3BHJA

Crystal structure of human carbonyl reductase 1 in complex with glutathione
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
275
structure length
275
Chain Sequence
b'SGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonyl reductase [NADPH] 1
publication title Human carbonyl reductase 1 is an s-nitrosoglutathione reductase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 103
structure length 275
sequence length 275
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2007-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bhjA00
1ZK0A 3ASVA 4NBWA 4Z6KA 3WG9A 3ZV6A 1AHIA 3ADPA 3OIGA 2GYYA 4QXMA 4M86A 3SX2A 5CG1A 1M67A 2EF1A 1N7HA 2WJPA 4J2OA 4E5PA 2WE8A 3E9MA 3IQDB 2EKPA 3MTGA 4PVDA 3D3EA 2X0NA 3D3WB 1LSUA 4FQ8A 3DOOA 3ETGA 5B4UA 5L45A 2EXXA 2B5WA 3EMKA 2PY6A 4PLHA 3CIFA 2C5AA 3DHYA 4FSHA 3ZCXA 4BS9A 2P9EA 3KSDO 2VUUA 5T67A 4HFJA 2NNLD 4ZRNA 5JNLA 5T5QA 3R3JA 4OSPA 3AY3A 3UUWA 1DIBA 1ENOA 3IUSA 3CSDA 1M2WA 5T57A 4WLUA 3FI9A 3GG9A 2J8ZA 4CQLA 3UGKA 4YT5A 3O4RA 1JLLA 2VYVA 1HZJA 2P4HX 3SLGA 3ZWMA 2W98A 4CMCA 4FDAA 4FPXA 5JAQA 2JCYA 5A5FA 1IB6A 3TL3A 5TX7A 1B3RA 3RUDA 3H2ZA 2E4AA 3GRPA 1LUAA 3OJFA 4RJTA 1OZAA 4MVJP 4BVAA 4OOEA 1QORA 1RM0A 3WYBA 4ALIA 1HDOA 3IKTA 2AEMA 3WFIA 2FY8A 3DFUA 2Y1FA 3TOZA 3R6DA 1DLJA 1YONA 1G6KA 2NVWA 3ZH2A 3JSAA 4GAEA 1LXCA 2I67A 2UVDA 4RPHA 1KERA 4YTEA 3ABIA 3W6UA 3UW3A 4UVHA 3PI7A 2AMFA 2AEFA 1K0UA 4JJFA 4G65A 1SOVA 1WDLA 4XRGA 3EAGA 3L9WA 4A26A 4CM8B 3WGQA 1DHTA 2O3UA 2BFOA 5HTOA 2ZATA 3RBVA 1ZXLA 4N5MA 4P8RA 2BFAA 4XQ9A 5A5EA 3CH6A 2O3SA 5AYVA 3DC2A 1Z7BA 2IXAA 3L07A 3WGIA 1E3JA 1NQAO 3DBRB 3WBFA 2RHRA 4B3JA 3GK3A 2BFPA 4KTVE 3KTDA 2IXBA 3WGHA 4D42A 4BNWA 4PLYA 3KLPX 1ZK4A 1C1XA 3ZDFA 4F46A 3CPSA 3H9JA 1ULSA 1H6CA 3MZ0A 4W82A 4PLVA 5EINA 5I7FA 2FR0A 3BA1A 1BXGA 3IS3A 3WQRA 1PU2A 4KWHA 2Y67A 2V6BA 2ZB8A 4J2HA 4WCFA 1NNUA 1OAAA 3TNLA 1C1XB 4HADA 1VE9A 3ZI0A 5FI5A 4ID9A 4XWYA 4N7RA 2VWHA 5DCUA 2QHXA 3H3JA 4Q3DA 1ISIA 4UUOA 4W4TA 5JDCC 1DPGA 2HK9A 2QW8A 1NX6A 4YQZA 3PQDA 3CMMA 5BNIA 3H2SA 1ZXBA 3FNHA 1R4MB 4WECA 1LC3A 1N1GA 2GR9A 2ZTUA 2R6JA 2O2SA 3IDSA 2IEDA 3WS7A 3GAFA 3QHAA 2AQHA 4WUVA 1DC5A 2X0IA 3AUSA 3GF4A 5TLSA 1UP4A 2TMDA 4W7IA 2BMAA 2EP5A 3PWKA 4E2YA 3JD2A 1LX6A 4TKLA 5F5NA 5KKAA 3HUDA 4FFRA 2FZWA 2B36A 5KJFA 2ZCUA 2VWGA 2V6MA 2UYYA 1EQUA 1HDCA 1HYEA 1ZVMA 3WTCA 3I9MA 4O6VA 1A7AA 2PGLA 2VCYA 4D0SA 3AOEC 4AJEA 4BQPA 2P68A 3IOYA 4GL4A 4AJOA 1ADCA 2VNSA 3F46A 4A5OA 4DPMA 2Q4BA 1SBYA 2O3RA 3GNTA 4R3NA 4IUYA 1E7RA 3QP9A 2YV2A 4EDFA 4BOYA 1SCUA 1X7DA 4K28A 5ES3A 4F3YA 2YV1A 1DRWA 3G3EA 3PGXA 1DFHA 1ONNA 4GSLA 1YL6A 3SJUA 2H5LA 4OOFA 3VZRA 1HDZA 1OC2A 4PZEA 1UUFA 4YQYA 4IINA 1HLDA 2HJRA 1KS9A 3QWFA 3GZNA 5B1YA 4IQ8A 2WYVA 2CVOA 4LSMA 3OSUA 3TQHA 4DBZA 3FNEA 3SBOA 2OOSA 1Z73A 3DDNA 1ORRA 1NVTA 3A4VA 5IZ4A 1RPNA 2PKRA 4YVFA 3NGXA 5DT9A 4PG8A 3NT5A 3ST7A 4E33A 3F4LA 3GA0A 4TRJA 3WJ7A 4E13A 4DBVO 3OJLA 4BO2A 4R9SA 2FP4A 3AU9A 4P4GA 1H2HA 4WLVA 2PZJA 2ZB7A 2Y1DA 4H15A 3CUKA 5KJEA 1MX3A 1NM5A 4NPCA 4PRLA 4ALMA 3ZWCA 1GU7A 1WVGA 3PZRA 3WGOA 1E6UA 1HSOA 3TZQA 4WCDA 3BMQA 3JQCA 5LC1A 2PA3A 4WKGA 4QECA 3PRJA 5ITWA 5L40A 4KZPA 2HU2A 4LW8A 3FPCA 4M54A 3OBBA 4MJLA 1FMCA 1Q7CA 1T2DA 4MVJH 3WGTA 4E2WA 4ALLA 1LDGA 3GC6A 5G0WA 3DMTA 3TN7A 5JS6A 4J4HA 1LNQA 5J23A 4TSKA 3Q1LA 4ZN6A 3PZBA 4J4TA 3GGGA 4EUHA 1E1LA 3RFVA 1J49A 3D4OA 3BMQB 1K6JA 1R16A 1E0DA 3RKUA 1GYRA 4I5DA 5AXAA 3H65A 2JHGA 1S7CA 2O50A 1V3UA 1SB9A 3BHMA 4O1MA 3H3FA 4IDFA 4NDNE 2O7QA 1W6UA 3LC2O 1RM5A 3WJAA 2IZZA 3PVZA 5HBRA 3KEOA 3WYEA 4R41A 4MP8A 4FW8A 4UEOA 3ZWNA 4BO7A 5A03A 1YDEA 3JQGB 3UCXA 2ZB3A 1U3VA 4XJSA 3F9IA 3QIVA 4OXYA 2W2KB 1D1SA 2X86A 1BVUA 2WEKA 4XA8A 2D3TA 4BGUA 5BNFA 3HDQA 2UUPA 3NYWA 1EBFA 3F1KA 1ZNQO 4U8GA 3VKUA 5I9LA 3TZCA 1N8KA 4UUNA 3PJFA 5JAZA 5KVCA 3S2GA 4YB8A 5FWNA 4GGPA 1U2DA 4WNCA 2H6EA 3AI3A 1GAEO 3CXRA 4XB2A 2PGJA 1UP6A 4PIVA 1A4IA 4EJ0A 1SEPA 3E82A 5JO0A 3A06A 1G1AA 1CQJA 1P0FA 4BMSA 3K73O 2P9CA 4MKRA 2O7SA 4UEJA 4BIIA 1WDKA 5GZ1A 1WNTA 3AOGA 2X8LA 5KWEA 4XYBA 1XG5A 1VI2A 3IIEA 4E21A 3UHAA 1U2GA 1PJQA 4A27A 1LQUA 4EITA 4AJ2A 1JWAB 4ND4A 4XX0A 4IXTA 3WSVA 1K6XA 4RVDA 2D59A 2D5CA 2JFGA 1ZK3A 2WWRA 1E1KA 3ZNQA 4MINA 4ILKA 4DQVA 4EBFA 1ZBQA 2Y99A 2OZPA 1YS4A 3L4BA 5G0SA 4CM3A 4QTZA 5EJ2A 2DTXA 2W4QA 4CQMD 4GMFA 5IG2A 3HN2A 1I3KA 3VPSA 4AG3A 1WLYA 3BMCB 4XGKA 5C7OO 3G1UA 2EIHA 4WE3A 3AK4A 4XDZA 1I8TA 2Z1MA 1T4BA 2FWMX 3EDMA 4OXKA 1K89A 3JYQA 4B4WA 2BELA 3PHJA 3ONDA 2PKQP 4HFNA 2OP1A 3QV1A 3PHHA 1HE3A 1LLUA 4OO3A 4C4OA 1H6DA 4E3ZA 2IE0A 3MWEB 3QJ5A 4G2NA 4PLWA 5A1TA 1PX0A 3H8VA 2YHIB 1PGJA 1UXGA 3DZFA 4ZU3A 1R12A 4R16A 3DZIA 1GV0A 3NV9A 3JQ7B 3EVTA 2UUOA 1QYWA 3Q2IA 4Z0PA 3CEAA 4J1QA 3ZWXA 3HHPA 3MJVA 4TZTA 2JFFA 1ADFA 3WWZA 2B69A 2PD6A 3ANNA 1A4UA 1Z82A 2FR1A 4IMPA 1AXGA 2Y1GA 4I9UA 4NR0A 2AXQA 1NFQA 4BKRA 4XYGA 3L6OO 4BV9A 1O0SA 4MPDA 4BO5A 4E32A 4YJFA 4J7XA 3TZHA 5G0VA 5KJCA 1U5AA 4WLOA 4OHUA 1TT5B 1Z45A 2WD8A 1DAPA 4MVJG 3FNFA 5THQA 2A9FA 4HY3A 3U5TA 2ZCVA 4BNJA 3NDRA 5F1OA 1K3TA 4R9RA 2FZEA 2D8AA 1CETA 3VPFA 4BHTA 