3BHJA

Crystal structure of human carbonyl reductase 1 in complex with glutathione
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
275
structure length
275
Chain Sequence
SGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonyl reductase [NADPH] 1
publication title Human carbonyl reductase 1 is an s-nitrosoglutathione reductase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 103
structure length 275
sequence length 275
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2007-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bhjA00
1QYCA 3UF0A 1Y9EA 1UXGA 3RQSA 3V8BA 1YQDA 1V6AA 2QYTA 2C59A 3RUIA 7ADHA 3IAHA 1X13A 1DJQA 1JKJA 1PWZA 1SEVA 2X22A 3OJEA 4IINA 2Q49A 4AJ4A 1HDCA 2VHWA 3ROKA 4OL9A 2NVUA 2Y0CA 3MWDB 5AXAA 4DPKA 2DBVO 4MVJD 3JQ7B 3D0OA 3PIDA 1B3BA 1MGOA 4A7PA 4EEXA 4ZQEA 3JD0A 1H2BA 2O50A 4D0RA 4XCVA 1R15A 5TRTA 3RWBA 4CUKA 1Y5MA 3JYQA 2E82A 4YEDA 3ZNPA 4EYEA 2ZCUA 1E77A 1TLTA 2EF1A 1CEQA 5ENVA 5BSHA 4E3ZA 4W7HA 2VRCA 4UEKA 5TS3A 4I8XA 1OC2A 2PZKA 3WFJA 3RI3A 3TF5A 5L51A 4RJTA 4ZGWA 1W8DA 2DAPA 4TQGA 3ZHBA 1UAGA 5A02A 1H9BA 1T24A 1Y5RA 4NHEA 1N92A 2HU2A 4AVYA 4PZEA 4FGWA 1RM0A 1Y8RB 2ZQYA 4BNTA 1FXSA 1P0CA 3LC1O 1A9YA 4D3FA 4OXKA 4RVSA 5IDQA 3WTCA 3ANLA 5TJHA 5I9MA 3QWBA 4ND2A 4J7UA 2VZ8A 4RL6A 2HLPA 3A28A 1AGNA 5JBIA 3OEYA 1DFHA 2Y99A 1PL6A 1QYVA 4DLBA 3ICCA 4L8VA 4KDFA 1EDOA 2FN7A 3DBHA 3GHHA 4TRMA 3ZW8A 2X0NA 1JDJA 4UREA 3GEMA 5TIIA 2WWRA 2X9VA 3D3WA 5BNTA 1NP3A 2A9FA 2GYYA 3DEYX 3WWYA 4RLHA 3WMWA 1HYGA 2ZTVA 4IZHA 3GEGA 4I5FA 4LMPA 5IXSA 1XSEA 1SOWA 1BW9A 3F1KA 4IS3A 1H9AA 4L9RA 2FMUA 3F6YA 3AY6A 3CE6A 3K31A 3MJVA 1ZJYA 3AUTA 1YVEI 1QLJA 3GGOA 4RPJA 5JYEA 4W99A 1U3UA 2GLXA 3O4RA 1KS9A 3FF4A 4BNJA 5KVCA 1E7SA 2YV1A 3KBOA 4MVJH 1E5QA 3ZDFA 2PD6A 2DPHA 4BNMA 1B0AA 4A2CA 2WYVA 1WAMA 1EBFA 1PQWA 1FDTA 5BSGA 4GBJA 4B3HA 3PHIA 1GQ2A 4NPCA 5B4TA 1KERA 1OZAA 2VHYA 4B7XA 3DOOA 2TMDA 3D4PA 3OMLA 1VSVA 2JHGA 2VYNA 3WX0A 4BNWA 4DUPA 1KEWA 1ML3A 1L7EA 4DIOA 4E5YA 2GERA 3PTZA 1X1TA 3KEQA 3VC7A 3GVPA 1V3TA 2VHVA 3FRJA 3QP9A 2HJRA 4LCEA 1MP0A 1PL7A 3GNTA 1PX0A 4H3VA 3OEWA 3KYDA 4KZPA 1Z7EA 3GY0A 3KSZO 3OBBA 4R3WA 2C2XA 3M1AA 1NFRA 2Y1EA 3E03A 3ST7A 3I9OA 4D43A 3V5NA 4ZD6A 2YDYA 1OI7A 4Z0PA 5DP2A 3GQVA 1VE9A 3FI9A 3KB6A 4ALMA 4E2YA 1LA2A 2WM3A 1O6ZA 3JD4A 2Q1SA 3NEPX 1CRWG 1QG6A 1TB4A 5T67A 4W6ZA 3B20A 3MCVA 1P1HA 4EITA 2WD7A 2GUGA 3V1YA 1SOVA 1K6JA 4HUJA 3L77A 1VKOA 3PLNA 4GMFA 3OIFA 2G17A 4R69A 3LT2A 4OM8A 4BGUA 4FFOA 1DIRA 3CSDA 2VTDA 1EUZA 1R4MA 2A4KA 4DLAA 2DT5A 4FN4A 3QWHA 4L76A 1QKIA 1GZ4A 2GF2A 4BNZA 3AM3A 3B1JA 3GGPA 2Q45A 4DPLA 3LDHA 4ZN6A 1HL3A 2D8AA 5FEUA 1M6HA 1TVEA 4LCJA 1LDYA 2BFPA 2Q3EA 2YHIA 4YT4A 1B8PA 4CODB 3HB4X 3WIEA 2X7HA 3KYBA 4XIYA 2YV3A 4FFPA 3I4CA 4LGVA 3NUGA 2QRKA 4P38A 3EVNA 4UEOA 4YB8A 4FJ1A 4MKRA 5I8WA 3IOYA 3KVOA 4J3FA 1ISFA 5F5LA 3RBZA 3I6IA 4TZTA 4U0JA 3UAGA 3AOEC 4CM3A 4Z0TA 4EZBA 1RM5A 4OH1A 5A04A 1PZFA 4CV2A 4WE3A 2O23A 4YT8A 4YPOA 4CMBA 3KTDA 1Q2XA 4PCVA 4G2NA 1DRVA 3JQFC 4GPD1 3ONFA 3WGOA 5TJ9A 3ZV4A 1DO8A 2O7SA 2BF7A 4ROSA 3D5TA 4BS9A 3UCXA 5C37A 4DIBA 2IE0A 1C3VA 1U5CA 5JSFA 3K5PA 1ZMOA 5DT9A 3AJRA 1B16A 1YDWA 5CDGA 1T2EA 4MDHA 3ZNOA 4FOSA 1JAXA 4ZQHA 2C0CA 4B4UA 3F1LA 5LCXA 5JAMA 1HDGO 3DZJA 2GDZA 3WQRA 4XWYA 1ID1A 3IDSA 5JDCC 4ND4A 3TFQA 3VPFA 1V8BA 3RD5A 4FR5A 1WWKA 1E0DA 2HK7A 3MEQA 3AW9A 2PKQP 1AHHA 1T2FA 1E7QA 4AJOA 1P0FA 4K26A 2PV7A 5JS6A 2A35A 3NT4A 3D1LA 4W7IA 5L7YA 2X58A 3SBOA 2WYWA 4CM6A 3G0OA 3VH1A 4YJDA 2E4AA 3H5AA 2VNAA 3U4CA 4B3JA 3ONDA 3H9EO 1PJSA 4YJGB 4D46A 5G0SA 4WGGA 3WGIA 5COBA 4G5HA 1YQGA 2I65A 1EUCA 3HQ4O 1XU9A 1DRUA 1R0SA 3HSKA 2B4QA 1E3SA 1XCBA 3H7AA 3EDMA 2PZLA 1TA4A 3ROMA 1YL7A 2DUUA 4WPGA 1I2CA 4TZKA 1P77A 4A26A 1ISIA 1GY8A 1XDWA 4KUGA 2VHZA 4PIVA 5IF3A 5HTOA 2IZZA 3FWNA 2EW8A 4AG3A 5EQDA 1A5ZA 5A9SB 1U4SA 2HMVA 4ID9A 2EIHA 4GVXA 4PVCA 2GCGA 2O2YA 3Q2KA 2P9GA 2HQ1A 3RU9A 3WLFA 3L4BC 2B4TO 3WTBA 1X0VA 4PLHA 4RGBA 3GRKA 5JYDA 1R0LA 1NXQA 1PQPA 3BMQA 3TPCA 4BO3A 9LDBA 1RYEA 3S2EA 2FR0A 1YH3A 3S2IA 4D44A 4J2HA 3L6EA 4J1NA 3WYCA 4FFMA 4NR0A 1HE4A 3D5QA 4Q39A 1YKFA 3E18A 4CQMD 1KVUA 3KM0A 4XYEA 1K6IA 2AEFA 3WNQA 2OL4A 3RCBA 3PP8A 4IUYA 3ZWCA 2HMSA 2JD1A 5I8ZA 2VHXA 5A9TA 3DZGA 3D4OA 1HKUA 4WLVA 1HSZA 2X5OA 4DIFA 4J7XA 1PJ4A 3BAZA 3AY3A 4PLWA 1J49A 3EGOA 4L4RA 5CG2A 4OXYA 5I7VA 2CMDA 1LSUA 4JJFA 2EGHA 3JQGA 2J6IA 4TKLA 2RH8A 3E9MA 1CERA 3K30A 1C0KA 3RASA 2DVMA 4N5NA 3ZV3A 2YQ5A 2LDBA 3KSDO 1EE9A 2BMAA 1O0SA 4A5OA 2Y1FA 1I2ZA 4JIGA 4MP8A 3X2FA 4EUFA 3VDRA 2J5RA 4F46A 2GN8A 1KIFA 1MB4A 2GD1O 3CPSA 4BGVA 5JDIC 5TT0A 2YDXA 2VN8A 2HDHA 3CH6A 1T2CA 3AOGA 2O3QA 2QRJA 3BHIA 1T4DA 3DAPA 1N7GA 3WWZA 1ORRA 4LRSB 4BQRA 1LBEA 3UFXA 1GPDG 4CMHA 1AXGA 3JQ9C 4E2XA 3BMOB 4GQAA 5CPFA 1LDEA 1Z82A 1ZEMA 1DIBA 3OQ1A 3KV3O 1UDCA 5GZ6A 5HRUA 2R00C 4J4HA 4ITUA 3ZU2A 3I9KA 4L0QA 1LX6A 3U62A 2GASA 4FGSA 3ZWVA 4NBRA 1LI4A 1GCOA 2D3TA 4K28A 5JE8A 3KRTA 3KYCA 4BGEA 5JAZA 1PJTA 2VWQA 4CMIB 4WCDA 3WSVA 1H2HA 2FHSA 4CLRB 3FTNA 3QVXA 3N74A 1WP4A 1LRJA 4FBGA 3QWFA 2BKAA 5A3JA 1K89A 4BV8A 4ZRNA 