3BHJA

Crystal structure of human carbonyl reductase 1 in complex with glutathione
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
275
structure length
275
Chain Sequence
SGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Carbonyl reductase [NADPH] 1
publication title Human carbonyl reductase 1 is an s-nitrosoglutathione reductase
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 275
sequence length 275
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2007-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bhjA00
2VN8A 3C7AA 1UXJA 1NPTO 5JMPA 1C1XA 3GN2A 2NU7A 5BSGA 1HE3A 1KEUA 1WDMA 4WCFA 5T8KA 1KETA 1QXSA 2Y66A 1D3AA 3IC5A 4E2YA 5C37A 3VH1A 3CH6A 2RH8A 1TVEA 3K2BA 4XYEA 4IJWA 2O3QA 3L9WA 3KUXA 3L4BC 2Q2QA 1GQYA 1EDOA 5F5NA 2Q99A 2Q4EA 5CG1A 4WGGA 5GZ6A 4PLFA 5KVCA 1ZK1A 4OSPA 1HSOA 2OOSA 3OJOA 1JKJA 2A9FA 1OOEA 3GNTA 4Z9FA 1DIHA 2D0IA 4HADA 3PVZA 3FPCA 4CMJA 4XEHA 1C0LA 2JHGA 2OZPA 2OBNA 3U62A 1T2AA 3H6KA 1DIGA 5A9RA 3ZGYA 1KEPA 3LYLA 2AEFA 4O6VA 5CG2A 3PZRA 3PHJA 1CRWG 2GD1O 2H5LA 2YUTA 4C7JA 5TX7A 2Y93A 3LC2O 4I9NA 2J5RA 4MPDA 3HHPA 4IPTA 4W7HA 3RVDA 1PS8A 2IXBA 4F6CA 3DMTC 1QKIA 2C7VA 1JVBA 2X9GA 3IIEA 1I10A 4MVJM 2BGLA 4XR4A 1JU9A 3D5QA 4BNVA 3MEQA 4NI5A 3CINA 4NFYA 3ZNPA 1H9BA 4BO7A 1BHSA 4WLUA 1NPDA 3K5PA 1I36A 1LDEA 4YA6A 4XKJA 3ONFA 4NH4A 5I7SA 5G0SA 4LVCA 4TRMA 2BFAA 2Y68A 4BOYA 1ENYA 4XYLA 1OAAA 1DAOA 3PGXA 5G4KA 2ZTMA 4UVEA 2AQ8A 2B37A 3OH8A 4YAJA 3V8BA 4E5YA 4BNLA 3GVPA 4YPOA 1O8CA 2ZIZA 1PQUA 2X0RA 2IYPA 5KNLA 2FPIA 4CMEC 1LQTA 4DGSA 1XDWA 4ID9A 4PFJA 1TA4A 3LC7O 3TFQA 2UAGA 1NBOA 4Z3KA 3DTYA 5CP8A 2HRZA 2XAAA 4ND3A 4NG5A 4U5QA 4CLDA 1YL5A 2NACA 3M1LA 3T4XA 2PWZA 1U9JA 5L7YA 3SJ7A 2UDPA 3UKOA 3TZCA 5ICMA 3CUKA 2PKQP 4WK6A 4PCVA 1CERA 2CUKA 5I8ZA 1Y8QA 1PJBA 4XWYA 4DMLA 5A5FA 1ISHA 4CODB 3QQPA 4ZQGA 4IIUA 3T7EA 4FOOA 4Z3DA 1P45A 1NFFA 1K0UA 3ENKA 4BGVA 1QV6A 3U3XA 3BHJA 2BH9A 5A5EA 2CY0A 1C14A 1A4IA 4WECA 3AUTA 4RORA 1HLPA 4GI2A 2V6GA 1O89A 5DBGA 1PGPA 1MFZA 3CZMA 2HMWA 2X7HA 3W6ZA 2A35A 1PJLA 2DVMA 4D41A 3DZFA 4YBZA 5L4NA 1R0SA 4JCOA 4EGFA 1SB8A 1P9LA 4XZ3A 5KKCA 3L4BA 2C5AA 2I9PA 2VYVD 1QP8A 2YHIA 4IMRA 2XPCA 4NDNE 1MG0A 3LDHA 4AJIA 3Q2KA 2P68A 3GA0A 4BO9A 4CUJA 3UUWA 4RQUA 2DBZA 3D4OA 3P2OA 4R1NA 4MVJD 2EGGA 3ROPA 1TT7A 1ZEMA 4YYZA 2QRLA 4OXYA 4ALKA 1Q1NA 4D3SA 3Q2IA 3GUYA 3VH4A 3C3XA 4L0QA 5EMHA 2B35A 1V8BA 1Z74A 5MDHA 4HNHA 2ZK7A 3Q9UA 2WEKA 4DTIA 1RWBA 3I9JA 4CV0A 4Q3DA 4D46A 4J91A 1NYTA 4BO4A 5JY1A 5DZSA 2J6IA 3SJUA 2DPHA 4YAIA 1WP4A 4JGBA 1B14A 3OQ1A 3VC7A 5BQFA 2HK8A 5KVQA 2HU2A 2QHXA 4EI2A 2RCYA 4N5MA 3SEFA 3H65A 3WGQA 2R2GA 4IDBA 4PG6A 4BKUA 1F17A 2C2YA 4E12A 2CDBA 4XB2A 3TFOA 4IJUA 3AUSA 3OHSX 5COBA 3QVXA 4RF5A 2Q1UA 1DFIA 1MA0A 1VKOA 5BSHA 2I3AA 1F06A 2OGUA 2H63A 3D7LA 3RWBA 4DPKA 3NEPX 2GDZA 5L4LA 4RZHA 1T24A 3I9KA 4IS2A 1ENOA 4Z9YA 4CQMA 2W98A 1VSUA 2IXAA 4H16A 1DJNA 4PVDA 4CMEA 1ZSNA 3WIEA 3ZWMA 1NFQA 1UZNA 3NDIA 4L74A 2PGDA 2BKAA 3WLFA 3D1LA 1CF2O 3JD0A 5ILOA 2BLLA 2ZYGA 3H9EO 1C1XB 3ST7A 3WQRA 4WCFB 3EW7A 1ZXBA 2Y99A 3V2UA 4EUFA 2OBYA 3GNQA 1J4AA 1LSOA 5DBFA 1IHXA 3E9NA 3K9QO 4EJ6A 4WNIA 4B7CA 4E33A 2X5OA 3AJRA 2JJYA 2NQTA 1UDAA 4BO3A 3MJCA 1AN9A 3EGOA 3UICA 3I9LA 3AFMA 4EEZA 1N8KA 3R0IA 3F3SA 1KERA 1BSVA 1YH3A 1UAYA 4WOJA 3WWZA 3ZW9A 3OJLA 5TIIA 5MGBA 4CLHA 3PYMA 4YWJA 1KVUA 3PFFA 2BD0A 5LDGA 1DIRA 4ILKA 5GY7A 1NXQA 4XIYA 4TQGA 1DJQA 1GV1A 3EC7A 5DN9A 5BSEA 3ZHZA 4BMNA 3HG7A 4BNWA 3VDRA 2FZEA 1FF9A 1K89A 2NTNA 3N74A 4FJ0A 3W6UA 1J5PA 1NTOA 4PG8A 1IB6A 5IAAA 1MXFA 3QV1A 2B5WA 4R01A 1YB4A 2OP1A 4J2OA 1R66A 3E82A 3GEGA 2VQ3A 4CV2A 2QQ5A 1AHHA 1ISIA 4K26A 4UVGA 4II3A 5DULA 3IUSA 4W4TA 2BF7A 3T4EA 2XOXA 4GPD1 5FFFA 1EUDA 4O5OA 3RIHA 1ULUA 1LX6A 4JN6B 4GVXA 3INGA 5ITVA 1ID1A 4OJNA 2QW8A 3ZWVA 3AM5A 1HE4A 1F0YA 4QUKA 2VZ0A 1QYVA 3AOEC 4E30A 1ZEJA 4OQYA 3ANMA 4A73A 1PZFA 3E9MA 3O38A 3NDJA 3U4CA 5G4KB 1Q7GA 4FDAA 3LU1A 2P9GA 4Z0HO 4FJ1A 1I2ZA 1BDBA 2EJWA 4ZA2A 3ONDA 1PJ2A 1PL6A 2CVQA 1DLJA 4TRJA 1HDGO 1HDYA 2EHDA 2UV8A 2YQ5A 4ALJA 4OL9A 3NYWA 4KOAA 4I9UA 2I5PO 2O50A 4MVJE 2Z95A 1ZKMA 4HUJA 1BRMA 3ZHBA 4DPMA 2O7QA 2EWMA 5JXWA 5EIOA 2UUPA 1DXYA 3GGGA 4PLWA 3I5MA 3SLGA 1V6AA 1TLTA 1VJ1A 1E1KA 5K9ZA 3HDJA 3JYNA 2FR0A 4QTZA 5C5IA 4CMCA 5I7VA 1Y8QB 2VUSA 1E0DA 1MG5A 2Q46A 3EVTA 3D3EA 3AU9A 3B70A 4XQEA 4KUEA 2UUOA 1DPGA 3C85A 1GAEO 3WFJA 3ZNQA 2ZTVA 4K1LA 2X9NA 5FF9A 3WGZA 1T4BA 3CKYA 1NP3A 3FHLA 1VC2A 3R3SA 4BO2A 5TLSA 2BELA 2QYSA 1T1RA 2O23A 1P0CA 4XQ9A 2WSBA 2HQ1A 3FNHA 3S8MA 3E9QA 2YHIB 2ZB8A 2NVUB 4OSOA 4IDAA 3K31A 2QRKA 2DBVO 3PLRA 1GUYA 3TWOA 1AE1A 2YV3A 4XJSA 3OMLA 2DKNA 3GNSA 1LRKA 4RVGA 4B7XA 4DA9A 4NNJA 1CIVA 1U1IA 4FFNA 2IZ0A 4BNHA 1O5IA 3RUCA 3B6ZA 4FC7A 4UUNA 1MUUA 1KS9A 3VOSA 1PEDA 2VTEA 3RC1A 1ZJZA 4WLVA 3NRCA 2Q2VA 3IKVA 3MZ0A 2R00A 1X7GA 1UP6A 1MV8A 5TGDA 1U3WA 3M2TA 3ZDFA 1U3TA 3ZV4A 1P0FA 4S3MA 3ROMA 3WQQA 5LC1A 4L75A 1Y8RA 4ND1A 4E4YA 1I0ZA 1BXKA 3B1FA 3F5QA 4YAEA 2JCYA 1MC5A 1YBMA 2IDZA 4DLBA 1YE3A 1OZAA 1PSDA 2J3HA 3CTMA 3JTMA 5J23A 3WICA 4J43A 2V7PA 4GAEA 1CETA 1T1SA 