5CK5A

Signal recognition particle receptor srb-gdp-mg from chaetomium thermophilum
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
301
structure length
221
Chain Sequence
YTTLPSVLLIGPSGAGKTALLTLFERGTSYKVDLDAAGATARKFLLIDTPGHPKLRGTTLQHLLNPSPSLTIIPTSDPYKSKLKAVIFLLDAAALADSDGDYLSQTASYLYDVLLSLQKRFHSRKNSRAPSSIPVLIAANKQDLFTAVPASLVKSRLEHELGRIRKTRQKGLEGWLGAVGSKEFKFEEMMEFDMEVEVMGGNVIGDGPGAERWWRWIGERI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative signal recognition particle protein
publication title Structure and Switch Cycle of SR beta as Ancestral Eukaryotic GTPase Associated with Secretory Membranes.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Signaling protein
total genus 69
structure length 221
sequence length 301
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09439 SRPRB Signal recognition particle receptor beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ck5A00
2C8VA 2QSYA 2FV8A 4BECA 3MWKA 3EZ9A 5KO2A 1OE0A 4QNRA 3NVAA 2G3YA 2ZSBA 4LBWA 3ZQ6A 3GP8A 4GPTA 4AI6A 2C96A 3L0IB 1WB9A 2R8RA 3EG5A 4MRSA 5B57C 4LHWA 3H0KA 3W3AA 3RC3A 1Q12A 5KSPA 4G1UC 3AF0A 1E2GA 2J5XA 4UNSA 4X8LA 2ZROA 2NIPA 2H5EA 4KJZA 4RKFA 1W36B 1E3MA 4TMXA 4C0LA 4LJ9A 5B64A 2VP6A 2CVFA 1COWA 1FUUA 1SXJD 2GCPA 1AK2A 1LTQA 2ZRPA 3QE0A 5DI3B 3I4LA 3KUCA 4RD2A 4XVUA 2AKYA 1W48A 3I3SR 2DYKA 2DCUA 1ONBA 2ORWA 2ZAOA 2UKDA 4G0NA 4XVQA 2XX3A 2ZITA 2OSBA 1SVSA 5EP3A 2WICA 2FFHA 3LH5A 1S1CA 5K8LA 3WP1B 1QHHB 4OI1A 2OXCA 4QM7A 3AGPA 4ILEA 3QXXA 4Q48A 3L43A 3UATA 1HE1C 4UXJA 1YU9A 5G41A 4ZDIA 1H8HD 1XTRA 4GZLA 2C9OA 3IEVA 4RSGA 1XPRA 2NG1A 2CK3A 2OCBA 2ZRBA 3Q3JB 5DI3A 3S1AA 5JJIA 1TEVA 4DLXA 4M21A 4KVAA 4FWTA 3BJIC 4RFSB 3A1TA 4PAOA 4RZXA 1UKVY 3ZVRA 4GFDA 3WNDA 2AR7A 3LY5A 4M9ZA 2FDCA 4H9GA 4HSEA 1E2QA 4RY2A 4Y0AA 4YXWD 3TAHA 4GL2A 1VCOA 2PJRA 3ETLA 3MJRA 5CLLA 5G3YA 3AGQA 5JRZA 4DDWA 3KXLA 4LX0A 4LPSA 3AKCA 5D3MB 2FGKA 2NPIA 1UBCA 3Q85A 3OFNA 2HXYA 3NEYA 5TV2A 2XTMA 3NBFA 4QL3A 4GI7A 3AF1A 3UWKA 3GLFA 1PV4A 3CR8A 1KI9A 5CB8A 3P4XA 2XOKD 2OLKA 1E1QA 5JEEA 2V6IA 2MSCB 3B1WA 3CWQA 4FMDF 4CT5A 1MABA 2V7QA 3TR5A 2B21A 4NONA 2JLQA 4FW9A 3T34A 5C2JB 4B2LA 2G1JA 2V3CC 4M1SA 4BLQA 5D3MA 3ADKA 1NMZA 3CRVA 1OIXA 3W3ZB 3GLGB 1XMVA 2QE7D 3A4LA 3A36A 3SBEA 3SNHA 2FMXA 5FUYA 4Q01A 1VYUA 1T91A 4DLYA 1RKBA 2ANBA 4ZDKA 4JLJA 2WJYA 1EFUA 5DIFA 4CW7A 2OE2A 2ZVQX 4Q21A 4IDQA 1JPNA 3ICEA 3ONWA 1EXMA 2BM0A 2XNSA 3DKPA 4J0QA 1WRBA 2GCOB 4PSAA 4ABYA 4G5GA 1P2UA 1NKSA 3VNUA 3EAQA 4LUCA 3P26A 3DVLA 2IF0A 4D81A 1E0SA 3P20A 4DT1B 4AURA 1G8PA 4HUTA 1Q57A 5C18A 2NMVA 4K8OA 1RZ3A 4Q1CA 2AKAB 1P60A 4NYIR 5JBQA 3OEHD 3B1VA 3K0SA 1X3SA 4JZKA 2YWGA 3SFVA 3SHWA 2GRJA 5GJWC 2EU8A 1GM5A 5BWMA 5H8WA 4TZ6A 1W5TA 5CK4A 3W6NA 4U5XA 4C0SA 1OHHA 1TNDA 4URYR 5K8UA 3K70D 2F43B 1JNYA 4Q7JB 1UKEA 4UXIA 3RWOA 4KBGA 4YQFA 2R65A 2ZM5A 3OEEA 3CPHA 5DNYB 3U7HB 4ZCMA 2CBZA 2ZI5A 4PZLA 4NYJR 2DY1A 2GJ9A 1Z6TA 1OW3B 3GEEA 2E9SA 3RS2A 1AS2A 2CCKA 2GF9A 4RFVA 1U94A 2BMJA 3HYRA 1KDOA 1FPMA 2XZOA 2D62A 4HLUA 3MAAC 1E9EA 2PBRA 5BQ5A 3QXHA 4PHFA 3I8XA 3KQUA 2JCSA 3UG6A 1JQLB 2VF7A 4DC9A 2NTYC 4P31A 1ZNXA 2QMOA 2ZYUX 4Q1BA 4LJYA 3SYLA 3NDBB 2EQBA 3A1SA 1ZU5A 2PZFA 1LS6A 4TMTA 4AC9A 2QN6A 3W8NA 5ELXA 4D4MA 1TTTA 2PX3A 1VMAA 5P21A 2C99A 3D3QA 3EZ2A 1XF9A 4DCNA 3ZVNA 1MO6A 2V4ZA 1SKQA 1XP8A 2HF8A 2ZANA 1UFQA 2GEDA 3HPRA 4OHVA 1XU4A 3RRZA 4ZV4A 5JS8A 4NL4H 3KKNA 4XWOA 2VP0A 2WBLC 4K46A 3EWAA 1GAJA 4KFRA 1DAHA 2OFXA 3OAAA 1K6MA 4QFMA 1JJVA 1DVRA 1KIMA 2Q21A 1VIAA 3A1VA 2EFGA 1IBRA 1KO8A 1M74A 2X2EA 4TLEA 4EPXA 1DPFA 4XD7D 4QM6A 1QBKC 1ZCBA 2ERYA 3AUYA 4LV6A 5L3SA 1XCGB 2EYUA 1SQ5A 1SXJB 4XTRA 5AJXA 1FFHA 3TVDA 1G8FA 2KBEA 3LW8A 1GP2A 2ANCA 3WMEA 1OH8A 4DHEA 4HZIA 1W2GA 4RD4A 2DPXA 3MCAA 4KCGA 1IM2A 2JDID 1F2UB 2D74A 2BDTA 3FDIA 2OFWA 5SZIA 2XTNA 1U8AA 4PPQA 1VHLA 2ZJBA 1P72A 1W4BA 4HI0E 1BS1A 4LJ8A 3R9WA 2VQSA 3TQCA 3IQXA 4NCNA 4DJTA 4ZDJA 1U9IC 2N46A 1K5DA 4MDFA 1QG2A 4LYAA 4JLDA 5H1YA 4G5SA 1NG1A 2CLDX 5LPNA 3I62A 1SXJA 3QXJA 4AKHA 2QP9X 1P73A 4JL5A 3QG5A 4PO1A 3BK7A 2QG6A 4EFLA 5BN4A 1E2EA 2ZRAA 3TSOA 5L3VA 4LDJA 1MR3F 1R10A 1XJ0A 4AKGA 2PEYA 3TLXA 2ODEA 2O0HA 4WZBE 3CPEA 3QF7A 3VR5A 3F5FA 1XD8A 3TW8B 2QP3A 4BZXA 3F0TA 4DXAA 1E9AA 4DCVA 1K8RA 2FSFA 1NIJA 3REGA 3C5CA 2Z43A 1H8HA 2RGNA 4JLOA 2ZI3A 4V0OA 4W5JA 4JVSB 4AG5A 1NN0A 5EE3A 1DOAA 4BEBA 3BFVA 3GLHE 4JYCA 2WAXA 3VQTA 4PFSA 2PCJA 5JMTA 3AH8A 1KI2A 3K0FB 1P2SA 5CIWA 3NH6A 3RSOA 4A6XA 4CF7A 4YLGA 4URVR 1HE8B 3B82A 4KHZA 4M1WA 2RGDA 4B73A 2LWIA 1ELOA 3K0AA 4G5OA 5BW8A 2GVZC 5KHOC 1XTSA 3LXRA 1VG8A 2FF7A 2AN9A 1LF0A 5CIQA 3EIEA 1M7BA 1GL7A 1W0JA 1NVVQ 4B48A 4B6EA 1EX7A 5B2ZA 3EPJA 4R7ZA 4LYFA 3IPYA 5SZHB 2Z4SA 2GJAA 3Q72A 5B58C 1UBFA 3OESA 3ZDQA 1IXRC 3KDSE 1JB1A 2XOKA 1FL9A 5FOVA 2ZRMA 4BPBA 1XWIA 2JLSA 3M1IA 4E03A 4JYBA 1IOZA 2R44A 2ZSDA 2FPLA 2GJKA 3TSWA 4BWYA 2XB2A 2ZYWX 1G3MA 2CL7X 2FZ4A 4NCJA 2OEPA 3IIMA 4O0MA 3RS3A 4RZ2A 5G3ZA 4DSUA 5F9HA 5KNCA 1KGDA 4NCHA 4QHSA 2F7SA 2ZE8A 2QE7A 3JVUA 4PHTA 1R5OA 1KO7A 221PA 3U3KA 3VNVA 1KK2A 5F98A 1ZP6A 3PR1A 2AX4A 2GXSA 1LY1A 3P1JA 2BBSA 2PT5A 3JVVA 1NVXQ 