4CMJA 1CJCA 2BI7A 2W90A 1OOEA 1T2EA 2O2YA 1N9GB 1YVEI 1PZGA 4LVCA 3GVPA 3NT4A 2R2GA 1ISJA 3QE3A 3E5RA 1QP8A 3RIHA 2IYOA 1Y8QA 2Q1SA 1JAXA 4JCOA 5DP1A 3U0BA 2PR2A 3BIOA 5BR7A 3P2OA 4A2CA 2C07A 1DAOA 3GHYA 5GY7A 2HMWA 1PJCA 1UDCA 2NLOA 3DOJA 2VUSA 1HZZA 4HV4A 1PGOA 4E6PA 1I10A 2DKNA 3GRKA 3CTMA 3GFGA 1A9ZA 1X0VA 3T4EA 2EEZA 2IZ1A 2XXJA 3NTQA 1ZZEA 4EYEA 4CMIB 4S1VA 4Z3DA 4AJ4A 1HL3A 4CLRA 5L4LA 1BW9B 3G0OA 1ISMA 2X4GA 4JN6B 1EMDA 2X5OA 3E5MA 3LT0A 4LMRA 4RDIA 1WMAA 4Q3CA 1PQWA 1NQOA 3ZWPA 4YBZA 1F8GA 5JC8A 3PTZA 1WWKA 3OJEA 2C7VA 2G0TA 1AHHA 5KVVA 5IF3A 1NHGA 3GT0A 4GX5A 1PZHA 3F1LA 1X14A 5BT9A 3DZKA 1WZIA 2VZ0A 5ER6A 3NGLA 3O38A 3DHNA 1ADBA 3ENNA 3VPHA 1B8PA 4BNGA 2RCYA 4RF4A 3D7LA 4E12A 2D0IA 3ZU2A 1H9AA 2NQTA 3JYOA 4DRYA 2B5VA 3JYPA 2AEJA 3RVDA 1LRKA 5I9NA 3JYNA 1Y8RB 1RKXA 4FR5A 5DZSA 1PEDA 5DNAA 1EVZA 4Z0HO 3DZJA 4FFNA 1WPQA 4Q3EA 4NFYA 3JQDA 3RQSA 2O23A 2HMTA 3LYLA 2JL1A 4RO0A 1IZ0A 3TOXA 2AQ8A 4FBGA 4E2XA 3NTOA 4I08A 4DTIA 3KBOA 1CWUA 4OL9A 3I3OA 4FS3A 4D79A 1K2WA 2IZ0A 4PLGA 4CL8A 3KRTA 3ADOA 1KC1A 4GLOA 1YWGO 3HWRA 3C1AA 3NAQA 3C1TA 3GDFA 4FJ2A 4IPTA 2BGKA 1L7EA 4JP2A 3DZHA 1YE3A 1LLCA 2J5RA 3MOIA 4JGBA 1YOVB 3GDOA 3RAJA 2BFMA 3ZHBA 5L4NA 4I5EA 4MIEA 5CDYA 1T26A 3KYDA 5EQFA 4Y9DA 4ALNA 4XQEA 4EEXA 5HS6A 1P1JA 3PDUA 5JCXA 5K0ZA 4YCAA 4UREA 4CM9D 3ZU3A 4DC1A 1YH3A 4KMSA 1U8XX 2DUWA 1T1RA 3GMDA 4FFPA 1HLPA 3QVTA 1I33A 3DBVO 4RQUA 4CL3A 3S2FA 3WMWA 1CQIA 2OBNA 3H5AA 2EJWA 1YBAA 1O6ZA 5JE8A 5T8KC 3LC7O 3K2EA 5JYEA 3EYWA 1HT0A 4U0KA 3UXYA 4PCVA 3PHIA 1NP3A 2HRBA 3OH8A 3ZU4A 1GUZA 2F1KA 3EC7A 3X2EA 4KDFA 3GVIA 4BO3A 1CERA 5JXWA 2EHDA 4ZQBA 2H9IA 1E3LA 2A92A 1UDBA 2I9PA 1Q1NA 3ZV4A 1QV7A 4F6LA 5L7TA 4LGVA 1HSZA 4Y67A 2CFCA 5ITVA 3MJSA 4UUMA 3RU7A 1NTOA 1D3AA 2VT2A 2R00C 4JXKA 2XOXA 4L76A 5BQFA 5C37A 2HDHA 6ADHA 4EUFA 2PKQO 3TL2A 1XYGA 1ZH8A 2PH5A 2YY7A 3V1TC 4URFA 4O5OA 4BO0A 1I0ZA 1KVRA 1MGOA 1MP0A 3FN4A 1X0XA 5IXSA 3EGOA 5LDGA 1MC5A 3BHJA 1R4NA 3UOGA 4JJIA 5HWSA 1W0CA 5JCJD 4XEHA 4XJTA 2CF5A 1JQBA 1CRWG 1U3WA 3JQ6A 4Z9XA 4BO8A 4J9VA 2CF6A 1LU9A 1SPXA 4ZJUA 1JVBA 4CMEC 3GZ4A 1YL7A 1DIHA 4IXWA 4E30A 4YRAA 1ZJZA 5GZ6A 4QFCA 3ETDA 3OQBA 3PWSA 3H9UA 1V3VA 1C0PA 2J3HA 4PFJA 1R0KA 1PJLA 1IPFA 3H9GA 5CEJA 3RBXA 3E18A 3RC1A 2PH3A 4L9RA 3WXBA 1YB4A 1ZMTA 1ISHA 3AM5A 2ZYAA 2ZJ1A 5JY6A 1IL0A 3PGJA 4DC0A 4O59O 1ISFA 4OGWA 3Q11A 1ULUA 5KNLA 3NRCA 1SC6A 2EG9A 1Q0HA 4RV9A 5BSHA 1GUFA 1ZKMA 1EZ4A 1KYQA 3WYCA 5L3ZA 1BXZA 1Q0QA 3LZ6A 2FN7A 3QRWA 3RFTA 1Y6JA 5MGBA 1LEHA 1HXHA 1XGKA 3KV3O 3QWIA 4Q3BA 2VHWA 4BNFA 4NJOA 4II3A 3RJ5A 4R1TA 1QYDA 2NTJA 5I9MA 3BTOA 1NFFA 5I8WA 4HUJA 4Y6RA 4E31A 4KWIA 4KQWA 3LSYA 1XEAA 4UVEA 1JKIA 4FFMA 2Y1EA 3LVFO 5CPFA 4HNGA 2I99A 3GVCA 5ENDA 4KTTE 4TQGA 4J1TA 4R5HA 3WNQA 1IYZA 4H3VA 2RH4A 1PS8A 4DGSA 3H7AA 4XRRA 2ZKLA 2YHUA 2XAAA 4CQLB 3L9XA 4Y8VA 1UJMA 2I5PO 2P2SA 3OETA 2NV6A 2VYND 4CM6A 2E82A 1H5QA 2AG8A 5I7EA 2Y68A 4NBUA 3JV7A 2DC1A 4BKPA 2EV9A 1EUCA 1KEWA 1KBZA 3JQBA 4R3WA 1H6AA 3GVXA 2E6UX 2FOIA 1PGNA 5KCZA 1I01A 4HFRA 1E6WA 1Y81A 2AA3A 2VWQA 2DTDA 4JBIA 1E3WA 3GEGA 5IZCA 4A0SA 1WDMA 5TGDA 1T2FA 3TF5A 3IAHA 1DB3A 4ND1A 3ITKA 1FK8A 3R3SA 4RORA 1B15A 1GZ6A 4R4JA 4AJKA 2QYSA 1LJ8A 1U9JA 1KETA 3GN1A 1JAYA 3DBHA 4ITUA 3VVBA 3IJPA 2QIOA 3D5QA 1LDBA 3BTUA 2I3GA 3GNSA 1ZSVA 1JKJA 2WTBA 3B70A 4Q3AA 2GZ1A 1C1DA 4GVLA 3E9NA 1E6EA 4DIBA 2D1YA 1YB5A 2C82A 4FD3A 2Q2QA 2Q3EA 1XLTA 1NBOA 1KY4A 4ND5A 2HCTA 3L6DA 3JQAD 3IKVA 1S6YA 1I5RA 4GPD1 4PVCA 5BNTA 3ASUA 3KO8A 1PJSA 4QX6A 3D4NA 2Q45A 1I3NA 5KTKA 3RI3A 4DXHA 2GO1A 3INTA 5FEUA 1BDBA 5BSEA 3LT1A 3OP4A 3W8EA 3I4FA 5IDXA 3C3XA 5B12A 4J1SA 5JDIA 3BMNA 5L4SA 3I9OA 4YRDA 4B3HA 5ADHA 1GPDG 1XU9A 3MEQA 4EW6A 4J6FA 2VUTA 1CYDA 4D0RA 1EVYA 4BO1A 1QR6A 2D5AA 1PJ4A 1YJQA 1Y5RA 3D5TA 3L4SO 4ZQHA 1BXGB 1SMKA 3F5QA 3UN1A 4Y6PA 2Q1WA 4PG7A 3TZKA 5CDGA 4WCFB 1BGVA 2OORA 3WWYA 1NASA 3BMNB 2Y0DA 2YQ5A 4I9HA 4XGNA 1TA4A 5THKA 2WD7A 5IJZA 1B2LA 1K6IA 3KB6A 1QV6A 5EQDA 1JA9A 2ZTMA 5G0TA 1X15A 4INAA 1GYPA 4R1UA 3WQSB 4RVGA 1FXSA 4RZHA 3DZGA 4WGGA 1DC6A 2C2XA 1Q2XA 3GGOA 2NADA 3FHLA 3UAGA 3G17A 3MJ4A 3OM9A 1NFRA 2BKAA 1YB1A 2QRLA 3RSHA 2FRDA 3VTFA 5IDYA 1QG6A 4BO4A 3U4CA 3B1FA 3VH3A 1PZEA 4J1NA 4PLFA 2EGGA 2Z95A 5JMWA 3KSZO 1ENPA 3ROKA 1AN9A 3ZNOA 2PWZA 1PS9A 1ZFNA 1EK6A 3M6IA 1RM4A 4DMLA 2AHRA 4Y6SA 4JP3A 1E92A 1V8BA 2HKIA 3WICA 4IIUA 1IHYA 4CM4A 4CQMA 3INRA 3PK0A 1F0YA 3H4VA 5MDHA 4HXYA 3VZPA 4CM7A 3RC9A 4NZ9A 3HB4X 5CDTA 1HYGA 3DWFA 4BNKA 1L1FA 1DIRA 1I30A 5KKCA 3WB9A 1E3SA 4XQCA 3V2HA 3NDIA 1JU9A 4WEOA 2X9VA 1ZIDA 2YUTA 3DEYX 4EI2A 4P38A 4DIOA 2V7PA 3W8FA 1NAHA 1Z6ZA 4YT2A 4DUPA 2NVBA 4BL5A 5B4VA 1U5CA 2JCXA 3E03A 1RJWA 3GZNB 1RYEA 2VYVD 2YZ7A 4LK3A 3WDSA 2B4QA 3MOGA 1ZEJA 5FFFA 1VL8A 3DONA 4EGFA 3OICA 4A7PA 3ZZNA 1NQTA 5CDUA 2UV8A 1G0OA 3LT4A 4HKTA 2DPGA 2VOEA 2YFQA 4IS2A 1SZJG 3E1KA 4DLAA 2Q2WA 2V6GA 3C85A 4MP6A 1N92A 2NVUA 3CINA 3D0OA 2VZ9A 4XB1A 1QRRA 1O8CA 3DAPA 3KEQA 4W9NA 5A02A 1IY8A 2VHVA 1WP4A 1B0AA 4IZHA 3RC2A 4K9DA 1KEVA 1V9LA 4XQGA 2FSVA 4UEKA 5JSFA 1B8UA 4CUKA 2PFGA 3STHA 5JYDA 1GD1O 