4I5FA 4IDCA 3PWSA 4TZTA 3MTGA 4L9RA 5F21A 2H1SA 5A4DA 1AGNA 3DQPA 2AMFA 3RKUA 5CEFA 1LSSA 2RHCA 3ADOA 2VYNA 3BTVA 1JWBB 4RPGA 3RFTA 5JW6A 1B2LA 1K2WA 3Q0EA 3GK3A 3U0BA 4AJOA 5B4TA 1LC0A 1RM0A 4BV9A 1UJMA 3IQDB 5LCXA 3AM4A 2DQ4A 3QWHA 1E1NA 2GZ1A 4CQMB 2ZB7A 4DPLA 2HUNA 1BXZA 5CDTA 3DBHA 2RBEA 4A2CA 4NK5A 3DO5A 1E7SA 4ND5A 4CMBA 4NZ9A 4YDRA 1GEEA 3HZZA 3DOOA 4P38A 4L8VA 1GQ2A 2JFGA 3OJEA 4IGEA 4W82A 1R4NA 3LT1A 4EJMA 3JQ8A 3ZI0A 4MKRA 3EVNA 1VKNA 4DC1A 3CZRA 4XR9A 3KYDA 2AEJA 4NR0A 3I23A 4R41A 1E77A 3PRJA 2C54A 4YB8A 1DC3A 4BKOA 1B8UA 3TPCA 3WSVA 2X0NA 4BGUA 4R69A 3GVHA 1YGYA 3TZHA 1PGOA 3BTOA 3SC6A 3NAQA 4BNYA 3CIFA 3ZWPA 4CQLA 4LRTB 1FXSA 3CPSA 3VPGA 5CPFA 3V1TC 3RKRA 4CMAA 4XDYA 5B37A 1TT5A 4B7UA 4GSKA 1HRDA 3ZWBA 2X0JA 1LSJA 2PD6A 5AXCA 1HDZA 4FFMA 3G0OA 1ZFNA 2YW9A 5T8KC 1JKIA 4R54A 2E82A 4ZRMA 2H6EA 1LDNA 4HBGA 4GQAA 5FYDA 1VSVA 3PIDA 4AJKA 4DUPA 2E37A 4I5GA 3JYOA 2O3UA 1Z7EA 3C1TA 3KYCB 1M6WA 2Q3EA 2VRCD 4W6ZA 1DHTA 3E1KA 3OJ0A 4ONEA 4RF2A 3PWZA 3H8VA 3MJSA 3HDQA 3GH3A 2PGLA 1KVQA 3HFSA 2POQX 4HNGA 1MLDA 4WASA 4CR8A 2PNFA 3HN7A 1UXIA 1A5ZA 2O3TA 5ADHA 3FWZA 4JK3A 2X22A 4UEOA 2AQIA 4DIBA 3JYQA 4IUYA 2G1UA 2HDHA 2BFPA 2D59A 1W8DA 4INAA 5U4QA 4B8ZA 1LQUA 3VHRA 1L1FA 1I5RA 3GHHA 2JD0A 3HSKA 3O9ZA 2OMEA 3DAGA 3I4FA 5TC4A 3WJ7A 1CEQA 4YAGA 4YT8A 3RSHA 3MOIA 4QO8A 3K73O 3E48A 2O2YA 1UUFA 3BYZA 2AE2A 1ZK3A 2P9EA 4H15A 1FDTA 1Q0LA 4E5MA 4J16A 4QQRA 4EW6A 3JQDA 1Q2XA 4FFPA 2GN8A 2PH3A 3GEMA 3K2EA 4M86A 4UEJA 3MOGA 2CFCA 3PYXA 2PLAA 4YCAA 1P33A 2VWHA 3AY7A 3UCFA 1WZIA 4XGNA 4CPDA 1HXHA 1KOLA 4BNZA 1Q0QA 5KTKA 1FDWA 2PGJA 4Q39A 2WDZA 2X8LA 3PP8A 2PD3A 3H9GA 5DBIA 2FY8A 1C0KA 3X2EA 3ZWXA 3DBVO 3RROA 2NTVA 2EG9A 5C7IO 3GC6A 3GG2A 4JIGA 4DVJA 3G17A 4XQGA 1V9LA 2XF8A 4RL6A 4LSWA 4J7UA 4CM5A 5IZCA 1H6DA 3IP1A 5IN4A 3RBZA 3P2YA 2Z5LA 4J2HA 5H81A 3WQSB 3UGKA 4MIYA 2VNAA 3AUUA 4RPKA 3BMNA 1N9GB 4YR9A 2IODA 1YL7A 5DF1A 1B3BA 4LISA 1IE3A 3WGOA 4EBFA 3JQ7A 4GMFA 2W2KB 3KO8A 3FNGA 4II2A 1N7HA 4NJMA 3F6YA 2VYVA 2VTDA 3AUAA 4XYMA 1T2CA 3G49A 3WNQA 3FTNA 3V2HA 3DAFA 3GPIA 1U3UA 3RAJA 2Q1TA 4JROA 3FBGA 1T26A 4MVJA 5G2OA 2V6MA 4YJGA 1QG6A 1XSEA 1I01A 4WE3A 2VUUA 4CLRA 1F8GA 4JP2A 4UEKA 3NT4A 3ICCA 4OXNA 5FI5A 5FEUA 4GWKA 4Z0TA 2JFHA 2EV9A 1X7DA 2C2XA 1PU2A 3B1KA 4BGEA 1LC3A 3U4IA 5BSFA 3RUHA 5L45A 1XU9A 3ZWYA 1K6JA 4BS9A 5IF3A 3CSDA 3BHIA 3MJTA 1NR7A 2YJZA 2X58A 3VTZA 1M6HA 1ZK2A 1ADBA 1BMDA 1DC6A 1NVGA 1Y8RB 2IZZA 1NQ5A 4PZDA 2VHZA 1QRRA 4KDFA 3GZ4A 5B4VA 3QVTA 2ILTA 1JKFA 3ANNA 2B5VA 3Q3CA 1PZHA 4BNXA 4IJKA 4IXTA 2R6JA 3ZNNA 3OM9A 3RJ9A 1EVJA 3EK2A 1YB1A 3KM0A 4R1TA 3JQCA 2FRDA 3JD3A 2P4QA 1IY8A 3E8XA 5KJ1A 3PJGA 4J90A 1NQTA 4YT4A 2ET6A 4M8SA 4J9VA 3ROKA 2B36A 1MGOA 2BGMA 2GN9A 3TZQA 4IY1A 4E3ZA 1PL7A 1H93A 2PZLA 3BTUA 2PFGA 2E6UX 4AJHA 2P5YA 3DL2A 4N54A 5T5QA 2X0IA 3DBHB 3HFGA 3FF4A 3KRTA 4MVJP 3TJRA 1XCBA 1DFHA 3I9NA 4J7CA 3Q11A 4XJTA 4AJLA 4D7AA 1NQAO 4CM7A 3DC2A 2ZJ1A 3JQ6A 2ZB3A 1H2HA 3JQ8B 4WPGA 3UCEA 4TROA 2TMGA 1GD1O 4FQ8A 3VH2A 5TNXA 5L95A 2WWRA 3IJRA 4O59O 1JTVA 2GSDA 2JKVA 2EF1A 4BNIA 2F1KA 1KIFA 1ZNQO 3E5MA 5ER6A 3UOGA 1LLCA 2GGSA 1DC5A 1M75A 1I2BA 4Q3BA 5JLAA 1ZUD1 5EERA 3HQ4O 2W2LA 1DHRA 4M49A 1UXKA 5L40A 2IE0A 4CQLB 4YJDA 2EJVA 4AJEA 1WMBA 4IQGA 2EERA 3NUGA 2I6TA 2YQ4A 4ZRNA 1WLYA 3IDSA 1TT5B 1B26A 3FN4A 5JFOA 3G3EA 3ZU4A 3DTTA 4CV3A 1V35A 5EESA 1IPFA 3AI2A 1I3MA 5TT0A 3RUEA 4EITA 4G2NA 4J49A 4JBIA 3FWNA 1CJCA 4NK4A 4UUPA 3BZUA 1UAGA 2BRUA 1QR6A 3P19A 4GSLA 4DXHA 2IRWA 3DZIA 1FDVA 2Q49A 3P5SA 4PZCA 1C0IA 2AG5A 1GY8A 3ZV3A 2VWPA 3GF4A 5AXBA 3WS7A 3K6JA 1E3LA 5TT1A 2Y1OA 3AU8A 4BIIA 4YVFA 2G5CA 1KC3A 1UXHA 2WM3A 4OYRA 1XIVA 1DB3A 1KVRA 4XIJA 4TVBA 3L6EA 5H82A 3E18A 1FDSA 4BMSA 1A9ZA 3I9OA 3WBFA 2ZYDA 4MOWA 4B4VA 2Y0EA 4FS3A 1G0NA 2HLPA 4I08A 2X6TA 2FMUA 4YQZA 4R9RA 3H2ZA 4ZHSA 1W73A 1YJ8A 1JAXA 4L4XA 5U9CA 3EMKA 2WYWA 3ORFA 3V2GA 5IDWA 2ZTUA 3X2FA 3VH3A 1ZXLA 1WAMA 4OHUA 4WLOA 4KUGA 2BI8A 4BGIA 3AW9A 4JLWA 4RGBA 1DRWA 4BKRA 3LT2A 2PZMA 5JAQA 1XU7A 4HV4A 4OO3A 2JD2A 1E3SA 1Z7BA 2VRBA 2CF5A 1VI2A 2VHWA 4PLYA 3TQHA 4OH1A 1YXMA 1ZK0A 4CMGA 1LRJA 2D2IA 4QSMA 4CMIA 1E3JA 3OP4A 3WX0A 4RVHA 1WNTA 2JL1A 2HMTA 3B20A 2A92A 1OI7A 1QSGA 3Q9NA 3D3WA 3QIVA 4XGKA 3ZZNA 3DZBA 1E1LA 4R68A 5AYVA 1NAIA 2WTBA 1K6XA 1YJQA 4BB6A 1SBYA 1PJTA 1YOVB 5COAA 3HJAA 3D4PA 2HK9A 5K0ZA 3D64A 4RZIA 5EQDA 4AFNA 3VTFA 2O4CA 4JJIA 3I6IA 4AJNA 3ZN2A 2IZ1A 3KYBA 5JDIA 1OMOA 3RFVA 3QVSA 1IL0A 4JBGA 5EL0A 2VHVA 3KBOA 1U2DA 2JD1A 3QVWA 4B4UA 3UAGA 1Z75A 1ADFA 4IIVA 3UXYA 4NU5A 3C7DB 3BMNB 4L76A 5JCJD 1BW9A 3VZPA 3H5RA 4BNGA 3JQAD 4J7XA 2FOIA 3DBLB 4WEQA 3BTSA 3OECA 1R4MA 3ADPA 3TOXA 1YL6A 4R1UA 3JQBA 3JQ7B 3TDKA 3VPXA 2GF2A 1I33A 3N7UA 4A0SA 4I1IA 4ALNA 3AY3A 3F46A 4BO6A 3SVTA 2VZ8A 4NJMB 2DTDA 3V1YA 1YVEI 2J3IA 4P4LA 2GERA 1ZZEA 3UH1A 5JY6A 1YONA 1WMAA 2JFFA 4WLFA 1P1FA 4FFRA 1LUAA 2VNSA 1E7QA 3H7AA 3I9MA 4HWKA 4O63O 1KBZA 3OEWA 3OFSA 3W4KA 5K6AA 1EK6A 3CMCO 4CLRB 1LXCA 1X7HA 3QHAA 3JCZA 4TSKA 1HWYA 3V5NA 4PLTA 2YHUA 3STHA 1A7AA 4BNNA 2O48X 1HYEA 1I32A 4ZVVA 4PLGA 4TMFA 3FRJA 