3BHJA

Crystal structure of human carbonyl reductase 1 in complex with glutathione
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
275
structure length
275
Chain Sequence
SGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonyl reductase [NADPH] 1
publication title Human carbonyl reductase 1 is an s-nitrosoglutathione reductase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 103
structure length 275
sequence length 275
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2007-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bhjA00
1RM5A 1LLUA 1ZEMA 2VZ9A 3AU9A 1YL5A 3G0OA 1LDBA 4IJVA 3OBBA 2YUTA 4LN1A 2PNFA 4FCCA 4GWKA 1FK8A 4O63O 3HFSA 1UZLA 3GGPA 4BB6A 4CM9A 4F6LA 2YHIA 4HNGA 1UDCA 2NUAA 3DZFA 4NBRA 4XCVA 3DMTC 3GHYA 4CMEC 3UHAA 3EZLA 1N7GA 2I3AA 3SJ7A 3H2ZA 2CDBA 1MB4A 3LLSA 2O4UX 3P2OA 3TWOA 5ER6A 4PVDA 3V1TC 4BNFA 5AQ1A 4NK5A 1E3IA 5F1KA 4A73A 1QP8A 2ZATA 1DFGA 3BMCB 2B5VA 4QFDA 2EJWA 4P4GA 1I3LA 4LRTB 3L07A 1KEWA 2Y0EA 2WD7B 3V1UA 4CUKA 4ND2A 2GN8A 4IDDA 2O7SA 1E3WB 3U5TA 5AXAA 1PWZA 4YCAA 3VTFA 2I65A 3H8VA 4QO7A 1GD1O 1U3TA 3D5TA 2JHFA 1BXZA 2VRBA 1DHTA 1FMCA 1UUFA 3GPIA 3JQGB 3MJEA 1EVYA 1R4MA 4UEKA 3TRIA 3KHUA 2DC1A 1DJQA 4MVJF 1WW8A 1O0SA 1I36A 1LSSA 3GFBA 3ZU3A 1YO6A 1EDZA 2HQ1A 4CV1A 4DC1A 1ONNA 4IQ8A 4Z3DA 3EYWA 2P68A 2ZQZA 1LSUA 4BQPA 1LI4A 3VH1A 3GDGA 3EC7A 2AMFA 1YL6A 1F0YA 2HAEA 4F6CA 1B8PA 4B4UA 1DBVO 3WWZA 4DYVA 1T2DA 1IZ0A 4CLXA 3ZNOA 2G76A 1A9YA 4PVCA 3VPFA 4BGIA 4BNHA 3GR6A 3V1YA 5FI3A 4EZBA 4PG8A 4WCFB 3AFNA 3UF0A 1PGQA 2V65A 3X2EA 4ZVVA 3HSKA 1ADBA 3PYMA 1A9ZA 2EP5A 1ONOA 3HUDA 1H0KA 2IZ1A 4GX2A 4JK3A 4BO6A 3EGOA 3K92A 3ZV4A 3PDUA 3GH3A 3RC7A 4GKBA 4INAA 1WPQA 2C5AA 3OICA 4NI5A 2I3GA 3WLEA 1NAHA 4JJIA 4E5NA 1LXCA 4FQ8A 1U2GA 2YY7A 4CM4A 1U2DA 1AGNA 5FYDA 3KB6A 4GI2A 2VTDA 1FXSA 1CJCA 2NU9A 1SB9A 4ALIA 1B2LA 3FF4A 4NBUA 3UFXA 3WOHA 3PWZA 3CXRA 3AY6A 1ZW1A 4OIMA 1IE3A 3JQ7A 3M1AA 3WQSB 1OBFO 1YVEI 4PLVA 3K2BA 4JROA 4PRLA 1I30A 3TZQA 1DIGA 1E7WA 3ROMA 4CUJA 3Q11A 3ZU4A 3H9QA 4YPOA 4RL6A 2J3KA 1YH3A 4OAQA 1DPGA 4RVFA 4R1UA 4IM7A 5CPFA 1PIWA 2VHXA 3QA9A 4E32A 4WUVA 2I76A 5IN5A 1FDVA 4FR5A 4C4OA 4K26A 3MOGA 5B37A 2EWMA 1E5QA 1WLYA 1SZJG 5B4VA 1ZIDA 4W4TA 4F45A 2ZJ0A 3C7AA 4GL4A 4R16A 5I9MA 5L4LA 1BVUA 3KEQA 2SCUA 1DRUA 2Z5LA 4DBVO 4MP6A 4DMMA 5TLSA 1NHGA 1UXIA 3T7CA 1XG5A 1DIAA 4FFOA 4I1IA 1WDLA 1ENZA 1H93A 3G17A 5KKAA 2OP1A 3BA1A 1A27A 1YONA 2PK3A 1P1HA 3F1LA 4JCOA 4YJHA 4C7KA 5TIIA 1VSVA 1A72A 3I52A 5JAMA 5G4KB 2B5WA 1HE5A 1A71A 1N1GA 2IDZA 5DDIP 3F4BA 4CMIB 2BFOA 4TQGA 3PJFA 2WWRA 3QWIA 1D1TA 4OM8A 9LDTA 2EW8A 2X7HA 4QX6A 4GMGA 1I3MA 3ROQA 3H65A 5CG1A 5K6AA 2IE0A 2Y05A 4XIYA 2BELA 5KVSA 2G0TA 5DOVA 3RUCA 3GF4A 2H63A 3BAZA 3OIDA 3H9GA 3UGKA 1UDBA 4D44A 1J5PA 3C85A 3LYLA 2PD6A 1X1EA 4NJMA 3QWFA 2VT2A 3DQPA 4IDBA 3R3JA 4CLDA 4LVUA 4PLCA 1OFGA 3PJGA 4J0FA 1SOVA 1YS4A 1VJ1A 3CINA 3F4LA 3C3XA 4OXYA 2Q1UA 5BNFA 2FPIA 4RVHA 3CZMA 1UXKA 4NZ9A 5MDHA 1E3JA 1WVGA 2WD8A 1DC5A 1G1AA 3JQDA 3U09A 3E9MA 3GPDG 5EQFA 4W7IA 4IQ0A 3U4CA 3V2GA 2QQ5A 4BNKA 1GTMA 1KVRA 2X1HA 1EK6A 4HFRA 4CL3A 4FGWA 2OHXA 2G5CA 5T67A 2Y68A 4ID9A 3EK2A 4FJ2A 4KQXA 1X15A 1BHSA 4FIZA 3KETA 1DDOA 2Y93A 4Z0PA 4E5PA 3TFQA 5KJFA 3KRTA 4AVYA 1P1JA 4H16A 1SAYA 3JQBA 1BW9A 3ENNA 3BTUA 2X86A 3GQVA 3B1FA 4IQGA 4IDCA 3S2GA 5G0WA 1HEUA 1E3EA 1UDAA 1S6YA 1EZ4A 2C29D 3IMFA 3WYEA 1C0PA 4OO3A 3IQDB 3SXPA 1ORRA 1XCBA 3C1OA 5A06A 3UOGA 3ITDA 3PP8A 2IODA 5CHEA 2J8ZA 3WQQA 4A2CA 4FC7A 3KSZO 3MTGA 4AJ1A 1BXGB 4DPKA 2HK7A 4FJ1A 2X5OA 1VE9A 5LC1A 1EMDA 5C7LO 1PJBA 4CMGA 1EVIA 3DZBA 1JWAB 3BTVA 1HT0A 1LLCA 3X2FA 3W4IA 5EN4A 3GY0A 3OQBA 4IY1A 3W4KA 3KUXA 1VL8A 4AJJA 2X9NA 1F8GA 4AL4A 5A9SB 4BNYA 2VNSA 3QWHA 1WXDA 2C7GA 2IYPA 3JQBC 1U4SA 5JC8A 4B7UA 2AG8A 3UCXA 3V5NA 4WLOA 3C7CB 4YJGA 3AI1A 4A0SA 3ZW8A 1X7DA 2AE1A 1KBZA 4BNTA 1Q7BA 1QR6A 2Q50A 5ILOA 4CLEA 1PJQA 4NBWA 2Q1WA 3HZZA 3EVTA 3QSGA 4TMFA 4HUJA 2QG4A 4GLLA 4M89A 5IN4A 1X7GA 3FR7A 4ND4A 3PWKA 4WKGA 2X58A 5CDUA 2HMWA 5AVOA 1MUUA 3H5NA 4L75A 1O5IA 4QUKA 3OETA 4XD2A 3ZCXA 2EERA 1OI7A 1Z73A 5A1TA 5JSFA 4ZQEA 3VZRA 2A9FA 5COBA 5JS6A 5H81A 4CLRB 1SC6A 1VKOA 1BRMA 4HP8A 3WNVA 1I0ZA 2VUUA 1QYWA 4PZCA 3GC6A 3ICPA 3IDSA 1LNQA 5ICMA 4LCJA 1QKIA 1P44A 3QWBA 2A92A 3QVWA 3ADOA 4GGPA 1M6HA 4PG6A 1AUPA 4Q3NA 4CUZA 1A7KA 2QRJA 3D3WB 4UUOA 1DLJA 3GEDA 3E82A 4GKVA 2IYOA 3ETDA 4BO8A 1X1TA 4CR7A 3ETEA 3ULKA 1T4BA 3JQ8A 2A35A 4ALJA 5T57A 2QZZA 2BHLA 3DAGA 4YT2A 1RKXA 2C7VA 3JQ9A 4OSPA 4GVXA 1DFIA 1HZJA 1KOLA 1KVSA 2CZCA 1I32A 2AQHA 2CY0A 1YBAA 3BMOB 4BGVA 4EJ0A 2VWPA 1XWFA 2VZ0A 4IPTA 3GGGA 1SNYA 1CDOA 4PLGA 2B35A 3EAGA 3S2FA 5L4NA 2EKQA 3DHYA 1LA2A 2O2YA 2OOSA 3BHJA 4O59O 2UV8A 5ILGA 3GZNB 3B20A 4OYRA 1GYQA 4JJFA 5C3MA 1LDGA 3SC4A 1BDMA 1P1IA 4I08A 1I5RA 3TN7A 3DBHA 4XKJA 5JCXA 3HDYA 3FNGA 4J2HA 3WDSA 4IIVA 3CIFA 2TMGA 3ZH2A 4KUHA 3ZDFA 1EUCA 1HYHA 3ABIA 3NTQA 3TOXA 2DBZA 3WJ7A 4BVAA 3ZWYA 3UCFA 3P7MA 4FD3A 3NT4A 3E1KA 2DKNA 2NSDA 3ROPA 4YJFA 3KBOA 3LVFO 4II2A 3TJRA 4CM3A 3Q6IA 1ZUD1 4PZEA 2QZ9A 1NWHA 1L7DA 4Y8VA 2PGLA 3ZHBA 