5CK5A

Signal recognition particle receptor srb-gdp-mg from chaetomium thermophilum
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
301
structure length
221
Chain Sequence
YTTLPSVLLIGPSGAGKTALLTLFERGTSYKVDLDAAGATARKFLLIDTPGHPKLRGTTLQHLLNPSPSLTIIPTSDPYKSKLKAVIFLLDAAALADSDGDYLSQTASYLYDVLLSLQKRFHSRKNSRAPSSIPVLIAANKQDLFTAVPASLVKSRLEHELGRIRKTRQKGLEGWLGAVGSKEFKFEEMMEFDMEVEVMGGNVIGDGPGAERWWRWIGERI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Putative signal recognition particle protein
publication title Structure and Switch Cycle of SR beta as Ancestral Eukaryotic GTPase Associated with Secretory Membranes.
pubmed doi rcsb
source organism Chaetomium thermophilum
total genus 69
structure length 221
sequence length 301
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09439 SRPRB Signal recognition particle receptor beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ck5A00
4WA7A 3QBTA 2GXUA 2GCNA 5EE1A 3DKPA 5TB5A 4M53A 1NIJA 1XXHA 2F6RA 1ZMXA 2TMKA 3GPLA 3RAPR 1G3RA 4UXJA 3TLXA 4QGGA 2GEDA 5KNBA 1T3LA 4C7OA 4GI7A 4QBGB 3B5JA 4ERNA 2XJ4A 4BFZA 4DSTA 4TMZA 4Q02A 2YWHA 2FDCA 3I61A 3ZJYA 4Q4HB 4IFEA 3VR4A 3TQFA 3LWNA 2VA8A 4AKEA 3PEYA 3DPUA 4BGDA 2BBTA 3PV0A 2QT1A 3FMOB 2ZAOA 1LVGA 2JLSA 1U8AA 2ZSAA 3NG1A 3T1OA 1OT3A 1ODFA 1S9DA 1EESA 3U61B 4ABYA 2IEZA 2FGKA 3LA6A 2VSFA 1T0JB 1HT1E 1ELOA 2ZS8A 2JLQA 1VIAA 4WBSA 3W5JA 2DFKB 5HKKD 1NVWQ 5AJVB 4RCYA 1KK3A 3CF0A 1OPXA 4UQOA 4IJMA 1AS2A 1M7BA 4XD7D 5H1YA 2QU8A 2VSXA 3AVOA 4NYIQ 3TUJC 5G3YA 4A15A 3T15A 3K8YA 3FHTA 4JLPA 4DLUA 1TX4B 2A5JA 1XPOA 2GEUA 4II7A 2PEZA 1CR0A 3H0KA 4F93B 3EW9A 2DFNA 3B6EA 4DLVA 2QTHA 1E0JA 1OHHA 1M2OB 4LWZA 1E9FA 1WRBA 2BWJA 2EWWA 2O52A 1G7TA 1DS6A 2LWIA 2ZJYA 1Z06A 3T1QA 4D6PA 4PX9A 1P6XA 2GK7A 1JJ7A 4JKIA 4UKDA 4LGMA 3AVWA 1P2SA 3F5FA 4LPSA 2DWOA 1TL7C 2QEQA 5J40A 2N1BA 2XJ9A 1T3HA 2V6JA 2BEJA 3TVDA 1X8JA 4G1UC 1ZC4A 5IRCD 5AUOB 2VLIA 4OI4A 1Z29A 4MKHA 1JPNA 4I1UA 1SKQA 2CNWD 4US1R 4CW7A 3SR0A 2ZI6A 3UWOA 5JS7A 5LPNA 2IYLD 2JJ8A 5K8TA 1AS3A 4YONB 2QQEA 3EPHA 2O0JA 2IA5A 2AWOA 2QROA 3EWAA 3BS4A 4TMKA 3WYFA 3TW4A 4B3FX 4YXWD 3EASA 4DVGA 2VHUA 3IBYA 4LJAA 5B30A 3WRXC 2WWYA 3DHWC 4PQFA 4XSHA 3QPUA 2GILA 1MABB 5LD2C 3KTAA 1N6PA 5ELXA 4RD6A 2OLKA 4PSVA 3UMFA 5F98A 2QE7D 3PVSA 2YWEA 4RFVA 2Q3FA 1NY5A 5CLLA 3RYTC 2CCKA 1N5KA 2ERXA 5E7JA 4L5BA 3R8CA 2XB2A 4TWZA 4DRZA 3KQNA 3RWMB 4KV9A 1XWIA 3PEVA 3K0FB 4Q9JA 4PC2A 2ZSFA 1KI1A 1N5JA 3THWA 2Q3MA 2QNRA 1LY1A 4JVNA 5H68A 2A78A 3K09C 4L4UA 4EUNA 3P4XA 3U7EB 3SJCA 3E5HA 4JYCA 2QGNA 1WE2A 1DOAA 1QRAA 2QP9X 5L3QA 1SVIA 4RZ3A 3V9PA 1O87A 3WY9A 1DADA 2QQ0A 4EAQA 2GZAA 1II8B 3KB1A 4NTZA 1WF3A 2ZE6A 4IOKA 3RDPA 2RGNC 2R2AA 1W47A 2YVUA 2HCBA 2Z83A 4N1AA 4CEIB 4AKIA 2B21A 2EQBA 1UKVY 4ZDIA 4M1SA 2J3EA 1T8UA 2VTKA 2BC9A 2XZLA 1SVMA 4HATA 1RJ9B 3NH9A 3EZ9A 2C9YA 3RANA 4JSYA 4QC2A 3F8TA 3ZS9A 2VPPA 4AKHA 1N0VC 3B78A 1P61B 3LD9A 4HI0E 3U7HB 1JEDA 1HEIA 2FFAA 4Q18A 1YZQA 4C30A 2NTYC 1YKSA 1AN0A 1CU1A 1MKYA 1Z6GA 3CB4A 3T35A 2ZRNA 2UZ3A 1ZU4A 1SXJC 3UG7A 3EIEA 5FR1A 2ZUCA 2QMUA 3MAAC 3NH6A 5FUYA 3WP0A 1IN7A 2LKDA 5B2ZA 3THOA 4CDGA 3K53A 1F3OA 5JWHA 1KK2A 2QBYB 4IEIA 1YQTA 1GFIA 1SHZA 4JL8A 4F4CA 2NMVA 4KFRA 4K8OA 2J1LA 5GJBA 1BH2A 2JEOA 3PFIA 4DDUA 1Z6XA 1MRSA 1N3BA 4LYHA 4TYYA 1XD8A 1GKYA 4Y0VA 3U44B 1NSFA 4UXHA 5D3QA 1R0XA 1KI7A 1QZXA 1TNDA 4C0QC 2QM7A 5HCNA 2F9LA 2GJ9A 3QJYA 1OKKD 1CJKC 3BERA 4PC1A 4Q9LA 2QMOA 4LUCA 2K5UA 3ONWA 3KKNA 5J5CA 5JJKA 2CDNA 2NO7A 1T6NA 2PEYA 2FG5A 5CM8B 1J99A 1KNQA 1NSTA 2ZREA 4DBLC 2IUSA 2J9RA 4XD7A 4EJSA 2P2LA 4TSFD 1RC8A 4Q7LA 1LNZA 3A4LA 4MGYR 1KNXA 5EP2A 3SNHA 4QOSA 2PL3A 1PLLA 4HAUA 4CYMA 4KO8A 4ACBA 4I81A 3VKGA 4CGZA 5F3WB 2IYSA 3HU2A 2KBEA 2FSFA 2CLCX 1Z8FA 3KZ1E 2QTVB 3LV8A 3ADDA 4GNKA 2NGRA 3U3MA 3VX3A 4O2LA 4TLDA 2C98A 4Q4JB 2KB0A 2CHQA 2OAQ1 3WRYC 2ZYWX 4A8JB 1R5BA 1G20E 3FGNA 4DSOA 2P3SA 1KO8A 1MO6A 2F1JA 2NO6A 5FFMA 1L4UA 1OFHA 3FFAA 4NZYA 2CNWA 2F1RA 5EZ6B 4JJZA 3KKOA 3NC0C 1LS6A 1PLKA 2FSHA 3CRVA 1IY0A 3UWKA 4MUBA 2WWIA 4NU0A 1J8MF 4B76A 3TR0A 2J59A 1F60A 1OXSC 2VP6A 1DG3A 1U81A 4PANA 4BZQA 4YXWA 4AIIA 2ZRCA 2CJWA 1XEXA 3B60A 3MLEA 1ZIOA 3B1ZA 1CF4A 4ZPXA 5EE3A 5EXSA 4FMCB 3L0IB 4A2QA 1RW4A 3E2IA 2WVJA 2WZQA 2GESA 4KXFB 1NLZA 5FTJA 4DSUA 1P75A 4B2IA 5DYIA 1ZJ6A 4ZIRA 1OJLA 4KLZA 5FL7D 4TQAA 4OL0A 1AKYA 1VPLA 2WOOA 4HLQB 5KOYA 2OM2A 1OW3B 1ZBDA 2IYXA 4KHZA 5CM9C 3Q8XB 4L15A 3K0AB 1Q44A 1X8KA 4TTRA 2IYQA 5JI2E 1I4DD 4QHYA 2DFLA 1J2JA 4XH9B 4Z8XA 2IWRA 2W2VA 2L0XA 1RIFA 3H84A 4DCUA 2Z5FA 3TE6A 1SKYB 3HU1A 4TZ0A 4XVUA 1M1YE 2H17A 5SZIA 2PJZA 3I4LA 3Q72A 4Q9IA 5HR5A 4CIDA 3LX8A 5JCZA 3A36A 5JJLA 2G1JA 1CS4C 2R44A 5FUXA 4NKRA 4L9SA 3K0CC 3NDBB 1EK0A 4ARZA 3K9GA 4YDSA 3WMEA 2JDID 2MSDB 3ZYCA 2PCJA 3DZDA 4AK9A 3VKHA 1SXJE 1CJMA 3B1YA 2FE4A 1JQJC 1XCGB 3EPKA 1PLJA 2QI9C 1NMXA 1ZC3A 4BEJA 3EZ2A 1UDWA 1JI0A 1KMHA 4KLNA 4D4KA 2FWRA 5J4YA 1SZPA 2IXFA 3CF2A 1W49A 3AVXA 4QGHA 4B74A 2ZJZA 3A4MA 1OIWA 2NPFA 2GWHA 4KITB 2CBZA 1F2TB 2MMCA 1KI6A 5ANRB 1QHGA 2VH5R 1WQ1R 3SU8A 1U9IC 4C0KA 3OESA 4BFWA 1EXMA 3UMRA 2DBYA 2WICA 5EUMA 2ZM5A 1HY3A 1RKBA 