5CK5A

Signal recognition particle receptor srb-gdp-mg from chaetomium thermophilum
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
301
structure length
221
Chain Sequence
b'YTTLPSVLLIGPSGAGKTALLTLFERGTSYKVDLDAAGATARKFLLIDTPGHPKLRGTTLQHLLNPSPSLTIIPTSDPYKSKLKAVIFLLDAAALADSDGDYLSQTASYLYDVLLSLQKRFHSRKNSRAPSSIPVLIAANKQDLFTAVPASLVKSRLEHELGRIRKTRQKGLEGWLGAVGSKEFKFEEMMEFDMEVEVMGGNVIGDGPGAERWWRWIGERI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative signal recognition particle protein
publication title Structure and Switch Cycle of SR beta as Ancestral Eukaryotic GTPase Associated with Secretory Membranes.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Signaling protein
total genus 69
structure length 221
sequence length 301
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09439 SRPRB Signal recognition particle receptor beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ck5A00
2GXQA 5GVRA 1NJFA 1HH4A 1XP8A 4LBWA 3V00A 1E2MA 4RFSB 1L8QA 2BEJA 3PEWA 1IN5A 3QXXA 4B35A 4YDHB 2FFHA 2JAQA 2VEDA 4OBEA 4X8LA 4LI0A 1II0A 3CZQA 4EPRA 2O8BA 1GP2A 1RE0A 4PAQA 2XJ9A 4TTQA 2H16A 4RD1A 5J5CA 2WV9A 3SFVA 5A4JA 1XEWY 3OE7A 1N5LA 1HT1E 1DAEA 3B9PA 3QF4B 4M8NE 4ON9A 2GAOA 3NDPA 3LRPA 4HAVA 1W0KA 4RSGA 1CU1A 4OQXA 2IYXA 2W6IA 1YJ5A 3RS3A 3TAUA 3CX6A 3PUYA 2QBYA 2YINC 4Q7LA 3VX4A 5GADl 4CEJA 4U00A 2WM9B 4JT4A 1X1SA 4HB3A 1T5IA 3QQ5A 3BRWD 5EZ6B 1Z6XA 1TEVA 1R5OA 3C14C 1GTVA 1ZNZA 2IF2A 1VMAA 2ZRLA 3LD9A 2ZUDA 2F43B 3KX2A 4C4PA 4FXPA 1GDDA 3PXGA 4TSFA 5FBVB 1VCOA 2FFAA 2ZE6A 4OL0A 4LCBA 4BEBA 4C0AC 4RKEA 4GFDA 1II8B 3UMRA 2OM2A 2WVJA 3FKQA 3TE6A 3G82C 4Q19A 1AS3A 3QE0A 1R6BX 3QPVA 4JLBA 2AR7A 3L82B 1KMQA 2ZREA 3BH6A 4HB2A 5LDDC 4DB2A 1OIWA 3T5DA 2B7BA 4GDFA 1CULC 4PZZA 2WAYA 4AC9A 2QGNA 5JEEA 5JRZA 1U9IA 5J4LA 3MCAA 2VHQA 2PJRA 5JWOA 5JRJA 5UKDA 3TSOA 3EPHA 4M9QA 1E0AA 4B71A 4DIDA 4MRSA 5DO9A 1M1YE 1P2VA 3VKHA 4FMCF 4PPFA 3LAWA 4TZ0A 2C77A 2PEZA 4JKIA 5FPHA 1E94E 2ZVPX 5H1YA 4QBGB 1UKEA 2EYUA 4DLRA 2XGJA 5D3MB 1XEWX 2OZEA 2ONKA 2FNAA 1J90A 3GEHA 4ACBA 1OYYA 5FUXA 4FW9A 2CJWB 2ZRJA 3ONWA 3CPJB 4JIMA 4C2UA 2GBLC 1Z0AA 2YVUA 1HQCA 3EWSA 4IDQA 3WNCA 1AM4D 2QM7A 1GOTA 3AKYA 4HZUA 3BGWA 2IXEA 2O0KA 3GJ0A 4Q4HB 2FFQA 2IK8A 1JEDA 2D2EA 4K46A 3H86A 2X1VA 2ZS9A 4YMWA 3AF4A 2Q6TA 1Z2AA 4HAWA 1G20E 3SNHA 1W5SA 2EQBA 1WB9A 1N6PA 3AVOA 4LHYA 1KAOA 4AK9A 5L8VA 2XZLA 2VF7A 1NF3A 1X3SA 2IUSA 2ZSAA 4DT1A 4BRUA 4KSBA 1KI9A 1EFUA 1FX0A 1VG1A 1DAHA 5EXPA 1E9RA 4HLQB 2YNMA 1E9AA 2E9SA 1UDWA 1FUUA 2OBLA 3QPWA 2VA8A 3IHLA 4RJLA 3R9WA 4EQ6B 2B8WA 4EFNA 1E4VA 2H18A 2KBEA 3REFA 3RNLA 1DO2A 5HKKD 1F60A 3U61B 3QNUA 4YMUA 2GJ8A 1T3SA 3L8YA 1W4BA 2RGCA 1ESNA 3NHBA 1OXSC 4CEHB 1XEXB 1DBSA 2VYFA 521PA 4GNKA 3BE4A 8OHMA 4KVGA 1OXVA 2QTHA 3Q8XB 4U5XA 1DARA 4AKGA 2FPKA 3QKSB 2EFGA 2RGXA 4OK6A 1WBBA 2AD1A 3A4NA 4PX9A 5CB6A 2RGGA 2ZAOA 1ZNYA 4Q02A 4HLUC 4DHEA 4DSUA 5KYKA 3LWNA 3LLMA 1SXJC 4NYJR 3U6BA 2P5SA 1CXZA 1CJMA 2VH5R 4WZ6A 3BFXA 3CO5A 3WNBA 5AUQA 2JCSA 2RGNC 3A58B 5IDVA 1LB1B 1F2TA 3E5HA 4LJ5A 3E1SA 5EE1A 1K6MA 1GNQA 5E7JA 3ZVLA 1CR1A 3TJZA 1SULA 1KO1A 821PA 4JSYA 1ZP6A 3R8CA 4I1SA 4HB0A 5JCZA 1M2OB 5D3QA 4I1UA 2QEQA 4PPGA 2O5VA 3CLVA 1S1MA 1PLKA 3I62A 3QBTA 2VL7A 3VR4A 4MYCA 3O8RA 2W2XA 5DGXA 3UG7A 4AD8A 2DWOA 4NU0A 4BFTA 3MRSA 2PBRA 3OEED 4KYUA 2FZ4A 2IXGA 4CT5A 2VTKA 3KQKA 1J7KA 3CH4B 2QROA 2F1IA 5H68A 221PA 2JEOA 3W34A 2QMEA 2XTZA 2CNWD 3L2OB 5JHHB 3ADDA 4BFYA 2QORA 4HUTA 4RD4A 2ZSDA 3X1WA 2G1KA 3K09A 1XJQA 3WXMA 4RZ3A 1EFHA 4P4UA 3ZZTA 3P20A 1LS1A 2F1HA 1TUEA 4KBFA 4Q47A 4GRAA 3SHWA 1BIFA 5A5GA 1GG2A 1N0UA 1W1WA 5KSOA 2VP4A 4DEXA 3TUIC 3PEUA 4ZDJA 1E2LA 5HKKA 2KE5A 4MGZR 3MJRA 2GNOA 3HDTA 4K81B 4IOJA 1IY0A 1KK3A 3WMGA 1P9WA 5EE5B 1G18A 5LPNA 3W9YA 3VU9B 2IF0A 1Q44A 3HP1A 3T15A 1CS4C 4UNPA 2EFHB 5F3WB 5KDOA 2IYRA 5CDFE 3TH5A 1GITA 1J8MF 3AGPA 3UIEA 2D7DA 3SJBA 1MRNA 2X2FA 4MKGA 1GNRA 1NN5A 2IYZA 4PSVA 4KAXA 1HV8A 5JWRA 1D6JA 4ZV4A 4JLOA 4D26A 4CF7A 4MQBA 1XNJA 5BYKA 1QHSA 4MYHA 1A2BA 4TL6A 1AA9A 4RD0A 1P6XA 3SYLA 4KODA 4QC2A 1Z6TA 4M1OA 2OEPA 3GLHA 1EXMA 2VPPA 1UDXA 3UWOA 1B0UA 2EFCB 2WOJA 4LHXA 2J46A 2WMNB 4MKIA 5E7IA 3K1JA 2UVQA 4NYIR 4KFUA 4DB4A 5FTJA 2QP9X 2WAXA 3OEEA 5HZHA 2Q9BA 1S9HA 5JWHA 1Z3IX 3GJXC 1XD9A 5B57C 3WNDA 1HYQA 3C8UA 2X77A 3K0FB 1HUQA 1N6IA 2CNWA 1XMJA 2IYSA 2UKDA 1SVSA 1XTRA 2ZSBA 1KSJA 1QF9A 3H0KA 4PZYA 3MUFA 3PITA 2CL7X 5B2ZA 4D0NA 1KI8A 3GJ6A 3MD0A 4LBZA 4Q7MB 5BW8A 3UWKA 2QT0A 3O8BA 2N46A 2IEZA 1IM2A 3EZ6A 3DM5A 4O2LA 4BGDA 2KWIA 5SZIA 2HXSA 3TLXA 1YZGA 1NNEA 3KKNA 2WIAA 3LW7A 4ITRC 2BC9A 2FGKA 1W36D 3RSOA 4FMBB 2DBYA 3PUWA 3SEAA 4AYWA 2FGJA 3LY5A 5C1BA 1HTWA 1TPZA 2CCKA 2V1XA 4HLDA 3U44A 1COWD 2LWIA 4EJSA 1A7JA 1ZIPA 2WSMA 2HV8A 1NMZA 4FMCB 2ZQ5A 2OAQ1 2QA5A 3DMNA 4GZMA 3FHCB 4DZZA 2ZANA 1FNMA 2CLSA 1ZINA 5DSZA 3QSYA 4TT3D 3U5ZB 1A5TA 4LJ4A 1KNQA 1ODFA 2Y8EA 1Z07A 5G40A 2ZRCA 1M8PA 1G7RA 2CJWA 1Z0KA 2XX3A 2YWHA 3IO3A 5FBLB 1KYIA 4BLQA 1OFTA 4Q7KA 4FD2A 4UXIA 4OHZA 2ZRMA 2HDNB 1U90A 2JGNA 3EAQA 5SZHB 2PT7A 3JZAA 4IW3B 4XH9B 2J9RA 3UANA 1OB5A 1N5KA 1U8AA 2CLCX 4R2IA 3RC3A 5DN6D 