3VAZA 1SO8A 1ONPA 1EVIA 2A4KA 4FFLA 3RUAA 1HETA 1RYDA 4K6CA 2CD9A 4A03A 1KEPA 3OA0A 5CEEA 2P91A 4ZGWA 4QSMA 5LCXA 1K5HA 3ONEA 2HK8A 2G76A 3Q2KA 3F4BA 5I8ZA 1HWYA 1A7KA 5BSFA 1VC2A 5TF4A 4A10A 2HK7A 3JQFA 3NDJA 3PXXA 4L4SA 1GPJA 2EW2A 3UH1A 2DLDA 1NAIA 4CR6A 2QRJA 5L7WA 3DR3A 3DO5A 4PRKA 3FTNA 1ZW1A 4D41A 1KOLA 3LLVA 3CZMA 3SLKA 2EJVA 1QLJA 3RUHA 3PQFA 5AQ1A 1LTHR 1O95A 2EWMA 1PJ2A 1GV1A 2JAPA 1VKNA 3AUTA 3ZW8A 3K5PA 4I8XA 3JD3A 1SB8A 1C0LA 4PG6A 2X22A 1ZMOA 4NNJA 1LC0A 3V1UA 3IJRA 4OQZA 1H0KA 3JTMA 4FOOA 3AWDA 4IMRA 1DLIA 1DO8A 3M1LA 2DTEA 1NQ5A 2ZYDA 3GY0A 3AM4A 3ZN2A 3ZNPA 3BTSA 4CMKA 2ZIZA 3HSKA 4JQCA 3RKRA 4MO2A 1VSVA 2JCVA 4AVYA 3K9QO 3OECA 4BNTA 3C7AA 3RASA 3VTZA 5COQA 3TJRA 1QXSA 3P2YA 1LRJA 4NFSA 3HG7A 3OIDA 5EESA 1F14A 2OUIA 3K2BA 3WX0A 4GVXA 3D1LA 2H1SA 1GTMA 5FYDA 1HE4A 1GZ3A 1SEVA 2FPPA 1T4DA 4CMEA 2OL4A 4BNMA 5KJ1A 1DC4A 5ER9A 3MJCA 4UVIA 4BO9A 1E1NA 1T1SA 2OBYA 1CF2O 3ON5A 4O0LA 4TROA 5ILGA 2W8ZA 3H9QA 4FC6A 1LDNA 4BKOA 1DXYA 2NUAA 4D3FA 1VL6A 3NJ4A 1DHRA 3PJGA 3SXPA 3SJ7A 3K31A 4CLOA 2XF8A 3MJEA 2ILTA 1PZFA 3I9KA 5IDQA 1B8VA 3BYZA 3TWOA 1DIAA 2NQ8A 3A9WA 1E7YA 3OF2A 1YBMA 4GLLA 3VVCA 3V8BA 3PLNA 1KVQA 5LDHA 2DBVO 4YJGA 5FF9A 2OXIA 1X1TA 3LF1A 5IDWA 1IHXA 3GLQA 3PHGA 5C7LO 1ZEMA 2ZQYA 3O8QA 1RWBA 1VJ0A 5DBGA 1YKFA 3F5SA 4NBRA 1U8FO 5IN5A 2QX7A 4UVGA 2B35A 3KOUA 1YQXA 2UAGA 3H5NA 2GZ3A 4A73A 3P19A 4D3SA 1JTVA 3FTPA 4CM9A 1JKFA 3QWBA 1P9LA 2CDAA 4LMPA 1NVGA 3FWZA 1HDYA 3M2TA 1Y7TA 5T6BA 1I3LA 5L95A 2C20A 4FOSA 5G4KA 2DUUA 4DPLA 2OGUA 3WSWA 1J5PA 1ZK1A 5DBIA 5CAEA 2CVQA 3KSUA 2ZTVA 3RUIA 4FCCA 5DULA 2NU8A 3KUXA 2VRCD 1P1HA 5IFLA 4GKVA 4JBHA 1WZEA 4NHEA 4WLFA 4U0JA 5KIAA 1Z74A 1I2ZA 2Y0CA 4JK3A 4RGBA 4ZD6A 1H2BA 4J9UE 3L77A 4Q3NA 3VPXA 4DLBA 3ZV3A 2YYYA 1FF9A 1PWXA 5G2OA 4YJFB 2PGDA 4YJDA 1BHSA 1UAGA 2PNFA 5TS3A 2HLPA 2Y1OA 1V35A 1EUZA 3EZLA 2GUGA 3E8XA 2D2IA 2FSSA 1Y5MA 1P0CA 2NU9A 3JCZA 4YYZA 1TT7A 3M1AA 1Z75A 3PQEA 2YJZA 1LDMA 3ROMA 1E5LA 3HDHA 4CV2A 4ND2A 3HZZA 2RAFA 1H9BA 1GZ4A 4DIFA 1Q7GA 2GZ2A 1UZMA 2JJYA 2Y0EA 5JCJA 3EY4A 5TQVA 1GL3A 3ZHYA 1Y8QB 3HFSA 4IDEA 4E5MA 5A9SA 1KIFA 4GSKA 4CV3A 1AE1A 3VDQA 4U7WA 2AG5A 1CIVA 3PIIA 4J90A 1W8DA 2O3QA 4XIYA 4TKMA 2PD3A 2PK3A 3H6KA 3B20A 3U4HA 5JBIA 4KDEA 1GQYA 1ID1A 3SC6A 3DBLA 3QW2A 1OMOA 3R1IA 4MVJD 2O3TA 4CLRB 3BZUA 4ND3A 4BGIA 4DQXA 4YAIA 5ICMA 1E3IA 4QFDA 5TSDA 3FBTA 2X58A 1UZLA 3Q3CA 1GQ2A 3X2FA 1XKQA 3RUFA 4D44A 3MCVA 2QZZA 2IODA 4KUGA 1NPDA 1TXGA 2X9NA 1NVMB 4DLLA 5JDCA 1JN0A 1FDWA 2X23A 2ZQZA 2J3KA 4Y98A 1N7GA 1XHLA 4BMNA 4TRRA 3L0DA 7MDHA 3NJ8A 4N18A 1MLDA 4RPLA 4XZ3A 4J0EA 3Q9UA 4AFNA 1FDUA 4YAJA 1WMBA 4OYRA 2OP0A 2POQX 2JD2A 4PG4A 1SNYA 1LDYA 5EPOA 3ZU5A 1HE5A 4P4NA 4GWGA 3A1NA 2X7HA 1EBUA 4LCEA 3S55A 3TFQA 4CLXA 2I3AA 5CEFA 3A28A 4CV0A 4DWVA 4B7CA 1GFSA 3U3XA 2EKQA 1MFZA 1IUKA 4D43A 1LQTA 4GWKA 4ZRMA 4GX0A 1FDVA 4XD2A 2BHLA 3PYMA 1M76A 5GZ3A 3GUYA 2WSBA 4J91A 3AOEA 4QT0A 5CHEA 3NEPX 5GMOA 3HQ4O 2VTEA 1P33A 2HMVA 2GN4A 4XIJA 1KVSA 4R69A 3F3SA 2JAHA 3PIDA 3ANLA 2IYPA 3VH2A 4YAEA 3AJRA 3OIFA 3NTRA 4OKNA 1O5IA 4CMAA 3NUGA 1NYTA 3OJ0A 1ZCJA 2O3JA 4NK4A 4NQZA 3I52A 4B4VA 6LDHA 4RDHA 3I9NA 4II2A 4NMHA 4B8ZA 4PZCA 4BO6A 2X0RA 4EEZA 3DMTC 3ENKA 5IXYA 1LSSA 2EGHA 1LLQA 2DM6A 4KUHA 4RQTA 1YL5A 2HMUA 4JIGA 4NBVA 1GR0A 4B8WA 3RUEA 2PZKA 3KYDB 4LISA 2PV7A 3B6ZA 4PLPA 5HA5A 4XYEA 3JD1A 1R66A 1J6UA 2NWQA 2D4AA 3LU1A 3AFMA 5G4LA 3M2PA 3KVOA 4K26A 1M66A 4FIZA 4FN4A 4F45A 1E7MA 3ZWAA 5F21A 1JW9B 4CM1A 3I5MA 1SOWA 4KP7A 8ADHA 2HUNA 3I23A 3JQAA 1WW8A 4K6FA 2GD1O 1A71A 1D8AA 3BAZA 1TB4A 1NPYA 3DXFA 2BD0A 1GEEA 1ZSYA 1U7TA 4UUPA 1PSDA 5G0UA 4YACA 3CMCO 4B79A 4BB5A 3PWZA 3RC7A 4TWRA 2VNAA 3DL2A 4M89A 4TRNA 2NACA 3GPIA 3LF2A 3S8MA 1P3DA 1XQ1A 4RPGA 4CUZA 1EFLA 1A9YA 2RH8A 2GRAA 1BTOA 5BSGA 4HBGA 3EHEA 2AQKA 1DOHA 4L73A 1OC4A 3KYCA 1UXIA 3PP8A 1EE2A 1H93A 4CR8A 4PLZA 4WLNA 3C7CB 4QUKA 2JHFA 2BF7A 1VM6A 2VHYA 3QSGA 3UKOA 1C3VA 4I1IA 3O9ZA 2Z1NA 4HNHA 4H16A 3T7EA 4BKUA 4ROSA 1DJNA 5AOVA 4BNHA 3OQ6A 2FMUA 2PZLA 1P1FA 4J43A 3PYLA 2VWPA 1R4NB 1C14A 4LN1A 3AY6A 4BNIA 4RCVA 1R0LA 1DJQA 4JJGA 4YEDA 4QO7A 4WEQA 1LDEA 4CMHA 1X7HA 4ZQFA 1M6WA 3LC1O 2DQ4A 1QYVA 2FPIA 3D3WA 3QWAA 4XCVA 4DMMA 4L8VA 2ZYGA 5I7SA 4OH1A 1MUUA 4JLWA 1LBEA 4BNXA 2BGMA 3MJTA 5U9CA 2O4CA 1PL8A 2NU7A 4NK5A 4BKQA 3KLMX 1MC4A 4CJXA 2LDBA 5JO9A 1T24A 1AGNA 3K92A 5TT1A 5TRTA 4YXFA 4IBOA 3I83A 1E7WA 3SVTA 2SCUA 3GH3A 3T7CA 4IQ0A 5JY1A 2B4RO 5DDIP 3R0IA 4N5LA 2YV3A 3RCBA 1IOLA 4B7XA 4CMBA 2NU6A 2CY0A 3H5RA 3DHEA 2G17A 3PYXA 1U4SA 2EERA 3OHSX 3OEWA 3ZW9A 4M49A 4R54A 5TC4A 4LRSB 3WTBA 2B4TO 1P31A 5HM8A 1Y1PA 4YJHA 3HDYA 1UAYA 2DT5A 2TMGA 5TNXA 3W4KA 1D1TA 4ONEA 3VH4A 1GUYA 2GGSA 4CMGA 4U5QA 3ANMA 1C0IA 3VHRA 4RZIA 1V6AA 4IS3A 2Y05A 5JAMA 2B0JA 4IJKA 3EVNA 1LLDA 4OKIA 5TT0A 3TFOA 1DRVA 4J16A 4J7UA 1QYCA 1F12A 4U6SA 1XU7A 5KVQA 1XIVA 4YJHB 1PIWA 1BRMA 4BB6A 2F00A 2C59A 1DFIA 4RVHA 3BTVA 1E5QA 2PLAA 4JX8A 1M75A 3IC5A 5IAAA 4ZVVA 4CM8A 1B16A 4R1NA 4BNUA 3FSRA 1V0JA 2CMDA 2DBQA 4R1SA 4X54A 1N1EA 9LDBA 2GN9A 4DA9A 3GHHA 2X5JO 3HE3A 2FPGA 