1P9NA 4XVRA 2ZJOA 1EESA 5L3RA 1KJYA 1GRNA 2VHJA 3OHMA 3TQFA 1G291 1B0UA 2GHIA 2ZR9A 3CF0A 3K70B 5UKDA 2P0EA 2IT1A 1YR6A 4GOJA 5DH9A 2CLSA 2QM7A 2OCYC 2IHYA 4KSCA 3RANA 4BFXA 2FSHA 1KK0A 2GBLA 2OBLA 3F3YA 4LBZA 3PEWA 3OEHA 4DLZA 1N5KA 2JLXA 3MFYA 3I5YA 1G21E 3U7FB 1AZTA 2W6ID 3AP2A 1E2KA 5JWOA 1FP7A 1WP9A 5IF9A 1XTQA 3TH5A 1Q44A 1N6KA 4PAMA 4A2QA 1PLJA 4US2R 4OI2A 2EW1A 4M1YA 3AVWA 1XEFA 1Z0FA 2QBYB 1Z29A 3IHLA 3QKUA 1AKYA 1AQUA 2R6GA 3BBPA 4EIWA 1XMIA 3GLIE 3SYKA 1G7SA 1KY3A 3TVTA 4CRWB 3KX2A 3NTUA 4OQNA 4Y0VA 2B6HA 4YMTA 1R0XA 3PENA 2FH5B 1NY5A 2UZ3A 3QPUA 3ECCA 4IEIA 4C0AC 1AS0A 1MRNA 1W47A 4JLAA 2GKSA 4ZI2A 1NMXA 4GDFA 2P5SA 2VLIA 4C0JA 2ZXUA 4Q4HB 4MRRA 1GFIA 1TUIA 3CRW1 4LC0A 4URUR 1WBBA 2QBYA 2OLJA 1WE2A 2HUPA 1N0VC 3ICQB 4JL6A 3BH7A 1E9CA 2VEDA 2OAP1 5FUVA 1OPXA 2HYIC 1F60A 4DLSA 3EX7C 2O8EB 4D4JA 4LC1A 1NN1A 4G3XA 4H1VA 1LFDB 1Z6YA 2G77B 4H1UA 2A78A 4DB2A 2B8TA 4F38A 4ZDWA 5GVSA 1QZXA 1RIFA 1T5LA 4B3CA 1ZM2A 4R9UC 3SI7A 1YZLA 2WSSD 1XDBA 1QRAA 4WAUA 4Q9HA 1YVDA 4GRAA 4R71A 3TAUA 2A5DA 2BBTA 1N6HA 1U8ZA 1II8A 1Z0KA 2IYYA 2QPAA 2IUUA 1EFCA 2E1RA 3NKVA 1II9A 3K0CA 4ACAA 2IXGA 1BH2A 3TE6A 3PXGA 4IVQA 2WIAA 1X8LA 2YYZA 4L4UA 5JEDA 1Z63A 4PSVA 3G5UA 3AM1A 1KI7A 4XD7A 4W5WA 1FNNA 1T3LA 1ZIPA 2FZLA 1LS1A 2C04A 3A1WA 1CULC 4C0BA 4PC7A 521PA 1BYUA 1IY0A 1ESNA 1N5JA 1OYWA 2GETA 4Q19A 2XXAA 4MKIA 4EPYA 1QHXA 1G4UR 4LRWA 3LLMA 4TN1A 4ESHA 1U99A 1GKYA 2GK7A 1OH5A 1Q3HA 2IYZA 4M1KA 3A1UA 1KMQA 3O47A 1Q1QA 3K1JA 4ZKEA 2JDIA 2IEYA 4LV5B 4A0RA 4M1OA 2CE2X 1Q1EA 4X8MA 1W5SA 4L15A 4LHXA 5TMPA 2IS2A 4WZAE 1CBUA 1F3OA 2AFHE 2OCAA 3EA5A 1G5RA 1J7KA 5JHGB 2ASEA 2BC9A 3QI2A 2FU5C 2WOOA 3F8TA 4W7SA 4AYTA 3ZGXA 3KB2A 3IEUA 2H18A 4DB4A 1QVAA 4MKGA 2I1VB 2E87A 4I1SA 3KQLA 3SBDA 1WF3A 5DN6D 5L3SB 3T61A 2VF8A 4UXHA 4IOLA 5CDFE 2D06A 5LD2C 2C2HA 3T5DA 2H7VA 2WMNB 4DUGD 1S2MA 1R0YA 2BWJA 1N5LA 4I4LA 1FUKA 1TUEA 1OH7A 1KK3A 4PPNA 2IC5A 3FKSD 3NWJA 3T1OA 1KKMA 3U7GA 4TYYA 4GP7A 4B76A 3LVQE 3NBXX 4MITA 3DZ8A 1JR3D 2QTFA 3THWB 2ZRLA 4MH0R 1UF9A 4JLPA 1ZD8A 1M8PA 1QF9A 1E0KA 2BCJQ 4TLAA 2RKOA 5KU1A 3ZZUA 3CF6R 4YC7A 4IFBA 4JLBA 1LW7A 4BE7B 1U0JA 3L0SA 4JLKA 2YJTD 3BH0A 4A92A 2PT7A 4QBFA 3T1VA 1XXHB 4C0KA 5EE9A 1YZNA 1G5TA 4MYHA 3IBGA 4N0EA 5DHFA 3THWA 2VO1A 1AIPA 3SU8A 4PTLA 3GJ5A 4NCIA 4BFTA 1TQ2A 2I3BA 4I81A 4CEJB 2XJ9A 4O2RA 3R9IA 2DFNA 3VKHA 1S0UA 1IQPA 3GEHA 3B8HA 3B2EA 2BMFA 4ZPXA 1D2EA 3LBNA 4AY2A 4RCYA 2G88A 1W4CA 4HB3A 1Z0DA 5BN3A 2ZE6A 3ADBA 3SYNA 1CEEA 4C4PA 2CHVA 2NO9A 2CCJA 3ZLJA 2ZR0A 3V4RA 4IOJA 1A82A 5J4LA 1NBME 3CRQA 4PHGA 3L8YA 2C9CA 5SZJA 3X2SA 1AGRA 3BS4A 4EJSA 2DB3A 1K5GA 2VHUA 1RYHA 2FOLA 2OILA 5AWFC 1D2MA 4P4UA 4ERNA 3KB1A 1KSFX 4A6PA 1VTKA 1CF4A 4ESVA 1Z0IA 4ASUD 2IYQA 3IQWA 1IHUA 4GOKA 1XPUA 1G3RA 4K81B 3AVVA 2EWVA 1P9WA 2AFIE 1NMYA 3B1YA 2DHRA 4TYQA 4O2LA 2CVHA 1HYQA 3CLVA 1NVWQ 2V1XA 1ZUIA 3BAFA 2RGEA 2G6BA 3CUEF 1U2RA 2W6IA 2DWPA 4M9SA 3KTAA 2WTUA 1G7RA 3BB1A 1T4GA 2Z83A 3D8BA 4GP6A 2QNRA 4QC2A 4M9QA 1ZU4A 4MYUA 1FOEB 2JIZA 1Q20A 4P33A 5J47A 5JZVA 3KFXA 3O8DA 2J1LA 2WWGA 1TF2A 5AJVB 4A36A 1F6BA 4CGZA 2XAUA 2R9VA 3BIFA 3VHLB 1T0JB 2HYDA 2BBOA 1I2MA 1W44A 4QHYA 5DYGA 4B32A 1PJRA 3T12A 4TL6A 3HU1A 5FBLB 4YMWA 1PLKA 2CE7A 1JR6A 4PHHA 1PUIA 3RNLA 1II0A 4NE2A 4RD6A 1XTIA 2R6DA 2ZU0C 3LX5A 4TZ0A 2IXFA 3DO6A 3THXB 1FP6A 1P61B 5BXQC 1N6OA 5E3HA 4M9XA 3L8ZA 3KZ1E 3NBYC 3FVQA 3UG7A 4D82A 3BRWD 3AF3A 4QGGA 1H8ED 1U0HC 2CXXA 4B2IA 1IJFA 4UNRA 3QJYA 1KSGA 1Y63A 5GJCA 1ZVQA 2WSSA 3BFKA 2WHXA 1VPLA 2R2AA 4PO8A 5FTLA 2QMEA 1IXZA 4PX9A 1XX6A 3LFUA 1BIFA 1Z28A 1OYYA 2QT0A 4BFZA 4FCWA 3M6AA 2CLCX 1ZINA 1C1YA 1G7CA 3GFTA 5LB4A 4DLRA 2J0SA 4KO8A 5D3QA 1E9FA 3HDTA 1NVUQ 3KXIA 1JPJA 4Q9JA 5HZHA 3IILA 3PVSA 1XEXB 1ZJ6A 4IRUB 4KI0A 4IJMA 2YVUA 1NP6A 2IBMA 2ZU6A 4GMDA 4PZYA 3FGNA 3K09A 5CM9C 2ODNA 5A0FA 1VDZA 1TF5A 1QHHA 1F5NA 2OV2A 2KE5A 3LVRE 4Q4LA 5BYJA 4B6FA 3CZQA 4A1FA 4EPTA 2J7KA 2WIBA 2WJIA 3KKOA 4V02A 3U5ZB 3VR2A 3VR6A 1UPTA 5AJZA 4P4SB 3C4JA 1ZW6A 1MRSA 1R5NA 4HEJA 2IXEA 1W0JD 1X8KA 2R6AA 3LBIA 2ZRHA 2DWQA 1UBEA 1Z47A 4C3ZA 1L8QA 3AUXA 2REBA 1ZD1A 4RFSA 1KKLA 5G53C 2WWIA 1E2NA 5TARA 5LDDC 4BLOA 1S3GA 1X86B 2XTZA 3DMDA 4WZ6A 1RVDA 5C1BA 3EPHA 4PC2A 3I73A 4BFYA 2HT1A 4LHZA 5DN6A 3LBHA 4JBYA 3NH9A 4P4SA 4XOIA 2AHOA 4ZKDA 3V4FA 2NOAA 4BFSA 4DUGA 4BLTA 1TADA 1OXSC 2ZJ5A 4JLMA 4POAA 4RZUA 5FL3A 3FKSA 4P4TA 3WNCA 2QRNA 4D2IA 2ZE5A 5KSYA 2KI5A 4OKSA 1XBTA 1TQ4A 1JR3A 2NZ8A 3AP1A 3I32A 2Q6TA 1KDRA 2JASA 3IIJA 3LNCA 2HXSA 1ZM9A 3W9YA 3FHCB 1F2TB 5J4VA 4FMDB 3J81k 1Z8FA 3FFBA 1HH4A 2GDJA 2A5GA 1P2VA 2J0VA 2GNOA 2PEZA 1Z07A 3P27A 3LA6A 2ONKA 1BKDR 2ZRFA 3SR0A 3DL0A 4Z54A 1A1VA 4D4LA 1OIVA 2LKDA 3C7KA 3SJCA 3BORA 1WXQA 4FINA 1UADA 3GLGA 2F3TA 4LBYA 4A15A 1W46A 5EXSA 2CEAA 2O0KA 4PXAA 5GADl 2VA8A 2IS6A 3DM5A 1NSTA 2VP9A 1WA5A 2YV5A 1F2TA 1CR2A 1YJ5A 5GVRA 4FMCF 2Q0HA 1TEXA 1A5TA 3HP1A 3WYGA 2GCOA 5FI0B 2RCNA 1G7TA 1KZ7B 3ZD6A 3GEIA 2WJGA 4DT1A 1DS6A 2QA5A 4Q47A 4RZ3A 4A8JC 2IYRA 4ACBA 4TLDA 1S9DA 1NN5A 5JSZB 4KYUA 2O0JA 2WKQA 2IEZA 1E2MA 4A2WA 4EPRA 1OB5A 3CF2A 1W4AA 1Z22A 2HV8A 2IUTA 1PVOA 5FTKA 4TTPA 3M4YA 