5KSYA 3R8FA 2OUKA 4E5UA 3CX7A 1XCPA 4Q4HA 1S2MA 4KI0A 1G9XA 2O8EA 1NLYA 1XB2A 3QENA 4M9XA 2FSFA 2F1RA 1P73A 3DOFA 4C0BA 1Q1QA 4FN5A 1RJ9A 1KMHB 2Z4SA 1PUIA 2QRNA 1P61B 1T9HA 1WMSA 4BRWA 3Q5EA 3EIEA 2OCPA 4D6PA 3FYHA 4QG7A 2GEDA 4L4UA 2NPFA 4LZZA 1KJZA 1IJEA 1GL7A 4DCVA 1KI3A 1NVUQ 2A5YB 2NPIA 2QG6A 4NYJQ 4TMVA 3KB2A 1E32A 2JLZA 3AP2A 1KY2A 4LJ6A 2XZOA 4HSEA 1IXRC 2NTYC 4IRUB 3TKLA 2C9CA 1I2MA 4EQ6A 4C2TA 3PFIA 3KQUA 3GFPA 4PO1A 2ZIAA 1NVXQ 621PA 5CITA 4X8OA 3TQCA 1RYHA 2I1VB 3GCGA 4M0LA 2VP5A 3I5YA 2ERXA 4GMDA 1DE0A 1G4AE 4CEHA 2J59A 1XEXA 1COWA 2WJJA 2UZIR 1BOFA 4OKSA 1AZTA 4RZUA 3PQCA 2W2TA 4M1TA 1YVDA 4IKEA 3DKVA 1CRPA 2XAUA 3KL4A 4NKRA 1HE8B 4PAMA 1U9IC 2QP4A 3K0AA 1ZUIA 4M1SA 3SC3A 5FPKA 3ZH9B 3G5UA 3U4QB 1NL3A 2F9LA 5EP3A 2QNRA 4Q1DA 5LD2C 4FWTA 4IEEA 4LHWA 1RC8A 1U0LA 4NCIA 4KV9A 3QF7A 3DHWC 3OAAD 2ZR9A 3IIMA 5F9HA 3F5FA 3IBGA 1LFDB 2ODEA 3NG1A 1OH5A 2J0QA 5DN6A 1RIFA 2LKCA 4ZI2A 4IOKA 1WF3A 4ARZB 4Q4AB 1CBUA 3NTUA 5J4YA 5JJLA 2GF0A 1FOEB 4DC9A 4Q9HA 5CK4A 1YZNA 3PIRA 1JAHA 1G3QA 4ZPXA 4OI0A 1P2TA 2AN9A 5JECA 5AJWA 4QHTA 2HLDD 2BJWA 5CDFA 4V0KA 5TXGA 3THXA 2OHFA 4MA4A 2FN4A 2XXAB 5FUVA 3IUYA 1ZU5A 4ZIRA 3NEJA 4TMZA 1KI2A 1U2RA 2HT6A 3NH9A 4B3BA 1UF9A 5JMTA 2IWHA 5DIFA 1FUKA 5FTKA 3GLFB 2C99A 4A1FA 4BFXA 4EPYA 4C9BA 3QPUA 2XB4A 3MFYA 4WA7A 2D2FA 3WMEA 1OHHD 1OXXK 2E1RA 1FTNA 4LOAA 1Z6AA 2F6RA 4LPSA 1GRQA 5L3QB 3TQFA 4XTCS 2ZE8A 3BB3A 1VHTA 2RCNA 4PSAA 1E2KA 3QY0A 1E2IA 4AIIA 5JJIA 1DADA 5JSZA 5M04A 2P6NA 1VCMA 4ZO4A 1EFRD 5L3VA 4NYIQ 2Z43A 4TLCA 3RS0A 2Q21A 3WBKA 4Q1BA 3NDBB 2DFKB 3MWLA 1MO3A 5DYIA 1KY3A 4AKHA 3F0TA 2O8FA 2GWHA 3IIJA 2CHGA 2FWRA 3RRZA 2IS1A 4RFVA 4DIEA 5SZKB 4EPXA 2FDCA 1P3JA 3OAAA 2IS6A 2VIIA 3CWQA 2IYWA 2ZRDA 3C16C 4GOXA 1BYIA 2NO6A 4NZYA 3SZRA 4HAZA 1VYVA 4DLWA 4P3YA 1HURA 1QHYA 4F92B 2CK3D 1SVKA 4Q1FA 1Q1EA 1E0SA 4I4LA 4R9UC 2Z6VA 1MRSA 3SFZA 2HLDA 2W58A 1T3LA 3WYGA 4A4DA 3ZD7A 1QHHA 4D82A 3K70B 2A78A 1UKYA 2C96A 3QJYA 4Q1CA 5FI0B 5LB2A 4LK2A 2JLXA 3K0FA 4P4SA 4F91B 4JLNA 4EFLA 1E6CA 2HXYA 1HQYE 1MH1A 4IHQA 4FWIB 2B8TA 3OIYA 3SJZA 2FG5A 3EG5A 3TR0A 1CR4A 2A2ZA 2W0SA 1R10A 1GFIA 3MJHA 1GZSA 3FOZA 2IHBA 3FTQA 4QBHA 4RD3A 1SHZA 1E2HA 3U3MA 2G3YA 2RHDA 4MKHA 1OHHA 2RB4A 4HATA 2G0NA 1NSTA 5JBQA 3VTKA 4A2PA 5TARA 2IX3A 4H9GA 3NIBA 1IQPA 4XTRA 2EWWA 3K09C 1WP9A 3QUSA 4OJQA 3T1QA 1PUJA 3NC1C 3OE7D 2ZXUA 2VBCA 1KKLA 4P32A 2IYYA 1EFRA 2H57A 3WYAA 1R5BA 1OFHA 1ZNXA 1FP6A 3REGA 5L3SB 3U60B 4L8GA 4Q1EA 1C1YA 1JEEA 3LFUA 3UPUA 3SQWA 3OIUA 1T8UA 4D0LB 2ZRBA 4PSKA 3I61A 4MITA 2R6GA 2H8KA 3VHLB 3AUYA 3T12A 5FPTA 5AWFC 2GXUA 5KNBA 3RSLA 3UKDA 3WY9A 4AY2A 3BIFA 4KFTA 3I92A 3L8ZA 1KJWA 4GP7A 4I1VA 3K53A 2IUUA 5F9FA 1C9KA 2OFWA 1N6KA 3QVUA 1SVOA 1NMYA 2QQEA 1FL9A 2CK3A 2GF9A 2IBMA 4MRRA 4JVSB 4FCVA 4BFUA 4B33A 1XTJA 2P65A 4X8HA 2O8CB 1XXHB 2C2HA 2FV8A 5DHFA 1FMJA 1NBME 4DJTA 2GESA 5G53C 4Q48A 1G7TA 4KYIB 4WZBE 1H8ED 5HCIA 4E22A 3FFBA 3CZPA 4A0HA 1TMKA 1XRJA 3B1YA 2IT1A 3FMFA 3GFOA 1GSIA 2GCOA 1F3OA 1S3GA 1Z6GA 3MGCA 4TN1A 2QSZA 5FOVA 5IRCD 3HR7A 4HDCA 5HE9A 4YQFA 2DHRA 3AKEA 4A0GA 2Z4RA 2ZROA 3KKPA 2IYUA 3K0EA 2YWFA 3X2SA 3RRYA 1CJKC 2C9OA 3GP8A 2CCGA 1DS6A 4R7ZA 4ZCMA 1ZM3A 1QZXA 3QXHA 3TMKA 4Q4LA 3UMSA 1GL9B 1IAQA 1XXHE 3LVRE 4OHVA 5TY0A 2FMXA 3C5CA 5J47A 1NY6A 3E2IA 2VP0A 4JVLA 3DEFA 1ZBDA 4TYQA 4BWYA 5FI1B 1QVAA 2EU8A 2V1UA 2ZJ5A 2BM0A 2PLFA 1XFAA 3LQQA 3L43A 3GLGA 3F8TA 3TW8B 1D5CA 1OXUA 2DCUA 3DDCA 4WW0A 3U4QA 1N25A 2W00A 2HYIC 4OI2A 1JXOA 4EJSC 5FTMA 4KBGA 4PHGA 5CYOA 3JVVA 2KBFA 2ZUBA 1NRJB 4XWKA 5FTLA 1LTQA 2NOAA 3BERA 2GKSA 3MWYW 5DH9A 1XPUA 5FL3A 3RS5A 4NTZA 2PCJA 2EVWX 3VNUA 3CF6R 3T1OA 2IHYA 3TW4A 2HUPA 2JLQA 5FH9A 2GVZC 2VHCA 2ZTSA 2ZETA 1KHTA 3P4XA 3LO5A 1NVVR 1GAJA 4C0QC 2FH5B 1KJYA 1P75A 3SN6A 4MRVA 3Q72A 1QBKC 4C0KA 2YWGA 3QKRA 5EE0A 1M7BA 2F9MA 3AP1A 3U7EB 1JALA 1XTQA 2AFIE 2J0VA 3K70D 1CJVC 2R2AA 2V8OA 2XXAA 1U99A 1H8EA 4S2EA 1VPLA 1CRQA 1W0JA 1PLJA 5DLQC 3NBXX 4W5WA 1RW4A 4NPHA 3TGPA 5FR1A 1LS6A 2FU5C 4W5JA 1QHXA 1ZCAA 2RGDA 1KI4A 1KGDA 2ZYVX 4IOMA 1E0KA 1BKDR 1R4AA 3ZDQA 2L0XA 3SDZA 3AVTA 4A8JA 5ANRB 5EQTA 2AKYA 4Q1AA 5FOTA 2H17A 2GZHA 2H1LA 2V55B 4URWR 5L3QA 4P33A 2J7KA 2FJUA 3LVQE 4EPTA 3RANA 4JT2A 4BLTA 1SVWA 3VNVA 3Q7PA 3ASZA 1NBMD 4M1WA 2C03A 1G3MA 1F2UB 1MABB 2A9KA 2ZSEA 4R71A 1W36C 1GWNA 4PC3A 3W6OA 3MAAC 2PX3A 4KFSA 1DELA 1NIPA 4JS0A 1VECA 1KZGB 3ICEA 3NWJA 4NL4H 4EKDA 3THYA 5FTNA 1A2KC 4A2WA 2CE2X 1T0HB 1E96A 4BUJA 5SZJA 1QVRA 1CP2A 2BCJQ 2V9PA 3KKOA 3EZ7A 4WAUA 1UPTA 3GLIB 1WE2A 4PHTA 4JL5A 3IILA 4DLVA 3A6PC 1SGWA 3W8RA 4B3GA 1R2QA 2WZQA 3DOEA 1XPOA 4UKDA 2MSDB 5KPJA 1XMSA 1ZVQA 1XCMA 2I4IA 5CIWA 3VR5A 4R2HA 1L4YA 1OH6A 2VSXA 4JLAA 4LJ8A 2IS2A 1NSFA 1G16A 2WWFA 4M2LA 1II9A 1NN1A 1D2EA 4KLZA 1E99A 1PLLA 2O8DA 4M9ZA 4KSCA 1JJVA 2DR3A 1DPFA 3TVTA 5AUNB 1MKYA 1R0XA 1Z22A 2QE7D 4MRPA 2BMFA 4V02A 4URZR 2BBTA 2XITA 3PUXA 4PANA 4F93B 4CRWB 2C9YA 3IBYA 5CIQA 1T91A 2R62A 4JBYA 2OFXA 3V4FA 1U98A 3CWZA 1IONA 1W4AA 2Q9CA 3S1AB 4L9WA 4PC1A 5AJYA 3M1IA 1SZPA 1TUIA 5KSPA 5KDDA 1G8GA 1XWIA 3A36A 5JLJA 4RCYA 3EW9A 1P4SA 2W83A 5GJWC 3B82A 2NG1A 3SQXA 