5CK5A

Signal recognition particle receptor srb-gdp-mg from chaetomium thermophilum
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
301
structure length
221
Chain Sequence
b'YTTLPSVLLIGPSGAGKTALLTLFERGTSYKVDLDAAGATARKFLLIDTPGHPKLRGTTLQHLLNPSPSLTIIPTSDPYKSKLKAVIFLLDAAALADSDGDYLSQTASYLYDVLLSLQKRFHSRKNSRAPSSIPVLIAANKQDLFTAVPASLVKSRLEHELGRIRKTRQKGLEGWLGAVGSKEFKFEEMMEFDMEVEVMGGNVIGDGPGAERWWRWIGERI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative signal recognition particle protein
publication title Structure and Switch Cycle of SR beta as Ancestral Eukaryotic GTPase Associated with Secretory Membranes.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Signaling protein
total genus 69
structure length 221
sequence length 301
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09439 SRPRB Signal recognition particle receptor beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ck5A00
1TEVA 5JSZA 3TMKA 2IYXA 3Q72A 4W9MC 3W3ZB 1N6OA 4YXWA 2WSSD 3LH5A 2DB3A 2J0VA 4C30A 2ODWA 2XAUA 3NHAA 1KI9A 1CR0A 1E99A 3ETLA 2H7VA 4N0EA 4DEYA 4AKGA 2MSEB 2J9RA 4HDCA 5HKKD 2IHBA 2NIPA 3WYAA 3WP1B 5DSZA 2F9MA 5GJVC 2QGZA 3M0EA 3E1SA 3AVWA 4PTLA 1YVDA 2HLDD 4WBSA 5F2EA 4LJAA 4LJ9A 3KXIA 3AB3A 4M4SA 2V7QA 2EFHB 3TGPA 1XEWY 1QG2A 1ELOA 5GJWC 3IO3A 1OSNA 2ZR9A 4I1OA 4PC2A 3REGA 2GILA 1XP8A 3HU2A 2X2FA 1CRQA 1NKSA 4LC1A 2BMDA 4I1UA 3NG1A 5A0FA 3B1XA 1TU3A 4LI0A 4L9WA 5JWRA 1OV4A 2JDIA 4GDFA 3L0PA 2NG1A 3LDAA 3LAWA 2NO9A 2GVZC 4Z1MA 4EFNA 1RPZA 3CF0A 3AVXA 5CK5A 3W34A 3TUIC 4ACBA 2ZSAA 4A0GA 4WIAA 1QHSA 4Q9HA 4IDQA 1E9AA 4BZQA 2W6IA 4B3FX 3A1UA 4ZI2A 5J47A 1JQJC 3FMOB 4HAUA 1NN0A 2YINC 4QG7A 5FPTA 1R8SA 2E1RA 3FFAA 2YWGA 2JA1A 1ZAKA 3OEEA 1KY3A 3I73A 3QXCA 2YVUA 2GWHA 3BIFA 2RGNC 3AVPA 1W4BA 4CEIB 4R98A 4EPRA 2FGJA 2OG2A 4Q4LA 3U3MA 4XH9B 5L3SA 1S1CA 1US8B 1OIXA 1TEXA 2VEDA 2GJ9A 2IEYA 2GXSA 5KNBA 1HV8A 2ZUDA 3ZJYA 1ZUHA 1E2HA 1G20E 3FKQA 4UXIA 1IN4A 1E2GA 2NZ8A 3P4XA 2O8FA 4B71A 2I1QA 4Q1DA 2GEUA 4LJ6A 2OXCA 5B30A 2QORA 2ZAMA 2OUKA 2ZRPA 1RE0A 1SVLA 5H70A 3LD9A 1NJGA 3SEAA 1XJQA 3P1JA 4P4SA 1CXZA 2IEZA 4DUGA 1ZNYA 2P5SA 4IJMA 1G4UR 2QAGB 5EE5B 1KHTA 4HAVA 4LV6A 1IOZA 4PO9A 4B3DA 4HSEA 4D81A 2LCFA 1SVKA 2FSIA 3DM9B 3K0CA 3QIAA 5FPSA 3HPQA 3THWA 3ADBA 5JEDA 3CRW1 1VIYA 4YONB 4DLVA 1XMSA 2O8EB 3CO5A 5KDLA 4YDHB 4BLQA 4V0NA 3GLGB 3T5GA 1OFHA 2OCPA 1OT3A 5LBIA 2EFGA 2P3SA 2GHIA 3F5FA 3R9IA 3VU9B 1KI6A 1Y3AA 3CX8A 1CTQA 1E2PA 1Z3IX 4GOJA 2EFDB 1G3QA 4DDUA 4TYWA 2FPMA 4LGMA 1NVVR 5AK0A 1UKZA 3SZRA 1HYQA 5FL7D 4EAQA 4LYJA 3TUJC 3LA6A 1KMHA 4TZ0A 1F48A 4ASUA 4KHZA 1XXHB 3C8UA 4PHTA 4RZUA 4EJSC 2HF9A 4Q7LA 3TBKA 4TSFA 4M1WA 1F2TB 2H92A 1KDTA 2QRZA 3CUEF 3AF0A 2YOGA 5KPDA 1EFHA 1EG7A 3CF2A 3H4MA 4G01B 1TADA 3N2EA 3UMRA 2V6IA 3VR5A 4D0NA 5IT5A 1IM2A 4NZYA 4FW9A 4KFTA 2XITA 1N6LA 4NCIA 4MUBA 3THXA 4MRNA 4P4UA 4Q4AA 4EIWA 4E22A 3NBZC 1L4YA 2H57A 2IHYA 3LWNA 2C04A 4MYUA 4NYMQ 4GMDA 4BFYA 2REOA 3FGNA 4DLWA 3FWYA 4LHWA 1GL6A 1PUIA 1TQ6A 5EE0A 1EX6A 4Q4HB 4F4JA 2ZYVX 3SC3A 3I92A 2CL6X 3SE0A 3K9NA 2PEZA 2Z83A 4JYCA 4RKFA 3B85A 4IVPA 1JAIA 5G41A 1XCPA 3K0FB 1ZBDA 1LS6A 2ONKA 3B13B 3EZ6A 3SYLA 1ANKA 1G41A 1G7SA 4A8JB 4EDHA 3U44A 5TY0A 1FW6A 4OL0A 5IDVA 2ODNA 4LY6A 3T06B 5LDDC 2R8RA 4MRVA 2RB4A 1Z2CA 3T1OA 1P61B 3FVQA 4OK3A 1Q1ZA 5GVSA 1AZTA 4W7SA 1I4TD 2XTMA 4RD2A 3BWDD 1LFDB 4PZLA 1EGAA 1OE0A 4TTRA 2A30A 5EP2A 5ELXA 2X1VA 2R62A 2P67A 2KBEA 5DE3A 1W0KD 2YOHA 4XOIA 3VKWA 4AD8A 2R6CA 5FI0B 5KDOA 2F3TA 4DEXA 4HYYA 4CZ2A 3QKRB 2O8DB 4M9QA 4XWKA 4URWR 3ICEA 3QXSA 4CW7A 5FOVA 5HE8A 2SHKA 4UQOA 2JLSA 3UATA 2FDCA 4LBZA 1W36B 3FOZA 1P3JA 2FNAA 5DHAA 1QG4A 5CK4A 1ZM4A 2IL1A 3B60A 3GQBA 4GSYA 4BFZA 1J7KA 2RGNA 4BFXA 2QSYA 3JZAA 4B6EA 4HLUC 1E79A 4HUQA 4IFBA 1JXMA 2FFBA 1V5WA 1M8PA 1FQJA 4G5SA 4WZBE 2GESA 4AWXA 2BOVA 3S1AA 3DKVA 5H1YA 4LK2A 5FTKA 1JPJA 2A9KA 4AYTA 5IF9A 1E3MA 4D80A 3GLIA 3BJIC 4JJKA 1OXUA 3ZDQA 1NLZA 2Y8EA 4QHYA 3PCRB 2WIBA 5FOXA 3AVUA 5JJKA 2WSMA 4URUR 3W3AA 5C18A 4V0KA 4GRAA 4PPNA 4Z8XA 2IA5A 4M9SA 2FU5C 3T5DA 4G5GA 3DL0A 3QVUA 1R0XA 3ZVNA 2WJJA 4CF7A 4TZ6A 2PX0A 5F9FA 4DDWA 4QM6A 1KO1A 2PEYA 5AR1A 3RWMB 1YZKA 2QUZA 4IHQA 3QSYA 4LV5B 1A1VA 1NMYA 1CS4C 4RZ2A 5FPHA 4G5OA 4B74A 2GNOA 4DLSA 5FH9A 4XVQA 2XB4A 5A5GA 2JLVA 1Z08A 3BK7A 3A6PC 5FUXA 2D4HA 2A5YB 2QP4A 3KFXA 4EQ6A 1VCNA 3NTUA 3X1XA 4Q5IA 3SBEA 1E9RA 3F3YA 4MRSA 5CDFA 4B2LA 2ANBA 2JJ8A 2H8KA 3G5UA 4DXAA 1FNMA 1P4SA 4AURA 4KCGA 2ZR7A 2GJAA 1K6MA 1YRBA 4PQFA 2ASEA 3SHFA 2Z4RA 4BFUA 3P26A 4XD7D 1G291 2GKSA 1KSGA 4LBYA 2BBSA 1Z0KA 2WIAA 4F7WA 4LUCA 3RNLA 5AJWA 4DCUA 1D8TA 2VPPA 3A1SA 4Q7MB 3NC0C 1T8UA 1UEJA 3KKQA 1WBDA 1HY3A 4QC2A 1KK0A 3EXAA 5HR5A 2F3RA 3HR8A 3QPVA 4EJSA 5HPYB 2G88A 2WWWA 2GCPA 3PUZA 1ZM7A 1W1WA 1GL7A 3P32A 1T8TA 4QNRA 4US1R 1VHTA 3WP0A 4KSCA 3ZVLA 1R0WA 1ODFA 2DYKA 2F1IA 5KSZA 3KKOA 3WXMA 3PIRA 2G83A 5FTJA 2ZSFA 4LBWA 2Q21A 1NBMD 3LBHA 3T1TA 4ARZB 3BRWD 3EIHA 2PMDA 3LXXA 1Z0FA 2FF7A 3QBVA 3PEWA 2ZU0C 2C5LA 2NPIA 4QHSA 5JJLA 2CCGA 3ND9A 4MKGA 2YZ2A 1DAKA 621PA 1FQKA 4IDHA 3TH5A 3HWSA 1OFUX 4KSBA 2B7CA 1DOAA 2Q0HA 4Q03A 5C2JB 4RY2A 