3BHJA

Crystal structure of human carbonyl reductase 1 in complex with glutathione
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
275
structure length
275
Chain Sequence
SGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human carbonyl reductase 1 is an s-nitrosoglutathione reductase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Carbonyl reductase [NADPH] 1
total genus 103
structure length 275
sequence length 275
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2007-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bhjA00
4OSPA 3JQ8B 3AY7A 2WE7A 3DZFA 2AG5A 1E1LA 3DFZA 2J3IA 4DRYA 1JW9B 5A9TA 3NYWA 1XEAA 1FDTA 1NVTA 1C1XA 1E1MA 2XAAA 3F6YA 3EUWA 3I3OA 3LC7O 3VOSA 3Q3CA 4TMFA 3QVWA 2J8ZA 3PZBA 1PGQA 2LDXA 1R4MB 3JD0A 1UP4A 4DQUA 2VZ8A 3D4NA 3A9WA 5JYEA 3B20A 1UZMA 1ENZA 3GEDA 3DBVO 1FXSA 1H0KA 1U7TA 1HSOA 3DBLB 3HN2A 1W4ZA 2X22A 2HSDA 4J4BA 3PHGA 3DZHA 1MFPA 3UAGA 1U3WA 1MXHA 7MDHA 5K6AC 3PDUA 3GEGA 1XYGA 4U5QA 3KTDA 2PV7A 4J4HA 3SVTA 4N5NA 1NQOA 5LDHA 2VHVA 4U8GA 3GQVA 1EUDA 4J1NA 4Z3DA 2V65A 3H4VA 1BVUA 3RFVA 4AJEA 2HMSA 1P1RA 3ETEA 3ZNPA 5K6AA 3KV3O 1DHTA 4IZHA 3GFBA 1YONA 2CDCA 5A06A 1Y9AA 4IDGA 5TLSA 4Z0PA 1F8FA 1WDMA 1KVRA 1GFSA 2O3QA 5BR7A 1LRJA 1Z7BA 4YJFB 5I8WA 3ORFA 2BGLA 1PR9A 1XKQA 2Q4BA 1MUUA 2QRKA 2TMGA 3CINA 3OJEA 5LC1A 2ZTMA 3AUTA 2X5OA 3G3EA 4ZN6A 1R66A 2IXBA 3RD5A 3LF2A 3I23A 3F9IA 1GAEO 4KWIA 4OGWA 4UAGA 4ZQBA 4L4SA 1NP3A 1SB9A 4J9VA 3QWAA 1ENPA 2O2YA 3ZU5A 1QSGA 3O8QA 3WFIA 1PX0A 4RVUA 1SOVA 3L4SO 1B14A 3DBRA 1P33A 1N92A 5B12A 5CG2A 3SXPA 3U09A 3S2GA 4B7CA 1P3DA 3EAGA 3ROQA 5A9SA 4EGFA 2NADA 3PGXA 3ZZNA 3Q9UA 5DBFA 1ARZA 3WS7A 4NBUA 3ABIA 4XZ3A 1T1SA 3PEFA 4DIBA 3TL3A 2VT3A 1LRKA 1N9GB 3I52A 1SB8A 2RAFA 1VM6A 3GVIA 4OXYA 3C24A 1YDEA 1T2EA 4R4JA 1FDSA 5A03A 1W73A 3E8XA 4DPKA 4QECA 1KC3A 1P9LA 2IRWA 2YZ7A 3JYNA 1I3MA 3DZKA 5A04A 4ZD6A 4OAQA 5IF3A 4FJ1A 1PQPA 2YFHA 5TX7A 4PZDA 4YT8A 1U8FO 3DTYA 4K1LA 3V2UA 4WCFC 2Z1NA 4QFCA 4J49A 2A4KA 3C1TA 3TZ6A 3VH4A 4RVDA 3ZWXA 3WQQA 4B3IA 4CR6A 4OYRA 1Q2XA 4BNMA 4I9HA 3U3XA 5JY1A 1EUCA 2QZZA 2YDYA 2IODA 2GASA 4GVXA 2D8AA 3ZW9A 1ZJYA 4WOKA 3LT0A 1NVMB 1PGNA 1GZ4A 3DEYX 4ZVVA 3PJGA 3ETDA 2X86A 3OECA 3L4BA 2OP0A 4J6FA 4FJ2A 3MWDB 3SLKA 5B1YA 2CD9A 2Y1DA 3MZ0A 4I5GA 1PL6A 1TXGA 1YE3A 2NQ8A 4CM4A 5IG2A 1WP4A 4CMBA 5A5EA 4J16A 2I5PO 4DBZA 3G17A 5ENVA 2GZ3A 4E0BA 4GMGA 2NVWA 2I76A 3LYLA 1D4FA 5CDTA 1HRDA 2HO5A 5KTKA 1YBMA 1YB1A 2D5CA 4A0SA 1FDVA 2DFDA 4OKNA 1R12A 2JFGA 3VVCA 3WBBA 1YOVA 5DDIP 3FWNA 1OC4A 1ONNA 4O1MA 1R0KA 2JD1A 2AQ8A 3OETA 5F1PA 1NFFA 2BI7A 4YJGB 1C0PA 2W4QA 2C7VA 3GNQA 3DAFA 4C7JA 5A4DA 3DOCA 1S7CA 3KSUA 3EDMA 1GV1A 3CXRA 1ZMOA 3T4XA 4W99A 4YB8A 2YV3A 2AEMA 1BSVA 2ZB4A 3OQBA 1LI4A 5C37A 4LVCA 2BF7A 3TFOA 4U0KA 3QVTA 5I9NA 1GEGA 1GYRA 4QUKA 1I10A 1HDYA 4DA9A 3EVTA 2UDPA 3INGA 5EESA 3OBBA 3FWZA 3FBGA 2ZYGA 1LSJA 2CVZA 3OF2A 2FY8A 4FN4A 3WTBA 1DFIA 1E3LA 3KVOA 3NT2A 4DMLA 1KC1A 3UW3A 1R0SA 1LNQA 3GRPA 1LC3A 4PN3A 2RCYA 1H6BA 1YO6A 2E82A 4NJOA 4Y8VA 3TQHA 4WLOA 3HZZA 2EKQA 2X0NA 3PYXA 3SLGA 4YYZA 1NXQA 3T7EA 1RWBA 4BV8A 1X7GA 2Y1OA 3H7AA 4TVOA 1Q7BA 3WGZA 1QYDA 4WCFA 2NWQA 4BV9A 4IQ0A 5KJ6A 1M75A 2I3GA 1H93A 1B0AA 2DM6A 3INRA 4I9UA 3RC9A 1PSDA 1F17A 2GZ1A 1MG0A 7ADHA 3PDJA 4RPKA 3LU1A 4FDAA 3W4JA 1YL6A 4F6LA 4A03A 4EUHA 2B4RO 4FCCA 1VC2A 1YQDA 4QFDA 3RQSA 3NTOA 1U3TA 1G1AA 4E5YA 1CIVA 4DC1A 1WAMA 3JD2A 4IDFA 4CV0A 2BFAA 2J6IA 3GMDA 1FMCA 4NBTA 5BQFA 4ID9A 2C59A 4IDBA 3BYZA 2XPCA 2JCXA 3QWIA 2DTXA 3H9EO 3ULKA 3HFGA 1LLCA 2VHXA 3PTZA 4AJNA 1RYEA 3WJAA 4KUHA 1XDWA 4RDHA 3JQEA 4XD2A 3SBOA 3IOYA 2QYTA 1QP8A 3QIVA 2EWMA 4D46A 2POQX 2YJZA 1RYDA 1DJNA 4ND1A 3C7DB 3HADA 1P45A 4ZU3A 3ZWCA 2J3HA 1M6WA 1PGOA 1F0YA 1NM5A 3M2TA 4ND3A 4GX2A 4LCJA 1D3AA 1QV6A 3UN1A 3VPGA 1LDEA 4PG4A 3VH3A 4PLFA 2HK8A 1KERA 4BNYA 4TWRA 4AJKA 2O7SA 2YHIB 4TRJA 2PFGA 1EK6A 4YBZA 5JXWA 3OJOA 5HA5A 4EITA 3P2OA 3ZV3A 1SCUA 1DC6A 4FC7A 4O59O 1YOVB 1QORA 5K0ZA 4XA8A 1ADCA 1V3VA 4J90A 1QYXA 4D3DA 3PZRA 2PGLA 3FI9A 3STHA 1I3NA 3JQAB 2X1HA 4NJMA 3PFWO 1A4IA 2E4AA 2X9VA 2Z1MA 4FPXA 3D7LA 1QG6A 3Q1LA 1ADFA 3LDHA 2PA3A 4B4VA 1MP0A 3Q0EA 3PJDA 1E0DA 1Z75A 4BNHA 1S6YA 2JCYA 3HDHA 2DQ4A 4RPLA 1OC2A 1WNTA 1HYEA 4HY3A 5JMWA 4GVLA 1VSVA 4HBGA 4XR4A 1E3EA 1ZZEA 4FFPA 3Q2KA 3WNVA 5L4SA 1E5LA 3JQ8A 1VL6A 2ZK7A 1DLIA 3BA1A 4AJOA 3S2FA 4A5OA 5JDIA 1X1EA 3AJRA 3KRTA 3A14A 1C0KA 2CUKA 1Y6JA 2ZCUA 1ISGA 3DOJA 3H5NA 3KYDA 5L7WA 4BGIA 3ZWMA 2P2SA 3IKVA 1RJWA 1T1RA 4G5HA 4L0QA 3I9KA 1DB3A 1UZLA 2Q1WA 4NDNE 2YV2A 4NQZA 2D5AA 3Q11A 2ZB7A 4OQYA 5CEJA 1BWSA 5JC1A 4E33A 4E2YA 3H2SA 1DRWA 4CMEA 1RM0A 5FFFA 1MC4A 5CHEA 2Q3EA 1HZZA 3PGJA 3KBOA 4YXFA 1LJ8A 2XF8A 1CRWG 3N74A 3HDQA 5DCYA 3NT4A 4A26A 5IDXA 3DHEA 3U62A 2PGDA 4H16A 1U8XX 2FOIA 2IDZA 3GDGA 4JBGA 1PJLA 5COBA 5JPIA 4I8XA 6ADHA 3D1LA 4CM8A 1I36A 3VH2A 4BL5A 4MP3A 4EBFA 3ANNA 4G2NA 1FJHA 2GUGA 2Q2VA 4YWJA 3GZ4A 2VZ9A 3VDRA 3BMQA 4BNWA 4OL9A 4DLBA 4KP7A 4I5FA 2G82A 3LF1A 4QO8A 3RUHA 3WMWA 5BSEA 3G0OA 3PFFA 4FSHA 4D3FA 3WDSA 2WYVA 5T8KC 5L3ZA 5CEFA 4XX0A 2D59A 