2QMHA 1CJUC 1GM5A 4KHZA 4IDPA 3TSZA 1KO5A 2CE7A 4XVQA 1EX7A 5TVKA 4R98A 4HDQB 1ZM7A 2WSSD 1NBMA 3C7KA 2BJVA 3OIVA 4CGZA 2WHXA 1GRNA 4D0GA 2QRZA 3ND9A 1OH7A 4AG5A 2ORWA 3ZIAD 3DL0A 5GJBA 1W2HA 1I2DA 4DLXA 2VLIA 2X2EA 5DHAA 3RVBA 1A1VA 3I32A 2GJ9A 3CR7A 5P21A 2JJ1D 3CRQA 3THWB 3CM0A 4O25A 3QG5A 4PQYA 2QMOA 2XTMA 2IXFA 3WRXC 1PZNA 1E9SA 4DSTA 3IO5A 4ACAA 2GJSA 4CT4B 1KI1A 1Z47A 2QT1A 4PZLA 4B73A 1E2PA 2E87A 1E2FA 2J0UA 1FZQA 1KDPA 2ZRIA 3M6AA 4XJXA 5FOWA 1G64A 2C98A 4ILEA 5KHOC 3D3QA 1VYUA 1KDRA 5FR2A 4NHOA 3FB4A 4ZDWA 4O3MA 1N6OA 2DFLA 1DAKA 3GJ8A 2QAGA 2R9VA 1YZQA 4OQFA 3ICQB 1AKEA 1E69A 4PR0A 2QU8A 2ORIA 4A36A 2JLRA 2OG2A 4DLUA 2H7VA 5LB4A 4U7DA 1SXJB 2GETA 1XBTA 3BAFA 5IHPA 4LC1A 1G8HA 3K0SA 4P4TA 2DPXA 2QE7A 3C41J 1Q21A 4FCWA 3VR3A 1YQTA 4PXAA 4D25A 1GIAA 2WICA 4IVQA 5AR1A 5IF9A 2ZI6A 2VHTA 3GJ5A 4QM6A 4RFSA 1VKJA 2WPDD 4LJAA 1DTSA 2WWIA 4ESVA 4M1YA 3X1XA 1JI0A 3CW2A 3IQWA 1H8HA 1TQ2A 3A4LA 4JLVA 5IT5A 4RZXA 3EPLA 4TMXA 1D8TA 1SVIA 1T6NA 4NCJA 2D62A 2GK6A 5EUQB 3QF4A 3CRW1 4V0OA 1Q0UA 1HE1C 1YZKA 4G5GA 4W7SA 3FVQA 3K9GA 3A8TA 3ZQ6A 4M1KA 3VFDA 2WSSA 1NVVQ 3KFXA 1Z29A 4GMXA 1CKEA 4HUQB 4NDZA 1JBKA 4ZI3A 4BPBA 3BXZA 1LF0A 1VG0B 4CZ2A 1SXJE 3CH5A 4RY2A 3U2QA 4LBYA 3U6KA 4HI0E 4POAA 3ZIAA 1NVWQ 2ODNA 4DXAA 4Q01A 4B34A 2D3WA 1X8JA 2YWEA 1W2GA 5DI3B 2QZ4A 1RYFA 4WXPA 2JJ1A 4TWZA 3IQXA 5KPDA 2WKQA 3FDIA 3HU3A 5KUTA 2F43A 4LYHA 3DPUA 4TL8A 2WOOA 1BS1A 1QG2A 3B1VA 1VYTA 4UNSA 4RD6A 2D74A 2DFNA 1ZM4A 4Q5IA 4B3FX 1II8A 4NMMA 3H1TA 2TMKA 2ZYWX 1E2NA 2BOVA 1G5RA 4B6FA 4CW7A 3HU1A 2VHUA 1S4QA 1GNPA 5KNCA 1X8KA 4AKIA 4XOIA 1JAIA 2OXCA 2JA1A 2WJYA 2QENA 2AXNA 1F48A 1K8RA 3GJ4A 3ZQJA 1M74A 2VP2A 2PCLA 3FE2A 1A4RA 2C5LA 3BOSA 2BKEA 1D9XA 2IUTA 2PL3A 1G3IA 3GQBA 4O2RA 4E03A 4IEIA 4A2QA 5G3ZA 5HE8A 2ECKA 1RRPA 1E4YA 2OLJA 3U3RA 1EG7A 2YHSA 4OYHA 2V54A 3PEYA 3H2YA 4Y0VA 3BS4A 2WPDA 4JVMA 5FUYA 4URYR 3RC8A 1GILA 2Q3HA 1LV7A 3V9PA 1N5JA 3U3KA 4OQNA 5D3MA 4CEIB 3N70A 2QN6A 1FTSA 2W0MA 1UAAA 1R0ZA 2ZRHA 2PMDA 3KKQA 2BMDA 3EA0A 3VR6A 1ESMA 3PR1A 3B9QA 4QHYA 2AWOA 3KKMA 4JVNA 4TLDA 2KSQA 1FQKA 1TU4A 5FOUA 1AJEA 1ZUNB 3R7WB 1YZLA 4CDGA 3ADBA 1Z5ZA 4EFMA 1F2UA 1MABA 4LHVA 3KQLA 3DZDA 2N1BA 1ZM2A 3EIQA 4NCNA 4Z8YA 1NG9A 2VRWA 3EC1A 3X1ZA 1TQ4A 4LX0A 4Q9JA 421PA 5FBRB 4B44A 4URXR 5CLQA 1KI6B 4BFVA 1IJFA 3QKTA 4J0QA 3LA6A 1QRAA 3B7GA 4WXRA 3RS2A 1YE8A 1ZM9A 1IOZA 3NBZC 3OFND 1GKUB 2ZPTX 3EIHA 4C0SA 1DAGA 2MMGA 3U7GA 2IYVA 1BH2A 5E3HA 4URUR 4QXAA 3AF2A 5CLLA 3T1TA 1EFTA 4DKXA 4M1MA 1K5DA 1YR7A 2X19A 2WMOB 3B1XA 4MKFA 2ATVA 4BFWA 2ZI3A 3P1JA 2P2LA 4MGIR 3GJ7A 3I8XA 4OI4A 4S35A 4OHXA 4D4KA 1TEXA 2QTFA 3KTAB 4RCZA 4O0MA 1JR3E 2ZI9A 1Q1ZA 4TLAA 2CHQA 3IIKA 4QM7A 5C4MA 4L9SA 4TL9A 1NJGA 4AURA 1L2TA 1OW3B 3A1UA 1Z0DA 4LJYA 1XD8A 2PZGA 5HTKA 1E3MA 1G7SA 1G5PA 3AM1A 4EAQA 2A5FA 4LBVA 2QGZA 1H65A 4BZQA 4OHWA 1F5NA 1IY2A 3QKSA 2ZRPA 4Q7JB 3SBDA 1VTKA 2GAAA 2IWRA 3T61A 5E4FA 1YU9A 1GKYA 3TSWA 1SQ5A 4M22A 3NBFA 2JLWA 3R9XA 3VR2A 1R8QA 3ZGXA 2O8BB 4JJKA 1S0UA 1XCGB 3G0HA 4F4IA 1JPJA 1U81A 3SS8A 1E9DA 3FFAA 3LXRA 3U7HB 4TMKA 1HEIA 4G5QA 4A8JC 3D6TB 4LJ9A 3QVVA 1UM8A 4GPTA 4PPNA 2O0JA 3RRNA 4G0NA 4G5RA 4XWOA 2R44A 1L4UA 1V43A 1Z2CA 2WJIA 5DE3A 1YR8A 3NC0C 3RS4A 4CEJB 4F7WA 3D31A 2Z0MA 3IPXA 1VIAA 4PQFA 1WRBA 4WBSA 2DYKA 1KK2A 2RKOA 1ZIOA 1GUAA 4H1VA 3PENA 1XPRA 4IFEA 2PZEA 3T35A 3OFNA 2QPOA 3VKGA 1X86B 2ZJBA 3TUZC 5AJZA 3L0IB 3ADCA 3BB1A 1N6LA 1NKTA 2AXPA 3AVQA 2V4ZA 2NO1A 2AHOA 4WIAA 2RAPA 4IOLA 5EE9A 4XVUA 2DB3A 1E9CA 3VKWA 1FPMA 4Q9IA 1EK0A 3MLEA 3Q85A 1NI3A 4IDHA 2XB2A 3BK7A 3M4YA 2W2VA 4N0DA 4OI1A 2ONJA 1TQDA 3CNNA 2RGEA 3EZ9A 4IDNA 1DAFA 3D7MA 2J5XA 2P67A 4A0FA 4DCSA 3IEUA 2JDID 1BMFD 1Z6YA 4HLUA 3MWJA 2XZPA 1SHKA 2G1JA 1SKQA 2CXXA 3BB4A 3N2IA 3SU8A 5JJKA 2Q0HA 5G3YA 3VU9A 2JASA 1ZYUA 1S8FA 2CEAA 2OSBA 3ND8A 1AKYA 1AZSC 1T3HA 1E79D 2RGNA 3UMFA 5LD2B 1M34E 4HAYA 1XTSA 1Y63A 3LBHA 4MUAA 4C0HA 3K70C 3CONA 2GHIA 4WZAE 3DKPA 2F3RA 1EWRA 1KDOA 2FSIA 5KSZA 3KXLA 2A7QA 4M21A 3JVUA 4JLDA 4TLEA 1E2QA 1LVGA 2WWXA 1Z63A 2WIBA 3I8SA 3GLFE 3SJAA 4HB4A 5BWMA 1OB2A 4Q03A 2FSHA 4JL8A 4Z54A 3L0SA 4GBMA 1XDBA 3DM9B 1UADA 4PAOA 1Q57A 1JR3D 1MO4A 1US8B 2F1JA 3FMOB 4HUQA 4DLYA 1Q3TA 2ZUCA 1KO4A 2QMUA 2V6JA 1W4CA 4HZUB 2YZ2A 3IHWA 2QQ0A 2C95A 1QHNA 3OESA 3RAPR 2J3EA 4EUNA 3K0CA 4Q00A 4TQAA 2ZJZA 3A4MA 5FPYA 2BM1A 3CKLA 1JR6A 5DI3A 1TU3A 2FX3A 2R8RA 1JNYA 1XMVA 4IVRA 4IXNA 1E1QD 2J45A 3DZ8A 4OK3A 2FZLA 3T34A 1Q22A 2QI9C 2OV2A 4TYWA 4PFSA 4X8MA 1I4TD 4F4JA 1XZQA 4GZLA 2JIZD 3PG5A 3IEVA 1G21E 5C46F 1FW6A 1V5WA 2P0EA 3K9NA 5AJXA 1NKSA 4N1AA 4Q21A 4RZ2A 3QOFA 4XSGA 2ZRFA 1W47A 1YRBA 2RGAA 4MGYR 2A5DA 1G8YA 1IXZA 1ZNWA 1UKZA 2JDIA 1BMFA 2A5JA 1ZD1A 2XSZD 3TIFA 4OHYA 1UBFA 3B13B 4DSOA 2ZYUX 1KO7A 3ZYCA 2SHKA 1ZRHA 2G0TA 1O87A 1P9RA 4TL7A 3Q9LA 5CM8B 3EASA 5AUOB 2P5TB 1FNNA 1ZCBA 1E79A 1VG9B 3KXIA 3QBVA 1CR0A 1TL7C 2QAGC 3TVDA 3R20A 3X1YA 3EA5A 1YR6A 3GFTA 3QG1A 5FFMA 2ZRGA 3AF0A 2FF7A 3AVPA 4DUGD 4C3ZA 2GEVA 1EFCA 4JKYA 1U94A 3OF5A 1ZU4A 3RYTC 4LYAA 5TB5A 3I73A 2GJKA 5EP1A 3RS7A 2ANCA 1GRRA 4JJZA 3KB1A 4TQ9A 1SVLA 1UJ2A 3B60A 4KCGA 3AVYA 1UKVY 