 4JBHA 3NEPX 1GR0A 1PWZA 1B2LA 2X9GA 2X23A 3QWFA 2X6TA 1H2BA 2VRBA 2I67A 5I9MA 3TZHA 2HJSA 3BTOA 4HNHA 3A9WA 5BNFA 3H7AA 5T64A 1C14A 4WPGA 5FFFA 5GY7A 2QX7A 3GEGA 1IY8A 1LDNA 4YQZA 3Q3CA 4BNJA 1O0SA 2C59A 4IJKA 4QT0A 4F46A 3CTMA 2GGSA 4RLHA 5IZCC 1YBAA 4GX5A 1DLIA 1R4MB 4IGEA 1HE3A 5JNLA 4GVLA 1WW8A 1ZBQA 1UXGA 2IODA 4CL8A 5LDGA 3W6UA 2EW8A 1ISMA 1I2CA 1N7GA 2HK8A 3OEWA 3ZNQA 4CMAA 4Z9YA 2WJPA 3ZH2A 2ZB7A 4O6VA 4L76A 1RM3A 1UXJA 2B37A 2WE7A 4QTZA 3DFUA 4Q9NA 3L6EA 4GGOA 2Q3EA 4IMRA 1ZCJA 4B8ZA 3HDYA 4J9UE 3JYLA 1DIAA 5F1PA 3BMNA 3PQEA 3ENNA 3I52A 3M1AA 1GAEO 2BLLA 1EFKA 3QWAA 4GLLA 3WQSB 4B8WA 3NJ4A 2VTEA 3DHNA 2PD6A 1V3VA 1ISGA 4CV0A 2WYVA 4Q3DA 3A4VA 4AVYA 3FPLA 3KUXA 1U3TA 2CD9A 3FNFA 4D3SA 1TEHA 1ZSYA 4Z0PA 1EVZA 4R4JA 3KYCB 1T4DA 2Q4BA 3Q9UA 4CQLB 5DCUA 3FTPA 4UAGA 4ITUA 3GLQA 2RBEA 5CG2A 1XDWA 1DBVO 1VL6A 2PZJA 4MO2A 2EKLA 4IBOA 3IUSA 5EERA 5L53A 3LC7O 5JYDA 4I8XA 1U8FO 5DN9A 1ZK0A 5IXSA 1BXKA 1PR9A 1Y81A 4CLOA 4XQGA 4CM5A 1NASA 3VHRA 5CHEA 2V6MA 1A7KA 5BR7A 3LLVA 4I5GA 2JD1A 2HMWA 2P4QA 2EW2A 3FPCA 4CM8A 4JBGA 1PJTA 9LDBA 3ZW9A 2J3IA 2NVWA 3LT0A 3ZU5A 1WXDA 2Y0EA 1H6CA 3E6AA 3ST7A 4PLGA 4B4UA 4BNWA 1H93A 2X7HA 4XZ3A 4G2NA 1K3TA 1WLYA 3PDJA 3GY0A 2Y1FA 2RH4A 4DUPA 5L95A 4RVSA 1RM0A 1A9YA 1FXSA 1E1LA 2G82A 2Y1DA 2X22A 1ONPA 3KOUA 3OJFA 1ONNA 4K1LA 3UXYA 2DKNA 4BO0A 4CMIB 1X15A 1YKFA 2A4KA 4IZHA 8ADHA 4KUGA 1I3LA 1CDOA 4F3YA 4MP3A 3CH6A 3PFFA 1D1TA 3WGIA 2YHUA 4B7XA 3FI9A 4WCFB 2AW5A 3OICA 1ISJA 4E5KA 1U28A 4WCFC 1QYCA 2PWZA 3TNLA 2J3KA 4YAEA 2YDXA 4YT4A 1TI7A 2CNBA 5AXAA 3RBZA 3ZV6A 4TKMA 1EVIA 2GF2A 1DIRA 5KKAA 2DTDA 4CMEA 4HFRA 1LSSA 2ZJ1A 2C5EA 5KVSA 4YVFA 4YRDA 4CLOB 1I3MA 3JV7A 2NU9A 3TSCA 4XYEA 3EGOA 5JMPA 1UAYA 3DL2A 5L45A 4ALKA 1SBYA 1LI4A 3NT4A 4R41A 1PJQA 3K92A 3VOSA 1PGJA 4XKJA 1NVMB 5TT0A 4CM3A 1PX0A 3FWZA 4IDDA 4CQMA 2DC1A 3BZUA 4CM1A 2YUTA 5HS6A 3WGHA 2D5AA 1KVUA 4OXKA 4G65A 3M6IA 1GQQA 2PZLA 2H1SA 3IQDB 2IZ0A 1QSGA 3DWFA 3PZRA 1LDGA 4RLSA 1ZSNA 4MP8A 5T6BA 3KTDA 5ICSA 1ISIA 1PZHA 3UOGA 1T24A 1LEHA 4ND1A 1ADFA 3GZNA 1U2GA 2QIOA 1NNUA 3B1FA 3DAFA 3X2EA 3N74A 3MJTA 3D3WB 4LISA 4IXWA 4MVJD 3WYBA 4IS3A 1MFPA 4RDIA 4YJFA 3WWZA 4J1NA 2CF5A 3VAZA 1LX6A 3GMDA 3D0OA 2Q1TA 4J1SA 3U4DA 5KJ1A 1JVSA 1IHXA 4YT2A 4WLFA 1ENZA 2DU8A 3ONEA 4H7PA 3ANMA 3FR8A 1NPDA 2B5WA 4B4OA 2OUIA 5CP8A 4UVGA 4PRLA 5H82A 2DM6A 5IN5A 3PGJA 3D64A 4BNIA 1PGPA 2PGDA 1B8UA 3FN4A 4LW8A 1AHHA 5L7TA 1E3LA 3K8ZA 4OOEA 1CIVA 1H94A 4K28A 2Y66A 4Y6PA 1E0DA 3HN7A 1E7SA 1BTOA 4Z6KA 4EUFA 1I30A 4ALLA 3QVWA 5KVQA 3W8EA 1ONOA 3BMQB 4OAQA 4J4HA 4URFA 4NBWA 5C7IO 4E33A 4O0LA 3DEYX 4CMGA 3EC7A 2GN9A 3MCVA 4BOYA 1FMCA 3QWIA 1MV8A 1CERA 4IPTA 2I76A 4ALMA 1GEEA 2ZB4A 3BMCB 4PZCA 1AUPA 4E5NA 3P5SA 2W2LA 3PI7A 4A27A 2B83A 1HLDA 3NDRA 3C85A 1V9LA 1I01A 2JCXA 3AFNA 2Q2QA 5A9TA 1H6BA 2W98A 2GERA 1E77A 1QP8A 2C29D 1A7AA 2PD3A 2AEJA 2VWPA 