1R16A 3GHYA 1LLDA 2J3JA 5HRUA 4FSHA 2LDBA 3ZNOA 4ALMA 1D4FA 3GAFA 3AI1A 1G0OA 2HK7A 2C07A 3DBRA 3IOYA 5TJHA 2HMUA 2DBQA 5ES3A 5ICSA 1ZSVA 1GCUA 1R0LA 3BMOA 2DAPA 3E03A 3WR5A 1Y6JA 3KEOA 2W2LD 2VWQA 1H2BA 1A72A 1Y5MA 4IZIA 5FWNA 5TS3A 4YTEA 5KCZA 1R0KA 1YWGO 4BNKA 4Z9XA 4E5PA 1HZJA 4RVSA 3JD2A 1N1GA 1M2WA 2I65A 4IQ8A 4R9SA 4KQWA 2EEZA 5ER9A 1CDOA 3NGLA 5A1TA 3F9IA 3BXXA 4FCCA 1DRVA 2H9IA 1FDUA 5JAIA 3H9UA 4XYBA 3MJEA 4IDEA 1IULA 4GVLA 2WYUA 1PGQA 1SEPA 3I83A 2R00C 4B8WA 4D42A 1F12A 2D1YA 2J5QA 1MFPA 1CYDA 1BTOA 4CR6A 3WDSA 4YJHA 4UVIA 3G1UA 4C7KA 1H6BA 4DMMA 5C3MA 4Q3EA 5IXYA 1LDBA 3B1JA 4IDDA 4YJFA 1DRUA 4CM3A 1ARZA 1YO6A 1SZJG 4FW8A 1O9BA 1C3VA 3INRA 1G6KA 3WGTA 1I3NA 4BVAA 1EE9A 2GUGA 1U4OA 2Y1FA 1T2DA 3GLQA 4M55A 1JAYA 6LDHA 1E6EA 4CM1A 1U8XX 4RVDA 2WYVA 3WJAA 1EVIA 3W8EA 1I3KA 1NASA 4NIMA 5EINA 3OICA 1FMCA 4UULA 1IUKA 3I52A 2EKQA 1B16A 1NWHA 1W0CA 2ZKLA 5ENVA 1MXHA 1KEWA 1PIWA 5IJZA 1PJ4A 5DNAA 3D4NA 4ND2A 3Q6IA 1P31A 4B79A 2DPGA 1H6CA 3DDNA 2BFMA 3LT4A 4FD3A 4IZHA 1GPJA 3NTOA 5T6BA 1LBEA 5DOZA 5DP2A 4QEDA 1M66A 1C0PA 4OXKA 3E5RA 2B0JA 3NX4A 3UN1A 2IEDA 4W9NA 4MKZA 1UH5A 1Z45A 1NNUA 2DC1A 4ALLA 1HYHA 2P5UA 1Q7BA 5CDUA 1SNYA 4AVYA 3UCXA 4YRDA 4E5KA 1LSUA 1GUZA 4RLHA 3WTCA 2OO5A 4D43A 3A14A 3WSWA 4OIMA 2GRAA 3GVCA 4ITUA 1U5CA 4L4SA 2CSUA 4FGWA 5IDYA 3WXBA 2VRCA 1W4ZA 4CM4A 1ADGA 3FCOA 1KC1A 3RU9A 3IUPA 2DBRA 4D0SA 1E3WA 2GN6A 3INTA 3KSUA 5COQA 4CUKA 3OIDA 3A28A 3TZKA 1XKQA 1OC4A 2AQKA 2VUTA 2NU6A 4WUVA 2TMDA 2Y1CA 3GGOA 4G65A 4HY3A 1NR1A 3FNFA 3GDGA 4NJOA 3ZWCA 3OIGA 1UP7A 3NTQA 3W8DA 2NLOA 2HO5A 1IOLA 3EAGA 3A1NA 1N2SA 4GLLA 3R6DA 1PJSA 3F4LA 1C1DA 2VCYA 1PQPA 4IXWA 1LDYA 4Z6KA 1CQIA 1ZSYA 3DONA 3GN1A 4Q3NA 4U7WA 2OXIA 1JN0A 5CDSA 5H83A 1JWAB 1EFLA 1E7YA 2Q4BA 4NMHA 2X5JO 3GFGA 4LSMA 2G82A 3NKLA 4CL3A 1NAHA 1R15A 4J4BA 4IQ0A 4WKGA 3GUCA 4Y98A 3VPHA 2AEMA 3IKTA 4CJXA 2ZJ0A 1RPNA 2Y1EA 3K8ZA 4K9DA 2C7GA 3HADA 1MP0A 2GZ3A 3BIOA 4ZJUA 1AXGA 1VL0A 1VJTA 2J5KA 4XA8A 1AUPA 3WYCA 1PX0A 1UZMA 4O1MA 2ZYAA 4B4OA 1E1MA 1LI4A 1O0SA 4FOSA 1I8TA 1A27A 3COSA 4RPJA 5IDQA 4P22A 4B3HA 2YYYA 5A03A 2FHSA 4BO1A 5CPBA 5C7LO 3PJEA 3VZQA 4E2ZA 5KJFA 3ON5A 5B4UA 2Q50A 3CE6A 3GT0A 3DHEA 4UVHA 3LLSA 5DP1A 9LDTA 2FSSA 1P44A 4FBGA 1E92A 1YKFA 2CNBA 4J9UE 3GEDA 3WNVA 5IG2A 2Q1WA 1E3EA 3LSYA 4KTVE 3T7CA 5HS4A 3OETA 3KSZO 4YT5A 4AL4A 2EKPA 3WGGA 1VPDA 5CDGA 5BT9A 5BR7A 1VL8A 2J3KA 4LW8A 2CMDA 3OSUA 2Y67A 5IZCC 3TRIA 5IXSA 4CM9D 1KYQA 3PIIA 4J1QA 4R51A 5T57A 4RDHA 3PI7A 3C8MA 3RQSA 3V1UA 1YQXA 4MVJG 3WGYA 5IN5A 4Y67A 3DB2A 3LF2A 2O3RA 2VWGA 3KOUA 3GZNA 5T67A 1NHGA 4IINA 4BNJA 4KDEA 5KKAA 3DBRB 2EIHA 1EE2A 1SOVA 4RPLA 3BMOB 3PWKA 4MVJF 1D1SA 3O8QA 4PLVA 3TF5A 1JLLA 5BNIA 2OHXA 1LLUA 1PJQA 1ADCA 2W8ZA 3S2EA 2W4QA 3EDMA 1YRLA 3ASUA 4URFA 3ZU5A 4FIZA 1P1JA 1UR5A 4RO0A 3DZKA 5BNFA 1P1RA 5G0UA 3KLMX 4NBVA 4WLNA 3WMWA 4TVOA 5B12A 4GWGA 4D3DA 4ND4A 2JCXA 4CUZA 1PS0A 1M76A 4KTTE 3BAZA 3VVCA 1PZGA 2HJSA 4R3WA 1QYXA 1Q0HA 3Q1LA 1YQGA 4ZQEA 3P7MA 3W1VA 1XYGA 5I9LA 2P2SA 3GAZA 3TN7A 3FNEA 4I5DA 5GMOA 3RUAA 4GH5A 3JYLA 4KP7A 1MB4A 2ZB4A 1R12A 4X54A 4KMSA 4BNTA 4BNUA 5DCUA 4D0RA 1HSZA 1B8VA 2EP7A 4C4OA 1RJWA 2NTJA 4EDFA 4LMRA 4K6CA 2DM6A 4CL8A 3NT2A 1H6AA 3RUDA 1A71A 4HFNA 1N7GA 1HZZA 2BMAA 1T2EA 5F3RA 2C0CA 1I2CA 4M54A 1B8PA 1QYCA 5JYEA 4QT0A 3JD1A 1VRWA 4EEXA 2FZWA 2QRJA 3C1OA 1D8AA 4YXFA 5EJ2A 5A9SA 2GNAA 1TI7A 4XQCA 4DIOA 4OKNA 3G1TA 1NM5A 2PZJA 1U5AA 2EKLA 1EK5A 1L7EA 3F1KA 3F5SA 3FI9A 1IZ0A 3KTDA 4RF4A 3S2FA 4NFHA 5DCWA 4D79A 4DC0A 2PY6A 4L73A 4CLOA 5L51A 1V3UA 5JMWA 4CM4B 2YDXA 1NQOA 5EPOA 1B7GO 2PZKA 3BMCA 4W99A 1P1HA 4J4HA 2RHRA 5AQ1A 1P77A 1UP4A 4RDIA 1AXEA 2WMDA 2YFQA 4S1VA 3PFWO 3WMXA 2QX7A 4DYVA 5KVVA 2W90A 3ETEA 2CVOA 2VHYA 4YRAA 1NX6A 4MP8A 1ZVMA 4A26A 5JNLA 1RM5A 5TQVA 2B4RO 4L4RA 4HP8A 1SOWA 2CDAA 3PDUA 3LK7A 2ZCVA 3L77A 3NV9A 3F1LA 3OJFA 1B0AA 2GCGA 3CEAA 5L7TA 1ZMOA 3RU7A 4WNCA 2YV1A 2XXBA 2NNLD 1YBAA 4E5NA 2FPPA 5U1PA 1EVZA 3CMMA 3JQGA 2I99A 2NVWA 4GKBA 1E7WA 1PR9A 4HKTA 4OQZA 1P3DA 1QV7A 1HL3A 1XWFA 5JS6A 1QLJA 3NDRA 3U4DA 1HLDA 1PWZA 4LRSB 1I24A 1WW8A 1NPYA 2D5AA 4MKXA 4OKIA 4RF3A 4BB5A 3IP3A 4MP3A 3S1LA 1XEAA 3EUWA 3GGPA 3PK0A 2GZ2A 2FN7A 1U7TA 1HDRA 3ZHXA 5TSDA 5JCJA 3JQAA 2V65A 4DQUA 3H5AA 4J0FA 3M2PA 5JSFA 4DREA 3DFZA 3QVOA 1O95A 3PHGA 4GX1A 3SLKA 4P4GA 1HDXA 3SXPA 3ULKA 5F1PA 5L53A 4GLOA 1PGNA 4OMUA 4DLAA 1PQWA 4PLPA 3NGXA 5G0WA 4N18A 4BQRA 3SC4A 4EUEA 3DFUA 3DMYA 3H5NA 2ZTLA 1U8FO 4E0BA 5IFLA 5AVOA 2NSDA 5AXDA 4F46A 1DAPA 1GTMA 2RIRA 3ZWNA 2OP0A 3JQ9A 5THQA 1CWUA 1Q7CA 4LN1A 2OORA 3DZGA 5JDIC 4YEDA 2X86A 3AWDA 4BNMA 1E7MA 2C5EA 2I67A 3ASVA 3IS3A 3UF0A 4A03A 4ZGWA 2G76A 2NWQA 3HDYA 3F47A 2X4GA 1Y9EA 1E6UA 1CQJA 1IPEA 3JSAA 4YQYA 4LMPA 2X1HA 4P8RA 1R4NB 3L6DA 1DDOA 2O2SA 4RV9A 4DYDA 3U09A 1A7KA 4E21A 2DLDA 3GZNB 1Y1PA 3KYDB 1GADO 2PTGA 3JQBC 2O3SA 3PJFA 3TOZA 1EFKA 3KLPX 4LK3A 5JAMA 5BNTA 3O8QB 5KJ6A 4J1SA 4GX2A 3EYWA 5CEJA 1KY4A 1Y5RA 1GZ6A 2B69A 1GV0A 5EN4A 1N92A 3OQ6A 3RBXA 4UAGA 4E2XA 2GLXA 5K6AC 1TXGA 2PH5A 2B83A 1PR3A 3F4BA 1NVTA 2JHFA 2Z1NA 