1F2TB 1CJTC 5CK5A 3SBEA 4N3NA 4QHSA 1OFUX 4EIWA 2FPLA 1AQUA 2NO7A 2X8AA 4XVRA 2ZU6A 4B47A 2WJGA 1JR3A 3R7WA 3RHFA 4B43A 5EE3A 4YMVA 2BMJA 2ZRNA 1D2NA 2RH5A 2OXRA 3W8NA 3B5JA 1W5TA 4DEYA 3WHKA 3LW8A 4NP6A 2LKDA 4A9AA 4QJ5A 1MOZA 1U0JA 4YLGA 3EXAA 1KI6A 1M7HA 1E1QA 5FOXA 4B75A 4ZCIA 1TADA 1Q3HA 1KMHA 3TUJC 3PJRA 5J4VA 1G3UA 5JZVA 1OKKD 2Q3FA 1KOFA 3HU2A 1W0JD 4Q18A 4PPQA 2JIZA 4BZXA 1R8SA 4D4MA 4PQRA 2YKGA 3K9LA 3ZS8A 2GA8A 3QXCA 4JSTA 1WXQA 3P27A 4M53A 5BN4A 2EW1A 1AQYA 4ZKDA 4I99A 3U3OA 3J81k 3LX8A 5JFGA 1MT0A 2HT1A 2F3TA 2HF8A 4C0LA 2XSZA 4DDTA 1Z28A 3IPYA 4GT1A 4XSHA 4DBLC 5HZKA 2ZRAA 4US0R 5FUWA 1Q20A 1CLUA 4LV6A 2ZJOA 2REXB 4D80A 1LF5A 1EWQA 2QUZA 3TAHA 3N5CA 3U7FB 2QSYA 3AP3A 3W3ZB 1NG1A 4B3CA 4DUGA 1K5GA 1QHIA 2OCYC 1R0YA 4JLKA 3VHXA 5HR5A 121PA 3A37A 4MUBA 5L3RA 3LNCA 2YV5A 1AS2A 4GI7A 3AH8A 1DOAA 3WBJA 4DRZA 3I1FA 4C30A 1W4RA 3C4JA 5B58C 5KU1A 2OT3B 3O8DA 3GLHB 2EYQA 3GJ3A 5H70A 4Q66C 3A1SA 2P6UA 4KXFB 2B92A 1Z08A 2WWWA 4HLCA 4Q4AA 4ARZA 4LRWA 1M7GA 1OF1A 1G41A 5JCPA 4UJ3A 2VO1A 4C7OA 1U8ZA 3BWDD 2G9NA 4B3DA 4CYMA 4BZPA 3RDPA 5EP2A 5KOYA 4NYMR 3EWAA 4DDVA 1NMXA 3R9IA 2R65A 1T8TA 2NO0A 3PUVA 3FMPB 1OKKA 2PX0A 2AK2A 2A3RA 4IJMA 2GRJA 1EESA 2HCJB 4B3XA 1RKBA 2AL7A 4C7OB 1ZAKA 5J4HA 2QL6A 1G17A 2CBZA 5EP4A 5FOSA 5JHGB 2UZ3A 3CBQA 5DI9A 3RWOA 3GLFA 2YC2C 1BO6A 3EARA 3GLHE 4DCTA 1G19A 3C15C 2F55A 1YHNA 3M0EA 1R7RA 1PJRA 5FBQB 2ZVQX 1AGPA 1IN6A 1TAGA 2R6DA 1OLOA 1UBGA 1NN0A 4US1R 1TTTA 4Q9KA 4GSYA 1OIXA 2ZITA 3LH5A 3GD7A 4G01B 2ZS8A 4BLRA 3U44B 4IFBA 3OIWA 4EJSB 5F2EA 2EFDB 3E70C 2HCBA 4HZIA 3PEVA 2JLUA 1XJCA 1W49A 3DVLA 3L0PA 5GJVC 5EXSA 1VIYA 4ZKEA 3HYTA 5C18A 1N6HA 4FIDA 4HYYA 2ZI5A 4ESHA 4NH0A 1KSFX 4PC2A 3QEJA 1YKSA 1KSHA 5HCNA 1KSGA 3W90A 4XWAA 3FHTA 5CB8A 2WKRA 3THOA 4BLPA 5IK2D 4P0TA 3MMPA 4B2IA 2GVDC 2CMKA 3KQNA 1US8A 3D8BA 2HYDA 3UG6A 3AGQA 3PCRB 3W5JA 3Q7QA 2R6FA 3WYFA 1G291 1VCIA 1YRAA 2ZS7A 3A1WA 1VCNA 5E7MA 1IBRA 4NONA 4BE7B 1VG8A 3AKCA 2O8EB 1G8FA 1SKYB 3MG9A 1XD2B 3FKSD 1N2CE 3NXSA 2AKAB 3AV0B 1RJ9B 3BD9A 3HPRA 3OHMA 4FI3C 4BLSA 1ZUHA 1Z8FA 3QXJA 2G83A 2ZEJA 2H5EA 2QTVB 4L5BA 2GXSA 2AX4A 2ZI7A 3HWSA 3U3JA 2ZR0A 1WCV1 1T4GA 2VQSA 1OJLA 2IYLD 3F3YA 2PLRA 2QP3A 2ZR7A 5CJ2A 4AYXA 4DLZA 1WBDA 1PVOA 4URVR 1FFHA 1N3BA 2PT5A 4UNNA 3A1VA 3O8CA 1JB1A 2IA5A 1J99A 2A30A 2IL1A 3GLIE 3EPJA 2WKPA 4LC0A 4TLBA 2OLKA 4LHZA 4QRHA 3HJNA 5DISB 1H8HD 1GVNB 3H84A 4GOJA 1W36B 4ZDKA 3AVXA 3LX5A 2BMEA 3FHOA 1SKYE 2IW3A 2GK7A 4FINA 1IN7A 1B23P 2BBSA 3NBYC 3ZVRA 1D2MA 1CR2A 2FOLA 1NN3A 1KZ7B 2RHMA 4TYNA 4YMTA 4F4CA 1UBEA 1DEKA 2D06A 2GCPA 4JLPA 3FPAA 3P4YA 2PJZA 4W5HA 1P60A 3CX8A 1F6BA 3K0AB 5L3SA 4MDEA 2ANBA 1DVRA 1YZTA 2I1QA 2H92A 5EJEA 5H8WA 4LYJA 1G6HA 1P2SA 1IN8A 2ZU0C 721PA 1VDZA 4BFSA 1XJ0A 2B7CA 2CL6X 4DDWA 5IK2A 2ZSFA 4I81A 3GEIA 4HDOB 1OH8A 2GJAA 3CRMA 4QGHA 2J7PD 4QOSA 2CVHA 3HPQA 3KUDA 4L15A 4UNQA 2JJ8A 2Z5FA 3TK1A 3L0OA 4HEJA 2JATA 4A92A 3HYRA 1VHLA 4JLMA 1E2GA 2WWHA 1A82A 4RD2A 3B1ZA 3C5HA 2J0SA 1Q1BA 4KJZA 2QY9A 3KJHA 4GOKA 5AUPB 2O8CA 1XXHA 4M4SA 1JXMA 2ZJ2A 2OAP1 3FKSA 3EX7C 4NBSA 2GZAA 3H4MA 4F38A 1ZD9A 3Q3JB 4GP6A 3RWMB 3FMIA 3THXB 3BORA 3I4LA 2BEKA 2BDTA 2R6AA 5FL7D 2HJVA 3AF3A 3RABA 5J40A 4ZIRB 3K0CC 4M9SA 3ZZ0A 1KK0A 2ORVA 1Z06A 5BXQC 1DG3A 1JPNA 1R0WA 5ELXA 2J1LA 2NO9A 4QKQA 5KO2A 1RRCA 4DCNA 1ZMXA 5JI2E 3T1VA 4KVAA 3BFKA 2D4HA 3EZ2A 3ETLA 3CNOA 5F98A 4YMSA 2QAJA 2G6BA 2PEYA 1ZD8A 2OO7A 4L16A 1P7CA 4YDSA 3B85A 3NKVA 2PMKA 3I72A 1EGAA 3BFVA 5K8TA 2ZE7A 3DO6A 4D81A 2N42A 2XNSA 4A82A 1TF5A 1IN4A 1L7VC 3KZ1E 4LPKA 3CPEA 1Y3AA 4QNRA 1U0HC 2HEIA 2V7QD 5JSZB 4AI6A 3SYKA 4KFRA 2IYQA 1N0VC 3UATA 2J41A 2REBA 5JEDA 1RVDA 2JLSA 4NYMQ 2KI5A 3KXKA 4MRNA 2ATXA 3HR8A 1FP7A 1U8YA 4C0JA 4A0RA 3VX3A 2BKUA 4MH0R 2O8FB 4Z8XA 1OT3A 1TNDA 1RZ3A 4UQOA 3W6PA 1SVMA 2YOFA 4DWJA 2J7PA 4LV8B 5TMPA 4MDFA 2C78A 4Q4JB 1N6RA 4QGGA 4XD7D 4RVCA 3LQRA 2BVNA 4QGFA 4IVPA 2MSCB 1KO8A 1YZUA 5A0FA 1JJ7A 1DG1G 3JZMA 4ASUD 3SJCA 2OBNA 1RRGA 2K5UA 1MO5A 4EPWA 3K8YA 1UBCA 2HF9A 4V0ME 1ELOA 2G77B 2OCBA 4DLSA 2LCFA 5BN3A 2ODWA 4QBIA 2C8VA 2XEXA 4ERNA 2BCGY 3SR0A 1QHHB 2OE2A 3FWYA 2NIPA 2Q9AA 4B48A 2JLYA 5FL7A 2KJQA 4B6EA 4P4SB 5CM9C 3KQHA 1KDTA 2FE4A 1DAIA 4UNRA 4EDHA 1XTKA 1XMIA 4II7A 1XTIA 4LWZA 4UJ5A 4TTPA 1FMLA 4N0EA 1YR9A 1OIVA 4A6XA 4HAUA 3BJIC 1S1CA 1X1RA 1RFLA 2A5GA 2GXAA 1N0WA 5CYPA 2RMKA 1JQJC 1N5IA 2ZJAA 5TV2A 4G1UC 4AG6A 2VP6A 3WMFA 2JLVA 1G3RA 1KI7A 1T0JB 4PO9A 1MR3F 3NHAA 5C2JB 4Z51A 1AGRA 3AF1A 2V7QA 2HJGA 2VP9A 4YXWD 1E2DA 3WP0A 3TRFA 3X1DA 2GDJA 3N2EA 1LW7A 3ZD6A 4DCUA 1OE0A 1KIMA 4QJ4A 3CNLA 2OILA 2GZDA 3B1WA 2Q3MA 1TF7A 3Q5DA 5K8IA 4U02A 1X6VA 1S3SA 2XJ4A 5TDHA 5B64A 1DAMA 4B32A 5LBIA 1S96A 3CR8A 2J87A 4H1UA 1XX6A 4DLTA 4KLNA 4TQUS 1XZPA 1KK1A 1E98A 2CVFA 1T5LA 3T06B 3UK6A 4XD7A 5KNDA 3W3AA 1I4LD 4UXHA 4G5SA 3GLIA 1JQLB 2EFEB 2IYTA 3CRRA 5AK0A 3LXXA 5B30A 2AD5A 2XNDD 4ASUA 2CL0X 4YONB 3W6NA 2NZJA 3ZLJA 1ZW6A 2ZYTX 4FMDF 2NMVA 2ODBA 4QFMA 1OXTA 1DO0A 1IHUA 3KJIA 1XD2A 4PHFA 5EXTA 1KNXA 2WBLC 4PO8A 5FPSA 4QL3A 4B74A 1J70A 4JBWA 1Z0FA 3ZVMA 4NE2A 1NIJA 1NY5A 2V3CC 1SXJD 4JYBA 4I1OA 1OSNA 