3WSWA

Crystal structure of minor l-lactate dehydrogenase from enterococcus mundtii in the ligands-bound form
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
316
structure length
316
Chain Sequence
KTSRKVVIVGTGFVGTSIAYAMINQGVANELVLIDVNQEKAEGEALDLLDGMAWGEKNVSVWSGTYEECQDANLVILTAGVNQKPGQTRLDLVKTNATITRQIVKEVMASGFDGIFVVASNPVDILTYLTWQESGLPASRVVGTGTTLDTTRFRKEIALKLAVDPRSVHGYILGEHGDSEVAAWSHTTVGGKPIMEYVEKDHRLEENDLTVLADKVKNAAYEIIDRKKATYYGIGMSTTRIVKAILNNEQAVLPVSAYLNGEYGEEDIFTGVPSIVDENGVREIIDLSITPQEKAMFHQSVSELKAVLDTVRLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
publication title An alternative allosteric regulation mechanism of an acidophilic l-lactate dehydrogenase from Enterococcus mundtii 15-1A
doi rcsb
source organism Enterococcus mundtii
molecule tags Oxidoreductase
total genus 105
structure length 316
sequence length 316
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wswA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 3wswA02
1NHWA 1MLDA 1JVSA 3MOIA 2ZYDA 1ULSA 4AJPA 1FXSA 3CZRA 2EJWA 4BS9A 2RH8A 1OAAA 4MVJD 3CMCO 2V65A 2HMTA 3LDHA 4B8WA 2VWHA 1DIBA 1VL6A 1DSSG 3EMKA 4ND1A 5B4UA 5ITVA 2X8LA 2WE7A 4TSKA 2Y99A 5DCYA 1SEVA 1WMAA 2FRDA 2WEKA 1Y8RB 1MC4A 4ZHSA 1NVGA 3Q9NA 1UZNA 5IN5A 2NU6A 3I1JA 3ZWMA 4BGIA 4QUKA 3RD5A 4E2YA 4N54A 2JHGA 1IHXA 1LSSA 3WYBA 2Q46A 1D3AA 4EEZA 2J5QA 1Y8QA 3O8QB 3W8EA 1R4NB 2Y1FA 4ALNA 1T24A 3R1IA 4QEDA 4BNUA 4UVGA 5DNAA 4ALMA 2CDBA 2YFQA 3QVTA 4A10A 2ZIZA 2GGSA 5JNLA 5JBIA 4CMBA 3ZV4A 4FS3A 2BFMA 4LSWA 3WWYA 3E6AA 2DU8A 1T2DA 3KZVA 4XGIA 1A4UA 4NFYA 1LDMA 3JQ7B 4J4BA 3S8MA 4S3MA 3TDKA 3VVCA 2WYUA 1P0CA 4RORA 2GYYA 3DZKA 1QV7A 3G17A 3HFSA 3IKTA 4K9DA 3ABIA 4LVUA 2ZATA 1YOVA 3OJOA 3INRA 2CF6A 1X7HA 3JQAD 2JKVA 3KYCB 4CJXA 5CDUA 5EN4A 4NH4A 3AM4A 1T2CA 2OORA 4B7XA 4IQ8A 4Y6SA 2VYND 2XPCA 2Z1NA 2VZ9A 1BXKA 