2QAGC 1GG2A 1BMFD 3TBKA 2VSXA 5FOWA 1AKEA 4DWJA 1DE0A 3LX8A 1GNQA 2QL6A 4JT2A 3LLUA 4HLDA 4QJ4A 3VR4A 1OT3A 4TYNA 4F91B 2F43A 4TLBA 2EFHB 3N5CA 1SKYB 2TMKA 4IXMA 4ASUA 3GPLA 2IYWA 3PJRA 2OT3B 2WV9A 1G1MA 4S35A 4BQSA 4BRUA 3CX7A 5JWRA 1XCPA 2LCFA 3WXMA 4KU4A 4BLPA 4NYIQ 2GXAA 4DLVA 5E7JA 4QNMA 4EPVA 4Z1MA 4D6PA 3A4MA 2V54A 5CJ2A 3B85A 5HCNA 1N6IA 4TL9A 4B34A 3TUJC 2I1QA 5JECA 1SVWA 4JKYA 4QGHA 5HE8A 2IYLD 3CKLA 4Q9IA 2VP2A 4FI3C 4LI0A 2EYQA 2V9PA 1T8TA 3FWYA 2WOJA 2XB4A 4DDTA 3BXZA 2R6CA 4NYJQ 5TB5A 1CR1A 4EAQA 1KDTA 1VG9B 2C03A 3BB3A 1RRFA 2XSZA 1YQTA 4D4KA 1W36C 1I4DD 3KFVA 3Q8XB 3SJBA 1E2HA 2ODBA 2EFCB 2WKPA 3PEYA 1NLYA 4MGIR 2ONJA 4A2PA 1P3JA 5EE5B 2AWNA 2PMKA 1MV5A 2QI9C 1IN8A 1S96A 2ZS9A 1E6CA 4GSYA 1R7RA 1Z0AA 3T15A 2W2XA 2XEXA 4ZI3A 3A37A 1XTJA 5J4HA 5JHHB 5F3WB 3CR7A 2OBMA 3G0HA 4MQBA 1AQYA 1KNQA 2QEQA 1W49A 2JAQA 3BFXA 3NG1A 2BEKA 1H8EA 1ZM3A 2HCBA 3RRYA 4EKDA 1J90A 3VR3A 3RSLA 5FPTA 5AJWA 4KSBA 4EPWA 4TMWA 3TR0A 1DBSA 1ZUHA 1F2UA 1HA3A 1HQYE 4AKIA 2C98A 1N0UA 4Q9LA 3SS8A 2PX0A 1Q3TA 3T5GA 4CYMA 2G83A 1WDTA 1GOTA 4HATA 4D26A 2GXUA 4DBLC 5IHPA 2GWHA 1SVMA 2YC2C 2SHKA 5H70A 4Q7LA 4QJ3A 5CYPA 1MT0A 1E94E 1PUJA 1NI3A 2W2VA 2ZRNA 1UEIA 3MJHA 4KLNA 1ZAKA 2GZHA 3PEVA 4Q1DA 2GTPA 2D7CA 4QGFA 5TVKA 2BOVA 3Q5DA 3U61B 4JBXA 1NKTA 1ZD9A 2CL0X 1GUAA 4Q00A 3GJ4A 3AVYA 4KAXA 2NPFA 3O8RA 2ORVA 3AVUA 2BVNA 1N5IA 1S8FA 2WWWA 3AB3A 4F4JA 3E70C 1FMLA 2W83A 3CH5A 3CONA 4PR0A 5IDVA 3BGWA 2GCNA 1Z2AA 3EC1A 6Q21A 3MWLA 3KKQA 5JCZA 1XB2A 1GL9B 2WWYA 2ZJAA 4PQRA 1P5ZB 4WXPA 3K0FA 2J7PD 2JLWA 4E09A 4YMSA 1YRBA 4Q4AB 5IK2D 4G5RA 2Y8EA 2Z0MA 5LD2B 3DMNA 1KOFA 3HWSA 4WOPA 1XEWY 2FPKA 1KJWA 2RGCA 3K0EA 4CEIB 2ZRJA 2YWFA 3GMTA 4QOSA 5KDLA 3SC3A 3IO5A 1LNZA 3CNNA 3UMFA 1G19A 4I1VA 5CB6A 1LV7A 4HB4A 3UK6A 3LD9A 4JS0A 4A4DA 2WZQA 3IO3A 2BHRA 2A3RA 4FWIB 1G6OA 2O8CB 3RWMB 1E32A 1E9DA 3VHXA 4LYHA 4R98A 3TJZA 3SN6A 3VMFA 4HLCA 1EFHA 3C5HA 3MSXA 3NHBA 4Q4AA 5IRCD 1JQJC 2ZJYA 1NN3A 2FFQA 2X77A 1Z0JA 4E22A 1KJZA 3BWDD 2J0UB 5FOXA 3KQNA 621PA 3KUDA 1H65A 4CEIA 1CTQA 3M0EA 1A4RA 4HLUC 4YDSA 3WYAA 1EX6A 2Q3FA 3HYTA 4FCVA 2R6FA 1IXSB 3GJ8A 4Q7MB 1P7CA 2WSMA 3W5JA 4BZPA 2FEMA 5HTKA 1YR7A 2W2TA 2ZPTX 4XJXA 1OXVA 1KO4A 3B1XA 3OIVA 2G0NA 1OKKD 4EQ6B 2QTHA 3IBYA 2CNWD 3SJAA 4B35A 3FMIA 4OQMA 4U7DA 4OHZA 2WMOB 3X1WA 1GTVA 3LO5A 2BV3A 2BKEA 4HDCA 1MO5A 4DCUA 4DEYA 2PLFA 1G5PA 2J0UA 4OQXA 4HDQB 3RYTC 3LQRA 4DCSA 2ATVA 1W4RA 2C9YA 2P5TB 1EK0A 4XWKA 4IXNA 4M8NE 3OIUA 1N25A 2AK2A 4LV8B 2V55B 1B23P 2JIZD 3JZMA 3T06B 4OJQA 4PC6A 2ATXA 4A0HA 2VRWA 4V0MA 4Z8YA 5CK5A 5DO9A 3RAPR 4DLUA 4Q1AA 4QG7A 2JLVA 1E79A 2HT6A 3WMFA 1WMSA 2VL7A 3A4NA 1VHTA 1CR4A 1RW4A 1ZNYA 2ZI6A 3GJXC 3FMFA 1BMFA 3L2OB 1PLLA 3FFAA 3K9NA 3W90A 1Q22A 4Q9KA 1ZC3A 4BFVA 1NG9A 1GNPA 4JBWA 2BMEA 4KYIB 3RRMA 3KQKA 3IIKA 4N0DA 5E4FA 1FNMA 1GWNA 1P2TA 2CL6X 4P3YA 4MGYR 3IKJA 3QVVA 3B60A 3E2IA 3C15C 3GFOA 2RHMA 1X6VA 4LWZA 4JKIA 1RRGA 4C2TA 3KL4A 3UMSA 4DIEA 3MWJA 5B30A 4WVFA 3NDPA 3FYHA 4LPKA 4AYXA 4ZIRB 1XZPA 2HJVA 3B6EA 5AUQA 5FOTA 2FE4A 3RS0A 3AEZA 4Q4HA 4B3XA 1RE0A 4B33A 1SXJC 1T6NA 2A5YB 3ND9A 2N1BA 4PSKA 2CCGA 4RD0A 2J45A 4URZR 5F2EA 2QROA 2OZEA 3W8RA 4DEXA 4BGDA 3GLFE 1KYIA 5HKKD 2YKGA 3DOFA 121PA 5EZ5A 2QAJA 1DTSA 1KI3A 3H2YA 2J41A 3I8SA 3U44B 3PV0A 4HYYA 2O8EA 3SE0A 1DAIA 1DARA 1VCNA 1Z6GA 3BC1A 1C4OA 3EZ6A 1KHTA 4ITRC 4ZIRA 1I4LD 3OF5A 4UQOA 1W0KD 4JVLA 5GJBA 3TGPA 2C5LA 3IGFA 4NKRA 4KBFA 1GITA 2QSZA 2RGNC 4A9AA 2ZE7A 4G01B 4B2PA 4I1UA 1XMJA 5DISB 2ZJZA 1VG1A 3QOFA 1JR3E 1QHNA 3PIRA 2F1HA 4Q66C 5HCIA 3U44A 2RH5A 4FXPA 3CRRA 2O8DB 1RFLA 4RD3A 1D9ZA 2LKCA 1IY2A 1OV4A 1T3HA 3PCRB 1Z06A 4RVCA 2IWHA 1Q0UA 2BMDA 5HZKA 2GA8A 4MYTA 3TNFA 3VX3A 5GJVC 3UANA 4JVMA 1AM4D 1NL3A 2QZ4A 2W0SA 5KDOA 2Z6VA 5FI1B 1O87A 2VHTA 3GLGE 1XD9A 4L9WA 1T8UA 4UKDA 3C14C 5FBWB 2VHQA 3OE7D 1YR8A 1G8HA 3TRFA 2ZRKA 1GDDA 1O3YA 1UAAA 2IL1A 3UXMA 2P65A 2J87A 4CT4B 4N3NA 3ZH9B 3VKGA 2AXPA 2BBWA 1ETUA 2QMHA 3BB4A 2W00A 2D4HA 1TU4A 2A9KA 1IJEA 3IPXA 5FPSA 5EE0A 4MUBA 2WWFA 1KI1A 4TT3D 2ZSEA 4FMBB 1AN0A 1T0HB 2JA1A 3KXKA 3IUYA 4HZUB 3MRSA 3VX4A 1KSHA 4GZMA 1W1WA 4QXAA 3KJGA 3C41J 4M0LA 2IX3A 2UVQA 3PEUA 4M1MA 4FN5A 5KDDA 5J4YA 2H8KA 1CP2A 3PUYA 4NTZA 1NJGA 1U98A 4P32A 4AIIA 3BERA 5BN5A 4TWZA 2AWOA 3NHAA 2ZR7A 4D80A 4L9SA 3ND8A 2DFKB 1KO1A 4DLTA 2YINC 4QRHA 4DRZA 2OAQ1 2OXRA 2J0QA 2VPPA 2WWXA 4HZUA 5FBVB 2J7PA 2Q3HA 1E2PA 2GBLC 1DO0A 2AXNA 5IK2A 3W34A 3LXXA 2G1KA 3FMPB 5K8IA 1IN4A 8OHMA 421PA 1VCIA 2QT1A 2CDNA 2ZYTX 4P0TA 3PQCA 1CJTC 3GLHB 1XXHA 1MO4A 2XITA 2P67A 5FPYA 3X1YA 4D25A 3K70C 3PFIA 2H57A 3GJ7A 3EZ7A 1AS3A 1ZCAA 3QPWA 3ASYA 4CEJA 1IN7A 2J3EA 2YWHA 3N2EA 3NXSA 2ZYVX 1VYVA 3THOA 4N1AA 1KSJA 1TU3A 4OHYA 1XRJA 2ZI9A 3GCGA 3SZRA 1N6NA 5EQTA 3GLHA 2D7DA 2XZPA 2ZRIA 1SHKA 4OHWA 2CHGA 2JJ2D 1G3IA 2FGJA 1OIWA 3CPJB 4OHXA 1GL6A 1HT1E 4WIAA 1S1MA 4B3BA 4OYHA 1OKKA 1YZGA 4Q4JB 2CNWA 4Z1MD 1A7JA 2VSOA 5F9FA 1PZNA 1UEJA 4F4IA 1N6RA 1NIPA 4OL0A 5E95A 5JWHA 1Q1ZA 2P2LA 4TL8A 1MKYA 2EFEB 2GZAA 2REXB 4U00A 3Q7QA 1TAGA 1SXJE 2AL7A 4CZ2A 2IYVA 3SEAA 1EWRA 1KZGB 2QGZA 3B13B 3TK1A 3IDQA 5L3QB 3GD7A 