2J6IA 5HRUA 4IDDA 2WYUA 2X0JA 3DBRA 4PZDA 5TJ9A 4RVUA 2WE7A 1BDMA 3EW7A 4TVBA 5JLAA 5C7IO 2CNBA 1E3WB 1H6BA 1F06A 3IUPA 3JQ9C 3WQQA 3EUWA 5DCWA 4RLSA 3PFWO 4H7PA 3W6ZA 5L7YA 3S1LA 4E4YA 3G1TA 3QA9A 1J0XO 2B37A 4QQRA 5HS4A 3DBHB 2ZTLA 1PJTA 2VQ3A 4IDAA 4XGIA 1WXDA 3N58A 4N5NA 3WR5A 1P44A 3VH1A 5COAA 5DOVA 3EK2A 1C1DB 2DU8A 3BXXA 4WPGA 3SEFA 2GNAA 3PEFA 2AE1A 5JPIA 3PPIA 3VZQA 1UP7A 3B1JA 5L53A 4GMGA 1DBVO 4WLEA 4FJ0A 1KY5A 2GCGA 3GGPA 1YQDA 1X1EA 3CE6A 3HB5X 4I5GA 4EJ6A 1ISGA 3P7MA 5T64A 2C5EA 4TMFA 3WGGA 1V3TA 1ZJYA 4GBJA 1NWHA 1A5ZA 2J5KA 1BVRA 2OFPA 3UVEA 1O9BA 2W2LD 3E6AA 4CR7A 4OMUA 4FFOA 1HRDA 1R4MA 4BNNA 3FRJA 1I2CA 2Q46A 1PQPA 1H94A 3W4JA 3COSA 4D3DA 1HE2A 1MV8A 3T4XA 2WYWA 2RIRA 3QVXA 4YAGA 8LDHA 5CFZA 1PGPA 3RROA 4CPDA 3N7UA 1D4FA 2V65A 2G82A 2YW9A 1ZSNA 1CDOA 5DP2A 4CLDA 2NM0A 4DYVA 3IL2A 3C7DB 2QZ9A 5K6AC 1AXEA 1DSSG 1UXHA 1EDOA 3GR6A 2BRUA 1DC3A 1UXKA 4RLHA 4FGWA 1GCUA 1NPTO 4ZA2A 2WD7B 3A14A 4BUCA 4DQUA 3WIDA 3DOCA 2VRBA 3JQ8A 1W4ZA 4Q9NA 2DAPA 3GDGA 2C2YA 4M55A 4NI5A 2H63A 3QQPA 3U9LA 2ZB4A 5A3JA 4EZBA 2Z5LA 2J3JA 3V1YA 5F3RA 1ZO8A 3WGYA 1YGYA 2VHXA 4WK6A 1U4OA 4D45A 4GI2A 4BGVA 1ZK2A 1P74A 4J0FA 4OQYA 3NKLA 4M87A 4WJZA 1E7QA 3KYBA 2PTGA 2QRKA 5U4QA 3UICA 3JQ8B 5CDSA 3HN7A 4FC7A 1W73A 2IDZA 2HQ1A 5H81A 1U28A 2B83A 4JBGA 4RF3A 4IJUA 4CM4B 4CQMB 2QQ5A 4U6QA 2I66A 2WM3A 4IGFA 4NIMA 4RPJA 4AICA 1QMGA 2HO5A 2GERA 3P5SA 1XWFA 1GADO 4CLEA 4BNLA 4Z9FA 3IMFA 3PFFA 4D7AA 1DIGA 3JQEA 1E3EA 1PGQA 3PJDA 3ULKA 3OFSA 1VKOA 3I6QA 3ZV5A 1ENYA 5H83A 3HNPA 3LT2A 4BMVA 4NU5A 1LSOA 4EJMA 3Q6IA 3DFZA 3W8DA 3ZWWA 1BSVA 3OA2A 4IQGA 3S2IA 4DVJA 1PJBA 2EKLA 3QVWA 4MVJE 3GNQA 4BQRA 3GVHA 4O63O 2VRCA 4TRMA 4MIOA 4B3IA 5K9ZA 1PJ3A 5EERA 2Y1CA 1YJ8A 3E48A 4Z9YA 4PG5A 4AJ1A 1MB4A 2Q1UA 3GN2A 4BNZA 2XXBA 4AJLA 4ZQGA 1SAYA 4MKXA 3V2UA 4YPOA 1B3BA 3GEMA 3KZVA 4BV8A 5A9RA 1P1IA 1YXMA 4XYMA 4TVOA 1EQ2A 3TZ6A 1U3UA 3LLSA 2P5YA 1EVJA 4XR4A 2NVUB 2GF2A 3ZWYA 4RPKA 3ETEA 4E5KA 5EIOA 3RJ9A 2Y66A 3W1VA 1O89A 3JQGA 4MIYA 2VTDA 2X6TA 1R37A 3FPLA 5TJHA 5B4TA 1HEUA 3FF4A 4OM8A 2W2KA 3TPCA 4JROA 4OJNA 4P22A 2VZ8A 5AXCA 5T8KA 4XYLA 3S2EA 1XQ6A 3G49A 2CUKA 5C5IA 3WFJA 4CLHA 1TVEA 1QYXA 3EZYA 4ESOA 1VSUA 2CDBA 2JFHA 3H9EO 5B37A 3B1KA 3FCOA 3ZWVA 5JAIA 2Q99A 1ARZA 1GY8A 1I3MA 3LQFA 4IGEA 4M1QA 4OIMA 2VOJA 4N54A 1J4AA 4JNKA 2Q4EA 3K6JA 1MA0A 3PLRA 3C24A 4ALJA 3G79A 2R00A 4MVJM 4MVJA 3C8MA 3I9LA 1XR3A 3I1JA 4R68A 4B4UA 4MP3A 4NG5A 1RM3A 2AW5A 2CSUA 4LCJA 1VLLA 3NX4A 4L75A 2C54A 3QY9A 1DRUA 2I65A 3DAFA 2X9GA 1JVSA 3AY7A 3OQ1A 1O94A 1I2BA 1Y9EA 4KUEA 4DYDA 5L51A 5KOIA 5ENVA 3ZHZA 1WAMA 4L4XA 4RF5A 1OFGA 1NR1A 1T2CA 3GG2A 4IIVA 3AUUA 4OXNA 1EE9A 5DCYA 3V5NA 2HMSA 4NBTA 2DFDA 3KM0A 2I6TA 5ILOA 4E5YA 3UCEA 1QLHA 2P9GA 2RBEA 4DL9A 4EUEA 1I32A 5CP8A 3BMCA 2X1HA 1YQGA 4J4BA 1A27A 3QVSA 4FJ1A 2E48A 3VOSA 1DEHA 4YT8A 1KVTA 3RFXA 4HWKA 1YDWA 4Z3KA 1HYHA 5CG2A 5I7VA 4AJPA 4ZICA 1ENZA 4Z0TA 5H82A 3QLJA 3JQBC 4UAGA 1ADGA 2LDXA 4IJVA 1B7GO 2ZJ0A 3JYLA 3ZGYA 3INGA 3AFNA 1T25A 3GEDA 1VL0A 2Q50A 1EDZA 2G5CA 3JD4A 2YHIA 1G0NA 4CLOB 3ZWOA 4CV1A 3FWNA 3LDHA 3W4IA 5IN4A 5IZCC 5C3MA 1IPEA 4PLCA 3Q0EA 1MG5A 1XELA 3WLEA 2C7GA 1EK5A 3JQ7A 1UR5A 3I4CA 4RF2A 5JMPA 3U49A 3MWDB 1JWBB 3DQPA 3PHLA 1D7OA 4MKZA 4YJGB 5EL0A 3VKVA 1PL6A 3WBBA 5F1PA 3QVOA 1B14A 3AI2A 4LVUA 3O8QB 3GPDG 1TLTA 1CEQA 4K1LA 2PZMA 2P4QA 3GAZA 5EMHA 4IDCA 3AM3A 1U1IA 2HJSA 2PD4A 1NHWA 3V2GA 1ONOA 5EN4A 2A35A 3ZNNA 5L9AA 2GN8A 3U62A 3RU9A 1TT5A 1IULA 5A04A 1PR3A 4G5HA 3VZSA 2O4UX 9LDTA 2GLXA 3BMOA 3DAGA 1LI4A 3AW9A 4E0BA 2GPTA 4WOKA 4FB5A 5FI3A 4YR9A 3UF0A 4KQXA 3E9QA 5G4KB 3WNVA 5JFOA 4WCFC 1N9GA 4AJJA 4AL4A 2YQ4A 1PR9A 4YWJA 3TRIA 1HKUA 3ROPA 5JDIC 4IM7A 5F5LA 1BMDA 1A72A 1E7SA 2EW8A 1DDOA 2Q1TA 2GN6A 1UDAA 4IJWA 4CUJA 3BMOB 4I5FA 3VPGA 1YBVA 1HDRA 2AQIA 5A05A 3U4IA 3WLFA 1Y9AA 3AUAA 3C1OA 4OAQA 2EP7A 1OI7A 4C7KA 1VJ1A 2BGLA 4DREA 4HX5A 4GH5A 1HDXA 5A06A 1T2AA 1HTBA 2J3IA 4GQAA 4NH4A 3WIEA 4CMIA 2IRWA 2A94A 2HSDA 3NT2A 1IZ9A 4Q39A 1BW9A 3Q9NA 5DOZA 4QO8A 3JQ9A 4IDGA 3FNGA 1UZNA 3OMLA 3ZHXA 1XSEA 3F47A 1PQUA 4TZKA 2VHZA 1VPDA 1MXHA 2JKVA 2GASA 4MVJF 3WGZA 3GFBA 1L7DA 2YDXA 2IEBA 2WDZA 1LA2A 4OSOA 3ONFA 2GDZA 3ORFA 2YFHA 2WMDA 3SC4A 2DPHA 2XPCA 1YRLA 2Y93A 3OEYA 4M8SA 1ZUD1 3FR8A 5A9SB 1BWSA 3GMSA 5AVOA 4R01A 4YT4A 3FD8A 3KHUA 1U7HA 1R6DA 3UFXA 3U09A 1ML3A 5DF1A 2UDPA 3I9JA 2C0CA 3HADA 3HDJA 4W6ZA 4PN3A 1DFGA 3FR7A 1KC3A 4CODB 1X13A 2V6FA 1TEHA 1E77A 4R51A 4D46A 4CM5A 3DBLB 1Y8RA 2Q49A 4MVJI 1XCBA 1Q7BA 4LSWA 1MXFA 4IDBA 4MOWA 2YDYA 1HF3A 4S3MA 3WOHA 1MG0A 2ZK7A 4GX1A 1LRLA 1E1MA 1QSGA 4GKBA 3CZRA 1P77A 1XA0A 4GX2A 4IY1A 3DMYA 3DZBA 1GDHA 4YA6A 1P1KA 1BG6A 1R0SA 1VJTA 1I24A 4ALKA 1LSJA 3O03A 1FJHA 3F6YA 3LK7A 4C7JA 3DB2A 2OO5A 4AJIA 3ZWBA 7ADHA 1PS0A 3ICPA 3UCFA 4F6CA 1AUPA 1F8FA 1OBFO 4NJMA 4AJHA 3HJAA 3K8ZA 4RVSA 3WMXA 5K6AA 1EUDA 2NSDA 5U1PA 3K96A 3BHIA 3HFGA 5AXDA 2GSDA 3RUCA 1VRWA 4KOAA 1TI7A 3DTYA 4UVDA 1B26A 4UULA 2VYNA 2BLLA 1M6HA 3ICCA 4YAKA 1N5DA 1YOVA 3KETA 3DTTA 4LRTB 3OJOA 2QYTA 3GUCA 3L6EA 2O48X 4BNYA 1HDGO 2JD0A 5DBFA 