2WYUA 1IY8A 1V8BA 3OQ1A 2ZK7A 4N54A 1MV8A 4XB2A 3I4FA 3PRJA 2V7PA 4XQGA 4B3IA 1X0VA 2Q2VA 3RI3A 4AG3A 2FR1A 1YB4A 4HADA 3WXBA 1BTOA 3QLJA 3H5RA 1ZK2A 4UUPA 5G4LA 3IOYA 3MCVA 4WLNA 3ZNNA 2YV1A 4OGWA 1JDJA 3IC5A 1I01A 3UVEA 4YDRA 4MOWA 3S2IA 1DIBA 3SC6A 5GZ1A 4BHTA 1AXGA 3DOJA 1GQYA 2X0JA 4R1TA 4BKRA 1C0KA 1GEGA 1LDNA 5F5NA 2G82A 3DZIA 3ITKA 1TVEA 2Y1EA 1F14A 1VM6A 4ND1A 5JAZA 1OMOA 2FWMX 3L9WA 4YA6A 3RROA 4NQZA 5JFOA 3FNHA 4MIEA 1IUKA 1MA0A 2P5YA 2B0JA 2J3JA 2XF8A 1KETA 4DIFA 4CPDA 4TWRA 1Z75A 4DPLA 2RCYA 4J2OA 4TRNA 2IRWA 1DHRA 2GGSA 3Q9NA 1ZJYA 4Z9XA 2IEDA 4FFRA 3FD8A 5I9NA 4CQMA 1MC4A 1T2CA 1QSGA 1MC5A 1DLIA 4KMSA 4M8SA 1MFPA 4NBTA 4TVBA 4XDYA 2PKRA 3WSWA 1OAAA 2GASA 4DYDA 1U8XX 5A05A 2C2XA 4IDAA 4CJXA 1E7MA 3BMNA 3OSUA 1HTBA 1L1FA 3GA0A 1F12A 3BHMA 3GOHA 5A9RA 5JBIA 4AJIA 4NG5A 3DC2A 2V6GA 2HUNA 3K6JA 4EGFA 5BQFA 2C82A 1X0XA 4BNXA 1GUZA 1HSOA 1HDOA 2Y99A 4XJTA 4AJEA 4MVJI 4BMSA 1PGOA 3AY7A 4W7HA 2HJSA 3SLKA 1FF9A 3C7DB 1M66A 4AJPA 3AOEA 3QVXA 3GN2A 1NNUA 1QG6A 4JBIA 4DA9A 4DC0A 2NTVA 3H7AA 4E4YA 3RCBA 4KDEA 3NV9A 4DIOA 2VOEA 4J49A 4CL8A 1C1DA 3I5MA 5JDCA 1WP4A 1H2HA 3U3XA 2BMAA 2FR0A 4WOKA 4YJDA 3QE3A 2P4QA 3E5MA 4M87A 4O5OA 5KJEA 3ZWNA 3GUYA 4NDNE 1IOLA 4BO2A 2DUWA 4E2WA 3JQEA 3JYQA 4U7WA 1NPTO 4NFHA 4CQLB 2PZLA 3PEFA 1ZZEA 3LC1O 5FFFA 3SBOA 3GDOA 3QIVA 1EEHA 2DAPA 3AUTA 1ADGA 2JHGA 3DR3A 3ICCA 4MVJH 1EE9A 4D0RA 1XKQA 2E37A 4K1LA 1WDKA 1HDZA 3ZWOA 4DTIA 4YAKA 3DO5A 4Y67A 1HZZA 2AG5A 2B4TO 3JYOA 1PS9A 5L4SA 3GVIA 1DRVA 5I8ZA 3RU9A 2IXBA 3JD2A 3KLPX 2UUOA 4LISA 1PGJA 4IDEA 1DIRA 2PWZA 5DCWA 4XRRA 1Z7BA 3VPHA 2XXJA 5I7FA 2D5CA 4KP7A 4L4XA 3S1LA 5KJCA 3B70A 1O95A 1QV7A 3RFXA 3GVXA 4TSKA 5AXBA 2D59A 1EBUA 4KTTE 1HLPA 1C1XA 1DJNA 5IZ4A 3WS7A 4R3WA 2X8LA 2DQ4A 4E31A 1I2BA 5HRUA 5KKCA 1P0FA 5ER9A 2HK9A 3ZI0A 1PL8A 1V3TA 4PFJA 1H94A 4DLLA 1I3NA 1YDEA 3K2EA 3KV3O 4ND5A 3RIHA 1K0UA 4UVEA 3NDIA 2CVZA 4QQRA 1BG6A 3H9UA 1XU9A 1PSDA 5CAEA 2AEMA 4WGGA 5CEJA 2DBRA 3S2EA 5BSFA 2HK8A 2GD1O 4JP2A 3WG9A 3TF5A 4PLZA 4ESOA 1LRLA 1X13A 6LDHA 4J9VA 3IKTA 5IXSA 3VVBA 1KVUA 3K96A 1Q0HA 1NR7A 5JE8A 4K6CA 4MPDA 5FI5A 4YT4A 3KYBA 4D3SA 2BH9A 1PQPA 2HDHA 4FOSA 1GCOA 1T4DA 3QVOA 1F17A 2YHIB 1UJMA 3FBGA 3A06A 5DNAA 3P5SA 2YZ7A 1PZHA 1EUZA 1FDSA 3GMSA 3OJFA 1N9GA 3KYDA 5FWNA 4ZQFA 1I33A 5JAIA 4MVJM 2VHZA 4NIMA 3KOUA 2EIHA 4IZIA 4B4WA 2VWHA 4TRMA 4BO9A 3D4OA 1FJHA 5HBRA 3L77A 3JQFC 1T2AA 5JPIA 4IS2A 3WWYA 4A27A 1FDTA 3OJ0A 2WE7A 3FNEA 2J5QA 3GMDA 1N7HA 3V2HA 1Y1PA 1LC0A 3KO8A 3KTDA 4G2NA 5CDGA 1PJTA 3E8XA 4KQWA 4Y6RA 1K6JA 4OXKA 3BYZA 2FPGA 3N7UA 5BSHA 3VZQA 3AW9A 1XQ6A 5ICSA 2O4CA 2DFVA 4MJLA 4CM5A 2ZB3A 4EUHA 3ZNPA 2J6IA 1YKFA 3ZWPA 4II3A 4YQZA 3VAZA 2IXAA 3LF1A 5TRTA 4ALLA 4CV3A 4D43A 3BMCA 2QHXA 3AUAA 4IGFA 1HDXA 1DAPA 3OJLA 3KSUA 3WGGA 4BNMA 4W82A 1QRRA 2WD7A 3NKLA 4IZHA 1NVTA 1E92A 4J7XA 5DZSA 1E3WA 1XQ1A 2JCXA 2Y0DA 3AY3A 5COQA 4YAIA 5HTOA 2VYVA 5ES3A 3WFIA 3VPXA 5DP1A 5L45A 2ILTA 1Q7CA 2AEFA 3LU1A 3MJTA 1BMDA 4G5HA 3TQHA 4FC6A 3JQGA 4DVJA 2Z1NA 4LMRA 2OZPA 3A1NA 1M67A 3K8ZA 4YEDA 3RBZA 5IDWA 4D0SA 5B4TA 1GY8A 4HV4A 1ZXLA 4PLTA 2WEKA 3SJUA 3CSDA 4WASA 5JAQA 2UDPA 4AJKA 2PD4A 3WLFA 2H9IA 3L9XA 4WE3A 1M2WA 1NTOA 1E0DA 5TT1A 1GZ4A 4XR4A 3H3FA 1CWUA 1P74A 1GZ3A 1Y8QB 3EMKA 1AXEA 3MJSA 4Z0TA 1NM5A 4ALNA 3JQAA 1E77A 2DTXA 4BUCA 2BD0A 3E18A 3NJ4A 1U5AA 1B3BA 5HS6A 4CQMD 4WCFA 4TZKA 4MP8A 3WGIA 1ENOA 4IGEA 4FGSA 4IMPA 1PJ2A 2LDBA 3WMXA 1H2BA 2QW8A 4YRAA 5G0TA 2JFFA 3HADA 4ZD6A 4AJOA 5A5EA 4TZTA 4FFMA 3VKVA 4Y9DA 1R6DA 4J4TA 2QIOA 4UUMA 5IDXA 1Z45A 1Q1NA 3RUEA 3RUHA 3S55A 3F1KA 1JQBA 3ZZNA 2VYNA 3ZNQA 5JDIA 3OMLA 1D1SA 1KEPA 3E03A 4L9RA 3H9JA 4CMHA 4HWKA 2HMTA 2PY6A 1I8TA 3L6EA 4YVFA 4XB1A 5ENVA 1CERA 1MX3A 5IF3A 4A26A 1VRWA 1Z7EA 5A5FA 3UN1A 4MKZA 5I7VA 1C0LA 1B8UA 3NGXA 1PL7A 3QQPA 2GZ1A 1IPEA 3G49A 1LBEA 1XA0A 2G17A 1E7YA 3DBVO 4GX0A 5KWEA 3GT0A 5F1OA 1V3VA 2FR8A 2ZYGA 4HY3A 4NBVA 3HFGA 1I2ZA 5IZCA 3JQ6A 3NEPX 2D5AA 3LT4A 4HFJA 3HJAA 5A02A 1I2CA 3PFFA 2JD1A 3WBFA 3DEYX 3H9EO 3ZU5A 4MIOA 3RUDA 3LQFA 1D8AA 4DQVA 1HE4A 4FFPA 1U5CA 1UXJA 1Y6JA 1GUYA 2NNLD 3BXXA 3NX4A 1G6KA 2CNBA 5G4KA 5CDTA 5BT9A 3BMQA 4CMIA 1R4NA 3JD1A 5COAA 5I7EA 3ENKA 3AWDA 3WBBA 4XYLA 4HX5A 1EK5A 1YGYA 4LSWA 3R3SA 5CPBA 4J1TA 5TGDA 3RFVA 4FN4A 5U9CA 3GRPA 3B6ZA 4UVDA 9LDBA 4PZDA 3KVOA 4X54A 4BO0A 3E6AA 3NJ8A 3WGZA 1JVSA 1XIVA 1R15A 4MP3A 1J4AA 1YL7A 2FSVA 2PV7A 2XXBA 3ANNA 2YDXA 4HNHA 3SVTA 2OUIA 3V8BA 2GYYA 3K31A 3IKVA 4OJNA 4QO8A 3GFGA 4XR9A 4CMCA 2CDAA 1GPDG 5F5LA 3ZWBA 4F46A 3U49A 3M6IA 3H5AA 4ZJUA 1N92A 4YBZA 2O3QA 1H6AA 5K6AC 3IP1A 3CUKA 3IJPA 3NT2A 1JN0A 3I23A 4D7AA 1BW9B 3WQRA 5IFLA 2H5LA 1O94A 1BSVA 4RPHA 4OKNA 3JD4A 4OSOA 3K73O 4GWGA 3I4CA 4XYEA 4EUFA 4RPGA 5JNLA 4BIIA 5TF4A 1ZMTA 4JBHA 3JYLA 4JJGA 1YRLA 4QXMA 2DTEA 4ZRNA 2OXIA 3PHIA 4UVHA 4FB5A 4BNNA 1ZFNA 2X6TA 4JIGA 4YRBA 3KZVA 4RVDA 4HFMA 3KYCB 5TSDA 5JMWA 3F9IA 2EKPA 5ENDA 4BNUA 3OF2A 4WEQA 4E5MA 1PQUA 3O8QA 1KEUA 1NR1A 3I6QA 2NVUB 4D3DA 1ZH8A 1ZVMA 4NK4A 3EZYA 3OA2A 1GR0A 2X9GA 3RFTA 4PLPA 4ZQGA 5AYVA 3SX2A 2ZTUA 4AJ4A 3AI3A 