1S3SA 1XMSA 5LB2A 4PO9A 4AYWA 2RMKA 3EW9A 3LDAA 2XSZD 2L0XA 2PJZA 1E2LA 4GT1A 4JSTA 3I92A 2GILA 2X8AA 3I1FA 4Q4JA 1LVGA 4QKQA 3WNBA 3QF4B 4LY6A 1JJ7A 3K0CC 4HAXA 3RVBA 1IN6A 721PA 2P6NA 1YR9A 4TYPA 2BCGY 3AKDA 2XGJA 3R9XA 3EIHA 1CJKC 2J59A 2EFDB 4PPGA 3U7EB 5L3QA 4UNNA 2P3SA 3DDCA 4BEJA 2ZUBA 4AG6A 4F7WA 2V6JA 1E98A 3D31A 4MRNA 1NBMD 4C9BA 2F1IA 3GFPA 4ZCIA 3I72A 2MSEB 2PLRA 1UM8A 2AD5A 3QF4A 5CM8B 2VTKA 2XNDD 4I99A 4IVRA 4WXRA 4QBIA 2ZRDA 4NH0A 1V5WA 1DEKA 2WAYA 4GNKA 4IKEA 4BLRA 2ZSFA 5CLQA 3CX8A 1G18A 3LRPA 5AJYA 2IW3A 1SULA 3CO5A 1IONA 5A5GA 1D6JA 3KKMA 4LYJA 3T1QA 4OI0A 1R6BX 3THYB 5KYKA 1QHIA 3EARA 3O8BA 3BE4A 4A0FA 2JLZA 3THXA 4MKHA 3GLIB 2J46A 1RRPA 4NPHA 5HKKA 1FTNA 3ZZ0A 1QHYA 1ZIOA 2J9RA 2V8OA 3UIEA 5HR5A 2ERXA 2GK6A 1ZMXA 2XJ4A 2KBFA 1DADA 4AKEA 3AVPA 1UKZA 3FHOA 2I4IA 2QM8A 1MO3A 1W0KA 3NEJA 4RD1A 5E7IA 5FUWA 3K9HA 3S1AB 1FMJA 5L8VA 4IW3B 4PZZA 3ZS8A 5CITA 4FCTA 4NYMR 3THYA 1SVIA 2ZUDA 1WBDA 1GIAA 4JLNA 4YONB 4AWXA 2JLUA 4X8HA 3GLIA 3R8CA 4MGZR 5AUNB 1P75A 3MWYW 3AF2A 3DOEA 3WY9A 3L0OA 1D9XA 1OB2A 4LJ5A 3A58B 1ZC4A 3E1SA 3AV0B 4OBEA 3SFZA 2IS1A 2RB4A 1J2JA 4URWR 3ZYCA 1JXMA 2BEJA 3FE2A 3MG9A 4G5QA 2DR3A 5DYIA 1FQJA 1S9HA 5BYKA 1DG1G 1XEXA 4EFMA 3FTQA 2W58A 3GLFB 3QUSA 2FA9A 4CVNA 3DKVA 3ZD7A 2PL3A 2QY9A 4UJ5A 4HAVA 3OE7A 3OIYA 4ZO4A 1ESMA 2QUZA 1U9IA 1YZUA 2A2ZA 3FOZA 1TQDA 1CKEA 2PZEA 4M4SA 1MABB 4NDZA 4QHTA 1DELA 3RDPA 3W6OA 5JJKA 1WQ1R 2QPOA 4II7A 3EPKA 1KDPA 1QVRA 1US8B 3SOPA 3WHKA 3DEFA 4D0GA 5JS7A 2A5JA 3AVXA 4DVGA 1SVKA 3DM9B 3KJIA 2FWRA 2IWRA 4L8GA 3GQBA 4V0ME 1AA9A 2ZQ5A 3ZIAA 4DSTA 3K9LA 2JLYA 1W2HA 4NYMQ 1X8JA 1EFTA 2GEUA 4IDPA 3UMRA 1TL7C 3DPUA 1KMHB 3HU2A 2MMGA 2FX3A 4TT3A 2O8BB 3K9GA 1J99A 4HAYA 2VH5R 4GOXA 4BLSA 1E0AA 1QG4A 1CS4C 3U4QB 2ZUCA 3FPAA 1XJQA 2OUKA 3KQHA 1US8A 2VIIA 4WBSA 4EJSC 5C4MA 1VIYA 1YZQA 3CB4A 3FKQA 4PPFA 1VG0B 2MMCA 4MRVA 4AD8A 1P6XA 4O3MA 1UKYA 2ZJ8A 4O25A 4JL8A 5TDHA 1E2DA 2BJVA 4S2EA 1KMHA 2O8BA 4LK2A 1XNJA 4PAQA 3SDZA 1OFTA 2GEVA 1GRQA 3QG1A 3DZDA 3U4QA 2Q9AA 3AVTA 4IDOA 2H1LA 3CIOA 4NHOA 2QMUA 2X2FA 4IVPA 4MGKR 4ARZB 4B44A 2WWHA 1Y3AA 4BFUA 4QJ5A 5C4GB 1E69A 1GKUB 3RS4A 4LZZA 5FPKA 1EFRD 5DLQC 2BM1A 1E79D 4DCTA 2BIFA 1JALA 2JLRA 1Z83A 4PQFA 1M7HA 5FL7A 3N70A 2WJVA 5KTYA 2ZRGA 3EXAA 4Q5IA 1FX0B 3U2QA 2JJ1D 5CDFA 5TY0A 5JI3E 4NU0A 1LF5A 1RPZA 4FMCB 1P9RA 5EUQB 1SVLA 2ZAMA 4FD2A 1V43A 2VHCA 4ARZA 1S4QA 3DHWC 5CYOA 1XJCA 2XZLA 4EUNA 4B3DA 1C9KA 4MRPA 3MGCA 1X1SA 2JJ2A 4HB2A 5JSZA 2OG2A 4ON9A 3MUFA 3E5HA 2B7BA 3U60B 1DG3A 1HQCA 1GSIA 2W6JD 3EWSA 4LJ7A 4R2HA 1MH1A 1TQ6A 3I61A 1FX0A 5EXPA 5JRJA 1VCMA 4DSOA 4B74A 2OESA 1IAQA 1R4AA 4PANA 1KI6B 2DFLA 5FUXA 3TKLA 1L4YA 1JBKA 4RCZA 1QHSA 4IHQA 1FW6A 1JECA 5FTNA 1U0LA 2OM2A 2YNMA 4B47A 1CIPA 2VP5A 4LJ4A 2ZETA 4Q7KA 3VFDA 1JAIA 3TIFA 4Q18A 1N6LA 1EG7A 2VSFA 3AVQA 3EZFA 3T1TA 3B1ZA 4XWAA 1KI6A 4KFTA 1NNEA 4XTCS 2B8WA 1M7GA 2KJQA 4C2UA 2EVWX 3H84A 4IDHA 5JLJA 4OJKA 2F9MA 3BOSA 2C77A 2ZS7A 1NJFA 3ZJYA 2CJWB 4HDOB 2IS4A 1M1YE 1JAHA 3OIWA 1KI8A 5KUTA 3K09C 1NBMA 2GVDC 4M1TA 4TSFD 2JGNA 4HAUA 3FHTA 1CU1A 3B7GA 1N3BA 1NF3A 1OFUX 2XNDA 4YDHB 1ANKA 5E7MA 5FTJA 2RGXA 1YZKA 1IN5A 3AKEA 1D5CA 2HJGA 2YOGA 5FR2A 1L7VC 2ZI4A 1NLFA 2WKRA 5FOSA 1DO2A 5DSZA 3WRXC 1E99A 2D3WA 2WPDD 4LBVA 2CJWA 2FSIA 1UBGA 2HLDD 4I1OA 1KAGA 1Z3IX 2K5UA 3CNOA 4TQUS 1ZYUA 3QBVA 3VR1A 4D0NA 1SZPA 2GF0A 1UJ2A 2P6RA 1GVNB 2ORIA 2ZREA 5K8TA 1Z6AA 5JFGA 1HY3A 1L4UA 3QBTA 2QENA 4NBSA 5HPYB 1ZRHA 1NVVR 2ZI7A 4QBHA 4TL7A 4PC3A 5J40A 3X1ZA 4CEHB 3HU3A 5A4JA 1XXHE 1E4YA 3Q9LA 4CIDA 3QEOA 4KFUA 4EDHA 3C8UA 4BZQA 5DI9A 4W9MC 2REOA 3X1DA 3RRNA 4HAWA 4RKEA 2WJHA 3TUZC 4UJ3A 2GXQA 2UZIR 5HE9A 4FIDA 2NO1A 4F93B 3K0AB 1ZBDA 4DLWA 2DWOA 821PA 2WM9B 4NP6A 5LBIA 2DBYA 3CNLA 3ADCA 2RGBA 1U8YA 4JJZA 3CH4B 3QKRB 4D0LB 1KAOA 3CW2A 3QEJA 1NSFA 4KV9A 4CEHA 1EGAA 4HUQB 1N0WA 5KNDA 4C0HA 1J8MF 1BOFA 1G8YA 1UDXA 2IUSA 2IK8A 3QPVA 4LGMA 4MUAA 3LAWA 4UNQA 3X1XA 2MSDB 1KTVA 1HTWA 5EUMA 4C7OB 1CJMA 2WVJA 3Q5EA 2ECKA 4LHVA 4OQLA 1KK1A 1T5IA 2R62A 4X8OA 4QBGB 1OSNA 3EA0A 3CZPA 5JJLA 3ASZA 3CX6A 3EC2A 1GZSA 4B71A 4XIGS 2GJSA 4Z8XA 4YXWA 5EJEA 3ZQJA 1DAKA 3QKRA 1UDWA 1T9HA 3ZZTA 4DDUA 2PCLA 4HUQA 3HR7A 5DE3A 3SQXA 1NRJB 5FFMA 2GAAA 4C7OA 4HB0A 3B9PA 1XTKA 4V0LA 1E1RD 5C46F 4BRWA 4PQYA 1RRCA 2FEOA 2HF9A 4DDVA 5EE1A 1R8SA 4L16A 3AVOA 1DAGA 1I2DA 2BJWA 4HAZA 3SHFA 2ZSAA 3VTKA 4TMZA 5CJPA 5FTMA 2FFBA 5M04A 1TMKA 3SQWA 2YOFA 2P6UA 1P62B 3QNUA 5AUOB 2ZJ2A 1U90A 2GESA 3RC8A 1D8TA 1Z2CA 1QHGA 5JCPA 1FTSA 2F1RA 5FBRB 1NY6A 3ZS9A 3CRMA 2O8CA 2VYFA 2IHBA 2GAOA 2H17A 3A8TA 3NC0C 1VKJA 1ZNZA 3KJHA 3B9QA 1G17A 1E9RA 1CR0A 5KNBA 1CRPA 3R20A 1DAMA 1T3SA 1TX4B 4JLVA 2QQEA 1R0ZA 2ZIAA 4E5UA 4NCKA 4IOMA 3RHFA 3QKSB 2IYXA 3B5JA 3QENA 3PUWA 2QP4A 3GJ6A 2NO6A 4BASA 3HPQA 2F9LA 3BH6A 3QXSA 4EQ6A 1EFRA 3KJEA 4C30A 1RYFA 3QXCA 4B3FX 4KODA 2QTVB 3I5XA 2B7CA 2QU8A 1U81A 2FNAA 4YMVA 4F4CA 3QIAA 4OK3A 4M22A 2IYTA 2JJ1A 5FBQB 3WMGA 1CRQA 3ZVMA 1OJLA 2FG5A 4BUJA 3SJZA 3QKSA 3WRYC 5AK0A 2JATA 2YOHA 1VECA 2D2EA 3L0PA 4US0R 1E4VA 3MD0A 3G82C 2QORA 1SHZA 1YZTA 2YWEA 2VBCA 3CM0A 1QDEA 4IDNA 