3PJFA 4BNIA 4CMEA 3C7CB 1ZFNA 1SEPA 3QY9A 4R4JA 3KYCB 3E1KA 3DOJA 5TC4A 5ILGA 1XHLA 2JFGA 4BMNA 4K6FA 4I9UA 4NQZA 4ILKA 4MVJP 3DZKA 3DONA 5L7WA 2WD8A 2IYOA 4J2OA 4Q9NA 5DBGA 2EP7A 1PEDA 1DC5A 1G1AA 2RH4A 1ENOA 1HT0A 4YT5A 1U9JA 3KLMX 5ER6A 3NTOA 3OICA 5A4DA 4IBOA 3VPHA 1MX3A 1K0UA 2AQ8A 5KTKA 1FJHA 4MVJI 3QWAA 1I32A 1NR7A 2PWZA 4PG7A 4PLVA 1ZMTA 2EJWA 2NM0A 2IYPA 2OMEA 5C7OO 4RORA 3P5SA 2H5LA 3GN1A 1M6WA 2J3JA 3L9WA 3AFNA 3SLKA 4GKVA 3ASVA 1H6AA 4KWHA 1A72A 1DSSG 4BKQA 2P4HX 1F14A 1I36A 3PZRA 5GZ1A 3FN4A 3NGLA 3WBBA 5DP1A 2B37A 3I9LA 4GI2A 1AE1A 1IYZA 2NTVA 2D1YA 3G17A 2DFDA 2H1SA 2W98A 3GZNB 2AQIA 2GN6A 3M1LA 5TNXA 3TOXA 4N54A 1ONOA 2D5AA 2BHLA 3AFMA 4M8SA 3DXFA 3DR3A 4UVIA 4WKGA 1N8KA 3SC4A 1DJNA 4NI5A 1QP8A 3HHPA 1IZ0A 3RC1A 2YV2A 4IDCA 5IDWA 1E7YA 3JV7A 3E8XA 1K2WA 4FQ8A 1UZMA 3W4KA 4R1NA 5I7FA 3VKVA 4NFSA 2W8ZA 5KJFA 3PQEA 3C7AA 3PK0A 3DTTA 4XYMA 1KVQA 2Q2QA 4YJFB 5JFOA 1IY8A 4CUZA 2OGUA 4AJEA 1GFSA 1PJLA 4MVJF 3JQBA 5A1TA 1ZZEA 2NQ8A 4WUVA 2DU8A 2X6TA 3OETA 4IXWA 4I1IA 2Q1WA 3RJ5A 1AUPA 1B14A 2FOIA 3INRA 1QV7A 1YBVA 3LLSA 1E1NA 4R16A 3VVBA 3AY7A 3JQ6A 3FBGA 5K0ZA 3MJCA 1QORA 1RJWA 2C07A 4OQZA 1T1SA 7MDHA 4RO0A 5TSDA 1E3EA 1C1DA 1FDUA 5JY6A 1U1IA 4DC0A 4YRAA 4J9UE 1Z6ZA 5IAAA 2W2KB 3SVTA 1X7HA 4S1VA 5AOVA 4IS2A 4CLOA 2ZK7A 4IGFA 2PD4A 1DFGA 3U0BA 5CDTA 4D42A 1HETA 5JY1A 1EQUA 5T8KA 2ZKLA 3UW3A 4AJ1A 3P2YA 3PGXA 3ETDA 4GWKA 4E2WA 3MOIA 1HLPA 1ZK0A 3TZQA 2GN9A 5THKA 1P1FA 1CJCA 4O6VA 4TROA 3KXDA 4OKNA 4A10A 3ON5A 2VT2A 4W82A 2PY6A 3U4DA 2O3UA 2ZIZA 5H83A 4FB5A 4OSOA 5DNAA 3VAZA 3HN2A 5T64A 1YXMA 3UXYA 1HDOA 4P4LA 4HADA 1E92A 3CZMA 3OIGA 4DPMA 1BXGB 1IOLA 2SCUA 1E1MA 3AU9A 1D3AA 3GHYA 3QA9A 2R6JA 1IUKA 3JYPA 4WASA 2O2SA 3ZWXA 4RPKA 4Z6KA 3FPLA 3Q6IA 3ZU5A 1Z7BA 1ZK2A 3C1AA 3OJOA 3DFZA 2V6GA 3NTQA 3AI2A 2Y67A 3CMCO 5CG1A 3RROA 3DMTC 3PYXA 5JO0A 3GPDG 2D2IA 4RVFA 3ZWWA 4OOFA 3K73O 4KUEA 2PZMA 3ZNNA 4AJHA 4B79A 4J4BA 5GY7A 3ZU3A 4DVJA 3I5MA 1Z45A 5C3MA 5FF9A 1Z74A 2VYVA 4CMCA 3GF4A 2B0JA 4QO8A 2HSDA 4GGPA 3GDFA 4LK3A 2VT3A 3WQSB 1ENPA 3VVCA 5HM8A 1HLDA 3WQQA 1Q0HA 3JTMA 1DAOA 4BHTA 6ADHA 1N1EA 1FMCA 2WJPA 4HFRA 2GO1A 3WGZA 3O03A 3O38A 4OOEA 5F21A 1NVMB 4RQUA 4CM9A 5CDSA 2QYSA 1DHRA 4RF4A 3Q3CA 4KOAA 4FJ0A 2V6MA 2BFOA 4ZQGA 1GUZA 2P5YA 2YZ7A 5KKAA 3W6UA 1ADBA 3QWIA 1TXGA 1EEHA 3D64A 1MG5A 1C0PA 2CDBA 4UVGA 2NV6A 4Y67A 4PLZA 1A7KA 2YY7A 5H82A 1CF2O 1PGJA 2F00A 2HRBA 3U3XA 3F9IA 4CV3A 4MJLA 5K9ZA 1U3TA 3UGKA 1JKIA 1BMDA 4U7WA 2B5VA 4LSWA 2CVQA 4YAKA 4WOJA 1CIVA 3JQAA 3OJLA 8LDHA 1BVRA 1D8AA 4LVUA 1UP4A 3JQAD 2P4QA 2ET6A 5JCJD 3MZ0A 3UVEA 3CXRA 2G76A 1P3DA 4GKBA 4XQ9A 1GYRA 1CYDA 4MVJA 2YYYA 4BO8A 2PGJA 2W4QA 2BGMA 3CIFA 3OSUA 4QQRA 2IXAA 4R5HA 3V2UA 3HDJA 4GAEA 5CEEA 3ASUA 1XEAA 3QRWA 1HDZA 1NQ5A 1BHSA 4CM4A 4PLTA 2PH5A 1E1KA 2ZB8A 2EP5A 4CR6A 3QSGA 3OIDA 3X2EA 2HO5A 3RIHA 1I3NA 2UUOA 3KO8A 1CETA 2AHRA 5F5NA 5JAIA 1YB5A 4DGSA 2NVUB 5BT9A 1B8VA 3BHMA 2F1KA 1D4FA 1GU7A 3HJAA 4BQPA 5ENDA 1FK8A 3L6DA 3B70A 3EHEA 3RSHA 3NYWA 1NWHA 1YL5A 2B83A 2YQ4A 4QFCA 2QG4A 2ZTLA 4BVAA 1ULUA 1WDMA 1VI2A 4F45A 4FFLA 2QZZA 1P1RA 4NDNE 2BH9A 4UEJA 4UUOA 1N1GA 1GEGA 4J1TA 4E21A 5L4SA 3HB5X 3HDQA 4CV0A 3BMCA 3C7DB 1M75A 4BO5A 1LSOA 5K6AA 3V1TC 4YRDA 5MDHA 4HBGA 4R9RA 1SO8A 4E6PA 4BMVA 4E5NA 2I67A 1Q7GA 1C1XA 2OOSA 4KTTE 1I30A 3PYLA 4NJOA 2ZB7A 3GC6A 1HF3A 3FTPA 2VRBA 1GUYA 3FNFA 1D1TA 4IDGA 2O3JA 1H94A 3DWFA 4XR9A 4ZICA 1EE2A 1UP6A 2EJVA 3JQCA 3ROQA 1GZ6A 4UVDA 4BNLA 1OC4A 1IPEA 1UDAA 3DBHB 5IFLA 5A03A 4I9NA 3PZBA 5GZ3A 3D3WB 3JYLA 3A1NA 1GTMA 3GOHA 1LXCA 5BSEA 5T5QA 5KJEA 3E9QA 4HKTA 2EW2A 1GUFA 4RDHA 1IL0A 1EVYA 3SXPA 1BW9B 3QVSA 1YJ8A 4KDEA 2O7QA 1PJQA 1EQ2A 1BRMA 2B5WA 2ILTA 2XPCA 1SPXA 3EZLA 3L07A 1GEEA 2EWMA 1KY5A 5TLSA 4CMKA 5T57A 1ISJA 2X5JO 3NDRA 3PHJA 4NFYA 4R1SA 3TDKA 1NBOA 3WGYA 5U1PA 3RFTA 3ZWMA 3O9ZA 4IGEA 1KVSA 2GRAA 2AXQA 2GZ2A 2OBNA 5BR7A 3H6KA 2EKQA 1I0ZA 4YVFA 3EMKA 3FD8A 4A27A 4FOOA 4JROA 2V6FA 4XR4A 1B2LA 4OXNA 4CLXA 5A06A 1KC3A 1U5AA 1ZSVA 5A3VA 5F1KA 4L4XA 1ZIDA 2AG8A 1EFKA 2B35A 1EK6A 5IXYA 5IDXA 3FCOA 2BGLA 3LSYA 2UYYA 5EINA 3SJ7A 4ND3A 1GZ3A 3BTUA 3PI7A 3TSCA 3FPCA 3HN7A 1LLCA 4R9SA 1R0KA 2VCYA 1KY4A 2O3RA 3CTMA 3FR7A 2C82A 3RC7A 1O8CA 1NQTA 5JLAA 1K6XA 1GDHA 5AYVA 5ICSA 5I9LA 3KYDB 5G4LA 3I4FA 1ZH8A 4M49A 2D4AA 4IPTA 1ZVMA 5B4VA 2FP4A 1P31A 4JBHA 3VPSA 5I9NA 2C2YA 3AI3A 4CJXA 1J5PA 1GR0A 3JYOA 3HDHA 3R0IA 2AW5A 2VUTA 4BOYA 2OO5A 4R1TA 1DXYA 2V6BA 1JLLA 3H5RA 4DC1A 1PU2A 3NJ8A 3F5SA 1U28A 4RCVA 2WD7B 4MOWA 4CLHA 4XRRA 4ALKA 1RKXA 1PR9A 3QVTA 3LLVA 4XGIA 3JQEA 3HNPA 1X7GA 4XDYA 4ZQBA 3DZHA 1E7WA 4YAEA 4J16A 2AE2A 4DRYA 4YACA 2E6UX 1A27A 2ZCVA 1R4MB 1VLLA 3TQHA 3EY4A 3PJGA 1YDEA 2I6TA 1JTVA 3H4VA 1T2DA 4E5KA 5EIOA 4XQEA 3R1IA 1I24A 3CKYA 4LVCA 1LLDA 4OQYA 2YHIB 2NSDA 2J3HA 1RM4A 1JA9A 4ZJUA 5AVOA 1PS0A 1JU9A 4WNIA 3E9NA 4F6CA 3UKOA 1MG0A 1MC5A 3TJRA 4I5EA 1IULA 2PGLA 3VH3A 4W9NC 4Z9YA 4CMGA 1PSDA 2DM6A 2PH3A 2WYUA 4XRGA 4JBIA 4WOKA 3FBTA 4L73A 3GG2A 3KOUA 1UZLA 1WZIA 4KQWA 4YA6A 1VC2A 3ZV6A 5KCZA 4URFA 1GV1A 3LZ6A 3PWZA 4YQZA 5THQA 