2C7GA 3I5MA 4E3ZA 2E48A 3COSA 2ZATA 4R1SA 1E7MA 3ZU4A 2B4QA 4I5DA 4JIGA 5JY6A 1T26A 1XA0A 5MDHA 2Q1TA 4WLNA 1E1NA 1ZKMA 4JROA 5L4LA 4RF2A 2NSDA 3H9JA 5ES3A 3FR7A 4R01A 4S3MA 3BIOA 3SX2A 4CM1A 4M55A 1T2DA 2PZMA 4I5EA 1DIGA 3FRJA 1A7AA 4DYDA 1U3VA 3WLEA 4DQXA 3RAJA 4LRTB 4XYMA 3VDQA 3NRCA 1J6UA 5C7OO 3ETGA 3T4EA 5TIIA 3OJ0A 3D3WA 1HDCA 3RUDA 4ZQFA 4QQRA 4FFMA 3IC5A 4MP6A 2YY7A 2OMEA 1XU7A 3E9NA 4RLSA 2PZLA 5IXSA 4CR8A 1KS9A 4XIJA 2OUIA 5DP2A 5A05A 2DPHA 1UXGA 4ZICA 4XJSA 1WVGA 2RIRA 5CAEA 1P1JA 1MXFA 3K6JA 3PI7A 2GERA 4TQGA 1MA0A 1QXSA 1SZJG 2TMDA 1E7SA 1TA4A 3R0IA 2VWGA 3QWHA 1ZUD1 4XR9A 1W0CA 1HXHA 4GBJA 4R68A 3D4PA 3H8VA 4LISA 4NMHA 4QXMA 1C3VA 1OOEA 3OJLA 4RF4A 1GCUA 2VHWA 2Q49A 4MOWA 3DZJA 3IJRA 4PFJA 1PEDA 1BMDA 1P74A 1ZK1A 2C07A 4BB5A 3WR5A 4ZA2A 2Q2QA 4JCOA 1C14A 2UUPA 3VKVA 1E6EA 3TZHA 1W8DA 3K2EA 1DXYA 2NTVA 4OMUA 4IS3A 4KOAA 3LLSA 4HFRA 5GZ6A 1GYQA 2ZYAA 4MVJI 4TKMA 2P9EA 2BKAA 4XIYA 4LMPA 2HMTA 4AL4A 5FF9A 2H9IA 2OBYA 3WX0A 3QJ5A 3VZQA 4BNIA 3ROPA 3V1TC 2W2LA 2GR9A 4JJGA 3DBHB 2Q1UA 1TVEA 4M54A 3E48A 1DPGA 1E77A 1NQ5A 3OHSX 2DBZA 1NTOA 3OH8A 3W6UA 4MVJF 2UAGA 2EG9A 3GVPA 6LDHA 4L74A 3C1OA 1E5QA 1LQUA 3H9QA 5TF4A 2H5LA 1XLTA 1DIRA 3LLVA 4ITUA 5CP8A 1Y1PA 2PH5A 2Y0EA 4TRNA 1HE2A 2G1UA 4XYGA 2VTEA 3WSVA 3A1NA 4BO4A 4JGBA 3MJTA 1O6ZA 5IZCC 3GGOA 2C5AA 1F8GA 3KXDA 1GUZA 4OH1A 5ADHA 1E6WA 2AEJA 4UVEA 4WKGA 4RVSA 2RBEA 3GT0A 4PRLA 4KTTE 4UREA 1H6DA 1A71A 1DHRA 3HHPA 4XWYA 3X2FA 3JQCA 5EIOA 3ZWWA 1E7QA 2EEZA 4TZTA 4IDCA 1LDNA 3W8DA 3OICA 4CQLB 4NJMB 3WIDA 3KUXA 3GUCA 4PRKA 1EDOA 3GGGA 2EV9A 3PLNA 3ZWBA 4L4XA 4B4UA 3OJFA 4W9NA 2PZKA 3MWEB 4RV9A 1VL8A 4CM8B 1P31A 3UCEA 4PG5A 5KJ1A 3NTRA 4EEXA 5CEEA 3IMFA 3DTTA 4DPMA 2JAPA 2C5EA 4UUNA 2BD0A 4J7UA 5LDGA 1NHGA 3PYLA 5JAQA 5JDCA 2EERA 4CMIB 4BMNA 2PD4A 3X2EA 4A7PA 4Q3NA 3NTQA 4NZ9A 3JYLA 3HUDA 4ILKA 4JX8A 3RROA 4CQLA 3IAHA 4PGFA 1UH5A 4IZIA 1U5CA 3CMCO 5GZ3A 2R6JA 1YS4A 5U4QA 3RVDA 1NR7A 3TJRA 2AQKA 4MVJA 4IBOA 4RQTA 1UDCA 1UXIA 1LA2A 4JN6B 4K9DA 3WYCA 3IKTA 1SMKA 3I1JA 4KMSA 2FPGA 2HKIA 3OA2A 4ALKA 3H3JA 4YJDA 1PTJA 4BNFA 4IJWA 3ZWAA 1C0IA 2Y67A 3A28A 3BHJA 4JK3A 1HETA 5DN9A 1OI7A 1HE4A 1H6AA 5B37A 2QHXA 2OHXA 4BNXA 3RKUA 5DT9A 2WD7A 4GH5A 1FDUA 2DU8A 3JQBC 3M6IA 5EQFA 1I2BA 3C8MA 2JHGA 3DB2A 3GVXA 3PHLA 4IUYA 3AOGA 5G4LA 1QMGA 4UULA 2PLAA 4J4TA 3U4CA 4OIMA 5J23A 3VKUA 1V6AA 2PKQP 3BMQB 5C7LO 1FK8A 1NWHA 1ZSNA 4OOEA 3DBLA 2X0JA 5CDSA 4IGEA 2AG8A 5LCXA 2X6TA 4P4LA 2CVQA 3QSGA 1RM4A 1NQTA 1J5PA 2B5WA 1CJCA 1CQIA 2A92A 2QIOA 5IJZA 2HMVA 2QZ9A 3EZLA 5EMHA 1T2AA 4DREA 3RBXA 1NFQA 4ZQGA 3WYEA 3ZN2A 2QG4A 3FNHA 2VHZA 3W4KA 2F00A 3DZIA 4HV4A 3PYMA 5DP1A 3FNEA 2W2LD 2EKPA 1NFRA 3WGTA 5BT9A 4B8WA 1BDBA 3U49A 1DO8A 1NASA 2ZB3A 4URFA 2BHLA 1GUFA 1A27A 2NTJA 3UOGA 5L51A 2OGUA 1QR6A 4PCVA 2Q1SA 2PGJA 1DC3A 5EQDA 3ZWPA 4P22A 3D0OA 5HRUA 1R15A 5ER9A 4IDEA 4BO2A 2H63A 3VZSA 1LBEA 4H15A 3JQFC 3RSHA 3D4OA 4D79A 2B0JA 3F47A 4KUGA 1AGNA 2P5YA 5T5QA 3EY4A 3TOXA 1ULUA 3CPSA 3OQ1A 4W9NC 1C1DA 1HLDA 2EP7A 5CDYA 1HEUA 2AQHA 4ALLA 3GVCA 1U1IA 1Y8QA 3D5QA 4NU6A 3GNSA 1Z6ZA 4WE3A 2WTBA 3PRJA 3E5MA 2YQ5A 4XEHA 4R9RA 4YEDA 2V6BA 1Y7TA 2E49A 2EF1A 4IY1A 4F6CA 1A9YA 4E2WA 4I1IA 4AJHA 5G0VA 4FGSA 2OXIA 3TZQA 1HDXA 1D7OA 4II2A 1YRLA 1VPDA 1QRRA 3G1UA 5TT1A 1B16A 5HTOA 5A02A 2P9GA 4BO6A 1PJQA 3AY3A 1LSSA 4R54A 4GWGA 3JV7A 3GH3A 2OOSA 1JTVA 4ALMA 2JFHA 3ZHBA 2AW5A 3I9LA 1YB4A 1DC5A 1Z74A 4MJLA 5AOVA 3TDKA 1TT5B 4X54A 2CFCA 1F06A 5KJFA 1NPYA 4LMRA 2NU8A 2FR8A 3ENKA 3F46A 3MTJA 5CG1A 4MO2A 2BRUA 3QWBA 3UH1A 4YAKA 3B6ZA 3I6QA 1P1KA 3DOOA 3L9XA 4MVJE 2VRCD 4BHTA 3RWBA 2UV8A 4F45A 2B4TO 5HS6A 1GL3A 9LDTA 4JJIA 4CODB 2YYYA 5F1OA 4JLWA 4Q3DA 4FJ0A 4XCVA 1P0FA 2C82A 1PZGA 3JQAA 1ZFNA 3SC6A 2FSSA 3P19A 4NI5A 3PHIA 3FCOA 4OSOA 3DHNA 2YDXA 3ZCXA 4XYBA 1HT0A 1DAOA 1I3KA 4FFNA 4GI2A 2NVBA 5KKAA 4L8VA 3NT5A 1GUYA 3MJVA 2DTDA 2YQ4A 4G81A 5F1KA 1GYPA 2ZCVA 4RPHA 3CMMA 4BQPA 2GCGA 1VJ1A 3P7MA 2YHUA 5G0WA 3V8BA 3WFJA 3DDNA 3OMLA 1EFKA 1EUZA 2ET6A 2XXBA 4OM8A 4BNJA 4O5OA 2ZTLA 5G4KA 5ITWA 1UP7A 1H6CA 4S1VA 4RO0A 2Z5LA 4PLYA 5DF1A 3B1KA 5H81A 3KETA 5U9CA 1ZK0A 5AXCA 4PG8A 1KVSA 3BMNB 1LDYA 4JQCA 1ZW1A 2BLLA 4GKBA 5L40A 4G65A 4GX5A 3GAFA 2C29D 3QVOA 1OMOA 4DL9A 1NHWA 1ZXLA 4OOFA 2EP5A 2B69A 2VCYA 1A72A 2PTGA 3CKYA 2VYND 4KDEA 5COAA 4UVHA 3WWYA 3VZRA 4AFNA 1BGVA 3R3JA 3DO5A 3ASUA 1K6JA 1NR1A 2GZ2A 4A10A 3ZHYA 3L07A 1ZK4A 2C2YA 3GZNA 5BNFA 4YPOA 4XYEA 5I9MA 1PJ3A 3IIEA 2PKQO 3AUSA 1KVQA 2RH4A 1XWFA 1HE3A 3AUUA 5DBGA 5DULA 4BNNA 5A5FA 3JCZA 3E03A 3BTVA 4YT5A 3ZU2A 3H9UA 3ZNNA 3CSDA 1NAIA 3WSWA 5A3VA 3K96A 1VJTA 5HM8A 3GC6A 3ICCA 4K28A 3BXXA 4L73A 1EQUA 3NKLA 1L7EA 1A9ZA 2NACA 4NBWA 3VPHA 4FFLA 1IPEA 1ISMA 4RGBA 4D3SA 4WPGA 4BGUA 1WDKA 4YAIA 3K92A 1HWYA 1K5HA 1GZ3A 4WLUA 4Z9YA 4UEOA 4WCDA 4BNLA 5F5LA 4CLRA 2VRCA 5L4NA 1LDBA 1SPXA 2DKNA 3VC7A 3JQ7A 3TNLA 3H5AA 4EZBA 4NR0A 2ILTA 2R00C 1A5ZA 1B8VA 1BXGB 1C1DB 3WG9A 1NYTA 5TSDA 2GD1O 4YAJA 4M89A 1Y8QB 1ZMTA 1EZ4A 5I7SA 3L0DA 4NPCA 3GUYA 4MIYA 1WMBA 3U4HA 1N7GA 3UXYA 4KQWA 4YJFA 4WASA 1SAYA 2GF2A 2P4QA 