2RGGA 2FEMA 1BIFA 1AIPA 3IHLA 3OFNA 4DIEA 3DZDA 2AK2A 5FTLA 3CPJB 3QPUA 4P4TA 1CF4A 1DTSA 3Q3JB 4A9AA 1YR8A 1SVMA 1QHXA 3GLFA 1O3YA 2CE7A 2GF9A 5C1BA 3SBDA 4QKQA 4M1YA 5LD2C 2GJ8A 2QI9C 3C16C 1X3SA 2YV5A 1JQLB 1SHZA 4U7DA 4BPBA 2LKDA 3KX2A 3TVDA 3IPXA 1GZSA 2KWIA 3ZS8A 4LYHA 3OESA 4NMMA 2HUPA 3QKSA 1BYIA 4FMDF 3KKPA 1E9CA 4F38A 1S3SA 5AUPB 3B1VA 1SXJB 3OE7D 3I8SA 1LF0A 4GNKA 1E9BA 2A5GA 4OQXA 5BXQC 2UZIR 1I2MA 2BBTA 1O87A 2J7PD 1VYTA 1H8ED 1LW7A 1XX6A 3MJHA 1G7TA 2OFOA 5AUOB 4TYYA 3TRFA 1S4QA 3FKSA 2GCOA 1PLKA 4JLPA 1II0A 5IRCD 4MKHA 4MRPA 1G21E 1JJVA 3I8XA 2H5EA 1I4DD 2VHTA 3JVVA 4Q02A 4QBHA 1NJFA 5JI3E 4V0MA 5SZHB 1WDTA 2AR7A 1J2JA 2BBWA 3L8ZA 3X2SA 4D4JA 1KI1A 4HI0E 2PMKA 1GM5A 1COWD 4B2PA 1P6XA 1XD9A 1CEEA 1SKYB 1VDZA 5BYKA 1N5JA 2J0UA 2R65A 2ZJBA 3K0AB 3L43A 2XSZA 5KSYA 1Z28A 721PA 4HLUA 2ZU6A 1T3LA 2VP6A 4O2LA 1QHGA 2WWXA 4B3XA 1KI8A 2AFIE 3CB4A 3VKHA 3UG6A 1KGDA 3DOFA 2ZI4A 2R2AA 1ZCBA 1IBRA 4RD4A 2G9NA 1GIAA 1NY5A 2JLXA 2QM7A 2VO1A 3C5CA 1FMLA 2F7SA 3SYKA 1G6OA 3VTKA 2NZJA 2XZPA 5BYJA 5K8UA 4DHEA 2EYQA 2EQBA 3RS0A 4RD3A 3CRMA 1T6NA 4HUTA 2BJVA 4GBMA 2YOFA 4OHZA 4EKDA 3QNUA 1AZSC 4FXPA 1VMAA 2CLCX 1AM4D 2UKDA 1EX7A 1G3IA 2E87A 2IK8A 4X8HA 2ZE8A 1NBME 4TYPA 4NYMR 5JRZA 5KNDA 3L2OB 1GKIA 4JLMA 3LX8A 4A92A 3PUVA 4PO1A 4L4UA 3EASA 3GLHB 2G0NA 3D31A 4ZIRA 1ZMXA 2BEKA 4M53A 1ZVQA 4JYBA 1RJ9A 3OEHA 2ERXA 1WP9A 2ZVPX 2AX4A 5FFMA 3C41J 1SQ5A 4DBLC 3WBKA 3KTAB 2CJWA 2KBFA 4RKEA 4TN1A 2BMFA 3B8HA 1UADA 3Q8XB 2C78A 2HJGA 2GXUA 3AVVA 1XWIA 2BEJA 3KKNA 5J4YA 2XXAB 5JJIA 1FL9A 1ZU5A 2WBLC 1CU1A 1G5RA 3LW7A 1UAAA 1N2CE 1X1RA 1XZPA 3CLVA 1XTRA 2BJWA 1WMSA 4BASA 2VP2A 4URVR 1DAFA 3LFUA 1YZUA 1ZW6A 2AFHE 2DFKB 3GLHE 3HU3A 3RSOA 4NH0A 2RGAA 3GFPA 3O47A 4YXWD 1NLFA 1A2KC 3C7KA 1KTVA 5IK2A 5AUQA 1WBBA 3ADDA 2C9CA 3L0OA 1KSJA 3BB1A 4C2UA 1K5GA 1AS2A 4HB4A 4LV8B 3WYFA 3B2EA 4QGFA 4JLKA 4LOAA 3PG5A 4F4CA 1XD2A 1H8HA 1QF9A 1OFIA 1ESMA 2ERYA 2VP4A 3K9GA 3I5XA 1JR6A 4C0LA 1FNNA 2ZRJA 1JPNA 3FFBA 3ND8A 1H65A 3K70C 1KDOA 3DMNA 2V7QD 1NN1A 3CM0A 3LLUA 2JGNA 1E9DA 3QI2A 3SN6A 4QBFA 5JFGA 1IXZA 5FR1A 4DT1A 2DFNA 821PA 4POAA 5E7IA 3IDQA 3R7WA 2J46A 2OFXA 5FOUA 4BQSA 1RYHA 4Q1BA 2G1JA 2HJVA 2ORIA 1X8LA 3NDBB 3ZZUA 2XZOA 2REBA 2VA8A 4EPXA 1MH1A 1XEFA 2RMKA 5G3ZA 2JDID 4DB2A 4TQ9A 4BZPA 3W6NA 1GILA 1XTSA 4Q9JA 1DO2A 3W6OA 2ZI9A 1Q1BA 4Z1MD 5K8LA 2C9YA 5EUQB 3WMGA 1G8GA 4JLJA 3THYB 5EP4A 3BE4A 5B64A 5C4GB 4Z54A 1U2RA 4KFUA 1OFTA 4NKRA 3U4QB 1LTQA 1ZRHA 4TMWA 1G4AE 1J90A 2W6ID 4FWIB 3I61A 1N6NA 1XTKA 5F9HA 1JBKA 3KJIA 4PXAA 2EWVA 1U8AA 1L7VC 5FBVB 2Z4SA 3OEED 2GJKA 1YR6A 2IXGA 2V9PA 2R6DA 4HAZA 3BH6A 4Q7KA 3ZYCA 3PFIA 1HH4A 3QQ5A 2MMGA 3UWOA 2W2TA 2QBYB 3AKDA 3Q5DA 4XTCS 3UIEA 2GAAA 3PR1A 2IXEA 3CWQA 4P33A 2F43A 1F2UA 2O8CA 2GEDA 4AG5A 1V43A 4BE7B 2Z6VA 2GETA 2CMKA 5EUMA 3U3RA 2PZFA 2WHXA 4TTQA 3TAHA 2ZI3A 4C0SA 1OW3B 1BO6A 1G17A 2AKAB 4E09A 1R0YA 2HT1A 2ZJYA 3HU1A 4XSHA 2JLYA 5CB8A 2A5JA 3DPUA 1SZPA 3LX5A 1F60A 3T12A 3T1VA 3TR0A 4A82A 2DFTA 4QNMA 2PLFA 4DZZA 3IBYA 1G64A 4HAYA 4JVSB 4UXHA 1XBTA 3KB2A 2GJSA 4DUGD 1XB2A 4XWAA 2X2EA 5FR2A 1YQTA 5LB2A 5ANRB 5M04A 4NPHA 3RS7A 4AK9A 1E9SA 4RD6A 5FBLB 121PA 1QHYA 3IIMA 4A36A 2PT7A 2BC9A 4Q47A 3IEUA 4Q1EA 2IYTA 2WM9B 3OIYA 2JASA 1SHKA 1WRBA 5KDDA 1NG1A 3C4JA 5E4FA 3U3KA 2B7BA 3SR0A 3ZQ6A 2CCKA 3O8DA 3NBXX 4KFSA 1JALA 2V55B 4B35A 1D2MA 1E0KA 1QHHA 2FEOA 2ZTSA 4PSKA 2BV3A 4Q66C 4QM7A 1HE1C 1OJLA 1ZYUA 3B82A 3AGPA 1XTQA 2PT5A 2QMUA 4U02A 4FCWA 1GL9B 1KKLA 1R4AA 4AKEA 3BFVA 1HUQA 3DKPA 4LHVA 4A2WA 2Z0MA 1IHUA 2V1XA 2VIIA 3X1ZA 4TMKA 4JLNA 2O8BA 4ASUD 1AGRA 1UJ2A 3I1FA 3BFKA 3X1WA 2OESA 4TSFD 4ZKDA 2ORVA 2LWIA 1T5LA 4UNNA 2WJYA 4V0LA 4QL3A 4A8JC 5K8TA 1FP6A 2FZLA 3AUXA 1MV5A 4BECA 1NIPA 1A4RA 3PVSA 1XPOA 3ECCA 4JKYA 3TK1A 2VQSA 3AF3A 5LB4A 4OKSA 1XFAA 4EPTA 1HURA 2VYFA 3MUFA 3TAUA 2DWOA 3A4MA 1W4CA 4Q1CA 1NVXQ 4JVMA 1ETUA 3V4FA 3KJGA 3QENA 5FI1B 3WHLA 4BLSA 1P9NA 1Z2AA 4U00A 1W7AA 1E9FA 1E1RA 3ZVMA 1DAEA 3BXZA 3EA0A 4X8MA 4LX0A 3V4RA 2E9SA 2V6JA 4A0RA 1DAIA 2IT1A 2QE7A 2ZJZA 3QKTA 4GZLA 3VNUA 5CIQA 3NBFA 1W36C 3M1IA 4OBEA 4HB2A 3RRYA 1KJYA 4OQNA 4FIDA 2J41A 1VCOA 1PVOA 1U0JA 1E0SA 4KVAA 2IYLD 5L3RA 4CEIA 1J8YF 1GNPA 2QA5A 1P72A 4M8NE 1US8A 5KOYA 1W2HA 2D7DA 1YHNA 2ORWA 1P62B 4G5QA 5AJYA 4B76A 3MSXA 4O3MA 3B9PA 4OQMA 1IN8A 5FPYA 3K1JA 4PC7A 4NCJA 3UG7A 1S0UA 1KO7A 2R6FA 1PV4A 1MO4A 1YKSA 2QQ0A 2OCAA 1VKJA 3LXRA 4GMXA 5AUNB 1DEKA 3OAAA 1KY2A 4QXAA 4XWOA 4RFVA 1OKKA 3NWJA 5CLQA 4BLRA 4TL7A 5K8IA 3SU8A 3RDPA 1JB1A 1R7RA 2V54A 4C7OA 4EFMA 4TL9A 4G0NA 2CVFA 1OPXA 3CIOA 3OF5A 2W2VA 3ZIAA 1KIMA 4B32A 1VCMA 4RJLA 1EWRA 2HCBA 4NYIQ 1VG8A 1E79D 2YNMA 3OIUA 5TB5A 2IX3A 3TQCA 3N70A 1L8QA 1VG1A 2BVNA 2D7CA 4HEJA 2CK3A 1TNDA 3D3QA 2YC2C 4G1UC 4LHZA 2WWIA 2GXAA 5J4LA 4S35A 2NQ2C 4ZDKA 1U99A 1UM8A 5LPNA 2NOAA 2O8EA 2ZSEA 2IUUA 3VR2A 3EPHA 3GLGA 1N5LA 2OBLA 3CR7A 1A82A 1M7BA 4TT3A 5C46F 3CNOA 3Q85A 4PR0A 2B21A 1TMKA 1ZNWA 4A15A 3VU9A 4PC1A 3AUYA 4J0QA 1KMQA 3CRVA 1J70A 1SULA 4DLYA 1CR1A 2F55A 4DCVA 5D3MA 3CWZA 3GFTA 4Q1FA 2DBYA 5DI9A 3CNNA 1P9RA 4NYJQ 4Q19A 1W49A 4QJ4A 5DIFA 5F98A 