2JHGA 3I9NA 4A7PA 1HDYA 4RPLA 1XELA 4DQVA 3G0OA 2PY6A 1KVRA 3KYDB 1B7GO 4CM9D 3MJVA 3GFGA 1NM5A 3JYOA 3ZNPA 1A4IA 5HWSA 3OIGA 3W8DA 3I1JA 1KERA 3IUPA 4GKVA 4KQXA 3WQQA 1I2BA 1XLTA 4CL3A 1LQTA 2JAPA 2P68A 2R2GA 4HUJA 2OBNA 1P74A 1ZEMA 2CDBA 4NH4A 3RUHA 1ZKMA 2HMSA 1HETA 1MUUA 2FWMX 2Y67A 3UICA 4HP8A 5CDYA 4WLEA 5IAAA 4P4GA 3C1TA 2O3TA 4YQYA 5EL0A 2X4GA 4Z3DA 3ZW8A 1D1SA 1PGOA 1NWCA 3D4NA 4RORA 7ADHA 4TRJA 2XAAA 1VL0A 1WDMA 2OP1A 2QRJA 4Q3NA 1PL6A 1ZVMA 3WLFA 1C1DA 3GHYA 3UFXA 5C7OO 5HTOA 2HQ1A 4QFCA 4ZD6A 1EEHA 3QQPA 4DC0A 2ZK7A 4MKRA 1HDOA 3PXXA 3CE6A 5A06A 5L7YA 1V3UA 3U4IA 4FJ1A 4NFHA 1Y1PA 1YJ8A 5GZ1A 2ZQZA 3OSUA 5CFZA 3GNSA 4BL5A 1UH5A 1NQOA 4D41A 3LF1A 4YR9A 5B4TA 1Y9AA 2Q49A 1G0NA 1WZIA 3PQDA 5K9ZA 3GF4A 4II2A 4WECA 3OFSA 5JC8A 1U1IA 5ICMA 1E92A 2Y0CA 3TL2A 1WP4A 3ANNA 1ZZEA 3WOHA 1SEVA 3UUWA 2FPGA 3O8QB 4NBTA 1O95A 3U0BA 1HTBA 2NACA 1I24A 4JNKA 1NFQA 3T4EA 3IJRA 1ZK1A 4RVHA 2DQ4A 3JQDA 4YBZA 4BNMA
chains in the Genus database with same CATH superfamily
2XD4A 2H1IA 4O4JF 4YJDA 1OB2A 1TXGA 4L0MA 1W5TA 2UKDA 4XW2A 2XXBA 4R6WA 1HL7A 5AI0A 4HNSA 4OSEA 1IQUA 1RR6A 5DYTA 1XHLA 2CNKA 1GRCA 1KEZA 1ML4A 2ETVA 4ZQEA 3HXKA 1OQAA 3TXAA 1XFDA 2GM4A 3NV9A 1UXOA 4I08A 3QF4A 1C29B 1CDDA 4I5EA 2ERXA 4RF4A 4W82A 3ZI4A 4ZV4A 3E9YA 1G6KA 3IQIX 3K5HA 3O8OA 2XVMA 2ZRPA 3FAKA 4O2BA 4BB6A 4DVGA 1T3TA 2XA1A 4N1AA 2V7PA 4QE3A 1YJAA 3GVHA 1J9ZA 3PFKA 3UF0A 3KSDO 4NG4A 4FR5A 3I9LA 1BXZA 2P6PA 3L8DA 3NIDB 4BDTA 3QFRA 4OQ4A 3HE3A 4D3DA 5JBNA 1WDWB 3E1KA 3ZIDA 4QRIA 2NTVA 5J2UA 3H87A 3K16A 1RLIA 4P0PB 1NMXA 3AL3A 4XB2A 3AKZA 4EG0A 3A6ZA 4X3PA 3KXLA 2JB9A 1YQWA 1ZOPA 1U8TA 2HQOA 2E55A 2RHMA 3DOCA 2VF7A 1VL2A 3JWGA 3NHJA 5FF9A 2REOA 5BN5B 2R5NA 1GKYA 3SYRA 1QUFA 1GU7A 1TW2A 4FGSA 1QVRA 3KE9A 4CLHA 1BVYF 3WRWA 1XLTC 3DM9B 3WXBA 4ROTA 2IUSA 3AVWA 3HU2A 1TE2A 2VAWA 2BEWA 2XW6A 4DLLA 2D1TA 4E0BA 1YFLA 4MR7B 1UWKA 2WAMA 3HPQA 1E6LA 3L1IA 3PQCA 5CCDA 4KN8A 2IHKA 2QTGA 1A9QA 5EP2A 4U2KA 1IVYA 1OHHD 1UP7A 3AETB 4ZT3A 3RTCA 3OLCX 4DZRA 2GN4A 2O07A 1AIPA 5F3RA 2BGTA 5HKLA 2A3NA 4LDAA 3P9IA 5FPKA 1TRHA 2RHCA 1NDUA 4C0SA 3K70D 4B7AA 4AQ7A 1H6DA 1E4EB 2J85A 1CJCA 2XDQA 1O9HA 3ESBA 4JJIA 4PIPA 4WNCA 3F6PA 1NJ6A 4KNWA 4KMRA 4LV8B 4X1YA 2D0OB 5HKBA 3PHHA 4Q9DA 4C3VA 1TTHA 3VDNB 4Y1FA 2DQSA 2VHQA 3PDWA 3SBXA 3TZQA 1H0KA 3JAMA 2E49A 3B82A 3IUEA 3HCCA 4MB6A 3UMVA 5KOJB 2DFPA 4RJLA 4J1TA 3FPBA 3ADKA 2P4HX 3GI1A 3TLCA 1BRMA 1Y1KE 1XDUA 3DL4A 1ZITA 2L69A 3RWBA 2Q0SA 1PSZA 2XRYA 3ORSA 4JY7A 4F56A 4ZO8A 1GTSA 4QTUB 3L0DA 3MUEA 2BFMA 3BEOA 3PSHA 3WADA 1U3DA 5IUJC 5D3ZA 4G1EB 2V03A 4B6GA 1SO8A 3S2ZA 3FPKA 3ZLJA 3MJFA 5GPBA 2W6JA 3ZDQA 2W8BB 3KJNA 2ZTHA 3QH4A 4JI5B 4MHTA 1OXUA 2ZR7A 4W5QA 4BJ5A 3D02A 4ZTZB 4Z3KA 1ZOLA 4S0XA 2KYRA 5HGJA 5HQ3A 1RHUA 2Q2VA 3DMFA 5CM8B 4ZTUB 1DXHA 2H59A 5A6VA 3SE0A 2DHQA 1Q11A 3GJYA 1A8SA 1UP6A 2EF1A 3HNRA 2ZT8A 3V1NA 4EDFA 