1MC5A 1U9JA 1D1TA 1EE2A 1X7HA 3EK2A 3CTMA 1ADGA 5I8ZA 1NPDA 2WE8A 4DWVA 4GL4A 4CLDA 1U2GA 5ENDA 3UGKA 4BKPA 1JLLA 3QW2A 2NU9A 2NVUA 1I24A 2I99A 3PQFA 2EJWA 2VWPA 1Y81A 3F4LA 3O9ZA 2P9CA 2G17A 1KY4A 2HCTA 1I8TA 1I32A 3F5SA 4CLXA 1EDZA 2P5UA 1P1FA 4KUEA 1PQUA 5DOVA 2I3AA 2FN7A 3K31A 4W4TA 3TFQA 3AM4A 2A35A 3DC2A 3U9LA 5IN4A 1PJCA 4YRBA 1D8AA 1KY5A 5H83A 2NM0A 2C20A 4M86A 1BHSA 1Q0QA 2FP4A 1MB4A 1HTBA 2D2IA 2HUNA 4GSLA 1Y5MA 1QYWA 3BMNA 3FD8A 3G79A 1E1KA 3WJ7A 4RORA 3ZNOA 1M6HA 5JCXA 1GY8A 2O50A 1F14A 3DAPA 4YCAA 2HK7A 3NDJA 4NFYA 1JQBA 3GN1A 4HXYA 3DZGA 3WGHA 3AFNA 1ZJZA 4LK3A 4FW8A 2DTEA 4CMGA 2VNAA 2AHRA 2CZCA 3NDRA 4E5MA 3L77A 2VUUA 3B70A 2VRBA 4BIIA 1WMAA 3M1AA 2DVMA 3TRIA 3R6DA 3VVBA 2HRBA 3JQGB 2J5RA 3WGIA 3V1UA 1PS0A 3RC1A 4A2CA 4DYVA 4PLVA 2P91A 2CY0A 2GN8A 3W4IA 2RHRA 4QO7A 4BQRA 2BMAA 3UUWA 5FI5A 4E4YA 1ONOA 1DBVO 4E12A 1HZJA 4UUOA 1WLYA 1SO8A 2ZJ1A 4U7WA 1B8PA 4UEKA 2VN8A 2DUWA 3PLRA 4Y67A 2W2KB 2JL1A 1I3LA 2Q4EA 1E3SA 3RUFA 4R16A 1SEPA 3I6IA 4Q9NA 2O4CA 4HP8A 4R5HA 3HB4X 3JQGA 4ROSA 5JO9A 4MVJD 1H9AA 2H6EA 2AQIA 2HQ1A 2IYOA 3I9JA 4NNJA 4WCFB 3GPIA 3I9OA 4WOJA 5KOIA 1TEHA 4XB2A 1E6UA 1BXZA 2NNLD 3I4FA 3RC7A 4R5MA 3TZKA 2XXJA 2O3RA 4UVIA 5G0TA 3W8FA 4RDIA 1TB4A 1NBOA 2G76A 2I67A 1I30A 4AVYA 3BZUA 3O26A 2AMFA 2J5QA 3K9QO 3E82A 4BS9A 1YL7A 2D1YA 3PVZA 2CDAA 2Q50A 1HDRA 1ENOA 3ASVA 3RCBA 4Y9DA 3GRKA 1SEVA 4Q3BA 4BNZA 4CR7A 2IEBA 5I9LA 4CQMD 1WXDA 1PZEA 2QQ5A 2NU6A 3OIGA 4L4RA 4IMRA 4BUCA 2O48X 4HNHA 3GK3A 1JKFA 1PGPA 4HUJA 3S8MA 1ZSYA 4LCEA 2HK9A 4KDFA 4F3YA 5JSFA 4CUJA 5L9AA 1Z7EA 2GN4A 1E7YA 2FPPA 3H2ZA 2GLXA 1PIWA 2VYVA 1U3UA 3IP1A 3ZV5A 5KWEA 4E6PA 4J7CA 1EVZA 3TWOA 2CNBA 3AY6A 4BNGA 2G5CA 3C7CB 1J49A 4MIOA 1MFZA 4CQMA 1Q7CA 1C1XB 2FR1A 3HNPA 3RU7A 4LN1A 1Z73A 3UCFA 4GWKA 4N7RA 1H5QA 4PLCA 2ZKLA 5TS3A 5JFOA 4Y6RA 3E18A 1YJQA 5KCZA 2BELA 2X5JO 3PK0A 4CUZA 1IPFA 4WK6A 5ILGA 1DIBA 5JNLA 1GQQA 5L95A 1G6KA 2VWHA 4PLHA 4EEZA 3Q2IA 3T7CA 1R4NB 4BO0A 3O4RA 2W2KA 2PZJA 4IQGA 1EE9A 4NHEA 4ZQEA 5BSHA 3RBVA 3H6KA 4ND5A 3L4BC 1P44A 1LU9A 4CQMB 5AXBA 2LDBA 4MP8A 4PG7A 4IJKA 4RZHA 4IJUA 4AG3A 3M1LA 1UXKA 4K6CA 5KNLA 3S2IA 4BMVA 3K2BA 1H94A 2Q46A 4H7PA 1GZ6A 1SNYA 1TT7A 1X0VA 3VH1A 1JVSA 3LK7A 4MKXA 2WD8A 1JWBB 1HYHA 4CPDA 5THQA 3VAZA 3WICA 3WYBA 5L7YA 4CLOA 1KEUA 1WW8A 4FFRA 1R4NA 4PLZA 2CF5A 3MJ4A 4JP2A 5AXDA 2XOXA 5H82A 2Y1CA 4FIZA 1G0OA 4ZGWA 1IY8A 1R37A 1DRVA 3EW7A 1N2SA 4DBVO 4DIOA 5JW6A 2FZWA 3AM3A 3PHHA 1DFHA 1AUPA 4PVCA 3NEPX 3QE3A 4GAEA 4B4WA 4DQVA 4XQCA 2VQ3A 1BVRA 4L76A 3BHIA 4HKTA 1LRLA 4WJZA 4CLEA 5THKA 2WMDA 2C2XA 3C85A 3B1FA 4YA6A 4IXWA 4CLOB 3QVSA 3E6AA 9LDBA 3L9WA 5F3RA 4RJTA 1B3RA 1W6UA 2BGKA 2ZQYA 3OFSA 4MPDA 1V3TA 4QT0A 2WYWA 3WGQA 5BNIA 2F1KA 1GTMA 1EFLA 1ZIDA 1E3IA 3CZMA 1O8CA 1P0CA 3FPLA 1KETA 3EVNA 4WNCA 1HE5A 3GA0A 3SC4A 4P8RA 1K2WA 1PWXA 4R51A 1GV0A 4W7HA 1UJMA 4GX1A 3SJUA 1N5DA 4YR9A 2GN6A 3VZPA 5JAIA 4JNKA 4NFHA 2VYVD 4ALJA 4RF3A 2DLDA 3OM9A 1L7DA 4E31A 1I0ZA 2QX7A 3DMTC 4N18A 4QSMA 3TPCA 1AHHA 4CMHA 1Q0LA 1RPNA 2NU7A 4Z0TA 4ESOA 1JDJA 1Z45A 3ZI0A 5TC4A 1U5AA 4RPJA 1K0UA 3FR8A 3QA9A 5ICSA 3H5RA 4IPTA 2RHCA 4GLLA 3ZH2A 4BB6A 1VKNA 3WOHA 1PJTA 4PLWA 1M76A 1F12A 3AI1A 4DGSA 4AJPA 3EMKA 1XG5A 2RH8A 2V6GA 4CMIA 2HU2A 3IL2A 2DAPA 3TZCA 1ZK2A 3WMXA 1HYGA 2PWZA 5KVVA 4YQYA 3F1LA 4D0SA 3FF4A 3E9QA 1JAXA 3ZV4A 4MVJP 3OA0A 4XB1A 2IZZA 4ZRMA 1XHLA 1WZEA 1PWZA 2UVDA 3VPXA 4D7AA 2O3JA 4NK5A 4XDYA 5JLAA 5FWNA 2YHIA 8ADHA 4LSWA 2VWQA 5TRTA 5GZ1A 3WLFA 4WLFA 1HL3A 3PP8A 1Y8RA 2B35A 1IOLA 1GPDG 3IP3A 4J2HA 3R1IA 3WQRA 5ILOA 3OEWA 1ZVMA 3UVEA 5A1TA 3K8ZA 4BKOA 4O0LA 2JAHA 3TN7A 3JQBA 4IS2A 3TL2A 3KEQA 4K26A 3ZWNA 3MJSA 5HS4A 4IJVA 3L6EA 2JD0A 3RUEA 4B3HA 3NV9A 1ZK3A 3RU9A 4EW6A 3UICA 1Z82A 4J1SA 4AJJA 3KHUA 2Y93A 1HSZA 1O89A 4RPGA 4FFOA 3OQ6A 3PXXA 1X15A 3PIIA 2JJYA 1JKJA 3E9MA 4II3A 3PJFA 3L6DA 4FQ8A 5DZSA 5AVOA 4Z9XA 3ROKA 1ZXBA 1MV8A 4L75A 2Y66A 4E13A 1PGJA 3KOUA 2BI8A 3MCVA 3PIDA 4INAA 4XRRA 3V2HA 4EUEA 1BRMA 1TLTA 1ML3A 3BMCB 3VTZA 4GLOA 3H65A 3MOGA 3GNTA 4MVJG 5C3MA 3U4IA 3H3FA 1V9LA 1VLLA 4QX6A 4J43A 4YACA 3V2GA 1YXMA 5IN5A 3DMYA 2PD3A 5CFZA 2X8LA 4C7KA 5GY7A 5L53A 4ZHSA 3ZU3A 1EVIA 3C7AA 4CMJA 1YJ8A 2O2SA 4JBIA 1YKFA 1OZAA 4DIFA 4ZJUA 3DR3A 1PZFA 1EEHA 1ORRA 3LSYA 1U7HA 2EW8A 2AA3A 3OSUA 3WB9A 1MG5A 2IZ0A 3QRWA 4FR5A 4J1TA 1X14A 2B37A 3JQDA 2O3SA 1LLUA 3ZWOA 4RQUA 2FR0A 1AXEA 1G0NA 3O03A 4WNIA 3WIEA 3GVHA 4N54A 1NAHA 3PHJA 5B4VA 1V8BA 1I2ZA 1SC6A 4M49A 4CM9A 2CVOA 2VUTA 4TRMA 4R1NA 1NVGA 2VOEA 2EXXA 5I7FA 4MVJM 2IXAA 3KM0A 1HLPA 3A06A 4E2XA 1NWCA 4H3VA 4J9UE 2X0IA 1E7RA 4U6SA 4YJGA 2W90A 4DTIA 4R3NA 1U4OA 3NUGA 4CV1A 4DVJA 1NX6A 1JVBA 4I08A 1DIAA 3DHYA 2WD7B 3ONFA 4BKQA 1EK5A 5JBIA 4PLPA 4BNVA 3QWFA 1KIFA 3WTCA 5T57A 2ZTVA 1YGYA 2DBVO 3S1LA 5TJ9A 3FTNA 4B7UA 4DUPA 4E5PA 3MJEA 4Z0HO 3RJ5A 1QV7A 1QLJA 1QLHA 3CUKA 3RBZA 4KZPA 2NV6A 4A73A 8LDHA 1LDMA 3LQFA 3QHAA 2D3TA 3AK4A 1CEQA 4WLEA 4XRGA 1ADBA 1HF3A 2HLPA 3UF0A 4BGEA 4IXTA 2GRAA 3IDSA 1V3UA 2HJSA 1NPTO 2X4GA 4Q3CA 3UKOA 3U0BA 3BMCA 1XQ1A 4YT2A 1UZNA 2AE2A 4E21A 3WNQA 