1PL7A 4NJMB 4G81A 3AU8A 3D64A 4J7CA 1X7GA 4PGFA 1XDWA 4J3FA 3JD0A 4L74A 2CZCA 4WASA 4W9NC 1PWZA 4XKJA 2VN8A 4YRBA 3CKYA 2AE2A 4NU6A 4ZQEA 2C29D 1F17A 1KEUA 3TDKA 1EEHA 4IZIA 5COBA 2J5QA 2NTVA 1R15A 2QG4A 1U3TA 1UH5A 1UXJA 2NTNA 4GGOA 5CPBA 3KXDA 3PJEA 2X5KO 3ITDA 4W7HA 4B7UA 1I36A 1NXQA 1BXKA 1IE3A 3O26A 4BGEA 1NR7A 4J49A 2HAEA 3JQFC 5ICSA 4YDRA 2G1UA 2CDCA 1N2SA 2FHSA 1GCOA 1EFKA 5KVSA 3N74A 4BNVA 2OMEA 4QEDA 4RVFA 5F1KA 4WNIA 2BI8A 3D4PA 4P4LA 5A9TA 3QWHA 2DFVA 1GQQA 3GOHA 1Z7EA 1GEGA 3JQAB 2HRZA 4L0QA 3MTJA 1FDTA 2E37A 3IP1A 5A4DA 5KJ6A 1JDJA 1GYQA 5JW6A 2CVZA 4E5NA 1KVUA 2VT3A 4W99A 5JC1A 4WOJA 2JD1A 1P45A 3TSCA 2OHXA 3RWBA 2P5UA 2W2LA 3I6IA 4I9NA 5DN9A 3IP3A 4L4RA 4XR9A 1PTJA 2DBRA 4MDHA 2E49A 5AXBA 2DBZA 1YO6A 3GQVA 1MFPA 5TIIA 3RD5A 3PDJA 5A3VA 4HP8A 3ROQA 4ZHSA 4E2ZA 4FGSA 4RL6A 3KYCB 1NWCA 3U4DA 4XDYA 2ET6A 4NFHA 2I76A 1QKIA 2Q2VA 4DPKA 1C0KA 1FDSA 1P1RA 4HFMA 3FBGA 4PLTA 3RBZA 3VDRA 4B4OA 1Q0LA 2RHCA 3K30A 2DVMA 3L4BC 2BH9A 3AI1A 3VC7A 4AJNA 4R5MA 2FR8A
chains in the Genus database with same CATH superfamily
4NBWA 4A91A 4OI0A 3WG9A 4C7OA 3ZV6A 2XWJI 1M1XB 1RAHA 4DBLE 5C5DA 1HO3A 3OIGA 4RSGA 1C7ZA 3I01M 3I01A 3G8BA 1ZVKA 1PBNA 5ALPA 1TAUA 4REMA 3R7WB 2AFVA 2B2CA 1F4LA 3WBJA 1MAHA 1N7HA 4J2OA 1RHKA 4WXYB 3AVVA 4X65B 3MTGA 2FQXA 4ZVNA 2X0NA 3BVPA 1LSUA 4GI3A 3VR0A 3IQWA 3VYVA 1KI4A 4YCDA 1YI0A 2PY6A 1DARA 3G9XA 5EZYF 2FZ4A 2C5AA 1KI2A 3OEEA 3DHYA 3O7MA 4FSHA 4WINA 3U44B 5EIBD 3ZCXA 1LV8A 4Z86A 1MABB 1VSBA 3WLAA 4C29A 3D8HA 1DTEA 1GILA 1P1BA 2H59A 2V7BA 5AUOB 2Y77A 1S2IA 2ZSIA 4ZRNA 5JNLA 2UVQA 2DSTA 4OSPA 3QLEA 4EHBA 4EOGA 3R9WA 2SCUB 4EARA 2G04A 4Q4CA 5KB3A 1UT8A 3ANTA 3K0CC 5AVXA 5T57A 5DPMA 1FXWF 3FI9A 1YS7A 1BJTA 3GG9A 1XWWA 4YT5A 2XADA 3UKDA 2DZDA 2A7XA 3GEEA 2P4HX 4QNRA 3B89A 2W98A 2IQ5A 2QN6A 2R47A 5FJJA 4DB4A 2C77A 1VXRA 5E7IA 2OXCA 1KRWA 1SCJA 1QGUA 2N75A 4PR3A 3GRPA 4WZBA 3WGLA 1U2QA 3SF0A 1TTTA 1IRIA 1OZAA 4NPAA 2FZ5A 2CLHB 4BWGA 3RKSA 5I4CA 3Q9SA 4OOEA 4K9LA 4MKHA 2C9MA 2HRQA 3B3FA 3WYBA 4ALIA 1DXQA 2ZSHA 1EFPB 1NW9B 3QFSA 2O14A 4F97A 1V43A 2P2GA 3ZDZB 1NYQA 1NKSA 3ZZ0A 1G6KA 1A8IA 3IEVA 5HEKA 4TV9A 1EIZA 4AW9A 1V9SA 3QU7A 2QLNA 1Z0FA 3KJEA 4GAEA 2FMTA 5J3JA 3M70A 4G9BA 2UVDA 5T4EA 1KERA 1EHIA 4O4JB 4PC2A 3W6UA 3UW3A 2MOKA 1W19A 3P4XA 5DSZA 2AMFA 2AEFA 2YMLA 4CU2A 4HS9A 2PSHA 4PQYA 1WDLA 4OYYA 2A57A 4A1FA 3D02A 3ZHCA 4NWIA 4D4GA 3THYA 2QVLA 1DHTA 3ANYB 1ZXLA 4P8RA 4XQ9A 5B7QA 3FOAA 4UM8B 2XUZA 2OHIA 1W88A 2C5HA 2IXAA 4OA5A 1QIDA 1Z07A 2WIFA 2FK8A 4L3OA 4TWIA 3O75A 1JAHA 1NBIA 4GOLD 4LJ8A 3WGIA 1NQAO 3FPHA 2XWPA 4KNYA 3LXMA 4NKRA 3R76A 1BRTA 1U94A 5IMSA 3BUSA 4LXQA 2BFDB 2OV1A 3A4IA 3THXA 1RLMA 1ISRA 16PKA 2OGTA 1QWOA 3ZDFA 4UMDA 1QQAA 1RI1A 3UJNA 2XY4A 3W5UA 2WHQA 2CFIA 3FZNA 1H6CA 4Q9AA 4ASUA 1O5TA 4BBPA 1XX6A 2FR0A 3BA1A 1C3OB 3IA7A 3DGFC 1X1RA 2X40A 3C39A 1RJ9A 2WHEA 3UB4A 1PU2A 1O6CA 2ZSKA 4P53A 4DS3A 4ZTZB 3PXDA 4JXXA 2X76A 3MD0A 1JXAA 4QLAA 1R9GA 1OAAA 3P9IA 1C1XB 2Y6UA 4HADA 3LSTA 2VJKA 1ZM4A 4X7MA 4ID9A 3UOAB 4BQQA 5DCUA 4B6GA 1XTVA 3CZCA 1V39A 1ISIA 3H3JA 4X5OA 2GJKA 4LHEA 4X8HA 4UUOA 4Y2YA 3TQCA 2JLYA 3Q0TA 4Z8XA 1UMCA 1DPGA 1RQLA 3OCCA 1GU1A 2B20A 1NX6A 2R1TB 1YD7A 4F5ZA 5IKPA 1JT2A 1I7PA 3WLRA 1RWOA 2WA2A 3LCRA 5BNIA 2H4WA 1GVNB 1GGFA 3O94A 2PX0A 3H2SA 3FNHA 3CEHA 3DMHA 1L8LA 3YASA 3HPQA 2GR9A 1USGA 4ZTBA 1C41A 1F6WA 2ZTUA 1F2UA 2INGX 4JC4A 1GXSA 3GQBA 3ORSA 2A5YB 1K5PA 3FHTA 1Z17A 4ZOCA 1WY5A 4I5IA 1N0HA 2FX5A 3AUSA 4IV0A 3T7SA 4W7IA 1THGA 2TMDA 2EP5A 4KKXB 4O4HF 1WTCA 3GP5A 5KKAA 3EAQA 4FFRA 2YZGA 2FZWA 3STUA 2ZCUA 2VWGA 2UYYA 1T9GS 2F1JA 1HYEA 2QVBA 2W8BB 3KE9A 1XZPA 3FMPB 5BSTA 5CIWA 3WTCA 3DLTA 5EHQA 2V9ZA 1QDUA 4DM4A 4WVLA 3AOEC 1VP9A 3EJWA 3KOMA 4GL4A 1FYFA 1ADCA 2G80A 3F46A 3HVIA 4DPMA 3R09A 3GEBA 4J3JA 1ZQ9A 2LVBA 2IWRA 1M73E 2O3RA 3L8YA 4G1FA 4TTSA 1UMBB 1K4KA 4ZI5A 4QOEA 3UOWA 2Q1XA 2QN8A 5JNVA 4LXXA 1DEKA 3V7WA 4K28A 2ZU6A 1DRWA 3CO0S 4Z49A 3PGXA 4JGIA 3GRCA 2YWDA 4D9GA 5BWOA 5HR5A 3FHOA 2W42A 2WTAA 3GLGE 2PZ8A 2H5LA 1XNHA 1LVGA 1Y1KE 2NUBA 4PM4A 2A1TS 2PANA 4PZEA 5D86A 2GPJA 4ZGBA 4UOQA 1OUMA 1P2SA 3EB9A 3QWFA 3T9FA 3WB0A 4JZYA 5ALOA 5JH7B 3K70D 4MROA 3ZJVA 1VL1A 1RQXA 1OYWA 3OSUA 3BKXA 4LSMA 4Q6BA 5DTMA 3UWKA 2C8LA 5ALGA 4ETIA 3JR7A 3JS5A 3V4SA 1NKVA 2CB0A 2J9XB 2WPDA 2ZJ8A 4ODIA 4OL0A 1A9SA 1LBQA 2ONZA 4LOIA 3RS7A 4F4CA 2UUAB 4UDOA 4MV5A 3Q6NA 3HSYA 3NGXA 1E2DA 5A3SA 4PG8A 1M1YB 2CXRA 2A67A 1UC4B 1KFBB 4UMFA 5I7AA 3GD5A 2IUFA 3DTVD 3GA0A 2FPLA 2IU0A 3WJ7A 5C8YF 2KLHA 5KHOC 3KZNA 5KNCD 2FP4A 4OP1A 5F73A 4CVNA 3ABQB 2QX4A 1NBMA 2BVNA 2ZB7A 4D6XA 2Y1DA 1XI2A 5LP6A 2WKRA 2B7CA 1GZDA 1IAVA 1W49A 3GJ5A 5EGNA 5IVKA 2ZBUA 2J6BA 4JR0A 3PGLA 4C6TB 5JMTA 1E6UA 2FV8A 3TZQA 4CCYA 5DN6D 3M9WA 3BCSA 3KKQA 1QF9A 5FBVB 2W2TA 5FR2A 1QYIA 3LNTA 1TMOA 3BD7A 3I6MA 1UT5A 2HU2A 1L4EA 3FPCA 3OBBA 1CS4C 3QG1A 4M54A 4KPFC 2R25B 1Q7CA 4PC7A 3EDRA 1T8UA 4E2WA 4KPUB 4NE2A 2OHFA 3DMTA 2R6HA 4J4HA 1LNQA 5J23A 2G77B 4TSKA 1BYIA 3A2MA 4EYQA 2XMGA 1AUXA 3CBQA 1N2CB 1SCNE 2FMIA 4OM7A 3GLGA 3LUDA 5GADl 2VYFA 2VK4A 1YR3A 