4XGNA 4OO3A 4L4SA 1OFGA 1ZSNA 3JD3A 3BA1A 2TMGA 3W8EA 1NR1A 3HDYA 3V2GA 4DQVA 4UUPA 4D3DA 1NM5A 1RWBA 3A4VA 4BB6A 3ZGYA 4MVJE 2PNFA 1EDZA 3G49A 1GD1O 2NNLD 5L40A 1YB4A 3PPIA 3IKTA 4QO7A 4B4WA 4IXTA 2VWGA 3DAGA 3AUAA 3Q11A 3SLGA 3LF2A 4MP6A 3WYBA 1WDLA 3R3SA 3LVFO 2FSSA 2JFHA 2Q2VA 3FNGA 3UCFA 3IQDB 5KJ1A 1ZSYA 3GR6A 3R3JA 3GUYA 3V1UA 4EUEA 4NU5A 4BB5A 5TX7A 3I6QA 4CM1A 1QR6A 3MJ4A 4XJSA 5F1PA 4KUHA 3NDIA 5MGBA 2G82A 3VTZA 3B1KA 1QV6A 1QRRA 5EMHA 3RBVA 1EVZA 1QMGA 4Z0HO 4K9DA 4NZ9A 3WXBA 3DHEA 1U4OA 5A5FA 3OFSA 1TEHA 4E32A 1T4BA 3VZRA 4JX8A 4U8GA 2VWHA 5IDYA 3RFXA 3GNSA 1BTOA 1GAEO 2ZB3A 1X7DA 3AM4A 4TMFA 3ZNQA 3S55A 3B1FA 4HP8A 2XXBA 2EKPA 4ND5A 4IJUA 4WK6A 4QX6A 4GH5A 1LNQA 3AOEA 2CUKA 2HKIA 5U4QA 3ZHYA 4CQMA 1LDGA 3LF1A 1BG6A 1GCUA 3CUKA 4RPGA 3NTRA 1V35A 2C29D 1W73A 3INTA 5FI5A 5G4KA 1SC6A 1N5DA 3BMQB 1CWUA 1E3LA 3PWSA 2DQ4A 3JQFA 3NAQA 4IDAA 3S2FA 3EW7A 3GFBA 1IZ9A 1I3LA 2UV8A 4EJ0A 4W4TA 4GX5A 3K6JA 1QLHA 5L53A 3RUDA 4DBVO 3PVZA 1P44A 2C5EA 4TSKA 1WDKA 3FNEA 4J1SA 4PG6A 2DTEA 3DTYA 4IM7A 4PRKA 1HWYA 4J9VA 4TRRA 3RKRA 4C4OA 3HUDA 1LTHR 4J90A 4D41A 4EJ6A 1SBYA 1NX6A 3OH8A 1XLTA 5JDCA 1DIHA 1ZUD1 3VZQA 4B7CA 4TWRA 1LQTA 1WMAA 4Q3EA 2QIOA 4RVGA 4YR9A 5IZCC 1SB8A 4NU6A 1N2SA 3B6ZA 1GYPA 3Q9UA 1I2BA 1Z75A 2Q1TA 4NBTA 1TT5A 4JLWA 3M2TA 1RYDA 3JQGB 2RIRA 2WMDA 2OFPA 2VOEA 3GRPA 2FPPA 4GWGA 2VUUA 1VM6A 1NFFA 4BKRA 2Z1MA 1JWAB 4JJIA 2FR8A 1DLJA 3L4SO 4N5LA 3WNVA 3T7EA 5L4NA 5T6BA 1DC6A 1H5QA 2A94A 3PQDA 4D45A 4OHUA 4WLEA 4HX5A 1Y1PA 4Y8VA 4YQYA 1NFQA 1E3IA 4Q3AA 3L6OO 5KVSA 3CINA 9LDTA 1NQOA 4PLFA 2CY0A 2CZCA 1HYHA 2P2SA 3OF2A 4P4NA 5ES3A 3IMFA 2VOJA 2DBQA 3RU7A 1SNYA 3S2GA 2BELA 2ZQZA 1HTBA 4QFDA 2NUAA 1ZW1A 2PA3A 4CL3A 2C5AA 3GDOA 5L95A 4BUCA 4BGIA 3ZWAA 3L4BA 5F1OA 2HJSA 4UUMA 5B12A 1UXIA 3H2ZA 4BMSA 1X1EA 2POQX 3GEDA 3QQPA 3L0DA 2DPGA 1DBVO 2P91A 4H16A 4R51A 2PR2A 1O89A 3OJFA 3DBRA 2NVWA 3H9GA 2JCVA 1Q0LA 4Z9FA 1YOVA 4D0SA 4BKOA 4BO2A 2V65A 3K8ZA 4RDIA 3VTFA 3SX2A 5IN4A 4GGOA 2G1UA 3C3XA 4LN1A 2CNBA 4NG5A 4R3NA 3D7LA 1NVGA 3PHGA 4TVBA 3W8FA 4ALIA 2YFHA 5KNLA 1PTJA 3FSRA 3JQ8A 2V7PA 3GAFA 4HFNA 3DBRB 1V9LA 3JCZA 3U5TA 1X14A 5JAQA 4CQLA 1O94A 4G81A 3OECA 1JW9B 4HWKA 4NH4A 4PZDA 4AJJA 3MJSA 4FC7A 3VZPA 1LEHA 2NACA 4RVUA 1MXFA 4UAGA 2Z1NA 4GL4A 3RVDA 2VUSA 1GADO 5DF1A 4Q3BA 3R6DA 1XA0A 3F4BA 3WB9A 4D7AA 1E3JA 1PR3A 1S7CA 2WEKA 4YT2A 4IIUA 2UAGA 2NLOA 5BNIA 2C7GA 3ZV5A 1LJ8A 2VZ0A 4XGKA 1BSVA 5CHEA 3HZZA 5TT1A 4E5PA 1U3VA 2VTEA 1LDMA 1DC4A 1ENZA 1FDWA 5JDIA 4ZHSA 1QYXA 2AQKA 4NJMA 4YJHA 3C1OA 1GQYA 2IZ0A 3TL2A 4AL4A 1HE5A 1DIAA 1VSUA 3JQ9A 4YTEA 3TZKA 3ORFA 5FWNA 1I10A 1ISHA 1UH5A 3HWRA 4CR7A 2FPIA 1JQBA 3ZHXA 5G0VA 2R00A 2PLAA 2AEJA 1L1FA 4BV9A 1KVTA 1PJBA 1W4ZA 2GPTA 3ANMA 4GX1A 5EN4A 4EJMA 1I01A 1SB9A 1PGOA 3HFGA 2Y68A 5CDUA 5TQVA 2BRUA 4YJHB 4MIYA 5JC1A 2QX7A 1U7TA 3U4IA 4NMHA 1PJCA 2QHXA 3QIVA 4BNHA 4BNVA 4XQGA 2X5KO 2X0JA 3WSWA 1MA0A 4YXFA 1OAAA 4IMPA 4WEOA 3JYNA 3UOGA 3IKVA 1A71A 5HA5A 3WBFA 2GSDA 3VOSA 1PGQA 4JJGA 4D3SA 3K9QO 2PKQO 3D3EA 1SMKA 1ULSA 1C1DB 4YCAA 1Y9AA 1DRWA 1PJ3A 1XG5A 4LMRA 2BI7A 5DOVA 1GYQA 2I5PO 3IJRA 1J0XO 4TKMA 4CLOB 1M76A 1HZJA 4DQUA 5ITVA 4NNJA 4MKXA 3ZN2A 1Q7CA 4B4OA 4XIJA 1H6CA 4K1LA 1HRDA 4II3A 2I3GA 2JFFA 3TL3A 4IJVA 4A73A 1ZO8A 1YQXA 4KWIA 1XIVA 1NTOA 2J5KA 2VZ9A 2EERA 3PIIA 4GLLA 1G0NA 3LQFA 4CR8A 4GX0A 4PG5A 1YRLA 5FYDA 1ZEJA 5LDHA 1H6DA 4XYLA 4QSMA 1I8TA 3GFGA 3O8QA 3PHLA 4H15A 4P8RA 3F3SA 1JN0A 4E4YA 4E0BA 5DZSA 3WR5A 5FI3A 4BNKA 2OZPA 3GGGA 3AU8A 3E6AA 1ZNQO 4I9HA 3OQ6A 4J91A 1Z73A 2ZYDA 4CM7A 4P4GA 1LC0A 3GPIA 1P74A 3I9MA 4FCCA 1XGKA 2O4UX 5G2OA 4ZVVA 1I5RA 3KZVA 4Y6PA 4MIEA 5COQA 1C14A 1IB6A 2JKVA 2GGSA 5L3ZA 2OUIA 3QVWA 2FY8A 3C8MA 2PGDA 4DMLA 4KQXA 2R2GA 1E7MA 1B26A 2W90A 3LT4A 4L75A 5DBIA 2ZJ1A 4Y6RA 2NQTA 3PEFA 5JMWA 3L9XA 3RC2A 2IDZA 3BHJA 3LK7A 1NQAO 4J7CA 1GL3A 3DO5A 1C0IA 3LC7O 1EFLA 2HK8A 3QLJA 3M2PA 3WS7A 3NT5A 4PG4A 5L45A 5EJ2A 1E3WA 2GR9A 4HNGA 2GZ1A 1LUAA 1PZGA 2DUWA 2NADA 2ZB4A 3DL2A 3IC5A 3O26A 2OP0A 1D1SA 3ULKA 2O3TA 4CPDA 1YBAA 1H0KA 3K2BA 5JCJA 1DLIA 4A03A 3QV1A 1M67A 1PL8A 1YL6A 5JNLA 1DPGA 3GNQA 3PJEA 4J6FA 2Z95A 5DCYA 4EEZA 4ZU3A 2RHCA 4Y98A 1WMBA 2JHFA 3G1UA 3H8VA 1E3WB 1R6DA 4WECA 3RBXA 4BO0A 1YJQA 1IHXA 3ABIA 4Z3DA 3CEAA 1NNUA 3JQ7A 4FSHA 2I3AA 4Y9DA 3RKUA 4PLYA 4EUHA 3JQAB 2JAPA 3MJEA 3OQBA 4NFHA 5C7IO 5L9AA 3DAFA 5CEJA 3EAGA 1EMDA 3BMNA 1MXHA 3ZI0A 5CFZA 4XEHA 1V3VA 2Y1GA 3BYZA 3U49A 2EXXA 4GSKA 4X54A 3KEOA 3PHHA 4II2A 4TVOA 3EUWA 3OHSX 4NK4A 4GX2A 1AXEA 2X4GA 4AJ2A 1M2WA 4FC6A 1DHTA 1SAYA 2IZ1A 1JVSA 2Q1UA 4CM4B 1PZEA 4DMMA 3H9QA 3OM9A 2PTGA 3QHAA 3UUWA 2NTNA 4M54A 4XA8A 3VDQA 3HADA 4BO1A 4PLCA 1ADCA 3BMNB 2NWQA 3RAJA 3WIDA 1Y8RA 1W6UA 1LLUA 3Q9NA 2IRWA 2QQ5A 3H9JA 2VRCD 3DMTA 4B7UA 1VKNA 2NTJA 1EK5A 3H9UA 4ONEA 3KHUA 3RUEA 4CV1A 3ETGA 3GLQA 3WJAA 1QSGA 3W4JA 4ND1A 4Y6SA 4P22A 1VL8A 1ADGA 4R68A 1P33A 3RUHA 1AN9A 3PXXA 1G6KA 5ITWA 3H3FA 3T4XA 3BMCB 3Q1LA 2JJYA 1M66A 5KVQA 3UN1A 1R16A 3E48A 2X86A 4H7PA 4IQGA 3QW2A 1MV8A 4PRLA 5EPOA 4R54A 4IQ0A 1C1XB 4RVHA 4N18A 4RPHA 