1IE3A 2A9FA 3D5TA 3K73O 5JMPA 4ZRNA 3GY0A 3JD1A 4YRAA 1ZNQO 4E5KA 5DCUA 4BO3A 1B7GO 2HRZA 3DBHA 1Q0HA 3GN2A 3NDIA 4JP3A 2FZEA 1WDLA 3GEMA 3B1JA 1ISIA 1WZIA 4L9RA 4YAGA 1EBUA 2GSDA 3ENNA 5TQVA 4N5MA 1R6DA 4Z3KA 5T6BA 1KBZA 3GFGA 4O6VA 3UHAA 5B4UA 1HDOA 2QRJA 2V7PA 3E1KA 3WGOA 3S2EA 4RCVA 1LC0A 2X58A 4BKRA 5A9SB 1X1TA 4GGPA 3PQEA 3F1KA 3K5PA 4XKJA 4R69A 4D45A 2PH3A 2GN9A 5EERA 1I33A 3JD4A 4WECA 1PL7A 1PJ4A 2EW2A 1N9GA 4NG5A 1EQ2A 3ONEA 3QLJA 5KVSA 1PS9A 3VPFA 4E5NA 1NNUA 3EC7A 3KO8A 4BNUA 1K3TA 2BFMA 3ADPA 4OKIA 1I2CA 4R1TA 4BO5A 3JQAD 3ZHXA 5DNAA 2DBQA 2X23A 1PZHA 2PY6A 3SJ7A 4A27A 4D41A 5U1PA 3C1AA 4Y6PA 1I5RA 4GGOA 5JO0A 3N7UA 4BO7A 5IXYA 3OEYA 5JYDA 3AOEC 1DIHA 2VTDA 4IQ8A 1Y9EA 4AJ4A 2Y68A 2ZB8A 1V35A 1I01A 1ZCJA 1Q7GA 1O95A 1QYVA 3GPDG 1YWGO 4CMCA 1DC4A 4GKVA 1JN0A 1KEVA 4MKZA 1PJ2A 1A4UA 1UDBA 5BSGA 4YTEA 1BXGA 1KVTA 4RL6A 1D1SA 4B4OA 3FBTA 3CE6A 5FYDA 4W6ZA 2P4HX 3IUSA 1ENYA 3ST7A 1JWAB 4JBHA 3WXBA 2WSBA 5KIAA 1C0LA 1P1IA 2ZQZA 1XCBA 1GQYA 1H9BA 3AI2A 5G0UA 2YUTA 4BOYA 1X7DA 4DMMA 4NK4A 4GMFA 4CM4B 4MINA 3CH6A 4HNGA 1K6IA 1MX3A 2JFFA 1CQJA 3AW9A 4BO9A 1CYDA 4MKRA 1ISFA 3I9NA 5JCJA 3RKRA 1LLDA 5CDUA 5T8KA 5I7VA 3KEOA 3NAQA 1M66A 3GF4A 1GDHA 4ALNA 1M67A 2Q99A 4K6FA 3PWZA 5IFLA 1ZEJA 3GOHA 4CM9D 4KWHA 4LGVA 3BAZA 1BDMA 3RJ9A 1ZSVA 2FWMX 5G2OA 1GPJA 2OO5A 3OIDA 4GX0A 2J3JA 5IZCA 5FEUA 3S55A 1DDOA 1KEPA 1E3WB 2VOJA 4YT4A 4CM7A 4IDAA 5BSFA 3DWFA 4B79A 3JSAA 1YQXA 4HX5A 1E3JA 4CMKA 3AM5A 4U0JA 3KYDB 1JAYA 2DC1A 5JAZA 2AE1A 2JHFA 2OFPA 1GR0A 2FRDA 1PL8A 2VUSA 4LRSB 3INTA 2QW8A 3EGOA 3GMSA 4RVGA 1ULSA 2FHSA 3JYPA 4TVBA 1UXHA 3ADOA 4RVHA 1BW9B 1DOHA 3WBFA 5IDYA 3IS3A 2BGMA 1IL0A 3BTUA 2BFPA 3GR6A 5IZ4A 1BXKA 3FPCA 2O7QA 5G4KB 2EHDA 3LT2A 1E3WA 3JQFA 1ZBQA 1N1EA 4M87A 4EDFA 3QV1A 1JA9A 1H2HA 1TT5A 1OBFO 5TGDA 1CETA 5TT0A 1A7KA 4HADA 3VHRA 4LVUA 2UUOA 4YJHA 4EJMA 1EBFA 5JDIC 3RC2A 5ER6A 4Z9FA 3GHYA 2B36A 2OZPA 1B2LA 1AE1A 4EYEA 3AFMA 3DBRB 4HWKA 2I9PA 2Z95A 3LC1O 2I65A 4TROA 3L6OO 3I9MA 1DFGA 2E6UX 4W7IA 3N58A 3ZGYA 4R3WA 2W8ZA 3BTOA 4IDDA 2YFQA 3HFSA 2Y0DA 3PQDA 1X0XA 2A94A 1L1FA 3FN4A 3PWKA 2PK3A 5AQ1A 2W98A 1IZ9A 3KLMX 4ND2A 1ZEMA 2IZ1A 2BH9A 1RM3A 1YDWA 4I9NA 2WEKA 5ICMA 4DLLA 4WEOA 2JCVA 4Q3EA 3AU8A 2CMDA 4TSKA 2IYPA 2WWRA 4MIEA 2VT2A 2C54A 4AJIA 4XYLA 1U4SA 1T2FA 3TOZA 2DT5A 1YVEI 4J2OA 4RVFA 3I83A 3RI3A 1DSSG 1T4BA 4YVFA 5AXAA 4EJ0A 3QP9A 1V0JA 2Y1EA 4WUVA 4UUMA 3MTGA 5IDWA 1R0LA 2GGSA 5JCJD 1YL5A 5B4TA 1LDGA 2Y1FA 1ID1A 2R00A 1IULA 4BVAA 4OHUA 1B15A 2FSVA 4RZIA 1YB5A 3O8QB 2ZTUA 4HFJA 1CWUA 1VKOA 3F4BA 3LVFO 1ISHA 3DQPA 1VRWA 2Y0CA 3HDYA 1ZH8A 2I66A 3WGYA 4FGWA 4EUFA 4CUKA 5ITVA 4RF5A 4MDHA 3O38A 5DOZA 4IMPA 1SBYA 1IUKA 1YQGA 1DLJA 1R16A 2C0CA 4XQGA 2ZYDA 3JTMA 3H9GA 2OBNA 3OIFA 1H2BA 1UDAA 3BTSA 4CL8A 1GD1O 2AEFA 1T25A 4BNKA 3AU9A 4B3JA 1T4DA 5TJHA 3CIFA 3GLQA 3V1YA 1UUFA 2DFVA 3GG2A 4BNTA 3NJ4A 5KJCA 3KB6A 4IIUA 1SOWA 2NUAA 5A3JA 2EGGA 3QVXA 1LTHR 3JQ9C 2GDZA 1ONPA 2IE0A 4EJ6A 2X9GA 2P68A 4EI2A 3AWDA 3HWRA 4BMSA 3LT4A 4CLHA 1GQ2A 3RIHA 2PR2A 5EJ2A 1LQTA 3GGPA 1U28A 4W82A 4XGIA 1JKIA 2H1SA 4TKLA 4CMAA 4CJXA 3EZYA 1KEWA 2Y1GA 4YJHB 1N8KA 4YRDA 1U2DA 4B8ZA 5IDQA 4XQEA 4AICA 4JJFA 3ANMA 4LSMA 5EINA 5F21A 2DPGA 3KYBA 2Y05A 2B5VA 4NH4A 1K6XA 2EJVA 1O9BA 1WWKA 4KQXA 4CM6A 4Q3AA 2UYYA 4Q39A 1O0SA 2EKLA 1AXGA 1GCOA 1T2CA 2OORA 3IQDB 4IGFA 4KTVE 4XGKA 4ZQHA 1K89A 1B3BA 3AI3A 4XQ9A 1Q1NA 3EHEA 1DRUA 2GNAA 4QEDA 5EN4A 4LW8A 1CDOA 1ZO8A 2HMUA 4OXNA 4YDRA 4AJLA 3GDFA 4XJTA 1IYZA 3HG7A 2NQTA 2WYUA 1XQ6A 2V6FA 1PJSA 3DXFA 3KSDO 1UR5A 2ZIZA 3C3XA 3RUIA 4FBGA 3JYOA 1XU9A 2HMWA 5K9ZA 2CF6A 3F3SA 3FHLA 1ISJA 3Q6IA 2Y99A 3K30A 1IHYA 4Y98A 5F5NA 1O5IA 1LSUA 3DFUA 1OAAA 3ZDFA 1PR3A 2R2GA 3OP4A 1MLDA 2OP1A 4D44A 4E2ZA 4NIMA 1FF9A 3KLPX 1OFGA 3VPSA 3W1VA 4PG6A 5C5IA 3NJ8A 3HDJA 3PWSA 1RM5A 4IIVA 1XR3A 4PZCA 1IZ0A 2SCUA 3ON5A 2VYNA 3RUCA 4OO3A 1XGKA 1WPQA 5EPOA 1VL0A 2DBRA 3W8EA 5EL0A 4U6QA 4HFMA 1HDZA 2PKRA 3BMOA 4FS3A 3ANLA 1KOLA 3ZWVA 4D42A 4YAEA 2B83A 4P4NA 3ITKA 3W6ZA 4AJ2A 5JS6A 3P2YA 2O3TA 3E5RA 3WGGA 1AN9A 3DONA 3D3EA 4F46A 1PQWA 1JU9A 2YV1A 1HKUA 4NBRA 2J3KA 4E30A 3RFXA 4DLAA 3ZWYA 3UCXA 4CV2A 2WM3A 3JQ9A 4CLRB 2QRLA 1RKXA 3RFTA 4Y6SA 4D0RA 1E92A 1NQAO 1LEHA 4YQZA 1XELA 3ITDA 1Y5RA 3LC2O 3HQ4O 5COQA 3U4DA 3ZHZA 1R4MA 3V5NA 1PU2A 2V6MA 4CM3A 4E32A 3ROMA 4ALIA 3FTPA 1BW9A 4XDZA 4AJ1A 3CZRA 3UFXA 1VE9A 1O94A 1GADO 3HN7A 4QTZA 2QYSA 4R41A 1UAGA 1EVYA 3MEQA 3LT1A 1T24A 3QY9A 1GU7A 1HDGO 4Z6KA 2I6TA 3A4VA 2X9NA 3WWZA 4UUPA 2O3UA 2O4UX 5KJEA 3KYCB 3M2PA 4XGNA 4R9SA 4CV3A 2X0RA 3GZNB 2G0TA 4DXHA 2VHYA 3WQSB 4PLGA 4J7XA 2GPTA 4FB5A 2BFOA 2NVUB 3QQPA 1J4AA 1XIVA 4BGVA 4NU5A 1PS8A 1P77A 1GEEA 4N5LA 1VSUA 3R3SA 4CL3A 3CEAA 4OXKA 5L7TA 4UVGA 1LSOA 2FMUA 3DAGA 4GSKA 4CMEC 3HJAA 3GHHA 4GPD1 4UVDA 5DBIA 3GDOA 5IAAA 2JD2A 2ZJ0A 3GG9A 4J0EA 4M1QA 3RUAA 4J91A 1LUAA 1KYQA 3AUAA 4PLTA 1DAPA 2PD6A 4PZEA 4BKUA 1AHIA 1KVUA 3DL2A 4WGGA 3G49A 4IM7A 4WLVA 3JQ7B 3KZVA 5JE8A 2EIHA 4J0FA 1X13A 3PPIA 2X5KO 4DC0A 4R1UA 2WDZA 3IUPA 3TSCA 5CPBA 4NFSA 4C4OA 3MJCA 3BMOB 5T67A 