1ONOA 1YQDA 2CVZA 1K6IA 3IAHA 1X15A 4Q3CA 1X1TA 3AK4A 3UVEA 4RLSA 3DHYA 2AHRA 4AJ4A 1E5LA 1LRLA 4NBTA 4BHTA 3ITDA 4PRLA 5GZ1A 3I1JA 3ZU3A 3LF1A 3U5TA 1HTBA 1LA2A 4N5LA 3RC9A 3MJ4A 1JDJA 4I5EA 2ZATA 1ONPA 4FJ2A 1SAYA 4Z0PA 4AJJA 2CDCA 4I9HA 5JE8A 5TJ9A 4D3FA 3H9QA 1ENPA 4R4JA 3UHAA 1VJ0A 3GQVA 5I9NA 4MDHA 3WG9A 4J4TA 1S6YA 1BGVA 1LNQA 1RM4A 3PQFA 4LVUA 4ZN6A 3K96A 1M67A 2BFOA 1HETA 2E48A 3GMSA 3H3FA 3PDJA 1UDBA 1EVYA 4PN3A 4ZQFA 4XDZA 4NBRA 2DTXA 1LU9A 2ZCUA 4RCVA 3TNLA 1SMKA 1UZLA 4IGFA 3QWAA 3W8FA 5JO9A 4E31A 3PXXA 4E32A 1GDHA 3RUFA 3AM3A 3DZHA 1X0XA 2Y1GA 2DFVA 4DBZA 5A9SB 4FPXA 3RCBA 5JC8A 3HB5X 1U3VA 3M6IA 2HJRA 4R3NA 1WVGA 5ITWA 1W6UA 4YAKA 3QSGA 4JXKA 2UVDA 4DBVO 3S2GA 1HDOA 3ICPA 4CLOB 4PGFA 4HX5A 4E2WA 3I4CA 1UXGA 3BMCB 4HFRA 3LC1O 3VAZA 2CD9A 1ZBQA 3EHEA 1Y81A 4A7PA 2NVUA 4K28A 2WD8A 4NBWA 1LDGA 2J8ZA 2E4AA 4BO5A 3EZYA 1ULSA 1PTJA 1VL6A 2WJPA 3GY0A 4NU6A 3S55A 2O4UX 3ITKA 4N5NA 2AW5A 4W9NC 3U9LA 5JYDA 4F45A 3O26A 2VHXA 4FR5A 3QP9A 5CDYA 1DIAA 3E6AA 1E6WA 3QW2A 5AOVA 1MX3A 1PWXA 1Z73A 3C7CB 3NT5A 4GGPA 4IDGA 1R37A 2FP4A 3S2IA 3HB4X 4DQXA 1BXGA 4IBOA 1XG5A 3HUDA 2VZ9A 3SBOA 3FR8A 5A9TA 3DMTA 4ZD6A 3H2SA 1V0JA 4Y6SA 3ETGA 1YBVA 3KVOA 3L0DA 4PZEA 4WEOA 4BKQA 5I7FA 3DOJA 2GYYA 4J0EA 3WWYA 4BO8A 2GASA 1KY5A 1A4UA 3D5TA 2NVBA 3A06A 4FGSA 4A27A 5B1YA 9LDBA 3JQGB 4YJGB 1VLLA 2BI7A 5I9MA 1EZ4A 3TL2A 3ZW8A 4QO7A 4EYEA 1GPDG 3QLJA 3D0OA 1T4DA 3DXFA 4O0LA 1LTHR 3PHIA 2PA3A 1P1IA 3OQBA 1E5QA 4JNKA 1VM6A 1WZEA 4ESOA 1GYQA 1ZK4A 2NQ8A 4XRRA 2NUAA 2G17A 1O94A 4U6QA 3U4HA 4AICA 1H0KA 5CAEA 4GX0A 3GRPA 3L9XA 3QWFA 3R3JA 5G4LA 1ZIDA 5JCXA 4BL5A 3JQAB 2VT2A 4Y8VA 2CZCA 4R5HA 5A05A 3ZWAA 3PTZA 1XQ1A 3RUIA 2PR2A 1I3LA 3EZLA 1DFGA 4B3IA 2XXJA 3LZ6A 4KZPA 1KVTA 2JAHA 4CMKA 4QECA 5TF4A 1HEUA 3G79A 1NWCA 3KHUA 2FPGA 3WGHA 4OOEA 2X23A 3FD8A 4FFLA 4WOKA 3ZH2A 1X1EA 3DEYX 3W4JA 4CV1A 5KWEA 4MINA 4CM9A 2AE1A 4FFOA 2FR8A 3HDHA 2WD7A 4J3FA 3AI3A 3GDOA 3MWDB 1EBFA 1SPXA 4KQXA 4U0JA 2C29D 2VOJA 1GU7A 3TZ6A 5DT9A 2FSVA 1HYGA 1R6DA 4MIEA 2EXXA 2ZQZA 2GN4A 3M1AA 1X0VA 5A3JA 2WE8A 4EUHA 4RPHA 4DQVA 2OFPA 4M87A 1MC4A 1GCOA 2RH4A 4MVJH 3RBVA 4PLCA 5HM8A 4FC6A 2X9VA 3LVFO 4U6SA 3KEQA 3PQEA 4M1QA 3WB9A 3KYCA 5HWSA 4TKLA 1U2GA 2OUIA 3EY4A 3WLEA 4XRGA 4MVJI 1ISMA 1QORA 1SO8A 2LDXA 4RQTA 4GX5A 4XCVA 3ENNA 4OGWA 4CLEA 4ZQHA 5ENDA 1F8FA 1E7RA 1NFRA 1SB9A 3QY9A 2SCUA 4DL9A 1ML3A 4GKVA 4KUHA 2DTEA 3QA9A 1PJ3A 2Y0CA 2DUWA 3IMFA 1X13A 4Y6PA 4IS3A 1ZCJA 2D4AA 1Z6ZA 3BMQA 3DWFA 3FPLA 2V6FA 3DOCA 2QG4A 3ZHYA 2AQHA 4LCEA 4YACA 4PG5A 4DIFA 5HA5A 3ANLA 1WWKA 4JJFA 1J49A 5GZ3A 1RYDA 4TWRA 3H9JA 5A04A 2JAPA 4LGVA 1GL3A 5KJCA 2DT5A 1F14A 2QZZA 1WPQA 3L07A 4EZBA 4CR7A 1EEHA 4BUCA 1ENZA 2NADA 4QFDA 3VVBA 2D8AA 1QYDA 2NV6A 1YDWA 1KVSA 4B4WA 1GR0A 5EQFA 1B3RA 4J1TA 4XB1A 2YZ7A 1U4SA 3KETA 4J1NA 3WBBA 1RM3A 3GRKA 2AG8A 4MP6A 4AJPA 1ISJA 1E3IA 3VKUA 1YS4A 2WE7A 4OM8A 1WDKA 3GOHA 3GMDA 3MCVA 1BVUA 1TEHA 4CMIB 4MJLA 3FR7A 2NU9A 1LJ8A 4J6FA 3OIFA 1JQBA 1KEVA 3D3WB 3ROQA 1GEGA 1N9GA 2PV7A 4E6PA 2OL4A 3WFIA 3RD5A 2DUUA 1DLIA 4PRKA 3KZVA 5A3VA 1BDMA 2C20A 4F6LA 7ADHA 4BMVA 5T64A 2W2KA 3PEFA 3HE3A 3ZV6A 1ISGA 2HSDA 3IL2A 3AOGA 5L9AA 3ABIA 1GZ4A 1SCUA 3A9WA 5KOIA 3JQFC 4P4NA 3OA2A 1OFGA 4CQMD 4BV8A 1OBFO 4CM8A 1BW9B 1HKUA 1JA9A 4JP3A 3OBBA 1PZEA 4PLHA 3JYPA 3GFBA 4U8GA 5DDIP 5ILGA 1R4MB 1HT0A 1PL8A 3QE3A 3R1IA 1H94A 3QWBA 4U0KA 4AJ1A 2B4QA 4F3YA 2P91A 4R5MA 1O6ZA 1BXGB 1D7OA 2Q45A 2IYOA 3BHMA 4YT2A 3WGIA 2EP5A 4I8XA 2E49A 4UUOA 4JJGA 2VOEA 5JDCC 3C1AA 3DAPA 3PHLA 3NJ4A 3RASA 2A94A 4BKPA 2PK3A 4R16A 5KJEA 4OAQA 1HF3A 3UFXA 2Y05A 3JD4A 5L7WA 1HE5A 1PGJA 1ZJYA 2BHLA 3PHHA 4TRNA 2F00A 4TZKA 4PLZA 5I7EA 3RFXA 4PIVA 2Q2WA 1BVRA 5DCYA 1PJCA 2GO1A 1EQ2A 4DLLA 3AOEA 5F1OA 3GG9A 3DHNA 1D1TA 1U28A 3GR6A 3WTBA 1GUFA 4TRRA 3I3OA 5JAZA 4RVUA 1G1AA 2D5CA 3GDFA 1DOHA 4CLXA 5L3ZA 3WIDA 4G81A 3O03A 3BA1A 3PQDA 4R1SA 4GBJA 5L4SA 2FR1A 4ZQBA 1Z82A 1RYEA 3RJ5A 1NHWA 4A5OA 1AHIA 1K3TA 1SC6A 3GVXA 1GFSA 1LDMA 1XA0A 1I30A 2AXQA 3VDQA 5JPIA 2O7SA 4BNFA 3H3JA 4JX8A 4FN4A 5FI3A 2AA3A 2DU8A 3OA0A 4K6FA 5G0TA 3WYEA 3FSRA 7MDHA 3UW3A 1YB5A 1PS9A 4XGIA 4WLEA 1EDZA 4QX6A 1P1KA 4OOFA 1XELA 4IM7A 4Y9DA 5F5LA 4XD2A 1N5DA 4NBUA 4ZU3A 3PYLA 3O4RA 5THKA 3ONEA 1GQQA 4AG3A 5JC1A 1XLTA 1ZW1A 1A9YA 4YJHB 1J6UA 1ISFA 2HMSA 3DZJA 3PGJA 3PJDA 5JBIA 5F1KA 1P74A 2WD7B 3WYBA 3LT0A 4YJFB 4Q3AA 1WDLA 3KXDA 1T2FA 4NHEA 4W7IA 2EW2A 3I6QA 2HCTA 3FBTA 1FK8A 3OF2A 3IJPA 3KV3O 2YY7A 2BGKA 4NFSA 3QWIA 6ADHA 3ETDA 1DEHA 4E13A 4GMGA 4WCFC 3JQEA 1HE2A 4H3VA 4PVCA 1XGKA 2PKQO 4XYGA 4MIOA 3VPFA 1YDEA 4WJZA 8ADHA 1JVSA 5LDHA 4N7RA 4JQCA 3PPIA 1T25A 3JQ9C 1IZ9A 3N58A 2GPTA 1XR3A 4UUMA 5JO0A 1H9AA 2UYYA 2EGHA 1EMDA 2V6BA 1V3TA 4PG7A 1RKXA 1J0XO 3RC2A 5C7OO 4H7PA 4BQPA 4MO2A 5KIAA 8LDHA 3JQFA 3VPSA 2O3JA 2EW8A 4BO0A 1ORRA 3NTRA 1LLQA 4WCDA 3K92A 4PG4A 2PKRA 3HWRA 2NM0A 1DC4A 4HFMA 5CFZA 2P9CA 3ZWWA 1X14A 3OEYA 2G0TA 5IZ4A 1NVMB 1ZH8A 2JCVA 1ONNA 4M89A 4TKMA 4IJVA 3ZU2A 4IMPA 3BMQB 3ZV5A 1FJHA 1LEHA 1K5HA 3MTJA 4LCJA 4A10A 1DIBA 1ZO8A 3TSCA 4ROSA 5AXAA 3ZCXA 