3LQQA 4OK5A 2GZDA 3MMPA 4TQAA 4XSHA 3U3OA 3R7WB 2W6JA 4B75A 2BKUA 2OBNA 1GKIA 3N2IA 4IEEA 2FPMA 1KNXA 3CWZA 3WYFA 5FH9A 2IYSA 1G9XA 3K8YA 1Z5ZA 5EZ6B 2YHSA 4U02A 2G9NA 3PITA 2B92A 1J70A 4NMMA 3WBJA 4B43A 4C0QC 1XPOA 3QKTA 1ZM4A 1CLUA 4GBMA 3VU9B 3D7MA 4JT4A 1R8QA 5EXTA 1II8B 3R8FA 1SVOA 4Q1EA 4GMXA 4PC1A 2RAPA 3R7WA 4Q03A 1HURA 1COWD 3FMOB 3NC1C 4XSGA 3RS5A 3TSZA 1E9BA 3VKWA 1JXOA 2QRZA 2Z4RA 4UNPA 4KITB 1G3QA 2AD1A 4L5BA 2XXAB 4LCBA 3MLEA 1YKSA 1DAEA 3TMKA 2HDNB 4MA4A 1HEIA 2IF2A 2ZVPX 2RGAA 5AR1A 4LJ6A 3K53A 1D2NA 1KO5A 1OFIA 3QSYA 1XD2B 2OFOA 1HT2E 1G16A 3VU9A 1W36D 4TYWA 3GJ3A 1G41A 4CDGA 1G6HA 4DKXA 4JJKA 1ZM7A 4LJAA 4NZYA 3JZAA 2ZRCA 5EXXA 4TSFA 2HEIA 3L82B 4US1R 3FB4A 3HJNA 2CK3D 1EWQA 5DHAA 2PZGA 1WCV1 3H86A 2ODWA 4WA7A 3V9PA 2JJ8A 2OCPA 3RABA 1A2BA 1KI4A 1GNRA 2N42A 2O52A 4DSNA 4YMUA 4IFEA 1AJEA 4TMVA 1L2TA 1NLZA 4LOAA 2DFTA 2WPDA 4QGAA 1XD2A 5H68A 2W0MA 2IYUA 1G64A 5TXGA 1DAFA 4V0KA 3BD9A 4OI4A 2HLDA 2JEOA 4TTQA 2O8DA 4E07A 3U6BA 4HLQB 2KB0A 4KFSA 4M53A 2F3RA 3WHLA 3EPLA 1CJVC 1MOZA 2A30A 4LSGA 1OXXK 5KSOA 3ADDA 3TW4A 5AUPB 3ZIAD 3OFND 4W5HA 2Z5FA 1LB1B 1RJ9B 3REFA 5FPHA 5ANRB 1YE8A 3QVUA 1G20E 1M2OB 1F48A 2QGNA 5EP1A 1E1QD 3UKDA 2FSGA 1Q21A 2KWIA 1BO6A 2V7QD 3AQ4A 3CBQA 3H1TA 1R0WA 2RGGA 3HR8A 3NIBA 4TTRA 4MKFA 3W5IA 2QQ0A 3QY0A 5KPJA 3IHWA 1R2QA 2Q3MA 3U3MA 3A6PC 2FN4A 1ZNWA 4M2LA 2D2FA 5SZKB 3OZXA 2WJJA 1BYIA 4F92B 1FZQA 1RJ9A 4TQ9A 1CJUC 2OO7A 1SGWA 2C95A 2NZJA 4AK9A 1JEEA 5G40A 4JIMA 5DGXA 3VAAA 2CHQA 3U3JA 4LHYA 3LV8A 2A5FA 5FOUA 3UPUA 2EWWA 1AZSC 4XH9B 1E2JA 2O5VA 2AK3A 4TLCA 1XEWX 2H92A 2NO0A 4JMPA 3W6PA 2C78A 5FR1A 4KXFB 4DZZA 1E2IA 4Z51A 1P4SA 2FFAA 3EASA 3EIQA 3H4MA 2PH1A 3RLFA 1KY2A 2IA5A 4DIDA 1M34E 2NQ2C 3PUXA 4JSYA 1SKYE 3WP0A 5KOYA 3PG5A 2O8FB 1HUQA 1N6PA 2OHFA 4TMKA 1TF7A 5FL7D 4KVGA 4WW0A 1Z6XA 1E1RA 1OXUA 1G4AE 1IY1A 1E2FA 1YRAA 1I4TD 1VYTA 3AF4A 5JI2E 3RS7A 3U6KA 5IT5A 2QPTA 2YZ2A 2F6RA 2F1JA 4EJSB 1OHHD 1RC8A 1OXTA 1ZUNB 4Q02A 2G0TA 1OH6A 4RJLA 4EFNA 3OEED 2Q9BA 4V03A 5J5CA 5KPDA 2V1UA 3V00A 4ZCLA 2RHDA 2O8FA 4B3GA 1N2CE 4A82A 3NBZC 1Q1BA 1E0JA 1OFHA 2Q9CA 4KLZA 1OLOA 2X19A 3GJ0A 4R2IA 3C16C 1TPZA 1GILA 3O8CA 4MYCA 4BFWA 2ZTSA 1G8GA 1HV8A 1GRRA 1ODFA 3KTAB 1JI0A 4IOKA 1R5BA 2H16A 3P32A 5EP4A 1XFAA 1M6NA 5EP2A 1X1RA 3AKYA 1J8YF 4Q1FA 2GJ8A 4A8JB 5KSZA 1JEDA 2ZEJA 3KKPA 3LW7A 2NGRA 2X1VA 3T35A 3TUIC 1CXZA 1G3UA 2F55A 3ZVLA 2KSQA 2FJUA 4A0GA 3LWNA 3PUZA 2YC4C 2QAGB 3PUVA 3WBKA 2ZS8A 4URXR 1E96A 1OF1A 2CMKA 1AGPA 4JVNA 3D6TB 1FQKA 1YHNA 1Z08A 2NO7A 3AP3A 3P4YA 1XCMA 4OQFA 1W7AA 2A7QA 2VP4A 1A2KC 3U3RA 4A8JA 3UWOA 2PMDA 4V0NA 4MDEA 3OAAD 4OK6A 3QQ5A 3B78A 5J4KA 2QAGA 3Q7PA 1XZQA 2HCJB 1E9SA
chains in the Genus database with same CATH superfamily
5G2OA 1WWKA 1X80B 3DZFA 2W9XA 5FWXA 3NVKI 3L7IA 2XWSA 2J6IA 2RKWA 3UJAA 3VVBA 4QNRA 4LBWA 4KR9A 3L0IB 4X1YB 3LHIA 2DERA 3CRZA 4LHWA 3TCXB 4GLJA 4N3BA 1PR2A 3G49A 5B1IA 2CFCA 4KAJA 2Z5LA 3U7IA 3OD5A 3AF0A 4X7MA 3NUQA 3QHQA 3B6IA 3G5LA 3S99A 1QTQA 1A27A 2C5FA 2H5EA 2FWAA 2Z6AA 1TO6A 1GTJ1 1R5JA 4J6EA 2FAXA 5KOJB 5LKRA 1Q7RA 4LJ9A 5B64A 1IUOA 1BVRA 5C1OA 3FUTA 3MPUA 5BR8B 4MX8A 4QXRA 1SXJD 2AOXA 1P1HA 3DXXA 1JAYA 5JSYA 2OOKA 4M8SA 1C1HA 4MARA 3ZZNA 2IZ7A 3I4LA 3KLBA 3KUCA 1K3UB 1W48A 3OOJA 2AVNA 2DCUA 2DYKA 1EVIA 4KH0A 4A8TA 6YASA 2UKDA 2ZT6A 1R37A 3GRVA 3QUCA 3ISVA 4WJKB 4XVQA 3Q8MA 3G2QA 4E21A 2ZITA 1E5LA 1TZKA 1UDCA 2Y1FA 2WICA 2FFHA 1YIOA 3D54D 4OI1A 4E70A 1QM5A 4ILEA 4DJAA 3QELA 2WPNA 1J8VA 2LTAA 3EAGA 1UBUS 1XRSB 2C9OA 2VT7A 1M6VA 4EM6A 3K0HA 2NG1A 3IA7A 3VO1A 3H7AA 1RT9A 1HDOA 1VE7A 2C2WA 2NTVA 2QTZA 1Q3KA 1WPRA 1P0MA 4M21A 4BE7B 4DLXA 5HW0A 2GYUA 1R8JA 4KVAA 4UUMA 4UZEA 5ENVA 4FWTA 1RWOA 2NXEA 3A1TA 5I7WA 5EKTA 1GZ3A 1ZK4A 3BGOS 1OCEA 1UKVY 2Z8YM 4B31A 4P3PA 1N7GA 3E8XA 1H2HA 3KZNA 1IG3A 2H00A 3O2JA 4OHRA 4Q7EA 1O9HA 3B38A 3WNDA 3LY5A 1JX6A 1U8FO 4M9ZA 1GT91 4H9GA 4MR9B 2FDCA 2J3JA 1E2QA 3GNQA 4RY2A 4Y0AA 1Q0PA 5KTKA 4L5YA 1N4AA 4C4XA 4AZ3B 4UNIA 4LY3A 3GPCA 4BNUA 5C35A 3KQUA 3KXLA 4GUAA 1WQ3A 2FGKA 3TD2A 3Q85A 1UBCA 4KDRA 4RL6A 3AM5A 3OFNA 4EHBA 1UK6A 4XI9A 2BEUB 2R1TB 2X8LA 5TV2A 4BS9A 5IVPA 4KR0A 1XYVA 4CNBA 4XPIB 1TD9A 2E6KA 3NLLA 4GE0A 4NOMA 1C0KA 5HGXA 1KI9A 2YV2A 1Z4MA 2XOKD 2OLKA 1E1QA 4RV5A 2EKPA 3GY0A 4YCDA 2WVGA 1MABA 1M1ZA 4HPJB 3PB3A 4HGNA 3UGKA 3JAMA 2XB9A 1PJZA 1JB9A 2ACEA 3QYAA 3AIOA 3T34A 2ZPAA 3RKSA 1XDZA 2QUJA 4HO1X 4BAUA 4YRMA 5C2JB 5A3SA 3OZWA 2V3CC 2X3FA 5JVDF 1UPCA 4MCJA 3ADKA 3LDGA 1NMZA 1WCWA 4D43A 1OASA 3I64A 3IT0A 2QL9A 3D4IA 5LWQA 1WDWB 2Y1OA 3HCOA 3IR7A 1YE5A 4AO6A 1BA3A 3A36A 2R8ZA 3PRKE 3SNHA 1H6AA 1WUKS 5FUYA 2EW2A 4DLYA 2ANBA 4JLJA 1EFUA 4Q21A 1N2JA 1N33B 2C7GA 1U2SA 3FCCA 3PI6A 3ONWA 2BM0A 5H81A 3WIUA 3INRA 2X9GA 3S5UA 4J0QA 5CNMA 1GAEO 1WD5A 4OLHA 4GUDA 3EAQA 4LUCA 4PG4A 2XMSA 5ERXA 1LSJA 5CT8A 2G40A 2IF0A 1T9AA 3OQHA 5C7LO 1IBLB 2ZYIA 2V6FA 4I0WB 1JYEA 1LVHA 2Q5OA 1FTGA 1G8PA 2XGGA 2FLWA 2J3DA 4CR8A 3FNQA 4LWQA 1EINA 3WGYA 4DSZA 3GGDA 1EQ2A 1PK7A 2AKAB 3DPIA 1EJ6A 4YRJA 3NONA 5KCMA 4AQ7A 3GMDA 2YR0A 1L4MA 2GRJA 3BE8A 3OKCA 5D1NA 5DTEA 2X1MA 2B0CA 3KQPA 4WESA 3KYCB 2X0KA 