3NGLA 1YBVA 4HFNA 5TNXA 5BNTA 5CPFA 3IJPA 3G1TA 1TI7A 2O23A 5C7IO 5I7EA 1VJ0A 4P38A 4NBVA 2FPIA 2AXQA 4O63O 3TF5A 1P1HA 4WEQA 4D43A 3U5TA 3HB5X 4BO1A 1M2WA 5T64A 3Q9NA 5CDGA 1MGOA 3FNFA 2X7HA 4FD3A 1J0XO 4FOOA 2GYYA 2CSUA 3I4CA 3LZ6A 1Y8RB 2Q2WA 3ZW8A 4P4GA 4J3FA 4M8SA 1IB6A 2VNSA 3D64A 4DPLA 5JC8A 5FI3A 1FDWA 1DEHA 2YW9A 3PJEA 1UAYA 4GQAA 1BTOA 2WJPA 5L45A 3NX4A 4FC6A 3FNGA 4MVJH 2E37A 1E7WA 3KYCA 3BHMA 3D3WB 4OJNA 1VI2A 1DJQA 3VTFA 3ICPA 1B26A 3FSRA 1CERA 4RLHA 3ZV6A 4BO8A 1LLQA 1LXCA 2GO1A 3SEFA 1QKIA 1XSEA 2J5KA 5A9RA 5KVCA 1IHXA 2HDHA 5G0SA 1BG6A 1EVJA 2DUUA 3JD3A 4CM5A 2IEDA 1QYCA 3P5SA 4B7XA 5JAMA 2D0IA 4JXKA 4ND4A 5MGBA 3KSZO 2EGHA 5KKCA 3NGXA 4PVDA 2HJRA 3JQ6A 5GMOA 3ZNQA 2NTNA 2PNFA 1N7HA 3AOEA 3HE3A 4UEJA 1B8UA 1CF2O 1YBAA 4J1QA 1UXJA 4ONEA 2JKVA 1UP6A 2NLOA 1LX6A 1YH3A 5KVQA 4TRRA 3MOIA 3RASA 3F5QA 2CDBA 1N1GA 4TZKA 2Q45A 1PJBA 2VZ0A 3EYWA 4FOSA 3ONDA 4OQZA 2OL4A 5HWSA 2HAEA 3JYQA 1EMDA 5HBRA 3DZBA 5AYVA 3GAZA 5JDCC 3DMTA 2D4AA 3HSKA 4IINA 5DCWA 4PIVA
chains in the Genus database with same CATH superfamily
1EZ1A 1B1CA 1W88B 3HJBA 4BPRA 1Z6TA 4D9GA 2WE7A 3GBSA 5LYJB 4DRYA 5TEVA 5KO2A 2LPMA 1XEAA 4O4JB 1GZUA 1O95C 1E1MA 2XAAA 5AM2A 2AVNA 2D2FA 1EVKA 3HZRA 3UIEA 1FFHA 3VOSA 3Q3IA 4HPWA 2YVKA 1P2BA 3HP4A 4M1WA 4X44A 3QYAA 4LMBA 3HB0A 3PZBA 4KQFA 3TCKA 1PGQA 2XE4A 1NMYA 3RB8A 2H85A 4FKBA 2MYTA 4P86A 2CLSA 1UP4A 3ZQUA 1CYEA 3LP5A 5AI0A 3FIUA 3GEDA 1J9EA 2IOYA 3DBVO 3G2KA 4WW0A 4IRXA 1FXSA 1U0OC 2ZAIA 3DBLB 3FB1A 4QXRA 5LKAA 2QN2A 2P3LA 3OCJA 4NZZA 3QNWA 2WG0A 1YVDA 2PLNA 4B8YA 5K6AC 1NQXA 1ZLYA 2RHDA 3KTDA 1R00A 4J3JA 2DR0A 3Q12A 4U8GA 3GQVA 4B3XA 3C1UA 3A32A 3F67A 4PTYA 1TM5E 4J1NA 1XFDA 2GXQA 4Z3DA 1GSHA 2V65A 1OHHA 3H4VA 2HMSA 2WWVD 3HUEA 5K6AA 2J9ZB 4IDHA 2AJ8A 3EXEA 4IZHA 4WKPA 2LNDA 3TLMA 2CWWA 5HTKA 4BMPB 4YMUA 1HFEL 1Y7PA 5TLSA 3IV9A 3VR2D 3QOFA 5JTUA 1D2NA 3MNFA 5KOHB 1PHPA 4KV9A 5AHKA 2GBFA 3EUAA 4ZI7F 5FDFA 2H7VA 2GUWA 1T3ZA 4QDOA 4WA8A 5I8WA 4HPJB 4K8OA 1XBTA 2G4VA 1F3OA 1PR9A 2Q4BA 2QRKA 3CINA 2TMGA 2AJDA 4QOIA 5AHRA 2ZTMA 4F3YA 1J2EA 5G3ZA 4C3UA 4QD3A 3T9AA 2VXBA 4Q1DA 2I55A 1RIIA 4DV6B 1RYMA 1UADA 5JS8A 2BYTA 4UAGA 2QE6A 4ZQBA 4G56A 1Z5OA 2OCGA 4ZWNA 2FVXA 2GPBA 4H7FA 4R0VA 4J9VA 1Z62A 2JFZA 4L6AA 4TN5A 1ENPA 4KN6A 5IC6A 3LCVB 3WFIA 1PX0A 2IBMA 1Y34E 2TYSB 4MKHA 2PDAA 4JFAA 1SOVA 1IQRA 2PX5A 2WJ3A 3RK0A 1U6IA 1ZGCA 1P33A 3DMNA 2X0EA 2CUTA 4KMOA 1N92A 2X4LA 3OOEA 3H0CA 5KYGA 3ZHSA 2ACEA 5A9SA 4YJ2A 1OB5A 4V03A 3EZ9A 3V34A 2QTVA 3HR4A 3I01A 5DBFA 3Q15C 4WD3A 5LXTA 1ARZA 2JFWA 2UZ4A 3ABIA 3G9ZA 3TQRA 4AY5A 5A5VA 4LCBA 4A8JB 1PW7A 1R18A 2A57A 3TL3A 1LRKA 3KQHA 3I52A 1SB8A 3D6VA 3UAXA 4AG6A 3EXHB 1CX9B 2REOA 2HYDA 1T2EA 4I1YA 2ATIA 1OI3A 3ABQB 821PA 5L6MB 4DPKA 2FA9A 2ZR0A 3H5IA 2XKJE 1KC3A 3RTCA 3SYLA 5J4YA 1I3MA 5E2IA 4AD8A 1SR8A 3EVCA 1ZRNA 2AYYA 2HCRA 5A04A 3BE6A 5GPBA 4FJ1A 3VNSA 5JZOA 1GAWA 5CJPA 2Z58A 1IUNA 4YRJA 4YT8A 5HKKA 3DTYA 2F59A 2BFCA 4CQNA 1DDIA 2C0QA 4MV5A 3BVPA 4XEUA 4A9AA 1Z2EA 1ODFA 3VH4A 3L06A 3ORHA 2NU7B 4AN1A 3WQQA 4B3IA 1Q2XA 2FPRA 2D2VA 2Q0HA 1YMUA 2QA5A 4DSZA 2N1BA 3L7OA 3ZW9A 4C1NA 1G42A 4RZ3A 3D02A 4G63A 4ZVVA 3DEYX 2YXPX 3M6AA 3PJGA 3ETDA 4EHNA 1JDSA 2OP0A 3QKRB 4C4ZA 1R74A 3G7UA 3SLKA 3ID6C 4FBMA 5B1YA 2CD9A 5KOYA 3MZ0A 2COUA 4EY8A 3IAS6 1TXGA 3DXXA 4JITA 4N8SA 2KB0A 2YHSA 2O2DA 2Z83A 1L0BA 1M5TA 2H3HA 3LHDA 4UMVA 5HFJA 3ROZA 3MUEA 2PFKA 4XUDA 4QXAA 3PV0A 1A1SA 1CTQA 1VIAA 2CLMB 1XXLA 5ENVA 1Y42X 1GRRA 2NVWA 2CEKA 2I76A 3TQSA 1Z7WA 2BBOA 2B1JA 2NUPB 3N7TA 2BDTA 1PHRA 1YBMA 1YB1A 2OO3A 3FVWA 3IPLA 1FDVA 3FA2A 4LE0A 4OBXA 4W5JA 5AHXA 3NC0C 3WBBA 4Y9UA 3JWIA 1OC4A 5KZMB 1C4XA 4Z51A 1VLZA 1NJ2A 2AQ8A 4XARA 1C0PA 1HR0B 5BMVA 4G8JA 5FBRB 1QG4A 1ZI6A 3KSUA 1YZNA 4X97A 1IEWA 4DJTA 1GZ7A 4NZPA 3WQHA 4DQKA 1WTAA 1BSVA 4UD2A 5LBUA 5C37A 1G38A 3K9CA 2BF7A 1RADA 3H04A 2NIPA 3SJBA 3OZDA 1Z6XA 1XP5A 2JIRA 2WJYA 3AETB 4GLFA 3W79A 1LX7A 5I9NA 1FCJA 1GYRA 3MJDA 1I10A 1QCDA 1Y3IA 2D54A 2CXXA 2F1HA 4UHKA 1EDBA 3ZXXA 1ZBDA 1CE8B 1S3GA 3RSQA 2OXCA 1FFDA 5CTAA 3OBBA 3JWJA 1QAOA 3OEEA 3ZCVA 1LSJA 2ZE5A 4IV8A 4JEIA 2IXFA 3SYKA 1L5KA 2WTEA 4DMLA 1KC1A 3PG5A 1NF8A 3SNKA 4GNKA 1F8XA 4UMDA 2NPFA 4JUFA 2A33A 1Y3DE 3O3NB 3R3HA 1TCBA 4NJOA 3TQHA 1Y89A 4YYZA 2EKQA 4EG6A 3PYXA 5JHGB 1W4RA 4EPRA 1RWBA 1X7YA 1IH8A 1RMYA 3ZCRA 3DD1A 1JG7A 1X7GA 2RI0A 4UTXA 2DCMA 3AF5A 3WK8A 4IIJB 1WSDA 2GJSA 1YRYE 2NWQA 3LUKA 4WCFA 5ALFA 3T1TA 3R5HA 5H02A 1QMPA 2OCKA 3EODA 4TS4A 3EJWA 3VTAA 5KJ6A 3LL7A 1QG0A 4YPFA 3INRA 1TYAE 3BERA 4QYMA 7ADHA 3CR3C 1MG0A 5TS2A 2Q29A 4IR7A 1HLGA 2CLDX 4FDAA 3W9SA 2FPWA 4U7JA 3ETLA 3C6BA 1YL6A 3IPCA 1DQNA 1G7TA 4PSUA 3RV4A 3LYHA 3TE6A 1QTRA 2OGZA 3K0EA 2OESA 3ORQA 1VL5A 1K8RA 3C8DA 3NTOA 1G1AA 2A5FA 2IX9A 2QDKA 3P0EA 4CV0A 4Z7QB 1V5IA 1NW4A 1SXHA 2W2PA 3EIFA 1NVWQ 3GMDA 3QU2A 4RM3A 1FMCA 1QQBA 4C4TA 1MDFA 1VGVA 5JSQA 4QULA 3UXHA 2HD4A 5CIYA 1QE0A 2VDWA 4KQGA 3QWIA 4OQEA 4H7KA 3TNYA 3H9EO 4E1BA 1RZRD 3VO8A 4JT8A 3R8XA 1YHZA 1YS9A 3WJAA 3IESA 3LOPA 1TE2A 3QITA 4ZYLA 3SBOA 1IONA 1JI0A 3DWGA 3UC9A 3DP7A 2EWMA 