5JDCA 2PD4A 3A4VA 1WXDA 4CMHA 1VE9A 2GR9A 4Y6RA 5HBRA 1S7CA 3HN2A 3KB6A 1E3WB 5HTOA 1GZ3A 1QLHA 1SEVA 1OC2A 3GPDG 2ZQYA 1DSSG 4ZICA 5CEEA 5I8WA 2QIOA 1H5QA 5A06A 3MWEB 4AJ2A 2HMVA 1XQ6A 1EQUA 2DFDA 2A4KA 4YRBA 4RVFA 1N1EA 2C59A 2QYTA 1L7DA 3L6OO 1EUCA 2Y1DA 2HAEA 3C24A 1XHLA 3GVIA 1GYPA 2NU8A 1IYZA 1YOVA 3VZRA 1GYRA 3AY6A 3NJ8A 4Q9NA 3PLNA 2Z1MA 3QRWA 3RI3A 1BG6A 4NQZA 2YDYA 2YFHA 1UDCA 2YV2A 4IDFA 4CM6A 3HNPA 2I3GA 1C1DB 5CHEA 3PZBA 4KWHA 2I76A 3MJVA 2CF6A 1HDCA 2HKIA 1V3VA 3K30A 4D45A 3QJ5A 2D3TA 3FTPA 1QYWA 4GGOA 5KVSA 3H4VA 4EJ0A 3VKVA 1DBVO 3DR3A 3U49A 4D44A 2Q1SA 4GL4A 4DWVA 2FWMX 1EUZA 5G0VA 5IDXA 1B15A 1U7HA 3VZSA 3DBLA 4QFCA 1EBUA 1QMGA 1TB4A 1DO8A 4XX0A 2RAFA 5A02A 3LLVA 2VT3A 4HFJA 2B4TO 4UVDA 2VYND 4RJTA 1BWSA 1JW9B 1ZMTA 4FB5A 4QXMA 3SX2A 1Y9AA 2HRBA 2P4HX 4KWIA 3LQFA 4ALIA 4DRYA 4G5HA 2X5KO 3RC7A 1IHYA 5DOVA 2Y0DA 3L4SO 5TRTA 3W4IA 4JBHA 2C82A 4CM8B 4HXYA 3ZWOA 2IEBA 5HS6A 3TL3A 3WOHA 4B3JA 3JV7A 4NPCA 2QZ9A 3CXRA 3KSDO 4UREA 3AFNA 2I66A 1Y7TA
chains in the Genus database with same CATH superfamily
2FH5B 2IHZA 3DT8A 3GN2A 1Y98A 2VTKA 1HE3A 1JB1A 5BRNA 4Q9AA 2OBXA 1FU7A 1QXSA 3TS1A 1D3AA 2OPBA 2A1IA 4F3TA 1RWVA 5LZ7A 4OQFA 2R25B 3SPXA 2VPTA 4JWTA 4E2YA 2GM9A 3N6XA 3CH6A 4IGKA 1L8LA 3EA5A 2XB8A 1E5TA 4H27A 2ADFA 3L9WA 1ZD9A 3H2YA 1R4ZA 3KUXA 3OKPA 2C7OA 1LK5A 2M9MA 3NASA 3EY9A 1TD1A 2P4EA 3BE4A 2JG3A 4QUEA 4KVAA 3L43A 2AJBA 2WJ3A 3LZCA 2RGUA 3NCHA 1HSOA 5EY5B 1PR0A 1KJQA 4N1AA 1OOEA 4NMXB 4HAWA 3GNTA 3D8SA 2ZE6A 1DIHA 1R8YA 4BP1A 4HADA 3ROTA 3PVZA 5BY2A 1I51A 3QW4B 4RM3A 2BKVA 4OYLA 4XEHA 1R4AA 4CMJA 5E0OA 1BROA 2JHGA 2OBNA 4MWOA 2OAP1 3U62A 4B3XA 4JGIA 4AF7A 3AJ8A 4HZIA 3V3KA 3MGBA 3G9XA 4DSAA 1BA3A 1ZLYA 5AW5A 1OHHA 2YL2A 2PT5A 4G5XA 5CG2A 3PZRA 3I5UA 2GD1O 4C7JA 2YUTA 5B55A 5TX7A 1ES9A 3G0DA 5ESDA 4D6XA 3L82B 2Z8YM 2QQ0A 3U26A 3UMVA 3V4FA 1PS8A 4KLNA 4FDMA 4AKEA 2O8FB 3DMTC 4L3VA 3SQXA 5CA1F 2X9GA 4MVJM 4TL6A 4AZTA 4B44A 3WKEA 4F9TA 2J87A 3D5QA 2Q4RA 2Q5EA 4JEHA 5KNBD 4NI5A 3GLFB 3A8TA 3CINA 1RJ9A 1GPMA 2V3WA 5KWVA 1RHUA 2W0SA 4RQAA 2FQ1A 4IIJB 5CXUA 2FSFA 4PXYA 3KJGA 4C3OB 1FPMA 2XQGA 4G86A 2QPAA 3K0AA 1YUNA 5FJIA 4YHHB 1ZI8A 5DM60 4LVCA 1PT8A 1FLVA 4J0CA 3DG9A 5K3OA 5AJHA 5FBZA 5D8DA 1ZAKA 4GKAA 4DDUA 4ZCTA 3PUKA 2GLTA 4L2IB 2ODWA 4UVEA 2B37A 4YAJA 1ZUHA 3RREA 4DNQA 2QKYA 4DNXA 2PSEA 2NXEA 3A6FA 2ZIZA 1XU4A 2X0RA 4LXHA 3Q5EA 4F3CA 3GFPA 5KNLA 1RYZA 5C8VA 5IUJC 4FZ5A 1XMJA 2G77B 1P6XA 3H2GA 3OU2A 4RFSA 4FX2A 5DW0A 4D8YA 4DMRA 5AUNB 1TA4A 1CVIA 1XDGA 2RAPA 4PW0A 4I99A 1L4UA 3NH6A 1PG2A 4NG5A 4U5QA 4CLDA 1KU6A 1LPBB 1YL5A 2RHWA 1XHEA 2NACA 4PNPA 2R8YA 3W6OA 3IODA 6REQB 4OQDA 2FN3A 1CW2B 2IW1A 3INYA 3IXLA 4OFZA 4OL0A 3D8RA 4XW2A 3TZCA 3WLOA 2XT9A 3FWKA 3ZD8A 2PKQP 5ICMA 4FUTA 3EQ9A 1FSPA 1CERA 2W2XA 4RLFA 5AJZA 3CKMA 4Z8YA 1V5GA 3UJBA 1M6VA 1WU7A 1IVYA 2J09A 2KW5A 3OTWA 1SQ0A 2QE7D 4FCWA 4FEAA 4JBWA 2IHYA 1YAJA 1YIDA 4IDPA 4R7TA 1PJBA 4UASA 4EKGA 5A5FA 3M4XA 1T1IA 3MS7A 3RB8A 4UQPA 3ZZ1A 2OZKA 4EFDA 3OFND 5FBKA 1HUQA 5JH7F 3FI0A 1KHTA 4ZQGA 4YYEA 3EMDA 5E9QA 1FX0B 3JAMA 3T7EA 3TUZC 3I30X 1ZIOA 1P45A 1NNLA 3WRWA 2M6KA 4BATA 1G20E 3EQ6A 2R44A 3Q7TA 2ISSD 1SM4A 5EUCA 4LYAA 3BHJA 1K3FA 5H4HA 3TB6A 3U3XA 4CF3A 4PEVA 2ZRMA 3I58A 3W1EA 5FUVA 1G17A 2WU1A 3W5DA 4WECA 1LZKA 4CKBA 4ZO6A 5EJEA 2J48A 5KYXB 4GI2A 5LQAA 1O89A 2QTZA 5DBGA 1PGPA 2Z08A 2YFYA 5CCXA 3CZMA 5HKKD 1NOJA 3U4MA 1CY7A 3B9QA 3RVKA 3MUEA 4OUDA 2HADA 3W6ZA 2DVMA 3H19A 3WHLA 2HD4A 4YBZA 5JIBA 5CCBA 1SIBE 4EGFA 1OW3B 4B8YA 5JECA 3KQUA 4AQ7A 5AVSA 1N78A 4AS2A 4BYGA 3L4BA 2FUG1 2YHIA 4C4YA 1QP8A 1SC4A 2HB6A 2JRCA 2I29A 2PBLA 5C1BA 2XCQA 1PT9A 2D4HA 2IYVA 4UOZA 2ZJAA 3G8BA 3RS3A 4CUJA 1RKQA 1W49A 1Z6QA 5EEHA 3UK7A 3UUWA 4DCUA 5C81A 1EFCA 3D4OA 2L18A 3RWMB 5HQ3A 1E6KA 3CRQA 4B9EA 1WKCA 5E1OA 4KNYA 3D3KA 4MGHA 1E2NA 4OXYA 4ALKA 5GVSA 4KN9S 1P72A 4MGZR 2NU8B 1R5NA 2Y1LA 3GUYA 1G291 5HMMA 3DL4A 5EMHA 2CN1A 1UJ6A 1I7PA 5MDHA 1Z07A 4HNHA 3NEYA 4WVFA 5EHXA 5LZ4A 4LYYA 4D46A 3Q88A 5JS2A 1TUIA 3TW8A 3VKFA 4K9QA 1NKVA 2IXFA 2ZJZA 3RT1A 5LMCA 3K09C 1OKKD 4YAIA 3HY6A 3Q40A 4EARA 4JLDA 2B30A 2QP3A 3VZBA 5BQFA 1BD3A 2HK8A 2ECOA 3LXRA 3WK9A 2V58A 1TK3A 1UPTA 2LVBA 1F6DA 3RS8A 2HJ9A 3SEFA 2FLVA 4IDBA 3HO6A 3ASZA 1F17A 3ASYA 4R2IA 4V24A 5E2IA 2F9MA 3S7TA 4EW2A 3K6SB 4LMBA 2WSSA 3QUTA 3VMFA 3OHSX 4PN7A 3QVXA 3RC3A 1AV7A 5IKEA 3AKDA 1YBHA 2Q1UA 4JITA 3N2KB 4MI6A 1BHQ1 1GAJA 5HTKA 4Z49A 1B41A 3ZR4B 1VKOA 2I3AA 5A5GA 2NVOA 4HGPA 1W2GA 1J2RA 3D7LA 3JW8A 5I3CA 3NEPX 4HH0A 4Z8XA 4MUIA 1ZC4A 3BKXA 1T24A 4DDKA 3T5AA 1NVAA 3F6PA 1B8OA 2Q2OA 4KQCA 4NE2A 5AJTA 1BMQA 4R7ZA 3UT0A 4QDUA 2XITA 1Q0SA 5ILQA 4CMEA 2BDEA 4K6HA 4M8IA 1Y3BE 3K4HA 4BQFA 4Z7QB 1L8OA 2GM4A 3KXLA 2JHAA 2BKAA 4L4ZA 1I6LA 2QIPA 2WM8A 2Q07A 3D1LA 1BQ3A 1CF2O 2IPAB 3D81A 3HB0A 4M9CA 1Y7PA 3JX9A 4OMFG 4WL0A 1YB2A 1H5UA 3V2IA 2V3CC 4ZOLB 4RS3A 1NJSA 3WQRA 5I01A 2AOVA 3PFHA 3QX7A 4RBNA 3DEZA 3X1JA 1OFIA 3TD9A 1OZHA 4GPTA 1KMMA 1P4HA 1W46A 4MCHA 5ERYA 4CEJA 4IYRA 4QGHA 2K7FA 3OESA 1NTRA 3PDCA 4Q6WA 3COYA 4P5EA 2X5OA 2NO0A 1J9EA 1UDAA 