5GJWC 4KXXA 2A67A 1JF8A 4ZVRA 2AI1A 2DLDA 3HM9A 4P7KA 3CUWA 3TLGA 3TX6A 1AA6A 1TNDA 4NG5A 3IQDB 2C29D 2HSWA 4NEHB 4UE3S 2C3YA 5TRTA 2ZSIA 4I5IA 1JNYA 2X6QA 4Q7JB 2EKBA 4UXIA 5T3UA 1CZKA 2YICA 1UBLS 4GM0A 2X0DA 4KRGA 1X7ZB 1JMKC 2ZI5A 5IJAA 3TDKA 3GLFA 1WSDA 3T3OA 2DLNA 2VK2A 3IL2A 4ND1A 1FYWA 1OW3B 1ZSVA 4RVSA 4PZAA 2TMDA 3D6VA 2DR0A 4TKUB 2Q1YA 2CCKA 2I87A 2Y1EA 1FRFS 2GF9A 2JEZA 3E35A 4RFVA 1U94A 3WLFA 3RG8A 4RVUA 1F20A 1EAMA 4ALJA 2D62A 3E5RA 3IXMA 4XWTA 3OIDA 4IUCS 5SYMA 2AW5A 2KW5A 3SP1A 4B4WA 4E2ZA 5BWCA 4DILA 4GBGA 5AVUA 1JQLB 4DC9A 2G7MC 2JANA 2AZTA 1DTEA 1BWQA 1ECGA 2FPXA 1I1OA 1A98A 1HDGO 2AJCA 3RARA 2PUBA 2EQBA 3A1SA 4I9FA 1IB0A 4DIOA 2QN6A 4H4EA 3ZWVA 1JYFA 4BPRA 1IBMB 2R6ZA 4S1TA 1PZHA 2BAGA 1T9GR 1L4BA 4RQTA 4YV7A 4NH4A 1OFUA 2FCAA 2PX3A 1EUCA 1VMAA 3FHLA 2BW0A 2QLBA 4RGBA 4X0EA 1GPMA 1N1DA 4R2WA 1NM5A 3RRZA 4ZV4A 1UFQA 4OHVA 3OCUA 3LBAA 3T7EA 2H1IA 3K9QO 2PKCA 2XVAA 5KVQA 4RTMA 4RDHA 2WBLC 3EGOA 1NVEA 4XX1A 4ZARA 1YDHA 5GONF 5U4XA 4IHKA 1YJCA 1DAHA 4NV3A 2VPZA 4CODB 1SCIA 2OFXA 3V2UA 2BEVA 4QFMA 1YCGA 5E4JA 3C97A 3GU3A 3SIXA 4N40A 3LQ1A 3H16A 1IBRA 1KO8A 3PXUA 4TLEA 5HVNA 3CJRA 2X2PA 1DPFA 3HUTA 2WKSA 1DCFA 4HN2A 2AVDA 4WKNA 4LMBA 4XD7D 4CG1A 4EEKA 1JJFA 3AUYA 1AF4A 4LV6A 3UJHA 3FPEA 4P86A 5D6OA 3G7SA 3HGTA 1QC5A 3K05A 2VOJA 4KC0A 5AJXA 1EB8A 4ZU1X 4KXWA 2ANCA 1R1DA 1OH8A 1KBOA 3CB2A 5DM1A 2INGX 2CV2A 2VDLB 2G8NA 2F4VB 1V8FA 1SCAA 1W5AA 3VZRA 4TS4A 2CZGA 3MCAA 1HRKA 1IM2A 3WOVA 2JDID 1F2UB 2QLMA 3FDIA 4IIHA 1U8AA 2VOEA 4PPQA 2ZJBA 1P72A 4HI0E 2XYVA 1A7UA 1BDJA 3MM4A 4TYMA 5ALUA 3O3OB 5EYPA 4ZDJA 2EKLA 1TIPA 3EFEA 4ZO8A 4J0HA 4MDFA 4XZ3A 4G5SA 5A1TA 3KU4A 4KE8A 4BNHA 1SXJA 4CM4B 4UBLA 3MT8A 1BFDA 3C8MA 4PYRA 4NMXB 1TB4A 2ZBGA 2C8KA 3DBOB 3B8EA 3IAUA 4G9EA 5EJMA 1R4NB 3W4IA 5HM6A 4F9EA 2ZRAA 1DX6A 2XB6A 4PAWA 1R10A 1JFLA 5IPFA 4AKGA 2J9FA 1Z2DA 3LKBA 5ILGA 3CPEA 4EMBA 1JN0A 1NULA 3HXOA 3JU3A 3M1AA 2X7JA 2FEAA 4ZOCA 1E3WA 1Z0UA 3B9RA 3PQEA 3PLAE 4BZXA 2I71A 1TMOA 5ADWA 4ALLA 1K8RA 1NIJA 1NONA 1NVGA 2FN9A 2X3YA 4IEFB 2QUIA 4HPWA 4JLOA 3REGA 2A1TR 3H5WA 1FJ2A 4JVSB 3E8SA 4Y6PA 1DOAA 1HT0A 1U1GA 4JK3A 3BFVA 3GLHE 3COPA 5ALOA 5CYFA 4BEBA 3ABQB 3IVMA 5NULA 3VQTA 4PFSA 4CI9A 5D51S 1ZL0A 3HS3A 4F8YA 1ZXXA 3TL6A 1MZPA 2GBGA 3MLBA 4MLDA 3V8PA 2VCHA 1VRWA 1WUTA 4YLGA 2JH8A 4OFXA 3E3MA 4Q6BA 4TV9F 1DRWA 3B82A 4KHZA 2RGDA 3TW8A 2CHFA 1FXWA 4RF4A 1ELOA 2ZTMA 2D7JA 3EZNA 3HCPA 2NX2A 3K35A 4G5OA 4GECA 4XIJA 2IHKA 3TIIA 5L4NA 3KT6A 1EM6A 3OPNA 4EENA 5CIQA 3VVCA 3AG5A 3HZZA 5BV2P 4HFMA 5I5GA 4RM2A 4B48A 1Z5PA 3KAJA 2BGWA 4B6EA 2AJLI 3EUAA 5TQ0B 2BI8A 5EJ9A 1RQ7A 4NQRA 4R7ZA 4FE4A 2O3SA 5JO9A 1K8YB 1KVTA 1NQAO 1W8IA 4P3KA 4ZZ0A 4DTIA 1L4LA 2F8SA 1IE3A 3UMMA 3Q72A 3FOEC 3UV6A 4OJTA 3KEGA 3BG5A 3OESA 3UN1A 1IXRC 1Z33A 3GAAA 3KDSE 4KXLA 4MVJM 4CQMD 2XOKA 4FYYA 5COQA 2ZRMA 3KZKA 4WCDA 1XWIA 1Y9EA 2HB6A 3BMOB 4HWRA 1PHPA 4E03A 1TM3E 2JJMA 3Q40A 4CLXA 3FUWA 2X5XA 2ACWA 2WM2A 5KYNA 1MJFA 5HKBA 3GFVA 5K6RA 2FZ4A 4NCJA 3RTBA 1IB6A 5D85A 4FDMA 3D8NA 3T5CA 5HQTA 2AH5A 3AHDA 1RXIA 2O20A 4RZ2A 5G3ZA 4F5YA 4F4UA 4GS5A 4JDUA 1YC2A 1RQXA 1XZ8A 3OQBA 4Z7NB 5LMUB 4PHTA 3RYFB 1GG8A 1RQLA 4X63A 5DWDA 3OT5A 4JYZA 3MHPA 1ZP6A 3QUBA 1LQUA 2Q27A 5F98A 1Y8QB 4P82A 2Q7DA 2WLTA 3IRVA 3JVVA 1P9OA 5L3RA 4G23A 1GRNA 2VHJA 1C7JA 3EEYA 2HX1A 1P19A 5ETJA 2GHIA 3WJAA 2LP4Y 5UKDA 2P0EA 4KXYA 4MWOA 5ENZA 1ZK3A 2ZATA 3QLUC 4AUMA 2OCYC 3RANA 3U1VA 3A4YA 5A9TA 3ZE6A 2FSHA 1KK0A 2GBLA 1EVZA 4R31A 3HI4A 2PUCA 3MFYA 5CFOA 1G21E 3U7FB 1AZTA 2QJFA 5JD5A 3BQ9A 3ORFA 5JWOA 1FP7A 4ND6A 4BBAA 5G1PA 3QW2A 5IF9A 1XTQA 1PV1A 4RIEA 5BPFA 3DVQX 4US2R 4YCLA 3MIIA 2CXHA 3HFSA 4GX0A 3R0QA 4KAFA 2E0IA 2K2WA 2HSJA 4H27A 5DM2A 3ERCA 1DO8A 3QKUA 1DJOA 2MYPA 3JPWA 1E8MA 4IF6A 3GLIE 3TVTA 2J4CA 1PQPA 3KX2A 2QTVA 4WXHA 3OICA 3NTUA 2ZWVA 1GPNA 2IP2A 3D0RA 2QVCA 1HDZA 2OQ2A 4JU9A 1R0XA 3PENA 4G65A 1RHRA 4D6YA 1NY5A 4JJ6A 5LP6C 3QVSA 4U5QA 2YHBA 3ECCA 4LMRA 4JLAA 5ELMA 2GEJA 2GKSA 3A6JA 3F9CA 1NTRA 4BVGA 4C0JA 3U3ZA 2H9YA 4FZJA 3RYCB 2B1JA 4YP7A 2B37A 2AFVA 2CVOA 1GFIA 3NORA 4MRRA 5DHSA 3VPGA 1TUIA 3NYRA 4Z9XA 1EVEA 4X1KA 4H7IA 1Z5NA 2X1HA 1TQHA 3BH7A 3KTDA 3MFQA 5AMXA 2VEDA 3FVTA 1ADYA 1PEKE 4DHWA 5M29A 1PW7A 4O29A 1T1RA 3UW3A 5IS2A 3DW3X 1CS0A 1A04A 2YN4A 3EUFA 2A78A 2NV0A 2Z3ZA 4F38A 3STTA 2YV3A 4BOYA 4NBTA 1J8FA 1T5LA 1V4BA 1VLQA 1C2YA 3V1YA 4W6ZA 1JT9A 1H2FA 2BUBA 2QM0A 1GGVA 1VPEA 1KU6A 4HYEA 4K9SA 1NW6A 4MV5A 4W9NC 1QOQB 1PEDA 4C88A 1RZUA 4PRKA 2A5DA 5IYZF 3LPCA 3UKOA 1N6HA 1UM9B 3EQ6A 2FHSA 2H54A 2IYYA 2G17A 2QPAA 2IUUA 4I55F 3VYTB 4PRLA 1II9A 1CK4A 3CUTA 4LTNA 3TIVA 5HIJA 3I3OA 1IRIA 4L4UA 1X8LA 4CLOA 3SVLA 1Z63A 4IAOA 4PSVA 3VU8A 1KI7A 4I4IA 4XD7A 4W5WA 4FTWA 3U3XA 4ZYLA 3BJMA 1XLUA 1LS1A 2C04A 3IB6A 1V45E 1XRNA 1SVNA 3A9WA 4YDRA 1HZZA 4OXXA 1FFXA 2DWCA 4Q19A 1QHXA 1AU9A 3IOCA 4LRWA 1JG7A 3LLMA 4U2BA 1V39A 2JZOA 3KQWA 2DSNA 3ZZMA 2GK7A 5F1PA 1Q3HA 2DTDA 2C2OA 2C59A 4M1KA 2JK0A 3O47A 1ORTA 2FPIB 2WTXA 4QWMA 1Z5OA 3A1FA 1MO2A 3JWEA 4S1NA 4A1OA 2JDIA 2QW1A 4XM1A 4LV5B 2ENWA 2PV0A 4LHXA 1UZNA 3Q9SA 2G1UA 3GAZA 2SCUB 1T2FA 3CN7A 4AECA 