4MOWA 4E5YA 5A4DA 1DIAA 5FEUA 4TZTA 1E77A 4YCAA 1EQUA 4NBUA 3LC1O 3RC7A 3OJEA 4BVAA 3GAFA 4XX0A 4MO2A 1WAMA 3F5SA 4MVJP 4PN3A 1G1AA 3SXPA 1DJQA 1GEGA 4NFHA 5KKCA 4OHUA 3I9OA 4R1SA 3VZQA 2D3TA 3I4CA 1LLDA 1K5HA 2NQTA 3O4RA 3FNEA 1OOEA 1NM5A 3FR7A 4PLZA 2PZMA 1KY4A 3H9QA 1ISMA 3FR8A 4E2ZA 4NK5A 1LRJA 3EW7A 4XA8A 4RO0A 3F1LA 1F12A 1N92A 4CR6A 3ZV5A 3KOUA 1EEHA 4IBOA 4Z9YA 5DOZA 5BNFA 4J1TA 3ZWOA 3PQFA 2PKQP 3WWZA 1FDSA 3QWAA 2X22A 1P1FA 4PVCA 3N7UA 5C37A 3ZHZA 1AHIA 2VNAA 4NHEA 5CP8A 4YT2A 3I9LA 4PGFA 1JVBA 1P44A 5KIAA 4CLOB 1O94A 1QORA 1ZNQO 4CMEC 3TZKA 3BHIA 1FDUA 3OETA 4JROA 1OC4A 4UREA 1AE1A 1XQ6A 4XDZA 1HDOA 4MIYA 3AJRA 3F4LA 3QWFA 3C24A 1IL0A 1BGVA 2ZTUA 4FC7A 3CH6A 4WGGA 3BYZA 2RIRA 4J7XA 3H3JA 3X2FA 2OZPA 3GQVA 2DT5A 3I6IA 2VHXA 3EVTA 3UAGA 5FI3A 5AXBA 1P77A 4GMFA 1I36A 2OP1A 1GUYA 3P19A 5I7FA 3DZFA 3JQAB 3ZH2A 5JC1A 1VL8A 1Z74A 2AEFA 3O9ZA 4BOYA 1DOHA 4DLAA 1PGNA 1SMKA 4G65A 2H5LA 1Q2XA 3HADA 3WBBA 1P0FA 3F9IA 4FC6A 3U3XA 5JDCA 4GBJA 2JD1A 1UDAA 4GGOA 1TI7A 3DZBA 1IPFA 4CQMA 1NFQA 2CSUA 5JAMA 4IUYA 1PQWA 4MKRA 4Q9NA 4EJMA 5L4LA 3FI9A 3IDSA 2VWQA 4R54A 4J4TA 2AEMA 2AHRA 1ZJZA 2AQ8A 3NUGA 4OL9A 4YDRA 4BNFA 2P5UA 2FSSA 2HRBA 3JD3A 2X5KO 8ADHA 3DR3A 4I08A 3WXBA 1JWAB 1PR9A 3KRTA 2EP5A 4P38A 1AXGA 3AUSA 1EVJA 2C20A 4OYRA 4BO1A 2R6JA 3GK3A 4BO9A 2WWRA 2EERA 4CM8A 3WX0A 1HDRA 3NYWA 2DBVO 2DM6A 3SC4A 4GSKA 3WICA 2PTGA 3SVTA 2ZYGA 4U0KA 4AJIA 1F06A 1MGOA 2RHRA 2LDXA 2QG4A 1SAYA 3TNLA 1RJWA 4NBTA 3LSYA 3HG7A 3TF5A 1X7GA 5AXAA 3ZCXA 4ZD6A 3AOEC 2VTEA 3D0OA 4S1VA 2G0TA 4FFMA 4YQZA 2P68A 4R5HA 2UUOA 4E4YA 2WE8A 3DWFA 1LXCA 1IPEA 3OJLA 3EVNA 4PVDA 4R41A 5T67A 1A9ZA 3Q2KA 3RBZA 4IDBA 1WMBA 3JYLA 1PZGA 5HS6A 3RFVA 1ISFA 5HWSA 2PWZA 5A06A 3PEFA 2O3UA 3TL2A 3PVZA 4DC1A 2O2SA 3RWBA 1JWBB 1HZJA 5JPIA 2EJVA 4DA9A 2EWMA 4E0BA 3QW2A 1VC2A 4B8ZA 4LISA 1J5PA 3RUIA 