5G0UA 4AJKA 4JBGA 1R37A 5JPIA 4N5MA 1WNTA 4IJWA 3GN2A 3U4HA 3ZWYA 4WLNA 5JW6A 4WCFA 3U09A 4RQTA 4FJ2A 2XF8A 4R01A 4R1UA 4AJIA 1I3KA 1V3UA 4GLOA 4OSPA 4RZHA 3ENKA 1L7DA 4DA9A 4CLEA 3ETEA 3OP4A 2O48X 4JN6B 1MUUA 4UULA 3ANNA 2B69A 4XJTA 4CLDA 2FRDA 1DDOA 3ZWOA 2HCTA 5DBFA 1Y7TA 3WGGA 4WCFB 1NASA 4O5OA 3W1VA 4BO7A 1FDSA 1LQUA 1NWCA 3E5RA 4S3MA 5IZ4A 1P9LA 3ZWNA 3JSAA 3A06A 2J8ZA 3CZRA 1JWBB 4YDRA 1PGPA 4XDZA 2NU9A 2ZATA 4DREA 3HFSA 4BNXA 4M87A 1OMOA 4FFNA 1GPJA 2Y05A 2Q4BA 3LU1A 1C0LA 2CF5A 4QUKA 1A4UA 4I5GA 3SEFA 3QE3A 2X0RA 1U2GA 1P1JA 2VYND 3UCEA 3ZHZA 3I1JA 2Y1OA 1KEPA 1T26A 2AEMA 2EHDA 4IMRA 3NDJA 4LW8A 1VJTA 1YBMA 2GNAA 5DN9A 5LDGA 3UICA 4PG8A 4AICA 5U9CA 3SJUA 4I08A 2G0TA 1O9BA 2CDCA 4BNYA 3P2OA 2YJZA 3NKLA 4NBUA 1VL6A 1R66A 3PDUA 3COSA 3I3OA 3VH2A 4KMSA 1DAPA 5JO9A 4CM8A 1U2DA 2IEBA 1ISGA 1HE2A 1UDBA 1VRWA 1VL0A 2ZJ0A 1XELA 2PK3A 4IJKA 2E37A 3PDJA 4F6LA 5COAA 1DOHA 2O4CA 3F5QA 4DLLA 5CDYA 5ADHA 1LRLA 1QYDA 3ADPA 3RJ9A 3H2SA 4FW8A 2J5QA 5ICMA 1B3RA 4BIIA 1H93A 3GDGA 1ZBQA 1K3TA 2Y1DA 3F47A 5L7TA 4CM8B 3GMSA 4NBVA 1S6YA 4YRBA 4QTZA 4TRNA 4J0EA 1U7HA 5BNFA 2FZEA 4AFNA 5JMPA 2J3IA 3VHRA 3I83A 4NBWA 3NV9A 4RLSA 1HXHA 1XKQA 5EERA 1I33A 2E49A 2E48A 3MTGA 1PIWA 1PJ2A 1UUFA 3N58A 3AUUA 4LISA 4BL5A 1PQUA 4Q3CA 2Y93A 4RF3A 3WGTA 5B4UA 2Q46A 4U0KA 1KVRA 3NGXA 1WVGA 3P19A 5IN5A 3GVCA 3WOHA 5AQ1A 4Z9XA 5EQFA 3UH1A 4JGBA 2YUTA 4YWJA 3GK3A 1BWSA 2OBYA 4IDBA 4FDAA 3QVOA 5I7SA 1K5HA 5HBRA 2Y1CA 4YAIA 3BTSA 5KOIA 2QW8A 3FR8A 5L4LA 4B8WA 4DYDA 3BIOA 3WMXA 4CMAA 4Q3NA 1E6UA 3K92A 4YAJA 1P1KA 3W8DA 2I66A 3MOGA 4M1QA 3GAZA 3DDNA 1IE3A 4JQCA 3AUSA 1E5LA 3G1TA 4CUJA 1HSOA 2EGGA 2P68A 4IDEA 1YO6A 2OORA 2Q99A 1PWXA 3AM5A 3G79A 1X15A 2H63A 4O1MA 3ITDA 4OYRA 4BKPA 4ZA2A 3PRJA 4OIMA 3DB2A 2P9CA 2CSUA 1U8XX 2C54A 1EVIA 4PVDA 4M86A 4EDFA 1P45A 2X1HA 5HS4A 3RUAA 3PFWO 3TZCA 1MLDA 3Q0EA 4PGFA 3JD2A 1A4IA 4BO9A 5H81A 2QRLA 3WFIA 1DEHA 2RCYA 2DFVA 3GUCA 4YJGA 3INGA 4I5DA 4YBZA 5ER9A 4J4TA 1E7RA 1N9GA 1NHWA 3EK2A 2B4RO 4O63O 3ZU4A 4DWVA 1MFZA 2X8LA 4M89A 2D0IA 1XU7A 3ONEA 5AXCA 3GVIA 1B8UA 4IY1A 3E82A 4ZRMA 2FSVA 3WJ7A 3TZHA 5FFFA 2C20A 2XAAA 1LDBA 4IZIA 3GZ4A 4EGFA 3ZH2A 3DHYA 4IDDA 4CL8A 4EI2A 4WLFA 2HUNA 4L74A 4PN3A 4JNKA 3K2EA 1N9GB 4UVEA 4JP3A 4M55A 1B15A 3BTVA 2XXJA 1ONNA 4QEDA 3WGHA 1R4NA 4GMGA 5A9SA 4Q3DA 5BQFA 3S8MA 2B36A 3DBLA 1UAYA 4E5MA 5TF4A 4U6QA 1Q7BA 1DIGA 3DHNA 2RHRA 1F06A 4E12A 4D79A 2CFCA 4YYZA 5JCXA 3AWDA 2WTBA 3C24A 4DYVA 4EBFA 4ALJA 1H6BA 2IEDA 2A92A 2UUPA 3OA2A 1WZEA 4JXKA 2VQ3A 5B37A 2D5CA 2AA3A 3PYMA 1R4NB 2CVOA 3ZWPA 4KTVE 4U5QA 1CQJA 3PFFA 4CMEC 3DBLB 3A9WA 5LC1A 4FIZA 2FZWA 2C7VA 1VJ1A 4WEQA 2IODA 1KETA 4U6SA 2JCXA 3PLRA 1E6EA 3NJ4A 2BLLA 4HV4A 4W9NA 4XB2A 1HDYA 3IS3A 2OXIA 4F3YA 1A7AA 3OA0A 1T1RA 5KKCA 1BGVA 4QECA 1F12A 4B3IA 4CQMB 4FD3A 1U8FO 1ZK3A 3IL2A 2BGKA 2OHXA 3F4LA 2ZTUA 5G4KB 1WXDA 3C1TA 1B7GO 3BZUA 3NRCA 1IPFA 4FPXA 1PGNA 4JCOA 3WG9A 1E6WA 3FWZA 2X23A 4OKIA 1N7HA 3AK4A 3ZZNA 5C7LO 1ZK1A 2Q4EA 4PFJA 3Q2IA 4Z3KA 2UDPA 3UHAA 3DBVO 4AJNA 4BNFA 4ESOA 5BSFA 3H3JA 3DOCA 2X9GA 1NHGA 3LT1A 1UXJA 1DB3A 1OBFO 4HFMA 2DKNA 2WSBA 3GMDA 5JC8A 4DXHA 1NPYA 1ADFA 2Q2WA 1YS4A 2CD9A 2VWPA 2WDZA 5F3RA 5A05A 5G0TA 1HE3A 2PKRA 5I7EA 5EESA 3BMOA 3I9NA 3KUXA 1UP7A 1XWFA 1TT5B 4MIOA 3IP3A 4BO4A 1F8FA 4ALLA 3OJ0A 2NU8A 4DL9A 3IUPA 3GA0A 4MO2A 5J23A 3ADOA 3WICA 3GG9A 2D59A 3RUFA 1AHIA 2IXBA 4CMIA 1LDNA 3GVHA 3T7CA 1RM3A 4OGWA 3JQBC 1YWGO 4CLRA 2EG9A 3JD1A 3VH4A 4E13A 3ENNA 4RF5A 1ARZA 1DFIA 1V0JA 4WLOA 2P5UA 1WW8A 4JK3A 1NPTO 3IP1A 3MTJA 5G0WA 5IG2A 2VNSA 3TZ6A 2DBZA 3GH3A 1DC3A 1YE3A 1UXHA 2G5CA 3DQPA 2FPGA 3VPXA 3U9LA 3DZFA 1QYWA 3GVXA 1W0CA 2HMWA 3MJTA 2XOXA 3EC7A 1HEUA 1LU9A 4XKJA 1KEUA 4XYBA 1ISMA 4XZ3A 2I76A 3P7MA 4FFRA 2H9IA 2ZTMA 2JAHA 2Y66A 1J4AA 1XQ1A 2HMUA 4OAQA 5EL0A 3W4IA 1ONPA 5T8KC 3D4NA 4IIVA 1CDOA 2DLDA 3JQDA 2DTDA 3DZBA 3EZYA 5JXWA 3KETA 1XQ6A 1I3MA 2ZYGA 2WE7A 5CEFA 2Y0DA 1MC4A 1VJ0A 3DC2A 1YOVB 1GQQA 2PZJA 1Y6JA 2I9PA 3WYEA 1HDRA 6LDHA 1O5IA 4BNGA 2P9EA 3IUSA 1SZJG 2JCYA 3DZIA 1BDBA 1XR3A 1E1LA 2I99A 3S1LA 3GT0A 4G65A 1ZXLA 3T4EA 1NAHA 4UUNA 3DFUA 3DMYA 3JQ8B 4B8ZA 1PS8A 4J43A 4MKZA 4CQLB 1F8GA 4J49A 1BDMA 4HXYA 4K6CA 3GZNA 3AI1A 2EEZA 3ROPA 2H6EA 5IZCA 2EV9A 3ZCXA 8ADHA 4R5MA 1PS9A 3PQFA 4MINA 3STHA 3FNHA 1IHYA 2Y0EA 2J3KA 3BXXA 4GVLA 4HY3A 2JL1A 1WLYA 5A9RA 3RFVA 5KJCA 1JVBA 3PWKA 4MPDA 4RV9A 4PLPA 2X0IA 3BTOA 4BKUA 1EVJA 2AMFA 3H65A 1QXSA 1TT7A 3NX4A 4GSLA 2PFGA 1BVUA 4KP7A 3IJPA 1CQIA 4JP2A 4YJFA 2NVBA 2OP1A 5AXBA 4CM5A 4DTIA 4BO6A 3RUCA 5C5IA 5DCWA 5DULA 4O59O 2EKLA 3NT2A 4LRTB 2CF6A 1SCUA 2BFAA 1LRKA 4C7JA 1G0OA 1LC3A 3K96A 3G3EA 5KIAA 4NJMB 1KYQA 2BD0A 1FDVA 3M6IA 3HE3A 1XYGA 3VZSA 2UVDA 4LSMA 1T2AA 4XX0A 4R41A 1ZKMA 4INAA 4OJNA 4E33A 4AJLA 4E31A 2ZYAA 1LSSA 1NVTA 4YAGA 4HNHA 1J6UA 5CP8A 5IJZA 2DTXA 4XB1A 3I9JA 2W2KA 5KWEA 3WDSA 3ZWBA 2HRZA 5GMOA 2AG5A 1HZZA 1UJMA 2AQHA 2BI8A 3TNLA 3TOZA 2NU6A 2YHUA 1VPDA 2O3SA 3FHLA 1A9ZA 1FF9A 4NIMA 2DBRA 1PZHA 1MFPA 1ZK4A 4QT0A 4AJPA 2X9NA 4A0SA 1F17A 3KSUA 3I23A 3ITKA 2JD0A 1EZ4A 3CMMA 4RPLA 