1T43A 3UJ3X 1DX9A 1LX7A 5JHGB 3RAGA 1RM5A 3QI2A 2WYWA 4YJKA 5DBFA 3L40A 4Z3KA 1J5EB 3DMGA 2J9GA 3G23A 2DQZA 1ZAYA 2C0QA 1NMSA 3KOUA 5LDHA 1CY2A 1OZGA 4RK1A 2H18A 3FCYA 3FBWA 4J3NA 1B41A 3Q41A 1N0IA 1ENPA 5HDQA 3LWBA 1CDZA 1JNXX 1M1YB 1YQ9A 1L5ZA 4BQOA 3PWTA 4I1SA 1FQOA 5GOTA 5JPCA 4ENTA 3O8LA 4QEDA 3FW1A 1HYBA 5DN6D 5BP7A 5KNCH 3HGMA 2VF8A 3ORSA 4N0PA 1F06A 4D9FA 1W8DA 2C88A 3M1YA 4OQQA 1VKOA 1XU7A 2HO4A 1BZYA 2WMNB 4YP1A 4WQMA 1ZHFA 2QTGA 3E9ZA 2R8YA 2ZT7A 3OQ6A 4I4LA 2ZYGA 1ZW1A 2P9ZA 5AW3A 4Y2XA 4LZAA 3CEHA 3GVPA 4OUDB 3R7DA 3T1OA 5KWVA 5FYQA 4LNUB 5BV1A 2FEWB 3PDWA 4B76A 2Q49A 3NBXX 4CKBA 5LIRA 2JCVA 1ADBA 3WLKX 2QTFA 1SD1A 2ZRLA 4D3YA 4DR6B 4CKEA 4I3FA 3GLTA 6CHYA 1V9LA 1QNLA 2RB5A 1QF9A 3FLBA 3IURA 1QG6A 3ZDYB 3CLHA 2OB2A 4HG2A 4JGBA 4AY3A 5A6SA 3SR4A 4Q39A 2R5NA 1OX5A 3GB9A 3O82A 4PWZA 4Y6SA 1GUBA 4E08A 3LL7A 3ETEA 4IFBA 4JLBA 3TBFA 1LW7A 1OZHA 1UFKA 3HNRA 4GOLD 3B9BA 2EJUA 2XB8A 2YHAA 3L0SA 4PSUA 4DMMA 4JLKA 1KAEA 3CV3A 4DYDA 2YJTD 1VHDA 3RU3A 4O63O 1JZSA 1U28C 2FB9A 2H9AA 1XXHB 3BUSA 4A92A 3TLJA 2W2KA 4CIXA 5AVVA 3E61A 5E9WA 1RE1A 1G5TA 2BTQA 3ZNNA 3QFSA 4C2BA 1BEZA 1AIPA 4KWTA 4LDQA 1IZ0A 1WBJB 2HA4A 4KXMA 2MINA 5DJ5A 4NCIA 5DLEA 4QUAA 1XMOB 3SFTA 1V4NA 2CXNA 3FROA 1A7KA 4INPA 5AJHA 2D5AA 4CQMA 3KUUA 4DGQA 1JHYA 1IQPA 2XBUA 3MF4A 5K0LA 1M6YA 1XRRA 3K1AB 4P0QB 3B8HA 1BCRB 4ZPXA 4YY3B 1YONA 3DOCA 4B79A 3F4BA 1D2EA 1QJ4A 1RI1A 1Z2PX 2PTHA 5FIUA 2A1IA 4ZVLA 1EBUA 4FOSA 4YWHA 4HX2A 1CVRA 5A9SA 5BN3A 3OTWA 4DM3A 4R84A 1BVUA 3GGOA 3EFOB 5CURA 4HDSB 4C4PA 3DE6X 4KE9A 4CMCA 4YAKA 1R16A 2EV9A 3ZLJA 4LI3X 3A6ZA 1YOBA 2XVYA 3CRQA 4PHGA 1KZYC 3EQ7A 4KIUA 4EYGA 1DIHA 3JZDA 4FFPA 4F6LA 2P6OA 1JHMA 4UU0A 4NFLA 1HX7A 8MHTA 1M5UA 2FG7C 3SVZA 1RYHA 5JCXA 3CLUC 5AWFC 1YXMA 1Y4ZA 3JWHA 3WLEA 4BAGA 3KB1A 1KSFX 4EBFA 2O5CA 4ZEOA 1AF7A 3LUKA 1CF4A 3Q12A 3GNTA 3GZTB 1KFCB 3H18A 2IYQA 3G9XA 4BN4A 3R09A 2M6LA 3RC1A 2N0SA 1IHUA 1RMQA 3WLNA 5DW3A 1XPUA 1TIBA 2J5QA 2Q1UA 2ZAYA 3G0OA 3GA0A 3CVYA 3I1JA 3T3PB 2GFQA 3B1YA 2DHRA 3G88A 2VJLA 3KVOA 1J09A 2V1XA 3BAFA 1ECBA 1G98A 2RGEA 4J1TA 3VSAA 4YR9A 1IMOA 2XY4A 5H3LA 1U2RA 1XHLA 2CYBA 4GXRA 3U31A 2AQ8A 2I8AA 3HDVA 2Z83A 5KYVA 1T8RA 2A6PA 3KOOA 1BGVA 3KYIB 4FOPA 4GP6A 4K9LA 3RIXA 2QNRA 3SXUB 4M9QA 3X3HA 2PGNA 4R2MA 3F7OA 2UDPA 4P33A 1E6EA 2SKDA 4LJRA 1SBYA 3PHGA 5IH7A 1ECPA 1ZISA 5K0BA 1UOQA 5CBPB 4TTTS 1AKQA 1ZZEA 4AQDA 2J1LA 2WWGA 1BE1A 1LX6A 5KJCA 5HK8A 2HPZA 3CCFA 1I4WA 4TOIA 1J06A 3M6WA 4E3ZA 2R9VA 2WF5A 4KQFA 3BIFA 3STWA 2WFLA 4KDFA 4PLGA 2BBOA 1ZR2A 4BFLA 4EVIA 4QHYA 4GVLA 3TF5A 4P80A 2Q0XA 5CU7A 1IVNA 1S8OA 3TRHA 4PLTA 4TL6A 3HU1A 3SLRA 1CJCA 4UQLA 5ITSA 4KDEA 3WK4A 2OC4A 5HZMA 3PCXA 3KJXA 3M70A 2CE7A 3OJEA 1MVNA 5FBZA 5FHQA 1BQEA 4C21A 3E27A 3MTBA 2QRGA 1R6TA 1PFQA 4FOOA 2XDAA 3DO6A 3SEFA 1U1EA 4B6RA 1H85A 2HRQA 2XMDA 5LU8A 1UEXC 1N6OA 3QFCA 3THXB 4BO1A 3REQA 2BLNA 3CRNA 4KO3S 3RK1A 1PFKA 1PI3A 4KGDA 3WYDA 1RLTA 3PF8A 3QYJA 1XHFA 1T26A 3H5TA 4KTVE 5GZ6A 3S2UA 3AF3A 4X3PA 3EPRA 1P7PA 5F64A 2P91A 4BWVA 3G68A 4B46A 1Y9JA 4BQNA 1L7OA 3F4LA 2R7AA 3BWXA 4N01A 4UNRA 1KSGA 1VSUA 1LSUA 3D2AA 2PO5A 4EY4A 4DKJA 1WZNA 1KETA 1MTZA 5BUZA 5EQFA 1Q17A 4D79A 1IXZA 4OQ4A 4BB0A 4QXOA 2QRQA 1EK5A 4P5DA 2IPNA 5LYYA 2P0YA 1OYYA 3P5SA 1YDGA 4H7JA 2I67A 1QF7A 2XUZA 4UBMA 4HFJA 3E84A 1FA9A 1C1YA 3CY6A 2JCYA 3TLEA 3B2QA 4FGSA 1T1SA 3WLQA 4LYGA 3QX9A 3WGVA 5JZMA 1NE7A 5KQPA 1E9FA 1NR1A 5IJXA 3ADOA 3EVFA 4XUCA 5AQ1A 2AHRA 3HDTA 5TSDA 4NBRA 3OE4A 2IPMA 2YWXA 2MYNA 2AN3A 4YRBA 1MIOB 1XEXB 1ZJ6A 3PVSA 4DSAA 4IJMA 1NQ5A 2P9JA 4F21A 2ZU6A 1QANA 2GEKA 2ODNA 1RWNA 1TF5A 4B6FA 2NPOA 2OV2A 3TJMA 1LLUA 4Q4LA 3ANMA 5TVGA 3KKOA 3X1MA 3AL3A 2QRHA 2SBTA 4H6XA 3UFBA 4ZOBA 4OQDA 4BQPA 3R6GA 3BXFA 3ROMA 1LLCA 3I4CA 2IXEA 3DCIA 3O1JC 2DWUA 3UZUA 3AHJA 3JZIA 5C5DA 1RQ2A 2VHWA 3FCUB 1AHHA 1LBQA 3QK7A 2RHHA 1SKAA 3DLIA 3LBIA 2NW6A 2ZBPA 3O83A 3NCHA 1Z8HA 3QXGA 4PPYA 1Z47A 2WAAA 2ZQZA 3AUXA 3OP1A 5G0TA 1KKLA 4UU7A 3HBJA 5TARA 4BLOA 1S3GA 3QSGA 2FPRA 4PC2A 1V2GA 3LYLA 5IKEA 4J1QA 2NTNA 5CVEA 3SPXA 5I7VA 1R8YA 1EXNA 4LHZA 5F35A 5DN6A 2VJQA 1XXLA 2NZWA 3KV1A 4O3FA 4P4SA 4Z0TA 5IMBA 1ZVVA 1Y5RA 3PC2A 5KX5A 2NOAA 1ML3A 1E1CA 4BLTA 1WSBA 1A50B 1TADA 4ABTA 1T8YA 2I4RA 2ZJ5A 3L7NA 3OZEA 2WT4A 4JLMA 2NUPB 4P4TA 5ALFA 3TTVA 1EXDA 2QRNA 1CUIA 2GN8A 4E13A 1SUIA 1QYWA 5JNVA 1W88A 5KSYA 5EZSA 1T10A 4W7HA 1TQ4A 1ZO8A 4M54A 1U2GA 2NZ8A 1RLIA 3CT4A 4L3WA 1JYSA 1KDRA 3G85A 5EQDA 4ZVKA 4B8WA 1ZM9A 2F3PA 3WICA 1U04A 5AKYA 3DLTA 4ZT3A 3B5EA 4MV1A 4YRTA 1QZ3A 3PLRA 1JU3A 1P2VA 1YGYA 2YZMA 3I52A 4GLOA 5AHRA 5EVJA 5FNVF 2BCEA 1HYGA 4GBED 2BZSA 3GC6A 4JJEA 2ZRFA 3SR0A 3DL0A 1R74A 2IP4A 2QN9A 4JOSA 1A4UA 1OIVA 1DNPA 4D74A 5JVDB 3ZDCA 1EZ4A 3C7KA 4RESA 1ZBQA 1KEVA 1L1EA 3AKZA 5DCWA 2F3TA 9ATCA 1G20B 2H0AA 13PKA 3C43A 1PJSA 1Y7HA 2O1EA 5EXSA 1VXRA 2I6FA 1QU2A 3OQPA 2IS6A 5JDCC 1AH2A 3WZMA 2Q2VA 4L02A 2R96A 4CJXA 1YJ5A 1L4NA 2VTDA 3BXHA 2E5WA 2Q0HA 1K6XA 5B7NA 4YK7A 3O91A 3NYWA 1I32A 2VRNA 3RFFA 1CCWA 4F71A 3KWJA 3MILA 2V65A 3CPSA 2ALJA 1AB5A 4WACA 1XELA 1ULBA 3ZD6A 1DOHA 2OFPA 4RDCA 5ALSA 4CMIB 6GPBA 3QRWA 2FWNA 