2WSBA 3LC7O 4N5NA 2EW2A 2DUUA 2GPTA 4WNCA 4AJ2A 5TC4A 1NPYA 3CE6A 1SO8A 3I9LA 1BXGA 5JO9A 1E3SA 3FPCA 5DBIA 1V35A 1K6XA 4RCVA 2NU7A 1GU7A 5EERA 2V6MA 1E1NA 3DBRB 1ZEJA 3VDRA 4YJGB 1LSJA 2PH5A 3GG2A 3I9OA 1YOVB 2DVMA 2UYYA 4RZHA 1CETA 4JGBA 4BKOA 5DBFA 4E0BA 4AJLA 2Q4BA 1JA9A 3RC1A 1Y7TA 1E1MA 2Y67A 2DTDA 2VUTA 2EJVA 3GEMA 1UR5A 3PFWO 1H5QA 4IXWA 4E3ZA 5A03A 2EEZA 3QW2A 4I5DA 2Z95A 4R9RA 2TMDA 2Q1SA 5BNIA 4L76A 3TZKA 2C59A 1XU7A 2OBYA 4DIBA 1TT7A 4OHUA 2QYSA 3PYLA 3K5PA 4RDHA 1Q0LA 1MFZA 1RYEA 3H3JA 2O3RA 4WOJA 1ZK4A 3DFZA 3V2UA 3FWNA 4W9NA 1QMGA 4RPLA 2W98A 2HMUA 3D4PA 4R1SA 3WR5A 3B1JA 3HNPA 2X5KO 4OL9A 1LLQA 3CPSA 2A4KA 1IYZA 4Q3CA 2RAFA 2VYVD 3OHSX 2Y0CA 4CM8A 4XQEA 2Q99A 1DSSG 3SEFA 1CF2O 3JQ8B 4KUEA 4XRGA 2AQ8A 2AW5A 3HN7A 5T6BA 1E1KA 3ZV6A 1JLLA 1QV6A 2O7QA 1VL6A 1ZXBA 3LF2A 1O8CA 3CMCO 1XSEA 1PS8A 4RZIA 5TX7A 1PWXA 4URFA 3D3WA 4JP3A 2VUSA 4DL9A 2C54A 1AHHA 1A4UA 5TS3A 3GNTA 3DBLA 1PR3A 2Q46A 3JQAD 2EKLA 1B14A 4PLFA 4BKPA 2I6TA 1H6CA 1KS9A 2P4HX 3W1VA 5KIAA 3QJ5A 4BKUA 1R0SA 5GZ3A 1E7SA 1A5ZA 1Y8RA 3DXFA 1RM3A 3FWZA 1SB8A 4NFSA 2YYYA 1XDWA 4RV9A 1ZSYA 2HSDA 2F1KA 4ZQBA 2XAAA 1H6DA 4RQTA 5G0VA 2FOIA 3U9LA 4Y6PA 5MGBA 4RLHA 1IULA 4E30A 4BS9A 1AHIA 1V9LA 2OMEA 3IUSA 1P1KA 1IZ9A 4DREA 1J0XO 4LSMA 2NADA 4LW8A 1NPDA 2Q49A 5KVVA 2GN6A 4MINA 1LSOA 4JX8A 2VYND 4L4SA 4XYGA 3W6ZA 2GO1A 3I1JA 2Y66A 3A28A 3ZWXA 4MVJE 1NVMB 3JQ9C 4IJUA 5B1YA 3LSYA 1WWKA 1CQIA 1R0LA 2D8AA 4XGNA 1PS0A 1PU2A 4YJFB 3R1IA 1SEVA 2YFQA 1MG5A 4U6QA 3BTOA 2R00A 1BWSA 4IUYA 4J91A 2P9EA 1LEHA 3H4VA 4L0QA 4UEJA 4J1QA 5A4DA 4E13A 4QFCA 4A03A 4BO3A 3WTBA 2Q1TA 1YXMA 2XPCA 4E33A 4ZU3A 2O3JA 3RUIA 1V6AA 4H3VA 2Q2WA 2PR2A 3T7EA 2NTNA 5F21A 3KLMX 4MDHA 4D46A 1GYPA 7MDHA 1N5DA 3WIDA 3INTA 3AM3A 3PPIA 4MKRA 1GQQA 2CMDA 3EVNA 4RORA 1TT5B 2BGLA 4B8WA 1PZGA 3PLRA 5BNTA 5DCUA 2FSSA 1IPFA 4K6FA 1NQAO 1A7AA 3NT5A 5DOZA 4CMJA 1ZJZA 5DF1A 5A3JA 1E5LA 3MZ0A 4PG4A 4Q9NA 2GR9A 3ASVA 1NFRA 3JYPA 3WSVA 4I9HA 3LLVA 4GX1A 4DLAA 2BGMA 3PHGA 1I10A 5FF9A 2YJZA 2P2SA 1R66A 2E49A 3NDJA 1M75A 4AICA 2DFDA 3E5RA 3DTTA 1EDOA 1U7HA 3PIIA 5G0SA 5GMOA 3DWFA 4QECA 3U4DA 1OC4A 2PLAA 2ZB4A 3Q9UA 4NMHA 2PGDA 1WNTA 5EIOA 1NQOA 2YV2A 3WYBA 4K28A 2CF6A 4ONEA 3W8FA 4RQUA 3PWSA 4J0EA 4B8ZA 3L4BA 1UZNA 2WDZA 1VL0A 4TKLA 4UREA 1LUAA 4UEOA 1R37A 1OOEA 1S7CA 4FFLA 1JKIA 1NAIA 3LC2O 3O38A 5JY6A 5G0UA 5CEEA 5I9LA 3VZPA 1KY4A 1DIHA 4YWJA 2UUPA 4R69A 3RUFA 1VC2A 3JCZA 2P91A 3RBVA 2NACA 3BMNB 3QVSA 4KOAA 4NH4A 2W2KA 4CLOB 1ADCA 1JKFA 3W8DA 3OIFA 5C37A 3C8MA 1K89A 4YAEA 1Q0QA 2RHCA 3FR8A 1SPXA 2W8ZA 2X0NA 4W6ZA 5L7YA 4BNVA 3FTNA 4BL5A 5B4UA 4J1SA 1WZIA 3HWRA 1TI7A 1BVRA 4DGSA 1GPJA 4BNGA 2CSUA 4GH5A 2BKAA 2YFHA 3A9WA 1ENPA 1HYEA 4DRYA 4NU6A 4BNWA 2O48X 3N74A 1ZK1A 1V0JA 4WLVA 2EXXA 3KEOA 1E6EA 3ZWWA 5KOIA 4R51A 1HKUA 3CKYA 1NBOA 3C1AA 1BDBA 2IZ0A 3TPCA 4CR6A 2EGHA 1T25A 3RVDA 4NNJA 5JC1A 5H83A 4GGOA 5T64A 2C20A 3TNLA 1P31A 2HO5A 3OJEA 2B36A 2EF1A 2Q45A 1LRJA 1E6WA 2X4GA 3LZ6A 2ZTVA 4HXYA 2RBEA 3DAFA 1ZK0A 1T2EA 2VHWA 1HSZA 5KJ6A 2GZ3A 3VC7A 3ONEA 4BMNA 1NP3A 3ADPA 3O9ZA 1Y9AA 5TJ9A 5A04A 3TZ6A 3GEGA 4FS3A 2YV3A 3UAGA 1DRWA 1HF3A 2JJYA 3ASUA 1HL3A 1MP0A 4YAGA 2QRKA 4P4LA 3DTYA 3KSDO 2PZMA 4IS3A 4R1NA 5DULA 4CM1A 2ZTLA 3S8MA 5JXWA 1VSUA 4DUPA 1J49A 3AOEC 4WLEA 1TLTA 3UUWA 3PDJA 3G3EA 1LDYA 2O3UA 2E48A 3HDJA 4IXTA 2JKVA 1K6IA 1VLLA 5KJ1A 3Q2IA 2JFGA 3MTJA 5JDCC 1KYQA 3CZRA 3DOOA 1MXHA 3HG7A 4XZ3A 4P22A 4YT5A 3ZHYA 1L7EA 1T1SA 1HE3A 4GX5A 5DT9A 5ITVA 3M2PA 2BFAA 3WMWA 4I9NA 4BO5A 1VKNA 3N58A 3SLGA 4E12A 3TFOA 4RF2A 1GDHA 1P3DA 3DONA 3GAZA 3BIOA 4BNIA 3Q0EA 1PL6A 3CEAA 1UP4A 3L4SO 5DCYA 5IG2A 1YWGO 1MG0A 1NHWA 1YDWA 2GZ2A 2H6EA 2HU2A 4WLUA 4ALMA 4YT8A 1LC3A 2VWGA 1IHXA 4N7RA 2OGUA 4R01A 3L0DA 3DMTA 3GHHA 4CMEA 5L7WA 1CEQA 1JAYA 1PJSA 1Z74A 1ISHA 5CFZA 2GN4A 2R2GA 1QLHA 1GZ6A 4L4RA 3NDRA 4ROSA 4XGKA 1CQJA 4EJMA 1HE2A 1Y81A 1GFSA 4PIVA 1OC2A 1JW9B 5JY1A 2X9VA 4Y6SA 3NRCA 3OECA 3DMYA 4Q3EA 3QY9A 4J1NA 1RM0A 1O89A 1VJ0A 2E4AA 3PXXA 3ANLA 4ZA2A 2B4QA 1LU9A 3PJDA 2O3SA 2D0IA 2AEJA 4YB8A 1FDUA 3D0OA 4OQZA 5JLAA 3WB9A 1NVGA 1ZSNA 2P9CA 2ZQYA 2ZTMA 3JD3A 5LDGA 1KEVA 1RJWA 3P19A 5ITWA 3ZWMA 1UAYA 1ZCJA 2WE8A 4LMPA 1KERA 5EJ2A 4JQCA 4AJHA 4Z9FA 2B69A 1EFLA 2BI7A 3NTOA 4RF3A 3I3OA 4NU5A 4CMKA 3OH8A 4GBJA 1ISGA 3DL2A 3WYCA 1VPDA 2AE2A 1FDWA 2CVQA 2Y1DA 5K9ZA 2CDCA 1JKJA 2BGKA 2CFCA 3HQ4O 1PGNA 2FZEA 3F46A 2DPGA 4MIYA 2HRZA 4BNZA 3DHNA 1O6ZA 1YBMA 2G1UA 4NR0A 3IIEA 3DOCA 1T1RA 1E6UA 1HDYA 2W2LD 3D4NA 4JLWA 3ANMA 3VPGA 3PHJA 2Z1MA 4GAEA 3ZU2A 4BNLA 1G0OA 3VZSA 3HB5X 3QRWA 4DXHA 1QXSA 1RPNA 1GYRA 4KZPA 1Q7GA 4DLBA 1NX6A 4W99A 5L51A 3LK7A 4TRRA 4HKTA 3T4XA 4DMLA 1RM4A 5K0ZA 1J6UA 1R4MB 1U9JA 4RLSA 3RAJA 4ZQHA 4E2ZA 4Z3KA 2PKQP 3COSA 2GCGA 4KWIA 2Q3EA 5CDSA 3OQ6A 5FEUA 3LT2A 3VH4A 4HFNA 3O4RA 4ND3A 1MXFA 1EBFA 4B3JA 2GDZA 4BO1A 2I9PA 3FRJA 4B4OA 4RF5A 1N1EA 4DQXA 4WK6A 3UCEA 3K9QO 3BHIA 1ARZA 1B15A 2RH8A 2CF5A 4OOEA 3UKOA 4WPGA 4IINA 1P1FA 3HDHA 1WAMA 1TXGA 4NFYA 1YB5A 3PZRA 2Y1CA 3ZWCA 2NWQA 3B1KA 3INRA 4GQAA 4ZRMA 3ORFA 4C7JA 2BI8A 5ADHA 