4N3CA 1EFHA 2QVZX 3QU9A 1ECCA 3B6MA 4MQFB 1R0RE 2O50A 1SB9A 2HO4A 3H3FA 1KOFA 5AW5A 1KZYC 1T5BA 2O6LA 3ZGLA 5AM5A 4C5BA 5C1DA 3ZY2A 2HF9A 3RK0A 5JD4A 6ABPA 2XMRA 3PVZA 3WK4A 2P8JA 2WF6A 3M4XA 3KEOA 2GS9A 1G21B 3FLBA 4MLPA 5HBRA 2P75A 3N07A 4URWR 1YDEA 1J99A 3FUCA 5GV8A 2Q6VA 2ZB3A 4K3VA 3QIVA 2AJTA 3DE2X 2FMKA 4IHJF 4KO3S 2WILA 5CLLA 2PT5A 5IYZF 2IPLA 1BVUA 1S3GA 2WEKA 1E9SA 3ND8A 3R3YA 4EG4A 2WKWA 4ACAA 3NYWA 2FPMA 4YY3B 4L4ZA 5KNBD 1FJXA 3IILA 1XD9A 1WBBA 3F1KA 3ZPXA 4CN9A 2IS1A 2NXCA 1SKAA 1RPTA 1NJ1A 1VMIA 5JAZA 1N6NA 1R27A 5KVCA 3S2GA 3QVGB 3WISA 4BLVA 4CWAA 4R1OA 1AUQA 4M7RA 4OJTA 1P2FA 4BFWA 4TZ0A 1EQAA 4W8GA 3PCRB 1Z5PA 5H80A 2I4MA 3SMVA 5LQAA 4F11A 4XB2A 3FRIA 4E88A 4X9XA 1FS6A 4PIVA 4ER5A 3MIIA 1A4IA 3QHQA 5EIAA 3PNKA 2IOHA 3E82A 1DG3A 2JBWA 1W75A 3E27A 4IRXA 2R4UA 5SZHB 3VUFA 1GSOA 2HDOA 1EG7A 1VYUA 1V5FA 4KVAA 3K73O 4R84A 3AKEA 2AFHE 2KLBA 2SKCA 3AOGA 3C3DA 4ZC8A 4HDRB 4TTVA 5KWEA 4R2WA 3R44A 1PJQA 4EITA 2PM8A 4PX2A 1O03A 3I2KA 4Y6OA 4AJ2A 4B84A 3KCNA 4AWBA 5BURA 3L04A 1Z29A 1TZKA 4W5TA 1Q57A 1G98A 3K0FB 2FFBA 3WSVA 3ZS8A 1K6XA 2D59A 3L4EA 2ZJYA 2P11A 3LVBA 2JFGA 4WXRA 2WWRA 1WVIA 4MVCA 3L41A 2QX9A 1G8HA 1ZBQA 2Y99A 1P3Y1 3AYZB 3AWIA 3GNLA 4KNVA 4LOAA 4JJKA 5LYJB 2F3TA 5G0SA 4CM3A 1E8NA 1MOSA 2ZRLA 3EQ2A 2FEWB 3IT1A 3RHSA 4CTKA 1JI0A 2O19A 4YWHA 1SURA 1MOZA 3K4QA 4QYMA 1BWQA 5JAPA 1I3KA 3A6HA 4F71A 2OXFA 4AQYB 5FBHA 2E2WA 4ZOLB 1TCUA 1WLYA 1IXRC 3BMCB 4H31A 5AVZA 3ROGA 3CNHA 1ULAA 4EUKA 5EUQB 5KTPA 3QUQA 1NNEA 2HRCA 4XDZA 1VHWA 1Z4PX 4LF6B 3DEJA 3UMRA 1JF8A 1PG0A 3IR7A 5F2OA 4DLSA 3PR1A 1IUNA 3QU2A 2QTRA 8OHMA 3PHJA 2OYSA 5L6LB 1HYBA 1ZRMA 2CHGA 4I50F 2OP1A 4C5CA 4CF5A 1GCAA 1HE3A 1LLUA 3W6OA 2XECA 1H6DA 4E3ZA 3SZRA 2VSYA 4X97A 1FSSA 2IE0A 2VK8A 3QJ5A 4WY8A 5A1TA 4Q1BA 3BDVA 5AW1A 1R5JA 2YIJA 3M6WA 2W6PA 4D8WA 1PGJA 3C4QA 5BVHB 3ZTTA 2IPXA 4XM1A 4YRZA 1SKYE 3IXLA 1CUJA 4N01A 1BD3A 3C15C 3HFJA 2BZGA 4YRRA 3NV9A 1FUYB 3VZCA 3ZWXA 4QVKA 4KK3A 2LKDA 3Q2IA 1JG1A 1XEWX 3MJVA 1RHJA 2JFFA 2HREA 2PD6A 3ANNA 1RYMA 5IDVA 4ABTA 1Z82A 2C1EA 2YNMD 5EJ6A 1C8VB 3VI3B 1AXGA 5I9BA 3UJAA 1VXOA 3JRWA 2H57A 4UZFA 1PFVA 3L6OO 4BV9A 1O0SA 3MLBA 2AN4A 4V0NA 4YJFA 3MFYA 2V4UA 4J7XA 4WNAA 5E7JA 3TZHA 3OBIA 1R0XA 3D0KA 2M2IA 2WD8A 3U7QA 4D8VA 2XW6A 3QEAZ 3E5NA 5ERGB 1LK7A 4IOLA 2A9FA 4J03A 4HY3A 3NIFB 4AO7A 1AURA 4WX2B 2PUDA 4Q21A 4BNJA 1I2AA 4QPJC 2OEPA 4WUTA 3UJPA 4CMJA 4OP2A 4WKPA 3EOZA 4V39A 2W90A 4I6GA 5TEVA 3NRJA 1G8PA 2DULA 2OE2A 3IHWA 1ORTA 3PPVA 4MMZB 3BXZA 3GVPA 3LUHA 3NT4A 2MSEB 5ADUS 3E7XA 2V59A 1DI0A 2GESA 3LUCA 1JR4A 1AVTA 1M2HA 5DP1A 3IERA 1AG9A 2AGVA 3ZE8A 1ECBA 3BIOA 3OOEA 4L2IB 1V11A 1WSAA 2JATA 1YZVA 3AP1A 3P2OA 4A2CA 3HJNA 4PFSA 3D4IA 1LZLA 2HMWA 4MV1A 5EQTA 3R7LA 1NXVA 3WQBA 1OIWA 5LUBA 1HZZA 1XRPA 2IDMA 3TCKA 5K03A 4JD5A 2DKNA 3GRKA 1ADJA 3GFGA 4AULA 4G0UA 3O3OB 4H59A 4WFKA 3NTQA 3UAVA 2FRDC 1BDJA 1GRCA 3SZMA 4S1VA 1F9AA 3U7FB 1KPIA 1BCSB 1GPMA 2WSLA 4KLZA 5FUYA 4PO9A 4CLRA 5C53B 3Q8MA 1QLWA 2G25A 3NDPA 7MHTA 3W5JA 3PIRA 3BCUA 3G0OA 3KEFA 2L19A 5H3LA 3LT0A 4RHEA 4LMRA 4RDIA 4NV3A 5KC8A 4Q3CA 3RRJA 4YBZA 1F8GA 2RGRA 3SPXA 3EXAA 1CR2A 4E6EA 2V3VA 3OM0A 4JZKA 1OASA 4MGYR 3OPMA 1J9EA 4PZYA 3N2KA 4GX5A 4HDQB 2YJTD 4FLFA 5BT9A 2FDRA 3F6CA 5AM0A 2ZE5A 1M8GA 2VZ0A 4XUGB 5EIWA 4QHSA 5T3YA 4CZ2A 2OBMA 1U1EA 2ATEA 2ZW9A 3FCCA 3TDNA 2BTEA 5HJ5A 2J31A 1HURA 3HCOA 5K4GA 2PGNA 4O2BF 4ZALA 2D0IA 5AI9A 3ABSB 3ZU2A 5L3SA 1W1IA 2LR0A 1GG9A 2NQTA 2HU8A 1VCOA 3JYOA 3QUBA 4RSRA 4XIGS 3MRVA 1I3CA 1N2GA 1N2BA 2QTVB 2AEJA 1SFRA 3FGZA 2YJ3A 1LRKA 3MK31 3GBPA 1ZM3A 2KS6A 3K1TA 4MQMA 3QBEA 2GTIA 2OCDA 2ZAGA 4R71A 2L42A 5A4IS 3LQ4A 2JLAA 4UTPA 3TSWA 1QFYA 2VDUE 2Y4OA 3OOJA 4Z0HO 3DZJA 1WV0A 4L5IA 3ND7A 3PA6A 1C3XA 5BWNA 3RJZA 3PNYA 3OCVA 2ZUEA 2F6RA 2EAUA 2K5UA 3IIKA 1QTRA 4ZK2A 2H0QA 1N77A 2Q0HA 3EFOA 4C30A 2AI2A 3BJMA 1FX1A 1X1SA 3UK2A 1QG0A 1Y34E 2ODTX 4J6EA 3RJTA 3SX0A 3I72A 1K2WA 2H1FA 2IZ0A 1K8QA 2PX3A 2I6UA 2JLBA 2B8JA 1SELA 2H85A 5CURA 2D5LA 4BMCA 4CL8A 2I3ZA 4KFUA 1KNQA 4L5JA 5LZ2A 4YLGA 3C1TA 2DETA 4IPTA 4HAWA 2BGKA 3WZMA 1Q5PA 2VPXA 4URYR 2TRSB 3GJ4A 4LPKA 3DZHA 4FGLA 4Q9KA 4M46A 2J5RA 5CJ2A 4NYJR 4LFBB 2X4IA 1VG0B 3NB0A 3PQ7A 5BV0A 2QD1A 4E3WA 4ZEXA 4GC9A 1RHUA 2HI0A 2XRZA 1PL0A 4UNPA 1CEEA 3DEIA 5IJXA 4HLNA 3GROA 5EXDA 5ED0A 1CVRA 2R6ZA 3ZZTA 3CF2A 4UREA 2PX8A 2PBZA 1JAZA 4MV8A 4TUYA 1YH3A 1EAYA 4G2TA 2XRMA 2DUWA 4PX5A 2OKCA 2WHXA 4AMUA 1L7BA 2V6JA 1X9GA 3QKSA 2VTKA 3UJ9A 3QVTA 5DX0A 4EY4A 1XZQA 2GBIA 3RRMA 2XA9A 1CQIA 4MMYB 4YAFA 2ZT8A 3OZCA 4JITA 5JE8A 3SK0A 2A0UA 4ME6A 4B4DA 1F3LA 1R8JA 1A9XA 3T3HA 3EYWA 2H7CA 1HT0A 1ZYUA 2R6FA 3HJGA 4U0KA 4WKNA 3B1XA 1BU5A 5MFZA 2D0PB 2PS1A 3P71T 4KIWA 2GJ9A 5KNDH 1A0OA 3GVIA 3T54A 5I4BA 4Q4JA 4KFCA 4DVGA 4JMPA 2RARA 3CLTC 1WD5A 4PSVA 3OSZA 4LC1A 1E3LA 2XTJA 1UDBA 3SBDA 3KKOA 3D3QA 4ZCLA 2DRIA 3NFYA 3LHDA 2FEXA 1NKTA 4MCJA 4RCZA 2WIKA 5F2KA 5LA6B 5ITSA 5L7TA 5K0CA 5DW0A 4GYJA 4A5SA 2BFBB 2CFCA 3B6EA 4MS1A 4YBRA 5A4AA 5I7HA 4P7FA 1T5OA 2I7DA 1J0DA 4PS1A 2F3SA 5B58T 5CDFE 4PXAA 2JPDA 4L76A 5BQFA 3EE6A 