4AKEA 4DDUA 4WOPA 2GCOB 4KITB 4ABYA 1NLFA 3LBNA 3QKUA 4DSNA 2MSEB 1G6OA 2ZJYA 4LGMA 1BYUA 3BH0A 1D9ZA 2BHRA 1P2UA 2GBLA 3S1AA 1WDTA 4BECA 4D4LA 3BC1A 4TTRA 2VF8A 4US2R 3K9HA 2B21A 2CHVA 2DWQA 3EC2A 3IGFA 1LY1A 3KJGA 5KDLA 1QDEA 2GCNA 4XIGS 3VQTA 3GEEA 3OZXA 4OQMA 3WP1B 4AYTA 3TR5A 5JS8A 3IKJA 3V4RA 1Z0JA 1LNZA 2OFOA 2W6JD 3I3SR 4YXWA 3P32A 2B6HA 2ZAMA 3GLGB 2QBYB 1MO6A 3B6EA 2DFTA 3AUXA 1FQJA 4TT3A 5E95A 4B2PA 1IY1A 3QEOA 1W48A 3VR1A 2JJ2D 2OESA 4JBXA 5BN5A 3CRVA 2R6CA 3AQ4A 4MYUA 4TMTA 3THWA 2BV3A 1J2JA 3QI2A 2G88A 3PVSA 1EX6A 1E9FA 2GEUA 4BLOA 3LBIA 3BH7A 4PC6A 3O47A 4UXJA 3AEZA 1CEEA 3LV8A 2XNDA 1Z0IA 3DMDA 3GPLA 2IC5A 4PC7A 3ZS9A 2QPAA 4LJ7A 3MSXA 4B76A 1RRFA 3SOPA 5J4KA 2WJVA 3EZFA 3QKRB 4P31A 1E0JA 1JECA 5HPYB 1XEFA 1S9DA 2MMCA 1R5NA 2P3SA 3OEHD 3PV0A 5FBWB 3GLGE 2VHJA 2QM8A 4G5OA 1TQ6A 3SE0A 4KU4A 5C4GB 4TYYA 1SXJA 1E1RD 4JZKA 1J8YF 1ANKA 3VMFA 5JS7A 1AIPA 3FGNA 4V0NA 1E2EA 1W7AA 4YC7A 1HY3A 4E07A 3NVAA 4LSGA 2FEOA 2VSOA 4TYPA 4CVNA 4A8JB 4LY6A 2BWJA 3CF0A 1O3YA 2BBOA 2RGBA 2FEMA 3ASYA 2KB0A 4A15A 1CIPA 1QG4A 1I4DD 2DWPA 1WA5A 5JI3E 5DNYB 3ADKA 3QXSA 4GL2A 2IEYA 2CDNA 2O0HA 4TZ6A 4V0MA 3MWKA 4W9MC 1QHGA 2CLDX 3CF2A 1C4OA 2W6JA 1KKMA 1TF2A 3SI7A 3WHLA 1G7CA 3AKDA 4BASA 1HA3A 3WRYC 2VSFA 2OBMA 2ZM5A 3LDAA 3RLFA 1KAGA 3CUEF 1CTQA 2ZE5A 6Q21A 2JJ2A 2XTNA 5BQ5A 1TX4B 3SYNA 3THYB 1AN0A 1IXSB 4OK5A 4CIDA 4DT1B 4Q4JA 3ZVNA 4LUCA 1E9BA 4MGKR 1W46A 1XF9A 2XOKD 4NCKA 1FX0B 3RRMA 2FA9A 5GVSA 4KO8A 1E9EA 1KTVA 2NGRA 4LV5B 1P9NA 4OQLA 4PTLA 2DY1A 2ASEA 3CB4A 3KUCA 5K8LA 2CCJA 3AVVA 3OEHA 2EWVA 1RPZA 2YOGA 4IDOA 4ZCLA 4Z1MD 3NH6A 5EUMA 3LLUA 3B8HA 2O8DB 3EPKA 2GILA 1E1RA 1P62B 2ERYA 1X8LA 4A6PA 2D7CA 1ONBA 3AVWA 4TMWA 5K8UA 4JLJA 1PV4A 2FSGA 3CIOA 5G41A 4LDJA 3ECCA 4V0LA 2AWNA 4QNMA 3P26A 1AS0A 5KTYA 4CEIA 4B2LA 1ETUA 2C04A 2NZ8A 1E2JA 2ZJ8A 2PZFA 4NCHA 1N6NA 4ZDIA 3VAAA 4Y0AA 4DVGA 4AWXA 4QGAA 1M6NA 1ZC3A 2Z83A 3I5XA 1G4UR 2YJTD 1HT2E 1ZC4A 2OCAA 3B2EA 1OV4A 4QBFA 5CJPA 2BIFA 3W5IA 4BQSA 1OFIA 1W0KD 2YC4C 1P5ZB 2REOA 3KJEA 4K8OA 1NP6A 2O52A 2W6ID 1G5TA 1XU4A 1G1MA 1NLZA 4EPVA 4JL6A 4MYTA 4E09A 3GMTA 2NQ2C 2ZI4A 4FCTA 1ZJ6A 3B78A 4WVFA 4JMPA 3TNFA 3PUZA 4D2IA 3A1TA 3AB3A 4JYCA 2FPMA 3AVUA 2F7SA 1MV5A 3UXMA 1Z83A 1OPXA 1P72A 1OYWA 2FFBA 4TSFD 5GJCA 4RKFA 1GL6A 2V6IA 2XOKA 1Q12A 4G3XA 4PHHA 1G8PA 2AFHE 2BBWA 2J0UB 4BEJA 4QJ3A 2YOHA 2WWYA 2P6RA 4IXMA 4D4JA 2WTUA 5BYJA 2YYZA 4FMDB 3NEYA 4V03A 4Q9LA 3KTAA 1GKIA 2WJHA 4BFZA 5EXXA 2QAGB 1UFQA 2IS4A 3KDSE 3QIAA 5AJVB 3IDQA 2QPTA 4Z1MA 5DYGA 1WQ1R 4OJKA 3CPHA 2ZRKA 2WWGA 2PH1A 1W44A 1CF4A 2I3BA 3BBPA 4HAXA 1UEIA 5EZ5A 1AK2A 1UEJA 2AK3A 4LYFA 3KFVA 3SHFA 3T5GA 3ZJYA 3ZZUA 3TBKA 2GTPA
chains in the Genus database with same CATH superfamily
1NXOA 2F4NA 3B20A 5TQ2A 2G72A 3DXZA 4PGFA 3T5PA 4WWHA 4RFSB 1L8QA 1OVGA 2V8BA 3GR6A 1IN5A 1IUPA 1N2GA 4UBLA 4YDHB 3EGWA 1Z6PA 1G8JA 2FFHA 1T5BA 3QSGA 3VU8A 4OBEA 4B3RB 4P5DA 1AQ6A 1II0A 3INNA 4J07A 4PAQA 4Q3DA 6REQA 4TTQA 3OCVA 3QELB 1MHTA 4FYIA 2WV9A 5A4JA 4DBVO 4JKOA 1AY0A 1VLVA 4KQXA 3QF4B 3B9PA 4M8NE 5DGHA 5T41A 4DA8A 4CIBA 2GAOA 1RZRA 1JHVA 2CLLB 2CXHA 1LSJA 3AHFA 2YZMA 2WWTA 2B78A 1BE1A 3UJPA 2X4LA 3VO2A 2DP4E 3C1OA 3CX6A 2UZ0A 4Q7LA 3EDCA 3COWA 4YCCA 1KS2A 4CEJA 2QLFA 4U00A 1RWNA 3R5HA 4HB3A 4ZRMA 4L78A 4ME6A 4G0PA 4XB2A 1ACMA 3UHPA 4WEQA 3R0IA 3BMQA 4IJKA 3ROGA 5LUAA 2ZXFA 4PN3A 2ZRLA 3ZKAA 3FMGA 4AZ3B 1KRXA 2W5UA 1IK4A 3GLRA 1N2ZA 3SR4A 3DYVA 5H4HA 2JHFA 4BXOB 3SS9X 3F78A 3I0MA 4OL0A 3FETA 4C0AC 1XELA 3FM9A 4PLPA 4QUKA 3FBTA 4X91A 5EJGA 3UMRA 2WVJA 3CEAA 3OZGA 3UAWA 4D5EA 3TE6A 3ET5A 3W5CA 1Z7GA 4KE7A 4GLFA 5FA8A 1CS0B 3TAXA 3I28A 3KYCB 4KE8A 2LW7A 2VDWA 3TQIA 2FMUA 2W2OA 4JLBA 4BLVA 2DH6A 5LDDC 3OUUA 3DLPX 4I08A 1Q1GA 3T5DA 1BVYF 4GDFA 1TECE 2WAYA 2YRXA 3M6MD 1Y8QB 2FP3A 2QGNA 3S99A 3QWBA 4BAGA 1KFCB 2AJLI 5BRAA 1NMQA 1TT5A 4UARA 5JEEA 1YZHA 3MCAA 4AN4A 3U1BA 2O1XA 3ZWNA 4C4XA 4KYTA 4FJ2A 5JRJA 2I67A 2JCYA 3WMXA 1KP9A 1JRLA 1AUPA 3IAFA 3NIDB 2DR2A 3OZWA 4B71A 1OTYA 5GQSA 4DIDA 5A4DA 4MRSA 5DO9A 3ICPA 3BZBA 3HZRA 5ILOA 1QO7A 1M1YE 1KH3A 3UT0A 3NYQA 3FHLA 2FLKA 2PEZA 2AZXA 2BH2A 1F7VA 1GPUA 2W2LD 4WEOA 3DL7A 1BTOA 3FB1A 3QHAA 1MX9A 1RQLA 3FN4A 4FUTA 4EFDA 2ONKA 3GEHA 4ZA2A 4BNTA 4I1PA 3FUWA 2QZPA 1G21A 3EOAI 2P2NA 2WK1A 2ZJ1A 1E1NA 4MUXA 3H8JA 5BNTA 3VUEA 2ZUEA 1PHRA 2XGMA 1Z0AA 3EWSA 4OK3A 4X0EA 1FBTA 3MCVA 1ONOA 5EIEA 2IIPA 4XWYA 3WNCA 4LJSA 5JAQA 2PQ0A 1UWVA 4I66A 3NHFA 1C3JA 4IIEA 1IH8A 2IXEA 2O0KA 3WGMA 1ORVA 4IF4A 1L4EA 3AHIA 1JEDA 2EW8A 3NQ41 3BRWA 3HCPA 3H86A 3R09A 4BV8A 5FYDA 2DUWA 2WU3A 1A9XB 3F7OA 4QWMA 3AF4A 5C3UA 1H2WA 3E5NA 3G5MA 3TW0A 2QB5A 4V24A 2GK3A 1W5SA 4CKEB 2EQBA 1LQ2A 2ZSJA 4G5YA 4CM4B 2Z6AA 5A0TA 4D92A 4AK9A 4JODA 2VF7A 2PL1A 4XE5A 3SVTA 2VYND 2XZLA 2J8ZA 2C00A 2K87A 4CMAA 4V0SA 1PP4A 3ZCRA 1WUTA 2XQIA 1FX0A 1VG1A 1DAHA 1ZL2A 3H9QA 4I50B 3HO1A 3W1EA 1Z4IA 2CJFA 2XADA 2XUZA 1UDWA 1OBFO 1JAZA 1Q16A 3ZHTA 2BR3A 1FUUA 2W43A 3D2LA 1SN7A 2OBLA 2DSNA 5ICCA 2XDAA 4XM0A 3IHLA 4AMYA 2I71A 3IPCA 2J0EA 2V65A 1O96A 4AJEA 2OC4A 4LKRA 3QVKA 3WA7A 4TVSA 1Y3FE 3B7WA 4O33A 3STUA 5HKKD 3QNUA 