1UP6A 2NM0A 2NVWA 3RJ9A 3OJOA 4G81A 3E9NA 4KWHA 3WGOA 2RHRA 5U1PA 4J43A 3U0BA 4A10A 2JCVA 4WJZA 4HBGA 2HRBA 2OBNA 3JQAB 1B8VA 3GRKA 4P8RA 4UULA 5J23A 5KNLA 4NJOA 4ZICA 3VH3A 3STHA 1PGPA 5JCJD 4CM4B 3DZKA 1YQXA 4I5GA 1PTJA 4UAGA 5H82A 5BSEA 1UP7A 4UVIA 4BQRA 4Q3BA 4MVJG 2JAHA 3I9NA 2D1YA 4OQYA 1Z82A 2PZJA 3JQ7B 2J3HA 5F1PA 1Y8QA 1IHYA 3LT1A 2D4AA 2X22A 4FSHA 5EINA 5HM8A 1PR9A 5THQA 3VH2A 5JW6A 4E5YA 5CDYA 4IJWA 3IJRA 1PJ3A 4EEXA 1NWCA 2NU6A 1NXQA 2VRCA 1ISIA 4IIUA 1W73A 2Q2QA 1I3KA 4XYMA 2WTBA 1ONPA 1GADO 4RVSA 1T2FA 2BRUA 1DEHA 4M54A 4RDIA 4CMBA 2WYVA 4GSKA 4AFNA 4CODB 3ONDA 3MWEB 2HLPA 2JCYA 1K5HA 4N5LA 3F3SA 1R12A 3PZBA 4U8GA 4YJHB 1U3VA 1CIVA 3OEWA 1P0CA 2QX7A 3AK4A 4WCFC 5T5QA 4A5OA 1C14A 5DBGA 2P5UA 1QYXA 2NVBA 1U1IA 2OO5A 4R54A 4J6FA 2I5PO 5T8KA 3DAPA 3W6UA 5BR7A 3WFJA 3AJRA 4ZN6A 1C3VA 4ZHSA 1U3WA 2VOJA 3GLQA 3DZHA 3ZW9A 4TKMA 1K3TA 1WDMA 2HJRA 1P45A 2FY8A 4FDAA 4GSLA 4WLFA 3ZV5A 3LT0A 1PZEA 2B37A 3L6DA 4DQUA 2Y1GA 5JDIC 4KUGA 4GLOA 4TVOA 4K9DA 4NJMB 3BMQB 1UH5A 2DLDA 2DBVO 4PLWA 3VOSA 1R4NB 2VZ8A 3WGTA 2YHUA 4YTEA 1B26A 1XGKA 3AM5A 3OEYA 3GVHA 5EQDA 3ROKA 1KY5A 3G1UA 2D2IA 3MJ4A 4L74A 2AHRA 3I6IA 1EUDA 3FI9A 3INGA 1HYGA 3D3EA 4MVJA 2WM3A 1I24A 3EW7A 3U62A 4LK3A 4J9UE 2CUKA 3RJ5A 3PJEA 4BO7A 1P9LA 3GN1A 3RD5A 2FMUA 4O0LA 1R16A 1ENYA 4J16A 1YB1A 4N5MA 1BXKA 2B4RO 3E9QA 3NUGA 5C7OO 1GCUA 4CV0A 4P38A 2NQ8A 3T4EA 3MOIA 3GAFA 2UAGA 4BGUA 1P1RA 1PJCA 2AQKA 5T8KC 2GF2A 4IDGA 2ZYAA 4YACA 5IZCC 1D4FA 3D64A 4A7PA 1GEEA 1B3RA 2VCYA 1BGVA 3F6YA 5L40A 5EMHA 4R5HA 1ZK3A 1HDCA 2O3TA 1H9AA 5IAAA 1MGOA 4D3FA 2WJPA 1G0NA 3I9KA 2JD2A 3GUCA 4U0KA 4RO0A 4BNJA 1DXYA 2OL4A 3Q1LA 4RF4A 4FJ0A 1SCUA 2FHSA 1ULUA 4XX0A 2C2YA 4XQCA 4E21A 2O2SA 3PQFA 4JXKA 4Q3AA 1W8DA 4YQYA 1XLTA 3WJAA 4ITUA 3A14A 2YQ4A 3ZWVA 3ZHXA 1NFQA 1XYGA 4JBGA 5G2OA 2EGGA 2P9GA 1LQUA 4Z0HO 5C7IO 2X5JO 4R3NA 4XWYA 1T24A 3CTMA 3O8QB 3OM9A 2EV9A 2EG9A 2UVDA 1Y5RA 3PK0A 3QHAA 4DBZA 3WGYA 2DBQA 2YW9A 8ADHA 2AQIA 4Y98A 5I8WA 1O9BA 2F00A 1X7HA 1HDGO 1IL0A 1ZSVA 4XEHA 4Z9YA 8LDHA 1GQ2A 4E5KA 3OFSA 2J5RA 3KYCA 3AU8A 4D42A 3UICA 4XQ9A 4TRJA 3H6KA 3PHLA 3U4IA 4DWVA 3R6DA 1KC1A 1EQ2A 2NVUA 2GRAA 1ZBQA 4IMRA 4O6VA 1WZEA 3WIEA 1KC3A 1W0CA 4U6SA 4CM9D 1ULSA 3RKRA 3TDKA 2PZKA 1JU9A 2Y1OA 4MKXA 4M1QA 1SBYA 2NV6A 1GV1A 5A3VA 4BMVA 2H1SA 4NHEA 2VN8A 3TOZA 5A9SA 3I9JA 1ISFA 3FHLA 4FW8A 1LDMA 1HETA 1JTVA 1JAXA 2CD9A 3D5QA 4CV2A 2C5EA 1CYDA 1CRWG 2GNAA 2IZZA 3DBRA 4S1VA 4CLHA 2JL1A 2I66A 3CH6A 5EPOA 5L3ZA 1F06A 1YOVA 4DPMA 1YBVA 3PQDA 1NYTA 2RIRA 3UH1A 4JN6B 1NQTA 2PKQO 4PG7A 4RPJA 1RWBA 2OFPA 3E48A 2D3TA 3I83A 1KVTA 3M1LA 1PJ4A 1E1LA 1TA4A 4OKIA 5I7SA 3AFMA 2I99A 4BOYA 1C0IA 1TEHA 3O26A 4ALKA 4CM8B 3NYWA 3BZUA 5TJHA 3PLNA 4CLRA 3L6OO 1AE1A 4M55A 3IAHA 2IEBA 4Q3DA 2A94A 3F5SA 4MO2A 1Q2XA 4LRSB 1JVBA 4RGBA 1XEAA 3WICA 5JYDA 1ADFA 4B79A 1UZMA 3RQSA 3A4VA 3HN2A 1ID1A 1KIFA 3FPLA 2RH4A 3ZHZA 4IJKA 3DBLB 1DFHA 2VQ3A 1N8KA 4B7CA 5TT0A 2GERA 1ZO8A 3TL3A 3WTCA 4BV8A 4IDFA 3PIDA 1HWYA 5JMPA 2W4QA 1PX0A 1Y8RB 4KDFA 4J90A 5KCZA 1X14A 4W9NC 1DC6A 1ISJA 3QVTA 3PYXA 1LJ8A 1VJTA 2ZYDA 2AXQA 2ZKLA 3BMOA 3R0IA 4H15A 4U5QA 1JWBB 3PTZA 7ADHA 2JD0A 3D7LA 3AM4A 5TNXA 4I5EA 4CM7A 2GSDA 3CMMA 1QYCA 3DBHB 3GVPA 2VTEA 3MEQA 4L73A 2ZCUA 3EY4A 2GUGA 4YYZA 1WMBA 1P33A 1M76A 5HS4A 2VHYA 3WGQA 3ST7A 1B16A 3GGOA 2FRDA 2VRCD 3HB4X 3W8EA 4EI2A 3GZNA 5C5IA 2BFPA 1DC4A 2POQX 5LCXA 2BLLA 3AUUA 2W2LA 1ML3A 3C1TA 1R0KA 1Y9EA 2PH3A 4RPKA 4EDFA 5TQVA 1U8FO 2ET6A 3P2YA 4EJ6A 2HMSA 4FPXA 4XDZA 5KVQA 3M2TA 1D3AA 1PJLA 2NQTA 3DZJA 2ZJ1A 5AXCA 3ZN2A 4B7XA 2QYTA 2YQ5A 4M49A 2NU8A 1SMKA 1LQTA 3LDHA 4JNKA 4XA8A 3JQCA 2FP4A 4BGEA 4G65A 4EW6A 4YXFA 4R5MA 2XOXA 3FNFA 2B83A 1HRDA 1SOWA 1EFKA 1EQUA 4J4HA 5U4QA 3FN4A 1V3UA 4R68A 4KTVE 2I67A 4D45A 3PI7A 3WNQA 1QYDA 2ZCVA 3TZCA 4QT0A 1EE2A 1U4OA 4WECA 2V6BA 3GG9A 2X0RA 5JO0A 1NFFA 1W6UA 2VNAA 2ZIZA 4M86A 3VHRA 4OOFA 3H2SA 4XIJA 2V6FA 5CP8A 4D41A 3DB2A 3IS3A 1GUFA 3RUAA 1H6BA 4OMUA 5F3RA 3RU7A 1TT5A 2R00C 1DB3A 3EDMA 1M6WA 1VI2A 4MVJD 3PQEA 4LGVA 5DN9A 3EHEA 1KVQA 3ZGYA 3PGXA 4E2YA 1T26A 2E82A 2JFHA 4FOOA 2PTGA 1PQWA 3JYNA 3NGLA 4R41A 5L9AA 5EL0A 3KM0A 1W4ZA 3JSAA 3I9MA 4I8XA 3JTMA 5HWSA 4ZGWA 3DZGA 3FCOA 5JCJA 3W4JA 4CQMB 2DPHA 4EITA 1GL3A 4MVJP 1EVZA 3F5QA 4EUEA 2DM6A 2QRLA 2WYWA 3AOGA 4N18A 2PFGA 5IXYA 5GY7A 2AA3A 1U28A 4FFNA 3BTSA 2WMDA 1DO8A 4PCVA 5EESA 1P77A 4E6PA 2GN9A 3FTPA 3O03A 4J3FA 2OORA 2VHVA 1N2SA 3ZV3A 3QP9A 3RKUA 4RVGA 4GPD1 1DOHA 2W2KB 2X0IA 1U7TA 5L53A 4QSMA 1OZAA 4EBFA 2J3IA 2LDXA 3GK3A 4BO4A 2HMVA 4B4VA 3MJCA 3TZHA 3F47A 3GNSA 3G1TA 3GZ4A 1B7GO 2JAPA 3WGHA 4PN3A 4L8VA 4CMAA 2OP0A 4QEDA 5IJZA 3ONFA 1RYDA 4I5FA 3HDQA 2EHDA 3C24A 2VT3A 3PHHA 3KXDA 3UW3A 3U4HA 2HCTA 1ZKMA 1ISMA 4U0JA 1XR3A 4CLOA 3K30A 2BF7A 3ON5A 4XJSA 1A4IA 4TROA 1K2WA 2DU8A 4FBGA 3RWBA 1C1DB 3L4BC 4WEOA 2O50A 3PGJA 3PVZA 3AUSA 5GZ6A 1UXGA 5AOVA 4D79A 2R6JA 4AJNA 5CEFA 4GVLA 1DAOA 3AI2A 1U3UA 2VWQA 3TSCA 5B12A 1DC3A 1YQGA 5LDHA 3NAQA 3VPSA 5IDQA 1EVJA 2GLXA 2E6UX 3GNQA 4J7CA 3OIGA 3DHEA 1QORA 3VDQA 4NPCA 4XYBA 5IDYA 5BSGA 5DP2A 