4TRJA 2HAEA 1T25A 2JD2A 3I52A 3VKUA 4MVJM 1ZJZA 5KVVA 5A5EA 1EBUA 4XYGA 1UXKA 4NK5A 1KOLA 3V2HA 4N7RA 4WJZA 3W6ZA 1BXGA 3LC2O 2YW9A 4PLGA 1X0XA 1YONA 3ICPA 4RF2A 1JAYA 4ALNA 1BXZA 4DBZA 1KC1A 3EVTA 1KBZA 2QZ9A 4J0FA 4MP3A 1GV0A 1JKFA 1P1IA 4C7KA 3F46A 3SC6A 1Q1NA 1HDXA 3HG7A 4DQXA 3ZW9A 1D7OA 3EYWA 4UVHA 1NYTA 2GZ3A 2NU7A 3QJ5A 2HK9A 3C85A 2BFMA 3TRIA 4EW6A 3O8QB 5DOZA 2LDXA 4BNUA 2GN4A 4XQCA 1LLQA 5AXDA 4BNNA 1U3WA 1RPNA 3PGJA 5HWSA 1UZNA 1YB1A 2Z5LA 3LT0A 4XD2A 5K6AC 1TI7A 4WLUA 1LSJA 1ENYA 4B4VA 5DDIP 1Y8QA 4OMUA 4WNCA 1ZXBA 2CVZA 2VYVD 3TN7A 4RVDA 2RAFA 4IQ8A 1BXKA 1F0YA 4ZQFA 5B1YA 3VPGA 3MWEB 3TWOA 2HMTA 2Q50A 1O95A 4MVJG 5DCUA 2FR1A 3H5NA 1Q0QA 5CPBA 1R12A 5TGDA 3N7UA 5KJ6A 4RZIA 3LYLA 4QXMA 2DC1A 5CAEA 4CM9D 5ILOA 1Y8QB 3TFOA 1WPQA 4O0LA 1NAIA 2W2LA 3RC9A 1YGYA 1ZCJA 4CMJA 2FWMX 4E30A 1KEVA 2W2LD 1OOEA 3E5MA 4WCFC 4J1QA 2AE1A 4FS3A 2YFQA 1NPDA 3PJDA 3A14A 1HYEA 4PZCA 2WE8A 1UR5A 3KLPX 2PD3A 2CDAA 4HFJA 3IIEA 3WGQA 1EUDA 4IDFA 1Y81A 3WLEA 4E2ZA 5HS6A 2RBEA
chains in the Genus database with same CATH superfamily
4CRWB 1Q91A 1QYCA 3BE6A 3FUCA 4AJ9A 3ISTA 3UBMA 1Y9EA 2FWNA 4IJ6A 2FQ1A 3CRVA 1FCJA 4W63A 5AM5A 2LP4Y 1E0KA 1YQDA 4GPEA 2QYTA 3H8JA 1F2DA 3ER9A 1HNWB 1JB9A 1DUVG 1GKKA 4BIMA 3WWDA 1MVLA 1ZM2A 1LJUA 2XYQA 2YH2A 2XECA 3D3JA 2NVUA 3OT5A 5I48A 1M2VA 4MJ7A 3EXHA 3RPEA 5EJ4A 1HRKA 2DG2A 3JQ7B 3QEKA 3C6BA 1OBOA 3C2QA 4R2XA 2W0MA 3PIDA 1MGOA 2C31A 4G1EB 4UMDA 2HHCA 4RPCA 2B2CA 2ZQ5A 3K32A 1H2BA 1M72A 4ZOBA 2O50A 2M6SA 4BV2A 1R15A 3LIIA 4L16A 5FH9A 8OHMA 2RB4A 5B30A 5E0KB 1DPFA 1UIMA 1CP2A 2OXCA 4MW6A 1KZ1A 3WFZA 4FBLA 2WAYA 4PFKA 4UEKA 3SQXA 4CKBA 2PZKA 3Q3HA 3KEMA 4KGDA 4J03A 2B8JA 1JG7A 1N5IA 1W8DA 2DAPA 1V3QE 2H29A 2P30A 4KAXA 1NUTA 3BWVA 3I2JA 4MCHA 3RNLA 3FOEC 2FDCA 1Q3TA 1S3SA 3STTA 4F3CA 2ZCJA 1Y5RA 1N92A 1YV9A 4FGWA 1E2FA 1EA7A 1Y8RB 2BUCA 3CX7A 3PQ7A 4G8JA 3TIXB 4B45A 5IDQA 1J09A 2HHLA 5JARA 2QT9A 1TEVA 2FZGA 1W75A 3NBMA 3EE6A 4ND2A 3UHJA 4MR8A 2O19A 1G5IA 2VZ8A 4J7UA 4Y0AA 3H84A 1XL1A 1MO6A 3IQWA 3G5MA 5MF6A 1ODKA 4DEYA 3D2BA 4FLEA 3SVLA 2BFFA 2XBMA 1JDBB 4L07A 5AI6A 1F8XA 2JGKA 3BGDA 3ER8A 2Y99A 2OHVA 2QL7A 4REOA 2FN7A 3DV0A 3D6MA 3DBHA 1OYYA 3GHHA 2Q3BA 2WWRA 1XNQB 3QOXA 5BNTA 3QVKA 1BCSA 1NP3A 1U8AA 2NO7A 3EEIA 4FYXA 5L8VA 4JLDA 4RLHA 2B6NA 2JI8A 1DWOA 1NONA 4LMPA 1K9SA 2FN9A 1UZUA 3FDXA 1XSEA 3DMPA 2KQUA 4ZVNA 3FZYA 3IEPA 4RWEA 4KPFC 3AHFA 2IY7A 3KAPA 1NW3A 3AZOA 3CE6A 3L5OA 3MJVA 3DVSX 4R98A 4QBHA 2WD9A 3UWSA 1YVEI 4D57A 1H9CA 2WU8A 1U90A 4S1OA 3SNKA 1RYHA 2BMJA 4JKOA 1VLHA 2GARA 3FROA 3SHQA 3T1OA 4W99A 3U16A 2ZIFA 1U3UA 3TQIA 2R9VA 4WTOA 5KYWB 4C78A 3DAHA 1Y3DE 2ORED 2YV1A 1BA3A 1NI4B 1U6JA 2FPWA 1E5QA 1U1DA 3FKJA 1T1GA 4MA0A 2A3NA 4OXXA 2DPHA 4FKMA 5EG5A 5AW5A 3PGKA 4BNMA 5L3QA 5A0TA 4RS3A 4MUHA 3TGWA 2ETVA 4FUQA 2GT1A 1Q1BA 2ZS7A 5HCUA 5K3CA 2WYVA 4A2CA 5BWMA 1PV4A 3V3KA 3T5CA 1EBFA 1QQBA 1CNMA 4CVNA 5AESA 1J25A 4RXTA 5H3LA 4NPCA 3JQRA 2PLNA 2GA9A 1KERA 1XK7A 3UMRA 3DXXA 3DOOA 3SP1A 3D4PA 5EJFA 3VR0A 1J24A 2IYEA 3WX0A 3DW3X 1SBNE 1G42A 1X1CA 2GBLC 4H27A 5JAHA 5K0GA 1PDOA 2BWJA 3HM9A 2E89A 1D6MA 3TLKA 2R6CA 1X1TA 1OZ0A 5BMOA 1YMUA 3GVPA 1V3TA 2YY5A 3VC7A 3VPAA 4KXVA 3PL1A 4KR2A 3A0RB 2P2DA 5J2UB 4COKA 2CT8A 4H3VA 4EB3A 3Q3GE 3HJHA 3AH8A 3AETA 1OAKA 4I6GA 2C2XA 2R1VA 1TUBB 3PHCA 3I9OA 1U0TA 3QLUA 4ZD6A 5KTYA 2UZ1B 4HVLA 4MGHA 4NZOA 3GQVA 3OKPA 1Q1QA 1U0NA 1V1MB 4ALMA 3CE9A 3AUFA 1DKMA 4UUBA 1G9SA 4JVMA 4BYGA 1T5SA 1FS6A 1O6ZA 1QVAA 2H17A 1NJSA 2PMWB 4K6MA 4MVCA 4TXHA 3ZLUA 5REQB 3I2IA 4I4IA 4X6YA 1CRWG 3AVTA 5JXGA 2HN9A 5T67A 1IRIA 3W2IA 4ISCA 2O07A 5G1PA 3NNSA 1TX4B 4YP0A 5GGYA 1Z56C 3N8DA 3GU3A 1K6JA 2GEUA 3WRVA 2ZRAA 4BQIA 4DTCA 3L77A 2XB9A 5EXEA 2IUYA 2LTAA 3AIIA 3PNSA 1G8JA 4D8XA 2P40A 3CSDA 2R2AA 1X7YA 1MMFB 3M6LA 3L8CA 1DT3A 3OZVA 3RFFA 2A4KA 4KIFA 4DLAA 1H4SA 2JK0A 4FN4A 4L9WA 4L76A 3T94A 3WLSA 2IP2A 1XXHA 4M9RA 1GZ4A 2CHFA 2KYRA 2HJGA 2Q8QA 3PT5A 2QDXA 3LDHA 3Q72A 2D8AA 2GPAA 4JLPA 3QE4A 4AY5A 1CF4A 5ULLA 2Q3EA 1XZNA 3BC1A 1XK6A 2QT0A 1Z7GA 2W6ZA 1HA3A 3VPDA 3WIEA 4CODB 1N33B 2O7VA 2YV3A 2DWPA 3H1TA 1FC0A 4LGVA 2HTEA 3R9KA 1QAOA 4KDCA 4X1IA 2ECPA 4YB8A 3EVNA 4I8DA 5DB4A 2OGTA 1NSYA 3IOYA 2XF2A 1KXJA 4OHZA 1TQ2A 3VISA 5KOHB 1PZNA 3NAMA 5CA0F 4BRUA 4HQNA 4TZTA 3RWOA 3UAGA 3AOEC 4Z0TA 5A04A 4OH1A 1PZFA 2P5TB 4UKDA 1FP1D 1T0UA 1VMKA 2PSHA 3K0AB 2RGNA 4V39A 1TZKA 4WE3A 1E0AA 4MYCA 4N4AA 4KR7A 4YPOA 3VHXA 4CMBA 4OD0A 3KTDA 4DILA 3H5VA 3QVVA 1INLA 4E5VA 1V7CA 4BXOA 2ZE6A 1DRVA 2VSXA 4KAJA 4LY0A 1EYZA 1ST2A 2OHFA 3B85A 3F71A 5LQKA 3NNDA 1N2ZA 1WY7A 3RYHA 4PZYA 4RD4A 2ZXUA 5AW0A 4AY6A 2KLHA 2XNDD 2QLMA 1RXUA 2O7SA 2BF7A 2FZCA 4AC9A 1RWVA 3GIDA 5C37A 3SZUA 1EDDA 3ND8A 4J7AA 1UOOA 2X2PA 5FFNA 1YDWA 4K46A 3SU8A 3ZNOA 5CDGA 1PEYA 2JS7A 4CU5A 2C0CA 4B4UA 3F1LA 2PUHA 2WC1A 3P4XA 3ZE0B 3K35A 5EAIA 1V26A 1O4VA 2GDZA 3AL3A 3WQRA 1ID1A 2QX8A 3OM1A 4PSDA 3STYA 4PYKA 4OM7A 1XZBA 1WOMA 4HBZA 4ANFA 2HK7A 3FKSA 4LYFA 3BXEA 3V8NA 3VOBA 1UKCA 3AW9A 1NT4A 3DULA 1ZAKA 1AHHA 4JS0A 1FYVA 1P0FA 2I78A 1Q1GA 1TIPA 1JRLA 4M1OA 1KAEA 