1T9HA 3U7GA 3FDIA 1VPLA 2Z43A 3KKMA 3I72A 3LBNA 4ZPXA 1YR9A 2J0SA 1XXHA 3RAPR 2JJ1A 4N1AA 3LNCA 5F3WB 4G3XA 3U61B 2WTUA 1F2TA 2ZXUA 1IAQA 4A6XA 5DN6A 2J0QA 2RHMA 4IXMA 3TQFA 2P6UA 4M1TA 4B3BA 4R9UC 3EA5A 2ZI6A 5FPKA 2VTKA 3Q5EA 2ZS7A 3UANA 4US0R 4AYWA 3A4NA 3EW9A 3K9LA 1E4YA 1GRQA 1G8FA 1M34E 3U3JA 1N5IA 1M74A 2J45A 2QT1A 1QHNA 1FPMA 1UKVY 3KQKA 5TVKA 4IRUB 2C2HA 1N3BA 1F5NA 1EFCA 1ZD9A 3GJ6A 4Q4JB 1Z0JA 2ZS8A 2P6NA 2ZE5A 4CIDA 3IHWA 1E0AA 4OHXA 4R2HA 4V0OA 3BH0A 1EFRA 2EFEB 4IOLA 3RS5A 3DZ8A 4BWYA 2EW1A 5CYOA 3SHWA 5JCZA 4S2EA 2PL3A 1NN3A 2B8WA 2FA9A 4OYHA 221PA 4Q4HA 1R5BA 1D2EA 4D4MA 3GP8A 3A8TA 2O0JA 3AKCA 2ZRGA 4M9XA 2ZIAA 1RVDA 2V3CC 2XB2A 4JLAA 3CW2A 4FD2A 4TMXA 3K0FA 1HE8B 2FPKA 3KQNA 4HUQB 2J5XA 1RFLA 2ZETA 3I5YA 4A8JA 4EUNA 3L0IB 1BS1A 3SQXA 3WBJA 5UKDA 4WAUA 5HE9A 4DDTA 1ESNA 1VHLA 4TMZA 3FHCB 2ZITA 4FN5A 1FX0B 1SXJC 3AVQA 4X8LA 2RH5A 2X8AA 3NEJA 1AN0A 1NSFA 2VHUA 3WHKA 4ZCLA 3D6TB 5KUTA 4HLDA 1WXQA 3EZ2A 1DELA 1Z0IA 3FE2A 4JKIA 3E5HA 1OIWA 1YR7A 2ZRKA 3D7MA 3OFND 1RZ3A 4M2LA 3MWJA 1JI0A 3GJ0A 2YWHA 1ZD1A 2CEAA 2OBMA 2ZPTX 3MFYA 3QKRA 1LF5A 3B1ZA 2QMHA 1AK2A 2NO7A 3LV8A 1AGPA 1CR4A 3AF4A 1HA3A 4IEEA 4M1KA 3KQUA 4LYAA 4CEJB 4YMTA 5EXSA 1FUKA 4Y0AA 3GLIE 3DMDA 2MSDB 3FB4A 5IHPA 1E2EA 1YZQA 1P5ZB 4AKIA 1LVGA 1KNQA 2FV8A 3NHBA 4IDNA 4RFSB 5B2ZA 4NP6A 2IWHA 3AF1A 4NL4H 4PC6A 1ZC4A 4EQ6B 1EFTA 1G1MA 1SVSA 2ZM5A 2QP3A 2C98A 4F91B 3U6BA 2ZYWX 3C5HA 3I32A 4XSGA 4KU4A 4WW0A 4XVUA 1C4OA 2Z5FA 3CZPA 1KK2A 4QGAA 4NONA 2Q3FA 4DLZA 3QG1A 4EPVA 1ZJ6A 3FKSD 1XTIA 2IC5A 3GJXC 1ZNXA 3GJ7A 4P31A 4Q9LA 1E32A 1P73A 2CLSA 3ASZA 1GUAA 3BC1A 3NH9A 4JL6A 4ZCMA 1E1QA 3U60B 1G8HA 3TR5A 3ONWA 4QBIA 3IGFA 3AH8A 3CR8A 1WCV1 1JECA 3IBGA 1LS1A 1OYWA 4KBGA 3AP1A 3RVBA 1W5TA 1QBKC 3DHWC 5AJXA 2N1BA 3EZ7A 5AJVB 1BMFA 4QJ3A 2IYRA 1XU4A 1YZTA 1MO6A 2ZVQX 1K8RA 2FFHA 5BQ5A 4WZ6A 2XSZD 4R7ZA 1RRCA 5TV2A 2FWRA 4AI6A 4Y0VA 4FI3C 1X8KA 3RRMA 3OIVA 1DAMA 2NO6A 2REXB 4DDVA 1KDRA 1ZD8A 2CHQA 3G82C 1N6PA 3FMFA 5E7MA 4ZV4A 1G5PA 1Q12A 2J87A 5FBQB 1CJMA 1K5DA 4HAXA 4OK6A 5DGXA 4RD1A 4YMUA 2C77A 3UMFA 4A4DA 3KJHA 1W5SA 1KK3A 4TQUS 1FTNA 1KI3A 2WKRA 1QVRA 1TU4A 3RC3A 5DI3B 1VIAA 4I81A 4DC9A 3FYHA 4JBXA 5KU1A 3DDCA 2XNSA 1E2NA 1CULC 3RLFA 1DBSA 4Q00A 5JEEA 4B34A 1J99A 3EZ9A 4MH0R 4C4PA 1MRNA 4DCTA 2ZQ5A 2ANCA 2P6RA 1XZQA 3FHOA 1G18A 3DM5A 3JZMA 1MRSA 2IW3A 1W2GA 4TL8A 2FG5A 4JVLA 4MKIA 4R2IA 2OAQ1 1R10A 2VHCA 3GMTA 5DNYB 1Z6GA 2ZROA 2ZRFA 3OEHD 3DOEA 4M22A 3BB4A 2OFWA 4H1UA 2X19A 3E70C 3CRRA 3KUDA 1UFQA 4EPWA 1RYFA 3GLFE 4ARZA 3R20A 1IXSB 4JL8A 4LJ7A 3C14C 3BERA 4Q01A 3ZH9B 4C0AC 4DB4A 1E2QA 4B3CA 4DCNA 3PXGA 3QKUA 4TTPA 2QZ4A 2HV8A 1Q3TA 4MGIR 2W0MA 3HP1A 4YQFA 1XCGB 4L9SA 5EXTA 1KJWA 4GT1A 2A2ZA 2F1HA 3SJBA 1TF7A 1RRFA 1G6HA 2WZQA 3BB3A 2Q6TA 4HDOB 4HZUB 4LSGA 4PZYA 3KL4A 5BN5A 5JHGB 2P65A 5IK2D 1W4AA 3RYTC 1N6HA 2JIZA 4LCBA 1NSTA 2GAOA 2J0UB 3QUSA 1U0LA 5SZJA 3CNLA 4FMDB 4P3YA 1AJEA 1MO3A 4PFSA 1KI7A 1Z6AA 2CVHA 2VL7A 3NXSA 2NTYC 4JLVA 2VSOA 1T91A 2ZRCA 4UJ3A 5EP1A 2Q3HA 4CEHB 2NPFA 1E2KA 1H8HD 4OI2A 1HT1E 1M7GA 1GG2A 2QT0A 5BWMA 1SXJA 2R9VA 3T35A 4I4LA 4V0ME 2O0HA 1WA5A 1VG9B 4MITA 1OH6A 1F6BA 1E69A 1Z8FA 3EIQA 2C03A 2QEQA 2QTVB 2QPAA 4C0JA 1CJUC 2JLUA 1VCIA 1YZLA 2JJ2A 2ZI5A 4NYIR 1R0ZA 3AM1A 2AXNA 3TLXA 3JVUA 1YZGA 4QHTA 3RWOA 3CRQA 1P9WA 3T61A 5P21A 1KNXA 2GCNA 4H9GA 3BH7A 1G9XA 1XMJA 5KPJA 1E94E 2CL0X 4URXR 2XOKA 3SJCA 1AA9A 1Q44A 1N6IA 4RD0A 2P0EA 3OHMA 1II8B 1Q1QA 2ZYTX 5KHOC 2G0TA 4AIIA 3OZXA 3GPLA 3H1TA 2W6JA 3NKVA 1Q21A 4NCNA 1TUIA 1JJ7A 1KO8A 2PBRA 4MGZR 1IJFA 4W5WA 4IW3B 1RJ9B 3SOPA 2IS6A 2DCUA 4LJ4A 4A2QA 5G53C 4DSTA 3QEOA 2HT6A 2XTZA 2CJWB 4NYJR 4MGYR 1XPRA 3QE0A 4ON9A 3LLMA 2GZDA 4BRWA 1GKYA 2RGEA 4I1VA 2KJQA 2I3BA 2WOOA 3QF4A 4L5BA 2A7QA 3Q7QA 4KYUA 3EG5A 3DO6A 3VR1A 3BFXA 3SFVA 5JBQA 2RGDA 2P5TB 2OV2A 1NVUQ 4PQRA 2DPXA 1CIPA 2OLJA 2XJ9A 3I62A 4ZDIA 2YJTD 2ONJA 4UKDA 1E2LA 4TWZA 2NMVA 4JL5A 4ZCIA 2YWEA 1ZP6A 4C0KA 2G77B 3TIFA 4JLOA 1LNZA 2I1VB 3FHTA 2WAXA 2DR3A 5EXXA 4LDJA 4QBGB 1HTWA 1P7CA 3VHLB 2AHOA 2WWFA 3RABA 3VR3A 2D74A 4D0GA 1OB2A 3Q9LA 4ABYA 4FMCF 1T4GA 5EZ6B 3QXXA 3ZS9A 1XD2B 4KODA 3QOFA 4K8OA 4BZXA 3T34A 1FMJA 2DFLA 2F1RA 3AF2A 4AC9A 2Q3MA 3KXLA 3ICQB 4Q18A 1PUJA 5HZHA 5FBRB 2ATXA 1IY1A 4KYIB 4B75A 1JR3A 1IY0A 1FUUA 1UBGA 4TLCA 2W2XA 2IS1A 1LB1B 3TSZA 1NI3A 1NF3A 2IWRA 3PQCA 2BBOA 1S96A 1NMXA 4MGKR 1UDXA 3B7GA 1EXMA 1TPZA 2HYDA 2Q9AA 2CNWA 2QGNA 3KB1A 1JAHA 3NVAA 4KBFA 1G8YA 1CKEA 4YDSA 4B33A 3W6PA 1R2QA 1DAHA 3W5JA 1PZNA 2VP0A 3QVVA 3MG9A 1ONBA 1B23P 1BYUA 2C8VA 1M1YE 3EC2A 2ODBA 4TMTA 1LY1A 3EWAA 4YLGA 2JLZA 3HPRA 4B2IA 1Q3HA 3RHFA 5L3QB 3PUYA 1W47A 3P20A 5AJZA 3IO5A 2AWOA 4N0DA 2QM8A 5JWHA 2HCJB 4QOSA 3CBQA 2QMOA 4KAXA 1Z0DA 4NBSA 3TW8B 1E2MA 2VRWA 2WKQA 4ZI3A 5CB6A 1KAGA 1IXRC 5KO2A 1E9EA 4D25A 4YMWA 4PHFA 5EXPA 1A7JA 4OK5A 2IYUA 4UNRA 4M21A 1KO4A 2VLIA 1TQ2A 3EARA 3VKGA 1NP6A 3DEFA 2BMEA 1CBUA 1F2UB 2QAGC 1N6KA 3P27A 4JZKA 4DRZA 2GF0A 1T0HB 2WPDA 4BEJA 1Q22A 5BN3A 5FTNA 1UDWA 4U5XA 2W0SA 3WNDA 3PV0A 3VX4A 3U6KA 1XJCA 4PPGA 3SJAA 1IONA 1MABB 2OAP1 4AYXA 1D2NA 2VH5R 4XTRA 5E7JA 4DVGA 