5EY5B 2OXTA 4KIFA 2POQX 2YJZA 3P32A 1M8GA 2GXUA 1OF1A 1THMA 2IX3A 3KQTA 2DWQA 1P45A 5IAOA 4E1VA 3QVGB 1BN7A 1PGOA 5G3YA 4ND3A 4B5KA 4JXXA 2RKBA 2QF7A 2X19A 2BM0A 4GX2A 4N6NA 4YJ3B 2M6KA 2C57A 3H6GA 3UWPA 4PLFA 1G60A 2OVFA 3P2MA 1W35A 3MBKA 4TS3A 1ZH2A 2AIRA 2B98A 5JRJA 2PFGA 2WLTA 1S8AA 2XDQB 1EK6A 3EFOB 4J75A 4YXWA 1WHSA 4YBZA 3IHTA 3KT3A 5BWNA 3UMMA 3O84A 3OJOA 2OB2A 1W9MA 2I7VA 2PRIA 3P2OA 4AS1A 1SCUA 2YN4A 1L4KA 4GKAA 3FFAA 1YOVB 1TYEB 4O59O 5DTEA 5LQAA 2BR5A 1ADCA 2IJGX 4L5AA 3X0DA 5AK4A 5H59A 1XEXA 3OTOB 2WKSA 4J90A 1QYXA 1OR8A 1TDJA 1PLJA 3REQB 4EYQA 4FLMA 4LJ6A 3OY7A 1SC1A 2DWOA 4RXTA 1J09A 1AB5A 1XZPA 3FI9A 2A5JA 1X1DA 2JHPA 3GJQA 3EGEA 1NSFA 2X1HA 4NJMA 3PFWO 4R9UC 3STHA 3S8EA 4HJXA 3ZGNA 1IK4A 3AL3A 3CB4A 4LBVA 5HSGA 2IYLD 2R86A 3X43A 1TJPB 3TRHA 3WL4A 2D1QA 1MO2A 2WQ6A 1H69A 3F7TA 3QKWA 7ABPA 2HF9A 2R6R1 4NP6A 4LFCB 1KEZA 4HH4A 3MXTA 1MP0A 1NZDA 3A9SA 5D00A 5IJ9B 4UE3S 1E0DA 4GVPA 3SSNA 4QUJA 3L43A 6CHYA 2DQ4A 1X94A 1GLVA 1PT6A 2ZJAA 2OLEA 1KJJA 1Z08A 5JYBA 4UVEA 2Q4TA 1H1TA 3OD5A 4ZU1X 4AP9A 2AYZA 3ZHRA 1VB3A 4RH0A 1W47A 1VBFA 2ODEA 4FYYA 4XR4A 5BV7A 3HJRA 1N2CE 3RH0A 4G1UC 3HBFA 2ZK7A 3BIWA 3BA1A 3WV4A 3GH1A 2H1LA 4JR0A 1MX1A 2XIQA 2C00A 3CUSA 4KO1S 4DM3A 2CUKA 3MM4A 1TEXA 2O5VA 1ISGA 3G02A 4V3BA 1SVOA 3QF4B 4BGIA 3RYCA 2V7GA 2FG5A 1WSAA 1T1RA 4EPXA 3AERB 3BG5A 3O9MA 2Q1XA 4GC9A 4HZUB 4P3OA 5JG7A 3EMVA 2D5AA 2FEKA 5EA2A 3QEMB 3DQQA 3K9NA 4OQYA 2ZWMA 3F2VA 4YRFA 1BX1A 1G8SA 4Z8YA 2W6JD 3W5BA 1DRWA 3LIIA 4L5BA 4CMEA 2HJGA 5KHAA 2XMSA 2UYQA 3P9XA 2JJ2D 5FFFA 4M3NA 2V9PA 1ABFA 4CG0A 2QTAA 3PRKE 1CK4A 1HZZA 4D9JA 3COJA 5ADUS 3OZ7A 2FOXA 3NANA 4P3KA 3HDQA 5ULLA 1U0LA 5IDXA 3ICOA 3DHEA 4QGFA 4RGQA 2WFAA 3CCCA 2WI8A 3L7KA 1X8KA 2WC1A 4G6ZA 2WAOA 1UJ4A 2N0SA 1PJLA 3GDGA 1S02A 3HVHA 1XEFA 4MRMB 4P1ZA 5COBA 1L5FA 3H0KA 4ASUD 4H2DA 1P4GA 3G9QA 4RMHA 1CUCA 3EC2A 5D6OA 2WLSA 4FYPA 1I36A 4BL5A 4MP3A 5EHQA 5MF6A 1FJHA 3QEBZ 4D8UA 3D43A 2I6SA 3TO5A 3BMQA 2INGX 1EP3B 2WNSA 1FZQA 3LF1A 4E2FA 2XUKA 3TAXA 4PNPA 3FIJA 3G0OA 4DMHA 5BSEA 3PFFA 1BIFA 1JFLA 1YS2X 2WYVA 5ENZA 4C7OB 2OC9A 3E27A 4BJHB 4CVNA 3BWEA 3KJQA 4BDTA 2Y1KA 3FBWA 1MO5A 2ZATA 1E7MA 3VJLA 1P39A 4FCTA 4N49A 4MO9A 4OP3A 2Q3HA 1XQXA 5MDHA 1XA0A 5H80A 4EATA 2CHEA 2XGGA 4KNWA 4ND6A 3FETA 3FWYA 3ESXA 4HNSA 3C4JA 4LDAA 2A86A 4QHYA 3ZI4A 1JKJB 3H9JA 3BDAA 1RLJA 4F4CA 4O4HA 4EYOA 4PYJA 1YZQA 2WF9A 3O4FA 2CXRA 2CJWA 4HNTA 1M2JA 2PZMA 3PKZA 1DIGA 4MW2A 2A5LA 1K06A 3QLEA 1ZVKA 5DM60 4R2JA 2DUJA 1U3VA 2R7MA 3WLEA 5EYPB 5BYBA 4LRTB 2QQFA 1GAQA 4XYMA 1EGAA 3LKVA 3LNTA 4LJYA 4RMNA 4C78A 1TTTA 2OXRA 4KQIA 4ZVKA 2EJTA 1YIOA 3ETGA 3P71T 5TIIA 1IRIA 1C8BA 4ZV9A 1WXQA 3ANSA 3P9ZA 3SS7X 4Y18A 1X3LA 3K8OE 4FFMA 5DHAA 4RLSA 2DZDA 5F64A 3SIXA 3W2FA 1YK0A 3GNLA 3ZJ4A 3GXBA 1WR8A 3W3ZB 3C15C 1QIJA 4I4CA 3A4LA 5J5AA 1JHXA 1UXGA 3PA6A 3N2KA 4MVYA 3WSTA 4ZICA 1H3EA 1U0HC 2Z2KA 3HXKA 4DV2B 1WUHS 1YZ3A 1C7QA 3IAFA 3DTVD 1ZIXA 1X1BA 3K6JA 4FSDA 1BWQA 1KQPA 1OWLA 3DLTA 3SK0A 5A4AA 2VZEA 2XTNA 1QQTA 1TAQA 4ZANA 2TMDA 3GA5A 5DBEX 1FX0B 1CJKC 3O8LA 4QDUA 1ZUD1 2R87A 4MKFA 2P9ZA 2VTBA 4MITA 1BGXT 4OIFA 3KQKA 2C77A 4QXMA 1C3VA 5DYTA 8ABPA 1N5OX 4BAUA 2FZGA 3ZCPA 3B5EA 2EP8A 3LO8A 3BRWA 1A96A 4MOWA 2EF0A 4PFJA 2ECQA 4JL6A 3N76A 1U0SY 4LOJA 4BB5A 1ZC3A 2C07A 4HDMA 4X62B 3WR5A 1S3IA 1N5IA 4YRLA 1ZHHA 4JCOA 4KO2S 4L6CA 4YMSA 5A71A 2PIDA 3K2EA 4DA4A 1DXYA 2P6UA 3LCRA 4BJ3A 2X2EA 4ZCMA 4HFRA 4MJ7A 1GYQA 1U2PA 3JZFA 2BZ1A 2ZYAA 5DLPA 1EWYA 4TV9F 1CP2A 2BKAA 4TMWA 2HMTA 4AL4A 1U6JA 1Z4OA 2ZYSA 2OBYA 2REQA 1DOAA 3PCRB 5FP0A 1VP9A 1CJUC 3ROPA 1DARA 5F7ZA 3L8MA 4V24A 3HC7A 3R76A 4RNDB 2P62A 2VJQA 1C1HA 3W6UA 2B6HA 5JLJA 2XWBF 1U2RA 2IH5A 4DMKA 5AVXA 3LBIA 4O4IB 1ZITA 1LPMA 2Q6KA 3SQOA 1T8PA 1B6SA 2BP7B 4EFDA 1EWQA 1E5QA 4DCNA 4DKJA 2TECE 3CB2A 3OJXA 4C7XA 5K8IA 1VTKA 5KNBH 1W5EA 3LLMA 1T9KA 5A4KA 3AG6A 2QRHA 3EVEA 3OEED 1ILWA 1XLTA 1Y3FE 2C04A 3B9BA 1R5OA 3A6LA 1H5UA 3B9PA 4HVTA 4AP6A 1P4AA 4BO4A 1MRSA 2IVFA 3D7NA 4JLAA 4L4YA 4NYMR 5F2OA 3W5JA 4MQ4A 3MJTA 5HHTA 2CVFA 1O6ZA 1KAQA 1G8FA 1RJFA 3PBKA 4JT4A 4KWTA 1DTEA 4MRPA 3KXDA 4H7JA 2PGIA 3KOYA 3L7CA 5AUNB 5IZCC 4BVBA 3RSCA 1E6WA 2W9XA 4FMDF 3AW8A 3E84A 3LRPA 1DQSA 2H3EA 4H1VA 1F2UB 3PUXA 3WKAA 3VOTA 1RHJA 4RD2A 2D1FA 4LWOA 1UPTA 4H7EA 5JQGB 1H6DA 1QV9A 4G4JA 2LUOA 1A71A 4J0JA 4GKJB 4XWYA 3X2FA 5FD8A 3U7QB 3R7DA 2IEYA 2ZU6A 1IM5A 4EM6A 1Q15A 2E4WA 4DCMA 2AOUA 1E7QA 4TZTA 5DXFA 2ZYVX 4IDCA 4F92B 3W8DA 2C5BA 4TL8A 4HZIA 2I4OA 5CLGA 3ZBPA 2XCIA 2QEQA 2CL5A 3GUCA 1RBYA 3N7AA 3N53A 5LXTB 1ULAA 4EB6A 4Q03A 4KW7A 2KHZA 1RKUA 4B4UA 3DFIA 2V59A 2G5PA 1LFAA 1V45E 2ANBA 3F8TA 4NF2A 4CM8B 5IKMA 5FUWA 2R4TA 1VIDA 3SDBA 3UJ7A 5KJ1A 1QPZA 4Y7DA 3K16A 3QLUC 1ND6A 3IMFA 4DPMA 5I51A 1I7QB 4Z54A 5I4CA 2VHTA 3MQFA 5FRDA 3MLAA 4J7UA 2QSUA 4P4UA 4FZ5A 3PYLA 1GRQA 2G0NA 1XWWA 1E8MA 4ER5A 1C80A 4RVNA 2FH5B 2ZE7A 4CMIB 1ZN9A 4B3CA 3N28A 2ZYHA 4LHEA 5B3AA 2ODTX 1YS7A 5ED0A 1JMYA 3VR4H 3JYLA 3T38A 1YR6A 2RBKA 3VFDA 1I0IA 1S7GA 2YHBA 4GLBA 5D86A 4ILKA 1OI2A 5CNMA 1BAPA 4FEAA 2NXWA 3BZWA 4CQLA 2OXFA 