4HLUA 1GP2A 2W2QA 1J2RA 2QXTA 3PQ3A 2WSYB 2WV9A 4F4IA 5ALHA 1TVEA 2ZE8A 4DPKA 5AYVA 1N9GA 2JBWA 2CVFA 4INJA 4IZIA 1PJBA 1KEKA 4U63A 4CLXA 1VYTA 2MIIA 4NCKA 2ISSD 4RHUA 4UCQA 3D8BA 1IMOA 3P26A 1ZC4A 3DEZA 4NXNB 2H65A 2XY4A 2Y71A 5ES3A 4AZSA 2IX3A 1YIDA 4G5XA 4EG3A 1H2FA 3ZYCA 1M33A 2OESA 1RC0A 4I3GA 3LY8A 1BMFD 2PLRA 5A02A 1WBBA 1FW8A 1DC3A 3TTWA 1JFVA 5L3RA 2ZZNA 4CF5A 3F46A 4NATA 1GFZA 2WYHA 4IR7A 4Q1EA 1KO8A 4COKA 5ITZB 5LOVB 1U98A 3BWCA 4EWLA 4DAOA 1SG0A 2I4TA 3HMQA 3K20A 1DIOB 3M6LA 3TLBA 3HM2A 4EO4A 3AGQA 3D8SA 4F1WA 2P9ZA 1P72A 5J5CA 1RXUA 1OWLA 4QM6A 2Z4TA 4CQMB 1ZJZA 4J4BA 4R7TA 1VJCA 5BWCA 3QW2A 3G8YA 1Z82A 2ZUUA 1RWWA 4HLCA 3CB4A 3FTNA 4FW9A 5B58C 1EK6A 3QUCA 5MFZA 2O0JA 3EFBA 2BZ0A 1R0YA 4WD3A 5BYBA 3KKZA 5IBPA 3UHAA 3L6UA 1GAQA 2I66A 2IBSA 3DWIA 1B2RA 3DLPX 5CTJA 3NVMB 2C4VA 4AKTA 1B0ZA 4W7SA 1DJPA 1W8IA 5EIBD 3ZE9A 1RE1A 1OTYA 4QWMA 4EX7A 4XUGB 4DT1A 4WBSA 4ZGWA 5B2EA 2IEGA 2YIMA 1NHWA 3GT3A 1DSSG 3BDVA 4JQYA 2V7QD 4KN6A 2FJ0A 2E4AA 3WLPA 1UEXC 3OCCA 5KREA 3KZNA 4BFSA 3IV6A 1X19A 1YJBA 4MCIA 2P2ZA 3E1GA 3DXZA 1TKAA 4MVJE 1MOQA 1XZ8A 1Z2NX 2VHTA 3LDHA 4FMCB 4FXPA 4IV5A 5FPPA 3TWOA 3OKFA 3Q8XB 5TY0A 1N5LA 3TSZA 4CPDA 4KMOA 4US1R 4GR5A 2OB2A 3EGWA 3RADC 2XYHA 4AN1A 4L3VA 4EHFA 2WB2A 2CHGA 3WL8A 2NZ8A 3PC8C 4MKZA 3FRHA 1FY2A 3MW8A 4XJSA 3NH9A 3D6HA 1QTIA 5F5NA 4PG4A 2CNDA 4G1MB 1KETA 2C97A 3SHQA 2FRVA 2AHRA 3ZZNA 2DR2A 1QV9A 2BGUA 4Y0NA 2TS1A 3JQ8B 4M0MA 1HMPA 3RVDA 3L92A 3C1AA 4FCCA 1RXVA 1TGVA 5AIAA 3JAWA 3JATA 3PD0A 1ZL0A 4UHCA 3A6JA 3ZXUB 1S2DA 4AZVA 3HDHA 5HNKA 1JTFA 2MDTA 4EHIA 3DDUA 1T8RA 1VJDA 4OJMX 3LUJA 5KNCA 4LIPD 2PSHA 2ZI9A 2CYAA 2IYZA 3DWEX 3FG9A 3HDQA 3SJBA 4RULA 2BD0A 3KETA 1GL3A 3AY6A 4EUNA 3V2UA 3Q3IA 1KO7A 1H2WA 3N53A 1I5RA 3ZE2B 4ZO4A 1QFZA 2ZI3A 1BCSB 1G20B 5J4VA 1BRTA 5TF4A 2BRUC 4BO1A 4EZIA 2I2FA 3LWBA 3K1JA 3ZBTA 1S8AA 3OEYA 4IIDA 3U13A 2DCMA 3FGOA 3GGJA 5LZ8A 2PZAA 3FYUB 3KVVA 3TLMA 3KSUA 4PQRA 5TJ9A 4CKEA 3U44A 5DF1A 1C1XB 2WHRA 4GM1A 2PUFA 4NCHA 2X5XA 3SQDA 1QU2A 3UGJA 1I0IA 3AHEA 3EIQA 1X9GA 3OF2A 2XCSB 4IDCA 1RJ9B 2CFTA 3QK7A 3V3KA 2BGGA 3OEHA 3T7RA 1OBVA 4BNUA 4BCBA 2ONZA 3KQYA 2WUVA 1A4XA 4N0PA 1IBMB 1NMYA 3WB0A 4YP5A 5JG7A 3TQFA 4AWAA 3A0UA 1E32A 3KHKA 4R8MA 4CIDA 6ABPA 3OP4A 4J6EA 2AZDA 2PUBA 3KP1A 3GB9A 4CKCB 2OHFA 2GXSA 3K09A 1GG9A 3O92A 4RL6A 4GP7A 1P61B 1P45A 1MKYA 3BWBA 3QVXA 1HNZB 2CHEA 2NUTB 1PFVA 1GZ6A 1I33A 4HDAA 1NYTA 1Z0AA 2KWIA 2FK8A 2OV1A 2ZYWX 2ZYIA 1VMDA 3WLRA 1VCMA 3JQEA 2PUEA 4GBED 3DLCA 3GA5A 3EISA 5K99A 3C8HA 3CZAA 4TTRA 4NMLA 4DPMA 4AY6A 2JLBA 4UBIA 1L5VA 3AP1A 3A6PC 3JAKA 4QUDA 4ALIA 3OLXA 1Y6QA 1LD3A 4GE3A 5J5VA 2JEOA 5C34B 2UYQA 2BKXA 1ZX1A 2YVAA 4QREA 2DH5A 3AOEA 3K6KA 1J21A 1WA5A 3DHEA 3EZ7A 3V4OA 2N1BA 4U6NA 1ADJA 1AK1A 2VQ6A 1AVTA 4HOYA 1EFTA 3GRZA 1POWA 2I6UA 3C6XA 1IUOA 2O8BB 4Z4CA 3TTSA 4I8DA 1K92A 1R7RA 2C3MA 3PR1A 2JATA 