4KI7A 3BH6A 2JIOA 1ZL2A 1O6GA 1BHJA 1X1DA 4IXMA 5E6UA 4BVKA 3TMYA 3D8NA 4XUEA 3NFYA 4TM7A 4YJDA 4F60A 5SYMA 4P7BA 5C35A 1JH8A 3MT9A 3A9VA 3ONDA 4M7PA 3H9EO 3L5KA 5IAKA 5H02A 1F7UA 2ECOA 3AEKB 4FYJA 1OJLA 2C92A 4FZRA 2OLJA 2I65A 2RHMA 5COBA 2PT7A 1EUCA 4H4EA 4ETNA 2W11A 1M1NB 1R0SA 4BASA 4Z54A 4CEHB 3KD3A 4RMNA 3I8OA 1J0AA 3MUFA 4DEXA 2PHZA 4BQOA 4QARA 3T0FA 2D7CA 1QOQB 4TZKA 1QGDA 4AT1A 2GXQA 4A26A 1F0KA 2WJ6A 1GY8A 2PSDA 2QRHA 3HACA 2JGMA 1XDWA 3NVAA 4MPPA 2B1RA 2CLOB 4YH1A 4B3XA 2IZZA 5KOYA 3TLBA 3EEYA 3IPAA 4L5JA 2HX1A 4QASA 1E60A 1GCAA 1EBBA 3OQIB 4PHGA 3R7WA 3KQWA 3WB1A 5A9SB 1PHPA 2EDCA 3BH0A 4ID9A 4PVCA 3WLFA 3LNCA 1ODSA 1RQLA 2AV6A 3Q2KA 4IHQA 3RU9A 5DHAA 3R75A 1OI2A 2W0SA 1RWKA 4B6GA 1YQEA 3A04A 3QHPA 5JXIA 3DO8A 2B4TO 2PG3A 1X0VA 3FUVA 4PLHA 4RGBA 3N2YA 3WTBA 3PNPA 3NKVA 4BBAA 1T8PA 2FMIA 3QMWA 1BRTA 4A0GA 4V0QA 3CXUA 1A97A 3BMQA 3TPCA 2XUFA 3TUJC 4BO3A 3GCZA 9LDBA 5DBEX 1RYEA 4MJ3A 2FW7A 3EZ6A 3NU1A 3RARA 3WYCA 1XWIA 1DXOA 4FBMA 2EP8A 1AKEA 5ARCA 5BN4B 3EXEB 1WABA 4HGNA 1QPBA 4QQ8A 5B7GA 5LL6P 2O5CA 1BX1A 1W9HA 4YCBA 5FEMA 2POCA 1YKFA 3RHFA 1XC7A 4OHVA 4ZJYA 4OMDA 1VIAA 3CNNA 3F7OA 4BJ6A 1YR2A 1K6IA 2AEFA 3WNQA 4WN3A 3PFBA 1T3HA 1AZTA 2GAAA 2WIAA 4P98A 2FG5A 5EWMA 2ZOSA 5I8ZA 3H9CA 1E9BA 2VF8A 5A6VA 4GQBA 3D4OA 1NMSA 4X8HA 3SKYA 1Z0UA 2AWOA 1PJ4A 4ZKEA 1OXMA 3A3NA 2ZAGA 3BAZA 3FTDA 2ZXFA 4Y6OA 3VI3B 1NBIA 4L4RA 1XE3A 2LW7A 2Y1WA 2WG1A 3O8OA 1UBMS 5K8VA 3KQUA 3D3KA 1ZU4A 1QRDA 3VR6D 2NV2B 4OXYA 4BLOA 3FW1A 5I7VA 1R00A 1LFDB 2PL1A 5E6SA 4C1BA 2GFHA 2ZRNA 1RADA 3DL7A 2GBIA 2J6IA 5KAMA 3E9MA 1L4NA 4OQMA 1VG9B 2AN1A 1U1FA 2WWHA 3KL4A 2FF7A 4M7OA 4Y1GA 1R64A 3RASA 4ARZB 4E11A 2C4MA 4PWYA 4M1TA 2C9CA 3ZV3A 3S28A 3THXA 3WY9A 4W5OA 4AAYA 4K0RA 4ENQA 3TKYA 1XX6A 1QS0A 3DLAA 1WQ4A 3SEZA 2UYGA 3O95A 3ZWQA 2JH8A 4F46A 4MYRA 1KIFA 2Q3HA 4A0FA 3CPSA 1ZH2A 4HX2A 2NXWA 5JDIC 2VDQB 2YDXA 3S1AA 1XZQA 1DX9A 2ZRMA 1PG5A 3KLOA 3TGPA 1ND6A 3DA8A 4G41A 1GTZA 4V0LA 4MQFB 1O96A 1C3JA 5CK4A 5IBRA 1ORRA 4BQRA 2X8AA 1LBEA 1DJMA 4L28A 2PX3A 1JDSA 4X63A 3RM3A 5LVAA 2CSXA 4PTZA 2E21A 2E4YA 3NWJA 4AS3A 3BMOB 3I2FA 1Z0KA 3P2EA 4IO0A 5EMNA 1LDEA 1ZEMA 3HPRA 3NOQA 5GZ6A 3X0DA 5CFLA 4M36A 5HRUA 2C3OA 4LTMA 1RSZA 1N5OX 1B6RA 4L0QA 5AI9A 4ERNA 4V0KA 3T7SA 3IR6A 1WPRA 1QP4A 5B7NA 1I6MA 2D3TA 4QE3A 3JVIA 3FOWA 1LS6A 2VH2A 5JE8A 3V55A 3ZXUB 2B1QA 2NV0A 3KYCA 3E7DA 1BKYA 1GFWA 5BMVA 5HQ3B 3ZDBA 3EZ2A 3KU4A 2BTOA 3QOWA 4BGEA 1PJTA 2PRSA 4CMIB 4WCDA 3WSVA 3YASA 5CNMA 2FHSA 2XHZA 3C8DA 4HDOB 3FTNA 2HEIA 4JDUA 3UGJA 3TFWA 3N05A 3LQYA 3N74A 1WP4A 2P4EA 5JSUA 4RTRA 1QC5A 3LUPA 5CA1F 5HKAA 1VZ3A 1MJNA 1MB0A 2BKAA 4LYJA 5A3JA 5JSQA 5GJCA 1Z83A 1JLMA 4OBXA 3ZE1B 4BNIA 3RO7A 3NG1A 2C0PA 4R4JA 1YBFA 3E1KA 1Q15A 3D6AA 5TC4A 2CFIA 4QEZA 2Q3DA 4YLGA 4WADA 3BKXA 1JQAA 2D7JA 2IPAB 3BRWA 3S4YA 4L6CA 2QUJA 1YCDA 2NX2A 4K9KA 4CHTA 1D2EA 2I4MA 5EMKA 4MW2A 4CEJB 1CZOA 1ZOIA 2C2KA 3CZ9A 3G68A 2CLHB 5DYYA 1G1AA 1ZD1A 1HT0A 2D5IA 3A27A 1M5RA 3WK6A 4INZA 4L5CA 3ZIAA 2LKDA 5H3HA 3RUPA 3ZGXA 4TKVA 3LUAA 4AZ0B 1MX3A 1TUIA 4C05A 3RT9A 2W4IA 2YZMA 1FJHA 4AN1A 2Z5VA 3USZA 2P4SA 3OCYA 1JG2A 3J81k 3GJ7A 1OXBB 1FSFA 4ZT5A 3WMFA 4PLVA 4C6HA 1RYBA 4V0MA 5BN5A 3K70D 3TLCA 2NM0A 3OWXA 3NHSA 1YI0A 5IFKA 1GT91 1C9KA 2H5LA 2PMKA 2WM9B 3GN1A 3P5SA 4RORA 5K2OA 4Y6QA 3L9WA 1NXXA 4ZVSA 4ZHQB 1O94D 4TLBA 1Z0FA 1H6AA 3UGQA 3M4ZA 4A3SA 5DW0A 2WWFA 1I36A 4DCMA 1XMPA 2RAPA 4XWAA 3U7HB 4URYR 1A8QA 3MS2A 1JR2A 1FX0B 3MF4A 1P5JA 3ILHA 4HQRA 2P9ZA 2CBXA 1NQXA 1MABA 2N1BA 3O94A 4INOA 2B37A 3EPPA 2JKYA 3AG6A 3I9LA 3L1UA 4GI2A 4KQCA 5MN5A 4BVEA 4BX3A 5HPYB 2H1SA 1LB1B 5HJ7A 4BC0A 1AS0A 1MC1A 3ZV7A 2GN6A 3CLTD 2GH1A 1MQ9A 5D3ZA 5DVZA 4D97A 3T3NA 3N3AC 5TNXA 1D4ZA 2QPOA 3KLBA 3RG2A 3TIIA 4M8SA 1NVVR 1TEXA 1RIIA 1XZGA 1LK0A 1AN0A 2YTZA 1N8KA 3LQKA 3G5LA 1DJNA 4MS1B 4MQMA 1QP8A 2H51A 2OBLA 3QY0A 3JQQA 4ZZ0A 3R0XA 4V1CB 3CT6A 3G2HA 3C6KA 1K2WA 3DVRX 3QMMA 4KWEA 4ZRDA 3W4KA 3VKVA 2A5DA 3HB7A 1R4ZA 1ZESA 1YRAA 4E6EA 1JJIA 4JT8A 3QNWA 4XYMA 2PL3A 1UMCB 1V5IA 4XQ0A 1QWSA 1UEXC 1PNOA 3KUDA 2G6TA 2AN5A 2QL5A 3K1TA 2EFHB 3UMGA 3JPWA 4AP5A 4W5TA 5JFTA 2R6GA 4JBWA 4ZVMA 3HXMA 1G5HA 3A1UA 2A1TS 1OHHA 2ZIXB 3F8WA 1E6MA 3H11A 4IIJB 5EKSA 5TGZA 4QFMA 1AUPA 3RJ5A 3LSTA 5BUSA 2FOIA 4E94A 5EZSA 2MSCB 3U4GA 4QZVA 2AXNA 2AMJA 4H3HB 5I47A 1G9TA 1U0GA 3LLSA 1E1NA 3NLLA 4Q7MB 3U48A 4XX0B 1IY1A 1CY6A 2XOKA 3DWIA 4CCYB 1LBSA 5SYNA 4OFXA 3JQ6A 2IS2A 4RM3A 1M0TA 2D2EA 1L3BA 1FVXA 3FA2A 5LR6A 2CL7X 7MDHA 2YWDA 3NALA 5F4BA 5JY6A 1USWA 4OQXA 3SVTA 1ZPDA 5CYOA 1VP9A 3GUUA 1VHJA 2CCJA 2FUKA 2NU6B 4D99A 1B1CA 3OZXA 3V3TA 3VYTB 1U2ZA 1RD4A 1EQUA 5DHFA 2ZKLA 2BEJA 3H87A 1HNNA 2DY1A 3H2BA 4MPJA 4KWTA 3RJTA 1JJAA 1KR2A 3ZR4B 1ZK0A 2GN9A 2H2AA 4EPXA 1KO4A 4EHFA 1MOSA 4BY9E 1XRLA 4TROA 2G25A 1TYAE 2HNBA 4PHTA 3G0HA 4OKNA 1GL7A 1CT9A 2FK7A 2V7QD 1G19A 4JQZA 4URHA 1SHJA 4E2FA 1E2QA 1LVGA 2C9OA 4W82A 4F85A 4Z4QA 1NVWQ 1WHSB 2DPLA 2O3UA 2GM5A 2ZIZA 5H83A 4BCDA 1X1RA 3ENQA 2Z6AA 3OQMA 4PBRA 3HN2A 1PK7A 3TE6A 4JXXA 3CLKA 2QA5A 2MMGA 4C06A 3LRTA 1Q0TA 3OIGA 4G86A 