3GEHA 3H1TA 4C0BA 3A1WA 3PUWA 2FJUA 1G8GA 2W2TA 1OKKA 4LDJA 2J46A 4LV8B 3U3RA 1TF2A 1QHHB 1TPZA 4HB0A 5GJCA 3I5YA 1E2KA 3BC1A 1DAIA 4OHYA 1Z22A 1Q20A 2EVWX 2WAXA 4BLSA 4HLUC 3ND9A 1QVRA 4FI3C 2HXYA 1Z6AA 4H9GA 3VX4A 1XXHE 2CE2X 2OCPA 3MFYA 1JBKA 4OK5A 4E09A 4TSFA 3AF2A 3ADBA 1E79D 3BBPA 1N6LA 4PQYA 1M74A 1G5RA 2HJGA 4L8GA 5EP4A 5TXGA 3L0PA 3QUSA 1OLOA 3SBDA 2HF9A 4BPBA 1ZD1A 3V4FA 3I32A 4OI0A 4TMTA 3CX6A 2FPMA 2JAQA 2XXAA 2IHBA 3QI2A 1OXTA 4LYAA 3KQHA 2F43B 4Z51A 4A8JC 5JZVA 1KHTA 3BAFA 3AKEA 1HE8B 1YU9A 3BD9A 4A82A 2H92A 4I1SA 3EARA 5D3MA 2JJ2D 4AD8A 2ECKA 5AJYA 1GKIA 5DIFA 3U2QA 4TT3D 1P62B 4V0KA 1PUIA 3PJRA 4POAA 3W6PA 2F9MA 1DG1G 3A8TA 3L2OB 4YMWA 3KJGA 1E1RD 4EQ6A 3HYTA 1K5GA 1L7VC 3AUYA 4JLNA 2FFHA 2HLDA 3JVUA 2IC5A 1D2NA 2XTMA 3MJRA 4A2WA 2V6IA 4LHZA 1GL9B 4PPQA 3SHFA 3H86A 2WIAA 3A1TA 1RZ3A 3T5DA 2GJ8A 1OH5A 2O8CB 2GTPA 1NL3A 3WMFA 5AWFC 1AA9A 4FCWA 1E2MA 1T9HA 2OAP1 3B8HA 2WM9B 3SQXA 4DT1B 4CZ2A 1YR7A 3FYHA 3GJ6A 4NCHA 3TNFA 3AKYA 1YZGA 3VNUA 4OJKA 5KDDA 3IUYA 3U3OA 5L8VA 4B3GA 3IQWA 4TLCA 4JLAA 2JGNA 3CNLA 1R7RA 1XJ0A 1XZPA 4FMDF 821PA 1KO7A 1GAJA 1Z08A 1E2PA 3OF5A 3N5CA 4HUQB 2WBLC 3PITA 3X1WA 5J4KA 2ZIAA 2YV5A 5TV2A 4R9UC 1JQLB 5FBVB 3A4NA 3B2EA 2RKOA 2Y8EA 3HDTA 1KDOA 2XNDD 3DMNA 4UNRA 4BFYA 1U99A 1E0AA 4CF7A 5FPKA 2ZVPX 1GVNB 3TBKA 3ZH9B 2IS6A 4Z1MD 2JDIA 4WZBE 3WNBA 2QTFA 3W9YA 2R6CA 3U3JA 3L0OA 2FU5C 2AXNA 1NVUQ 2VHJA 4BUJA 2GJAA 4TL8A 3KKMA 4G5RA 4R2IA 2RMKA 5BXQC 4URXR 3RWOA 1CJUC 5FOVA 1ZD8A 3GLHB 3DDCA 5JHGB 3U3KA 1SGWA 2G88A 2ZRGA 3OEHA 2NZJA 2QAGB 3U7GA 1N0WA 3FB4A 2E87A 4BRUA 421PA 5HZKA 4PAOA 2IUUA 2DCUA 1SVKA 4QM7A 3EG5A 3OE7D 1HH4A 4C2TA 1I2DA 5L3SA 5IF9A 3UK6A 3UKDA 1FMJA 3DOFA 2ZRAA 1I4TD 4NL4H 2OBLA 3VAAA 4CEHA 2ZJBA 5BN4A 2WTUA 1UADA 1JNYA 4MDEA 3OIVA 3TJZA 3QF4B 5BN5A 3TSOA 4ZCIA 5KDLA 4LHXA 3LAWA 1E96A 1QDEA 4OK3A 2ZI7A 4A2PA 5AJWA 2GNOA 4PC7A 1ZCAA 1EX6A 1XD2A 1E2JA 3QSYA 2VRWA 4V0LA 3E1SA 1GRNA 2FNAA 2V9PA 4OQFA 1W1WA 1KZGB 2GVDC 1YZKA 4C9BA 4Q19A 3CIOA 4C0AC 5EE5B 5CB8A 2RAPA 5F2EA 1CLUA 5LBIA 1NN5A 3RSLA 1G64A 3QEJA 4HAXA 4Q1FA 2ZJ2A 4R2HA 1B23P 3L8YA 1S1CA 3X2SA 4JBYA 2GCPA 2CEAA 1E2LA 1U90A 4TQUS 1DO2A 2O0KA 4F91B 3U4QB 3NEYA 1Z3IX 4AI6A 3X1YA 1FFHA 2PT5A 1DELA 1S9HA 3CR7A 4NCKA 4D4LA 2AFHE 4GOJA 2J41A 2JJ2A 2Z4SA 1T0HB 4E22A 2C99A 5TVKA 4GZMA 4ZDKA 2R6AA 4DLYA 4TT3A 3NBZC 3R9WA 4A36A 3RNLA 1VG1A 1W0JD 2OZEA 4R7ZA 4CVNA 2GF0A 2REXB 3LBHA 3EIHA 3B1WA 3QNUA 3ECCA 3I1FA 3W90A 4UNNA 3P1JA 1UDXA 2VYFA 4PSKA 2X8AA 2AX4A 4QBHA 3L82B 1HT2E 5SZKB 2R9VA 1KKLA 3SYLA 5KU1A 4PHTA 4A6XA 1RPZA 1KKMA 4QJ5A 3QE0A 3KXIA 1NF3A 2KSQA 2PH1A 1KO1A 3LQQA 2R6DA 1YHNA 1GSIA 3MGCA 1S4QA 3MWYW 1OXXK 3N2IA 2QMHA 2ATVA 2R8RA 1TU3A 1VCIA 1YE8A 1E0SA 1E2GA 1XTKA 2ZR7A 3T1VA 5BYKA 2MMGA 4DLXA 1SKYE 1E94E 1KY2A 1VCNA 3MWJA 2FMXA 2DR3A 3GLIB 2G77B 2IXGA 3NDPA 2A5YB 2IEYA 2OHFA 3AF0A 1QHNA 5TARA 2ATXA 4DJTA 2O8BA 2VP2A 1VTKA 2PBRA 5JEEA 3W8RA 2QPTA 1FP6A 1QHYA 1F2UA 2GXQA 1OH8A 1OFTA 1XTQA 2D3WA 2IWHA 1NN3A 1NVVR 1YZTA 4B48A 1ZIPA 2BCGY 4G5SA 4D81A 3KQLA 3MWLA 4HUTA 2HT6A 1G1MA 4DWJA 3FHOA 3S1AA 1TQ2A 4ZKDA 2CLSA 4H1VA 1N5IA 3ADKA 2ZRJA 1NLFA 3TVTA 4F4IA 5JWRA 5FTMA 1R2QA 5FTKA 4F4JA 3VR5A 4C3ZA 4HSEA 2HXSA 1FUUA 3RABA 3A1SA 3W5IA 4DLRA 4OQXA 2WWGA 5CJ2A 2DYKA 4BE7B 1S3GA 2AD1A 2CLDX 5KYKA 2QAGC 2IL1A 4RCZA 4D26A 2P5TB 5JEDA 1SQ5A 1ZRHA 1PJRA 5KSOA 1Z47A 1Z0FA 2ZEJA 2ZE8A 4TQ9A 4TTQA 4HZUA 3OE7A 4JLVA 1LFDB 3KQUA 3QXHA 5KNDA 1G4AE 1SXJB 5KSPA 3TR5A 4ESHA 3PUYA 3RSOA 5J4VA 3REFA 1DE0A 4LJYA 5EE9A 2IS2A 1NJFA 2ZAMA 3MUFA 2QT0A 3I73A 2BOVA 3Q9LA 3BXZA 2ZI4A 5UKDA 4A4DA 4MRSA 3CONA 1S0UA 4DC9A 3BFVA 2Q0HA 1E0KA 3LNCA 3C5HA 3K0EA 4QL3A 2GBLA 2ORIA 1DAMA 2VP0A 2ODEA 1AZSC 2B6HA 3FMIA 3ZVNA 3UMSA 1OXUA 4Q1CA 4TL7A 2V1UA 4O25A 5CDFA 1FUKA 2HDNB 4DB2A 2GJKA 1M34E 3LRPA 4MH0R 3SOPA 4Q4AA 3AV0B 4G3XA 3SJAA 1KO4A 1P2VA 2OFWA 1XXHB 2ZE7A 1E2IA 2IYVA 2VO1A 1KI8A 1MV5A 1LTQA 1OIXA 2O8EA 4C7OB 2GJSA 1MO5A 3C7KA 1E4YA 3CX8A 1AK2A 2PLRA 3DO6A 4HB2A 1C4OA 4P31A 4QG7A 3WBJA 2CL6X 2PZFA 1ESNA 3P27A 5G40A 2R6FA 4EPXA 4UJ5A 1JALA 1VG0B 1FTNA 1W0JA 4A9AA 4B33A 4DEYA 1UJ2A 5EP1A 1J7KA 4LJ9A 2LKCA 4EPWA 2GCOA 3KUCA 2D7DA 1VG8A 4URUR 1UBEA 2Q9BA 3RS7A 3SYNA 4MUAA 2ZRBA 1GIAA 1R10A 1CIPA 2QG6A 4QGAA 4JLOA 4GT1A 2WSSD 3FTQA 2Q3HA 3K0FA 1KDRA 2IX3A 1VYVA 2N46A 2BKUA 4DLTA 1IXSB 3ZZ0A 3QXJA 1FMLA 3FE2A 4U7DA 1G6HA 2WPDD 2CVFA 4M9ZA 3WNDA 3KQKA 1LF0A 2C9OA 1U8ZA 3IIJA 4NP6A 4MGKR 3DZ8A 3GQBA 1R5OA 5EJEA 3VHXA 1JB1A 3ADCA 4S35A 2WKPA 5K8UA 1II8A 2ZSEA 1KSFX 4LBZA 2REBA 4FINA 2Z6VA 4XIGS 1VHLA 2CMKA 4Q7JB 3FWYA 3B82A 1U2RA 2J7PD 4TYNA 3RRZA 3OZXA 2E1RA 1XDBA 1G8FA 4PC3A 1BMFD 5FOXA 4N0DA 3CKLA 5FOTA 3SQWA 1CEEA 1IXRC 4QBFA 1YR9A 3KB2A 4D25A 3CRMA 5C4MA 3RRYA 2A2ZA 2CE7A 2QN6A 2GKSA 2ZR0A 2IT1A 3GLHE 4XTRA 4XSGA 1UKYA 5LB2A 2J0QA 3NVAA 3DEFA 1XU4A 1W46A 2FSGA 3VFDA 1FQKA 1OYWA 3RRMA 1T3SA 2ODWA 3GEIA 2GXAA 3ZDQA 4LBVA 3OIYA 5AJZA 3TGPA 2ZQ5A 3O8RA 4AG5A 1NIPA 1Q57A 5EUQB 2A5DA 2Z4RA 3IBGA 2J0UA 4V02A 1Z0DA 2FN4A 4KU4A 4B71A 1PV4A 4B75A 1XTJA 3AVUA 3THWB 2WJYA 3KFVA 2REOA 4HDQB 1TADA 3CZPA 4OJQA 3RC3A 