3IAHA 4D4GA 4M1OA 2ZBGA 4PGFA 1UH5A 2VDMB 3UKDA 2ENUA 3L84A 3U3RA 2XDWA 3DOEA 1SVWA 1QB7A 4TTSA 3V6MA 1ZNYA 2OCDA 4FFVA 2W37A 4JD5A 1NMQA 1NR7A 3PUHA 3QYJA 4LA4A 1IG0A 1VLJA 1Z28A 5E4YA 3VVMA 1CVIA 3ENZA 1WCIB 3RSOA 1UDCA 3GYGA 3IAXA 1P2FA 5LVAA 2YHAA 5REQB 4AQDA 3IKTA 1DAKA 4KMSA 1SM4A 2F1RA 3W3AA 4PYNA 1MENA 3QVJA 4CEHA 3QJYA 1N9KA 5IXJA 2KX7A 2Q5CA 2GK4A 2AOXA 3OPYA 3HGMA 3T3OA 1RI1A 4O4LF 4FYIA 3LVQE 5DN9A 3R7SA 2P69A 3A10A 3MXOA 1HE4A 3ZY2A 2QHXA 4YDHB 5ALIA 2VSXA 1ORWA 4RTQA 2WD7A 4FYVA 1FDUA 1YASA 2DU8A 4A92A 1TPYA 3M6IA 5EQFA 1QYIA 2ZDQA 4R71A 1GGNA 1ECCA 4KN8A 1D09A 1NMSA 2JHGA 2X9LA 3DB2A 2R2AA 4V2UA 2IBSA 4GI3A 3GX1A 1OX6A 2VJBA 4FLFA 3LPAA 1Z9BA 1PT5A 1J2YA 4OAPA 2PLAA 2ZREA 4KQMA 5GP1A 3WYFA 3DAOA 3WHIA 4RXUA 2DF8A 1V6AA 2PKQP 5IM4A 1Z4KA 4IGIA 1GXSA 3K0CA 4PSAA 3H6HA 4UMEA 1QE3A 1D07A 1DEAA 1UT6A 3HJGA 1VI6A 3I8XA 5E6RA 1O97D 4IGEA 2X6TA 5E9AA 3IDFA 3KEGA 3PUKA 4DCJA 2Y2VA 2WF6A 4QUDA 1CQIA 1VLHA 5IJZA 4F97A 2DE0X 1Y8ZA 3EZLA 3OZBA 1HG0A 1T2AA 5EMHA 3LP6A 3GFFA 1D5WA 3SIRA 3TRJA 2RB4A 2QRNA 4A8JC 3LGAA 1NFQA 2QG9A 3PVCA 1AY0A 5HIKA 4X60A 4XE5A 1KJ9A 2QG4A 3KKQA 2VHZA 3JAWB 3R5SA 2F00A 1NQVA 2RC5A 2ZQ5A 3G9XA 1UOQA 3KAPA 2QN1A 3Q8WA 1D1PA 1G20A 2WV7A 4TZ6A 2O7NA 3KB1A 1NFRA 3B6JA 3IO3A 5GONA 1CC1S 2VHQA 3QX8A 4IMIB 4X6LA 5BT9A 3SHTA 2BCJQ 1GUFA 2EZ4A 3IE2A 3RW9A 2H4JA 5L51A 5T4BA 2F8SA 4RQBA 3AF4A 1KO5A 2PL9A 2Q1SA 1JDNA 3GIDA 5SY9A 1DC3A 1FL9A 3PR1A 4B82A 1E6LA 1GSIA 1Y6ZA 2NUBA 1R15A 5HRUA 4RFSB 4UEQA 3AJ8A 4QXPA 4S35A 4BO2A 1K92A 3ND7A 3JVEA 5GINE 4H15A 5JXGA 1M2OB 1WABA 3RSHA 1V8FA 1K75A 4EGSA 5IYZF 4D79A 1PV4A 1PQYA 1LI5A 1IQ0A 1I2AA 3QU5A 3PSHA 2IPAB 3BGSA 3EGXA 4MMYB 3P9PA 4Q66C 3QXGA 3E15A 2WU4A 3VYSB 4F11A 2JGFA 5BSTA 1NX9A 2AFIB 2EP7A 2R7KA 4C4RA 1WSWA 4LJLA 4NU6A 1SUWA 1ZNXA 2FUG1 3N8HA 3NOXA 4LQDA 4R2IA 2H1CA 4C7MA 4WE3A 4YH1A 1JI3A 1T9AA 2HA6A 2R8RA 2ISQA 4N39A 1OTHA 2V6BA 4G8BA 3WKEA 2E49A 1ESDA 1JL3A 4UHHA 3TMKA 1AMUA 3EUFA 5KQPA 1TQHA 1D7OA 3HVRA 2RE8A 1Q6ZA 3OLXA 4JLVA 4LXGA 3ITEA 2EHJA 4HDSB 1T0HB 1KU0A 3KJFA 1B16A 3X1DA 5A02A 5FBZA 4FWIB 1RKVA 3NWBA 4MUJA 1X7ZA 1PJQA 2ZRDA 4DCCA 3ODGA 3SR3A 2Z4RA 4D3XA 1IHDA 4R54A 1VI5A 1WD7A 3C3YA 1JTVA 2GBLC 4LF9B 2JFHA 2VDVE 4D56A 2AW5A 1YB4A 1LS1A 1CUHA 4YCSA 1ZL2A 4N4AA 5AOVA 1H4SA 1Z5PA 2ZRQA 2OCXA 3I04A 3JY6A 2XSZA 5EZ6B 5IMSA 1N5MA 5KWJA 3KPVA 3OJWA 4P9NA 1OZ0A 2C9OA 1MIHA 2GEUA 4Q1EA 3WAKA 2RGBA 1O97C 3JQPA 4RTSA 1IN7A 1VE3A 3AEZA 2BRUA 4HXGA 3I2GA 1J90A 3QWBA 2JCBA 1P1KA 2B8JA 1QFJA 1T0IA 1E20A 2GPNA 2UV8A 4U8HA 3VR3D 3C3KA 3AXTA 4JJIA 5G1NA 3DFMA 4G1FA 4Q93A 3ZVLA 1UPFA 2YKGA 4J6EA 1XEXB 3KQQA 4IMJB 2ACWA 4F91B 3BXHA 3R7WB 1M5UA 1F4VA 2R25B 2MYNA 2X1LA 2AR0A 3JQAA 4LHXA 4QIHA 3RC3A 3B2NA 2J3LA 1QGOA 3B1VA 2G1KA 1OXSC 3R6LA 2ADMA 4QG7A 5CK5A 5JALA 3DHNA 4XYBA 2VH2A 1KI2A 2PX6A 3I0ZA 4FFNA 3M5DA 4FGKA 3D7RA 1UWKA 4L8VA 3DPUA 3K4PA 3NNSA 1HQCA 4GLJA 2YQ4A 2P9JA 4G97A 3MMNA 3BWMA 4B83A 1NYLA 2Y0BA 2ZCVA 1KIAA 3R5JA 2WW8A 3S40A 3C5CA 1Q0PA 2C9MA 3QVKA 4BQPA 4L15A 2ZBFA 2GTHA 1S1CA 1VJ1A 2WM2A 2W6CX 3K1AA 4MTCA 5EZYA 1GDTA 1Q1GA 1QFMA 2YN2A 2QTBA 3V8BA 4KNYA 2BTQA 2G09A 3PNYA 4KQCA 4NFLA 2XW6A 2CNWD 1V39A 1EFKA 2BCGY 2FG7C 1OKKD 2VDJA 1C2YA 2H8KA 2XVZA 3FTDA 2X42A 4OM8A 4OXRA 4O5OA 4FGUA 4DV0B 1DRKA 2YVAA 2ZTLA 1Q11A 4P5PA 3EIEA 2F43B 4C2AA 4ZKDA 1ZJWA 2PS3A 3JS5A 1V95A 2AI3A 3BREA 4S1VA 3EDOA 2OHVA 4ZT7A 2PO7A 3H1AA 2RKOA 3EE6A 4M1KA 4LDQA 4QPPA 4RD3A 3NOVA 4BFSA 1AH2A 1K3FA 2HNAA 2IIPA 3QFCA 2DWUA 3F7NA 4OB7A 2CXQA 1PL0A 2AT1A 1YE8A 2AWNA 1CUFA 3SBXA 4DHWA 5HUJA 2IHNA 1XF9A 3AR6A 4G09A 2BLLA 621PA 1J00A 4GKBA 4EG8A 1P5HA 2JI4A 4IYJA 2DFPA 2A84A 2RHLA 2JGAA 3OUTA 1OY1A 2WFZA 2ZBPA 5GOTA 3SOZA 3ZPXA 4CIXA 4ZHQB 1ILEA 1YQTA 3PCTA 2E55A 4C01A 2NO0A 1RXEA 3UBMA 4D4KA 1QQAA 2EJUA 4K8RB 4I6EA 1ZXLA 2EP5A 3D0RA 3IP6A 4TLCA 4YHBA 4MEBA 2M9MA 3L0SA 2V7EA 1G98A 5EJ4A 3G0GA 2IPOA 3WWYA 4K6MA 3S2YA 3VPBA 1NXSA 1UPAA 2P40A 3R3JA 1S2NA 1GZDA 4I4TA 4MYDA 2OC4A 2YFKA 4RTJA 1WXGA 2GZ2A 4GFDA 3OPQA 4A10A 1E2PA 4JZYA 3L07A 4JI0B 4HQ6A 5BNFA 3GZNA 4EDHA 4AY2A 5DMXA 1G7CA 4ZJPA 4W5TA 3W6PA 2WJZB 1QC5A 2YRWA 3BSYA 4RJLA 1PJ3A 1LPNA 4QQFA 2BUCA 1BWRA 1UT5A 1ZGGA 4ZVUA 1JB9A 1KVQA 1MAUA 2FQYA 1NULA 1L4FA 2PUWA 5DBGA 4C0LA 2QTGA 1TCAA 1USKA 1KKLA 5BW4A 2YW2A 1O9GA 1X42A 4M46A 1R0WA 1VL1A 5HM8A 4MPTA 4K28A 3IDOA 3BXXA 2ZCJA 1X2BA 1DKNA 4CETA 4GOJA 3I0NA 3DQZA 1EH5A 1NL3A 2W5UA 2G9NA 3AR7A 5E0KB 1TPZA 4LIPD 1YJCA 2RK4A 3D1VA 3K92A 3QYFA 1Q1BA 3D3QA 3WNZA 4WLUA 4F93B 5DK6A 4BNLA 3I09A 4US2R 3VDXA 1SPXA 4YMGA 1NDQA 3AR4A 4MCHA 4EZBA 13PKA 1EVLA 3H1FA 3QFFA 1UEJA 2R00C 5DHFA 4X3PA 1BXGB 2D0PB 5EJFA 5C9ZA 4LBYA 1BQ3A 1YOBA 5KEIA 1QHYA 4YO8A 2AFHE 2HN9A 4YAJA 4W5QA 2W58A 3EXAA 4M89A 4AKSA 5I7SA 2RHBA 3L0DA 1KK1A 5FQNA 3FZGA 3GUYA 1N7GA 1CEEA 4JNCA 2P2DA 3A1TA 3HCWA 1HX7A 2BJWA 1ETUA 2WMYA 5F4BA 2I1WA 3EK2A 2FKNA 3CTMA 4AO7A 1NPDA 1HFKA 1J8FA 1U7PA 2WE8A 5JNUA 3U4MA 2RKWA 4AZTA 1G9TA 3B52X 3FB4A 1E59A 2VF2A 3KP1A 5ENDA 3UGKA 1IJBA 1DG3A 2FUKA 1D0SA 2QR3A 4OREX 3VKWA 3EQ9A 5EP1A 4RENA 1O96A 2H06A 