4WCFB 4LRXA 1C41A 2NXWA 3ZHVA 1A9OA 1ESNA 2GQ0A 3WLPA 1ZXBA 1R0CA 2I54A 3BE4A 8OHMA 1H5QA 4WKGA 2JCGA 1IZ7A 4EOGA 1DARA 4UOZA 2JC3A 4TVKA 2FPKA 1SKBA 1O4VA 3QKSB 2EFGA 3RC7A 2RGXA 2VH1A 1X7ZA 3DE1X 4OK6A 4P5EA 4MVXA 1PVVA 2RGGA 2ZAOA 1P5FA 1ZNYA 2P9EA 1ECJA 4Q02A 4QSMA 4X71A 4CG1A 4WLEA 3L92A 2UYQA 3SD7A 4E1VA 3HLYA 3UMGA 3C5EA 5KYKA 2QVLA 3DUWA 3LLMA 4U9UA 5ALOA 5CLJA 4DLBA 2IQ5A 5DOZA 2ISCA 1QRRA 2GA9A 3WNBA 4D44A 2JCSA 2RGNC 3A58B 2E21A 4HJRA 1L6IA 4ZTBA 5AD1A 1EJBA 1UBLS 4KQMA 1GGKA 1OX5A 4TS4A 1GA6A 3ENNA 3W9BA 3VR5H 4LZJA 3ZVLA 1VI6A 2OB2A 3EBLA 5FLXA 3GG9A 2FPPB 4JSYA 1J42A 5AHKA 4EKYA 7ABPA 4DV3B 1EXDA 4D9FA 2I62A 4IF6A 4LNUA 5F51A 1Z18A 5I9MA 4D46A 4NNOA 3ZIDA 2GEBA 1PLKA 3M82A 5DWQA 3UYLA 4RY0A 2W2XA 1UK7A 4AD8A 2IELA 2DWOA 3BCHA 2FZ4A 4CT5A 3B38A 2AUMA 3SM9A 3KQKA 2YW9A 1P4HA 1P7PA 3CH4B 2A0YA 4O0LA 1ZGGA 2IFTA 1PNOA 3BSYA 3MEQA 2JEOA 1KZHA 3U3DA 2XCRB 2HM7A 2EW2A 2XTZA 3IMCA 5C5CA 4EG5A 3G1UA 3NCHA 3T7DA 3CUKA 5JYBA 3O8NA 5C37A 4MS4B 3WL4A 4I3GA 1K3UB 3UJ3X 2XMZA 3P20A 2P30A 3G2NA 5A5GA 3JTEA 3FSGD 4AP6A 3MCZA 2YXLA 1U2GA 3P2OA 2EKQA 3IB3A 4M83A 2P77A 3P9PA 4IGIA 4IKPA 1E2LA 1KE2A 5A4FS 4DLLA 4KPFC 1CCWA 4MGZR 4BV3A 1YR2A 3PNLA 1M1NB 2VK2A 4IOJA 4DLPA 1KK3A 2YL2A 1NXWA 2HSZA 1Z4PX 3H6HA 3H8WA 4QYXA 2X3YA 4XM2A 3WMGA 3UMMA 4GKJB 1WMBA 3BWYA 2N47A 3HKDA 2OZVA 2VYVD 3WLHA 3T15A 1CS4C 3DW3X 2EFHB 3GZNB 2GPBA 2IYRA 1YUMA 5CDFE 1GITA 4RMHA 1FRFS 1UL1X 2FEXA 3RSFA 3MUOA 2IZOA 2G70A 4ML3A 4MKGA 2F8LA 2F67A 1GNRA 5EFOA 3NASA 1HV8A 1S7GA 5JWRA 2IGBA 4Y1EA 4ZV4A 3PL5A 2O8VA 4UPDA 2XMBA 3JWPA 4U7GA 4C7JA 5EE1A 1A3CA 1OLUB 4EUSA 1JHOA 2XF2A 4MQBA 3RIGA 1DIOB 3TLEA 1XNJA 3AWDA 4MYHA 4NE7A 5FWYB 4RD0A 2TRSB 5DRYA 4KODA 4LSWA 4QC2A 1Z6TA 1XDUA 4M1OA 1U7TA 2EATA 5D3KA 1UDXA 5KYUA 2H1OA 2JFUA 1N7GA 5BURA 3QOYA 2P9GA 3QE9Y 1KRWA 3ANSA 2HHJA 1QCDA 2Z5LA 2UVQA 2WZDA 4IYRA 1CP3A 5DEIA 3THOA 1MZPA 3W8FA 1Y4UA 1VE6A 3V8BA 4DJEC 4DB4A 3L4BA 4ENTA 2WAXA 3D4OA 3OEEA 4KZPA 2Q9BA 4RC9A 5HZHA 2PUCA 1CW2B 1V8PA 3CQ9A 3DFZA 5DK6A 5EESA 4IXTA 3WSTA 3BMXA 1X8XA 2IOHA 1XLTC 5ITWA 2ZZKA 3WNDA 5LP1A 1FTGA 1HYQA 3C8UA 1HUQA 2FZCA 5LL6P 2CNWA 2ZSUA 4IHJB 1XMJA 2UKDA 3VSDA 4PZYA 5FI3A 4HK4A 3PITA 4UUAA 4D0NA 2LPMA 3DAPA 3MD0A 4E4YA 5C7YA 5JTTA 1VJ5A 5BW8A 1GTG1 2CVOA 5DSTA 1PX2A 1V95A 4BRZA 3UGQA 3KQYA 4F9TA 1JIXA 3VDXA 1KFBB 3VVCA 2DHCA 3CF4G 5FWXA 3TLXA 2HXSA 3LIIA 3O90A 3MTJA 3LW7A 4DYVA 4ITRC 1GYQA 2Z3VA 4KP7A 2NU7A 2R4UA 3PUWA 2CY0A 2VFAA 1OZGA 2P9YA 4BCDA 2FGJA 3LY5A 4MV9A 1NF2A 5IXYA 3U44A 1COWD 1ZMOA 1BMTA 4TKZA 1NURA 1VDMA 1A7JA 2B0JA 4N03A 3SJ7A 1SG0A 2HV8A 3PFFA 1NMZA 2H48A 3DL2A 3HZOA 3JSXA 3KUUA 1JIUA 4MUIA 3SXJA 1JDZA 4D4GA 3KT8A 4CMIB 4EGSA 4JXZA 2W93A 1DX9A 1E7YA 1EP1B 1TM4E 4MI3A 5KQPA 1K9SA 2JGFA 1A5TA 4LJ4A 4UBJA 5D1NA 4ZXFA 5TVGA 3TLJA 1M8PA 2CJWA 2CVPA 1JHQA 2M9MA 4KG7A 3TD6A 2G9QA 1VL6A 1OFTA 3A06A 4UXIA 3NW9A 4C5BA 2DVMA 4W1RA 3WYDA 5SZHB 2BZ0A 4CM7A 3JZAA 5TC4A 3LC0A 1DKRA 3LOUA 4IW3B 3HDHA 1PZXA 2J9RA 3EQ6A 3G2OA 1N5KA 1U8AA 1ZHHA 1O95D 4XLLA 3ROMA 1IY9A 3BCUA 3LLSA 4HO1X 4TROA 3JCZA 5FBHA 3CX7A 1XCPA 1U2EA 3DBVO 4Q4HA 5A06A 5JD5A 4TSKA 3E7PA 1DI0A 3KC2A 4Y2RA 5CH8A 1R9GA 4GI5A 1NUHA 1XMXA 2F1RA 4RE5A 4RZQA 2CFSA 1JIVA 5FXMA 4PLVA 4FN5A 4PLFA 3Q12A 1JUDA 2IGTA 1VJ1A 2QRNA 1L8AA 5EIAA 5J58A 3OD5A 2WUDA 1WMSA 4BRWA 2H08A 3FYHA 1OPRA 1P29A 3AQIA 3PYLA 4OJMX 3EGXB 2FSVC 2XQVA 4DCVA 1GL7A 1NPTO 1KI3A 2NPIA 2QTLA 3RJ5A 2QG6A 2HLNA 4NFHA 2AMYA 2YQZA 3KB2A 1E32A 3NM4A 3AP2A 5BN4B 1HE3A 4QOHA 1GYRA 4IYJA 4HSEA 5DT2A 3PQ3A 4IRUB 3PVZA 5IJXA 4BIIA 4CMHA 4ZZ0A 1Z7WA 3FPGA 4KX5A 3JYHA 3KKLA 2V6MA 1GV0A 3GFPA 4PO1A 5TQ0B 5CITA 3HY6A 4IFIA 3W2EA 4D8YA 1QONA 2I1VB 3IDAA 3A3YA 5JH7B 4F56A 4XLTA 2QUJA 1CZOA 3SZMA 3OFSA 1P91A 2ERXA 5REQA 3N07A 1KJNA 3PWSA 1N32B 1G4AE 1O2DA 2ZYGA 2G5CA 3FPBA 4P3XA 4RM2A 4A10A 3CVXA 1H42A 1R00A 4XFJA 1AMOA 4ER7A 1PBNA 4ENRA 4EMBA 4ARCA 1KMCA 2W2TA 3UW1A 1JEOA 4B6GA 2B25A 4IKEA 1SBHA 3DKVA 2VZ8A 2XAUA 2B4RO 4H59A 4J76A 3OX1A 4JBHA 4E08A 4V1CA 5KTOA 2OC9A 3NS7A 1O6FA 5AW2A 2I2WA 3VHXB 5FPKA 2HWXA 4KB5A 3SMQA 3G5UA 4CKBB 2R7NA 2YDXA 1RYYA 2B94A 2IZ7A 3KWLA 2PKCA 3A14A 4OCZA 4RZIA 4R4JA 3NVKI 3LQFA 4Y2UA 3L0ZA 2CUKA 3SFTA 2F9LA 4YDQA 2QNRA 5LD2C 5E9AA 3HBNA 2Q2OA 1RC8A 4UOEA 2FLWA 1V8FA 3ZKWB 4IS2A 1NVMB 1SPBS 3DHWC 4KV9A 3OAAD 1OLSA 1XZKA 2DJ5A 4HFNA 5F9HA 3KWFA 2MWMA 3RYFA 3G9QA 1BXZA 4Y2SA 1LFDB 2OCKA 1OX4B 1VM6A 2YUIA 1UOOA 2ODEA 2VHWA 3NG1A 3SLGA 1ZHFA 5DN6A 2J0QA 2C59A 2I6XA 2GDZA 4OXRA 3NTUA 2JGDB 4HDNB 5IW8A 3IRVA 2GF0A 1H2HA 3HCAA 1F9EA 3AF6A 1JAHA 2H6EA 2Q1YA 2RHGB 3LCUA 5FNVB 5DYYA 1P2TA 5KIAA 3FIJA 4BC0A 3AJ8A 1X15A 2OGWA 3H4IA 1DZ3A 3GW8A 3F98A 4QHTA 3FOEC 5I4BA 1FMFA 1E5QA 3OOWA 4P3OA 1EGHA 1N2OA 3K5PA 4K9KA 2A86A 3WRVA 2XXAB 2AVNA 2FN4A 4GI2A 2VOJA 2WAMA 3Q6IA 4PXSA 3NEJA 3IUNA 1EZ1A 5DV9A 3V7NA 1DSSG 2HT6A 4L85A 5ALNA 5ECDA 4ZVKA 4ESEA 3O3NB 5JMTA 2YHAA 4FT4A 2IWHA 5CDYA 2JJYA 4Q3OA 5F73A 3A9RA 1WG8A 3V1LA 5FTKA 3GLFB 4P35A 2C99A 4BFXA 1UP6A 1Q1AA 1ODKA 1MU0A 3MFYA 1FFYA 1NNI1 4WA7A 4MROA 4AMZA 2QX6A 5K4HA 3FPFA 3WMEA 1NV9A 5C1DA 4QQNA 1TZKA 1QFYA 2E1RA 