2PMDA 1AM4D 1EFTA 5BQ5A 3FDIA 5L3QB 3L43A 2CL0X 1MR3F 1N0UA 1XJCA 4KJZA 4LX0A 1GZSA 4XTCS 5FBWB 4P4SA 2ZSBA 3J81k 4EPVA 4ILEA 5AUQA 5KUTA 3FFBA 2P6NA 1XTRA 3CUEF 1DVRA 1II0A 5JHHB 5CYOA 3QKSA 2OT3B 2UKDA 2YWFA 1OB5A 5FI1B 1CR2A 1DAHA 1TTTA 1W36D 4HLDA 5H70A 4DCTA 1IHUA 3RS2A 2OEPA 3IHLA 4PXAA 3DKVA 1AKEA 4A0FA 2KE5A 1G8YA 5DISB 3RRNA 1K6MA 2ZU6A 3WHLA 1KDPA 2D2FA 2JCSA 4FXPA 4LCBA 5HPYB 3BH7A 4CT4B 1NJGA 3QKUA 1DO0A 3GLFA 4NDZA 3NBYC 4ZKEA 1CJTC 3CRRA 3BB1A 3TAHA 4V03A 2CCJA 4CT5A 3CLVA 5FBRB 2AL7A 5EXPA 5G53C 1GOTA 1OXVA 3TMKA 3GFTA 2XZOA 1N6IA 2ZVQX 2C96A 3K70D 3SJZA 5DH9A 2GDJA 3GMTA 3HJNA 4LBWA 5CIQA 4QKQA 4P32A 3NTUA 4YC7A 1AS0A 2HUPA 3I92A 4WZAE 5JECA 4UNQA 2VF7A 3D7MA 2EFDB 4WVFA 2WWXA 2QPOA 4NYMR 1TQ6A 2GHIA 621PA 3N2EA 1T91A 2GBLC 5AUNB 1KJYA 1NG1A 3BH0A 4LBYA 5JWOA 4GSYA 2O8FA 2IUTA 1AJEA 3LQRA 1KO5A 3OIWA 4JS0A 1LV7A 1G6OA 1SVSA 3UATA 4PHGA 4B35A 4GZLA 3BFXA 4XWAA 4EJSB 1NBME 3IQXA 5JCPA 1U8YA 3HWSA 2WSMA 3ZIAA 4GL2A 1KSJA 2W83A 2WSSA 2W6JD 1CR4A 1G3IA 5JRJA 1GL6A 4HB4A 5E4FA 2WJIA 1Z83A 2ZRHA 2HLDD 4BQSA 3GLIE 3M0EA 3THYA 4PC6A 4FN5A 1XPRA 2WPDA 4ESVA 1KI9A 4Q1BA 4KBGA 1NKTA 1ZUHA 3QQ5A 3U6BA 4N0EA 3B1VA 4OQLA 2BCJQ 3TAUA 2LCFA 4X8HA 2J87A 4BLTA 4LJ5A 2BJVA 1Y63A 2W0MA 2B8TA 3IPYA 1OYYA 2XOKD 3IDQA 2PMKA 1Z0KA 4RJLA 2J7PA 1C1YA 2ZJAA 1W7AA 1M7HA 1AGRA 1XX6A 2C03A 1FP7A 4B44A 4FIDA 3CWZA 4NONA 4LSGA 5HE9A 1BMFA 1Z63A 2AN9A 3ICQB 4IOLA 2QSZA 2CJWB 1XEXB 1GNQA 2C5LA 2V1XA 1TF7A 3UXMA 4DB4A 1XTSA 1P7CA 3QVVA 2RCNA 4HLCA 521PA 3R9XA 4OHXA 2DPXA 1QG4A 2ZI9A 3AEZA 4YMTA 4YMSA 2G1KA 3CRQA 1GUAA 2J0VA 3LW8A 2G3YA 2JLUA 1OH6A 3AVTA 5EXTA 4ASUD 3ZQJA 3LW7A 4ZIRB 2F55A 1YZLA 2RGBA 4NH0A 4CEJA 2BV3A 4GDFA 2NO9A 2H57A 4QXAA 1X6VA 4B32A 2BKEA 1OV4A 2A30A 2YC4C 3DM5A 3G0HA 4TYWA 3OEHD 2XTZA 1R0WA 5E3HA 1Z0AA 1MT0A 1E2FA 2FFQA 3BB4A 4JVMA 3FPAA 1ZNZA 1HV8A 2VSOA 1E6CA 5SZHB 1KI3A 1OFUX 1CULC 3AP1A 4KYIB 4Q9KA 3EPLA 2O5VA 3AF3A 4LYJA 5FOWA 3VU9A 2XX3A 2WIBA 2W0SA 4FMCF 3GJXC 2FEMA 4GP7A 4ARZB 1K8RA 3FOZA 3IPXA 3EIQA 4GBMA 4KFUA 4BLPA 1D8TA 4ZDJA 5JMTA 3IKJA 4MYTA 2I1QA 3PENA 3SE0A 2EYQA 3KJIA 1RVDA 1XBTA 4DXAA 1KI2A 4D4MA 4XWKA 4M1WA 4Q03A 5P21A 2YWGA 2QM8A 3GEEA 2G6BA 1PUJA 4IFBA 5FPHA 1GKUB 4TL9A 1KMHB 3ASZA 4PHHA 4YQFA 1W48A 2FV8A 2ZJ5A 4YDHB 5FOUA 5FUWA 3EPJA 1ANKA 3GD7A 4BLOA 3Q7PA 4KSCA 1HQYE 1TMKA 3SYKA 1KI6B 2YOHA 3AP3A 3BB3A 4RD0A 5DYGA 3AB3A 2V8OA 5EE0A 3CWQA 1IQPA 5CYPA 3BWDD 5B58C 1E9AA 1G18A 2BM1A 2QENA 1DAGA 2PLFA 1W36B 3NHAA 4LK2A 1COWD 4GMDA 3T61A 3ZS8A 1FX0A 4C0HA 5JSZA 3QEOA 3ZVLA 2R65A 2VQSA 4R98A 2OV2A 3T06B 2QMEA 4LHVA 4EKDA 4KODA 4WAUA 1Z28A 3T12A 3IEVA 4I1OA 3DVLA 3SHWA 5J47A 4BFVA 3NHBA 4DDTA 4EJSC 4OQMA 1ZM2A 1GILA 4GPTA 5HZHA 2BVNA 2C04A 1N5LA 2ODBA 1GNPA 2QUZA 5CLQA 2HCJB 2W6JA 3CH4B 1IAQA 4W5HA 3QOFA 5E95A 1LF5A 3KJEA 3PUZA 3X1DA 3SS8A 1US8A 3LFUA 2XXAB 1IN6A 2FPKA 3PIRA 2O8DA 3BH6A 2UVQA 2BM0A 3AKDA 3GP8A 2WMNB 3B85A 2JLZA 1G9XA 2NOAA 2XOKA 3WYGA 1HQCA 5D3MB 1E4VA 1VIYA 3IO5A 4X8OA 4TLEA 4KFSA 3RS0A 4C4PA 4QBIA 5CK4A 4KAXA 1JAHA 4HDOB 3CPHA 4AURA 4B47A 1KYIA 2V55B 4Q1EA 4AC9A 1JXOA 1L4YA 5AK0A 4G5OA 3A58B 4AG6A 2WAYA 4IOJA 4EQ6B 2CHGA 1DTSA 3M1IA 1E9EA 5FPSA 3BJIC 1Z6TA 2GETA 4Q66C 4TMVA 2IYYA 4QNMA 1Z5ZA 4LY6A 1E9SA 2B7CA 1ZYUA 3M6AA 1BO6A 1GL7A 4HAZA 2KBFA 1CKEA 4ASUA 1U0LA 5KNCA 1E99A 2G83A 4WIAA 4C0SA 2AR7A 1E98A 1CP2A 2OCBA 1NN0A 3KXKA 2EFGA 3OAAA 4UNPA 4QJ3A 5F9HA 2I3BA 5DLQC 4KYUA 2ZPTX 1WXQA 1A82A 2ZJOA 2C2HA 1G7RA 1EFHA 3W8NA 4A0HA 3I62A 1UF9A 3MJHA 3X1ZA 4JT4A 2CK3D 3F0TA 3R9IA 4B2LA 5TDHA 3BRWD 4O3MA 2J0SA 2NIPA 1VDZA 3O47A 3HR7A 4M1MA 4V0MA 5FL3A 5EP3A 1XEWX 3L8ZA 1RRFA 2EYUA 3F3YA 2EFHB 4H1UA 4IW3B 5KPJA 1XP8A 4US2R 1OH7A 3MCAA 4FWTA 2FGJA 3HPQA 2QSYA 5DI3A 3AVQA 1S8FA 5C18A 4B73A 4M4SA 1VHTA 3SC3A 2IS4A 2MSEB 1Q3HA 2ZTSA 4URWR 2A7QA 3TH5A 5GVRA 1E2NA 1KAOA 1G3MA 3KUDA 3A6PC 3CZQA 3OEED 2NG1A 2YOGA 3IO3A 4M1KA 2YNMA 2B8WA 4P33A 5EXXA 5KPDA 4EFLA 2OLJA 3AH8A 1FZQA 3DOEA 5C46F 2GEVA 3U4QA 1JECA 3GFPA 4PZZA 2V3CC 1QG2A 2GAAA 4M9XA 4R71A 3VQTA 4A6PA 2JLYA 1N6OA 1E32A 4PO1A 2ZYTX 4IKEA 4EPRA 5L3SB 3PEUA 1S3SA 4DZZA 1UFQA 3AF1A 4CEHB 3HP1A 4QGFA 2WV9A 4UJ3A 1W4BA 1W36C 3ZD6A 1BS1A 4RFSA 1TEXA 4BZPA 3JZMA 1KJWA 1COWA 3QY0A 4D0GA 5JFGA 1EFCA 1P2TA 4LC0A 1DARA 2J7KA 3G5UA 3RS3A 5JRZA 2F1HA 3GLFE 1N25A 2GXSA 3GLGA 4B43A 2IBMA 2RGEA 5K8LA 1DBSA 2EWVA 3GFOA 3X1XA 1A2KC 1XD2B 4Q00A 2ORVA 2ZRIA 4LJ8A 1UM8A 2IYTA 3LLUA 1OB2A 5BW8A 1RRGA 3ZVMA 1XRJA 1ZM3A 1EFRA 3NBXX 4W9MC 4BFUA 3K70C 3LY5A 4MKIA 2QA5A 4A1FA 3FMPB 3R7WA 2XEXA 3LBIA 4W5WA 4BLQA 1RE0A 3VR2A 5FI0B 4MYCA 2QRNA 4DDWA 4I99A 3THXA 1FW6A 4PZLA 3VMFA 4OHWA 1P72A 5CB6A 3T1TA 1UAAA 5CJPA 2QGZA 4LYFA 5KSZA 2JASA 5GJVC 1WBDA 2QAJA 3RS5A 2F3TA 1FTSA 2RGGA 2ONJA 4C2UA 2IYRA 4MYUA 3EWSA 1VYTA 5AUPB 2AFIE 1G41A 3AGQA 1A2BA 2Z0MA 2WJVA 1KDTA 2XZPA 4NYJR 2IHYA 3K9HA 1Y3AA 1GRQA 2BIFA 5JS8A 5C2JB 3D31A 1FNMA 5IK2A 1QHXA 3R8FA 2BBSA 1WA5A 1NNEA 3BK7A 4PR0A 1Z07A 4DUGD 1Z2CA 1I2MA 1TU4A 1D6JA 1R4AA 4KVAA 4ZI2A 1W5SA 1KTVA 3C5CA 1WP9A 1XFAA 3QKRA 1SVOA 4TYPA 3QVUA 4OI1A 5G41A 4Q7MB 4JBXA 3BE4A 3NXSA 4MITA 