1NRJB 1OHHA 3I3SR 3PEUA 4FMBB 1R5NA 3HDTA 3AV0B 3THYA 5E3HA 1OB5A 2JEOA 1Z63A 2J3EA 4GOKA 2WJGA 3SFZA 5JSZB 3U4QA 4QRHA 4KXFB 3LY5A 1E1RD 4Z8YA 3UXMA 1NN5A 4D4LA 3GJ4A 1XEXA 1KDPA 3RS4A 3LW8A 2JLQA 2QE7D 1PJRA 4QGHA 3MRSA 3TKLA 2CDNA 3K70D 3U2QA 3MWYW 2RGCA 4O25A 3PEYA 5FTMA 3VHXA 3BORA 3BS4A 4D4KA 1CRPA 3TVTA 3LQRA 4AKHA 4M1MA 2FE4A 2Q9CA 2IUSA 5TDHA 3U3OA 3AEZA 2QBYA 1KI2A 1KO5A 1Z47A 1CJTC 1TAGA 2ZUCA 1NKTA 1Z22A 4C0HA 4EFLA 4MUAA 4WVFA 2NO1A 4Z51A 4RCYA 2QTFA 3M4YA 2F6RA 5DHFA 3EPJA 1LV7A 2BHRA 1R6BX 2HEIA 2IYSA 3CZQA 3K8YA 1IQPA 3ZD7A 2HXYA 2RGXA 3WYGA 2PJZA 4ESHA 4LWZA 1D9XA 2ZR0A 2V8OA 4CVNA 3VR4A 3X1YA 2XZLA 2EFCB 3OAAD 4MDEA 1WB9A 3IPYA 2YYZA 1OKKD 2GEVA 4F4IA 5JS7A 3ASYA 3WRYC 4TQAA 1DG3A 2QP9X 5KYKA 3B5JA 5AWFC 1TTTA 1GOTA 1Z6XA 4ACAA 1NVWQ 3N5CA 2FMXA 3AGQA 1IN5A 3CKLA 3EZFA 3ZIAD 2XNDA 2IYYA 4KVGA 3WRXC 1XMVA 2ZRBA 4V02A 3X1DA 1E0JA 4JSTA 2WWHA 2GTPA 4ERNA 2IF0A 2G6BA 4ZO4A 1W44A 4GP7A 3VX3A 3TNFA 1KSFX 2CK3D 2CHVA 1CJVC 5DH9A 3G0HA 3IEVA 2A3RA 2QN6A 5FOTA 3UK6A 5BW8A 6Q21A 5L3SB 1NMZA 2ZE7A 2EU8A 3BD9A 3B6EA 4TT3D 3B1YA 4ESVA 4RCZA 3LVRE 3W8RA 4LHYA 5TARA 2QQEA 2BKUA 2O8FB 4GPTA 3BGWA 5JCPA 3O8RA 1XTJA 3PUXA 2ZJ5A 3GEEA 5KNCA 1DO0A 2GDJA 3FTQA 4HB0A 1U8ZA 1CR2A 1G19A 1XMIA 2O5VA 3K9HA 1R5OA 4PHGA 1U90A 2NO0A 2OE2A 2C96A 1L4UA 1MKYA 4Q9IA 4P4SB 3K70B 1UKEA 1D6JA 2JJ1D 3CH5A 2AXPA 1S2MA 1W4RA 1XNJA 4MKFA 3W9YA 4DSOA 5DN6D 3AVTA 3F8TA 1XD8A 2OO7A 4PHHA 3N2IA 4HATA 4TLEA 2OEPA 8OHMA 1SVOA 1ZNZA 4HDQB 3ZZ0A 1P2UA 5EJEA 4QGGA 2C9OA 3KXKA 3P4YA 3TUZC 3DVLA 1X86B 2ZYUX 4P0TA 2AKYA 1KJZA 4XJXA 1FOEB 2B8TA 2UVQA 3J81k 1TQ4A 4LYFA 3THWB 2WWYA 1EWQA 4OJKA 2C99A 4LJYA 1W0JA 4B43A 2LKCA 3T15A 1GNRA 3L8YA 4DLUA 1X1SA 3BAFA 3EC1A 2WAYA 4OQFA 1EFRD 4A1FA 2IUTA 4RZXA 4V03A 5H8WA 1ZC3A 3AKYA 5J40A 3VAAA 4E5UA 2BDTA 1ZUIA 2KB0A 1KI6B 5HTKA 4JSYA 2N42A 1TUEA 1A2BA 1HT2E 4C7OB 1T3HA 2JCSA 2WSSA 1NL3A 1S8FA 1AQUA 4LPKA 3SJZA 4URYR 2HF8A 2QAJA 3U7EB 2PH1A 3WY9A 4TYNA 2R6GA 1G16A 1Y63A 1CLUA 1AQYA 2O0KA 1KMHB 1E2IA 1DAGA 4E03A 2AK3A 2JAQA 5HKKA 2KSQA 1Z07A 2QAGA 3K53A 4KJZA 4OHYA 4PPQA 2HLDA 3HYTA 4RVCA 2CXXA 2GA8A 1MOZA 3CPHA 2PJRA 4IOJA 3OIWA 3O8CA 4E07A 2FN4A 2J7KA 2F1JA 4HAWA 3THXB 1GSIA 2ZSDA 1HQCA 3H0KA 2PCLA 3ZLJA 3IILA 4K46A 1SGWA 4Q4AB 3R9XA 1J8MF 4IXNA 1GRNA 2JLWA 5J4VA 3FPAA 3M6AA 5JS8A 1RKBA 3BBPA 5D3MB 4UNSA 4IDOA 1IJEA 2FSHA 3CPEA 1TF5A 2PCJA 3GD7A 3QEJA 4PSVA 4CT5A 1U9IC 2I4IA 1W36D 1AKYA 3EAQA 4RSGA 1UKYA 3TSOA 1QRAA 5CLLA 3GLGE 1OH5A 4ZDJA 1P2SA 2OBNA 1N0WA 4F93B 1W48A 2ECKA 2G3YA 3AQ4A 3VNVA 3U44B 1RRGA 3L82B 4PPFA 2GBLC 3IUYA 5CJ2A 1MT0A 4R71A 3EPKA 2IS2A 5HCIA 1U94A 1SVIA 2H18A 3GFOA 2VF8A 2OXRA 4YMSA 3VMFA 1N5KA 3NIBA 5SZIA 3WMFA 1E1QD 3A1VA 2XJ4A 2AD1A 2FX3A 3H2YA 4GI7A 1XXHE 3SDZA 4MYTA 3FMPB 4GFDA 4IFEA 3SNHA 4OJQA 5HCNA 3SI7A 3ZVRA 2ZRAA 3SQWA 3VR6A 1Z6YA 3MCAA 1ZM3A 2CBZA 3RRZA 4N3NA 2ODEA 1DADA 2MSCB 2VHJA 1BMFD 4DIDA 2CE2X 4TYQA 3KQHA 1N0UA 3PEVA 4NU0A 3LQQA 5FUWA 1GAJA 4KV9A 4JBWA 1OF1A 2AWNA 4HLQB 1GWNA 2GZHA 3CH4B 4BUJA 3KDSE 3UKDA 4BFWA 1ZM9A 3NBYC 3Q7PA 2VBCA 1DE0A 2FFAA 2IF2A 5GVRA 4B48A 2ZJAA 4PANA 1NY6A 4OQLA 4FCVA 1UPTA 1X8JA 2WJVA 5JZVA 4FINA 4WA7A 2H1LA 2W00A 1S9HA 3NEYA 3RSLA 5B58C 1GTVA 3EWSA 3S1AB 1GFIA 2OHFA 2ZRDA 2FSFA 2ZANA 4Q4JA 2BM0A 3GLIB 4GP6A 3NH6A 2BWJA 2DWQA 2OT3B 2VF7A 5D3QA 1Z6TA 2WOJA 2DHRA 1OH8A 1G3RA 3CX6A 2VHQA 4DWJA 4MQBA 1JXOA 4C0BA 3ADKA 4M0LA 3AP2A 1I4LD 4Q21A 3PENA 4ILEA 2YKGA 2GK6A 3H84A 1YJ5A 3ZD6A 2IS4A 2A5FA 2O8DA 2GRJA 4UNPA 1B0UA 3KJEA 3U7FB 5A4JA 4G5RA 2OCBA 2PZGA 2ZREA 4CYMA 3QF7A 5FL7A 4C9BA 3KFVA 1PLJA 3IKJA 1C9KA 3REFA 2XGJA 1G7CA 1UEIA 4CGZA 1OH7A 1YE8A 1DPFA 1XPUA 4AY2A 1FX0A 1S9DA 5JWOA 2KI5A 2OLKA 2WV9A 5EZ5A 1U0HC 4O0MA 3RANA 2FZ4A 2CLDX 4MYCA 2GK7A 4A0HA 2PZEA 3TW4A 2K5UA 4YC7A 4BGDA 5DYIA 3TJZA 5GJCA 4B73A 2DWPA 1G3UA 3HJNA 2EVWX 3GCGA 4BEBA 4MA4A 4PX9A 4WZAE 1XJ0A 1QDEA 4PAOA 4DLXA 3UPUA 1CP2A 2D2FA 5JHHB 4TL6A 2IYQA 1XCMA 1S3GA 2D62A 2JIZD 4YMVA 4CEJA 2ZEJA 4QFMA 1WE2A 4XIGS 4HLCA 2TMKA 3AP3A 1Z06A 4L15A 1P60A 2C95A 3FMIA 3QXJA 5CDFE 4RFSA 4MRRA 2P2LA 2RCNA 4EJSB 4D82A 5EP3A 4PQYA 1SXJD 4OHVA 5C4MA 5CM9C 4A6PA 1GDDA 2R6AA 2IYZA 5H68A 3GEHA 4RZ3A 2ZRNA 1RRPA 3IQWA 2JJ2D 4PC3A 4JMPA 5FUYA 4LBVA 2VSFA 1KOFA 2QRNA 4KLZA 4JT4A 3CF6R 3CX7A 3A1WA 1RIFA 1U98A 3K09C 5KTYA 1GVNB 4ZDWA 4M1SA 2QU8A 2QTHA 2VP9A 1JNYA 2FGKA 4CDGA 2XOKD 3ADCA 1DG1G 1W0KA 1HQYE 1U9IA 1TL7C 4DCSA 5EE1A 2ZJ2A 3GLFB 4K81B 2KE5A 3HR7A 3QY0A 4KO8A 4Q7JB 2WWGA 4NCHA 2OCYC 1VECA 2W6JD 3MJRA 5G3YA 4PAQA 1ZM2A 3GJ3A 2QPTA 3KZ1E 1KKMA 4LPSA 2RGBA 2WMNB 4QJ5A 5TMPA 2WJHA 1FP7A 4IVQA 2QENA 5CIWA 3ZQJA 2GBLA 2XTNA 3HYRA 3A37A 3QKSB 4URZR 5DLQC 3R9WA 5CM8B 1RC8A 5JI2E 4IOMA 1VYVA 2B6HA 3EIEA 1UBEA 1ZIPA 3IIJA 4UNQA 3W90A 4UXJA 4JLDA 4I1SA 5DYGA 5DI3A 1EFUA 1JEDA 2GXQA 2ZRIA 3F0TA 2H17A 2GCOB 2V4ZA 3VQTA 1GRRA 1S1MA 2BCJQ 4DJTA 2MMCA 1TQDA 3EX7C 3QJYA 1OYYA 2ZAOA 2ZRLA 4TLBA 2Q9BA 2UZ3A 3LRPA 521PA 1AS3A 2FFQA 1FTSA 2EWWA 4CT4B 4B6FA 3MD0A 5GJBA 2AN9A 2NGRA 4IOKA 5DISB 3RRNA 1UBFA 5J5CA 5TXGA 2GVDC 4M9ZA 1XRJA 1M6NA 1KAOA 2N46A 3KQLA 3A1TA 1II9A 