4GSLA 3CUYA 3FBGA 2QJOA 3QEOA 3RIEA 2X3FA 3HVRA 2JLUA 1CS0A 3ZWDA 3F71A 1TMKA 2Q3LA 3D4BA 4D8XA 4DLWA 5B7PA 3P32A 4NZYA 4OIMA 2ZI5A 4MA0A 4X64B 3NBQA 3OJEA 4NYMQ 4OXRA 2PA3A 5JS2A 3CLTD 1VKNA 2GD6A 3BA6A 1HLPA 4LF9B 4NHEA 4FUTA 4LNUA 1FF9A 4OSOA 5JAIA 2XCUA 4D9FA 3CVWA 2BBTA 4GWLA 3IP1A 1KO5A 4YXFA 1ZGGA 3EG9B 3I04A 4ZQGA 4R16A 5BRNA 5GZ6A 2RGXA 3P4XA 4NG5A 1UC9A 5BR8B 1TO6A 3KALA 2Q4RA 3VPCA 2JZOA 2W2MA 1CYEA 5JMTA 2QYHA 4FQ5A 1BGWA 3HDGA 1SPBS 3BK2A 1WMEA 4L51A 1HFEL 2R2AA 1V5WA 4RPIA 3HTXA 1ABBA 2HRBA 4C01A 2NU8B 1O95C 3EQ2A 3ABOB 1VG1A 1RYHA 1T2EA 1KYIA 3D6UA 5GJCA 4L4ZA 3KQPA 2X9QA 4LCJA 4CQJA 5EOVA 3O8CA 1DU4A 3P45A 3ERCA 2ZVDA 2YJGA 3FCEA 1HUQA 1X13A 2LR0A 3HCNA 3KJFA 4V0SA 5D01A 4DMHA 4ERXA 1ZN8A 2H6EA 3IUJA 1TQ2A 4ZZ2A 1XVLA 2RHJA 3EY4A 3GAAA 2AZMA 4JBNA 5EA2A 1N77A 2QTHA 2LDXA 5A3SA 1A95A 1LWOA 5JD6A 3A27A 4JWKA 4QUEA 1HE5A 4I8IA 1F1BA 4UVHA 3U4CA 4PXSA 2WQ7A 5EHGA 3SJ7A 2CEKA 3FSEA 1KEVA 2B78A 2C8VA 2O20A 1ZK4A 3JY6A 1PSWA 3NGMA 5KWEA 1NY5A 1F4PA 1CDEA 2BIFA 1RCTE 2ZXFA 5KTRA 3AF1A 2F00A 2ZE6A 5EMMA 2HCRA 2KS6A 4DILA 4L4RA 1HG1A 2CFCA 1Z4JA 2GRJA 7AT1A 2P9FA 3CVYA 4GEGA 4C7OB 2WPDA 2ZIGA 5IKEA 3RAFC 4N8DA 3F78A 5KVAA 5E8JA 4C9BA 4UFPA 1CW2B 1RRPA 3NWOA 4RIIA 2I55A 5DV9A 4LHSA 4DWVA 4JI7B 3BIWA 4DDKA 1T5TA 4YA6A 3IT2A 1JDBC 3TPCA 5KS2A 3IP3A 1V8BA 4EB6A 1D8TA 3V4SA 2ES4A 3B78A 2JCYA 3TPFA 3UCEA 4R5MA 4MICA 2WVJA 1SFRA 3DDSA 4A8TA 2R4QA 1P4GA 1E1NA 5A7GA 4EYSA 1QGUA 5CBPA 4Y18A 1CJBA 3NRCA 3LQ4A 4M99A 5EZQA 2Z1NA 2FMIA 3K5PA 1JWBB 1V2GA 5JU6A 4G0MA 4GEKA 1FP4B 3A1NA 5BSHA 2GZ1A 5J47A 1TYAE 3CUUA 1RWQA 1QH8B 4IWNA 3R20A 5EJ4A 2DP4E 5A9RA 5BSRA 2QU8A 2VDJA 5DXFA 1X7GA 4I66A 2OM6A 1NBAA 5E9QA 5M29A 2HYIC 5K7SA 2C2WA 2PNFA 3RS3A 3ZIAD 1G8SA 1LWNA 4W1SA 4UM8B 3IPAA 3L8MA 4BMZA 2JGDB 1NW7A 3IE2A 5TJHA 2ZRKA 1ZHOA 1XLUA 3D81A 1KFEB 1NIJA 2HQRA 3E27A 1GHTA 4ALNA 3SYLA 3PEYA 1AN9A 1M34A 3LK6A 4IIUA 3AUSA 1DO0A 4LJ4A 1TVKA 1TYDE 1CRWG 1UM9A 1X7YB 1UKYA 3VU3A 4N0QA 1ZM4A 1GSIA 1JJFA 4YXWD 4M1TA 4PFSA 2NVBA 5KNDH 2JNWA 2XTJA 2V7XA 4F3YA 4GX0A 3G49A 3OU6A 4HYEA 2MU1A 1A7JA 1D0VA 3ZC3A 3K09C 2JBHA 4YRCA 4BMSA 2G28A 3KB1A 1I2ZA 1K8XB 3S44A 3F0TA 5FOXA 4TWBA 4QKQA 1WLSA 4L0DA 4PEVA 4UFNA 1Q84A 4B17A 4YCSA 4LYAA 3C5VA 3ADPA 3ZD6A 4HH3C 4KVGA 2GRUA 1JTVA 3ID6C 3P9NA 2ST1A 4WZ6A 5C2JB 3Q3HA 1AQYA 4GNKA 4GR4A 1QGED 4G0PA 4DYDA 4MMYB 1GQSA 1T9DA 4Q1BA 3I5UA 1PJRA 1RWNA 3RRBA 1E79D 2ZPAA 3GOQA 3KZVA 3OMLA 4B3DA 4CG1A 5J4YA 2HJHA 3V1TC 4G01B 3SOPA 5FADA 4D96A 2GM9A 4YI3A 4RK6A 2GHQA 5AM0A 5I9LA 1SIOA 3TX6A 3OTWA 1Z15A 4NQZA 2P27A 4AYTA 5IFLA 2X19A 4TUYA 4ND5A 5FFMA 1BMDA 3LKBA 3ZG6A 3WGTA 4LDQA 3M0EA 2SNIE 1U6JA 4O29A 1J0DA 1T3HA 3QPAA 2NXEA 1GNLA 2P6RA 3PCTA 4N40A 4IDEA 1SWVA 4WZAE 9LDBA 2GLXA 4JLOA 1ZMXA 3QVVA 4PYQA 1I1QB 3BPSA 2XE8A 4W5TA 2A3RA 5B37A 2EERA 4R2LA 3II6X 4RF5A 5KEIA 4C76A 4TM7A 2G1KA 2WKQA 1X9HA 