1ZM7A 1WEHA 1TKAA 2C2MA 4YV7A 1AS2A 2OZVA 3EGOA 2VT6A 5IK2A 3I9LA 2ATXA 4WK0B 5HQTA 1N8KA 3FY4A 1JEEA 1G4UR 3DOFA 4JC4A 4OHXA 2YOFA 3MB8A 4ND7A 1WZ2A 5AESA 3FCXA 1ZHFA 3PVCA 5IBRA 1XQXA 2K4MA 1IN8A 5TVGA 5AVVA 3VU0A 3RIYA 5FLEX 1WB6A 3QUQA 2HRCA 1KVUA 1DDIA 4PXSA 3RKSA 2ODAA 3REOA 4X64B 1W30A 1L7RA 1RCUA 3SHFA 2Q5OA 2WM9B 3ZEIA 4M0MA 4TQGA 1DJQA 1GV1A 2NYUA 3FVVA 3KKPA 3ZHZA 2YN0A 2NMVA 1Z15A 1OFVA 1M0TA 4BNWA 1B6GA 1W9HA 2YINC 3CCCA 4KMRA 1MEEA 2XE4A 2IHKA 5KYVA 5CB8A 5HFNA 1KIAA 3EDOA 1MXFA 3A1UA 3QV1A 3QITA 3LRXA 4R01A 4BE7B 4CKWA 3WLNA 1YB4A 1R66A 3HKBA 1UBCA 1F60A 1AHHA 1ISIA 1HR0B 3IUSA 1RXSA 2MSEB 3CG4A 3L02A 4W4TA 3TFWA 4ZK6A 1JEJA 4GPD1 3OTHA 1DEXA 1ULUA 4K86A 3WNCA 1VE1A 4JN6B 3INGA 1QIHA 2P6MA 5K01A 1Z39A 1NYQA 2ZVDA 1MC1A 3Q6MA 3UB3A 1KYYA 1SUIA 3RGWS 1F5NA 2HQSA 1IBLB 4FNMA 1NGSA 3AM5A 1WLSA 4P31A 4ZZ3A 1FRZA 4DV2B 1S2NA 2VZ0A 3P0EA 4B84A 3AR5A 4N48A 3GXOA 1ZEJA 1D04A 5ALYA 4ASUA 3O38A 1GGFA 2WUVA 3C1UA 4QATA 4UD2A 1B0ZA 5EHGA 4C4TA 4YLYA 2CT8A 3BUSA 3RRXA 4E6EA 3OQHA 1E2GA 2EJWA 1BWRA 2NQ2C 4IIBA 4Z99A 5E8RA 2WOJA 4I1PA 1KQPA 4L07A 1NE2A 2FPIB 2Z2YA 2Z6VA 4Q4AA 4TRJA 4GSYA 1HDYA 2EHDA 1SCKA 1AURA 2GAIA 5B58T 1XVIA 3NYWA 4WXEA 4M6WB 4I9UA 2E4ZA 1TM1E 2PKEA 1S8NA 3BD6A 4MVJE 5DGCA 4ZYYA 2JKYA 2PL3A 5A5DA 4UTNA 3QU4A 1X38A 5EZ6B 3AP2A 4BP3A 3AWIA 2EW1A 1SG9A 5BUCA 5JXWA 1OXBB 2BR3A 3CO0S 5EIOA 3A31A 4LHWA 1EESA 3DXYA 1A88A 5KX5A 2WAMA 1E59A 1NX9A 1RE0A 3T06B 1V6AA 1TLTA 3EG9A 1E1KA 1AK1A 1J9ZA 3GWGA 2XR1A 2A5LA 3F74A 1YJAA 4OXXA 4REQA 1RE1A 1FQOA 3B3FA 3W34A 1CUVA 3MQ2A 3CBQA 4M7OA 4CMCA 4HLUC 5KYKA 2LPMA 1A69A 4M0PA 3DUFA 1E66A 1PP4A 2VSQA 1D7AA 3B70A 4XQEA 4XH9B 3UAZA 1GSOA 5ALKA 2UUOA 2FW0A 2HU8A 1B6TA 1YNSA 3Q0IA 5TS2A 3ZS9A 1RZRD 1JHPA 2HNBA 1QP4A 2A86A 2ZTSA 2ZTVA 3I1FA 3NBUA 3MQFA 5FF9A 4NV3A 3T7TA 4WKNA 1YHZA 1GAQA 4TZ6A 1XTPA 3ZGOA 1XZGA 3S1SA 3N86A 3TW6A 4L7VA 1PE0A 2ATVA 2BELA 5DM4A 3V7YA 2QYSA 2O23A 2P30A 5T4EA 1Z22A 2PGXA 1XXHB 5HCIA 5GTDA 3QE4A 3KP1A 3L40A 2OY0A 2WSBA 1NMQA 1O4VA 4ER5A 4PS0A 3S8MA 3RHSA 2BSAA 5IASA 5EUMA 1J1ZA 4HQ6A 2ENWA 2R62A 4BBJA 4OSOA 4IDAA 3BOSA 4ZHQB 1V6CA 2QRKA 5IKOA 1AE1A 3ZGXA 4AZ0B 4LDPA 4K5QA 3RAEC 5DE3A 1OFUX 3GNSA 2XYGA 5CVCA 4YJKA 4RVGA 4IIFA 5IMSA 3QOFA 1QHGA 4FFNA 1O9HA 5D3MA 2PX4A 2EX4A 1QJ4A 4S35A 3TBHA 3ZEAA 3OZSA 1XD8A 2R1VB 4D9KA 3TAXA 3VOSA 2H5IA 1SBCA 5BSTA 5ESWA 2JFQA 3PV0A 3A3PA 5CURA 4B3GA 5EE9A 4MJ3A 3ZGLA 4MQFA 1MV8A 1TAUA 3M2TA 2ID9A 2GZHA 1YKSA 4O3MA 1KRHA 2TMKA 3H99A 3MCWA 4S3MA 3CX3A 4L75A 3HLTA 3NNDA 3F8WA 1Y8RA 3FWYA 3OX1A 4N9WA 5M5BA 1HEIA 3BWYA 3KD2A 1FTSA 1OZAA 1PSDA 3DOEA 1RT9A 1M1YA 2BF4A 2WU3A 3CTMA 4K03A 3S0JA 4DHWA 8GPBA 2W0MA 5BYJA 1JX6A 3SQMA 1Q7RA 3BL8A 2V1XA 4JI0B 5F21A 4D8XA 5K51A 1SXQA 2VYCA 4IVPA 2Z58A 3ZHVA 3DQPA 3NW9A 2DULA 1UF9A 3EFHA 3ADOA 4F6RB 2PUHA 1ZGHA 5SYNA 1IJEA 1DOZA 1XRQA 3D7NA 3M6UA 1BAPA 3JSXA 3W5IA 5KYTA 1NN5A 2R3SA 1H3NA 2GEJA 3NHFA 4B34A 4LRYA 3S81A 3OF5A 2ZAOA 1DPFA 3VU8A 1UJMA 4BV9A 5LCXA 4D0NA 2I4MA 4FDVA 3ACDA 3MT0A 5CAEB 3QWHA 1E1NA 2ZQ5A 1UQUA 5K5EA 3KQTA 5EZQA 3W8RA 2CHVA 1BO6A 3G5AA 4LFCB 3BILA 3QHPA 3AF3A 4A2CA 5FHQA 3OCZA 4NDAA 3VR6A 3B60A 5IWCA 1U6JA 1YMUA 2OK8A 4KV9A 4YDRA 3T7AA 4Q00A 4CMBA 4CI9A 3BA6A 1TM2A 4TLLB 3K0FA 5AI4A 3MNFA 4DRXB 1F0KA 1GTSA 1QGDA 3HU5A 4ZJPA 1R4NA 3LT1A 1T3TA 5CFPA 5DLQC 2QQFA 4GP9A 5K8LA 4DC1A 2Q6TA 4KGXA 4E2FA 1SUPA 4W8OA 1M2GA 4XR9A 4G8BA 5GV8A 4R41A 2GHRA 2WINI 3PRJA 5INTA 4FFWA 1B8UA 5DX0A 1VP9A 3T99A 1HG1A 4K3UA 1QDUA 4WQMA 4KQ1A 3X3HA 3E4CA 2DPLA 1E4EB 4OXRA 5CVEA 5LLSA 3SC6A 1QB8A 1GRCA 2V7EA 3BD7A 2RKOA 5BNZA 1OBHA 2Q4TA 5IU6A 2RKWA 3B8EA 1FXSA 4P6VF 3FPBA 3CPSA 3SKXA 1XZ8A 3VPGA 3EZ7A 3QFFA 4QWMA 4YFYA 2L0XA 4M7RA 3RKRA 4CMAA 1S9HA 2AG0A 2J0SA 2ZBGA 5B37A 2JCBA 3DA8A 2HJWA 4A2WA 1TT5A 4GSKA 4N3GA 1HRDA 1QFJA 2X0JA 4IDQA 4UJ5A 2IV2X 4C6RA 1JEQB 3GQBB 1FMJA 2MMCA 4O2AF 4Q3LA 5FAXA 2HA2A 4B75A 2FQYA 3G0OA 4LTMA 1GVHA 1WTCA 8AT1A 3KQKA 1KQFA 3H5IA 1YDHA 2A0WA 5IDVA 3IILA 1J39A 1MB9A 4HBGA 1GU0A 1ZM4A 1G4HA 2C92A 2Y77A 2Z2JA 2WZQA 1VSVA 1XEFA 4AJKA 4R0MA 2QSJA 5EJ4A 3E22B 3BORA 3JYOA 4PGHA 3FZQA 4JI8B 2G8LA 1M6WA 2GPWA 2Q3EA 3CUTA 2PV0A 1DHTA 3E1KA 3PX2A 2VLIA 5DIFA 5ECDA 4RF2A 4TTVA 3FDZA 1TNDA 2R6HA 2BDUA 3AJDA 3GH3A 3MK31 3PPWA 4JI1B 3K7EA 1UWLA 3H17A 4KN5A 3HFSA 3ZJYA 4CEIA 1EB9A 1K8YB 3ENWA 4L28A 1A5ZA 5ECWA 2XRMA 5FT9A 4JK3A 4RTNA 1K8QA 2DJ5A 3HSYA 2AQIA 2YRFA 4H4CA 3BXPA 2ZRCA 3IOCA 3DXXA 1W4LA 4GP6A 3L06A 3OPYA 3R4VA 3ND5A 3N8GA 1I5RA 2ODEA 3HSKA 3TLGA 3COJA 5JBQA 4KXFB 2OMEA 1K2VN 5TC4A 3ZY2A 4LNUB 1I9GA 3C5EA 3UK1A 1XEWY 2QTFA 4LFBB 1V8DA 3STTA 1UIMA 1TW2A 2QVLA 2O2YA 2AG6A 2AE2A 5J47A 2JJ1D 1V11B 4D2IA 1G8JA 4AW9A 2YXNA 4MQEA 3FZYA 3IEVA 1V45E 1CJVC 4JYPA 2W2MA 3DPSA 3EIHA 1PLLA 1TC1A 2BHNA 1EI9A 3NFYA 2ODTX 1PZMA 3ZHOA 3FGOA 1E9AA 3Q1KA 3SDBA 4EABA 4CPDA 2VJQA 3O4JA 4ZI7B 2XB6A 1ZUNA 2IUFA 1E2JA 5KTKA 4BNZA 4PE5B 1PVOA 4FKZA 1YZ3A 2XNJA 1IFXA 2R8RA 1KSHA 1NT4A 5LQSA 1JQDA 5ICGA 4L5BA 1I1OA 3FUVA 2UYHA 3H9GA 3LJKA 3X2EA 2QE7A 1U0NA 3RROA 2QD3A 4CDRA 1SOUA 2NTVA 4ZGBA 