4R31A 2QM3A 2COKA 4Q4HA 5LQSA 1ATZA 4R2WA 5H59A 2SCUA 2D3WA 2H9YA 3ZK9A 1E1MA 1JG6A 1Z4JA 3AU9A 3HZRA 3QA9A 4YUWA 5JMTA 1IUKA 4TWJA 3F96A 3FDZA 4F4CA 4ND8A 4B34A 4ZCQA 4XEUA 3L1JA 4HXGA 1G8MA 1X7ZB 2WSMA 1DKPA 5BXQC 1Z7BA 1ZK2A 2NGRA 4EJSB 3DFZA 2W6NA 1T5TA 3AI2A 4MV1A 4D8UA 5CG1A 3WO1A 3PYXA 4PPQA 2Z4TA 4P4SB 3GPDG 3TAUA 3ZWWA 5EZ6B 1QH8B 5TS2A 4CF4A 4H7IA 5ITZB 1DUSA 2AJTA 4AJHA 5AM3A 3C5CA 4J4BA 4PRYA 3PHBE 5HCIA 5C3MA 3M4YA 2CMKA 4NE2A 4CMCA 5JRJA 3BGSA 1T6XA 2X3UA 1FP4B 4KQJA 1TMKA 2NU7B 1NVEA 2QUIA 4GOMD 3H13A 3GDFA 4LK3A 2VHQA 4QO8A 3WQSB 2ZJ6A 2LIVA 1IXKA 1HLDA 3M81A 4M3NA 2ZRCA 1P1CA 3ZVLA 2WQ6A 3JTMA 2QTLA 4LXXA 6ADHA 4E14A 1QG2A 3TO5A 4FMDF 1NVXQ 3O03A 3O38A 2NP7A 5F21A 1QVZA 1MAAA 2VXYA 4RQUA 5JCOA 1IU9A 2OFFA 4BJ1A 4C4PA 2APJA 5C32A 3OF5A 1OPXA 2FUEA 2QYSA 4JJ6A 1LBQA 4Q4AB 3HVUA 1MX1A 3OLQA 3WLNA 4LRUA 2KB0A 4FJ0A 2V6MA 2BFOA 2W6OA 1GUZA 1NUAA 2X8WA 4LDQA 5DGCA 4ZQGA 1NN0A 3K7EA 1PT5A 5CXSA 2IPOA 4DANA 3H1GA 4FILA 4F5EA 3MWGA 2CL5A 1CK4A 1I1HA 2CJWA 4JU9A 4ZI5A 1M54A 5F9HA 1C0PA 2B8NA 1G5TA 2F4VB 2YY7A 1U3DA 5K9ZA 3U3XA 3NHBA 5FLYA 4GOJA 1U3TA 5CAEB 4UU0A 3S6JA 3MRSA 2GZDA 5IC6A 4PYJA 2AOUB 4GI1A 1XTIA 1L7MA 1ISPA 2C9ZA 1DWUA 4I6JA 5FUVA 1CIVA 3Q3JB 1J21A 2DULA 3ACBA 5IM4F 2GCEA 4IF4A 2Q6LA 4O08A 3JQAD 5HKOA 2P4QA 5JMOA 3QYJA 1SUPA 1SXJA 3AZPA 3R8XA 1L7RA 1ZCFA 1GPYA 2C4VA 4BE9A 1V1RA 1S2LA 1EWYA 1P1BA 4GKBA 3LDAA 3OPXA 2AC4A 2BFEA 1KJ9A 2EX1A 2IEAA 2PGJA 2W4QA 2BGMA 3NTUA 3G2KA 3CIFA 5LNK6 1QAMA 2EZ9A 4QQRA 1TJYA 5ABPA 4MHSA 3V2UA 3EGCA 1XRSB 4M1EA 1CBUA 2FH5B 1E8MA 3E0QA 4NAHA 1E1CA 2O2GA 3L7KA 1DMSA 1FS5A 2ODQA 1VL1A 4PLTA 4IDNA 1N0VC 3EIXA 5DYNA 1AKQA 3QSGA 5LU9A 4C4ZA 1GAXA 1I3NA 5A5VA 2RJNA 3DVAA 4MUKA 2PX0A 4RNCA 4Q9DA 2AHRA 5F5NA 1P2BA 2M6KA 3PUYA 1ZISA 2OFXA 2NVUB 1M2VB 4IH1A 3EXHB 5BT9A 1DINA 4D80A 4N41A 4X93A 2F1KA 1J22A 1GU7A 1TAHA 3NHWA 5EJIA 3TYXA 2DFLA 4JD5A 4BQPA 1JQ3A 4QPJC 2HIMA 1FX1A 2EJCA 1Y1QA 4ZCPA 5D6NA 4C0BA 1V41E 2G4VA 1YL5A 1MCZA 2QLJA 4KLCA 4JYCA 4NG4A 4DY6A 2YQ4A 3P71T 5KWVA 4F7DA 3IAEA 2ZTLA 3NO4A 1N0IA 1A76A 4K6OA 3R44A 1PYOA 3BERA 1I4DD 4TUYF 3CLRD 1P1RA 5DISB 2C94A 5K0NA 4CKBB 1N1GA 4EI8A 2HI0A 1P72A 4UD2A 5L4SA 3R3UA 4CV0A 3D0QA 3A1SA 5GV8A 1M75A 2FRVA 5HXAA 2XT6A 1V6CA 3OLWA 1WCWA 4C7BA 5MDHA 4OXQA 3UH0A 4FB4A 5L6MB 3CZQA 3UO8B 4GR4A 2O0HA 4BMVA 5LKRA 1JR3D 3D8UA 2V97A 2FGKA 5B2ZA 4EY4A 5BYKA 1E2NA 1KI3A 3LXRA 1D8TA 4GLFA 3B6JA 1NQUA 3BQMB 3FTPA 3HMKA 2VRBA 1V11A 4KLNA 4LQ4A 1X1BA 4FUTA 2KW5A 4RGQA 4IDGA 3FNFA 4KGVA 1SUBA 1E2MA 3P5BA 2PRJA 4MR8B 1C9JA 4EEKA 4FR2A 3C6YA 2R7KA 4MV3A 3VNAA 2BFFB 1RAAA 2XVXA 1KYVA 3KPJA 4UVDA 4BNLA 3X3HA 4JZKA 3KYJB 3OJCA 3DV0B 1W5EA 3DBHB 1DAKA 1UKYA 1HFWA 2D0DA 2AD5A 2G5GX 2QUHA 3BWCA 5FNVF 3ZJVA 3L7JA 3Q5GA 5GZ3A 1DAEA 1G98A 1XZIA 2XCQA 4NF2A 3GOHA 1ZNYA 1ZOPA 9MHTA 5KJEA 2Y1XA 5C8DA 3KVYA 1PT6A 1GUFA 2BY4A 2ADFA 1DBQA 2JBHA 1IL0A 5EZ5A 3R23A 3T3GA 1YJ8A 2Q5CA 2XUAA 4LIPD 4LV8B 3UBTA 3IE0A 1IK6A 1Q2UA 2JJ1D 2OK7A 1BRMA 1UK6A 3KKQA 3PGLA 2V9CA 1LZKA 2R7MA 3LMKA 3OO0A 4MRNA 4OB7A 3RK4A 5LD2C 3QNMA 5FP0A 1ZCZA 1ZH6A 3G9XA 3QOFA 3B78A 4OB8A 2WVJA 3NDRA 2P6PA 5T57A 1MEOA 2R0QC 1GTRA 1OFUA 5B6JA 4WFIA 5KNDH 1V47A 1NBOA 4UAJA 3WGYA 3ZWMA 1WW3A 3O9ZA 4GF5A 4M0MA 5E4YA 1ACMA 2JHPA 4P31A 5L3QB 2AB0A 1ZHFA 4H31A 1RLIA 4P2BA 4YVFA 3SBXA 3FD8A 2LNDA 3AY0A 1WKCA 4B17A 4X0EA 4F5ZA 4X97A 4P80A 5FA8A 1KC3A 3RVBA 2X3FA 3MWKA 3ZEIA 3WBKA 5IXYA 3ETHA 4ZI7A 1ESDA 1FQKA 3KOXA 5FL3A 5EINA 2BGLA 3LSYA 2WLTA 5B6IA 3SJ7A 1AS2A 1H42A 3VRHA 3FB1A 3H86A 4MVWA 4ZVRA 1GG5A 1M2JA 3HN7A 3EZ9A 5JQGA 3ZCRA 2OAQ1 3PX7A 2PT5A 3HJBA 2JATA 2PIDA 2HF8A 1XAHA 3CTMA 1PDWA 4OMCA 1AX9A 4UTZA 2C82A 1JKXA 4Z8YA 2INGX 3TDMA 4GKKB 1GDHA 4MB0A 3WISA 2J59A 5BY2A 1S4QA 1ZH8A 3CEJA 4EO7A 1JHRA 3AETB 4J0GA 3HVRA 4IPTA 4UXJA 4JBHA 2R1VB 3FMGA 1MOZA 4TS4A 4C21A 2J0UA 4CJXA 3VR4D 2B8WA 4DVGA 1TL7C 3BL5A 3EHDA 2Q07A 3HDHA 3TX2A 4QXOA 5ESWA 2OO5A 4EMUA 1RZRA 2J3QA 3H2KA 4ITRC 4RXUA 1DXYA 3I53A 1JLLA 3H5RA 2G0AA 2MR6A 3L79A 4DC1A 2AVDA 3BFXA 3SS9X 5FO1A 1W0KA 3WL4A 4R9VA 1DE0A 4RCVA 1GVNB 5KWSA 2CLIB 1H3EA 3BT7A 1CVRA 3PENA 2Z8YM 1PR9A 3IJ5A 4GOKA 2OVFA 2O59A 1X7GA 2ZFUA 4XDYA 1TM5E 1XZ8A 1L4GA 4G8DA 1OXXK 3LTNC 5IEJA 3L8ZA 4DRYA 2YN4A 2E6UX 1XMSA 4CKXA 3FZNA 4BUJA 4TKUB 4YCNA 5LQUA 4NV1A 1DELA 4FQ7A 1X7YB 1X1SA 3OI7A 4Q93A 3ZGOA 2QD2A 5K3SA 1DQZA 5IG2A 1PN3A 1NIJA 5HZHA 3EY4A 1XXHB 2WIDA 3PJGA 3MBKA 5EZQA 3A6GA 3H4VA 4RV5A 3FTFA 2ALJA 4FHGA 3QXJA 3R1IA 1FYEA 4UBMA 3DE4X 4GZMA 4DCCA 2DERA 4KQGA 4XD7A 3IT0A 1SVIA 4US1R 3L4EA 2Z2KA 3N8HA 4MV7A 4ZJUA 1ZM9A 1Y82A 5AVOA 4HUTA 2GMWA 3ONVA 1L7OA 2FSFA 2PS0A 2ZREA 3PQ8A 3QKIA 4F6CA 2JI6A 5WRFA 3V9AA 4X1IB 4AWBA 1MC5A 3TJRA 3IV6A 2WUEA 1IULA 5CNJA 2PGLA 4F8EA 1X7XA 4Z9YA 4CMGA 4R7GA 3LFUA 2RD2A 4GRIA 2BGGA 3OZWA 2BFWA 3GJTA 4Y3UA 4WOKA 3FBTA 4GZ5A 1GLNA 5F12A 4H59A 3ZV6A 3KOUA 1WZIA 2GFIA 3BD8A 3IP8A 4G9GA 1N0HA 3DL0A 4JP5A 4CKYA 1CUJA 3GJQA 3RTGA 1GV1A 1YS7A 4YQZA 2C98A 3SD7A 1VKJA 5THQA 2YIDA 1PP4A 3KQVA 3UMJA 3N53A 5BYAA 3V8EA 4BXOB 2ZAIA 4US0R 4WVLA 1ZSNA 4M38A 