2HDHA 1KQ3A 2FPKA 2QW1A 6ADHA 5KQGA 2AC2A 1ZH8A 3C41J 1D2GA 3MM4A 4HQRA 4UHEA 2WZCA 3FN4A 2XCLA 5LDGA 1VDMA 2PU5A 1DKNA 3ROFA 5J5VA 1H65A 4HD8A 4R9NA 2O8BA 5B64A 2XNJA 3RS9A 3T7TA 3CSUA 3HNOA 2II6A 4ECEA 2PLWA 2V7WA 5JCJD 2BFWA 2XCQA 2BR5A 2CF5A 1MC8A 5KQMA 1CRWG 2PMWB 3Q10A 3OX3A 2OPBA 4J9VA 1S3SA 1A9TA 2CF6A 2V8OA 3DNPA 3NVMB 1HMYA 3L6BA 4ILEA 1FY2A 4TX1A 5CM9C 2XDAA 3GZ4A 2RAUA 5CD9A 3O8RA 1DIHA 1W9HA 2P2ZA 3FVQA 5GAJA 4H1WA 5CVTA 1A9OA 3I8SA 2OB2A 3L1IA 4GEKA 4GXQA 4QFCA 2P1RA 2PMEA 4QDTA 3MMXA 3PWSA 3ZQ4A 1UINA 4RK6A 4CKCB 4FXOA 4NCBA 2J3HA 3LHFA 1AGYA 4Q0MA 2H29A 5LBIA 2WIGA 1IPFA 3H9GA 4G25A 4JVMA 3RBXA 3RC1A 2PH3A 3VKHA 1PRYA 4BYGA 2R8BA 1ZMTA 1ISHA 1E3QA 1UCFA 4JASB 4CIDA 4JB3A 2K7FA 5JY6A 1IL0A 2LP4Y 1UJ6A 4HGPA 3PGJA 2KQUA 4PNZA 4DC0A 5BMVA 4C7OB 3UYKA 2VAVA 3Q11A 1ULUA 1WDTA 2AXNA 4CIAA 4GXRA 2DUMA 1W2GA 3L0YA 4ESVA 2E6KA 1Z0UA 1CUFA 2FLVA 5MGBA 3DAOA 1LEHA 1XGKA 3QWIA 4QL3A 4O1HA 5AUQA 2PWYA 2Y71A 3RU2A 5CDFA 4BNFA 3KB8A 1C9EA 4X61A 4OPMA 1T5LA 1NFFA 1GN9A 1U4NA 4RMJA 1AKVA 1TCBA 1G6HA 2GPBA 2QXUA 3DCNA 3FF1A 4KWIA 5HBGA 1CR0A 1S9DA 3CRRA 3ZLJA 2XDQA 4OHVA 2RSLA 1JKIA 2GYWA 1XPOA 1K08A 2RGYA 1OWLA 2Y1EA 1NL3A 3OPYA 2N47A 3SSMA 4C4RA 4C7BA 4AAYA 4HNGA 4C87A 1KO7A 4EPXA 2SNIE 1QHEA 3SCZA 3PS9A 3ERCA 2O6HA 2CXOA 4TQGA 2FQQA 5DE3A 3VA7A 4J1TA 4R5HA 2P0AA 1IYZA 4H3VA 2X19A 2A0XA 2WP0A 4P86A 2IEIA 1FFEA 1WXXA 3JWHA 3EDCA 2YHUA 2I7VA 4JQSA 3HNRA 1Z47A 4AG5A 4ZO6A 4Y8VA 1SG0A 3WHKA 4UJ5A 2P2SA 2J08A 3U16A 3OETA 1UFQA 1SQSA 1STOA 2CLKB 2E82A 1D2RA 4FNGA 4PX9A 2JGEA 4MQBA 1V45E 2EV9A 1KEWA 1MA3A 3H05A 1EX1A 2X6QA 4NV1A 4L0DA 4OIFA 5J47A 5JXGA 1QGUB 2E6UX 1PGNA 3EZ7A 4WZBB 1VB5A 1XOIA 1WZ2A 1E6WA 1RLOA 3PUKA 4H4CA 3HO1A 2ZJZA 4EY3A 2OXTA 3CY6A 3LZCA 1W5BA 3AHCA 1OHHD 1E3WA 4JBIA 4MH0R 4RHYA 2I91A 3IAHA 1O7JA 3GP3A 3RNLA 2JLWA 4R4JA 3AM1A 2IS6A 3PSAA 1W1UA 1U9JA 3GN1A 4TV9B 1FVOA 1ECLA 1E2JA 3DLIA 3IJPA 1MR3F 2QIOA 5JZMA 3D5QA 1LDBA 4ZI7A 1DJPA 1ANKA 1Q44A 4Y1RA 3W06A 1OWPA 2WTBA 3B70A 2HXYA 4FDLA 1LTKA 3LPAA 4QU9A 3SHQA 3ZOKA 4DIBA 1YB5A 3MOSA 5K0LA 5EJAA 3RTEA 2ZR7A 3RYHA 1XLTA 3PNSA 1YHNA 5JSZA 1RTKA 3J81A 1PO7A 1ONBA 3JQAD 1U1FA 1AXRA 1S6YA 1I5RA 2QB5A 3CT4A 1LS1A 3FM9A 4GPD1 4HWPA 4PVCA 1XKTA 4Q3OA 4YV2A 1GAQA 1UDXA 1N6OA 1Z2NX 5DLYA 3U80A 1H8EA 1W88B 3OE5A 3O5AA 4RK4A 1AH2A 3BRWD 1BDBA 1ZNYA 2Q2OA 4RIFA 3A2LA 3W8EA 1G8JA 4RD1A 3IQHX 1IHUA 3U4QB 4Q19A 3THXB 5C51B 5JDIA 1WCWA 3GT7A 3SJBA 3TCNA 4C3ZA 5L4SA 3SI7A 1P7WA 1F20A 2PX2A 4EW6A 4J6FA 1EESA 3MB5A 4FYXA 1MT3A 2BFNA 2QGFA 5FIUA 1FP6A 1J0BA 1YJQA 5LZ5A 1K75A 3L4SO 4H35A 1SMKA 3F5QA 4LQCA 4ZQHA 3UN1A 1VE1A 1NXWA 1RJ9B 2C57A 3CX6A 2Q1WA 3T7RA 4F5YA 3TZKA 3AONB 3HWSA 1BGVA 3PQ3A 4BGDA 3WWYA 1NASA 4GPBA 1RMQA 2XVXA 3PD0A 3UBTA 2Y0DA 3HKBA 4Y2SA 2YQ5A 3EIEA 1N34B 1QVAA 2WD7A 4L0CA 3QTTA 2H9YA 3GLIA 1GZSA 2SKDA 1QV6A 3KE8A 3ITNA 1UMCB 1Z0JA 2OO5C 5GJCA 3C5CA 3ZDQA 4ROTA 1BHQ1 3R3VA 4RZHA 3ED5A 5E1MA 1DC6A 3C7TA 5F5XA 4N12A 3AFOA 3CO5A 4CYMA 3GGOA 1WW2A 2Y1WA 3K8OE 1UK6A 3G17A 3MJ4A 3P2IA 4H6PA 5IMBA 1XTTA 2XUOA 2QRLA 3VTFA 1IHPA 4P0QB 1EK0A 1F2UB 2OC9A 3OESA 3R41A 1NF9A 3VH3A 4BU1A 1SC1A 1GXSB 3R9XA 2EGGA 4D8UA 5TR9A 4MV7A 2PMFA 4AC9A 3TRKA 4D9IA 1QQTA 3R0JA 1EK6A 3E9ZA 3M6IA 3OU2A 2W0SA 4JAVC 3CT6A 3VGPA 1E92A 4QOFA 3WLJA 1P4GA 2EFCB 4FYYA 1M74A 4IIUA 4OBXA 1AV6A 4CQMA 3INRA 2AOUA 1GJRA 3O4JA 2REXB 4PYKA 5ARCA 3GH1A 2CJFA 2ZVPX 3IQXA 3KQQA 3DF9A 3Q87B 3T1NA 2Z5FA 1JDPA 3LPDA 4CM7A 2XNDA 5IRCD 2VDKB 1OW3B 3PDCA 3OEED 3QE9Y 3DWFA 4BNKA 2Z9BA 5CYFA 5KKCA 2ZDGA 4UAUA 2JI4A 1XU4A 3NYQA 3V2HA 1GNPA 1A9QA 3K94A 3NDIA 4I1YA 5FBKA 3KOXA 2ZXFA 2ZSUA 4MB2A 1M7BA 2VT7A 2X2OA 3FZYA 4UEWA 4P38A 4GXNA 2XR1A 2CLDX 3W8FA 3O82A 3HYTA 3TW0A 1DRKA 4KYUA 3ZS9A 4BL5A 5B4VA 5F9MA 3B52X 1XNRB 1QC5A 3VR6A 2C5FA 2WU8A 1JFLA 1OZGA 1G4AE 4EL0A 2YZ7A 2P6PA 4ZZIA 4MVWA 2IIPA 1KH3A 3BC1A 3MOGA 3ZK9A 1CJKC 2AFIE 3OZXA 4W6QA 1YB6A 4AMGA 1FFGA 3L8CA 5GQSA 1V8FA 3PQ8A 3DONA 1EFUA 3NEJA 4R1QA 2GHQA 1YR7A 4Q1CA 3SVLA 1NQTA 2EF0A 3BZBA 3QUSA 4NECA 5ALQA 5CDUA 5KTRA 1G0OA 2E21A 2DPGA 3BS4A 2YFQA 3K05A 3Q8WA 2G3YA 4HKTA 1SZJG 5AKGA 3T06B 4YCLA 3GI1A 1TCAA 2GAAA 2FP4B 4FW9A 2VF5X 2HFKA 2ZPTX 4H3HB 4N6NA 3D0OA 3E7PA 1IN8A 4EX6A 3L7MA 3A6ZA 4I3FA 4W9NA 3DULA 1IY8A 3S99A 3V1LA 5LP6B 4L08A 1WP4A 4ZCRA 2V6IA 2VCHA 4MGIR 2PFKA 4LQ4A 4URHA 4DQDA 4CCYB 3KLOA 4NMMA 421PA 3D81A 5JSFA 2DECA 2VO1A 2I6SA 4Z1MA 3RUPA 3HZRA 2N0SA 1F7UA 1A96A 1ZG3A 2VJLA 2VJMA 5JROA 4CIYA 4NL4H 4EKNB 4PHHA 3TTSA 1E3TA 5BW6B 1TF5A 3RUAA 2DFPA 4HLDA 1NMQA 3JX9A 2PYIA 2P91A 2Y27A 4ZGWA 1XLWA 4QSMA 3S5JA 1K5HA 2ZS8A 3JW8A 3ZJ4A 1NT4A 4NOLA 5AT1A 1A7KA 2G07A 3NUZA 5BSFA 1YFJA 4DHEA 4F85A 3JQFA 3V8VA 1DKPA 4NYIR 1CEYA 1I80A 4B4KA 3GLGB 5AJHA 2EW2A 2LKCA 4JL5A 1JG7A 5AR1A 4C89A 5BRAA 2E4WA 1FVXA 1V2GA 4OLFA 2HWWA 3TBKA 3LLVA 3CZMA 1TCCA 1QLJA 3BWDD 3DM5A 3I4LA 2Q5JA 3RGGA 4ASUD 5CVUA 1HEYA 1LTHR 3K72B 3AUTA 4QBFA 5EHIA 1EFAA 3FVWA 1IDOA 2FI1A 4HQFA 4OUDA 3M33A 3PP8A 1PG2A 3QZUA 3ETNA 4AZSA 3QNMA 3Q5DA 4PG6A 2KWIA 4N9WA 4R2KA 4NENA 3ZDBA 1QF6A 4OQZA 1H0KA 1RDFA 