3AHDA 2V74B 4B6SA 2BGWA 1IQ0A 4DVJA 3GG2A 1V9LA 1ZHHA 5FTJA 1R18A 4V38A 4UD6A 2YJ4A 3OFNA 3VOTA 1CY6A 3VNBA 2NZ2A 4RACA 5FH9A 2I7VA 3PHBE 4J2HA 3G68A 3BJMA 3BX1A 4TKUA 4MIYA 2VNAA 1EK1A 2BFBA 2OFXA 5DHQA 1B1AA 3JARB 1N9GB 1QQ5A 1HOTA 2XD9A 1JIUA 3GFOA 4MUYA 2GTPA 1E20A 4JJAA 4QEZA 3Q8MA 3UJNA 3CX7A 3P0HA 2NTYC 1GRNA 3T0GA 2I80A 3PL1A 4JB3A 4S2UA 4DYHA 3TJZA 5C80A 4GMFA 1YVUA 4QPZA 1R9NA 2PO5A 3KO8A 2IDKA 4MRVA 4II2A 5KNDD 1KFCB 3F6YA 5CFMA 1G5FA 3EVFA 1LK7A 3DP7A 4RJLA 4DXAA 1ZA2A 3EIWA 3F0TA 3I04M 3IAEA 3K0BA 4G5RA 4CG3A 3RAJA 2YZGA 2Q1TA 4JROA 4RHYA 3D6AA 2O7RA 2V6MA 4DV6B 1KO4A 1U1EA 4RS4A 1XSEA 1UMDA 3IQIX 4WE3A 4CLRA 5IJXA 2IP1A 4CRWB 4BBAA 4QTUB 4B7ZA 4GWKA 4JA2A 5FEUA 1L5HA 3DO8A 3ANYB 3UNXA 2G72A 3IUQA 4JEMA 3A1DA 1PU2A 1JQJC 1LC3A 3V4RA 3PDIA 4YDSA 5L45A 1XU9A 2GBCA 3D3JA 1NYLA 3D3NA 3GZTB 3PUYA 3DV2A 4MW1A 4Y1RB 1G9TA 3SYNA 2YZKA 3CSDA 2FWPA 3TW4A 2X58A 4OQPA 4C4PA 3VTZA 1QPGA 1MCZA 1PF7E 1ADBA 1OKKA 2V7WA 5LMNB 1OI4A 1NVGA 2AJTA 2IWHA 2LR0A 1KDOA 2VHZA 1QRRA 2Q5HA 3GZ4A 4D6PA 1EE1A 4JGGA 1XMOB 1DBPA 3SS7X 4IDHA 2ZW9A 4BNXA 3H6HA 4JLJA 5JALA 4IJKA 1EFAA 4IXTA 4RJKA 2F8SA 3OM9A 1Q7EA 1XTKA 3QELB 3OOWA 1QVVA 1O8BA 3KOOA 1YUBA 1ZRNA 3JD3A 2D8MA 2P4QA 5CXXA 2JJ8A 3G23A 1LFDB 3HYCA 4ZT2A 5SICE 3WL3A 1QOQB 5HM6A 2FK7A 4G8CA 1EGVB 4J9VA 4ZPXA 5LYJF 1T34A 1QU3A 2GN9A 3Q41A 5AHOA 5BOSB 4WKCA 5BP7A 1RYBA 3NWJA 1GGKA 3UENA 2H4XA 3S2ZA 1A9PA 2J6BA 3BTUA 4ND8A 4MUMA 4RAOA 2P5YA 3IA7A 4EPTA 2WVAA 3CR3C 3DBHB 3G8CA 3HFGA 3FF4A 2C5LA 4AUNA 2ERXA 4P3YA 2GEDA 4RANA 4NMLA 5CX1A 3HKEA 3EFBA 3Q11A 1E2KA 5E6UA 4AJLA 1P3JA 4FEEA 2JAUA 2WV7A 3E7FA 4CM7A 2FG7C 3RM3A 2VHJA 1H2HA 2I2DA 4WPGA 5A4FS 2PLFA 4DB2A 3VH2A 2XKAA 4R2MA 1TM7E 4HXFB 2XIJA 2JI8A 3EEQA 3DNPA 3BB4A 1JTVA 3IJRA 4R8SA 4RA6A 5E3JA 4OBWA 3ZWKA 3ZVRA 4TVKA 5AJWA 2OYCA 1A0OA 4ZARA 4MRAA 2BZ0A 1LLCA 4NCXA 1M75A 4EL5A 4ARZB 5DGDA 1I2BA 1TGYA 3C3WA 5JLAA 1ZUD1 3F8SA 5EERA 5BV2P 2ZUBA 2ODNA 5IJ0B 1L7AA 2PQ2A 5L40A 2IE0A 4YJDA 4MJXA 2P5TB 3DQZA 1FSSA 1QHXA 1VLJA 1NSTA 2O5VA 3A9CA 3OTGA 2HT1A 4ZRNA 1US8A 1WLYA 3AB8A 1W1UA 4C0JA 3IDSA 4DTCA 1D07A 3AYXB 3HRIA 1NMZA 3LGXA 3FN4A 3LCJA 3HKDB 5DGHA 3SQLA 4WFJA 2IPOA 4KKVA 4LRUA 1YQ9A 5ALPA 1N6RA 3LHIA 3ZU4A 4LVOA 2FPLA 4YMWA 1OWMA 4G0OA 5EESA 1YRHA 5TT0A 3UAYA 3RUEA 2BCEA 3I2IA 3KS9A 1V1RB 4EITA 5J4YA 2QM0A 4LGMA 1CJCA 1Z4IA 1H0HA 4UHFA 2R7MA 2R7NA 3DZIA 1FVOA 4DXHA 3T0IA 3UBTA 5B7NA 1XQ9A 2D62A 5BYKA 1QVRA 1QP7A 5B58C 2ISCA 4RY2A 3ZV3A 3GF4A 1OF1A 3O7MA 2ZRDA 1E3LA 1BMTA 3S2GA 5DYWA 2Y1OA 3MTQA 2A3NA 3LQQA 3N6VA 3PSAA 4YVFA 2G5CA 1SG0A 4YR7A 1XIVA 3QPVA 1DB3A 1FNDA 3OPNA 4C4XA 1JG1A 3L6EA 3LVQE 2AV6A 2IDJA 4TVBA 1IHOA 2QROA 2XGOA 4UPVA 5H82A 1FDSA 2JB9A 2KJQA 4S1NA 4AF6A 3I9OA 1M1YE 4FMPA 1JUDA 4PZAA 4F60A 1YRQA 5LJLA 5LZ2A 3FFXA 4RJJA 2CMHA 3LKVA 1BYIA 4EHNA 1OXKB 4XM0A 1WIWA 5U9CA 1V8FA 4NYMQ 2DUJA 3NORA 1AOXA 3EMKA 2CNWA 5CGQB 5FV4A 5B2FA 1USKA 2GSWA 4EY3A 3EXAA 3JZIA 2QM8A 2O2CA 4KSYA 4OHUA 3AV3A 1GXSA 5B6IA 1HX7A 4WLOA 5H68A 1G8YA 2BI8A 5BMVA 2EKBA 4GWLA 5B36A 4C01A 4X71A 3LT2A 2PZMA 4B31A 1W85A 3BGDA 4Y6OA 4I3HA 1YE8A 4HV4A 1Z7BA 2PVPA 3TQHA 2XZTA 2VXCA 1FUEA 4OH1A 4H1HA 1WS6A 2D2IA 3P97A 4QSMA 3FCEA 4CMIA 4EENA 3OP4A 4L8GA 4W9MC 3FYUC 3IP8A 3RTBA 1IY9A 1WNTA 2JL1A 3B20A 4XGKA 1PDWA 1GQSA 3SYRA 3D3WA 2ANBA 4F91B 3RFCA 1E1LA 2FZLA 3VM6A 1CKEA 3T38A 3FOZA 2GCNA 2PGOA 2WTBA 3KE9A 2IHUA 1YJQA 4K9MA 5T4FA 4BB6A 1CR6A 4UM9D 3N5KA 3P4UA 5K0ZA 3CIOA 3GLIA 4I50F 1SXJB 3I9V6 2G25A 4AFNA 5BR1A 3A26A 3I6IA 2CWDA 2BGIA 5KAPA 1TYBE 2IZ1A 1YQWA 1ZGZA 2ZWOA 3KYBA 4URWR 3WK6A 1FIUA 4CGYA 1NMSA 5AW1A 4KFUA 3OO1A 2IYXA 5C8ZA 1PCXA 1EYZA 2CL5A 3WGNA 2UZ0A 3B1ZA 4W8GA 1B2RA 4JYCA 4L8YA 3FE2A 3H7IA 3SP1A 1T6NA 3HVIA 4NU5A 4PY2A 2YYSA 1UMCA 1X8LA 3HCRA 2C98A 5H16A 1D2HA 1TUBA 1BX1A 2FOIA 2VQEB 4JI7B 3G9TA 3DBLB 2FEXA 1O95D 3VDXA 1XAJA 1Q20A 5JT1A 4QDZA 3TOXA 2JASA 2GD2A 3PBKA 4R1UA 4BQQA 1HE1C 4BO6A 1MOQA 3F46A 4CTNA 4FLEA 2QX8A 1OH6A 3KVYA 2VZ8A 3K8QA 2DTDA 5BW5A 2EHJA 1RQXA 2WT4A 2IV3A 1GUDA 4WH0A 5JASA 4PSCA 1YONA 1Z36A 2HREA 4U2GA 3KQPA 2ZSBA 4DDWA 1TTPB 5KO2A 4C3ZA 2V45A 2ZIFA 5H0IA 2GKGA 3OEWA 3OFSA 4DLRA 1K68A 3CMCO 1S3SA 3BRCA 5I7OA 1XTJA 4MGIR 2CGEA 4G09A 1QU2A 3JCZA 4PHHA 4TSKA 5LOVA 1J5EB 2VNHA 4KU4A 2IU3A 3PQ2A 4HDMA 1IQUA 1T8WA 1PFYA 2AC4A 2HTEA 2YHUA 1A7AA 3JAKA 3KEGA 2O48X 4AMYA 1JP7A 2BUBA 3P9IA 2QLNA 4TMVA 1DO2A 2HBZA 3VYTB 3UWMA 2BKLA 3D2AA 3U39A 3IDAA 2ZR7A 4Z3OA 3KKQA 1P4GA 5EVJA 4NYMR 4XLLA 3AI1A 3A4LA 2C03A 2HK7A 3IOYA 5J3JA 3MTIA 2HMUA 3BC1A 1UBUS 4HGYA 3RSLA 1CIJA 5ES3A 1ZSVA 4EAAA 2BSXA 3CR8A 1WULS 1UKBA 1LPMA 2BBOA 2GAJA 1Y6JA 2RHGB 4KXVA 2W2LD 4OP1A 1H2BA 1A72A 3TEFA 1IBMB 4QBHA 2ZAGA 1IBRA 3EVAA 4IHKA 4TQUS 3VJMA 4PC7A 3QVUA 1E3TA 1LLFA 1T36B 1CFJA 1M2WA 4IQ8A 4RWEA 4R9SA 1E5XA 1E98A 4KIJA 2IFTA 3SQNA 5C5DA 3P9KA 1U2TA 1CQZA 3BXXA 5BN3B 5EWMB 4KITB 5IAGA 1VMAA 4AO7A 3NBKA 2GAAA 2PZFA 5JWOA 1GGEA 5JAIA 5AW2A 4MUGA 3DW3X 3L8CA 3H9UA 2ZSDA 4XYBA 5M34A 1IULA 2GCEA 3TLMA 4CFSA 1SEPA 4MYRA 3T5TA 4C7VA 4E5UA 1Z56C 2F7SA 4PWYA 3VYWA 4D42A 