2YY6A 5JYDA 2RFLA 5H02A 5JSZB 1EFPB 1PL8A 5SY9A 2O0JA 4EPRA 1MIHA 1E2MA 1IIRA 1OMOA 1W4AA 1KH1A 1Z22A 2HV8A 2ODAA 4WT7A 5FTKA 4N6GA 3OF3A 4PV7A 4TTPA 1OVMA 1GG2A 3UCFA 1PZGA 3TBKA 6ADHA 1M8KA 2OPHA 3HV0A 1S3FA 2RJ3A 3GPIA 4JU8A 4DWJA 4PLPA 1DE0A 4JT2A 5HS6A 3LLUA 4LOLA 3R5HA 2H3HA 5F5NA 3EDQA 4LCEA 4MK4A 4TLBA 2EFHB 3L8CA 6NULA 1M34B 4X95A 3OCYA 2IUEA 4LHSA 1U2DC 1YL6A 2HFJA 3RUEA 3JATB 1FVHA 1TT5B 1X7ZA 2WV9A 3UHAA 3CX7A 5JWRA 1XCPA 3GPDG 2OOSA 3UJ8A 4BLPA 3BXEA 4TKUA 4EX6A 4G6ZA 5E7JA 1I5EA 4QNMA 4FN4A 1UANA 7REQA 1B74A 2AG6A 2KS6A 2V54A 1F4PA 4KO2S 3VM6A 1YZFA 5HCNA 4CTOA 2REQB 4B34A 3ETCA 1R64A 3HRKA 3TUJC 3Q1LA 2VNIA 3OJCA 2GM5A 2IZZA 2YYSA 3FCEA 4AT1A 1BMTA 1IIBA 1KZ4A 3KTFA 1OYOA 2IYLD 4Q3EA 2BTOA 3OZGA 4O4LB 1RRMA 4LI0A 5F78A 3CFYA 4KR3A 1MC5A 1Q7TA 3FWYA 4FYXA 4QDKA 4X44A 3KC2A 2AFRA 3BXZA 3UICA 2VK4A 5BOSA 4LFAB 2H7XA 3MAGA 1E59A 4WFIA 1R6AA 2OGWA 4JSRA 4EAQA 3RUCA 4EHLA 1KDTA 1VG9B 1RRFA 1G8SA 4HEA1 3S44A 1AKTA 2WINI 1P18A 2ZJ4A 3DGFC 1RWBA 3Q8XB 1P1CA 1E2HA 4Y7CA 1PHRA 1MB0A 2F90A 1NLYA 1RHKA 1T5SA 3OZAA 2VZ8A 3H97A 3UK7A 1J7JA 4M1QA 4WV3A 3OUTA 5F4BA 5LUBA 2Q4EA 4J43A 2JFGA 3NWOA 2B4AA 3Q3IA 3VJKA 1XZCA 3ZTWA 4CIYA 1FBTA 2YMLA 1JZQA 1N2CA 2ZS9A 1O0BA 3V7YA 5GONB 1E6CA 2FSVA 1R7RA 4DRXA 3T15A 5L7TA 4PLFA 4UPDA 2FOIA 1EYZA 4Q3AA 1CEYA 3FYUB 4EKYA 1XDSA 4R7GA 2JF0A 3LUPA 1FDOA 3CR7A 1QX3A 3VUFA 5JHHB 3CUSA 1M76A 3PC8A 1Z4KA 4JCOA 4MJXA 1PG2A 3PIIA 1LBHA 2XCLA 2PGJA 2CUTA 1W49A 2J8ZA 4E7PA 3CKYA 4XLZA 1YDWA 2GBFA 2HU8A 3LDFA 2W48A 1Z5VA 4Y30A 2IVZA 1S2GA 3E48A 3UNXA 3WJ2A 3O03A 3FTDA 2G72A 1NOJA 3RGWS 5THQA 4KSBA 2WTAA 4TMWA 3CGWA 3TR0A 1ZUHA 1PJ4A 1CY1A 1DTWA 1F2UA 1HA3A 2I22A 2C98A 3AY6A 2PX0A 4G37A 3IAM6 1Q3TA 3DV0B 5AXCA 3G1UA 3T5GA 3KKKA 4CYMA 5LWHA 4IIYA 1N2HA 2PG3A 4FJ1A 3UB4A 2QHXA 4P1ZA 1GOTA 3A14A 4HATA 2BGGA 1ZKMA 2YFYA 3HTXA 3N2KA 1DQYA 1UBRS 4F6RA 1TGVA 1LPAB 2YC2C 5T67A 2SHKA 4CM4A 3OJ0A 1KMIY 2PM8A 2W2VA 2AQIA 2XH8A 4FZRA 1UEIA 3HRIA 4JC5A 4IV0A 1ZAKA 4MPJA 4TVKA 5HIMA 2JIOA 1NFRA 5YASA 4U6NA 2AE2A 4E1BA 2WYUA 1NUPA 4QGFA 4JBXA 1CDOA 3PC7A 3TDNA 1NKTA 4X6LA 3PQ8A 1GZ4A 3QIVA 3ACBA 4ZWNA 1TOAA 5CFMA 1SMKA 4KAXA 5ALEA 4KQJA 3STVA 1ZHOA 2Z2JA 4F4JA 3AJDA 1MP0A 3VZQA 5DNWA 1JAZA 1XKLA 4MS1B 3BGWA 4NE7A 1Z2AA 5ER6A 1Q0LA 1QK5A 4NI5A 3UHOA 5J2UF 1DT5A 1XB2A 4FCCA 3G59A 5G1NA 2HBZA 1GL9B 1DHRA 4RULA 1P5ZB 2R66A 3VI3B 1O2DA 3UJCA 1OUMA 5ADHA 3HEBA 3RVQA 3DMHA 2JLWA 5FJIA 2QSJA 1AKUA 2PFGA 3BF8A 4FDTA 3WK7A 5IK2D 4G5RA 2HI0A 2QXTA 4BP1A 1VHWA 1VE6A 3MMXA 3PGA1 1V0JA 4E51A 2V7VA 1ULUA 1XEWY 3S55A 3K0EA 1I7QB 3KHTA 4CEIB 1U3CA 5HUJA 1QIJA 1WS6A 4QRIA 3S27A 1P1IA 3PKZA 3IO5A 3TAXA 5JIBA 1T3GA 3CNNA 4KQEA 4C4ZA 2X40A 5HF6A 1M6WA 1E1YA 1YH3A 4HB4A 4FDLA 3UK6A 2P2GA 2OBFA 2W37A 4NS1A 5TQ0A 5IZCC 3N0VA 1CUGA 4KMOA 3OWXA 2NXJA 1OWNA 4EEZA 3IO3A 5LXTB 3MERA 4D45A 2OGZA 2CNNA 2XCUA 3IJRA 1ZWKA 4R98A 3LYUA 4IR7A 5AOAA 4HLCA 5IRCD 5EPUA 2FFQA 4E22A 2X77A 1Z0JA 5CCBA 5FOXA 3BWDD 2J0UB 3KQNA 5K9ZA 1OV6A 4MS4B 3KUDA 2BGTA 2Q4RA 2AZDA 1N3IA 2V7WA 3P9SA 3M0EA 1MHPA 2QRKA 1WMFA 2BH2A 4BEWA 1ZOLA 4HLUC 4YDSA 4YUYA 5BT8A 4X6YA 2Q3FA 4BLWA 4KG7A 2ONCA 2I33A 4YV1A 3QLVC 4IMRA 3HJBA 1F9EA 4Q7MB 3W5JA 4YJGB 1A5AB 5HTKA 2W2TA 2ZPTX 1EG2A 4XJXA 3RW9A 5ALRA 4L8FA 3B1XA 4BO7A 3UQZA 4E46A 4EQ6B 4FLEA 2CNWD 4ATNA 4BVBA 4U7DA 3FFXA 1EVKA 2RHTA 3QBDA 1M9NA 4FOLA 1X92A 3LO5A 4KIJA 4XR4A 3RYFA 4HDCA 4G84A 1K63A 1MO5A 3UVEA 2Y1GA 1TA4A 4UTOA 1EFVB 4AG3A 3E5NA 3KQSA 1Y8QA 4BNFA 1LPNA 1INLA 1O96A 2E37A 2B4RO 4I14A 2CLKB 1W4RA 2P5TB 4OA8A 1P5JA 1EK0A 3IODA 4FPXA 4XIIA 3G8AA 1YRLA 3ORRA 3OIUA 4YRPA 3DL2A 4ZGWA 4CQNA 2F9FA 2X8BA 3DR5A 4QTXA 3NOQA 4A0HA 2ZB3A 4TVSA 3RAPR 1VZ2A 2W6PA 1AMNA 4EGCB 1K4MA 1N9ZA 3SY8A 1O94C 4Q1AA 5D7BA 5EJAA 3PTLA 3SLGA 2C9MA 1E79A 3HGQA 1W94A 2Y4NA 2DXIA 1WW2A 4PNHA 5BV7A 1CR4A 4B8YA 1ISIA 1X7YB 1RW4A 3DEAA 3GJXC 3MYYA 4R51A 1N8TA 4LDNA 5GINE 3L2OB 3ZV6A 2V74B 1AOXA 3K9NA 3W90A 1Z16A 1M3SA 2EXXA 3IA2A 4Q9KA 3U1BA 4XWGA 1I0IA 4BFVA 1NG9A 1YUMA 2FP4B 4AUEA 5L9AA 2QNBA 3IMCA 2BMEA 3KQKA 4LSMA 2W6NA 2ZUUA 4N0DA 1GWNA 3PC6A 2JHGA 2WB4A 2PKQO 5HMMA 2A9OA 7MDHA 4RVNA 4MVWA 3TE7A 1U0FA 2OV4A 1S5PA 3E2IA 3I37X 4Q93A 1D3AA 2DT8A 1X6VA 2X5JO 3GFOA 4F6CA 4JKIA 1RRGA 3KL4A 3CLRC 1CDDA 3GX1A 3K96A 4RTRA 4DPMA 4Y2JA 3NDPA 5DTJA 4BATA 3NIFB 5JG7A 4QTTB 3RV3A 4EW6A 4ZYUA 1XZPA 3AXTA 3P19A 2HJVA 3WLOA 3L1IA 4B3XA 2VNHA 3ELWA 1IOWA 1TVKA 3RYCA 1T6NA 4BTVA 1Y5NA 3BWYA 4URZR 2HMSA 2GN1A 3UJDA 2QROA 2Q5IA 2YBDA 3ZD7A 1A0OA 5IASA 3ZV3A 1KIFA 1SUPA 1BXRB 2BGRA 2O59A 1KYIA 2HGSA 2HGZA 1QLWA 4W99A 4BVFA 1GUYA 4QWWA 3KSBC 121PA 2QAJA 4L08A 1KI3A 3H2YA 4OH7A 4D6XA 1PAUA 3QUQA 2PHZA 3F6SA 5AK3A 1GXSB 3S8MA 3SE0A 1DAIA 2XHEA 4E7OA 1DARA 1VCNA 2FW0A 5AW8A 4J49A 3LX6A 1K9SA 4ITRC 3OF5A 3HABA 3ND5A 1RQNA 3LC2O 4DUZB 4WOCA 1HE2A 4NKRA 1L5SA 4KBFA 4XIYA 2IEIA 1V9SA 1XHEA 5K4GA 1OWPA 5AKZA 8ATCA 2QJOA 4RCVA 1NOIA 4ENWA 1SC1A 1DQRA 1T4BA 3DBHB 5A6VA 5BQXA 1Y8RB 1HETA 2ZJZA 2X22A 2HJ9A 1C81A 5JPDA 3ENWA 3N2GA 4KMSA 5AOVA 1JDVA 4BTEA 1F0PA 1PK9A 3D3NA 3DLCA 3T54A 3VR6D 1GFWA 2FUKA 1RFLA 4RD3A 3UM9A 3V8QA 1IY2A