4ZV4A 2DHRA 4IVPA 1W0KA 2ANBA 3R20A 3O8BA 3EX7C 4P0TA 1B0UA 5FOSA 4JIMA 3CX7A 3BIFA 3HR8A 5DNYB 1G8PA 2RGXA 2BBOA 2GF9A 4K81B 3CH5A 5H8WA 2W58A 2WWWA 1RRPA 4DCNA 3I8XA 4YMVA 4OYHA 1S2MA 2CK3A 2JA1A 1R0ZA 3DL0A 3LX5A 2O8BB 4DIEA 1VYUA 4Q4HA 5L3RA 3VHLB 1F2UB 5DO9A 1CR1A 2YHSA 1S96A 4M8NE 4PTLA 5KSYA 2DY1A 2V7QD 1W44A 3OFND 3SJBA 4RKEA 2MSCB 5DI9A 3WP1B 4B2PA 4N3NA 1NN1A 4URVR 3AF4A 1JR6A 3SFZA 1VECA 2AK2A 2P67A 3RLFA 3WYAA 3AVVA 1W4AA 3B1XA 3NEJA 3CNNA 3W6NA 1BIFA 4AYWA 2VHTA 1ZCBA 4MRNA 5GADl 4ZO4A 1E9DA 1E2HA 3A1VA 3OEEA 4D82A 3B7GA 2AKAB 1JAIA 1ESMA 2BMDA 2Q9AA 5J4HA 4GOXA 4L16A 4BECA 5BWMA 2F3RA 4Q4LA 1U0JA 2OBNA 1H8ED 3I3SR 1YRBA 2C9CA 4RD3A 1EG7A 1D2EA 1Q12A 2IF2A 2XSZD 2GZDA 3ETLA 3EZ7A 3A1UA 3I8SA 3PR1A 4HZUB 1KOFA 4LZZA 4V0OA 1IN8A 4JL6A 1YZNA 2J5XA 4RD1A 3M4YA 5LB4A 1BOFA 4Q1DA 3ZZTA 3OIUA 1Z6YA 3DMDA 2D62A 2PX0A 2P5SA 3AP2A 5DHFA 1BYIA 1Q22A 2G9NA 2FPLA 3EC1A 4BZXA 5JBQA 3QF7A 1VMAA 2IYZA 2C95A 4YMUA 4X8MA 2OCYC 4W5JA 2C78A 1DAFA 3TQCA 1KSHA 4RZ2A 4LJ7A 1Q1QA 2B7BA 2H16A 3VKWA 1XPUA 1MABA 1G5PA 3KFXA 2BHRA 1JR3D 1P73A 1E2EA 2QP3A 2XB4A 2PCLA 4PSAA 2H18A 4U02A 4RKFA 4O2RA 1XCMA 2JLRA 3ZIAD 2QP4A 4XOIA 4BWYA 1EFUA 4LOAA 3EA5A 4NCIA 1T4GA 4Q4AB 2YINC 2FX3A 2VP4A 5FPYA 3NWJA 3ZQ6A 1ETUA 4M0LA 3ZD7A 1IY1A 3TRFA 4AKGA 1WB9A 2O8EB 2Z43A 1DPFA 1E9CA 5KTYA 2OILA 3TIFA 2ZI3A 2NZ8A 1HTWA 2SHKA 1Q1ZA 4U00A 4Q9HA 2ZJ8A 3HPRA 1ONBA 3KDSE 3NC1C 2IXEA 3WHKA 1IJFA 4LPKA 5M04A 2XTNA 4CEIA 2EFCB 2KI5A 1W4RA 4TN1A 5HTKA 4D0NA 1NMYA 1ZP6A 1ZW6A 4OQNA 3C15C 3FKSA 2GCOB 1ZUIA 4PAQA 2G0TA 4KI0A 1RJ9A 4QRHA 4E03A 3CPEA 2X1VA 1OIVA 2FEOA 2QRZA 1KIMA 4MYHA 2VP5A 4DUGA 3K0CA 3Q85A 3U7FB 2VF8A 1Q1EA 2RHDA 4RY2A 2OXCA 4LI0A 4LC1A 1QBKC 221PA 1P5ZB 2FH5B 3RS4A 4M1OA 3KTAB 4ZCLA 4D0LB 1GTVA 4IDPA 4DEXA 2X77A 1U0HC 1UEIA 4JL5A 2QBYA 1KMQA 5IT5A 1MOZA 3QPWA 2KWIA 5A4JA 2QORA 1WMSA 4NYJQ 1WDTA 2R6GA 3ICEA 2RGAA 2YYZA 1DEKA 1TUEA 4Q1AA 1UBCA 1VCMA 4QNRA 3EC2A 1U9IA 4LV6A 3U44A 3PUVA 5IDVA 2ZROA 4NPHA 2ZRLA 3QG1A 1QHIA 1H8HD 4URZR 4D80A 2V7QA 4L9WA 3OFNA 4P4UA 3IEUA 2ONKA 1DAEA 1J90A 3AKCA 1NVVQ 1Z2AA 4RVCA 1Z0JA 4S2EA 1UEJA 4C0LA 1WCV1 2ZRKA 2ZRMA 5L3VA 1OE0A 121PA 4JMPA 1T5IA 3I72A 4PZYA 1AQUA 4M2LA 1CXZA 4HLUA 1IM2A 3U60B 3B9PA 1C9KA 721PA 4IRUB 4URYR 1I4LD 2DB3A 4OI2A 5G3ZA 5FH9A 4JLKA 3DM9B 1PVOA 1TQDA 4Q7KA 2GK6A 1G8HA 2DWQA 4B3BA 4B3XA 3TSZA 4DKXA 1D2MA 4V0ME 3IHWA 1H8EA 2IYUA 4X8LA 5FTNA 3PEWA 1LS1A 4US0R 2J0UB 1X1RA 4B3CA 2FZLA 1SVLA 2HYDA 2XSZA 3KKQA 3W3AA 4G0NA 4A0GA 4WXRA 1NRJB 4HB3A 2ORWA 2X2FA 4ACAA 3TSWA 4Q4JA 2ZETA 4PO8A 1R0YA 4A8JA 1GP2A 1H65A 2CVHA 4BEBA 5FTLA 4RSGA 1ZU5A 4P4SB 4QHSA 3TKLA 2F7SA 1TAGA 1VG9B 2VHCA 4DIDA 2YOFA 5FUVA 3W34A 3QENA 1LB1B 3AVPA 1MO4A 1SULA 2ERYA 1L2TA 4E07A 1ZVQA 3QKSB 4TLAA 5DE3A 5HKKA 2YKGA 1D5CA 1T8TA 1A1VA 4BFTA 1KJZA 3E70C 4TYQA 3FVQA 4NBSA 1ZM7A 4MDFA 2JLVA 5FR2A 4NCNA 3N70A 2H1LA 2IK8A 3K9LA 2OO7A 4JYBA 4LJ6A 1JR3A 3LH5A 1HURA 5E7MA 3FKQA 1XNJA 4RD2A 4XVQA 5FBQB 1XCPA 3U6KA 4PFSA 4AYXA 1HYQA 3GLFB 5A0FA 2AD5A 2JLWA 1XJQA 2OBMA 1FNNA 1XMVA 1XMJA 1EWRA 3K0AA 1J8YF 2WMOB 3C14C 4OHZA 4DCVA 2Q21A 2HT1A 1G4UR 4A92A 3GLGE 1OFIA 1XB2A 4NMMA 4G01B 2A3RA 3HU3A 5CIWA 2HEIA 1T5LA 1E3MA 1V43A 5DN6D 1W4CA 3KKPA 1RRCA 2JIZD 4EDHA 2ZUDA 4NCJA 1X8LA 4HAWA 3SI7A 5A5GA 3B13B 3QXXA 3VTKA 3Q7QA 3QPVA 3K0SA 2DWPA 2ZI5A 3D6TB 4FCVA 3BFKA 3GJ3A 3SZRA 2WKRA 3O8CA 1O3YA 4Q5IA 1XD9A 2O8FB 2DFTA 4BFSA 1Q1BA 1ZM4A 3PCRB 2GA8A 1CBUA 1IY2A 1IN4A 5BN3A 2ZANA 3EXAA 3P4YA 2BMEA 2QE7A 3LO5A 3ZGXA 3Q3JB 1G17A 2R62A 4LJ4A 3MSXA 1IN5A 4AWXA 4P4TA 3KJHA 4IVRA 2UZIR 3IILA 2C8VA 5JLJA 1KK1A 4BLRA 2OCAA 1LW7A 5FPTA 3SFVA 4WXPA 3ZZUA 4EFMA 3THYB 2PJRA 2VBCA 1M8PA 3KL4A 4PQRA 1P3JA 3EA0A 4GMXA 1NG9A 3GJ7A 4ITRC 2D2EA 1YVDA 4Z8YA 1X1SA 4IHQA 4KFTA 1F2TA 1SHKA 2NPIA 3OAAD 4QFMA 2I1VB 2B92A 4ZI3A 2CCGA 4JLDA 3K1JA 1H8HA 4TMXA 1NY6A 3PQCA 4FW9A 1QHHA 2FSIA 1MRNA 5TY0A 3MG9A 3P32A 4G5GA 4PPFA 4UNSA 1R6BX 3AUXA 1AZTA 1L8QA 4M22A 1A5TA 1JEEA 2WWFA 3ND8A 2GRJA 3TW8B 2ZU0C 4GOKA 1P4SA 3GJ4A 2IYWA 3NIBA 4XJXA 3NKVA 4EPYA 3GJ8A 1UKZA 4TZ6A 1JJVA 1G16A 2F1IA 2PX3A 3LXRA 3AQ4A 3B9QA 5HE8A 3TUZC 2ZXUA 3U5ZB 1KK0A 4CEJB 1E1QD 2KJQA 1YJ5A 2ZRPA 4JVSB 2HJVA 2ODNA 4MKGA 1AIPA 1RYHA 2AK3A 1CRQA 4JVLA 4QJ4A 2H8KA 2H7VA 1F6BA 2BBWA 1GITA 3GCGA 4Z54A 5AJXA 4FD2A 2F43A 2N42A 4FCTA 4AYTA 1E2DA 4OKSA 1CJVC 2ZR9A 1FQJA 3CO5A 4DSNA 1YR6A 4FMDB 2HYIC 1XZQA 3BGWA 2O0HA 4I1VA 5AR1A 1BKDR 1S1MA 4HAVA 1W2GA 2CL7X 2FF7A 4B6EA 2XNSA 2VIIA 3CM0A 3SBEA 1NMZA 3CR8A 3UANA 4QM6A 4WW0A 3VU9B 1XTIA 1EX7A 1KY3A 3A37A 5CDFE 4F38A 2ZRFA 4PPNA 1YZUA 4HAYA 4WOPA 2JJ1D 1KGDA 4TTPA 4GFDA 4PAMA 2PT7A 4KSBA 2JLXA 5E7IA 3Q5EA 1GDDA 2D4HA 1YRAA 3C41J 4Q48A 1ZAKA 5C4GB 3EAQA 3EZ6A 4DLWA 2P6UA 4JSTA 1QVAA 2A5GA 2EW1A 4FWIB 1QF9A 3P26A 5EQTA 2O8CA 1IBRA 4TMWA 3W3ZB 2G0NA 2W6ID 3GJ5A 4JZKA 4YLGA 4IXNA 3TK1A 1NBMD 4M21A 1F5NA 1FPMA 3H2YA 4B34A 5B57C 1EWQA 1Q21A 4DT1A 4JJKA 1EFRD 2VEDA 2PZEA 3CPJB 3JVVA 4JBWA 4LV5B 3T5GA 4D4JA 2OESA 2W00A 3K70B 1G3UA 2YC2C 2RB4A 3C16C 1HA3A 1G21E 1DAKA 4RD4A 3K9NA 3SEAA 2GVZC 4M1YA 4NE2A 1GM5A 5CK5A 5DN6A 2WWHA 