4GL2A 1F3OA 1Q20A 5L3VA 1G7RA 3E2IA 4FCTA 3KUCA 4BLOA 4LHXA 5DO9A 1OXTA 1YRAA 2F9LA 1KYIA 4W5HA 1U8YA 1GKUB 3AKEA 3WMEA 2A78A 2A5DA 1TX4B 5GADl 5G40A 1XF9A 1QHIA 1Z83A 2O52A 4LJ5A 1YU9A 5CITA 4KFRA 1N6RA 1ZU4A 1E2FA 5EE3A 2D06A 4AG6A 3LVQE 1OXSC 2XEXA 4NE2A 1JR3D 1EESA 2B92A 2WICA 4IDPA 3QBTA 5L8VA 2CL7X 2BM1A 5E95A 4IKEA 4L8GA 4PSAA 5JLJA 1BH2A 4C0QC 2OILA 2VSXA 2WJIA 3CONA 4PO8A 2CNWD 2OM2A 3D8BA 1SXJE 4XD7A 4HZUA 1DARA 1VTKA 4PAMA 5BN4A 1ZCAA 1M7HA 2ZUBA 4GZMA 2GZAA 3PITA 1PLLA 1D9ZA 4II7A 1IN7A 2RAPA 2ZRHA 4WXRA 3R8CA 1G5TA 2L0XA 3MWKA 3NC1C 4CEHA 4OI0A 3K0SA 2W58A 3QXHA 4ZKEA 4B47A 4BLPA 1E2JA 2CHGA 5KSPA 3IQXA 1MO5A 3K0AA 4JS0A 5FOWA 3GEIA 421PA 4ZIRB 4JJZA 3EPLA 3SS8A 2CCJA 2ATVA 4JT2A 5SZKB 3THOA 4L16A 4OI1A 2XX3A 2IBMA 3QF4B 1NBMA 3ZGXA 1GP2A 2QNRA 1SKYE 1BKDR 1NLYA 1OIVA 2WPDD 4EPYA 2ZJOA 1DVRA 1KZ7B 2IXFA 4UJ5A 1W46A 1OLOA 1OXVA 2WMOB 3UMSA 2FSGA 2W83A 2DY1A 1OHHD 2AD5A 3B78A 1KZGB 1NVVQ 4DSUA 3RS3A 3VFDA 4Q1AA 2QL6A 4BFSA 5EE9A 1II8A 3TSWA 1T3SA 3B1WA 1IN6A 2BKEA 3L0SA 1E6CA 2BMJA 4TLAA 4XVRA 1C1YA 1I2DA 2ZRMA 4DLTA 4FWTA 3WNBA 4Q9KA 2R44A 3PUWA 5KSOA 1TF2A 1SKQA 4JVNA 3QPWA 3MLEA 4M1OA 2QROA 2EYUA 2PLRA 2RKOA 3IIKA 4JBYA 4KI0A 4KLNA 1XEWX 1OXXK 3GLHA 1NNEA 2PX3A 4BFTA 4B3GA 3W5IA 3BOSA 3OE7A 2FJUA 4C2TA 3WNCA 1BOFA 1QZXA 1ZUNB 1E4VA 3U7HB 2J7PA 3LBIA 1H8EA 3K0EA 5J4KA 1CJKC 4F92B 1NG9A 1Q0UA 3KTAA 4DT1B 2JATA 1JEEA 3K09A 2HYIC 1QVAA 3R7WB 3MGCA 5FUVA 2O8BB 2J1LA 4WOPA 4I99A 2D3WA 2YHSA 4PZZA 4IVRA 1N25A 1Z0AA 4LC0A 1AKEA 3O8BA 4D26A 2XXAA 4NDZA 3GJ8A 3V00A 4DKXA 3GJ5A 4ITRC 4US2R 1NIJA 4C3ZA 4DLRA 4BFVA 4FMCB 3C15C 3B9QA 5LD2B 5JMTA 2HXSA 1Q57A 1T0JB 3MAAC 1RW4A 4HZIA 3UWKA 4B44A 1JR3E 3AVYA 4X8OA 1G8PA 3V9PA 1COWA 4P32A 1DS6A 4BLTA 5B57C 1KI4A 1P75A 2XNDD 2JLRA 3H86A 4LZZA 3ZZTA 4MYHA 1N0VC 1T5IA 5FOSA 2QY9A 4Q48A 2QMEA 1A5TA 1GNQA 2J59A 2VP5A 4A0FA 4OHWA 1U81A 4OI4A 1G3MA 1VG0B 2H16A 4TMVA 2ZSBA 1GITA 1UBCA 2D2EA 3R8FA 4D0LB 1E96A 1D5CA 4KITB 1AS0A 1ZIOA 1FFHA 2FOLA 2WVJA 2YWFA 5FL3A 3RS2A 1L2TA 2AL7A 4LRWA 2YC4C 4GOXA 1Z29A 1YZNA 3K0CC 4NTZA 5HZKA 1ZINA 2F43B 2O8CB 1Z5ZA 3T1QA 3MWLA 5JECA 5CJPA 5FBWB 5EQTA 2QPOA 2BIFA 3A36A 3U5ZB 3LO5A 2V1UA 4H1VA 3PJRA 2G1KA 1X6VA 1KK1A 1R8QA 3TE6A 1XEXB 1FZQA 1SVWA 4TLDA 3AVOA 2RHDA 2X77A 2OSBA 2ZJ8A 4JLBA 1XDBA 4LJ8A 2QG6A 5L3QA 1WQ1R 4D6PA 4MDFA 4W5JA 2BCGY 3NDPA 4IEIA 4DSNA 3W8NA 2ZI7A 3A4LA 2HDNB 3MMPA 2WKPA 1HEIA 4WXPA 1MR3F 1P2TA 1KSHA 1Q1EA 2IYWA 1P2VA 4A2PA 3I4LA 5J4HA 2OZEA 4CRWB 4O2RA 1WF3A 4D2IA 4HB3A 2FH5B 4JIMA 2ZE6A 1IY2A 4NCKA 1VYUA 2QSZA 2ZS9A 2IYVA 5CYPA 3SYNA 4NHOA 1W0JD 5JRJA 1E2DA 1EK0A 1MABA 3QG5A 1M2OB 3A58B 1E98A 1UF9A 3RC8A 2FPLA 4BRUA 1QHHB
chains in the Genus database with same CATH superfamily
1K9SA 2PUWA 1RLTA 2VYQA 2X0RA 2N47A 3WLQA 2MYTA 5JSZA 4I5EA 2EL9A 2CHFA 3MELA 1RJDA 5CA1F 3L40A 3W3ZB 2IU3A 1OXMA 2M6SA 3E8XA 1Y98A 2QZZA 2QX6A 3LH5A 2A84A 2VEOA 3HRIA 4C21A 1L5FA 7REQA 4AJPA 2IV7A 2VRBA 4YJFB 1V6AA 5JDIA 5KYVA 4YV0A 5BURA 2BFBB 1KU0A 3RE1A 1KI9A 1Y8RA 1PK9A 1COZA 1E99A 1RAHA 5DASA 3GEDA 1U5BB 2C7BA 1ZI8A 2B8JA 3RPEA 2IHBA 3IBSA 2XYPA 3R6LA 3ZI0A 1VPDA 2BUBA 1ZHOA 4WN9B 1GGEA 3INTA 4G4GA 4EW1A 4X41A 1ONSA 3QFCA 2ZVDA 4RMGA 4NABA 2HLDD 1VLMA 4M4SA 4G5FA 2IBSA 1DOZA 1ZUD1 2EFHB 1XO1A 2V7QA 3VRHA 2JGFA 5BNZA 4AF6A 1AJEA 1ELOA 3ZWWA 3QTBA 5I7OA 3I9JA 3WRVA 1TTHA 1NPTO 2PKCA 3FCYA 3GFQA 3REGA 2IDMA 3F7OA 1XP8A 2ZJFA 1WUJS 2F4NA 5EL0A 4TVSA 3ANTA 4G1MB 3NG1A 1JQKA 4QRIA 1TU3A 2HZ7A 2JGKA 2UV8A 2JDIA 4LI0A 1T1SA 4WINA 4KBYA 5JWRA 3L0PA 2RJOA 3IPAA 4Z86A 5EKDA 3QLJA 3UK2A 9LDBA 5I5EA 3DLCA 4EFNA 3R3UA 4HXFB 5JMOA 4KPEC 3W34A 3G2MA 4NZPA 2JBWA 4G41A 4MULA 3VVLA 4WIAA 3C5EA 4GLJA 1PR4A 1YA6A 1A27A 3EXHB 4ZC8A 3GRCA 3Q4GA 1JQJC 3FMOB 1NN0A 1JZSA 1PEKE 4X6UA 1G1AA 3D0QA 5JZSA 5FPTA 5DGDA 1KARA 4K6CA 4TKUA 2OD2A 1HE5A 2JA1A 4ETMA 3OEEA 1KY3A 3I73A 4I36A 4WXYB 2WQ7A 1CF2O 2YVUA 4PYKA 5CNJA 3GLRA 1PHRA 2RGNC 4RPCA 2IGTA 2PAFA 2VJPA 1ZVVA 4ME6A 4LKRA 2GOYA 4FS8A 2B36A 4R5HA 4AMBA 5IAGA 1PJLA 2NYUA 5G0TA 3EJ6A 3EIWA 4UQLA 1IVNA 2GJ9A 2HU2A 3CBGA 1N2OA 3WK5A 3ZV6A 3OCZA 3ZJYA 2ODTX 1E2HA 1GSHA 3FKQA 4UXIA 5DSXA 4G09A 2ENWA 4IY1A 4XVHA 1P0IA 2HFJA 3G1UA 1SQGA 3WLFA 1L6RA 4AJ9A 2AH5A 2I1QA 2I1LA 4YMIA 3ZWKA 3UPTA 2GEUA 3Q9NA 4MEBA 2ZYRA 3TCKA 2OXCA 2GUWA 2FB9A 3BCRA 5B30A 1IBLB 5L6LB 2QORA 1AOXA 1N9GA 2ZAMA 4U7FA 2OUKA 4ZAVA 3ZBPA 2F3QA 2MOKA 3E3NA 1DLIA 1RE0A 2BLNA 2ZRPA 3A4IA 4J1TC 2EHJA 3DMFA 3CRZA 5H70A 1RWBA 5HJ5A 3G02A 1ODLA 1MIHA 4M0UA 4J2OA 1LPAB 3X2EA 3C7CB 3DSRA 1C4WA 1R0BA 1SKBA 4NU8X 2FMHA 5EIXA 4IJMA 4LA4A 4R5MA 5KS2A 4HDNA 5EIHA 1T1EA 1EMDA 2D2XA 1ZH4A 3BXHA 4HAVA 1T9AA 1IOZA 1UP4A 1GR0A 2ZYIA 1F2DA 1E3WB 2XQGA 4B3TB 1VE9A 4PO9A 2D3TA 3HKDB 2FSIA 1M1NB 2W2LD 3HO6A 5J63A 4XYGA 4ER7A 4I8XA 3QIAA 1GPLA 2CVQA 2OZLA 3HPQA 1V4NA 3RIHA 4LCEA 1O57A 3CRW1 3WYDA 4L85A 4RTQA 2CV1A 1L7PA 2JCXA 1JG6A 2NO4A 2WF8A 4WDQA 4DLVA 1TD9A 3GL9A 1F8XA 3TRJA 4CT0A 2C3YA 5KDLA 5KHLB 4H0NA 1FVOA 1GPAA 2GDZA 2ZYDA 3C24A 5EERA 4EOGA 3GLGB 4YCAA 2P3SA 3LCCA 3M3HA 2HSZA 4PIMA 4Y7DA 1WHSB 1UQRA 3RJTA 3EQ9A 3EIXA 2H2HA 3WAJA 