1H66A 1RYFA 4HMQA 3EGXA 5JBNA 4Z9BA 4QJ5A 4K0RA 1SHUX 3KR1A 1F7VA 1XMVA 3LYUA 2HXYA 4DMMA 1U7DA 4OREX 2H65A 4XI9A 5C3MA 1NV8A 3B1JA 2OSBA 1QX3A 2I2WA 4CM3A 3DHVA 3B52X 1YO6A 5FQNA 1SZJG 5BXYA 5J4VA 5KSZA 3A0UA 4MPRA 1EE9A 5KKNB 1TTQB 3VHXB 1BJTA 4M55A 3GLQA 1NJ8A 1JAYA 2PU7A 3Q9LA 5KCMA 4CM1A 1OYWA 2O05A 3HM2A 3GI1A 4U63A 1XK7A 2R6R1 1KE1A 4WZAA 3WJAA 2F1JA 4D5EA 4LBWA 1I3KA 5EINA 3OICA 5HCNA 2IW3A 3D6VA 3R5KA 5CK4A 1NWHA 2ZKLA 5DW3A 2RGXA 3P4XA 3O8CA 1E9BA 1G3MA 1RWQA 2PGIA 3Q6IA 4K9KA 4HXEB 4LXGA 4AO6A 1DGQA 1P31A 4NQRA 2REXB 1G8HA 2WIJA 4HDRB 2ZDQA 3M9LA 1H6CA 3L1JA 3FAKA 3VNQA 2WU8A 4HK4A 1GPJA 3CJTA 2YZ2A 4ZZ2A 2RGNA 4Q9IA 2DKFA 1DBIA 4H4EA 2ETXA 1M66A 3NX4A 3TTUA 2REQB 2F64A 1K27A 4M1TA 2R1ZA 3IAM1 1T4GA 4XVUA 1UH5A 1Z45A 4OXQA 4ALLA 4E5SA 4JD5A 2P5UA 3SJAA 2DWQA 2ZT8A 3KALA 4AVYA 2BI4A 1DKRA 3DVAA 3GCDA 4DLUA 4NNPA 4U2EA 1P4RA 3I2JA 1BCSA 4NABA 4UEQA 1Z28A 2OO5A 3H05A 3RTEA 2AN4A 3A14A 4D43A 2QORA 1QH1A 4TV9F 3ZJVA 2CSUA 5B3AA 3TIGA 2BYTA 2D7CA 3LPCA 4L8LA 2B2XA 2MSWA 4N8SA 4EYSA 1BEEA 3VR3A 3SK0A 4CM4A 1ADGA 2IXEA 2EDAA 5EWJA 5JCOA 1NKSA 1F2UA 1G18A 1UFQA 2Q3FA 3TKYA 5KQMA 2B78A 2IE8A 4WXYB 2YJGA 1E3WA 2J31A 4N49A 2M1XA 4FYMA 3ZKWB 4KPUA 4OQEA 2BBTA 3ZOZA 3M6XA 1XKQA 3EGDA 3NHRA 1ZI9A 2QU7A 1X87A 4X6YA 5JQGA 2XQVA 4WUVA 2AQKA 1X77A 2VUTA 2TMDA 2WYIA 1A98A 2NXNA 3GGOA 4V03A 4G65A 4G37A 4A6EA 5H3HA 3GDGA 2E9SA 2OGZA 1VHDA 4EHLA 3ZWCA 1IAQA 3OIGA 3ZCUA 1UP7A 1DCTA 1TZ2A 1Y89A 2PWBA 2Q0HA 1H8ED 2WWXA 3E7DA 2OZLB 3DJYA 3M1YA 4KX5A 1N8SA 3CUEF 3SQDA 4MVYA 3W8DA 2JFNA 3EAGA 3A1NA 5AK0A 3PSHA 3LMKA 4RH3A 2LCFA 1IRIA 2PQMA 2QNRA 3V33A 4OK6A 4EG7A 4JUDX 2JJ1A 4Q12A 1LS1A 1Q7TA 2ZSJA 5FOQA 1F0NA 2HEIA 1QYRA 1YRYE 1ZN9A 1CQIA 1ZSYA 4GOXA 3GN1A 1FFAA 1GOTA 2OXIA 3RRBA 3D2BA 1UANA 1Z2OX 2C78A 4XWAA 2IYSA 1PDOA 2QLBA 2EQ5A 3IMKA 3K0HA 5FBWB 5IT5A 3OZBA 3K1YA 1K4MA 2H9YA 2EBUA 1ZZGA 2Q9UA 2X5JO 3GFGA 5DXJA 3SE0A 3VPCA 3WMEA 4BFVA 2Z04A 4LE2A 1S3IA 2GB4A 2G4LA 2I7CA 2G0NA 3G89A 3GUCA 4MR8A 4XDGA 2I2XB 4WRRA 4HDSB 3VPHA 1NBMD 1CG6A 3O3OB 1TYZA 3SSMA 2CNOA 4P35A 3HADA 3BIOA 2OQ2A 3F7MA 1PWEA 1WUIS 1AKMA 4L1KA 5IHPA 1NL3A 2JFUA 4MTCA 3IMGA 4RHXA 2QMYA 1X3LA 4BMSA 1AUPA 3D8TA 4YRNA 1J0AA 4HCJA 1XV5A 3RF7A 2BV3A 2OGWA 4O1MA 5LA6B 1LI4A 1DEAA 1O0SA 1I8TA 4FOSA 4RPJA 1JHYA 3BFXA 4P36A 2R7LA 2JS7A 4YN3A 5JAPA 3H2HA 4ZT5A 2FHSA 2BGRA 2CVPA 1L5VA 2C9BA 1P4AA 2J3EA 1PWYE 2Q50A 3SF8A 3GT0A 5DI3A 4F8EA 3DHEA 3ZGZA 3PFNA 2HIHA 1QM5A 1IG0A 4B47A 1QDEA 5TQJA 4EA7A 5AW3A 2XOKA 4E5VA 3SFZA 4FBGA 1FU8A 3N8HA 1Q19A 4YREA 3S6JA 1JTFA 4J9UE 1QV9A 2JGNA 2WJJA 4DLSA 1VHLA 3G88A 5BN5A 5KNDA 2IV7A 3FYSA 2Q1WA 1E3EA 1LB1B 4R9UC 5J63A 2F8LA 5HS4A 4JA0A 1KSGA 3HBLA 4AL4A 2EKPA 1YAHA 5EIFA 2JATA 4BLSA 3HCOA 2PNJA 2OHIA 5BR7A 1VL8A 4TMKA 4WZZA 5KC9A 1C8KA 2QQEA 2FGKA 1W75A 2CMDA 3R41A 3TRIA 3AEZA 5SY6A 2XT6A 4CM9D 3L05A 2WIGA 3PIIA 4D3YA 4EPYA 2IYZA 4KN6A 4RHCA 3PICA 2GBFA 4V2IA 2HZ7A 4JI5B 2G1AA 2GXUA 4J1QA 4QUHA 4UFNA 1Y4ZA 1O77A 3FCUB 3HSSA 4IDNA 4UHBA 1W96A 5T57A 5JCZA 4X20B 1C81A 3RQSA 4COOA 3Q8KA 4UXHA 4MVJG 4UMVA 1YJBA 1A8UA 3T4PA 4PQGA 1QH8A 3KOUA 3M6MD 3SS9X 4MGKR 3ZCVA 2HL6A 4QU9A 4BNJA 4KDEA 1FDOA 3DBRB 2O0HA 5A3QA 1SOVA 2PMKA 4OK5A 3VR0A 1JLRA 1DKNA 3IQEA 3UJCA 4MVJF 1O96B 1YDMA 5IYZA 3LA8A 1AK9A 1Q77A 3VSEA 1NW9B 2OHXA 1PJQA 4DR6B 4BCDA 2V3VA 1YRLA 2FF7A 3EMBA 3S2SA 3WIOA 3MTEA 4F5WA 4Z4IA 3X1MA 2M32A 5DYYA 1Y6RA 4PO1A 5CK5A 1T0JB 4I6GA 5G0UA 4QOJA 3KLMX 4F4DA 4Y2SA 4GOOD 4RHUA 4WLNA 4MYSA 3KOZA 3KQNA 4OAPA 2MR6A 1QONA 5EUBA 1RRMA 4BJ6A 2P9FA 5JXHA 4XX1A 3BM5A 1JG6A 4UMEA 1W581 3DZCA 3H1TA 5K8CA 4NNOA 1L4EA 2HJSA 3I4LA 1AHPA 4XJVA 4G5GA 1Z4PX 3TTWA 1WPRA 2Q0XA 4YO7A 5JQWA 4V0MA 1AY0A 4WZBE 1JRLA 1P18A 3P9ZA 3SIWA 5I9LA 1HLFA 3GAZA 5REQB 3TN7A 1E2HA 3FNEA 1AKTA 4YV0A 1O2DA 1Z8DA 4GH5A 1NONA 3JYLA 1XC7A 1LPAB 5DMHA 1XAIA 4L4UA 4JSTA 4LS3A 3C39A 4D4JA 5FPKA 2HWYA 2YVKA 4X54A 3T41A 1KI2A 5F9MA 2HZBA 1SC3A 3C6YA 4AUKA 1A8PA 2L42A 1SVOA 4TXHA 5BSVA 3FROA 4HFNA 3OMXA 3W5JA 4UAJA 3JASB 3I2KA 2AW3A 4OHYA 3V4OA 2BMAA 1CLEA 4GLBA 1TEZA 1PTKA 1N3IA 5E6RB 3E9RA 3ZIUA 1LKZA 5AVXA 4DT1B 5C52B 3ESCA 3EIUA 3DCJA 1B8PA 3CZ5A 1QYCA 2IUSA 1MJNA 4PGMA 5AHKA 5DJ5A 5JYEA 1L7PA 1L1EA 2GA9A 2Y2UA 2CYBA 1OJ7A 2QRJA 3T5MA 2HA5A 5DNDA 4KGDA 5EJ2A 3UWSA 3LOPA 3LY8A 4BFTA 4ZIRB 1JIQA 1LBTA 3IQXA 4X9XA 2F90A 2OHJA 3G7UA 1ZICA 3F98A 1OFUA 4I1SA 2R1UA 1JE1A 2H4FA 5CVDA 1H4QA 1TCCA 4X45A 4DREA 4MA5A 4LK2A 4E5DA 1IWOA 1UOPA 2J32A 3N8NA 4M1MA 4D79A 3RE1A 2O2DA 2PY6A 4L73A 4CLOA 1XK6A 5L51A 3G0BA 1XTRA 4ZMBA 4S05A 2VZLA 5AVZA 2X19A 3CWQA 1TU0A 2YDXA 1NQOA 4JVLA 3DQQA 4US1R 3U16A 2PZKA 1EHCA 3PQ8A 3O84A 1P1HA 2BJHA 3QHQA 5EXSA 2Z4TA 2O14A 2VQSA 1P77A 4HMPA 5CB4F 2ZJ7A 3BXHA 2PRJA 3G59A 4RSRA 1MB0A 2BDTA 5HK9A 4IH9A 3SC3A 1L8QA 3B36A 5FNVA 3IURA 2IS6A 2VP3A 4J3NA 2HPAA 2ORVA 3GT3A 2P69A 3K0CC 2Q6LA 3FWHA 1NZDA 2QX7A 5LD2B 2W90A 5DM70 2R84A 4TV8B 2VHQA 2B5OA 2F62A 2CHUA 3KJQA 4UPEA 4M76B 3PENA 1YC2A 2GLUA 2B8TA 4YRAA 1SRQA 1ZVMA 4A26A 1P19A 3EBPA 3F5MA 2EP8A 4HP8A 2LRHA 3RYTC 1UCFA 3N3AC 3TAH