3QG5A 4HUQA 2JIZA 2YZ2A 4MQBA 4O0MA 4EFNA 3LBNA 4NYMQ 4E5UA 5EZ5A 1E9BA 1FX0B 3SDZA 5JSZB 4JLBA 4JKYA 2X19A 4MRRA 4V0NA 3T34A 5C1BA 1NKSA 2HV8A 3HYRA 1UPTA 8OHMA 3C4JA 1D9ZA 2OXRA 4PO9A 5DHAA 4AY2A 5IK2D 1IJEA 1NI3A 5FL7A 4QHTA 3WMGA 2HF8A 1XF9A 4C0JA 3ASYA 2WJGA 3EZFA 3C8UA 4BRWA 3O8DA 4DDVA 3KX2A 4K46A 4OBEA 3GLHA 4FMBB 2ZE5A 3W6OA 1N6NA 5CITA 3RHFA 2IF0A 1N2CE 2QAGA 1ZNYA 2QL6A 4EPTA 1U94A 4M1TA 4TLBA 1W0KD 4BFXA 3PXGA 1E69A 1US8B 1IOZA 1KSGA 5B64A 2O8DB 3JZAA 2GZHA 4F92B 1SXJD 1TEVA 1ZUNB 1A4RA 2XITA 1P9WA 1AGPA 1XMIA 4ZCMA 4MGZR 1ZNWA 3AGPA 2QPAA 5F9FA 1P9RA 1XEFA 1ZM9A 2E9SA 2WKQA 3AM1A 1NP6A 4JT2A 4B6FA 1CRPA 2ZS7A 1G5TA 3MMPA 4HDCA 1OSNA 3QF4A 1KZ7B 1NVXQ 3MRSA 4P3YA 5KO2A 1E2QA 1GRRA 4IOMA 4DLSA 4A0RA 1IONA 4GP6A 4KVGA 5JJIA 2P65A 2A5FA 1YR8A 3QKTA 4MKFA 3CBQA 1QHSA 2FOLA 1M7GA 3FMFA 4EIWA 4Q47A 4LHWA 3SN6A 3V4RA 3OHMA 4M9SA 3WNCA 4ZDWA 2ZYUX 3TUIC 5J4LA 3AVYA 3VR6A 4UXIA 2BJWA 4B3DA 3CRW1 4IVQA 4KCGA 4NYIR 4MRPA 1UBGA 4BASA 2ZUBA 1E1QA 1R8QA 1VCOA 1M6NA 5LDDC 1F48A 1V5WA 2AXPA 1MH1A 2ZSDA 3RC8A 3BORA 2ZITA 1UBFA 1JPJA 1Q3TA 1G291 1GWNA 1N6HA 4Q21A 1P9NA 3D8BA 2AWNA 2BMFA 2Q9CA 3I5XA 2VL7A 3CNOA 2P6RA 1HE1C 1TUIA 2ZYVX 5FBLB 1J70A 1IXZA 5KDOA 3GJ0A 3LDAA 3RVBA 4NHOA 2BMJA 4GRAA 3LVRE 4F7WA 5DI3B 1GNRA 4HYYA 1VKJA 3VR3A 1P2UA 4DHEA 3IGFA 2J45A 1E79A 3VNVA 3G82C 2WJJA 2FFBA 6Q21A 1D9XA 2RGDA 1II9A 2JJ1A 2NO1A 2WHXA 3KXLA 4G5QA 2NO0A 2QZ4A 3REGA 2OG2A 3QXCA 2GAOA 3PG5A 2IS1A 5SZJA 4IDHA 2QY9A 3MWKA 3LXXA 4I4LA 4PHFA 2CHVA 3Q5DA 4IDOA 2P0EA 2RGCA 2W6IA 4W7SA 2IW3A 2ANCA 1BYUA 1NBMA 1X86B 2A9KA 2H5EA 3ZVRA 1OHHD 1N6KA 4D2IA 1U98A 4Q01A 2ASEA 1ZD9A 4JLJA 4XVRA 4MA4A 2XGJA 4MGIR 2RH5A 2V54A 2D74A 1G7CA 1OF1A 1W5TA 2FZ4A 4HZIA 3WBKA 3LLMA 3GLIA 3IIKA 1RYFA 3D3QA 3QBVA 2EFEB 2VHQA 3VR1A 4XWOA 3PUXA 1G19A 4KBFA 4RFSB 2WOJA 3K09A 1E1RA 1JR3E 1FOEB 5KHOC 2ZS9A 4U5XA 2FA9A 1P60A 1R8SA 3GLGB 1KAGA 4WZ6A 2Q6TA 5GVSA 1N6RA 2RHMA 1MO3A 2BEKA 2VP9A 3QIAA 4IDQA 2RGNA 4DCSA 2AHOA 2D7CA 1Z0IA 1SVWA 1AQYA 1CTQA 3WXMA 4LRWA 4OHVA 3FKSD 5TMPA 3ZLJA 3IIMA 2YJTD 1KI4A 1W2HA 4CRWB 5LD2B 2JATA 3UPUA 1UKEA 5IHPA 4PPGA 1XEWY 5K8IA 1ZINA 1JXMA 1ZNXA 1FL9A 2X2EA 1Q0UA 3L0SA 3R7WB 3UIEA 5GJWC 2D06A 4TL6A 3THXB 3LVQE 2CXXA 1GG2A 3UG6A 4Y0AA 3V00A 2NQ2C 4M9QA 2WJHA 1WBBA 4IDNA 1PZNA 1SXJA 3BOSA 2EU8A 1HUQA 3CW2A 4IEEA 3FHCB 4RZXA 2OSBA 4MRVA 2OFOA 4JLMA 2XNDA 4IXMA 2C77A 5BYJA 1X3SA 2OFXA 3P20A 3MD0A 4Z1MA 1K5DA 2I4IA 1G7SA 4OK6A 3CF6R 1A7JA 1E9RA 5HCIA 5JI3E 1EGAA 4ON9A 2OE2A 4HEJA 1R5NA 2PZGA 1G3QA 3QKRB 2BDTA 1NLYA 1TF5A 3S1AB 4J0QA 1TQ4A 1XMSA 2AKYA 2V4ZA 3H4MA 3NBFA 5DGXA 1RFLA 3QXSA 4RZUA 2ZRDA 5DSZA 4LHYA 4DLZA 2OUKA 2W2XA 2XAUA
chains in the Genus database with same CATH superfamily
2XWBF 3KWJA 3W2TA 2ZK7A 1ORWA 4Y2HA 3SF8A 3TOXA 3FBWA 1OGYA 4M53A 4BO3A 1XXHA 1ZMXA 1ZXBA 1C3OA 3L5OA 3LY9A 1G3RA 4ICIA 4UXJA 4U6SA 5I7RA 5LOVB 1YXMA 1T3LA 4WCFC 4ZV7A 3AO0B 4GI7A 3B5JA 4ERNA 2XJ4A 3RKSA 3W3AH 4JUCA 4Q02A 2XT6A 2YWHA 3HZHA 3QIVA 4WDQA 3I61A 1ITZA 3EWNA 4ZK6A 1G2OA 3TF5A 3PEYA 1Z2NX 2PANA 3GBSA 2X6QA 3PV0A 3FMOB 2GZRA 2JBAB 2X9GA 1NQWA 1L5MA 2ZAOA 2FRVA 3KSRA 2ACKA 4J0GA 4X94A 2ZSAA 3ANTA 3SKXA 4E3WA 2AF3C 4WBNF 2IXAA 4FFWA 1HM5A 3HNPA 1GA6A 1PEDA 3MM4A 1EVLA 4MV0A 4PYJA 3U61B 5ECDA 2Q7OE 2FGKA 1A5AB 2IP1A 3LA6A 3M5WA 1G42A 1MNQA 2BTQA 1ELOA 2QTMA 2ZS8A 3FGPA 3EGVA 3KBBA 4WBSA 3DA8A 1WZIA 1NVWQ 3ICPA 4LMRA 4RCYA 3JRNA 3CF0A 1OPXA 1DQSA 2X0NA 1AS2A 1U8FO 1J56A 2Y1DA 1URPA 2QU8A 2ZJFA 3N1UA 1ULHA 4NYIQ 3MT7A 1U9ZA 3TUJC 3ABZA 1JAXA 3A9VA 3K8YA 3TOVA 4JLPA 2CNDA 1KORA 2VF5X 1TX4B 3ZZ1A 4F60A 4TN5A 4II7A 3ZE1B 2VDRB 1MGOA 3H0KA 2X6RA 4F93B 3EW9A 3F7TA 1L5VA 3W9UA 1TT5B 4AJNA 4FNAA 4WINA 5C1DA 5KOJA 4HD8A 4XX1A 1YOBA 1OHHA 4IEFB 2LD4A 3RG8A 3CFYA 4QE3A 4Z86A 1W85B 3I6QA 4WGFA 3CLUC 3MF4A 3DAFA 1JJ7A 1ZRMA 4XZ3A 4X61A 3L7CA 3SOZA 4E2XA 3AVWA 1P2SA 1QX3A 2CXSA 3ZWYA 3DZKA 2P4SA 5C8VA 5J40A 3ZHCA 3G59A 1T3HA 3OOJA 4BCBA 5IAOA 1TVCA 1V6SA 4H1WA 3AIIA 3FYUA 1THZA 4G1UC 3DS8A 3MCZA 2MHCA 2VUHB 1QCZA 3EQZA 1VLLA 4I1UA 3DWFA 4FONA 1YS7A 2BM8A 3SR0A 2XMCA 3FPJA 3I0ZA 3QI7A 4IILA 2BD0A 2NU6B 2WVHA 2IYLD 2JJ8A 5K8TA 2HBYA 2UXDB 2EWMA 4JI3B 3N05A 3SR4A 4DNQA 3FNBA 2QJOA 4YXWD 4F85A 3IA2A 3NIWA 2N9UA 2VHUA 1F0YA 2Z8YM 1UK6A 3P52A 4J9UE 3ZHYA 2PRIA 2HJWA 4ZO9A 3DWIA 4F3YA 2BP7B 3KHUA 3AUAA 3F5SA 4CKWA 1JHMA 2GYWA 3V80A 2E4AA 4MXDA 5CT8A 2Q7DA 3G49A 4X84A 5LD2C 5ELXA 4RD6A 1JG3A 1ULZA 2FPOA 2OLKA 3LPNA 2QE7D 2ZYDA 4BBZA 3QFSA 2YWEA 2OBFA 4G9EA 2CCKA 2YCLA 4ND1A 4PRZA 4U0KA 3OPXA 1WZ2A 4FE3A 1NUAA 1ISJA 3PEVA 3K0FB 4G1VA 4LHSA 4WCVA 5E6UB 2CV2A 1N5JA 3THWA 2QNRA 3KZXA 1V16B 4JVNA 2CBXA 4ZMSA 5LVAA 1N2BA 2A3NA 3U7EB 4Y30A 3G1UA 2QGNA 4U2FA 4YJGB 3X2EA 1NT4A 1PQ4A 2QP9X 3E9DA 4LE2A 3V9PA 3ZLUA 3DLPX 2XIJA 3KVRA 4YR9A 1AQ6A 1PJLA 3BREA 1O87A 4U7PB 3AV3A 1DADA 5EL0A 1RJGA 2QQ0A 3TLKA 4EAQA 3DBOB 4M99A 1DUVG 1P7VA 1VB5A 2ZE6A 5GTDA 5ITZB 1W47A 2PLWA 4N1AA 4OHRA 4AKIA 3OCUA 1UKVY 2QRJA 1F8FA 4M1SA 5JG7A 2XZLA 3HZOA 1LCIA 3NHRA 1RJ9B 2C9YA 1RPTA 2BGNA 2OY0A 1DC6A 4JSYA 1X9GA 3EXFB 3F8TA 3WQHA 1H42A 4Q15A 4A7PA 4UTOA 1WOYA 