1SQSA 3A0UA 4OH7A 4HT3B 4QNMA 3BA1A 1NR1A 1N2BA 3GWZA 1QDUA 2BCJQ 4PPFA 3RYHB 4ZEVA 5KNCA 2IUFA 4XCQA 3P9QA 1YZVA 3CCCA 3KQQA 3SZ3A 4IQ4A 2ATIA 1KFCB 4G2TA 3VZDA 1UQTA 4MVJE 3HFRA 3GUVA 5GJWC 3ZGYA 4YMHA 5A9RA 8ATCA 3UAWA 3G49A 4KXYA 4F7WA 4FNGA 4PRZA 3H7IA 4QO7A 2VWGA 3AWIA 1RPJA 4XVCA 2DPXA 2HBYA 1JMKC 3TLJA 2XMDA 4M22A 4S12A 4HNVA 1WDLA 3E3MA 3OURA 3R3SA 1E6KA 3TTSA 2FSSA 4ME6A 2J3LA 3HU1A 3IEXA 2RMKA 3G85A 3RRXA 2B98A 4N6OA 3WIVA 4QYIA 4F56A 2FDRA 4UUAA 1XMQB 1D2GA 1ZSYA 3IKMB 1A96A 5KJ1A 5ESDA 3PX2A 2E5LB 2M2IA 1JE0A 4BB5A 1DXHA 2A67A 5FDFA 1AZLA 1TPYA 2CLSA 1QR6A 5C1IA 4DCOA 4XJSA 1XNHA 2VJDA 1RWOA 4JB2A 4KUHA 4A0HA 4KI0A 4DCNA 4HNTA 5E6UB 3T3EA 1Z2EA 2G82A 2R8ZA 1EFRD 3B1KA 1JBQA 2ZUUA 2MSNA 3T3OA 3WLTA 4MW9A 2J5XA 3UKJA 1QV6A 1O57A 1QRRA 2WJWA 4TXMA 5EMHA 5GOTA 3RBVA 1APBA 1KJJA 2WKQA 4AMZA 3L04A 3D7SA 5CCDA 2WB2A 1E3QA 3LW7A 1EUCB 3H18A 4FLMA 4NZ9A 2I91A 3AEUA 1T5IA 3WXBA 4RA6A 1FSGA 3RV4A 1GP2A 1U4OA 4I1OA 2IX3A 1ZR2A 1M1UA 3NFRA 4DLUA 1W34A 3I05A 3M49A 4E32A 3NHAA 4RTSA 2EQ5A 1T4BA 3MCAA 2UUCB 4DQKA 2TECE 4MWSA 4MLPA 5DSTA 3OE5A 4DAOA 4AUEA 3RFXA 3GNSA 1B0UA 2H2WA 4YRIA 2GHTA 3KALA 2L19A 2E9SA 2ZB3A 4EABA 3AEYA 1PL0A 3Q98A 3R7WB 2EBUA 5T4EA 2VI5A 1NXWA 2XXBA 3HB9A 4EO4A 4ND5A 2RJ3A 3J81A 3O91A 1F3LA 1NA5A 4GH5A 2HO4A 2XMRA 2XWQA 2P2ZA 2CUKA 2HKIA 4RANA 2EZTA 1C3OA 3ZHYA 5LJIA 1G8KA 1BG6A 3BREA 1P0MA 2XUIA 4RPGA 1Q92A 3K1ZA 3INTA 3OKFA 3BB1A 4NCAA 3QPWA 5G4KA 1UKZA 4URZR 3BMQB 1CWUA 2C9DA 1E3LA 1E62A 3HBNA 1YVDA 1PG0A 4HQ6A 2YN2A 4PYMA 5G40A 1OT3A 3BFKA 2B94A 3NAQA 4HDQB 1V9SA 2ID7A 4KGXA 2OQVA 3S2FA 3EW7A 3USCS 2EZ8A 3VI4B 3L8FA 2UV8A 4EJ0A 4IOJA 2FDXA 2K7FA 3BOSA 4V3CA 2QB5A 1QPGA 2NIPA 3DF9A 4UVIA 5D3MB 4QT4A 1P44A 3AW8A 2GHIA 4Q01A 5JBNA 4FONA 2OUKA 4TSKA 1E9SA 3D8RA 2HJWA 2IS1A 2E4VA 1EP3B 4PRKA 1NRXA 4TRRA 5AK6A 3U37A 4C4OA 4ETWA 1J06A 1EAYA 4Q3LA 5HFNA 4F5WA 1HK7A 4I8IA 4BEBA 4OLBA 2VAVA 1XQVA 4Q1BA 1NW8A 1EVKA 4RK7A 5ESRA 2GF0A 5JDCA 1LQTA 3Q4GA 3HUTA 4EW1A 3O8OB 3OE1A 2ZB2A 2I2CA 4RVGA 1V7ZA 3E53A 2QN7A 4NU6A 1SKQA 2V7WA 1GYPA 2JLCA 5E6SB 2YINC 2BSAA 2BM8A 2IPLA 3CZPA 3Q0IA 4KCGA 4NBTA 3K94A 4JLWA 3M2TA 4RJKA 1RYDA 3H0KA 1QM5A 1S01A 3AKYA 3EBLA 2ZR0A 3EOBI 4MULA 4OXIA 2G9NA 3EMVA 4OHPA 3OQOA 2GXSA 2YWCA 3PXDA 3R5XA 4KZKA 2I34A 1U9YA 3V42A 1W19A 1ZC4A 4DEVA 1WL8A 3THXB 3O7WA 1NFFA 3A26A 3GPCA 4IX9A 5DGXA 1AKVA 1HDEA 1KPIA 1QS0B 1TZJA 4EPTA 1DLJA 3L4SO 1VHTA 4N5LA 3R7NA 3T7EA 2OQ2A 5B3JA 1NF9A 1H5QA 2JAOA 1M2EA 1DT5A 1ULAA 4OHUA 4HX5A 3BJEA 3S1AB 4WNAB 2Q41A 3CU5A 2J6HA 2MSLA 3LYHA 5BOSA 4KREA 1G5QA 1GRNA 1QBGA 1O96B 1EFPA 1QIGA 5DU2A 4ZEWA 4FE3A 3L6OO 5IHPA 4WBNF 1KWKA 4CCAA 1NZFA 1YJCA 1S2IA 5BYJA 4ZT3A 1RJDA 2C3UA 5TVGA 3P45A 3OF2A 5ES3A 3QE9Y 3Q10A 2AT1A 4Z9BA 3QFTA 1XXHE 2VOJA 3S2GA 4LOKA 2ZQZA 2GN1A 3LY8A 4FWIB 1OLUA 4GXRA 4QFDA 4WESB 1Z0DA 1ZW1A 2PA3A 1T4MA 4BUCA 1NVUQ 2JLRA 1NBHA 3AG5A 1R6BX 4M0DA 2GRUA 3HEAA 4G07A 4ZOEA 1JSRA 3ZWAA 1GPAA 3ET4A 3NHLA 5BMVB 5B3AA 5TQ2A 1B2RA 1LGYA 5B12A 2P0EA 3H2ZA 2BMDA 4KODA 4U7TB 1UFOA 1K7SN 1X1EA 2A3RA 3VKFA 4C08A 5FR1A 1ZRSA 2IHBA 3L2OB 4H16A 4R51A 2QTFA 3CKLA 1T8UA 3QQ5A 4R2JA 3AR6A 3H1BA 2G9QA 1FJ2A 1E5XA 3H9GA 2IU6A 5AKHA 5FI1B 1Q0LA 2F3RA 3G2JA 4XVRA 1C0EA 4D0SA 4DR7B 4MV4A 4RDIA 1GGVA 2OE2A 3ZD8A 1P6QA 1JEOA 1R8XA 1IY2A 2JLWA 4QIHA 1IQPA 2HJ9A 3H99A 3PF9A 4U9HS 3LXMA 3B7PA 1DZIA 1O0CA 1NVGA 3DEHA 3PHGA 3IP5A 3SHVA 2UZ4A 4ZYTA 1LVUA 1N3YA 4JT4A 3UAOA 5KNLA 2TMKA 2DHQA 4L9SA 5PGMA 2FW6A 1M2NA 1G3MA 4RTKA 3JWPA 3DBRB 3JCZA 4U2FA 3U5TA 2GFQA 4PINA 5JAQA 5KAPA 9ABPA 5GTDA 1N5KA 3FB4A 3OECA 4P2GA 2OPHA 5FPTA 4UNNA 4ZP1A 4I50A 2R6R1 2HQOA 5J4VA 1MAWA 4TKVB 3VJMA 5BW8A 2XLBA 1HFJA 1NYQA 1X8JA 1FFGA 1ZITA 1RWPA 2IKSA 1K5DA 4M6WA 1WUTA 2BMWA 3HCNA 4LI3X 3R6DA 4R7ZA 1GZHB 1XA0A 5BN5B 4GI3A 3IMCA 5F98A 5BT8A 4WAUA 7AT1A 3EPHA 4QQKA 2OXEA 3K16A 4RW0A 5E38A 4J0KA 3VGPA 4NP6A 4Z7NB 4N03A 3DVQX 5TT1A 1YF3A 1LDMA 1MABB 1G8YA 1VMAA 4EOGA 1K3UB 2UVPA 3FMFA 3G8CA 3N59A 1XMOB 2AQKA 4CDNA 2WTAA 3FNIA 4CF3A 4NJMA 1SU4A 3HNOA 4WA8A 3RGWS 4BQNA 4K2AA 1GQYA 4AL4A 3HZHA 2Z3WA 4YRZA 3TW6A 1XP5A 3JQ9A 3A3OA 2JZNA 3HYCA 1KQOA 1ZD9A 1JQBA 2A9JA 1BE0A 2PLAA 1Q6ZA 3BIXA 2AEJA 3OOYA 2QTTA 5F73A 3MAGA 1KVTA 1XOIA 1L1FA 5DKFA 4GX1A 2QMYA 3SBDA 4BV9A 3OCVA 4OY3A 3LY5A 3OZ7A 5IJXA 1N9KA 3HFGA 2Y68A 3AQ4A 2UVQA 5CDUA 4KXQA 2WKRA 5E2AA 2BRUA 5TQVA 3WP1B 4LAFA 1J1ZA 4I4LA 3U4IA 4NMHA 3S0JA 4RELA 3OTOB 1OI3A 3QIVA 2GZRA 3ZYCA 4BNHA 1W36D 1TZ2A 4XQGA 1EP2B 4HEA6 5GM1A 1RLJA 2ERXA 3ML1A 1FQJA 4AX8A 1MA0A 3WWCA 2VK1A 1OAAA 3H11B 1Z6YA 4YXFA 4IMPA 1XVUA 5HHTA 5LYJF 5GADl 1NVFA 2A9RA 2XTZA 4MNTA 5HA5A 1SD1A 3LTEA 2TSYB 2XKJE 3GGSA 4L4ZA 4PX2A 5DTJA 4C14A 4ZGBA 2AVNA 1XQXA 3H17A 2ZYWX 3NWOA 1B42A 3F0TA 1V5FA 2PKQO 1SMKA 4YCAA 2P2GA 3FKQA 1M6EX 1VG8A 2XUHA 4QG7A 2WJAA 1DRWA 1XUOA 5IT5A 4KHPB 1JECA 2B8TA 4LMRA 2W70A 2XEDA 3TCXB 5LNK1 1GYQA 1D0SA 2WU1A 1ILWA 4C4XA 5KYUA 4OTZA 1RI5A 1P81A 3FFAA 4P81A 4DV7B 1OV4A 4OXRA 1OKKA 1QIJA 3NGMA 4MKXA 1Z8NA 2H11A 2O8DA 4A73A 3UPTA 4D4KA 2B2XA 2GAOA 4CW7A 1ZO8A 4Z1MA 4KWIA 4GC9A