2VDUE 1P62B 3NVMB 4XIIA 3WWCA 1VLVA 2ZIFA 3CF4A 3F4LA 1HTWA 3QBTA 5DE3A 4KSBA 1LWOA 2DCUA 4MWGA 1DKMA 4N0MA 3DEIA 1Q6YA 1ECPA 1V1RA 2VP9A 5JSZA 3U81A 4NARA 1KAOA 2P5UA 4MR7A 1YK1A 2HCFA 2H54A 3K31A 6REQA 3TFQA 4G25A 3AM4A 1PFUA 2A35A 3DC2A 4C1BA 1KY3A 3TFWA 1PJCA 2EU8A 4EKYA 3T1YB 4QODA 1OYWA 1AUXA 3VO9A 3D6UA 2NM0A 4NBSA 1NG1A 4R7GA 3UMGA 2IYYA 2IXGA 4DA7A 4OVKA 5BO5A 2QLTA 5IPFA 3LFUA 2B2XA 5K6RA 3MJHA 3SVZA 3N8DA 4WFIA 1G5HA 4GSLA 2YXBA 4IH1A 4HTAA 4AKHA 2QTNA 1QC5B 1E1KA 1V6CA 3FD8A 1V4BA 3HHEA 3HXPA 2BSAA 4IEEA 3GPBA 1M6HA 1NU8A 4KSYA 4ZOBA 3SDZA 5JCXA 1F14A 3DAPA 5FORA 4BFYA 2HK7A 3H4IA 1SVUA 1T5BA 3P4YA 3PVSA 4UXIA 4ZV4A 1JYFA 2ECOA 5CAEB 2YWEA 3E3NA 5EWMB 1P7VA 3DZGA 2ODPA 4FQ7A 3AFNA 4DZZA 2NUTA 4KPFC 3OZCA 2PHZA 3FCUB 1F9EA 1NG9A 1Q0TA 3A4TA 5JZBA 1ZJ6A 1TJ3A 3ND8A 4HWPA 2EAUA 1SVMA 2WAYA 3GCGA 3DE7X 1OLSA 4IHKA 3ZZUA 1FP4B 1WMAA 3ZD9A 1ZXXA 2A0UA 2JBWA 3TRIA 4BE4A 4E6EA 2ON6A 3R6DA 3T3NA 3CHYA 3HB1A 3VVBA 4LFAB 3FI0A 1JWLA 1KJWA 3SBEA 2O8BA 2A0FA 5AI4A 4ROTA 1IN1A 1IZZA 4UU0A 5LOVF 2FPLA 1PS0A 1TIPA 1X7WB 4Q9IA 4FMBB 1WUYA 4TYWA 2GN8A 3BQNB 3DDCA 3W4IA 2KBEA 3EWNA 2WFMA 4I8IA 4EVQA 1XNJA 1ZM2A 4OKSA 1FBNA 1IOVA 3L4EA 2YVQA 5D7NA 2Q3CA 4BQOA 2MSWA 2ZJ1A 3DYBA 4HWSA 5FPYA 1P7PA 3MGKA 2DUWA 4MGIR 4AKEA 4CKEA 3WLSA 4C06A 3Q40A 4X8HA 4FFWA 3UYLA 1E3SA 4RELA 1TNDA 2LRHA 2Z2YA 1HK7A 3R7NA 5FL7D 1SEPA 4JYZA 4FGJA 3I6IA 2B20A 1AOXA 4Q9NA 4Q3LA 1FNBA 4LHYA 4PE5B 4R5HA 4I5IA 3GLIE 4ROSA 3S0JA 3EA5A 3USCS 3WADA 2H6EA 4OGLA 2D1SA 2IYOA 1TC1A 3I9JA 3GIWA 3LRTA 4QVKA 1YR2A 1XAHA 5KOIA 1SKUA 4AUEA 3PQ6A 1BXZA 3DEZA 3S27A 3TZKA 5BR4A 3THYA 4JQYA 3BGWA 3R0VA 4X1KA 5AIAA 1NVVR 4RDIA 1TB4A 3W8FA 1NBOA 2G76A 1I30A 4JASB 3BZUA 3T9BA 4KPYA 4A0QA 4ZVNA 6PFKA 4DM7A 1I0LA 6REQB 1RYNA 3ZKWA 1G55A 1NJ5A 1XNHA 2H9YA 5A6SA 1YL7A 1P1CA 4HEQA 2Q50A 2PWYA 3BK2A 3TLGA 1WUIS 1ZOOA 1EK1A 2I6FA 1RQPA 2RHTA 3AETA 3F2IA 4CG3A 3ENQA 1SBQA 2HGZA 5T6MA 3T5BA 5EGNA 3G2PA 1WXDA 4K3UA 4BB9A 1D4AA 2NU6A 3LUDA 1ELOA 3OIGA 4ZVOA 1MC8A 4BUCA 1IBSA 2I2WA 2O48X 3R41A 5I9SA 1KQNA 1V2HE 4JBNA 4C03A 4HNHA 1K86A 2BONA 4UNNA 5KTYA 1QZTA 1YULA 2AV6A 3ZIAD 4KLAA 4DRXB 4JGGA 1O0BA 4CUJA 1EKXA 2GN4A 3TLEA 3ZV5A 3H2ZA 3IP1A 1A04A 3JQRA 4IOJA 3A6KA 4M0KA 2XA2A 4E4TA 4J7CA 4JI7B 1AURA 1TF2A 2VFAA 2G5CA 4ZOLB 5IABA 1V26A 4MIOA 2SICE 1E58A 3PQ7A 3G13A 4RAOA 5D1NA 1EX1A 2FR1A 4S1WA 4IJMA 5HEKA 3RU7A 1XDSA 4LN1A 4QM7A 3P9KA 1IJKA 1A5TA 4PZAA 5FWDA 1QZ3A 4GWKA 4N7RA 4PLCA 4HG2A 2X3FA 3E18A 4IJ5A 4QUHA 4DHEA 2X5JO 5KCZA 3PK0A 1J5EB 1IPFA 4FEYA 4WK6A 4TT3A 5CD1A 1DIBA 4LY9A 1O8BA 1VE1A 1ZN2A 3CLTC 5DPMA 2G25A 1AS3A 1EINA 4HNRA 1XZHA 1EZZA 3KELA 4N3AA 1GZSA 4EEZA 1R4NB 4V2IA 4BO0A 4IQGA 2W2KA 1XMJA 2YBDA 1XKLA 2QENA 4KB5A 4CDRA 4ZQEA 3E5HA 4IDNA 5E7IA 3SICE 3RBVA 3CBGA 3SZ3A 4RHUA 2WV9A 1NSYA 4Y2GA 3IQHX 4E11A 3L4BC 4BXOA 1SVLA 4CQMB 2A59A 2XCTB 3NMUF 3ZDAA 4QBIA 3FFWA 5BVHA 4RZHA 3H9CA 5F1PA 4D81A 2FR8C 1W36C 2HHAA 3FMVA 2X8WA 1YDHA 1GZ6A 5KQRA 1PTJC 1TT7A 1X0VA 1SQGA 2MSKA 3VH1A 1F2DA 3HDGA 4BASA 5CA1F 1NA5A 3LK7A 2EBFX 4MKXA 1A9XA 1JWBB 1HYHA 3I01M 1KZHA 3C41J 4Z4EA 1OIXA 4P3NA 1XRNA 2R6CA 1Z2OX 5CLHA 5THQA 3ZWKA 4PQEA 5L7YA 4DE5A 5DSXA 1Y3HA 4TN1A 1DO2A 4KI0A 5C81A 4G4SO 4G4GA 3FMOB 5LU8A 3HXMA 5IAJA 2VJYA 2AJTA 3MJ4A 4LF6B 2ZJ8A 5H82A 2P3QA 2CNWA 3CG0A 2JZNA 4FIZA 4BLRA 1FTWA 4FYMA 4V0KA 1NN3A 1E66A 3B89A 1WMEA 2A8YA 1I4LD 3PXBA 1NBAA 1XRSB 1JU3A 1XCMA 4YV0A 2ODBA 4MYUA 2DUMA 2H29A 4KAXA 3CGGA 2OHFA 5JROA 5J2UF 3JVIA 1K7SN 5HZMA 3S68A 1WCV1 2Q3LA 3LXUX 1LVGA 3P4UA 5KTMA 2GEJA 3QU9A 5F51A 4RZQA 4XQCA 4BJ1A 5LOVB 1GNTA 1K2VN 2JEZA 1O3YA 2E18A 3H75A 3ZWQA 1N2ZA 3WAJA 4NDZA 4WFKA 2JA1A 4HKTA 2UKDA 3GT7A 1LRLA 3NBKA 4WJZA 2GHRA 5ALGA 4CLEA 2HLDD 5I5EA 3C85A 3B1FA 3HL0A 4JUIA 1NXVA 2RK6A 1Z0FA 1EDDA 2BMVA 1OZGA 5EZSA 4RJTA 1B3RA 2PUFA 3RGWS 4KPEC 2F9MA 3WGQA 1V3TA 3RS7A 3KAKA 3EDYA 3NUQA 1J0DA 1FFWA 3OO0A 2Z6QA 2PRYA 1ZIDA 2FJPA 4TWZA 1N36B 4IX9A 1O8CA 1P0CA 1ZI9A 3N70A 1WCIA 1ODSA 1QH0A 3UB2A 3FPLA 4TT8A 1L5OA 2V58A 3ONWA 1WF3A 4Z4GA 3QE9Y 4FP9A 3GA0A 3SC4A 1E9DA 1YC5A 4BIMA 1BGWA 1KMMA 4L28A 3AP3A 3P0HA 5EE5B 5IW8A 3W90A 4DCPA 5JMTA 5KNCD 1F7VA 3AIMA 2WUDA 5ANRB 3UJNA 1JKXA 5E1BA 2FMFA 2H2AA 5JAIA 3H5OA 1O2DA 3L4JA 3A25A 2Q0XA 2RGYA 1NVAA 2QSJA 2CXSA 2A7QA 1M8JA 1UMCA 1D2EA 2X1VA 2QX7A 3AV3A 4KKXB 4E31A 1HO3A 5BWLA 2IZOA 4CMHA 4MDYA 1WD5A 5K4HA 4OBWA 4MLZA 2PUEA 4FZJA 5K0NA 3D8SA 2HBYA 1RPNA 3TQTA 4Q47A 2IXTA 4BZXA 4EGCB 5C46F 3ZI0A 3NAMA 4EY7A 2X5NA 4RPJA 5JWOA 1K0UA 3T1VA 2NO1A 4BQIA 4QBTA 1B1AA 4IPTA 2RHCA 4HATA 3ZH2A 1G3UA 5K0FA 2MR5A 7AT1A 4DG9A 2P5TB 4H7DA 4N3CA 4XWTA 2X3YA 4HDMB 1GDDA 4KQEA 3AI1A 3EMKA 4CMIA 3PF9A 4TSRA 2HU2A 1YZLA 1NBIA 1J1UA 4RADA 1VXOA 3CRZA 1ZK2A 3WHKA 3WMXA 3IERA 4RK7A 1N2XA 2PWZA 1EVEA 1CR6A 1RIFA 2O6LA 2R6GA 2O20A 4MDEA 1K8QA 4QOFA 2BMWA 1LCIA 3FF4A 3DTNA 3TZBA 3ZV4A 3NEJA 4MVJP 3OA0A 1P72A 1CUBA 1NJFA 2HSGA 3EXIB 1XHLA 2XB8A 3HCEA 3IUEA 1A5BB 4NK5A 4EA8A 1I7DA 4DILA 1L5HB 5FWNA 3RV3A 5JJIA 3LTEA 4PO1A 1HG1A 5CYOA 3HH8A 4KLZA 3WA6A 1FMTA 2VDPB 3TIVA 1NI4B