5KTPA 4FW8A 1VLJA 4GWLA 3HDGA 4C2BA 4AKHA 1N0VC 3WYEA 5JDIC 2GM9A 1FYWA 4XUGB 1P61B 3P2MA 1CX9B 1HEIA 3DGFC 3P71T 4MMXB 1YZQA 4TRRA 3HMQA 4AIRA 1QIJA 2NTYC 4FGJA 3OO1A 1TUGA 1AN0A 2P9HA 2YQZA 3H1EA 4WZBB 3BN3A 3NU1A 4WA8A 1ZU4A 4LXYA 5T4BA 5FUYA 3MAAC 3NH6A 4CDGA 3Q9SA 1IN7A 4QU5A 3K53A 2VUIB 1YJQA 3BMNB 3I9JA 2PAAA 2VHVA 1KK2A 1TM5E 2YJ3A 2AVNA 4JCOA 1J2YA 4MV9A 4C4SA 1D8AA 1SHZA 3E48A 4O4HA 3HRIA 4F4CA 3HB7A 4EG0A 3JY6A 3EXEB 2H5JA 3CEAA 3D9QX 1BH2A 1QBGA 1Z6XA 4E1BA 1TOAA 2RGWA 5JO0A 3U3ZA 1OTYA 4TSKA 3VJMA 4RJ2A 1NSFA 4UXHA 3Q8LA 4YRIA 1KI7A 2G9UA 3G0IA 1TNDA 1T2UA 1YR2A 3L7DA 4HZGA 2F9LA 2I5PO 3C24A 3NQ41 5G1OA 4KC0A 4EM6A 1OKKD 5KS2A 3OZRA 3QHAA 3KZCA 1VBKA 1BVUA 4G8DA 3SHTA 2QMOA 2A7XA 2K5UA 4W8HA 5JJKA 1NVGA 1Z8HA 3HA7A 1Y4SA 1T6NA 1BW9B 2M6SA 3KTDA 4X1KB 3R5KA 4B0OA 4ZAVA 1NSTA 2TMGA 1ENOA 5TRTA 1IUPA 1CQJB 3WGUA 4C08A 3O73A 2BJHA 4DBLC 3LUBA 3ZG6A 2P2LA 4ZYVA 4NCBA 1V8FA 2YWJA 1TTPB 1U04A 2OYSA 4BJ1A 3ECAA 1TM3E 4MGYR 1GFWA 3RS4A 4XDGA 1CY0A 1KNXA 3GEDA 3HJBA 3LKDA 4QOSA 3EXG1 4TV9A 1PLLA 3SZUA 3ETEA 3EVDA 3JR3A 4I81A 4L95C 3VKGA 4CGZA 5EMLA 1GUDA 2IYSA 2XMZA 3M5CA 3HU2A 3MTEA 2CLCX 2YN0A 1RJWA 1USUA 1XZHA 1XNHA 1ZSYA 2E82A 3KOZA 4FHZA 1IBMB 3GGJA 2M1ZA 2QQGA 3LV8A 3NHSA 3PXBA 2BSXA 4GNKA 4X62B 2VZLA 4DW8A 3V34A 2NAFA 2PS3A 2XF8A 2Z9BA 2XUQA 4FZ5A 2C57A 4MW7A 4O2LA 5JNUA 1OILA 4J0HA 2VWGA 2OAQ1 3IJPA 2JHFA 5B58T 1UT5A 2GSDA 4DSOA 1N2OA 5HBRA 3HYSA 4E32A 1L4UA 1OFHA 3FFAA 4J9VA 1MOPA 5EUCA 3IV9A 5I8PA 4JJZA 3KKOA 3WZ2A 4DR6B 2FX2A 3UWKA 2O2EA 3FCAA 1J8MF 1U2GA 4B76A 1OXSC 1U81A 3ROQA 1SZJG 2JBHA 2AFIA 3V33A 4I19A 1UK8A 2Q6KA 3LTEA 5D00A 2YFHA 1KVUA 3F4KA 4F4IA 3D2AA 1VJDA 5LC1A 2XMDA 2XWJI 1DXOA 3G9TA 1HX7A 1V37A 3NBKA 4O2AF 4FMCB 3G0OA 3L0IB 3ZEIA 4I9GA 1FFBA 2CNKA 1PR2A 2WZQA 3TR6A 2O57A 4KXFB 1ZD3A 3RTGA 2H29A 4DV6B 3SS7X 5HIAA 1ZJ6A 2WINI 2BW0A 2H5LA 2JAUA 3EGXA 3IDOA 1Y4ZA 2H7CA 5JXHA 2WOOA 3CX3A 1WTAA 2OM2A 2HSGA 1ZBDA 3NALA 4BO9A 4KHZA 2A94A 2A9FA 1JHXA 3LMKA 4N76A 4FZ3A 4L15A 4C03A 1OAAA 3BYZA 2H08A 2FZCA 2VPYA 2IYQA 3PE4A 1ND5A 4HWOA 4EECA 3W1EA 5KNCH 4ISCA 2DFLA 1BH6A 2IWRA 4WKCA 1XZ8A 3MLBA 1K1EA 2W2VA 3H84A 4M86A 4JYPA 4AUEA 1W88A 2IHUA 3GT7A 5DLDA 1Z5GA 2VHZA 2Z5FA 3TE6A 3D7KA 3GP3A 3HU1A 2Q1UA 1C3XA 4XVUA 4C7VA 1KRWA 3T4XA 2EQ5A 5SZIA 1KJ9A 2PJZA 4CTOA 4Q9IA 2VWHA 3HDHA 4YAFA 1VIMA 5HR5A 2V7WA 1OA1A 2X42A 4KMOA 1O96B 3OM9A 1KE1A 5JCZA 2PSHA 4HJXA 5FLYA 3TBFA 4UZFA 5A7FA 3QYAA 5CDHA 5LQKA 1VPWA 1CIJA 1WMFA 5BN3B 3F6PA 4HDRB 3K0CC 2BHSA 4L9SA 1Z39A 4QYIA 2Y1XA 1TKAA 3WMEA 1MJNA 3AHIA 1HLFA 4QAQA 3OMWA 2PCJA 3WWYA 3CNBA 1OASA 3BZUA 1SXJE 1K7CA 3MELA 3E3NA 1YA8A 5AO9A 2C82A 3RUPA 1TTHA 1IOVA 1XCGB 2HRZA 4ES6A 4DKJA 3WK4A 1JLLA 1N8KA 2Q0XA 5JO9A 3SC6A 4IMIB 5CA1A 3SVZA 1ORTA 1SU7A 3LQ4A 3TRHA 5D3ZA 1ABEA 1M9NA 3RD5A 2OZKA 3VNQA 5J4YA 1VI6A 3CF2A 5I6DA 1L4KA 4QGHA 2FMIA 1RC0A 3HGMA 4B74A 5G0UA 3M6VA 3KFLA 2NO5A 4ETNA 1GAXA 3BBLA 1A04A 3FRHA 1XTZA 1QHGA 3PUKA 2VH5R 2V6BA 1EGVB 4UUNA 1WQ1R 2Y1OA 1IVNA 1M2KA 3LX4A 4BMPB 5JYEA 3LCJA 2CWDA 4MROA 3OESA 4OB6A 4YUZA 3ESQA 3R0QA 4YAGA 3D64A 5D1HA 5EUMA 4OLAA 3GEHA 3H1TA 2JW5A 4HTFA 4C0BA 3ABSB 3SIRA 5KCZA 2W2TA 2XYPA 4LDJA 5AXCA 4MR8A 1T29A 2XCUA 4K8RB 5IVPA 1DAIA 1GUZA 1YULA 2CZGA 4W5RA 1Z22A 2W93A 4HLUC 5GOTA 3ND9A 3EDQA 3QVMA 4JBNA 2HRDA 1TA4A 5AI9A 4R1OA 2I91A 1XXHE 2CE2X 3MFYA 4QLOA 1JBKA 1SZDA 4PX5A 4M0EA 2OOKA 4XR9A 4E09A 2I6FA 1EM6A 3K1AA 3EF1A 4JASB 3J80A 2JHGA 1IOLA 1THTA 1APBA 3IUPA 4PQYA 1LSUA 2GPWA 3RSQA 1NVTA 2XVAA 4ND5A 2G1AA 1G5RA 4KDCA 5KTNA 2X2OA 4YYEA 4LJLA 4LRYA 3WLAA 2D1YA 1TYEB 4HEHA 4BWVA 3L0PA 3SBDA 2GJ4A 2HF9A 2QVBA 2E5WA 3FSEA 2VYCA 3E84A 4MVYA 5LZ7A 3RBVA 3TX6A 4OI0A 5J23A 1V3VA 3CX6A 5JAIA 3QI2A 1K7SN 1VBFA 2AVDA 4G4SP 3ROGA 1E63A 5ELMA 1TCVA 1WKCA 2GZMA 2OAGA 4Z51A 5CFNA 1LQUA 4LVNA 5IAJA 4CIAA 1HE8B 4AU1A 2BAGA 1T8RA 4A82A 4V38A 3O26A 1S2LA 1H4VB 3GN1A 3ZHUA 2HIAA 2IFTA 3WL6A 3TRJA 5BW4A 1W8IA 3UKJA 4ETWA 3TXAA 4DQUA 5DIFA 2ZZNA 3PC8A 5FLXA 3W5SA 4BV3A 1L4EA 2PYDA 1XTUA 1C80A 3QPAA 2H4JA 1YUMA 1ZITA 5EVJA 4YMWA 1N92A 4RENA 5DNAA 4DIMA 2CLMB 3EZNA 4HMOA 2UZAA 4EQ6A 5KKCA 3BWMA 3ACCA 4RIFA 2E0IA 5DW0A 3N76A 1VKRA 4F7DA 3K2QA 2BHLA 2ZP1A 1QCYA 5CHYA 4BV2A 2HLDA 1U8TA 3MJRA 1ZA2A 2XTMA 4M8SA 2ONYA 1NV8A 3OOYA 4FOTA 1P39A 4A2WA 2V6IA 4LHZA 3ZBPA 3IVAA 3V32A 4LSMA 1AMOA 3UBTA 3A1TA 4CGYA 5JYBA 5B6PA 1MFPA 1Q15A 3SQDA 3T5DA 1P5JA 5JAQA 3WMFA 4HPWA 3QH4A 2V96A 1BMQA 4WGGA 2OAP1 3VZRA 2WM9B 2PGNA 3HDVA 1C0PA 2P1ZA 1WSDA 2TMYA 1WUHS 4FFDA 5JSKA 3TNFA 2FP4B 4D7AA 4DILA 5HDBB 5EZSA 4BIMA 1D6SA 3PT9A 5KDDA 3IUYA 5L8VA 3TZKA 4HDMB 4HCJA 4B3GA 2RHCA 4TKVB 2JGNA 1XJ0A 2Q8PA 1PT9A 1KO7A 3ZQUA 4IVNA 2A6PA 2AW5A 2WBLC 5J2UB 5CBPB 1ZIDA 3WLQA 2CD9A 2ZIAA 3LY8A 2CFSA 5IJXA 2WSBA 4PZAA 5TV2A 5FPQA 1ZPDA 2I7DA 4JD5A 3TXXA 3T5TA 4GM1A 3E7XA 3Q8WA 4N7BA 3B2EA 1Y8ZA 2FMKA 4MJ3A 1Q16A 2PZ8A 4H60A 5T6MA 1M6HA 4QD3A 3PDUA 4UNRA 4RQAA 1NUHA 1U8CB 2JD1A 1JJAA 3MOGA 3R0XA 1E0AA 3TBKA 3ACDA 3BF7A 3OHSX 2H3EA 4TXMA 1XLTA 2CJPA 3WL7A 3ZH9B 5HFJA 5K0CA 2UYHA 1DKPA 1JMVA 3VPHA 2BMAA 3WNBA 2BT4A 3RAEC 2I4MA 2R6CA 3O4GA 