5A04A 1TFRA 1LC3A 2E6UX 3GLGE 2Y1LA 1M1YB 2PBLA 2WC1A 1E3SA 2XH8A 3CXUA 3DVQX 3OPYA 3CURA 5K2MA 4CZ2A 2JLXA 2IYXA 2WTEA 3TX2A 3QNMA 5CFLA 1BS2A 2UZ4A 3OJOA 1C81A 2WMYA 4JFRA 2PEZA 4NAVA 4WK4B 1FE8A 4RC9A 2XR1A 3DE4X 3W2TA 1D09A 1RAIA 3BTUA 3DFMA 4JXJA 3AEYA 2AZTA 4UDYX 4F2PA 3LUKA 3QU4A 5IW8A 1HC7A 4W8GA 2QZJA 3A6DA 4OFWA 3SOZA 2H2HA 3NHRA 4CUJA 2AXQA 1BHJA 4OGWA 4LYGA 1EFAA 2PKEA 1GY8A 2P6UA 3G9ZA 3LBFA 2FG7C 3LU1A 4ZV9A 2VPYA 2H0AA 4P4LA 3KO8A 3D0KA 1PG5A 1W5EA 4MI3A 3UB3A 3UGKA 1P7CA 2M32A 4NYIQ 5EQDA 4DCTA 2UUCB 3EN0A 3KZKA 4D8WA 2Y2VA 4UBOA 1L1EA 2G8LA 3CUEF 2V4MA 3LQRA 5IBCA 1HDCA 1ZCZA 2R8EA 5JAPA 1M10A 2K2QB 3BXZA 3FMFA 3N05A 3OX4A 4IOLA 1ZN7A 1TF7A 5KQRA 1FYVA 4OM7A 2YW9A 2Q3BA 3I8SA 3NIWA 4B48A 3CW2A 1N7JA 4CQNA 1URPA 4ZQHA 4C7BA 2BEUA 2QUZA 4RENA 3DH0A 3VC2A 2GR9A 4CMKA 2C5LA 1HQCA 1NVDA 1TZCA 4WSOA 3TG8A 1YI1A 1IXKA 3NAZA 3IVAA 3HXMA 2WB4A 2XTNA 3DZIA 4D45A 3JD0A 1LKZA 1VE9A 4BQNA 2PKXA 2I87A 2OK8A 4L5CA 2AOVA 4MS1A 1HWYA 4RZUA 4DG5A 1GPAA 1JS1X 5KDDA 2E5FA 1WL8A 5JWHA 3T3DA 4G9BA 3B20A 1IEWA 2BBSA 4TYYA 4X7MA 2FUEA 2IYUA 3JQRA 4FDLA 3DVRX 1ULUA 2LTAA 4K87A 5B3LA 1JE1A 3AVXA 4X71A 5A05A 3WX0A 1QAOA 3SC4A 1G8FA 2C2YA 2X1LA 4JBIA 1M66A 3EVZA 5FUYA 4RTSA 1TQDA 4K3VA 4DS3A 3BAZA 1QPZA 4KDFA 5KKNB 2CHQA 1L1FA 5BURA 2XSZD 4KH1A 4OF4A 3LQYA 4Y8VA 3N8IA 4X60A 2F43A 1S4QA 2F1JA 4BO4A 1VC2A 2QIPA 4LZWA 3VJRA 1PR5A 1TO2E 3WYCA 1U4SA 4TUYB 1KIAA 1MJ5A 2W22A 5C18A 1JJVA 4FKZA 1L6IA 3LUFA 2VQEB 1P7VA 2NGRA 5EINA 2IEAA 5C1OA 4FT2A 5MN4A 5LQRA 1EVYA 5JPDA 3COSA 3MBKA 4E5MA 4INZA 3FBWA 4G4SO 5A62A 1Z28A 2XGMA 1ORIA 1C7RA 3OE5A 3GMIA 2H18A 2LW7A 4CW7A 4GPEA 1TM3E 2ZVPX 1GQFA 3MUNA 2EFGA 4YRGA 1GNSA 4MUBA 5BWNA 4QBTA 1RQ7A 5H5JA 1OLSA 3C3DA 1DKUA 4QAJA 4YHBA 1ESCA 4YRQA 4ARAA 4YCNA 1U2RA 3OLVA 1ZISA 1DTWB 2QTCA 5DHFA 1A71A 2EQ5A 4J1TC 1W0JA 4CU2A 4HB0A 5ITWA 4B74A 5DBIA 1T5SA 4DJDC 4IFIA 3HKEA 4H7EA 4HDMA 1OTHA 3P9SA 2HY7A 2KQUA 2X1VA 3IHLA 3TJZA 1OZ0A 2HCFA 5JRZA 2AFVA 4RKWA 5AQEA 3CZCA 4ZQFA 4J7CA 4CG0A 3BWYA 1BAPA 3WGUA 1SR8A 4MAMA 1OV6A 4ESVA 4OLHA 1UM9B 3DDZX 2IOQA 4X65B 2JAHA 1BE1A 2IS1A 3VI3B 1KKLA 1M34B 2IDKA 3B2EA 3BGWA 3I5AA 1HNNA 3JQFA 1TC2A 4LK3A 3B3GA 3FSJX 4LHEA 3BGDA 3WNZA 2NWQA 5BR1A 3FDZB 3D3EA 4IEFB 1D6MA 4W5RA 1QG4A 1IG3A 1L1QA 2BJWA 3T15A 3UJDA 4PCVA 3I1IA 1LBIA 4HMPA 2PXAA 3MCZA 4RMHA 3E5MA 5EEGA 2UVDA 2YZ2A 1MRNA 4HDNB 1YCHA 5AM4A 1QH8A 4MVJI 2YQZA 1G8HA 4R1UA 5BO5A 4Q4HB 3S1AA 4EZEA 1Q7RA 4R9RA 3RUEA 2LCQA 2WWXA 3UK1A 4BB5A 5IAEA 2OORC 1LCIA 4ASUA 4EB8A 1I3NA 4PIMA 5D2CA 1CR4A 3FZQA 2JGKA 2EIHA 2PH3A 2YYAA 3HFJA 1DZIA 2GMWA 4P8RA 2I1WA 1OGJA 3H9QA 4KZPA 3M6XA 5FIUA 1CQIB 4E1BA 4IP0A 1S2MA 3BXXA 4D0GA 6ADHA 2E4WA 4TMZA 3ZJYA 4X7PA 4J6FA 4B6PA 2CJWB 4C05A 4K03A 1VHDA 3BGVA 2IU0A 1H2RS 1CJMA 1U1CA 2B4RO 3IIJA 4BQOA 3TQOA 2R6CA 5ADUS 4MDFA 1SKUA 7GPBA 1P1JA 4ID9A 2VUUA 1EAMA 4TSFD 