1IFXA 3A1UA 1QHXA 1WF6A 2VA9A 4C0QC 2NT4A 1ZU4A 3VTKA 1X80A 1DLIA 2N42A 1DO8A 1E9DA 4L72A 4QXQA 1DQYA 3T61A 3K1JA 3M1LA 3VPAA 1EEXB 4FX2A 4B3SB 5AK3A 3G59A 5J4VA 1UBRS 1IVNA 3O84A 3ZN2A 3AUXA 3USZA 2XMZA 1FXUA 1VBKA 4JQCA 3W9BA 1ODTC 1R0WA 4HO1X 5AHWA 4B3RB 3OECA 1RYBA 2MR6A 1IRXA 1RBMA 3NR2A 3T9BA 3UJ6A 3FDXA 5IARA 3RASA 1YRBA 2PYDA 4B44A 1YZNA 1QFSA 4JT2A 3F6BX 1KJ9A 3P2YA 1WMEA 1LRJA 4HC4A 1C9YA 5EESA 1UQRA 2XHEA 5K3AA 3WMGA 5CBPA 3E7WA 2OUIA 2OLEA 4KR7A 3DYVA 4YV7A 3D1LA 4B46A 4QZVA 1E20A 1NVVR 3PICA 3AQIA 4M9RA 1XDGA 4DLWA 1GZ3A 1T4DA 3F5DA 3QLUC 2OL4A 1TK2A 4RYDA 2IPOA 1PN3A 4NZYA 2GFIA 3MJCA 1AUVA 4UVIA 2PPVA 5E9QA 1WKBA 3RV4A 1D6SA 1M1NB 4O0LA 2W8ZA 3EUEA 3H2GA 1YMVA 4D3FA 1VL6A 2E0IA 4R83A 1DHRA 3SXPA 4DV1B 1BMQA 1KAEA 3R0XA 3SJAA 2ILTA 3I9KA 4KLNA 3WK6A 3O9VA 5CH5A 5FD8A 3A9WA 1TDJA 4OSEA 1WPRA 5KMGA 3AR2A 1OTHA 3VVCA 2GHTA 3V8BA 1P0IA 4HN2A 4G8BA 1KVQA 2J0QA 1L5GB 3MWDA 2D54A 1BFUA 1GUDA 5FNZA 1VI5A 1Z6PA 3PHGA 1J5XA 4JEHA 5C7LO 3EXG1 3LHIA 5DK6A 4F3RA 2CBGA 3CYFA 4KHPB 1W2WB 1VJ0A 5DIZA 2I1VB 3D2BA 1YKFA 4DNFA 2HV9A 4WFQA 3S29A 1XEWY 3IXMA 5CR9A 5IN5A 2VJOA 3O3CA 1T4GA 4MWOA 4UVGA 6PFKA 3KOUA 1SC3A 1GGEA 1MF7A 5D87A 1RBQA 1YA6A 4EAAA 2CB9A 3EPPA 4CM9A 1IATA 1R6BX 3DEAA 3BWEA 2WPDD 4DNPA 1RI2A 5BUCA 2QTAA 3BD8A 1C4KA 3N0VA 3HUUA 3FWZA 3M2TA 1HDYA 1RCTE 1WHSA 2FRXA 4G07A 1P9RA 3QKWA 4FMDB 1I3LA 4I46A 2C20A 4FOSA 5EKUA 2DUUA 3VU0A 5FV4A 5L95A 5TQ2B 1KE1A 4CEJA 1A5AB 4WRRA 4H0FA 5DBIA 5AVVA 3OE7A 1CV2A 4JBLA 3RUIA 4FCCA 1EVKA 3I34X 5DULA 3VBCA 4D8XA 4ZOAA 5ALTA 3PUZA 3D6HA 4GKVA 4JBHA 4TM8A 3VI4B 1FFSA 1NBMD 1XCLA 3G2LA 4RD6A 4WLFA 3PL1A 4ZYVA 3BDAA 2AFHB 5HW0A 4AROA 1YNOA 1FMJA 2IDKA 3TW8A 4MR7A 3FETA 1DINA 1LD3A 1J56A 3SX4A 4JK3A 3EA4A 2XSZA 3B3JA 1H2BA 2C2OA 3L77A 4ND7A 1Z56C 1JTEA 5FOQA 4L22A 4MJXA 5JXHA 5E7MA 1FQJA 1C1YA 4BEJA 1VRVA 3SYTA 1GGHA 1VZ3A 4RFSA 4YJFB 4WNAB 2PNFA 3TIGA 4AG6A 2HLPA 3BXOA 3FCYA 1HPLA 1WCIA 3A1CA 1EUZA 3NEAA 4K2HA 5FL3A 3U7QB 2JFBA 2HU5A 1SBZA 1P0CA 3ESRA 1Z0SA 4YYZA 1TT7A 2G09A 4ZPJA 3TAUA 1OU4A 4RY2A 4EG1A 3HZZA 2ZUCA 2HIGA 1GNSA 1GZ4A 5EFOA 4DIFA 3OLVA 3KWJA 4IXMA 1ES9A 4K8OA 5DVZA 2RG1A 2NXNA 3ZBTA 4EMSA 1XL1A 4ZXPA 2K2WA 3T3MB 1P75A 1OGJA 5IF9A 3GAMA 3LYHA 3QBVA 4KN9S 4C7VA 4AMZA 4LJ7A 4LF7B 1V11B 2RI1A 1QJ4A 1GPYA 1MX1A 2EBHX 2VEDA 3VUEA 1MB3A 3DAHA 3I39X 1DWQA 1N1DA 4FYMA 2IXTA 1Y8CA 4FDUA 2PD3A 1VJDA 2PK3A 4TKMA 4Y1EA 3IPYA 2FN9A 5HOQA 2C7RA 3AR9A 1NZJA 4OD0A 4RNCA 2FWIA 4RXMA 3U1VA 5JBIA 2JH3A 1E5VA 4RVOA 5K0SA 3BXEA 4U7DA 2OG1A 1AQJA 4CLRB 4G0XA 1RWKA 2YYSA 5NLLA 1E3IA 1X2EA 1RXCA 3FBTA 4GQIA 4N8EA 4URVR 3OTHA 4RIHA 4PR0A 5F1YA 4TPKA 1I4LD 1IY2A 2AIRA 5LZ7A 1M8KA 1VPWA 3E0QA 2O8EB 3AR5A 4A8HA 1XKQA 3RUFA 3VR3A 5H59A 5CLHA 4J76A 2R1UA 3HTXA 3RSOA 2XWQA 4EO4A 3GUZA 1NPDA 1TXGA 4BKMA 2X9NA 3F5MA 1NVMB 4BJHB 3X1ZA 3QG5A 1TJPB 4POOA 3GB9A 2J4FA 1BS2A 3D8RA 3N2KB 3QPCA 2FUKA 1GUAA 1N7GA 2XNHA 2WZDA 3FKJA 3NJ8A 4N18A 1F38A 3IEXA 4RPLA 3AP3A 4LDPA 4GPIB 4XZ3A 5JT1A 2IKQA 4AFNA 4YAJA 2CLEB 2OP0A 2TMYA 2AVDA 1MEOA 5L3SB 2MSKA 3I6YA 1SNYA 2LWIA 3C4VA 5FTMA 1R9NA 4CE6A 2C03A 1NG9A 2O1SA 3MQFA 4HOYA 1CSEE 1EBUA 3S55A 4ZEVA 5CEFA 1I3OA 1SHJA 2I3AA 1QR2A 2AD1A 4KC0A 1PLLA 4PICA 3TQFA 3W79A 3F6SA 1G6OA 1DBIA 3IPRA 1IUKA 4BQRA 3NMUF 2BHLA 3EMDA 3VMFA 1QNLA 2QLBA 4LRWA 3GJ6A 1XTUA 1I7QB 4MI1A 4QJ3A 3AOEA 1J42A 4QT0A 5CHEA 5GMOA 3GLFE 2VTEA 4KN6A 3NHYA 1DBWA 1P33A 2NSJA 3NHWA 1VZ2A 5FI1B 4E4RA 1I4EB 1KVSA 2HQOA 4GYKA 4WXPA 2QORA 3K9CA 3WL8A 4TMVA 5E38A 4EG0A 4ANFA 3PIDA 4RMGA 5TQ0A 2JAXA 3RARA 1D04A 3EFOB 3VH2A 4YAEA 3UAYA 2X3UA 3NTRA 1PNTA 3DC7A 2P2NA 2NIPA 1OT3A 4CMAA 3NUGA 1NYTA 3U61B 1B6RA 1ZJ4A 3OJ0A 4KSYA 1HTTA 1ZCJA 2WLTA 3EVBA 2ECOA 2JK1A 1W36C 4PIMA 1IONA 1WXQA 6LDHA 4RDHA 1CUZA 1U3CA 3LT5A 3DKKA 3I9NA 1ZAKA 3PC6A 1HLFA 2O20A 2X1LA 2C1XA 2Q6TA 4NMHA 3ZX5A 4B8ZA 1ZM9A 2QV7A 3CF4A 4BO6A 4EEZA 3ENKA 4MLCA 4FHEA 5FBWB 1LSSA 4NLLA 3PUJA 3A25A 4BX2A 4CFYA 2XNSA 2JLXA 4RQTA 1GNLA 3EIFA 4YLEA 4P81A 1TK3A 3KDAA 2HMUA 3MPOA 4JIGA 5JG7A 1E1QA 3WIBA 3N7TA 2C58A 2HC9A 2HU7A 3KPVA 3A1EA 5MN4A 2EKZA 4WVFA 5HA5A 4I4TF 4NPHA 4HNUA 4CL0A 2D1TA 5HK9A 2FEKA 2NWQA 1WPXA 3AFMA 3KVOA 2PGIA 4F45A 5DWVA 4TUYB 4AYTA 1ETHA 4UZSA 2XNKA 1C3JA 4BP3A 1T1JA 3I5MA 5ALXA 3WBKA 4JL8A 5CNKA 1P5JA 2QX8A 3I23A 8ADHA 3G1WA 3L0BA 1WW8A 3RC8A 4K6FA 3QKSB 2GD1O 5FKJA 1FTYA 3FYTA 5A62A 1NPYA 5I7OA 2G06A 2BD0A 2XDYA 5TVKA 4MRVA 2H9AA 1PSDA 2IH5A 2WWVD 3IPCA 4B79A 4BB5A 3PWZA 4UHFA 5BV1A 1A9XB 4ZCIA 4URXR 4WK0B 5HCUA 3PUIA 1YVUA 2IL1A 1VHLA 4V0OA 3ONNA 3ABRB 1NW3A 1XQ1A 3D1VA 4O4IF 3TRJA 2OGZA 1KDPA 2RH8A 4BQNA 3GJ7A 3DEHA 5JV5A 1Z36A 4OJQA 2ICAA 4B3XA 3NM4A 2RGAA 1UMKA 3CTPA 2EVWX 4UTRA 2QPLA 3W8NA 2IPNA 3X1JA 3EAFA 2WWIA 3KYCA 1SK9A 4JI1B 4MS1B 4QBHA 1H93A 3KVRA 3LCJA 4PLZA 4B3FX 4WLNA 1V4VA 1WD7A 2VQDA 3NHAA 4QUKA 3KAJA 5FPSA 1VM6A 2PMDA 5EUCA 1W4BA 4OMFG 3M9LA 4I1IA 4BMOB 4ZVPA 2QL9A 5DM70 1ZLXA 4HNHA 1ZWLA 4JSYA 4ZCPA 2OCPA 3L8ZA 1Q1AA 4FR2A 1FCJA 3I12A 4KITB 1CZLA 4LK2A 1AMOA 4KGXA 3CVVA 2OAQ1 4J43A 4BQEA 2VWPA 1ILWA 1E2EA 2CLIB<