2F6RA 2C2BA 4I5DA 4I4TA 1X7DA 4M46A 3RO7A 1FJGB 5F3RA 1YRYE 1VHTA 2RCNA 3P7MA 3TLGA 4YY3B 4BMPB 4QYMA 3ML1A 1K27A 3DMFA 2GCGA 4AIIA 1Q6YA 1JX6A 1XLVA 2DTXA 1DADA 1T8WA 2E2WA 5JSZA 4U8GA 3ORQA 3KOWA 1VE5A 2Y1XA 4RSRA 4PNEA 3RS0A 1O94A 3WGOA 1CERA 1NXXA 2SICE 3I6QA 1LEHA 4IIJF 2DFKB 1BX3A 4Z3KA 1ZCFA 3A9TA 1S4MA 1GEEA 4YMGA 1CUFA 1KY3A 1U7WA 1IVYA 1RPJA 4P2BA 3UW3A 2FWRA 2WYWA 1Z36A 3A6EA 4DIEA 4GL4A 3O8LA 4HT3B 3FLMA 3R24A 1WMAA 4FNOA 1HWYA 2VIIA 3Q6MA 1UMCA 3CLTD 2QYSA 2ZRDA 1HPLA 2XODA 2C9DA 2K7FA 4GOXA 1TVKA 4ZGWA 1E7SA 3U7IA 3G8DA 3BX1A 4HAZA 1B8VA 4HEHA 5EEHA 2YHBA 3TTUA 4ND3A 4P3YA 4DLWA 4EWLA 5HQTA 1TYAE 3CWCA 4F92B 2CK3D 2EKZA 2BGRA 3EXHB 3E82A 2HKIA 4I4LA 1J2UA 1CUAA 3A6KA 1U2TA 1G5HA 2OYRA 1TJYA 2HF2A 3V80A 3RUFA 5I9TA 2MSWA 1KEVA 1T3LA 3UMJA 3OZUA 1PJBA 1MIOA 2TSYB 1LPMA 1QHHA 1PO7A 2DBVO 2REQB 4BKRA 5BNZA 2A78A 4RDCA 3EIOA 4LF6B 2AQ8A 4OYLA 5DTJA 4JLNA 5HOEA 2QIOA 2HXYA 1HQYE 3F6YA 2B8TA 2QXTA 3SF0A 4YRKA 1BWPA 1NNLA 1VL5A 1IWPB 3IAS1 4RKQA 2VZ0A 4HAIA 2H65A 2NUBA 3FTQA 4I9UA 2F3SA 4L7VA 4FDUA 1JIJA 1J2TA 4I2NA 3LT5A 2G3YA 2RHDA 1OHHA 2RHJA 1ENOA 2YS7A 3FUXA 3P5SA 2G0NA 2HPZA 3IMEA 2PRSA 1YAHA 2FN8A 3NIBA 4RHXA 3E3NA 3INGA 3HVKA 1NP7A 3L4JA 4C1NA 1C3OB 2P3LA 1N1GA 2AZTA 2GN2A 3AG5A 3FPCA 1P19A 1ZK1A 1KKLA 1VSQA 3GUUA 2R0QC 4FHGA 1RTKA 3HSKA 4ZAFA 2H57A 1R5BA 3NXKA 1OFHA 4LA4A 4QXOA 2POQX 4JUCA 4XGIA 5JAUA 5EQFA 3BD8A 1NVGA 5ALPA 3L4KA 3HS3A 3T0GA 3U60B 3NOQA 5FLKA 1RWVA 4Q1EA 1FUEA 2QRJA 1JEEA 3UPUA 4QRDA 1G55A 3AIIA 4D0LB 4KRGA 4FFVA 5HQ3B 2EX1A 5LLSA 5AK6A 7REQB 5FPTA 2VHYA 1XRLA 5AWFC 4FYKA 3UKDA 1VIDA 2YJNA 4KFTA 3I9V6 4G41A 4H6WA 2AEJA 1DKUA 4GP7A 4I1VA 3K53A 4C7BA 4L57A 3OH8A 3PS9A 2X7JA 2ZB4A 5F5XA 1DQYA 1KWKA 1ICIA 1P31A 2QG4A 3QHQA 2QIPA 5EG5A 2HMSA 5FFNA 5ULLA 2W6PA 2XUQA 2IBMA 2Z8YA 3EGIA 4J4TA 4FCVA 4FEGA 1XTJA 2P65A 4NENA 4X8HA 4CLEA 4WFJA 2FV8A 2YYYA 2R1VB 4NDAA 1E6EA 1NBME 1XVLA 3AY0A 4R01A 3SIWA 5BOSB 5C5DA 5ETJA 4ZEOA 2ZBQA 3HI6A 2DE0X 2GESA 3LNTA 3PI7A 3GUHA 5CURA 2D8AA 2J9GA 2OKCA 5GIOE 1G7TA 4HPWA 4YP5A 4URHA 4WZBE 3U40A 1H8ED 2ZT6A 1H3NA 4P1ZA 4BX0A 4PAGA 4DWOA 2UVPB 3NBMA 1SQ6A 4E22A 1JA1A 3GA7A 4XYBA 3T3GA 4DM3A 2FXIA 4LFAB 1XRJA 4MWGA 2PD6A 1J5XA 5IYZB 2GCOA 3T5MA 3GDWA 1Z6GA 2UZ1A 1QX4A 1BMDA 2V03A 5IRCD 3HR7A 4UU0A 4YQZA 5HE9A 2FW0A 3A6DA 2ZBEA 3PA8A 1GQFA 4AJOA 4BTLA 3KT0A 1T2FA 1J2EA 3CVJA 1CJKC 4HY3A 3T7TA 2CCGA 5CUQA 3LK7A 1XL1A 4R7ZA 4ZCMA 1ZM3A 5ECYA 1YFZA 1XYGA 4Q4LA 4JP3A 1U0EA 1RWOA 4BOYA 1XXHE 4CM9A 3ZHXA 4P7GA 4NY1A 3C5CA 3GX1A 3Q3CA 4EX6A 3E2IA 1U8XX 2VP0A 3CKMA 2V5VA 3DFMA 3O4HA 4E3WA 1ZBDA 5CNMA 1K7SN 4JNCA 1THMA 1SCQA 3KU4A 4YPVA 1V6AA 2EU8A 4KQ6A 4OIMA 4AY3A 3L43A 1HLGA 3F8TA 3HN7A 4I9HA 3TW8B 4BQPA 3GLGA 2Z6UA 5DFAA 5JVDF 2A0KA 2C5HA 2RJNA 3VOBA 2WM8A 2YJ6A 4EP1A 1ENZA 1KR2A 2PGIA 3L7DA 2I6GA 3LY8A 4KBGA 1V1JA 2DR0A 3JQGB 3EZYA 3II6X 1Z25A 3DQZA 4XWKA 2I7VA 2VRBA 3NHWA 4C4RA 1B93A 3BERA 2GKSA 2BE7A 2OV3A 5G1PA 3KJXA 3DNPA 3OA0A 2DPMA 4KV7A 5FL3A 3BGIA 4NTZA 1PAUA 3I9FA 3GXBA 2IHYA 1D2AA 5EHQA 4LHEA 5FLYA 1DUSA 1GCGA 1QGYA 3HJCA 3NTVA 2VHCA 1H6CA 3CHYA 3LO5A 4E3ZA 4U7WA 1GAJA 3N58A 3M5PA 4GP9A 1SCBA 4K1XA 2V7BA 1F0KA 4X1YA 4X7BA 1C30A 3VBCA 1DBWA 1QBKC 2ID7A 2N75A 3HKBA 3TNJA 4C0KA 2YWGA 1GARA 4F4FA 2LD4A 4H08A 2BGNA 2M6RA 4XPIB 2F9MA 1H9BA 3MBIA 1X2EA 1XQ1A 3AP1A 2D1FA 1JALA 1XTQA 2AFIE 4MR7B 2R2AA 2V8OA 5K8CA 1ORDA 1ZH4A 1VPLA 1W6UA 1W0JA 1Z73A 4AMGA 1GPMA 5DLQC 4W5WA 5JQWA 1V16B 1YDEA 2X14A 16PKA 3TGPA 1XDDA 4JQCA 1YZFA 4EYSA 4ROTA 2YH2A 3DE6X 3RWBA 2Q0SA 1GSHA 4IY1A 4IOMA 2DZDA 1UT6A 1ZQ1A 1B16A 2PQ2A 1T43A 5BSRA 4YV1A 2VNIA 3B2NA 3H8VA 3MHTA 3R5XA 1E18A 3RTGA 4GWKA 4MO9A 4BO1A 4TV8B 2CKMA 4F8YA 2AKYA 1HDOA 4H7IA 4LXYA 4YJKA 1GTZA 5MFPA 3RVDA 4CLDA 1DIGA 2V55B 2C0CA 5L3QA 2J7KA 3LVQE 5AI4A 3U4MA 4N7RA 2D0DA 1CUZA 1YA4A 2C07A 4RTRA 2XQKA 1WOYA 3VNVA 1DQRA 3Q40A 1UR5A 3LY9A 6CHYA 4LIPD 5CU7A 4MP3A 3O84A 4KDCA 1E3QA 3Q7PA 3MT7A 2OD2A 1VL0A 2ZSEA 4ICIA 4O2BF 4R71A 5AVYA 2P69A 4TTJA 2EZUA 1V3QE 4NOJA 4MEJA 3B3GA 3OZRA 2BFDA 3JU3A 2W2KB 1EVJA 3AZOA 1VKRA 4GPBA 5IZ4A 4X85A 3ICEA 4JLWA 2C42A 1RXEA 4A8PA 4EKDA 1WV0A 4MIYA 2GFIA 2P1RA 4MOWA 2JIRA 2JGIA 4TWIA 4PCUA 5SZJA 4EAAA 3DUFB 1CP2A 2V9PA 5J5AA 3EZ7A 1QBGA 1UPTA 2RCYA 1GR1A 2G9VA 1XYVA 5EA2A 4J0IA 1AKMA 3WGKA 4PHTA 3ICOA 3LCVB 3A6PC 4NU5A 1SGWA 4QEZA 4MUGA 2ATEA 3W8RA 1U9CA 5JD6A 1OYOA 3IT1A 5JS6A 2WZQA 4PX2A 3OECA 3DOEA 1XPOA 1S2LA 1TYEB 5KPJA 1ZVQA 3PUJA 1XCMA 3WMRA 1W9MA 1MH9A 1G66A 1IBMB 1CZRA 1SUIA 3VR5A 4M86A 3MFQA 1SK8A 4YJ3A 3GCZA 3IEMA 2GPAA 3R0XA 2VSXA 4LJ8A 3LUAA 5EPUA 1NSFA 5C31A 4CI9A 1HYGA 1G16A 4M2LA 4D8TA 3BDAA 3E3MA 4LZAA 5KREA 9MHTA 1FE8A 2E4ZA 3IMKA 4M9ZA 5IVDA 1KVTA 1IHOA 1B8PA 1JJVA 1DPFA 3OZSA 5AUNB 1W59A 1UP4A 3FWKA 1GAQA 1Z22A 2QX9A 4MRPA 4V02A 4YDRA 3QPDA 2C31A 4PANA 3KSUA 4KIJA 4LWOA 4RVNA 3IBYA 4CRWB 1HX7A 4AULA 2PZLA 1T91A 3LLCA 2PQ6A 3W8EA 4CMEC 2A1UA 4WJZA 1P0IA 3BRSA 1IONA 1OWOA 2QM0A 5AJYA 4L95C 4BNWA 1SZPA 4YJHB 3TX6A 2G5GX 5JLJA 1QIFA 3KPYA 1AUOA 1TO1E 1EUZA 1EJ0A 3EW9A 2W83A 3V8PA 3B82A 2JEYA 3HB9A 3FFXA 2PD4A 1FRZA 2VQDA 3HYSA 3OSZA 