1F2DA 4KE8A 3GGCA 4QPPA 4Z1MD 4XUDA 4Z7JA 3M3HA 2QM0A 3VPSA 5JMOA 3DKVA 3Q7QA 1QVWA 4QBIA 2C9DA 2V55B 4A16A 4LXQA 3D43A 2RHTA 1G7RA 1R6UA 3HGQA 4FD2A 4QG7A 5EN4A 1A8HA 1I2AA 2W6MA 3EHDA 4ZVOA 2EFHB 1FP6A 2NZVG 2P2LA 3O84A 4DOMA 4EFMA 1UBHS 3RK0A 3BJIC 4F71A 1Z45A 4GZLA 4S3MA 3TF5A 4DUZB 2HZBA 3QU5A 4G89A 5SZJA 5TT1A 2RAPA 3I0NA 4XWYA 1M67A 4J1QA 4MQ6A 3FIJA 3NIBA 1XL1A 2WG1A 4XFKA 3RFCA 1AMUA 5FV7A 2I65A 3IESA 2CC2A 4FIDA 2AX4A 3H0EA 2WUDA 2IXDA 3P1JA 3EXEA 4BQRA 4LWZA 5K01A 3IT3A 2MSWA 1GPWB 4RFLA 1A3CA 2WJ4A 1JPUA 4W9MC 2HJWA 5CLIA 2FEKA 5FTJA 3QBEA 5HBGA 1V47A 1HZZA 2HXSA 2FPIA 4BVFA 4WXEA 3R7FA 2YYYA 2O14A 3HLYA 1UBFA 3I2HA 5IDXA 4ZEWA 1E2PA 3UO8B 4L7VA 2F9MA 2NTJA 1AQJA 3ZD8A 2V6FA 3OMWA 1NBWB 1C2YA 2AC7A 5DHUA 1VGVA 1KI6B 5JAUA 2YJ3A 5KTNA 3TRDA 2PZEA 3BCRA 3EG9A 4J0CA 4CEIA 4KR9A 3NTVA 3O2SB 2P77A 3FY4A 2AOUB 1SXIA 4LSZA 3ZEIA 3WFZA 3ASZA 3ZWOA 3NM5A 3L1UA 4Q6BA 2IUUA 4ZMSA 5LQUA 4LNUB 4YMSA 3OEED 2ZYVX 1F5NA 1BC5A 1E3WB 3DBRA 4HRYA 4Y1GA 3RJTA 2OG2A 2N9UA 3EBOA 3VZCA 3BB1A 1UPAA 3C39A 1C7IA 1E62A 1T5DX 1JKMA 4WWHA 5JH7B 3G5AA 4OXXA 1DFIA 2CLDX 1JG2A 1PR3A 1DELA 2OHXA 3L7BA 3QFCA 2CBGA 3ZWXA 3UJ3X 3W4IA 1H8EA 1F2TB 3QVOA 4JI3B 4KMSA 3OTQA 1KZHA 4EJSB 3CRNA 3FH0A 3X2FA 4PFJA 1SBQA 4AWXA 3ZHCA 3O4VA 3IELA 1OJLA 3U37A 1Q2UA 3T7SA 3UJ9A 4OQQA 4OM8A 2X9LA 4UXJA 1GRNA 4BASA 3WIUA 5IJ0A 2PLFA 3OSZA 2GEBA 4FWIB 4IVNA 1Z7EA 3I9JA 1ZINA 3M9LA 3T0FA 3OTOB 4CKWA 1OPXA 2B69A 3TFQA 2X40A 3MJEA 2JH8A 3LKVA 3N76A 1A9OA 1KJ8A 1TIKA 1JI0A 3V1MA 4K9PA 4P3YA 3TFOA 3W3AH 2IZ1A 4C4YA 4PNEA 1ZJWA 5DYGA 2J87A 2X0JA 3H2BA 2ZR9A 4UOZA 4YO7A 4RMJA 3ZE1B 2J3JA 3BIFA 3F7TA 4AX8A 3RTEA 1D4AA 2PRYA 3P0JA 4YPFA 7REQA 3LQKA 2GN8A 2YXEA 3G59A 3HCBA 3LBAA 4KXQA 3EARA 1KAQA 4LZNA 3O4RA 4TQUS 4H1TA 1GTL1 5ECYA 2JEZA 4B3JA 3CX4A 2CSXA 4GE0A 1QF9A 5TV2A 1ZXBA 5JJCA 1DJOA 3OPYI 3GPLA 5C8XA 1WXHA 1KEWA 1D07A 3PFNA 1SKYB 2W58A 1N8KA 1HQKA 4MVJP 3N2GB 2AN1A 1JHRA 1WPRA 1RI3A 2OV3A 2P9YA 4QUGA 1N32B 3UAOA 2JFHA 1O6ZA 3EHEA 2JI9A 5CVVA 4AUMA 2WIDA 2GA8A 1GUZA 3A11A 3DHWC 1V5IA 1BJKA 1K98A 3F8SA 5DGHA 4JV5B 3FYUA 4EY4A 4MMXB 3U44B 1B6GA 3CLVA 2R7KA 4KXLA 5CDGA 3RTAA 4BNZA 4LG1A 1E2JA 1T34A 3JRNA 4M1ZA 2CFIA 5KNDD 3B60A 3ECSA 4M89A 3NTLA 3RS4A 3GP5A 2WUWE 5ILOA 3ON5A 4HBZA 4BNNA 3QE9Y 3G0HA 3NBFA 4V2UA 3A25A 2G0TA 4QECA 5EHQA 1NBMD 1VCIA 5G0TA 16PKA 3T3IA 3UHOA 1RTKA 2DLCX 2OORA 2NPFA 4DR5B 3GVPA 3BFKA 3FJ1A 3K30A 4JK3A 4F4DA 3HP1A 4FBMA 4EL0A 2XI4A 2R7LA 1KIFA 2X5NA 5CH8A 3STWA 2XOKD 2C1XA 1G21A 3STUA 3H9UA 2JI7A 1X1AA 1XE3A 4FEYA 2OBBA 1G9SA 3NO4A 2IYTA 5F21A 1ODCA 1T1IA 2UYCA 1Y5RA 3KNZA 3EJWA 4UARA 5K4AA 3VH2A 4EENA 1E9BA 2ZBDA 5DW3A 4I1OA 5ALXA 2AG5A 4HAZA 4RIEA 1ENOA 4Q01A 2GSDA 1F9EA 2VATA 1XDZA 1UBJS 4KXNA 1A8UA 2Z5VA 1JAXA 4O4HB 4QPZA 1YVUA 3MT7A 2ZANA 3E15A 2GYVA 3PUJA 3SHWA 1SOVA 3P2IA 3VQTA 2PRJA 1IBSA 2I8CA 4GYYA 2QD5A 3NTRA 