2NTJA 5KTKA 3RBXA 6ADHA 1QLJA 3EUWA 4RJTA 1E3LA 4LVCA 1YQDA 4RVUA 3HHPA 1Y5MA 2NLOA 1XHLA 3Q2KA 4YRDA 4WNIA 2FPPA 3G79A 5THKA 2HKIA 3IUPA 4CQLA 4UUNA 1XELA 2PGJA 4PGFA 4ILKA 4IBOA 4XGIA 4R4JA 3RSHA 1WMAA 2PA3A 2W90A 2Y1FA 3OA0A 1UAGA 3DDNA 4PG5A 3WX0A 2X23A 4BB5A 3FBTA 1HXHA 2C07A 2EP7A 3RASA 2DT5A 1NASA 5L7TA 2FZWA 3DFUA 3FSRA 4I9UA 1LRKA 1E7RA 3Q3CA 4YR9A 1NQ5A 1D7OA 4Q39A 3VTZA 4B3HA 3NTRA 1C1XB 2C0CA 3ZWAA 3HE3A 3TL2A 4OH1A 1H9BA 1B0AA 4PRKA 1PZFA 2PD3A 4EEZA 3ETGA 1Z6ZA 1E7QA 5AXDA 3JD0A 1PEDA 5A9TA 2ZB8A 2J5KA 4PLYA 2O23A 1HLDA 4Z6KA 1YJ8A 1LX6A 2YDYA 4H7PA 1MLDA 3QWAA 1IB6A 3RC2A 1YE3A 4WCDA 1QYVA 3VVCA 4BKQA 1ZNQO 4GMFA 1F8FA 4O1MA 1GV0A 5KVCA 3IP3A 1LLDA 1ZMOA 3QV1A 4J4BA 1HDRA 4J7UA 5HA5A 3OP4A 2FN7A 3JV7A 1SEPA 2ZB7A 3MJVA 3IL2A 1AN9A 4S3MA 4EYEA 1GAEO 1UXHA 5L95A 4UVGA 3JQFA 1TB4A 4E2XA 4OXNA 1LDEA 5JYEA 4PLHA 4YAJA 5CG2A 3GDFA 4LCEA 2Q4EA 3MWDB 4P4NA 1YJQA 4BV9A 4F3YA 2BFMA 4R9SA 3GVCA 3VKUA 4CM6A 4QTZA 3UXYA 4CR8A 2CVOA 1N9GB 3KYDB 3RC9A 3D1LA 1LTHR
chains in the Genus database with same CATH superfamily
1RM5A 1LLUA 1R9GA 2JI8A 4C08A 2TMYA 2EWVA 1BH6A 3LSTA 2VZ9A 3JRNA 1YL5A 3BGIA 4KXXA 3O8NA 4U2DA 4IJVA 2FW8A 2QJFA 4X1KB 4YRKA 1AGXA 1VMDA 4QHTA 1DMSA 5KWJA 4GWKA 1FK8A 1IFXA 1NMZA 3HFSA 3PXGA 4PAWA 4HNGA 2ZBQA 1UDCA 1LD3A 5CXXA 4ZZ2A 1KJYA 2OCLA 3GXBA 4WKOA 3EZLA 3VPCA 4AS3A 4OBWA 4TM8A 3LLSA 5EJIA 2O4UX 4ZHQB 1ODJA 3O75A 2BEVA 3R7SA 3UIEA 4EW1A 4EGJA 3CKLA 5AOBA 3GRVA 1LWOA 4OP3A 1XTQA 2CLCX 1FYFA 4BNFA 5A0FA 5AQ1A 4FMCF 4QLBA 1H3NA 4IDQA 2N3ZA 4QT4A 3OPXA 2B3TA 2A1UB 4LYGA 4WWHA 3OE7D 2QDKA 3OIWA 4GM1A 5F1KA 5CVTA 4MULA 2BEWA 3S81A 1QP8A 2ZATA 2B5VA 4JKOA 4QFDA 4K0RA 1KJIA 1U80A 1UC9A 4P4GA 2IPNA 1SKYB 4QKQA 1DJMA 1U8TA 2X2OA 3PDWA 1QTIA 2BEUB 2R62A 2ZRFA 2QXYA 1E96A 5JNUA 1WF3A 3O93A 1GNQA 5JQGB 1T29A 5HDBB 1YS1X 3PA6A 4H17A 9MHTA 1DG9A 2PX5A 4LRWA 2VQSA 3LQ2A 3R8CA 4QDJA 3U5TA 3QUQA 2BZ1A 4W8GA 3AEKB 1NRWA 3D5TA 4LE0A 4A0FA 3WNZA 2JHFA 2Y6VA 2CLFB 1X8KA 4RU1A 4E15A 4HMPA 1GTZA 1JSZA 1L3BA 4JBLA 1IB0A 1S89A 1T10A 4QPJC 5CM2Z 3RYIB 3JQGB 4PNZA 2WZDA 4PTLA 3M3HA 1JI0A 2DC1A 5C8ZA 1EK0A 3R3VA 3UAYA 4LTMA 1I36A 1GZHB 1OD6A 3IP9A 1EDZA 4DC1A 4IQ8A 2W93A 3JZAA 2FZGA 2HREA 1P2UA 2QI9C 4ZC8A 5MHTA 1YKGA 3MGBA 2DCMA 4ZVRA 1YQEA 3DBIA 4RVOA 1F0YA 4DZTA 4BYGA 5FOWA 2BEKA 3G0DA 1ECLA 1SHZA 1DBVO 3SJCA 2C1XA 3CNQS 4DYVA 1IQUA 1U1GA 4DLXA 4EY3A 1IZ0A 1Z2EA 4R2KA 3W2EA 4QBKA 1Z5OA 2CFIA 3NBUA 4G0VA 2YWHA 3G6KA 5AVSA 1EYZA 3HNRA 2WJAA 2VHQA 2W2OA 4NAVA 1TAQA 2I4RA 3OOSA 4PVCA 5REQA 2H4ZA 2DFKB 3GR6A 5LUBA 4BGIA 1YR1A 4IILA 4ZT6A 2Y3IA 5ULLA 4NU0A 4B45A 4C0AC 2G5PA 5CVJA 3NANA 4WK0B 5AKGA 3UF0A 4ZYXA 1D8TA 5JSUA 3HACA 2DULA 5MN5A 1N5OX 4ZVVA 1ADBA 2QJTA 4OHZA 2PMDA 1ONOA 4OMDA 3IPCA 3F73A 3PKJA 2WG1A 3DLTA 5BWMA 1N77A 5DTEA 4N41A 3AETA 4Y0VA 2HTFA 3DL4A 3ZV4A 5FBKA 3U3ZA 3NTLA 1GGJA 3AUYA 3C15C 3II6X 4INAA 2ZJ2A 4IZ6A 4YAWA 1ES9A 5AKLA 5E7JA 5B55A 4Q24A 1JEEA 2P2NA 4JJIA 3ZDQA 4MW9A 4CM4A 1VE7A 1AGNA 5KYNA 5LA6B 3KB6A 1H8HA 4GI2A 2PZBA 2HBQA 2FUKA 2OD9A 3UMRA 4UUBA 1R5JA 2FW0A 3ZJ4A 4ZOQI 3QEAZ 4LRXA 3FDXA 1VA5A 3HVIA 3I64A 5H59A 2C77A 4ZZ1A 1X1SA 1IE3A 3JQ7A 5G3YA 1P61B 3LUFA 3FWPA 3K9BA 1YVEI 3F0TA 3PQ4A 2G8LA 1JEJA 3B5IA 3HZRA 4FEYA 1E7WA 2IP4A 4JROA 3TZQA 3HDTA 3Q11A 2PX6A 1KL7A 4XSGA 4YPOA 2VTBB 2XGJA 4B3GA 1UBGA 2J3KA 4BB0A 1DPGA 2CNWD 2AYXA 1DBSA 3BX1A 4G5YA 1C3LA 1T8SA 4WUVA 5KNBH 1GPBA 2I76A 5DK4A 5IN5A 2HR1A 1D2RA 4K26A 4PQRA 1A95A 1L4NA 2EBWA 2FX5A 5CVUA 3RE1A 1E5QA 1WLYA 1XL0A 1LS6A 1OSNA 4W4TA 3PICA 2GSWA 3C7AA 4N9QA 2XUKA 1QOQB 1QH8A 1UJBA 3C0KA 1NHGA 2H06A 1EDEA 3HMKA 3IRVA 2RI6A 2C9CA 3OX2A 4V3BA 4H31A 5KKAA 1TUEA 3HUEA 3CBQA 3BA1A 5C52B 2PK3A 3KYIB 1X92A 2HRDA 1N8SA 2JFPA 4JCOA 4YJHA 1VSVA 2EBHX 4RA9B 3OLZA 1A72A 3I52A 3PFNA 4S1WA 4CKEA 3EQ8A 1Y3AA 1HE5A 1A71A 3HKEA 4F4FA 1FS6A 1U2DC 2V0NA 4G5QA 2WTMA 4CMIB 4PX9A 1N2CA 3PJFA 2R6DA 2IT1A 2ZS8A 4KIGA 4LSGA 1D1TA 1FJ2A 4LJ4A 5HCNA 4JR1A 2EW8A 4QX6A 4AY4A 4DR2B 2ZJZA 2XCIA 1XVUA 4LJRA 2IE0A 2H59A 3KE9A 4KGDA 3HV0A 2XSZA 5KVSA 4IGKA 2G0TA 3DZ8A 5DOVA 3T0GA 1V2GA 5DH9A 3RUCA 1FQKA 3WGMA 3FOZA 1UBJS 3H9GA 3UGKA 1OZGA 3LNTA 4B3RB 2IYZA 1RAEA 4BUJA 3C85A 1GG5A 3H86A 2RGUA 3LUBA 1E1CA 1USWA 2P9QA 1Z5PA 5G40A 1NVBA 2J3EA 2VT2A 3HR4A 3JWEA 4OG2A 2PIDA 1JE1A 3KPJA 2REQA 4AUMA 4OB8A 1OFGA 4G9EA 1EFUA 1GPNA 1YS4A 4J0FA 1VJ1A 3D7RA 1HR0B 4FYHA 2OFOA 4C4ZA 2FUG1 2LZ0A 1OLOA 4RVHA 3CZMA 3RIGA 4XWWA 2XUGA 1V7ZA 5FIUA 1E3JA 1BQEA 1SUIA 2WD8A 4LUCA 5EKUA 2HN9A 1JUDA 1NI5A 5CITA 1VA4A 5KKNB 5AKHA 3N8NA 5F2EA 3D2BA 4GHWA 5F76A 1NVAA 4OV6B 4U2KA 4BNKA 1NDQA 1GTMA 1KVRA 4I8IA 2C7RA 2I6FA 1ZI8A 4CL3A 1XCGB 3R4VA 3U7QB 1AA6A 2P90A 1VI5A 4L5IA 2Y68A 1SCUB 1C3EA 1QGAA 4KIUA 4KQXA 2G63A 1X15A 1PKEA 3HRHA 2ZJ6A 4P5PA 4BVGA 1QQBA 1XMVA 2QQEA 1A8HA 1HMYA 5KTRA 3TFQA 3K0EA 4HQKA 4B2PA 2HEGA 1FP6A 1ZNYA 1ZGJA 4AVYA 4H16A 4FNOA 5AVUA 4DQ0A 3BTUA 2QN2A 3QELB 4OMCA 1C7EA 2O0KA 1T6YA 2YH2A 1KNQA 3GQVA 4KNWA 4TZ0A 3L7BA 2V7VA 1W25A 4J16C 3IVXA 4IQGA 2CCJA 2IXEA 3IPAA 4PYNA 3HJBA 4RD6A 4JUIA 1IN6A 5G0WA 