3PHGA 3DEJA 4PLTA 3GZTB 4ENQA 1NVUQ 4ZQGA 4BUJA 2XHEA 2GJAA 2FR8A 4IICA 4G1CA 4RTOA 4XGKA 1OI3A 1OR8A 4AL4A 3RWOA 1CJUC 4FYVA 2B0JA 4JLUA 2EQAA 1I2CA 3HCFA 3LCCA 1ODTC 5JHGB 3W2GA 3LOUA 4DCJA 5HIKA 2F3QA 2H48A 1SGWA 2NZJA 2QAGB 3FUCA 1CRLA 2E87A 3R6LA 4Q3BA 4A03A 1SQ0A 2GAIA 5DT9A 1F5SA 3ZH2A 4NG4A 5ALRA 2DCUA 3P0FA 2ZUTA 5LP6B 4PIVA 2XKKA 4C2TA 5G02A 3R5SA 1FFGA 1I2DA 1FNBA 1ORHA 1DEOA 4XUCA 4RVDA 5C5IA 5EZQA 5L3SA 3UKDA 3ZXYA 3U49A 2D54A 3JWPA 4IJQA 1A96A 4XD2A 2NU9B 5B4TA 2ZJBA 4FB5A 5L7WA 3FTDA 1H3EA 4NULA 4YGXB 1OWLA 3COPA 2NUTA 1IPEA 4RF4A 2YJ4A 1M1UA 1H22A 1M2VB 2BGMA 3T3DA 1V6AA 1RYNA 3TJZA 2NVUA 3NTLA 3WHIA 4ZCIA 3KC2A 3PQ3A 3G9XA 1CDEA 4A2PA 5AJWA 1QK5A 1IVSA 1XD2A 2XE7A 3DW3X 1Z45A 2H2FA 3PYXA 1JDBB 2II6A 3DC7A 2PA3A 3BGOS 3GFBA 4TTSA 3QSYA 4DC0A 3AZOA 2FNAA 2OO3A 2Z2IA 2JB9A 1H3NA 3BJMA 4X1IB 4N18A 2C5EA 5CB8A 3V4SA 5F2EA 5LBIA 3ORQA 1NN5A 3RSLA 5K4AA 1PYGA 4ZT3A 1V47A 1N4DA 1HOTA 3GAZA 2P3QA 2Y6UA 3X2SA 2LDXA 4J2TA 2DC1A 3V8PA 2Q07A 4ZJPA 1UQRA 1QRSA 5ISMA 3HGTA 1NV9A 1U90A 4IUBS 5T5QA 3UC5A 1IN1A 3DKRA 3PDCA 4E4YA 4F91B 4MUYA 3U4QB 1DXHA 4BGIA 1VLZA 3NEYA 1AKVA 3KZKA 3O1LA 4OUDA 1SY7A 1G9TA 4UW9A 3ZZMA 2AR9A 4E13A 4NZOA 4DMGA 3U7QA 3DYBA 4AS2A 1M76A 1TVKB 2JC3A 2GVNA 2GARA 2J41A 1LRJA 1ACMA 2Z4SA 3GHHA 5TMDA 3UOAB 4AFNA 4B8ZA 4QJIA 3N5KA 5TVKA 3RV4A 4GZMA 2P3OA 5AVSA 3F9IA 3V5NA 1G0NA 2HWXA 2UVPA 1GPBA 3GDFA 3DLBA 3GNSA 1FDTA 3LBHA 3OZCA 5KHAA 1IY8A 2C2MA 3P1JA 3KCNA 1PJCA 2Y1FA 3EEFA 4QBHA 4W7HA 1BN7A 1LVHA 3DDWA 1HT2E 5CH3A 3ABIA 5C1PA 1UPAA 1QE3A 1NYRA 3I3OA 1G20B 4Q93A 5KVAA 1GYPA 4IZIA 4MWZA 1F4PA 3SYLA 3DQQA 4HVTA 4DG9A 4QJ5A 4X20A 2BFDA 2DMRA 1LZKA 2FHPA 1NI4B 1S8NA 3WGGA 1N9ZA 1NF3A 1XRLA 1RCTE 3ELDA 4EGSA 1JIQA 1AC5A 3BM5A 2I6SA 3MWYW 4O5OA 2ATVA 3KB6A 1DRKA 1RHKA 4ND4A 1VCIA 1SKMA 1JIIA 1E2GA 4GUAA 5SYAA 1G2QA 3GGSA 2Y71A 1RI4A 5CVEA 2CNLA 3F2VA 5BYKA 2CGEA 4CETA 1SKYE 1WY5A 1KY2A 4EYOA 3REQA 2J6CA 2A5YB 2IEYA 2P41A 1CUBA 2QSUA 3DBVO 3OJWA 3CMMA 5JSYA 5TARA 2IQIA 3FWHA 4S0ZA 2ATXA 4DJTA 1R9NA 1VTKA 3GV0A 1ZA1A 3W8RA 1FP6A 2JAOA 3TG8A 4PGMA 4QQ8A 5ALKA 5JSQA 1AMNA 1OFTA 1H85A 3CKYA 1XTQA 1WMEA 4PW0A 3T54A 2YIMA 3KAKA 2C9ZA 5TQ2B 4WUTA 3ZPXA 4PNPA 4BNWA 2OD9A 3MWLA 4KXXA 4RA6A 4MWCA 1JL3A 3ENKA 3DWEX 3GFVA 3KQQA 3V8QA 5IAGA 3S1AA 6ADHA 3O3NB 1N5IA 4FJ2A 2ZRJA 1LX6A 3AEQA 2ATIA 3L07A 4ZCPA 5JWRA 4J7UA 2QKYA 4ZHSA 3QWFA 4L1KA 3WZLA 1M1YB 4HSEA 3I12A 2BH9A 2ZIXA 1EDEA 3JQAD 2Y4NA 4DWWA 2PVPA 1HG1A 2WWGA 3GRFA 5CJ2A 4EGAA 3RYCB 1T9BA 1XZFA 1JDVA 4BE7B 1S3GA 1KPIA 1R0KA 1H9CA 2AD1A 2CLDX 2QAGC 2WWTA 1PK7A 3QELB 3DO8A 2Q99A 4MV7A 2AUNA 2IL1A 1OI4A 1Y1KE 2I99A 2P5TB 3JCZA 4KOAA 2CSUA 1Z47A 2CJFA 2ZEJA 3WZMA 1OC2A 1DXYA 1U3CA 3DCJA 4JLVA 5EA2A 1LFDB 4WKNA 4C7XA 2AC4A 3QXHA 4R2MA 1UBJS 3ZY5A 4RUKA 2JBAA 2Q3EA 4C2AA 5J4VA 3RSOA 1FU8A 1AHPA 3P19A 4NU5A 3UVEA 1YC2A 4CV2A 3STTA 1C9EA 2WTAA 4BNFA 3WLFA 4MI6A 3HP7A 4YRLA 2GPTA 3G8BA 1NUUA 3HRKA 3DE5X 3PNKA 1VFNA 5F5XA 3C1AA 3W5CA 4RGVA 4RZIA 1H0RA 2QTGA 5FNVB 5A4DA 5HS4A 2O59A 1F17A 2Q0HA 1E5DA 3JVDA 2D3TA 1HPLA 3SXUB 3LTNC 4QL3A 2BEUB 1TYCA 2DR2A 2ORIA 3DJFA 4DYHA 3M89A 1DAMA 1WNTA 3GPIA 3IBSA 4MV5A 3ZGOA 3R6WA 1A72A 1XTVA 2YIVX 3PQ4A 1UBNA 2QR5A 2V1UA 3ZCVA 2FPUA 2HQOA 4ENSA 2XDQA 1P5HA 1Q77A 3L7LA 2QTCA 5IKOA 1W85A 2GD2A 3AEKA 2E6UX 2ZG6A 1VBMA 3FLBA 2D5BA 4BKQA 1X38A 1JH9A 4Q4AA 1BXRB 3AV0B 4TROA 4Z0PA 4B17A 3OSZA 4PYLA 5AOCA 1PQWA 1PG2A 1I7PA 1Y3FE 1YE3A 1NAIA 2J0EA 2VO1A 5A5DA 1N1GA 1LJLA 5HQJA 1IOWA 4C7OB 2GJSA 3W2EA 3OLYA 4JI2B 1PFWA 3EZYA 2JGEA 3ECSA 3I6MA 5E6RA 1AK2A 1T9AA 3DO6A 1Y6ZA 4HB2A 4MLCA 4WK0B 4GOND 2XRMA 5JALA 4MWGA 3ZU2A 2PZFA 3KS9A 3P27A 1GTG1 2PYIA 3JXEA 4N6NA 4AS1A 1WKVA 2FSVC 3EDCA 3W5UA 4B33A 3TN7A 3IBTA 5EGSA 2PS9A 1UBMS 1Z25A 1UJ2A 3QOYA 4CMIA 1JYFA 1J7KA 2QN2A 4WXMA 4MUFA 1RTTA 2JPDA 1UBEA 3GUZA 4UFOA 4F8EA 3H65A 5KTTA 3RS7A 2GBFA 3IJ5A 4MUAA 4GEGA 4YP9A 3VU8A 1DLIA 4MI1A 4D9EA 1D07A 1GIAA 4DN6A 2KLBA 1R10A 1P0CA 1Z6ZA 3ICCA 3AHFA 3PJFA 3D8NA 4F9EA 4HXYA 4ESOA 2DUMA 1BEUB 4QGAA 4DARA 1EEHA 4U6QA 2O3SA 4QSHA 3BFJA 3G02A 1V8OA 4YJ3F 3K0FA 4LQCA 3H5AA 4MVJM 3C85A 5E6UA 4HN9A 2IBSA 2VG8A 5CDTA 2H9AA 2MYNA 3E1GA 5B3KA 1SOMA 1G6HA 3IE0A 1R6AA 2B99A 2CVFA 3WNDA 1LF0A 2ZTVA 1JXQA 2C9OA 3NOVA 3HP4A 4NP6A 3RTCA 4B1FA 4MGKR 1NA5A 1EK5A 1R5OA 2COEA 3KL2A 1EE1A 3M33A 2FG7C 3IAHA 4S35A 5EHZA 1BOOA 1N2CA 1RKUA 1Z75A 1KSFX 3C6QA 1QCCA 5JD6A 1HYBA 1FJXA 5JSHA 2Z6VA 3B70A 4FZJA 1UXGA 3WDKA 5J1SB 5DXJA 1I1QB 3HM2A 1IMOA 1LSOA 1VHLA 2CMKA 3QMVA 4OLHA 1U2RA 3CSDA 4RMGA 4TV8B 1YF3A 3OZXA 3P9QA 5ILOA 1XDBA 1L1RA 2DJ5A 3N6RA 1UPXA 4OH1A 4HNUA 4NCAA 5FOXA 3CKLA 1XYGA 1CEEA 1U6IA 3W5VA 2R7NA 1IXRC 2C2OA 4QBFA 1KZ6A 2Y05A 2A2ZA 3L41A 3OOWA 5EIHA 5LDHA 4LCEA 2V7BA 2GUGA 3GLHE 2OKGA 5LB2A 1UKYA 2M2IA 1LNSA 2ZAGA 2W4IA 4JI1B 1XU4A 1BEEA 5TE9A 4FFMA 1DBQA 1W87A 4EJ0A 3RRMA 5EMNA 1T3SA 3OD5A 3RUEA 3ZR4B 3ZU4A 4ER0A 4LBVA 5D7NA 1GVHA 5A71A 1RZRA 1ZMBA 3LE8A 1HFWA 3E03A 1U3GA 1ZJ4A 2PFGA 4JUIA 4MQEB 4UVIA 2B5VA 4QJBA 1IIRA 5AJHA 3FTNA 5EUQB 5A6SB 4EYGA 1IQRA 4V02A 4ZJZA 3K2IA 3AINA 4Q82A 5AK3A 3PP8A 2J3MA 2WJYA 3ZKWA 4QQKA 