5CXXA 4LSMA 3LK7A 2BKLA 2VSYA 3ESXA 4HV4A 1C7EA 3PRHA 4C5AA 1G3QA 4LSZA 3VPFA 3NETA 5EPUA 4DVJA 4DDUA 5BWLA 5C1PA 4XRGA 2A94A 5AK0A 5KQGA 4I3FA 4EAQA 1G59A 5FO0A 1J0AA 1RHUA 1J2TA 1BVYF 2AOUA 3GN1A 1FJXA 1P4JA 2F9FA 3C8UA 4G63A 4OVKA 4XPIA 5H59A 4EJSC 4M8KA 1DG9A 4OLBA 3TBKA 1PQPA 2JIBA 3MSCA 3FZGA 1PR1A 3FTFA 2QRZA 4RY8A 4HGOA 4UOQA 1SXQA 1EFHA 3CF2A 3N87A 4G01B 1YIOA 2XHZA 3ABIA 3LQFA 4Y6PA 1PI3A 4D0NA 2DFDA 5IT5A 5LWHA 1Y8QA 3UHPA 3T5CA 2H48A 1S5PA 3L1IA 1UBMS 2R97A 1TIKA 4WJKB 3PGJA 5BVGA 3OZ7A 4RLFA 1PR2A 1PTJA 3K4HA 3GNLA 3TQOA 4MRNA 4Q4AA 1U9CA 3O4GA 3JRWA 4EIWA 1SG9A 1LX7A 1DL5A 2GUGA 1XCJA 3L07A 1KOLA 3M82A 3JQBA 1CDDA 1ZOIA 4G0MA 4GYWA 4JV5B 4OMCA 4BFYA 3M5DA 3OQJA 4B3MB 1W76A 1ZLXA 3FGNA 1U2SA 3ML1A 3OBIA 4IIEA 3CNHA 4GMHA 2NUAB 4B7CA 2IOFA 4CHTA 2H29A 1GL6A 2IE8A 1GNVA 5IXJA 1PUIA 3WRYA 1TA0A 1JBQA 1XDGA 3LT2A 2AYXA 4QQKA 1M34A 2ZYVX 4Q4HB 3I92A 3H2GA 3COWA 5H02A 3SF8B 1SPBS 2OGUA 2XY4A 4F21A 1T26A 3H1AA 4MRMB 1WMEA 2XD9A 2V5AA 3LCJA 1T9GR 5FNVF 2XA1A 3K0FB 4GC5A 4MVXA 2J9YB 5JXJA 2JLYA 3Q3CA 4YMHA 1IEXA 3EZ6A 4GUDA 1G7SA 1I6KA 1K75A 1QG6A 1V8FA 1XZ8A 1CJCA 1BMDA 3B6IA 3FDFA 3NRCA 3R3XA 4I0WB 3PPXA 4JT9A 4OL0A 1Z9BA 1PR9A 4BQOA 3CR3C 3WO1A 4EF5A 3C3JA 4YASA 1V4VA 3H17A 3P8ZA 4LY3A 2QK4A 5AW8A 5A9RA 1GARA 1AZTA 1UM9A 1Y89A 3FDZA 1R18A 1DKQA 4W7SA 6YASA 5ICEA 1OVGA 1U0BB 1PNTA 1ZH0A 4FSXA 4P2BA 3AHIA 5ITZB 1LFDB 3HCBA 3ZY5A 1EUQA 4TWAA 2A30A 5E6RA 4LDZA 5HBGA 2P67A 1R4ZA 1QOPB 4MIKA 4XOIA 4YRDA 1MLDA 2R6CA 1R6XA 2PX4A 4EGFA 3PT9A 2AHRA 2V6MA 1HLDA 4OF4A 4OL9A 2XMCA 3G0DA 4CW7A 4WLFA 1GAEO 1T4CA 1EJ0A 4RV9A 3O8NA 4CM6A 2J67A 5HE8A 3REQB 1SBIA 4M99A 1T35A 2WF7A 5AKJA 3HXOA 1XN4A 4NENB 3UATA 3T0FA 4HTAA 2I0FA 4LBZA 3KSMA 3IALA 2EIHA 2HI0A 3DOJA 1U0OC 4BFXA 5EJIA 2QSYA 2FSVC 3Q9UA 4N4AA 3C6YA 2YW2A 2YUIA 4AKSA 3D2AA 5AHWA 3E3AA 4R8LA 3UJ7A 1JXMA 1ZI6A 4LRTB 2D8AA 1FSSA 1O8CA 1VPEA 2BOVA 4TKVB 1GPKA 5I4KA 5H1YA 4G9GA 3O4RA 5I4IA 2A9KA 4C29A 4LEIA 4UU8A 1H2ZA 2XUAA 1A9QA 3BJIC 1OXUA 4L5IA 3QWFA 3LWBA 3NLLA 4QHYA 3L18A 5FOXA 1CJSA 4B45A 3AVUA 2VQ3A 2JAOA 4YH1A 3W3AA 4V0KA 1JEQB 3L7NA 3OJWA 3L93A 3PD0A 4GRAA 4Z8XA 4EA6A 5JJ5A 2NYAA 4K9LA 4M9SA 1I6LA 3T5DA 2AQHA 1G38A 2ZZNA 2TMGA 4G5GA 2N75A 1QB7A 1QRRA 5BN1A 4GBED 1OX6A 4ZZ0A 2WJJA 1TT7A 3PA8A 1E5LA 4J6EA 1HYBA 1KO1A 1TW2A 1YS7A 4XFJA 2YBDA 5EJAA 3RSFA 5DZSA 4LGVA 3C3DA 5AR1A 3V4VB 1JPUA 1YZKA 2QUZA 1SOVA 1YA4A 3PRKE 2AQ8A 4LV5B 3QKIA 4G5OA 2G9RA 2GNOA 4B74A 5FH9A 2V9CA 3QYJA 3D4IA 2JLVA 3HKBB 1Z08A 1Z35A 2FVXA 3BK7A 5A1JA 3VU3A 4C5BA 5IZCA 1G4HA 1VCNA 3NTUA 4FS3A 2DUMA 1LJUA 1MG0A 4Q5IA 3LWDA 4ZVTA 2YWBA 5CDFA 2ANBA 3L84A 4J0EA 4JWTA 4PBRA 1XMPA 4B2LA 4CTNA 4XX0B 1P4SA 4L3VA 4WKGA 4AMUA 3WL6A 1MG5A 4RGVA 4YP1A 3W9SA 4N3GA 3QJGA 4AF7A 4TV8B 4XM2A 6NULA 3BREA 1HYHA 3GUVA 4ENTA 4MKXA 2O3RA 1G291 4DG5A 1P45A 2GKSA 2H1FA 2J5KA 4MV7A 1Z0KA 5B7NA 4LUCA 2UXBB 3OU6A 4Q7MB 1H3FA 2NW6A 3NC0C 1UEJA 2D5LA 1J6UA 3MHPA 1H1DA 1PU2A 1LBEA 5GZ6A 5B37A 2X6QA 1HDGO 5B3JA 4Q3LA 1KK0A 5HR5A 4TWJA 5EJ4A 1YBHA 2XW6A 3QPVA 4COOA 2WWWA 5HKBA 3CX4A 1NNI1 3PJDA 4NESA 4UFPA 2GCPA 2JI7A 2XADA 1ZJ4A 3HB1A 1GL7A 4QNRA 4EWLA 1ST3A 2C83A 3WP0A 2D1RA 3ZVLA 4JK3A 5F5XA 5IDWA 1ODFA 1HZZA 3A3PA 3CG4A 5KSZA 1XKTA 1EVEA 1X0XA 3AIKA 3E1GA 2ID9A 3AUFA 3RHTA 2R87A 2Q21A 3OX1A 1Z37A 4LBWA 4KAJA 1M2GA 1VGRA 3K2EA 4FE7A 4IL5A 3O8OB 1VE7A 5F2KA 2X2PA 2QX7A 4F12A 4CKCB 4I4CA 2C5LA 1UBHS 2CCGA 4IMIB 3ZV4A 3A9SA 6GPBA 1XI2A 1FQKA 1KXZA 2CDBA 3CGGA 3LT5A 4B3RB 4RW0A 3JZIA 3TH5A 3VSCA 4KSBA 4BUCA 4Q03A 4P5PA 1PBTA 1K8QA 3W5UA 1D2GA 1NHWA 1NNSA 3IHLA 4IZHA 2UXCB 3DZDA 2PNJA 1PNQA 3R0XA 4KI7A 4B1FA 2BGWA 5J2UF 2OBYA 1GG8A 5BUZA 3GZTB 3BXOA 1XKLA 4K2AA 3UJ3X 4RTJA 3RSSA 1QIIA 5HHTA 2PPLA 3TI7A 1TZMA 5DGHA 2BGGA 2QI9C 2YY7A 5CG2A 1LQUA 1X3SA 3IMCA 4U7DA 4BPBA 3BMCB 2XQKA 2ZIGA 4TTIA 1XDWA 2CUNA 1PSZA 2XMQA 3H4TA 2QXTA 2XRMA 3RODA 1RPAA 3OQBA 4DR7B 1GZSA 2KWIA 1J1UA 1V26A 4B6RA 2L2QA 4HEHA 3HM9A 3LRTA 3QVOA 1R0LA 3BCSA 4NMMA 3QKSA 4FMDF 1MX5A 2NVUA 5TE9A 4L73A 1C3VA 1S3SA 1GN8A 1SCJA 4E2YA 5JBNA 1SXJB 3DHEA 1P33A 1U7XA 4P81A 5BXQC 1V48A 2UZIR 1VYTA 2X0DA 4MI3A 1C9JA 3IB6A 1M2NA 3DE0X 4N5DA 1UQTA 1EFAA 1O2DA 4IZIA 1DXHA 3PR2B 4C6HA 4TYYA 3AFHA 1S4QA 1WZNA 4EO9A 1E1LA 2B2NA 3HB0A 1SN7A 3HEAA 5HEKA 1RYZA 5BUQA 1SCAA 1WBJB 5AK6A 2NPOA 5IRCD 4XFDA 2P2DA 1A69A 2QD1A 4M88A 4N82A 1XQWA 1TJPB 4OATA 3IELA 4QBHA 1R5JA 1WO8A 3CLUC 3HNPA 2PMBA 1N8SA 3AR2A 3PSAA 5SZHB 1UMCA 2AR7A 2H3EA 1J2JA 2CVPA 3L8ZA 3M5WA 4D4JA 4JDPA 3DJYA 4GP9A 4LFAB 1GZHB 3K31A 3KUUA 1R9JA 4IIDA 4TQGA 2PUEA 1JLSA 2VG8A 1X15A 4RA9B 2QRMA 3DS8A 3T9AA 3L43A 1USVA 1Z28A 4ZHQB 1NMEA 4B40A 3KVOA 9ATCA 2DTDA 1NF9A 2C1ZA 3OPYB 1L3IA 4WY8A 2VBIA 4BQRA 5HIMA 4ES6A 1MAHA 1KGDA 5K09A 2V58A 1QVWA 2VK2A 4QDXA 1Y6QA 3BHJA 4DR5B 4RD4A 2XMBA 4L0DA 3HHEA 3JY6A 1V4BA 3RUEA 4BQEA 3E48A 3G7UA 5HIAA 3T1NA 1GIAA 1NY5A 4IIGA 1KFBB 2QM7A 1KIAA 1O9HA 2VO1A 1EKXA 1FMLA 3VHRA 4Q4CA 5I9NA 4CL3A 3QY9A 5BYJA 3HABA 4RD3A 1CV2A 3CRMA 1T6NA 2CMGA 3RTBA 5HX7A 1J5XA 3ASVA 2PUAA 1ZWLA 5FADA 1QU2A 3H83A 3I39X 3KHSA 4PX5A 1NVTA 2Y1WA 1BW9A 2DBZA 1A88A 1J23A 