3OM1A 2F6RA 1E3EA 3C3WA 4JR2A 1EZ4A 3UK2A 2AMLA 2CLOB 3BORA 4TT3A 5EMMA 3LBYA 4OO3A 3IUQA 1R3UA 5A06A 1Z7YA 3A4NA 1F7VA 3H1PA 3SYTA 1TADA 3EBPA 3Q4GA 4FBLA 1M73E 4PS1A 3IQGX 3NH6A 4Z5XA 1BXGB 4MMXB 3GJ6A 1T43A 2X5OA 1BROA 2FJ0A 2WM8A 1EMDA 3AFIA 1RXYA 3R3UA 3R44A 4J0IA 4REQA 4X63A 5C7LO 3NHKA 1C9EA 1CHDA 2WT9A 3V42A 1MOPA 4BJ1A 1HT0A 4K9OA 2YVLA 2QUHA 3F5DA 4HF7A 4W9MC 1KE1A 4TWJA 4EABA 5EN4A 5BVHB 3BICA 3HCBA 1EWVA 1V11A 2DFPA 4KEAA 5EIBD 1VL8A 2Q7OE 3KQVA 3QKRA 5IS2A 4B43A 4BTLA 3ZVNA 1T8RA 2I3BA 1FMJA 1V43A 2Q1YA 2PGOA 4BNYA 2P6NA 3JYHA 3AINA 1WXDA 1XZMA 3INYA 3JQBC 1U4SA 2BAGA 5JC8A 4IHJF 4B7UA 5FUWA 1FPMA 4EUKA 4GQBA 2NOAA 4B8YA 4PS0A 2VPPA 2W71A 1AX9A 5CW1A 3ZW8A 1X7DA 2ZYWX 3SP1A 1WKCA 4KR2A 2AE1A 1KBZA 4E5SA 4BNTA 1Q7BA 4GOMD 3KWMA 4L2IB 2HWYA 1GU1A 3Q3EA 1OYWA 5ILOA 2E4VA 5HOQA 5LQRA 3R9WA 3G02A 4HUJA 4I36A 1O6GA 3PPXA 2C5GA 1Z4LA 2MIIA 4MPRA 5JCZA 1X7GA 3UMYA 4DDHA 5T3UA 2X58A 3HGQA 4X1YB 1SUEA 3FYUA 4C76A 3Q3HA 4G67A 3M5WA 1T9AA 4UU0A 2EERA 1OI7A 2H1VA 3ROGA 1LQ2A 1GGVA 2G3YA 3HCPA 2A9FA 1R0RE 5COBA 3GFQA 4ES6A 3SXJA 5IKXA 2PLFA 1SC6A 1VKOA 2YXEA 3CQ9A 1SZPA 4DM4A 621PA 4V0NA 4TRMA 5BW6B 1Z0JA 2XUAA 4HDMA 2JFWA 4N7JA 3SBDA 1PL0A 2J67A 2W2MA 3VFDA 1WJGA 3QKIA 2QV0A 5DLDA 4DF3A 2ZUFA 2Y1KA 1ZD1A 3QVWA 3L7KA 2GBLC 3EJWA 4LF7B 1MQSA 1W44A 1ZD3A 2A8YA 3STVA 2PZGA 3M4NA 2C4MA 4F0JA 3IELA 2HY7A 1DLJA 3EH2A 3HUFA 3PT9A 4FN5A 4EP1A 2Q5EA 1GFIA 4LXIA 2PSEA 3ETEA 1STOA 1TNDA 4QXAA 1KDOA 5F2OA 5JMTA 5BOSB 2YJ3A 4F60A 1MC1A 3SU8A 1IPHA 3VOTA 1XRPA 2MHCA 1IHPA 3M6AA 1T8PA 3DAGA 2XZPA 4UMDA 4ZO6A 1RKXA 3PTAA 3MCAA 2RAVA 3SQNA 4GVXA 4BP3A 1XZIA 1Q7TA 1UODA 3GARA 2CZCA 1I32A 2AQHA 3H2JA 2I1LA 1UMBB 5EYPB 1HNNA 2EQBA 1NP7A 3BMOB 1W1IA 4BGDA 4X5OA 3HK2A 1P19A 2VDUE 3K1JA 3AB8A 1LPOA 3TW6A 1JR3E 4ZOLF 1XWFA 5A4KA 2UUAB 3GGGA 1MPXA 2LTAA 4F9EA 3EIHA 5ECWA 1SXJC 1PCXA 5LYJA 1LPMA 3EAGA 3S2FA 1W9HA 3M4JA 2FPKA 1HFWA 4QDUA 4AK9A 4QQNA 4P54A 1G5IA 3DHYA 1WETA 1LA2A 2GHIA 2OOSA 3LS2A 1DG1G 1E2UA 3AG5A 3CRMA 3HLYA 3PWTA 4RK0A 3KQSA 1HOXA 3I6BA 2QOEA 1DKUA 1US8A 1Z0KA 2NN3C 4KJZA 4MKFA 4QGGA 4JJFA 1Z39A 3O2NA 4MGEA 4A1OA 3FE2A 3O9MA 3LNCA 1A2KC 5EG5A 3BD7A 3K0HA 5F7XA 5BN4A 1EFPB 2TS1A 4I08A 1DO2A 3G5LA 4MV7A 4PFSA 2VDOB 3DBHA 4QU9A 5FPHA 3DJFA 3FBWA 5JCXA 1N2HA 1R8SA 2QGFA 2W2NA 3WDSA 5BRJA 3EFOB 1IXYA 3P32A 4KUHA 4BMOB 1EUCA 4ZOAA 2G28A 4ZRDA 3TOXA 3ZC3A 2AKEA 1WKBA 2HSJA 4BVAA 2ID8A 5J43A 5EWMA 1K6MA 2BGTA 2NU8B 2ZU6A 3V32A 3P7MA 2QX6A 1JIKA 5KYUB 1ODSA 4LC1A 4YJFA 2PX0A 1FU4A 3BJRA 5I7AA 2RGEA 3OLVA 4DUGD 2GYVA 4EO4A 2ECQA 5TQ2B 1QIDA 5KTOA 3MQ2A 2HSWA 1Z08A 1IEQA 2I0FA 1S2MA 4Q4AA 1OTHA 4Y8VA 4HAWA 3V8PA 2MSLA 5IW8A 5IK2A 1G8MA 2GCOB 3ZBQA 3CNHA 1A1VA 2YWBA 4Q9AA 5ALLA 2BR5A 3PRJA 2F3UA 3T5CA 3BGSA 3NHRA 5HJ5A 2VP2A 3VU3A 3GJ0A 3CR3C 3ESXA 1ORVA 4UCFA 2FR1A 5LBTA 3H75A 3KHSA 1BTOA 3N5KA 2DJ5A 2HZBA 3H5RA 4FI3C 1CZNA 3C5HA 4RIHA 4KGZA 4UUPA 5BPHA 1FRQA 3QPCA 4WLNA 2X8AA 3ZNNA 2YV1A 3KOMA 4G26A 1JDJA 4ZC1A 4L78A 1ZWLA 1I01A 5AOCA 1I2MA 2PGXA 1G21A 3DV0A 3SR4A 3HCOA 1S2NA 4GZ3A 1J8VA 5EKSA 4DIKA 1KI1A 3HY4A 4G01B 4TXNA 4BHTA 2H1LA 2SICE 5I48A 1AXGA 1MIHA 4R6XA 4BO5A 4EYKA 2GPJA 2F59A 1VLVA 3V7YA 3H17A 2VDKB 3WKDA 2CNLA 3R41A 3E7DA 4W7SA 2E7ZA 4ND1A 1A76A 2ZJFA 1E9SA 4RE5A 2Y76A 5LJLA 4YA6A 3RROA 3JWHA 4BX0A 2PMCA 1IOWA 3K4PA 3QU4A 4UATA 3F5MA 3CX8A 4RANA 5EGNA 3VKFA 4E94A 2J3JA 5CT9A 1KETA 4LHZA 2CLEB 1SCDA 3WGNA 4QDOA 4TWRA 4D3YA 1KO8A 1YS2X 3KR1A 3AG6A 4Z99A 3M3DA 4MR9A 3R7FA 4HWTA 4KDRA 4ERXA 4EHDA 5IRCD 3MJDA 2OV3A 3NDBB 3LUDA 1DHRA 2WSSD 1CDDA 1MVOA 1ZJYA 1Q95A 2CLLB 2IEDA 3AZQA 2J9FA 3FTQA 3HNOA 3I1YA 4FFRA 4WIAA 2ZYHA 1UK9A 4CQMA 5L6MB 3U44A 3D8HA 1U7XA 4ZT4A 1I6MA 1QSGA 1MC5A 2AR0A 4FCVA 2D2EA 3AEUB 2VQEB 2FDCA 1H3FA 1ICEA 1MFPA 1Y6RA 4NBNA 4NBTA 4RM2A 4XDYA 5DXAA 1PJRA 3UMVA 4ITVA 3WSWA 1N1MA 3BK2A 2GASA 2Y1LA 4FXOA 1HPLA 1QF9A 1XAGA 4WL0A 1U8XX 3PNLA 2XUZA 3R09A 4H2DA 4L5JA 4JJ4A 5D51S 4L0MA 5A05A 2C2XA 5TY0A 3VTAA 2Q4OA 3DS8A 4KK4A 4CJXA 3BMNA 4HSGA 1AG9A 5GTDA 5HZHA 1RPJA 1HTBA 3GA0A 1S8FA 4TTPA 1F12A 3VVMA 5C81A 5E3IA 5EMNA 4M9UA 3QUSA 2JEYA 4Q4JA 3RREA 3F7TA 5EFZA 3N2IA 3DT8A 2E18A 1NOIA 1Q21A 4LJLA 4DW8A 1BD3A 1PHPA 1XZNA 2YVUA 5JBIA 1YZHA 4U63A 2HUNA 2RBKA 3K6JA 5HIIA 1Y7PA 5D85A 4IIYA 2YBEA 4Q1VA 1OLUA 3U19A 4L07A 1V8OA 4DM7A 1E2MA 1SC3A 2BHSA 1HDOA 2Y99A 1H69A 3DJYA 4HQNA 4XJTA 3THSA 4MVJI 2AJDA 1ZVKA 4BMSA 4I9FA 4DCOA 1XPJA 3V4OA 4GR5A 2NPFA 1UKCA 3W5CA 1NNUA 3NPAA 4JBIA 4DA9A 3E5NA 3TG8A 3H7AA 2V9ZA 3TKAA 4E4YA 3RCBA 4DIOA 3GA5A 1JR6A 1NVVQ 3CLKA 4KXFB 4OQ4A 2VOEA 4J49A 3MJRA 4AUNA 4CL8A 2WKSA 5DSTA 4IXMA 4GOKA 1RWOA 1H2HA 1SG0A 1F2VA 1XMXA 1YASA 2FR0A 3B52X 1RHKA 1NW5A 3B9BA 4J6EA 3AH8A 2ISSD 1YZKA 4WOKA 4WOCA 4M87A 3NTVA 4M1MA 3CB4A 4DIEA 2ZE7A 3GUYA 1JJFA 4NDNE 3BJIC 3TTTA 4E2WA 5BP7A 4GI5A 2NXJA 1MRSA 4NFHA 1LK0A 1XX6A 2XVMA 1ICIA 1C80A 1T2UA 4R1MA 4LNAA 3W90A 2PZLA 1RTKA 1AS0A 1Y89A 1ZZEA 3A1SA 2QM0A 3IMEA 2PS9A 5FFFA 5JVDA 3GDOA 1T3GA 3WNBA 1U1CA 4ZTUB 4BVFA 1EEHA 3LDGA 1WBDA 2CHFA 2P30A 3DR3A 3WWOA 3E7WA 3WHPA 1OT5A 