4DMHA 4GRDA 1MN6A 3ZCTA 1AUXA 1VKNA 2CB0A 2PZBA 2PMDA 1K97A 3JQGB 3GAFA 3MMZA 3O83A 2P11A 3N2NA 3ACBA 4N39A 5CT6A 4JI0B 1CUYA 1DZIA 5ITVA 2DRIA 1MR3F 1N0UA 1XLUA 1J6UA 2E49A 2PZAA 2WG1A 5FBWB 4KTTE 2OZLA 5HA5A 3K8OE 1GPNA 4EWLA 4U5QA 4FS3A 1USIA 4YLYA 4I1IA 4J03A 2OXTA 2P6NA 1QS0B 4NMWA 4F2WA 5JHHB 2HU7A 2DBVO 3GGCA 3W4JA 4ZI7A 4YHHB 2O6HA 1R6TA 1A7UA 1CR2A 1TIKA 3HXLA 4UE2A 5ALTA 3WTCA 4ZHQB 2ZJ1A 4HLDA 3ZGVA 3KSAC 4UTNA 4DCTA 3M4ZA 1IHUA 1PN3A 4H16A 4BNJA 3TGLA 3RW9A 1H4SA 4PXAA 3SM9A 2VOEA 1D1TA 4JI5B 3S29A 1AKEA 1U5BB 4A0FA 5A4MS 1YFJA 2Z6UA 3V2UA 1FJ2A 2SCUB 5DISB 1BHO1 4QTUB 5AH0A 2WQ7A 2WJ6A 3UHJA 4LCBA 3M70A 4P82A 4YASA 4EKIA 4ZAFA 3GA5A 1DO0A 3VH1A 1QVVA 2WNIA 3HFSA 2VPZA 3BQ9A 3PNOA 3USZA 4NDZA 3AFGA 3GLFA 1S02A 4WY5A 3NBYC 3S2ZA 2WU0A 1H4QA 3CRRA 4B4UA 4CT5A 2C2BA 4W5OA 3LUHA 4PG8A 4J8PA 5BPFA 4M46A 3OFVA 1YDHA 1DDOA 3DTYA 1T25A 5EXPA 4DQXA 4IF6A 5C3MA 3GFTA 3DE4X 3SJZA 5DH9A 3BGVA 1RQGA 4MUIA 2EF1A 2P62A 4QKQA 3NPAA 4HH0A 4WZAE 3ZJ5A 2I80A 3FUVA 3UGTA 1CUSA 2UDPA 1VSTA 2W2QA 3D7MA 5A3SA 3NASA 2QPOA 2Q5QA 3KEGA 1IL0A 1BWRA 4J0FA 621PA 1ULBA 3UAXA 4XFDA 3N2EA 1EDZA 4X5OA 1JKFA 2GBLC 4II3A 2C1XA 1NG1A 2O8FA 4QWMA 1Q7GA 3CXRA 1ZGBA 3KSMA 3MS2A 4FFRA 4DABA 1GTSA 1EM8B 4TS9A 3RARA 1IHDA 1ESZA 1NHWA 4HGOA 4MNTA 4JS0A 1OBVA 2HRQA 3D7RA 3PC4A 3UATA 3GLUA 4PHGA 5DTRA 3RKUA 1LFAA 3BFXA 4EJSB 1NBME 5KKNB 4HC4A 4RF3A 5JCPA 2WSMA 1PFUA 4OREX 4MAMA 2P3LA 2WSSA 4G67A 1CR4A 5JRJA 1GADO 2VJPA 4MQFA 5PGMA 1N75A 4UTZA 4C05A 4DMFA 1LSJA 2WJIA 2ZRHA 4RHXA 3N2ZB 3PDHA 5L4NA 4O29A 4FN5A 2CDBA 1U0OC 5I7UA 1ECCA 1YU6A 4ESVA 3CGGA 1HDGO 1PSWA 1ZSVA 1MIOB 4Y0NA 1ZUHA 4XYEA 1E4OA 5FADA 4N0EA 2DHEA 5TQ0A 3W5AA 5BSMA 2RHRA 4IFTA 4X8HA 3ISJA 3WV5A 4BLTA 4FYXA 2CXPA 1E5LA 1D4AA 4JP5A 4JLWA 5G4KA 4CKYA 3IDQA 2NXWA 4FNOA 4CMEA 2OUIA 5BSHA 2WB4A 1ZWLA 2J7PA 2ZJAA 1W7AA 1AGRA 1XX6A 3Q6NA 4KO1S 2XB8A 4JV5B 3UHPA 3DBIA 4H7EA 4Q6WA 1EVIA 1Z63A 1SBCA 4IIYA 4WNCA 3BIWA 4ONEA 3S55A 4Z49A 2VOJA 4IIXA 1R15A 4KZKA 2VNAA 5LBUA 1XEXB 1C0IA 2XMPA 4I50A 1E3TA 4GSLA 5A2GA 1QLWA 1FFEA 1GNQA 1LUAA 1ZH0A 3CIFA 3FYSA 1IRXA 2V1XA 3KHTA 3OLCX 1PFKA 4P35A 4PWZA 4Q3DA 5AKJA 3DVSX 5AOAA 2RCNA 1SUWA 3EF3A 4YMSA 3T7EA 3CRQA 3VV2A 3AOEC 1DWUA 3TZQA 5DVZA 1OH6A 3GNLA 4P36A 3LKZA 2CMFA 5EXTA 4ASUD 3LW7A 3ZQJA 4ZIRB 4U9UA 3I5MA 2FWNA 2RGBA 2GCIA 3DMPA 2HSWA 4NH0A 4EW1A 5AK6A 3SYMA 5BV2P 5HQTA 5LSAA 1Z38A 3DBRA 1NW6A 2W8BA 1W581 3ZN2A 4CM4B 2YXEA 5B36A 1IU9A 1F8UA 1M6YA 1MTOA 2WQ6A 1OV4A 2BR4A 2A30A 3NORA 4J2HA 1I7NA 3VR6H 4EI9A 3AEUB 3THRA 4WK4B 5E2BA 3AIMA 1L7XA 5HFNA 4YMGA 1RPNA 1LNQA 1RWOA 3W8EA 2P6MA 2X58A 3O8QB 5DHSA 2ZBVA 1RLMA 5LWHA 1PJZA 2FW7A 2VK1A 3MPOA 1ORIA 3FPAA 4H0NA 2QSJA 4WHMA 5SY6A 1I6MA 3OLVA 5GGYA 3Q87B 2OGZA 4PYKA 1L6IA 4R51A 4Z6KA 2F48A 1XT6A 3EPLA 4MS3B 1U2QA 2O5VA 2OPHA 3T3OA 1RBYA 1R4NB 3AF3A 2XMSA 1FBNA 2XX3A 4FR2A 4IMPA 5FOWA 3RHZA 1KDZA 3VU9A 3N6XA 4FNMA 1I13A 4N01A 1CWUA 2FEMA 3NDIA 3VYTB 4XWTA 2QRVA 1ZN2A 1U2SA 1D8TA 3RUAA 4ZDJA 2HHLA 2JFXA 1YIDA 1MH9A 1TCAA 3BA6A 4MYTA 3SE0A 3IIEA 2EYQA 4HEA6 4C4RA 4S2UA 1KOGA 5AKZA 4YA6A 2G4CA 3ME5A 4LSZA 3G6WA 2OCIA 3K2BA 4RE5A 4M1WA 4Q03A 5P21A 3WLJA 2YNMD 1YMVA 2I33A 3GEEA 1PUJA 1XQVA 3QNWA 4RA9A 4TPKA 2FW8A 4BO1A 4DJDC 5FX2A 3HEMA 5HOEA 2OGSA 2P2DA 1XP5A 3FWKA 5FOUA 4CMHA 5MGNA 2OV6A 3PHBE 4KUEA 4M8IA 1LLUA 1D7OA 2Z1DA 3WLKX 5ALVA 8AT1A 3CINA 1P0QA 2PGLA 2PKQP 3IVXA 4KI7A 1TMKA 3DUFA 4R16A 3SYKA 4FDVA 1KI6B 1J2TA 1YD7A 3BB3A 3PD7A 2CMHA 4RD0A 1Z4LA 3AR3A 3TTYA 2W2NA 3LYAA 3D3WB 3QLTA 4EO7A 3O31A 3NANA 1FVXA 4HWGA 1PTKA 3BWDD 1M34B 2QENA 4NEHB 4X3PA 1DAGA 1C1XB 1CFZA 1ZMRA 2BM9A 3NHAA 1WM1A 1WQ4A 3OQIA 3AZPA 2PL9A 3GDWA 1M72A 4YUWA 5DWVA 2GEJA 2VQSA 2QMEA 1Z73A 4PIPA 5BRNA 4HGPA 3DVLA 3SHWA 3TYXA 3VNBA 2I3GA 1QR6A 4ITUA 1W19A 1FDIA 1H1TA 1OROA 2QD1A 3NHBA 4EJSC 1NVKA 3V7YA 4TXJA 3U1VA 4BP3A 3KNZA 3VU1A 3VO9A 1N5LA 1KVQA 3GFFA 2HCJB 3KVYA 2Z8ZA 4MAAA 2AI1A 1FS6A 3H16A 4D8YA 3WWEA 4QEZA 3PUJA 4O8ZA 4CF5A 4P3XA 1NE2A 1FLNA 1GPWB 2Y9PB 3IPCA 4HDMA 4D3YA 3C74A 1K88A 1U8EA 1XZKA 4TM8A 5ARCA 4BNYA 5CBKA 1LF5A 2YYYA 4CIBA 1DBIA 1P4RA 3ZUPA 1T9ZA 2HA0A 4MJLA 3X1DA 4EVIA 2A4KA 1FQOA 3LFUA 5BV7A 1IN6A 1ISGA 3PFCA 1NC1A 3BH6A 2VWPA 2UVQA 5EXDA 2F00A 1C1HA 3PLRA 1T6ZA 3HA2A 2WC1A 3R6TA 5U9CA 3PWZA 1J1ZA 3PZRA 1PFVA 1KYZA 2CFCA 4ZK2A 3I2IA 4DRXA 3HCRA 1BE6A 4UCWA 4KFSA 4QBIA 2QTRA 3AFIA 3R7LA 3VGPA 4KAXA 4O3FA 1GDTA 3VYVA 3D54D 1JGTA 3EXHC 4AURA 2V55B 3C3XA 3DHVA 3F7NA 4JR0A 1JXOA 4YLEA 5FFFA 4AJOA 4OQZA 1L4YA 3A6HA 5DHTA 3THSA 1Y6FA 4BYGA 3HLTA 4DNOA 5KQGA 4FEYA 5GM2A 3RYIA 1RWPA 2BF4A 4YI3A 3JQ8B 4FKBA 3ROEA 5B3JC 1JA9A 2I6UA 1XE3A 4Q66C 2AJCA 4O1HA 2H06A 4E51A 3KD3A 4KKVA 4TQGA 2IYYA 3UAYA 1P8JA 1Z5ZA 2R47A 2B7CA 1ZYUA 3G0GA 3M6AA 4HAZA 1TAUA 1IHYA 1EH5A 5THXA 1AH2A 5KNCA 1SIWA 1CR6A 1H2FA 5FQOA 2EFGA 1RRVA 3WK9A 3FTCA 2WR8A 2B20A 3CZ9A 2I3BA 1IG0A 4KREA 3KZNA 5DLQC 1K4YA 2ZTLA 2NU9A 5LM3A 5DLEA 3WRWA 1V4BA 3JZFA 1AK9A 4GZ3A 1C30B 1FLAA 3ND5A 4KL8S 4H7IA 3W8NA 4CCWA 1WZCA 4D9JA 5ABPA 2VJOA 4JT4A 2VT2A 1E3QA 4DPMA 2WFLB 4GKKB 4L28A 3K5PA 1DQYA 5TDHA 1BE8A 3IQGX 1DKMA