2ZCUA 4FXPA 4LMPA 4ZQFA 1ZOPA 2CLCX 2W43A 5GGXA 2X4IA 4QT4A 3NDRA 1EX7A 4Z1OA 3OCXA 5JIBA 2E87A 5K3BA 2UUBB 2ZWPA 3RFCA 1GA6A 1TGYA 3FJOA 4RK7A 3EVZA 2GERA 3MINB 1OYVA 2XIJA 4MUNA 4NYMR 3RYFB 3UUEA 5KNDA 4E13A 3G6KA 1WNFA 3C87A 1RI2A 3KK0A 3PUVA 3W2GA 3EASA 3NOQA 4OM8A 1ZMTA 3EXIB 2MINA 3AV3A 5CH3A 3ISTA 3D31A 3SHOA 1K4MA 3AY0A 3IJEB 4LXQA 3NNSA 1IB6A 3H99A 5JYCA 1QGYA 2ERXA 2PXXA 2PZBA 3FVVA 4C20A 3KHUA 1DU4A 1P8AA 2AC2A 5LYJF 1D0SA 1SQ5A 3RU3A 3UJNA 2BUAA 3WBKA 3PNOA 2CJWA 2CN1A 2KBFA 5D1NA 5C8VA 2P9FA 2V97A 4F2DA 3HZRA 3O4VA 5DT2A 3FIUA 4KX5A 4C3VA 4II3A 2W4MA 1DHTA 3G7SA 3KKNA 2W93A 5J4YA 5CLHA 1CU1A 1G5RA 4EGSA 4NG5A 1X1RA 4CL0A 3JTEA 2OP0A 1IULA 1A2OA 4LJSA 2A35A 1BG6A 1WMSA 4BASA 4LK3A 2J6BA 2YQ5A 1YZUA 3HU3A 3NCTA 1ZOOA 5U4XA 4NH0A 1K1EA 1JVBA 2RGAA 3I2IA 3OLVA 4E70A 2VYND 3IMGA 4YXWD 2FY8A 1L8XA 1UBJS 2BKVA 2R7NA 3DE2X 3OZTA 5LLSA 4FGSA 1NFRA 2PQ0A 4XR4A 3O3CA 5HF5A 1NTRA 2ZAYA 3R77A 5AP9A 2FQYA 4C2UA 2X8WA 4D8TA 4K9PA 4NI5A 4BRZA 3W8FA 1TI7A 1IEWA 3PG5A 4F4CA 1JVNA 3L8EA 2YVLA 2XDQA 3K9GA 5A2GA 3WDMA 3I5XA 3ZDAA 1V6CA 4N3CA 2PKXA 2WK1A 3DLAA 3GCDA 3TKAA 2R8XA 3K70C 1TO1E 2AMYA 4QPDA 5SY9A 3ZU3A 1NN1A 5DYTA 3LLUA 1OLSB 2IU0A 1EBFA 4AECA 1ITZA 2HU8A 3D0KA 5JFGA 1FNBA 4CTKA 2ZPUA 2WD7A 3FUUA 4BMDA 3STWA 1AXRA 3IDQA 2X7XA 3R7WA 8ABPA 5IKEA 4O4LB 3C4QA 4DMFA 1KH2A 1A2QA 2G1JA 2YYYA 4F72A 4IGEA 4JEUA 1QP4A 1UOEA 4DMLA 2YVQA 3NP9A 1IG3A 3FYUB 4R9NA 2REBA 4EPXA 3NDBB 1XEFA 2RMKA 2HCFA 3LBAA 4WNAA 4BZPA 2H31A 1FYXA 4MW5A 3W6OA 5K8LA 1QXSA 3FRIA 3WMGA 3SKYA 4UEOA 2ZYAA 3BE4A 4HRXA 5B64A 4KFUA 7GPBA 3ZE8A 3PNSA 3Q41A 4NKRA 2WVAA 1ZRHA 4J4TA 1U0NA 2I9PA 3D3WA 4L07A 2JVJA 4ZO8A 4UW9A 4Q15A 2FJPA 3H18A 4BO6A 3OIGA 3MGAA 4PXAA 2ET6A 2XEDA 3D4OA 3I64A 2C5SA 5DYWA 3BKWA 4QUAA 1N32B 4YHBA 1YR6A 4L8LA 3BH6A 3N8DA 4WV3A 3OX4A 1B43A 1GJRA 3V8EA 3E22B 2O2HA 3MMZA 2YNMC 4MW9A 4NBRA 4JHLA 2QBYB 1C3JA 3OJXA 1PRYA 1JT9A 3Q5DA 3MB8A 3GA0A 5CCEA 4CWAA 4EK9A 1CNMA 1C0IA 4H15A 1F2UA 3MQ2A 1A8UA 3MF4A 3CTMA 3DE3X 4ARAA 8MHTA 5EUMA 1DXOA 3FVTA 4IXTA 4TTQA 3U3RA 4XWTA 1ORIA 2I8CA 1NJ1A 1QTRA 1RBQA 4D9CA 1QZTA 1X94A 4NCAA 4XSHA 3PDWA 4D9FA 2QLJA 3QYFA 3HXTA 3MRVA 1SZPA 3T1VA 1F60A 1SURA 3TR0A 3VR0A 4A82A 2DFTA 2DG2A 4QNMA 3IDAA 3HUDA 7REQB 3QHPA 4UXHA 3T9DA 4JN6B 4CUJA 3NQ41 3WLRA 4BL5A 3E6AA 3KB2A 4CIAA 4DUGD 2N3ZA 1XB2A 3AB8A 3HSKA 4L8WB 4XWAA 2MSKA 5FR2A 1YQTA 3BE6A 1K6XA 2H1IA 3ZE2B 1BHSA 1Z4PX 1C80A 1IRXA 4WWHA 5M04A 4NQRA 3RS7A 3S81A 1OFVA 3A6JA 3DZFA 4FX2A 4K6FA 4M0DA 4C05A 4IJKA 3NOVA 2J8ZA 3BE8A 3N59A 5F78A 4GRDA 2PT7A 2BC9A 3QLVC 4Y1RA 2PL1A 3K1AA 3WX0A 4EI8A 5C5DA 1NM5A 1PDVA 2HMAA 3OQ1A 3MMSA 3DDZX 1B6TA 3ETJA 4D1YA 4KDFA 4WX2B 2VNSA 1SHKA 2FWNA 5B58T 2AMJA 2IJGX 4A3SA 4BU1A 3NTQA 5KDDA 1EHYA 3T95A 3OA2A 2PFKA 3U3KA 3K8ZA 2CCKA 1PL7A 2EATA 1YJ8A 3PRJA 4JT8A 3ZE9A 2AG5A 2X23A 3KAKA 1E0KA 5CB4A 1QHHA 3LC0A 2ZTSA 4O6VA 4KIUA 5FIUA 4OIFA 1KMNA 3HLYA 2I03A 1OJLA 1YGPA 2WFZA 2Y4NA 1ZYUA 3SLRA 1UJ4A 5DM1A 5JY1A 5C8XA 3JR3A 2G6TA 3H7IA 5DGCA 5AK4A 3TPCA 2IQ5A 1I3OA 1QH8A 3C3EA 4HXEB 3V7YA 3CJTA 1R4AA 1YC5A 3BQNB 3D6UA 3GCZA 1DXQA 1BRMA 4FZRA 2V1XA 3VPGA 3HXKA 3WJ7A 4TMKA 4ASUD 1N1GA 1IHXA 1UJ2A 1HO3A 1BCSA 2BSXA 2Q28A 3P52A 2ORVA 4XB1A 5AW4A 2JLZA 1JU9A 4DHWA 4BO7A 1TJNA 1T5LA 1HLGA 4O8ZA 2Q4RA 1CX9B 3UQYS 4FR2A 4Z9XA 5LQRA 4V0LA 1TM4E 1Y9EA 3VR5D 2IH4A 4CNQA 3T7IA 4UTOA 3OM9A 2FZLA 1MV5A 3KYJB 4WK0B 2FPSA 1QGOA 1C3XA 4UM9D 3PLNA 4JKYA 5MN4A 2YXEA 4MKZA 3P0IA 2V7XA 3WGVA 2CGEA 2VQSA 1NNLA 2WWVD 5LMUB 1UT5A 4HH1A 1BEUB 4G0QA 4EPTA 1RYEA 4OSOA 2QRQA 2VYFA 5EGNA 2GA9A 2Q5FA 5M2QA 4J16A 1BRTA 3GEGA 1JEAA 1NVXQ 1KA9H 1EK2A 2X22A 3W5HA 3WIBA 3QENA 2QVBA 3KLBA 2I8AA 2OD7A 1ZX1A 1O95A 1E3DA 1QFXA 2PKWA 2WTMA 2ZT6A 3QIVA 4U00A 4EFDA 4F5ZA 3R6WA 3E4DA 1MGOA 4GXNA 1DAEA 4UVGA 3EA0A 3LUFA 1PQWA 1SBYA 4RE5A 5TQJA 3RFVA 3L5KA 2A0FA 3JQ7B 4QFBA 2AVNA 4R2XA 1V95A 3D8TA 5ALQA 4KZPA 5KKAA 1ARZA 4AICA 3HY3A 4A0RA 2QE7A 2I2DA 1CHDA 4DLLA 1W36C 3RVQA 3OQPA 4OBEA 1P17A 1F6DA 3RRYA 2XE8A 1ZGGA 2EL7A 4FIDA 4ZU1X 1PVOA 3MCVA 5KJEA 4PFKA 4CEIA 2OZLB 4K9RA 1GFSA 4IIYA 4M8NE 5ECDA 4EUEA 1ABBA 1FLNA 2PANA 1U4NA 3WQQA 5BQ3A 4AX4A 2IYOA 2XUZA 1FDSA 1YHNA 4DADA 4Y2QA 5CXQA 1P39A 3AJAA 4MW6A 2ZG6A 3EK2A 3W7BA 3ZXIA 4Z9FA 3LVFO 4OQMA 3K1JA 3WL8A 3WADA 2P1ZA 3WHPA 4BB9A 2AOXA 1ZH8A 2OL4A 3NJ4A 4IM7A 4K7JA 3NYQA 3BKXA 2OPHA 1KO7A 2ZWAA 1FFSA 3GJQA 5BY2A 3AM5A 9GPBA 1MO4A 2QQ0A 4RABA 4OFXA 2IZOA 3ET5A 4M7WA 1V71A 1H2HA 5CIYA 1VKJA 2WA1A 5C8YB 4KYTA 1QTNA 1E3TA 4QPZA 3NWJA 2ZQYA 1L4GA 3O2NA 5CLQA 2OXTA 3T7CA 3SU8A 3VNBA 4BLRA 4CMEC 4JC0A 1QLWA 3IBFA 5K8IA 1OWLA 4FQ8A 1JB1A 4QWMA 3M83A 4M3NA 1R7RA 2ZSHA 4JROA 1W9MA 1LVHA 2I6UA 2O06A 1OPXA 2WG1A 3OF5A 1O6FA 3OCYA 3LY9A 2PGXA 5GAJA 2AN1A 2ZYSA 4BVAA 1VG8A 1NSYA 3QXGA 1JXQA 2YTZA 2IX3A 3DOUA 4JVOA 5K0JA 2GM5A 5LQKA 1PW7A 1Y8QB 1E66A 4K1XA 3BL6A 2ZUFA 1VG1A 1Y1TA 5C52B 2GPWA 2XCRB 3MJFA 1DB3A 2BVNA 3IAXA 1TNDA 3D3QA 3THSA 4QQRA 4WY5A 8GPBA 2QD2A 2WWIA 4S35A 1J7JA 4WOKA 2NQ2C 4UOZA 1PZFA 3N6XA 1OTYA 4HNUA 5KOJA 2NOAA 3PX3A 4BE4A 5LPNA 2MTBA 3I45A 1WX1A 4I9UA 1DIRA 4F45A 2IUUA 2QZSA 