4HC4A 5C9ZA 3NV7A 1RYBA 2RHGB 3E4CA 4G0ZA 1JS1X 3UTCA 3FZQA 1YT5A 2IPXA 2J32A 2B1GA 3IIIA 3HGMA 4KYIB 1F2UA 3U13A 2GN0A 1F3LA 2VNHA 3BXOA 4LFCB 4AYWA 4DKXA 3JYOA 3DEKA 5K8VA 1W87A 1ESCA 1UBRS 3FRIA 5JH7F 5EKDA 3THXB 1EP3B 4BATA 3JD2A 4DT1A 2WA2A 4RMIA 1HFKA 1PGJA 3JWJA 4EFDA 2VDVE 5A7HA 5A5DA 5HKAA 5J1SB 4CWAA 1DNPA 2XCQA 3IBCA 5EZQA 1TQHA 4MHOA 5I7FA 2D5CA 1QVVA 2PEZA 3AXTA 3KZCA 2P4EA 3ACDA 1O95A 3IVGA 3UT6A 2WAOA 1RKQA 4KNVA 4YRIA 1C1XA 1KMMA 1NA5A 3LY9A 4RUKA 4EI7A 5JNRA 3WS7A 1KAOA 5KPJA 4E31A 2A9RA 5HRUA 1ZM2A 5I7HA 3TUZC 1N5LA 5ER9A 3REQA 2DH6A 3DL7A 3NXSA 5FR1A 3SC3A 4MV8A 4O2AA 1H8EA 2OWEA 1DAKA 3BXFA 4PWYA 3TW0A 2XIJA 4F3NA 5AVYA 2P6OA 4HDCA 3NDIA 4WHMA 1SU4A 2IZ6A 2V5UA 5F5XA 5I5GA 7GPBA 5E9QA 2G80A 1TAUA 1VFPA 2AEMA 3DM9B 1N2EA 4XD7A 5I8PA 1WY7A 4GPEA 3UWDA 3EQ7A 3MS2A 3TQCA 3ENWA 3RC3A 3TF5A 4AKTA 2NT3A 4ESOA 2UYGA 3K3PA 2VJMA 5AHWA 2XMSA 1N75A 3VVBA 3AF5A 1NR7A 4E4RA 4DSAA 1GDTA 3KSMA 4M76B 4YO8A 1DT3A 3RFUA 4H1TA 5IT0A 1D1PA 2VH1A 5EZ5A 2OXFA 2XCUA 2YCLA 1RPTA 2I4LA 5FKJA 1HM5A 1VIAA 2X5NA 4MTCA 3CSUA 4ENTA 4BWGA 1PQPA 2HDHA 2OR3A 5IBRA 1GCOA 4X7BA 5JS2A 1G38A 1A9SA 2YHIB 1UJMA 2NO0A 3A06A 1E6KA 4GBED 1FCJA 3I0MA 2YZ7A 1RVV1 2GCEA 1EUZA 3RLFA 1FDSA 3CVOA 4EJSC 2CBZA 1N9GA 1KP3A 1XZJA 5EXEA 5FWNA 5AJHA 4JLDA 3TXAA 1Y8AA 4C20A 3WAJA 1WS6A 4N8EA 3WZ2A 2P1ZA 4BO9A 1QF6A 1C41A 1ZP6A 1YZQA 1M2OB 1SCKA 4X1KA 1EWKA 4PZLA 4FWBA 1XTKA 5ALYA 5HBRA 5KCMA 3ZVLA 3GT4A 4BUZA 1NLMA 1FZQA 5B1DA 4KRXA 1G7SA 4P7FA 3KO8A 4JGIA 1PJTA 4KQWA 4QYWA 1GQRA 3FHJA 4KO8A 4LGCA 3ZU6A 4DM3A 2FSHA 2MSDB 1IDN1 4A6PA 5JI3E 4H6XA 1N8NA 3RS5A 4DZRA 3IIJA 3VR3D 3VZQA 4MS3B 1J2YA 1EHCA 3FYDA 3H13A 2JFZA 4QRHA 5FLEX 1MBZA 2CE2X 2A1UA 2I34A 2XNJA 5GAJA 4CM5A 2KSQA 1LTKA 1PRYA 2ZRIA 3BCHA 3GOQA 3MQFA 3L4KA 1U02A 2BDUA 3I2JA 2J6IA 4C7BA 1YKFA 2B7BA 3QY0A 4II3A 4UD2A 2IXAA 4YQZA 2I2CA 4CV3A 4GE0A 5T41A 3AUAA 2GNPA 3DC7A 5M04A 2CFSA 4GO1A 4FGZA 1ABEA 2BEUA 2WF5A 3IQIX 3KEFA 4Q6WA 4Q9IA 3UT0A 3FOCA 2ODNA 4IZHA 5LD2B 2UYHA 3M70A 4B3DA 2GD2A 2CWWA 3FMOB 2Y0DA 2AWNA 4JMLA 1E20A 1QG2A 3A9SA 3AERB 1M2VB 2QQFA 2Z2JA 2VYVA 3AEKA 4GLBA 4IZOA 3T7JA 3IEMA 1VHJA 2O0LA 1FNSA 4M38A 4QATA 4RLQA 2DPXA 2XBLA 3MBIA 1QAOA 2AEFA 4OUKX 3ZBTA 1XC7A 4OAPA 3EGCA 4G5HA 3RYIA 4FC6A 3JQGA 3TQHA 3WI7A 4DVJA 2XZOA 2OZPA 4YEDA 3RBZA 2A7XA 3K4QA 3K9WA 4MPJA 2QN6A 5JANA 4HV4A 1A5BB 1Q3KA 4PLTA 2WEKA 1A82A 3T15A 3ZGNA 5H02A 1LF5A 1QGZA 4AJKA 2BUBA 1R9JA 2H9IA 5LXTB 1QPZA 3ZDCA 1THGA 1E18A 2C9BA 3KL4A 3GRRA 4JVMA 2R1UA 4H0NA 4HQFA 1TC1A 4TV9A 1UPBA 4HEQA 4XR4A 5ALKA 1CWUA 2FN9A 3A1FA 1YZYA 4D56A 2ZUDA 5D6OA 1W85A 2QDXA 4Z0TA 1ZGZA 5GP1A 3JQAA 2VKQA 3H5WA 4RHCA 3VSAA 1PSWA 1M3SA 2FCAA 3E18A 3QYPA 3ZY3A 3NJ4A 3C4JA 3QFFA 4MUKA 4NJEA 4Q7QA 2IV7A 5HS6A 2XUHA 1YMQA 4FGSA 4IGEA 4LHXA 4IMPA 4RABA 1PJ2A 1BU5A 2AOTA 3KB8A 4FE7A 4YK7A 3WMXA 3ZUPA 1H2BA 3BIXA 2V5AA 2VQ6A 1G20A 3NBMA 3ZS8A 4YRAA 4BX9A 1AH2A 2B94A 3E3NA 2W7TA 3PNQA 4YRNA 3FDFA 1RXCA 4FFMA 4WZAB 1GXSA 2QP9X 2ZG6A 4J4TA 2JK0A 4B6QA 3K8OE 2J9ZB 2ZDHA 2ZSJA 1JQBA 3ZZNA 2VYNA 1RQNA 3OQNA 1D1SA 3TD2A 5ENZA 3H9JA 5FNVF 2P9JA 4U7DA 3EPKA 2QM7A 4JBNA 2JJ1D 1Z8NA 4XB1A 3EZNA 1MX3A 5IF3A 4A26A 1VRWA 1SUDA 2VCHA 3P9XA 4QA9A 4MB0A 2B20A 2OECA 3L0ZA 4RTNA 4JWTA 4LC0A 3F67A 2VJOA 4MKZA 5KOJA 1YQWA 1FLAA 3ND6A 2ATIA 4ZALA 3NGXA 2CUZA 3QLEA 1Z26A 3IAFA 4P3OA 2DSTA 4JQSA 4JLVA 1GTG1 2ZSKA 4M9CA 2Q5IA 1LBSA 4FYXA 2EBFX 2GEFA 2RAUA 1CZLA 3ETJA 1UJNA 3DEIA 5TV2A 1KBQA 1EXVA 1V3VA 3HEBA 3BGDA 1GOTA 4HY3A 1FP7A 1NN1A 5J5CA 3H5OA 4W5TA 2AZDA 5KSZA 2D5AA 4L8WB 3HJAA 1GTVA 1XZHA 2HDNB 4A4DA 4D5GA 1E2EA 2R96A 3TLBA 3LOPA 4MIOA 3TX6A 4GXTA 1D8AA 3U7HB 2QR3A 1VLQA 1Y6JA 1GUYA 3NX4A 4UPDA 5EHGA 4RA9A 2WMOB 3RSHA 4U7JA 2AI3A 4LTDA 2Q5OA 2ARKA 2HOQA 2TMKA 3X1WA 1VIVA 2AK2A 4CMIA 3BS4A 5B30A 5CXQA 5I7EA 1L5YA 3T7DA 1Q3TA 2K5UA 1NNLA 1X80B 3PNMA 3WBBA 4BO7A 4XM2A 3O2SB 1EK5A 1NC3A 3QEJA 2GBFA 5FAXA 4QPPA 4Q5IA 4JYMA 5DBHX 4FN4A 4M4SA 5TGDA 2C8LA 1ORWA 2WTXA 1F6DA 1XNGA 4D9EA 1X9GA 3N0TA 4ENRA 1NKSA 5IWCA 1RIFA 3B6ZA 1BFUA 4PNPA 3ZK7A 3FLMA 2EZUA 3A1DA 1Q17A 3KXIA 4UDYX 3WGZA 4D3ZA 2UVQA 4DXDA 1XIVA 2E5FA 3NUZA 4TQAA 1KJWA 1J4AA 3FFWA 4MP3A 2REBA 2Z09A 3GDWA 2YDXA 4MJ7A 1KWKA 1UXOA 3A3NA 2H29A 2OUIA 3SF8A 4YUWA 2H2FA 3IVRA 3SVTA 3ZZ1A 1QFMA 3IKVA 1A4XA 1ZONA 2VSYA 4GEKA 2H4HA 3GFGA 4OJNA 4RZUA 2HU8A 3N5CA 1LFAA 1Y5NA 2FR8C 3ENZA 4R1LA 3ZWBA 4RMNA 1UFQA 1RLTA 1R8YA 4CIVA 3M6IA 1TMKA 1QHSA 3FPBA 4QNRA 3WBJA 5EXPA 4EVQA 4CN9A 1ISPA 3BXGA 2BR3A 3P71T 3CUKA 3S2SA 3FCEA 3UMCA 4ZTZB 2WU3A 3K70B 2BTQB 2ZJ7A 4QXOA 4YJ2F 3ZCQA 1WULS 3FSGA 1BSVA 3WISA 1NW6A 4JYBA 3HL4A 4Q9KA 4EPRA 3K73O 4MUEA 1AN0A 3K5HA 4Q00A 3U7QA 3FCXA 4EUFA 5JNLA 4JC5A 3OOWA 2BISA 4QXMA 3SHWA 4BVHA 4P53A 3HWWA 5AM2A 2WJIA 2X6TA 2ZIFA 4BNNA 4HG2A 3ODGA 4XIFA 2XCSB 2CDNA 4W8OA 2VHJA 3OPNA 1QMPA 3F9IA 3KWLA 3QELA 1JA1A 4AMUA 5JMWA 3UMMA 1RADA 1L8XA 3WLLA 2HNKA 2VNIA 2WIGA 4XARA 5FPYA 3L0IB 1YAJA 4FLMA 4INOA 2NVUB 3H87A 3NONA 1FXWF 1GRNA 3WKBA 4AMVA 4F9FA 3PX2A 3EZYA 5DISB 5K4AA 3OA2A 3FYTA 1SHLA 3EG5A 4Q9LA 2Z6UA 