5HJ2A 1CJUC 3RPEA 1EXVA 1NRWA 4FDAA 4KHZA 5A6VA 4R8LA 1JHXA 1YC2A 2VJYA 3E22B 3JAWA 5I4IA 4N5NA 4NEGA 4XVQA 2C57A 4IFTA 1J1UA 4OH7A 3TO5A 3C7KA 3O8OA 2X86A 4UUBA 3SX4A 4F7DA 2EEPA 1GRNA 2WHXA 2QRZA 2SCUB 1ZH8A 3ONNA 1PT9A 3ND9A 1UFVA 3UENA 3TOCA 2ORWA 4HUJA 5HS4A 4DLAA 1R6TA 1LPBB 2NNWB 5GJBA 2H1RA 4C22A 1VSTA 4TKMA 3S5UA 5BRJA 1RNLA 3KK0A 4WK0B 3KAPA 4F1KA 1DBPA 3H11B 3KPWA 5LUBA 3E8MA 4ZJYA 4LWPA 1PF7E 1DQZA 1P4RA 3N74A 1Q74A 1SBNE 3PD7A 4R5HA 3WRXC 2GJSA 4UM7A 3T94A 4DLNA 2PUTA 4PZLA 2XE7A 3MQ4A 3P9IA 2PN1A 4XJXA 4YRBA 1YC5A 1M2HA 4CLRA 3NRJA 1QK5A 1UBMS 4PRYA 2IY7A 1TUBA 2C98A 1Q1NA 4K2HA 1KDRA 1VL1A 3C43A 5FD8A 5FR2A 4ZDWA 1BROA 4OV6B 2ECQA 1ZESA 3PK0A 5AO9A 3ZU2A 3S81A 4O3MA 3WO1A 2QAGA 3IX7A 4QELA 2G40A 4HMQA 2IVZA 4OQFA 3EMKA 3UJNA 3ICQB 1H1LB 2QU8A 3G88A 2RG7A 2VQ6A 2JIPA 3L9WA 2OG2A 4X45A 4TV9B 5LB4A 3E1KA 4BO2A 1X7HA 3OM1A 1SXJB 3AOEA 5HKBA 4O2AB 5KQLA 1G8HA 1TKCA 4WN9A 2QE7A 2Y1LA 1QH9A 3UZUA 1YQTA 4PXAA 4RNCA 5B1DA 2WG1A 1M5UA 1ORRA 5AR1A 3AI1A 3GJTA 1Y6JA 1EBUA 1D6SA 3GJ5A 5I9NA 5CX4A 2MYUA 4LJAA 3WX0A 1DTSA 3FR7A 1N9GA 4FTWA 2Q4OA 4UZSA 2QMQA 3CW2A 3FTPA 3ANYB 4ZV7A 3ZJUA 1PDOA 2RONA 3VR6D 2GN4A 2NSDA 3VR4H 5EIHA 1D8TA 1RLJA 2JD2A 4OTZA 1AXEA 1J23A 2I2BA 1Q0UA 4G5GA 4O4IB 4LFCB 1JG3A 1VIMA 3KFXA 2C0PA 5FWAA 1CKEA 1R8XA 1THGA 1DNPA 1OBOA 1WAMA 4HUQB 3TFQA 3UUGA 1XMQB 2V7XA 3L1IA 5EZQA 1U1IA 5IXSA 4BPBA 3ROQA 4ZAWA 1RM4A 3U2QA 3U6KA 1P4AA 1I94B 4LBYA 3BF7A 3OJFA 4O4HB 5K2MA 3R2JA 1Y3DE 2JI7A 3RFVA 2EKLA 3UJ9A 4Q37A 4B34A 1W2GA 1PX0A 5DI3B 4F5YA 4ZYLA 3ZDBA 2H31A 2ZVDA 3CR3C 3HO6A 2FWBA 1CUUA 3KTDA 3QVSA 5EJ9A 1KY5A 3CSUA 2IXBA 4KQ1A 2ZJ3A 4K0KB 4TL8A 3VTZA 1PWXA 1BS1A 1QG2A 1K4KA 1XQ6A 3C3WA 2YVKA 1SEPA 3PYXA 2IP4A 1FBNA 4FFMA 2QTZA 2PXHA 3PPVA 4QBKA 3K4PA 3VNAA 2D74A 4Z1OA 2DFNA 4ZU3A 4CE6A 4B3FX 4WOCA 2NT4A 1II8A 4XKJA 4NMMA 5K0LA 5TS3A 1PTJC 2X2OA 5IJ9A 4KPGA 2JAWA 4OB6A 2AMVA 2XT9A 3BGVA 2ZYWX 2WLSA 3DAYA 4EJMA 4ESOA 1G5RA 3EVFA 2DY0A 3C3DA 2VTDA 2DQSA 2QD2A 3TOZA 5DNCA 1JAIA 1V5EA 3OQJA 2ZCJA 2X6TA 2B9VA 4XLZA 3RTCA 4ZJUA 2QTBA 1K8RA 2IP1A 4NJEB 3GCWA 1M74A 2HCRA 2PCLA 2EL7A 2C5LA 5H81A 3S2UA 4ZMRA 4NXNB 3A32A 1D9XA 2AZMA 3QWIA 1G3IA 2OQVA 4O08A 4G9GA 3ZI0A 3RSCA 1Z3CA 5ISMA 4XGRA 1RRPA 2OLJA 4X6XA 1EG7A 2X1LA 4OHBA 3N8KA 1G20A 3N3BC 3OCJA 4JI3B 3ZE6A 4BX2A 3BS4A 2WPDA 4JVMA 1RQPA 4C4OA 3PEYA 4TWJA 1GILA 1D0IA 3LHKA 5HMLA 1QLHA 1NW9B 3NIFB 1CPYA 4CEIB 4FQ5A 2OWDA 2OR3A 2WD9A 2QN6A 4P58A 3OZTA 3KKQA 4AZVA 1IOVA 3EA0A 3X1KA 3EWNA 1D6MA 1OREA 4QA9A 1KMNA 3IAAA 4QHYA 5I7RA 4ZO9A 3KKMA 1D0VA 4BY9E 3LU1A 4HQ0A 1QYVA 2AYZA 5A6SA 4TMFA 3B6IA 2VJBA 3E9ZA 4FOTA 1ZUNB 3GI1A 2O1EA 4HR7A 1M2EA 4ETNA 1YZLA 3LA8A 1LFAA 4CIXA 1PFWA 1BWSA 1Z5ZA 2XCLA 3OT1B 3TPCA 4EFMA 1N9KA 2X0NA 4NCNA 4IIJA 4RJKA 4EB0A 1NG9A 4X1IB 4I55F 3WVNA 1ZSVA 2VRWA 3X1ZA 3EOBI 421PA 4R84A 1V5FA 1HKHA 1EDDA 1T9BA 2BUCA 1ZD4A 3DD5A 2CF6A 3PXEA 4L5CA 2JZNA 4M7RA 4S1VA 1MQAA 1SEVA 2C2GA 4X90A 1ADFA 1PK9A 1YE8A 2V4UA 4XX0B 5ALTA 1GKUB 2ZPTX 3AESA 3HMQA 3EY9A 4C0SA 5EJAA 3WISA 4P4LA 1BH2A 1UANA 4J1NA 2JI9A 5CLHA 3AF2A 4GQIA 2FCAA 4MKXA 3U16A 1LC3A 2Z8ZA 2EARA 4TRNA 4BFWA 4P3PA 3U56A 2CD7A 5CT8A 3I8XA 4DV6B 4OHXA 2AUNA 1D8AA 1NP3A 1TEXA 4RCZA 3VDRA 1A71A 1XQWA 4CWAA 3AI3A 1PT5A 4KPYA 4R9SA 3EGEA 4PCVA 1KYYA 2FQQA 4IIUA 2IZ6A 3SC6A 5IKXA 1NJGA 2AQHA 1OC4A 2XUPA 2TMDA 3GHYA 4JEHA 1T25A 1PU2A 1XZEA 1OZHA 1Z0DA 3I01M 3IOYA 4X95A 4C89A 2DKOA 3SGLA 2PZGA 4G2TA 3JQQA 4R2XA 1E3MA 3IP9A 1B15A 4MLPA 2IU0A 2JKVA 2OG1A 5SY6A 4LBVA 2L19A 4BZQA 3MCTA 4R1PA 4BO4A 1F5NA 1IY2A 1Y81A 5DHSA 1EZZA 2I2XB 1F2DA 3SBDA 4TXNA 4YRMA 3PHHA 1HYHA 3WL8A 1EI9A 3AHHA 2AYXA 1NOIA 3D7KA 5EJFA 3ZTTA 1SBTA 3MTQA 5I4CA 1YU9A 1OAOC 1GKYA 5G0SA 1SQ5A 1EDEA 4M22A 2YHUA 1IB6A 1U5BA 3FPSA 1IXKA 1X1QA 4UHHA 2PSSA 1QE3A 3CG0A 4WN3A 3VR2A 4CQJA 3R9XA 2VF2A 3L18A 2FR0A 4JJKA 5KX5F 3L9XA 1NYQA 6REQB 2GZ3A 3RT7A 1XCGB 4E4TA 3C6XA 2OA0A 4F4IA 1RCUA 2YBDA 4WUTA 3BTVA 3SS8A 1GT6A 1FDOA 3FFAA 4IVRA 3LXRA 4R54A 4TMKA 1NJ1A 5DHTA 1KEEA 5U9CA 3D6TB 4GMFA 2G28A 4LJ9A 4TT8A 4D9JA 1QUEA 3RRNA 1L5OA 2O0JA 4G0NA 1BQ3A 4OSPA 3UH0A 4UD2A 5I7EA 3DS8A 1XMPA 4HBZA 3RS4A 1NI5A 3GBPA 4CEJB 4PQFA 5JU6A 3BMQB 3JXEA 2DYKA 4DSZA 2UAGA 4QXPA 2RKOA 3EMBA 2C4TA 3COSA 5BMVF 1GUAA 1OT5A 3FA2A 2P2GA 3A25A 4ZVVA 1QRDA 3VKGA 1D09A 1MDFA 2CB0A 2A3NA 2LR0A 3H99A 1T36B 3IVRA 3LC7O 1QYDA 4RAOA 4ROSA 4UVIA 5HX7A 1XWFA 1NKTA 2AXPA 4G36A 4WZAB 1NOKA 4UMVA 2RAPA 3OCXA 3KHSA 2ZBVA 4XVUA 2PUDA 3VKWA 1FPMA 1I36A 1ZEMA 2BY4A 2HI0A 4IDHA 2HA0A 3BK7A 1CK4A 4CU2A 3JAKA 3M4YA 4DIFA 4H7JA 1DHTA 1TCAA 3PCTA 3EZ9A 5DHPA 1T1RA 1Y4SA 3KQOA 5JE8A 3UMYA 1M3SA 2RAUA 3LGAA 2P67A 2UYOA 5U1PA 1XEAA 1W19A 1YD7A 2GLXA 1BMFD 2JDID 1Z6YA 2X6RA 4B6PA 1SXQA 2CSXA 1QMGA 2JZOA 1ZSNA 1CG6A 1SKQA 2CXXA 1V6SA 2G1JA 3EFEA 1ESDA 5DK4A 3ZCTA 4L2IA 2P2SA 1P4JA 2JASA 4WQMA 1S8FA 2OSBA 1SZDA 2QQFA 1M67A 2RGNA 1MD9A 1KKUA 2UUCB 4EHJA 3IR5A 1CEXA 4QPJC 3IV6A 1QLJA 3PFCA 3VYWA 4E88A 3FVVA 3LBHA 4TXLA 4BAUA 3B1KA 4YX9A 3K70C 3CJTA 4ZAVA 4J0DA 2AZDA 3CLSD 1MB0A 3VGJA 1LSUA 5T8KC 1CNMA 5EZYB 1CVLA 3AKZA 4KQWA 3LUFA 1G21B 3ZZ1A 4ZYWA