2BGNA 3EPHA 1PWZA 1M7BA 4EHIA 4BFCA 3Q85A 1JIQA 2B21A 4MK4A 2SNIE 3DWEX 4PC1A 3AUYA 2GRAA 1HRKA 3O3MB 4J0QA 4QUBA 1J5EB 2WU4A 1ADYA 3L0DA 1J70A 1L7BA 2GTIA 2KHZA 3OCWA 1QE0A 3SMVA 1M34B 1DIAA 3QUTA 3KJXA 4JBNA 4DCVA 5D3MA 5AKXA 1DQRA 2DLCX 2WA2A 3CWZA 1JVSA 3FSEA 3GFTA 4RY9A 5IC4A 5DI9A 3CNNA 3EH2A 3TTTA 1L9XA 3GA7A 1W49A 5F98A 4KP7A 1N3LA 2EKBA 5KVCA 3U7GA 1EXDA 3I72A 3OJOA 4ZPXA 3X2FA 3WA7A 1HNZB 1FMFA 5K3DA 2JJ1A 3LNCA 4DNXA 5F3WB 4Y9RA 5DSTA 1F2TA 4DDHA 2O1SA 1H2FA 5DWDA 1VXRA 5DN6A 2RE8A 2J0QA 2YIDA 4CDNA 2P6UA 3M6FA 2KS6A 1L4NA 4I9HA 4D96A 3TLAA 3F47A 5FPKA 1N2SA 3Q0TA 1UM9B 1PFVA 1NURA 4N9WA 3EF3A 3DD5A 3U3JA 1M34E 5CEEA 1RHJA 1M74A 2QT1A 3TZHA 4UPEA 3EY4A 3HCDA 1FPMA 1UKVY 5A6SA 5JPCA 1HSOA 1V1JA 1N3BA 3KUKA 2X40A 4Q4JB 4CIDA 2ZE5A 2ZWIA 4L4YA 2X76A 2XZDA 4PGMA 1G0OA 5EJ5A 1E0AA 3T3MB 4DXDA 3K9QO 2DHEA 1YNOA 1AMOA 5K51A 3F9CA 3U5TA 4ZVSA 3DLBA 3DZ8A 1T4CB 1HYGA 2H7CA 1BGVA 2PX6A 3I2KA 5CYOA 2C0PA 2IXDA 2Q3DA 2QU7A 5D51S 2PL3A 3T94A 2UYOA 2FA9A 221PA 3FJ1A 3OPNA 5ALYA 1V2GA 4D3ZA 3GP8A 2HC9A 2JG3A 2NNWB 1N7JA 1RVDA 2VUUA 2ZIAA 4GECA 2UYCA 2V3CC 2XB2A 1A1SA 2NUTB 2ZSJA 3OQIA 5IAJA 2FPKA 3L7KA 3KQNA 2OAEA 3NT5A 3TLBA 4QTYA 4REQA 4F5DA 4EUNA 4ZK2A 4OHMA 4G86A 4X91A 3SHTA 3VH1A 3WBJA 3TRHA 1CVRA 1VQ1A 4P22A 5HE9A 3U9TA 4TMZA 2ZITA 1NXSA 4D6YA 3LHSA 4K9QA 4XYEA 2O7RA 2Q2VA 4MR7A 1AN0A 1M8GA 4EG4A 3OZSA 4AXBA 2RK3A 4GOLD 3U4IA 4M0EA 4D8YA 1Y37A 3RTCA 1TK2A 1O1YA 3B2QA 3D6TB 4RORA 4BJ6A 1EGMB 5FFFA 1GPNA 2GEBA 3K15A 1ZZGA 1T36B 4YWHA 2AZDA 4JKIA 1OIWA 5C7LO 2W5UA 4WZBA 2O48X 2V6BA 3BWMA 3JARA 3GJ0A 5CYFA 5K3SA 2OBMA 3UA4A 2Z2KA 4X65B 4PGAA 3MFYA 2V59A 3OZIA 3WYNA 1D4ZA 3MQFA 3VZRA 2NO7A 3KT8A 1X7XB 1AGPA 1PZHA 1V1RA 2W98A 1HA3A 3EQ6A 1H6BA 3FNQA 1PJ4A 1PSWA 4KE6A 4URHA 3UQZA 4BNYA 5CFRA 4AP6A 1YJAA 4K9SA 4P7KA 1KH3A 3F71A 4RMHA 1L5SA 4QSHA 3W3AH 2MSDB 3FB4A 5FUMA 1AHNA 1E2EA 1YZQA 2QL9A 3I2FA 3MJCA 4ZYZA 3UGQA 2WT8A 4RFSB 4IDNA 5EGSA 1GLNA 1GAXA 2H8GA 3DUFA 4NL4H 5DP2A 2IPNA 4NE9A 1ZC4A 1KRXA 4UREA 3COPA 1D5WA 1EFTA 1QKJA 1TK9A 2IW1A 3DTVB 4WZAA 4C3UA 2ZM5A 1O0SA 3U6BA 3I32A 3RASA 2R8OA 3ILXA 4XSGA 4XVUA 1UFOA 2YV3A 1KK2A 5GM1A 1DC3A 3PC7A 2Q3FA 4DJEC 1B4DA 4AN1A 2H11A 1DTEA 5DLEA 5KC8A 2VRCD 5HQTA 3FKSD 4MV4A 4AIRA 3OOSA 1ZNXA 3BD8A 1E32A 1P73A 3BC1A 2B94A 3NH9A 2AQKA 1FS4A 1QTIA 2CNLA 2FFRA 4NK5A 3U60B 1ZI9A 4HH3C 3ONWA 4QBIA 3TR5A 4AJ4A 4BMNA 4YCMA 3GAFA 3IGFA 4ENVA 8ATCA 3AH8A 1R9NA 3ZW8A 3DOHA 4XCXA 1M6WA 3W2TA 4Z4IA 4RDXA 3L7DA 1OYWA 1HX7A 3AP1A 1L4HA 3A7EA 4XARA 5TMDA 5CAEA 4D9IA 1BMFA 2IYRA 4R7TA 5E9WA 3JPYA 5AKEA 2YN4A 3WDLA 5BQ5A 2QN3A 1X9GA 2WU1A 4WZ6A 3CA8A 4H7FA 3BTVA 1PVVA 5TV2A 1SCBA 1ECBA 3GBSA 3Q10A 3VO1A 4AS2A 4KN8A 5CBKA 1X8KA 1XCBA 5CDHA 3OIVA 2Z5VA 1Z5WA 1OX4B 2NO6A 1M8FA 4HG2A 3LT0A 3M1YA 1ZD8A 1TCBA 2AOVA 2HWWA 4E1VA 1M72A 1N6PA 3FMFA 1UDCA 4QU8A 4KGZA 4C03A 1G5PA 4ZV4A 1RP7A 3AHEA 4NMHA 5FBQB 2PD3A 4OMUA 4HAXA 5DN9A 4EG5A 4MWEA 5MFZA 1FSFA 5EJ2A 4R2MA 5KQRA 3IHKA 3F5QA 5LZ4A 3ZHTA 2J31A 5HJEA 2FW8A 3OFKA 2IZ1A 4OGWA 1ZIYA 4TQUS 4KQWA 1DRKA 3HO1A 4KQXA 1XP5A 4J75A 4BNUA 4YFYA 1V2HE 1XLWA 1D03A 4DLAA 3ZV3A 3PLAE 5D3ZA 2Q3JA 1IG0A 4DC9A 2JIDA 4OFWA 3OSZA 2K7FA 3V46A 1I3MA 1I2AA 1E2NA 2RARA 1CULC 3INNA 1TZKA 4DZRA 1DBSA 3FZQA 1IQUA 5JEEA 3DOIA 4TXLA 3GGDA 1J99A 4MH0R 5DYNA 5ARDA 3VDNB 1V8OA 4CR6A 2J3JA 1MRNA 1XCOA 4KQ6A 3BWEA 1QGUA 1XZQA 3ZCQA 3RAGA 2GZSA 3JZMA 4E14A 2J33A 4F85A 4TL8A 1HNNA 1MHPA 3LMKA 4Y2GA 1CQJB 2OAQ1 2P41A 3A9UA 5LOVA 2GN9A 3SQLA 1SD5A 3GMTA 1MX3A 5DNYB 5GQSA 4B9EA 2OOSA 3GA5A 2GEFA 1SA0A 1WUHS 2OFWA 3BB4A 1P4RA 2N0SA 3LRXA 4P08A 1I33A 4X93A 5JY6A 3E70C 3KUDA 2IY7A 2PWZA 3RVPA 3GT0A 4ARZA 4JZYA 1OC2A 1BDJA 2G1AA 2Y68A 1DCTA 3C14C 1FTQA 2HF7A 3ZGYA 4CMIA 3OY7A 4INJA 3DWFA 4XKJA 4BQPA 4MMYB 1P3Y1 4G4JA 2QZ4A 2B1GA 1QE3A 2HV8A 1Q3TA 4OYYA 3WE7A 4A03A 1KQPA 1U3DA 2W0MA 4X94A 1EHIA 1XCGB 1QV6A 3IFSA 2FSUA 4L9SA 4CV3A 5BR4A 2VTBA 3SSAA 3OP4A 5AO9A 2A2ZA 1RI3A 3HZZA 1TF7A 1WMBA 2YMQA 1RRFA 1G6HA 2WZQA 3ELDA 5ENVA 1WUKS 2AFIB 1L4EA 2G40A 3W8EA 2WJ3A 1BAPA 2Q29A 2VH2A 5BN5A 2HUNA 3VO2A 4B8ZA 3AMVA 1W4AA 3RYTC 5FJJA 2IFTA 5JAMA 5ARBA 1U0LA 3NIGB 3B8EA 1LJ8A 4FTWA 5SZJA 1N4DA 1GLGA 4CKEA 1MJNA 1ESEA 3NXSA 1ID8A 3S0JA 2VSOA 3CNEA 4UJ3A 5EP1A 2Q3HA 4PQGA 2NPFA 1H8HD 1YO6A 4OI2A 1BE0A 1GG2A 1TM7E 2J3HA 4NE7A 4QZVA 3HUFA 3SDBA 1W94A 4GI3A 4I4LA 1U7WA 2O0HA 3IEMA 1F6BA 2C2WA 2H4YA 3ABSB 4O63O 1Z56C 1EP9A 4GICA 5LP6C 2UZ0A 3EZLA 2FPOA 4LDRA 4RPJA 4F6LA 2R8ZA 4C0JA 3KEFA 1CJUC 4TN5A 4UHBA 2FPPA 1FRNA 1XZGA 1KP9A 1FEZA 2NTJA 2ZI5A 4NYIR 5EG5A 4AJEA 4QOGA 3TGWA 1W5EA 3OBBA 3TLXA 3R5XA 1LUAA 5FLXA 1LKZA 5CNKA 4RZHA 5J1TB 3ZOKA 1JKXA 3LI2A 4LZWA 3MWEB 5ERYA 5K20A 2DQKA 3A6FA 2O3SA 3GD5A 4L5JA 3CRQA 5FULA 1M10A 2GCNA 2HMYB 4X95A 4KPGA 5KX5F 4B5LA 4F71A 5IKPA 3O92A 1W52X 2HRDA 1FBNA 1IFXA 2VJYA 3L79A 4O0LA 3SJCA 1UPFA 3BZBA 1N6IA 1Y8AA 5DLYA 1GV0A 5K45A 1II8B 1XRSB 3PCXA 3L1JA 4KQCA 1EINA 4P7JA 4AIIA 3HNOA 3B7WA 1TD1A 2BFCA 1NONA 1RIIA 1YBAA 2VHXA 3OZXA 5F12A 1SXPA 1ISGA 1IZYA 4C1NA 2MINB 1Q21A 4HRYA 4NCNA 2I2AA 4YCBA 4EG6A 4MB2A 4NZMA 3TB4A 2R48A 3GJYA 4F2HA