2AXNA 1U6IA 2BOVA 5JNRA 1JWAB 5FDFA 3GZ4A 2R1VB 4AK9A 1ULSA 1VMEA 2ZITA 1VMAA 3LBHA 4MNTA 1JR4A 1KVQA 1SOAA 5CFNA 2EFDB 4NESA 1RC1A 2NUPA 3RU9A 2XNHA 2XMBA 2I03A 3DZDA 2G04A 3T7CA 4BLRA 3UNXA 2YIDA 3LUPA 1BGVA 4P35A 1W2WB 3AR9A 4UAUA 1U9CA 3BHNA 4QQRA 2RK3A 2J6CA 4DT1B 3CUSA 2RGCA 4I9NA 3W2HA 3U56A 4KYVA 4PGHA 3OZVA 4QTTB 4AF6A 1TA9A 1W49A 1DTSA 4MROA 5IT9A 1R9JA 1OA0A 1EMDA 1E3IA 4TYNA 1YL5A 2A1UB 3I0MA 1G7CA 3REOA 1R8JA 4J0GA 3P8ZA 5FWXA 3I9V6 3GJ4A 4NFYA 3SBDA 3R9XA 3IX7A 1DRUA 1DPFA 1GCIA 2ZBVA 4J29A 2HR1A 4B7CA 4P5PA 1J99A 3LNCA 1S9DA 2ORVA 2WNHA 1ZONA 4MRAA 4ZCTA 4G5YA 3VHQA 1P1CA 3GH3A 1LW7A 2P35A 1SUWA 2Q21A 4JUBA 3ZWCA 2D7CA 2XA2A 4TXNA 4AY3A 3PJFA 3LHIA 3PEFA 4QZVA 4EK9A 3PWTA 1ZWLA 4X97A 2QJRA 4OIFA 5F2OA 4FN5A 5AI6A 1S7CA 2I2XB 3GFBA 3NHBA 4O4LB 3T1QA 4LJSA 4EB0A 4ENRA 3U80A 4LNAA 5EYPB 3U9LA 6CHYA 1RTTA 3JXEA 1AHIA 4D3XA 4A9AA 1RLOA 3AH8A 3MMNA 2FSVA 4ZI7F 1VI6A 3UKJA 5ALSA 3UG6A 3RIYA 4DG8A 1IOLA 1Z16A 5G1OA 2PKRA 3UXHA 2I54A 3RODA 1YE5A 1Y48E 5BR4A 4DSUA 4CM7A 1T2CA 3IDSA 1NJGA 1NQTA 4BO3A 1ISPA 3N7UA 2QP9X 2P9BA 1JYFA 1E2EA 2HX1A 2ZWAA 3FI0A 4LUCA 4X1OA 1XNQB 4NBNA 2YMQA 2VN8A 3CNHA 2CJFA 3L18A 3EMBA 3I4CA 3PQ5A 4RS3A 2ZUBA 4ZCLA 3RFVA 3GX1A 3W8FA 3LT1A 2HWXA 1S6YA 5JJIA 4DA8A 4KRYA 4AB1A 1BHSA 2X2FA 1P33A 1JLSA 1WZCA 1G5HA 3C6KA 4KWCA 3X1MA 4TV8F 3SQLA 4ARZB 3U3XA 3DMHA 3CCBA 3E82A 4UUMA 4YRFA 1R0KA 3ELUA 3H8WA 4MOWA 4RANA 5HQ3B 4NDZA 1TAUA 2ACEA 4FT4A 1G42A 4UM5A 4L72A 4CIXA 3QI2A 4DSTA 3C0KA 1XKXA 1OXSC 1BEZA 4D4GA 4PG8A 2QL9A 3S99A 4ISBA 2EFJA 2EFCB 2AC4A 2W8BA 2I2AA 2CVZA 3M2TA 4ARBA 4JEUA 5JRDS 3OQ1A 2F8LA 1TCBA 3QKIA 5CYFA 3H17A 3IBSA 3U1TA 4UOEA 2JJ8A 1Q83A 5HMLA 2EXXA 1MD9A 1GTVA 4HNGA 4Q37A 5LMNB 1W94A 3B1VA 4KVFA 4BX3A 1EHYA 5J1TB 2XGOA 5ALTA 1F0NA 1UBLS 1FVXA 1YFJA 4QDTA 3DZCA 3GRKA 1XA4A 3B9RA 4D9EA 2H7XA 5JUWA 2RGAA 1OX4A 1W6UA 1JU4A 1TT5A 3S7TA 3RFXA 2REQB 4LJ8A 1JPVA 3SZRA 1VRWA 5ITVA 4JSTA 1GT6A 1FVHA 1MV5A 4GQIA 1E4EA 1GUBA 4BLSA 1JKJA 2PX0A 4ZALA 2FR8C 4YGYA 1NT2A 3H5RA 5FP0A 1G41A 1T8SA 3KBOA 1SA0A 1Q22A 4PPNA 3D9QX 4E7OA 3IR5A 3AB3A 3HN6A 2XPCA 2UZIR 3LX8A 5TX7A 4CTNA 1JT9A 3HSSA 2XRMA 2OZPA 3SJCA 2UYOA 3RUAA 1U7DA 1RSZA 2PJRA 2OC4A 2YN4A 2JFWA 3PEVA 2EJBA 2DJIA 1JR3D 3E9DA 3SZGA 3VV2A 1K9SA 4U39A 2J7KA 4PSKA 3TSCA 1E2GA 3NUGA 1E3QA 2DFNA 3WZMA 4RTKA 4MR7A 1MOSA 2YHIA 3GWZA 3TKLA 3WAKA 4X6YA 2YBEA 3I9OA 5CT4A 4UVIA 3UMYA 2QMZA 1DRVA 2CHUA 2H1HA 2NTYC 4KOAA 3QJYA 4PCAA 3EPJA 4RHFA 4KFCA 3D8TA 4XWAA 4ZQIA 4HVLA 2ZDHA 4E1AA 3TQTA 3DHVA 2Y9MB 2B36A 2B7BA 1X1RA 1S2GA 2W2XA 3CNLA 4JA0A 3N28A 4HDKA 4PR0A 1DEHA 4AF7A 3UAGA 2OBMA 1AS3A 2CL5A 2JL1A 1W4AA 2D00A 3KBBA 4OKNA 2Q99A 5TS3A 5IK2A 3KR0A 3I23A 1MBZA 1SQGA 2LXNA 3FNRA 2JA2A 2CMGA 4RD4A 5B7GA 5A2QA 2JJQA 3THOA 3VC3A 3H19A 1EIZA 3AVYA 1L7BA 1ZGHA 2HXYA 3F67A 4JT9A 5M3BA 2FWAA 5G3YA 3ROKA 1DIHA 3GLHE 3P2JA 4NYIR 