3C74A 1Z0DA 5FL7D 4MGZR 3P4XA 2IS2A 5JSQA 4NCNA 3K09A 3SR3A 2XA1A 4AJ2A 4EPXA 5DWDA 1NPYA 1XNJA 4HEHA 2Q41A 3I9LA 1BXGA 2ZEJA 1Z63A 1C9MA 1R5OA 2BCGY 2JBAB 3USZA 2AFIB 1MX1A 5TB5A 1TMOA 1VMIA 2GK3A 2V6MA 5D3MB 1YU9A 3DBRB 3VDRA 3TE7A 5EIXA 1UQUA 2GN1A 3B13B 2ECOA 3NHWA 1YZTA 2ZYUX 1L7MA 3MINB 4MUXA 5AKIA 4ZT3A 3ONWA 2FPWA 1YOVB 1Z17A 2UYYA 1DI0A 1CETA 5TMPA 1NF3A 5BVHA 1R1DA 4MRRA 5DBFA 1XDGA 1GA1A 3KAQA 2GD0A 2RHJA 4E0BA 4WY2A 2VYFA 2YN0A 4QIHA 4FOPA 5TGTA 1TJNA 3M34A 4I3FA 3UHFA 4H4CA 1OXXK 3AMVA 3EG9A 2EJVA 3GEMA 1ZCZA 2C94A 2X19A 4XXHA 3PFWO 3DM5A 2DPMA 5AI0A 4N3NA 3QW2A 1CJBA 1J56A 1V9SA 2IUTA 2QYOA 2V98A 2OKGA 3BSFA 4I5DA 1ZUIA 2JFQA 4M1OA 4R9RA 3T9BA 5BNIA 4G23A 1YRYE 3EVEA 4NLLA 2PFSA 1OCEA 4OHUA 2FXVA 3NORA 3PYLA 3SSAA 2OESA 1BYUA 1Q0LA 1MFZA 1RAGA 1RYEA 2WU0A 1JIXA 3H3JA 2QV7A 3KLOA 3OT5A 4PRZA 4RZXA 4WOJA 5IHXA 2O0HA 4FZRA 1A9XA 1QMGA 3PR1A 4D2IA 4OP2A 3B1JA 1FP1D 3KXKA 1R5BA 4EPYA 2GBIA 1G42A 4QVIA 5LP1A 4NZOA 2A4KA 1SY7A 3EZ2A 4RZ2A 1I94B 4LEIA 4ER7A 3OCJA 1XN4A 3QYFA 4CM8A 4XQEA 2Q99A 4Z2AA 2X15A 4L22A 1V4VA 5JAPA 2AOWA 2BGJA 3FCYA 4E88A 3Q5GA 2XD9A 3C3DA 3NWEA 1JXOA 4XRGA 3X43A 3IBFA 3ZV6A 4DCGA 1M6NA 3O2QB 1TVMA 5JD5A 1QV6A 2X6RA 3VTKA 4G8CA 2VDWA 1XRJA 1VL6A 2GZRA 3STYA 2C7PA 1JGTA 3T9FA 1O8CA 4AWXA 1XSEA 2BW0A 3PX7A 2Z2XA 4RZIA 2OOKA 1PWXA 3A2LA 4P3KA 3WGLA 1H9CA 4JP3A 2D7DA 2W6CX 2VUSA 3FYUC 1QCCA 2C54A 4IL5A 4CGZA 3W77A 3G2JA 3K9HA 1ODKA 2FSPA 2JLXA 3X1JA 4EA9A 3IMCA 3DBLA 4CN8A 1E9CA 1UEJA 3FPKA 4HNUA 4RDCA 2QRMA 2P4HX 3W1VA 5KIAA 1XD9A 3DDCA 4KSYA 3QJ5A 2AUMA 2HT6A 5C4GB 1KSGA 4BPBA 4M6WA 1RM3A 5LLTA 4AY5A 2J3QA 2XYRA 1SB8A 1LK5A 3STUA 5EYPA 2YYYA 3ZLUA 3VPDA 2IU4A 3NC1C 3T7KA 1T13A 1RACA 2HA0A 2NT4A 3K72B 4K87A 4MQUA 4ZQBA 3VO1A 1W4RA 3UK6A 3U9LA 1SBZA 5LLDA 5MGBA 3M49A 1TZ2A 4Y1RB 2V7QD 4CKBB 1J0XO 4LSMA 4QRDA 1NPDA 3I45A 2YC2C 1CY6A 2H57A 2GN6A 3OQOA 2VDLB 4NBKA 2GO1A 3UT5A 4TMWA 5DVZA 4PSUA 2PRSA 4MVJE 4ZVMA 5A4FS 3P4YA 4IJUA 4IHJB 5EKXA 2OCAA 4ZYWA 5EJ5A 1TEXA 1EVLA 2D8AA 1GCIA 1Z6TA 4K6HA 2BVNA 3OUUA 2HPAA 4O5AA 4R8KA 4URHA 5CDHA 3AF6A 5JPDA 1GZSA 3BTOA 3IQZA 3N8DA 4IUYA 4J91A 4KQHA 1LEHA 1B6GA 2FWAA 2O8NA 4UEJA 1EFPA 1JL3A 2VP9A 3RANA 1D4ZA 3A6FA 3EFOA 3EGDA 4M0EA 3CX6A 2ZIAA 2Q1TA 3EIFA 2IGBA 4IIGA 3RWMB 4E33A 2ETVA 2XMCA 2ZPUA 3EEQA 3RUIA 1V6AA 2Q2WA 2E5WA 4PR3A 4WVLA 3FMPB 3F78A 4LHYA 1E3MA 4C2BA 4BP8A 4ZCQA 4YCLA 3OEED 5JAUA 2B82A 5KYUA 1BS1A 2H9AA 4MCAA 4LXYA 4R40A 1N5DA 2NUPB 1TU4A 3PPIA 2CFRA 2JS7A 2YUIA 3EVNA 2P78A 4JGGA 4MKRA 5TQ2A 3B7PA 3GGSA 4C4YA 1B1AA 1BQ3A 4C2TA 1PTKA 3G5MA 4K6FA 421PA 3QPVA 4MRNA 3B7WA 5AIBA 5AKYA 5GVSA 2DJIA 3FLEA 1T5SA 2ZJ4A 4KACA 5CJPA 5DF1A 2WY2D 5A3JA 3WAGA 3MZ0A 1W6RA 3HBNA 4Q03A 4PG4A 4Q9NA 3ASVA 2ZSUA 3ET5A 4K86A 1OYOA 3H83A 2W8BA 4CODB 3ZTYA 1JIJA 1THZA 3NR2A 3QA3E 1ECCA 4V2UA 3H97A 1F48A 2VDNB 4HGRA 3CLRC 2QK4A 4O8CA 1I10A 1GG2A 5GONF 2E49A 3P2KA 3NDJA 1M75A 4JD5A 5ECGC 4AICA 1PKXA 1VZ2A 3HCEA 1WW3A 1E0JA 3AC0A 3R5FA 3PIIA 4LF4B 5G0SA 1CUSA 3DWFA 4NTZA 4D81A 5JEEA 1DO0A 3MMNA 2EYQA 3Q9UA 4GT1A 4ZZIA 5HF6A 1K6EA 3NYRA 2V9PA 3P2EA 3OJXA 3QG5A 5FD8A 2P9HA 3PWSA 3U9TA 1T3LA 1ZNWA 4J0EA 4WXMA 2PQ0A 3LUJA 5FT9A 3ZYCA 3CCCA 1JJIA 3KOYA 3L4BA 4XLLA 5CH8A 4ZOLB 4BAZA 4TKLA 4UREA 1LUAA 5KAMA 1FS5A 2VUIB 3DHVA 4R1QA 2RH9B 1NAIA 3IO3A 3NHJA 3VR4A 3LC2O 5FRDA 3O38A 2ZAOA 1WXFA 2FWPA 4Y6OA 4EPTA 5FTMA 1NBMA 5KC8A 1CW2B 4HCJA 1OYVA 1NV8A 2GKGA 3KU4A 3DXXA 4MCHA 5LR6A 3JCZA 2R4TA 4C30A 3PNVA 1I4EB 2P91A 3QVSA 4KOAA 2ECFA 2JLZA 4F72A 4F1WA 2OTCA 3N0XA 3T9AA 1ADCA 1RRCA 2CSXA 2ONJA 2H1CA 1P2VA 1ISRA 5C37A 2CT8A 4NCAA 1KORA 2F64A 3C8MA 1Y1RA 3K1AB 1Y1KE 2BHNA 3OU7A 3EPRA 1EWRA 3KJFA 1Q0QA 2QSZA 2RHCA 4XUGB 2QD5A 4IEEA 4W6ZA 5J3JA 5ALEA 1VLJA 5CLLA 5HRCA 3CNEA 3LL7A 3RRNA 4M60A 5BW8A 1BVRA 3MXOA 5CM8B 3BGWA 1VSBA 3UAOA 1WOMA 3T1TA 2QLLA 2WP0A 3LVBA 4NZPA 1MOZA 3A32A 4UDNA 3GELA 4NU6A 1QPBA 2X6QA 1FRVA 3FA2A 1UZUA 2H4WA 1WSDA 1ZK1A 4IIJF 1V0JA 4WACA 4YP0A 3OZIA 5DJ5A 3S5JA 4C03A 5KOIA 3C45A 8MHTA 3DCNA 4R51A 3CKYA 1AGPA 1G7CA 3Q5EA 5B2ZA 3S27A 3TPCA 3AWIA 5CDFA 3KKQA 2XB2A 2FWRA 1T25A 3LW8A 1CJSA 3KG2A 1KE2A 3MM4A 4PC1A 1P31A 1PUXA 2HO5A 1T8YA 4E11A 2H3HA 2OFWA 3T3DA 1X6VA 2FE4A 1VBNA 4XTRA 5K0GA 4YXWD 4IFIA 1NJSA 1UEIA 2PL9A 2FA9A 3GD7A 4Z7QB 1USUA 1ODIA 4RHTA 2PT5A 1KEZA 2GPAA 4WZBB 4NOKA 1V5IA 1OUMA 2QF7A 4BMNA 1S2DA 2QI9F 3O9ZA 3DE3X 1V8DA 1M1NB 5BSTA 4ZCMA 1P72A 2TRSB 4QBTA 1HF3A 1G4UR 1G5QA 2O8EA 1BCRB 3EC2A 2WR8A 2FPMA 3TS1A 4B6OA 3D4BA 2QZ4A 3AILA 2HIAA 4P4LA 1JHZA 3C6QA 2PZMA 3KSDO 4O2RA 4R1NA 3VGPA 4PV7A 1VSUA 4ENSA 4Y2PA 4OQEA 1AD2A 1EGVB 3UUWA 2R60A 1LDYA 2CCGA 3NNNA 1OGJA 4QNNA 5BT8A 3HDJA 4QDXA 3QTTA 3N7AA 4X93A 4KQ6A 2W83A 3AR4A 2JFGA 3MTJA 1KYQA 1ODCA 1CP3A 3MT8A 3X1DA 5IYZA 2YOFA 3LXRA 5JZ9A 1MXHA 4XZ3A 3I62A 1L7EA 4XVQA 1IZZA 2WRZA 1GPKA 4MUHA 4BVLA 1HE3A 4GX5A 2ZIVB 1NUAA 2EAUA 1AQYA 2ZIWB 3M2PA 4I9NA 3WMWA 1JR2A 3N58A 4NQRA 1DUIA 2FI1A 1POXA 3SLGA 4Q4LA 2VHEA 4KYUA 4RF2A 4QDKA 4BEBA 4C14A 5LQJA 3Q0EA 1XVTA 3CEAA 3H2BA 1Z13A 1BFKA 1NJ2A 3K0BA 5IG2A 1N6KA 1XOIA 1YDWA