4Q7LA 1WUYA 3O8OB 1J0AA 4EGSA 3DYBA 1FVOA 2AFHA 2DCUA 2X0FA 3HCFA 1LLCA 4XPIA 3FCYA 4QUBA 1IUNA 1EDEA 2WAAA 3R44A 4EZBA 4JUFA 2PZ8A 1Z6AA 3KLPX 3AXSA 2I3ZA 2CHFA 3HGMA 5AVSA 2MYNA 4Z0TA 2ZU0C 2NOAA 521PA 4R2XA 3MRXA 1DUSA 4BNTA 2YVQA 1QQ5A 3WA7A 4S2EA 1HY3A 4QGGA 2NXWA 3C5EA 4YUYA 3N2NA 3NFRA 3N86A 3F5SA 4PZAA 1JNYA 2QAGA 4FMDF 2FUCA 3P9PA 3A7DA 1MTZA 1ZI6A 2Q46A 3R24A 3BMOA 3K8QA 3WRYA 3ZI0A 4PHCA 4C87A 1U31A 1GPBA 1RKBA 1NKVA 2FPGB 2WFLB 1ZD5A 3PEEA 2ZYUX 3VZPA 4TL6A 3K6SB 4J49A 3DAYA 3E3LA 5FBRB 821PA 1KEUA 3ORYA 4OGLA 1DWPA 1I2DA 1WXIA 2G0AA 2JKZA 3QX8A 3ZDXB 2C1EA 4U2GA 4IIBA 4HNAA 2FZCA 2CNLA 1RMTA 3OT1A 1T6NA 4MS4B 4PVDA 4NMHA 3MAJA 5DBOA 1XVUA 5AJVB 2DMRA 2J8ZA 2HO4A 4RY0A 4RZHA 4UUPA 4BUZA 3TL3A 5HJ2A 1ZRSA 1DO8A 1DRKA 5BPFA 4KKXB 2OXFA 2WOOA 4EG8A 4MQFA 4RJ2A 3EASA 3VYTB 2ODNA 1HT3A 4DLYA 4U9UA 4BVJA 2D4AA 4JL8A 1KSJA 4N5HX 1TU4A 1YE8A 5CU7A 2ETXA 1FS6A 5FPTA 4QLBA 3DEIA 5BNWA 4FXOA 3QFHA 1F3OA 1XMOB 3UMRA 4E2YA 4QARA 1RQGA 2RK6A 4Z99A 2VHYA 2M98A 3CLHA 2XECA 5DE3A 3T1VA 4LMRA 3EIUA 1THZA 1EWYA 1S2NA 3K2EA 2NXCA 1BJRE 1JH8A 2XUZA 3K73O 3IPLA 4H59A 5E9WA 5HG0A 2C5AA 1MX1A 3PX3A 4URHA 4AUKA 1G59A 3P9XA 2PSSA 1QQTA 5ENVA 3SEAA 5LU8A 4QUJA 3RYTC 4BWFB 4BP8A 5JXIA 3ER9A 3LZCA 4CKYA 2X9NA 3K4QA 4Z49A 5CXUA 5JI3E 5BSVA 1JDZA 1YBHA 1YHZA 3LH5A 3GJ5A 3UBTA 3GQVA 1L4LA 3L7DA 4HEJA 4OFXA 1HZZC 2J6HA 1H2HA 5D3QA 4HI0E 1K6EA 2FQXA 4L16A 5ALFA 2FW7A 1QC5B 2W4QA 1MZPA 2P1DA 3W8RA 4NS4A 3NT5A 3VYWA 2CLMB 4HPJB 1OC4A 4JVOA 3ANTA 1E3MA 3OZEA 1LA2A 1RPZA 3RVNA 2HPZA 3KKOA 2W4IA 1N2SA 4NE7A 3WMXA 4FNOA 2YJ6A 3ZTWA 2DAPA 3CX3A 3S1LA 5HZHA 3N6RA 1ESEA 1C8VB 6REQA 1NVXQ 1HEIA 4KPUB 3D6FA 1XTQA 5E9AA 3W4KA 3ETJA 2BELA 5L8VA 2AT1A 3USCS 3EGXB 1HKHA 2O8FB 3WSVA 1RMYA 2RHDA 5JZBA 2WJGA 4IKOA 1HDRA 3IODA 2SKEA 1C0PA 1GPMA 1ZA2A 3JQFC 1OBFO 1IIRA 2ZAGA 4JR0A 3SX2A 1EFVA 3AY7A 1YULA 1VB5A 3FGNA 1OASA 1UPBA 5KWJA 3IRUA 3OZGA 3KPUA 3PPIA 3CSSA 4WESB 1E8NA 3ICWA 5EP3A 4D26A 1WZ2A 4WOBA 4EY8A 4CFYA 1YDEA 4BUCA 1QRUA 1XZDA 3L7YA 1RYEA 5DBFA 4B31A 2ZJZA 4EPTA 4O2AB 4J0KA 2V74B 2POQX 4IIGA 2CMFA 2Z9CA 1A2KC 2ZWIA 1NLYA 2WSLA 4LJAA 1QRSA 1IUPA 5U4XA 5AJUA 5AKZA 3EQ9A 4R71A 1QUEA 1Y3FE 4P3XA 4TTQA 1E64A 3ETLA 2IDMA 2WJJA 3VTAA 4EO9A 4ZI7B 1L5QA 3R5JA 4MVJF 5JS7A 3U09A 9MHTA 4PS1A 1ZRHA 4KGXA 3C7CB 2C88A 1W88B 3FTQA 3H8SA 4Y2XA 1MC5A 4C4XA 1FMFA 3EC2A 3W1WA 1SUFA 3U48A 1V1MB 1JJAA 2A35A 2O6HA 4DB4A 4IHJB 4P7GA 4LKOA 5DI3A 1MDBA 4GVPA 2II6A 1QZTA 2ZRCA 4V03A 1P2VA 3B3FA 2VYVA 4NDAA 3EVDA 3UBMA 4WKPA 3PGVA 2O48X 1P0MA 2P67A 2YZKA 4BMXA 3TE7A 3VO9A 1FSFA 3AVPA 1SZPA 2I4LA 1GUAA 1YVPA 1YA4A 4JI2B 2D5IA 2FN3A 1QFSA 4PX3A 5AR1A 2C4UA 4I4NA 4R1OA 3IEVA 1FDWA 1CRLA 4BMCA 3G2IA 1SHUX 2B61A 2R6GA 4KVAA 3K96A 5IEJA 3AR6A 4ZQCB 3LBIA 3P0IA 4UULA 4H4DA 1WDKA 5A7HA 1HQYE 1IRXA 3FA2A 1X8JA 1C0LA 1ZUNA 3UMGA 1E20A 1IHUA 4ZKDA 2BHTA 2PX6A 3B1WA