3TZHA 1R4MB 5AQ1A 4EDFA 4BHTA 2H6EA 4FFRA 3ASUA 4J91A 4IQ0A 1PGOA 3U4HA 1GZ3A 3JYNA 4Q3DA 2O3RA 3R0IA 3U4IA 3OICA 1CWUA 2R00C 4ZQEA 3ZWYA 4WKGA 1R12A 4H7PA 1Z6ZA 2O50A 2X0NA 4W82A 1TVEA 2HRZA 3LYLA 3PFWO 3R3SA 3M6IA 4P22A 1FK8A 4KQWA 5H83A 1FDTA 1YB4A 2NWQA 1LQUA 2P2SA 3GN2A 2R2GA 2HO5A 3AFNA 5DT9A 3S2GA 5ES3A 3CMMA 4WCDA 3ONDA 4B4VA 1YKFA 3OQ6A 1PWZA 3ROMA 1PZHA 2FPIA 5DF1A 4Y6RA 8LDHA 1UXGA 3K31A 3ROPA 1DRVA 2J3IA 3GPIA 1L7EA 5EL0A 2C59A 2EHDA 2Z95A 5FYDA 3SLKA 2X86A 3FTNA 1DIHA 3QY9A 4GVLA 2HK9A 4UUNA 1NVMB 4RPGA 1TLTA 3QSGA 1DIRA 2GERA 2NACA 4WECA 2B5WA 1LDNA 3QWIA 3KTDA 1E1KA 3BMOB 3JD4A 2I5PO 4GQAA 1I3MA 4CMJA 2NV6A 4J9VA 5EIOA 5I7VA 1H6BA 4BGVA 3U0BA 1LDBA 3G79A 3H9EO 4IXTA 1DFIA 3UKOA 4DQVA 2DTXA 3DB2A 4IQGA 1DXYA 1Q0LA 4UVHA 2EW8A 4X54A 1VI2A 1U3WA 2BKAA 3JQEA 4JBIA 1VRWA 2W8ZA 3LC7O 1KYQA 3LT1A 4J49A 4UVDA 3V2UA 5CPFA 3ZGYA 5ADHA 1EBUA 1PGQA 4Y67A 1UXHA 5IJZA 4W6ZA 3D4PA 2VWPA 2A35A 1SNYA 2QRKA 3D3WA 4FBGA 1LSOA 1JKIA 3TFQA 5F21A 2GN6A 3KYDA 4GI2A 5TJHA 4XB1A 1KERA 2IYOA 4YT5A 3QVSA 1VKNA 1BXGA 2J3JA 1IZ9A 2FP4A 2OHXA 4R9RA 4DYVA 4LSMA 3KLPX 4TRMA 3VH1A 1SEPA 4D42A 5IZ4A 4CM6A 1E3WA 1LTHR 3SBOA 3QHAA 2D5CA 4GWKA 2GCGA 4XR9A 1N1EA 1QYCA 4JBHA 2YDXA 5AOVA 4CLEA 4CM9A 1VJ1A 4BUCA 1W4ZA 3B6ZA 3IMFA 4LMRA 4D41A 4I5FA 1B8VA 3EZLA 1EVZA 1NFRA 3W4JA 1U3TA 2DFVA 1DRUA 3KHUA 5GZ6A 1CERA 2UV8A 3VDQA 1ULUA 2P9GA 4PG6A 4KWHA 3PYLA 4WASA 2OL4A 1LJ8A 1U7TA 1XLTA 3C3XA 4I9HA 4E2WA 3WTBA 3JV7A 1H6DA 3T4XA 3ZW8A 1HETA 1QYWA 2PKRA 4N7RA 4DIBA 4P4NA 5EPOA 4MIEA 2HKIA 1GUZA 1ENPA 1UAGA 2Q1UA 3GF4A 4J9UE 3ROQA 1K6IA 4B7CA 4IJWA 3JQ8B 1DEHA 5B37A 1W73A 1T4BA 3F4BA 5C7OO 5A5EA 4K6CA 2C29D 4M89A 1I32A 4ZRMA 1GDHA 3E18A 4CLRB 4DVJA 4QX6A 1JW9B 2PR2A 3PHIA 4KUEA 3BTSA 3WYEA 5BNTA 4KDFA 4HFMA 3AOEA 1YH3A 2A92A 1C1XB 1ADBA 3AUTA 4OM8A 3GPDG 4R51A 4R69A 4L8VA 4RCVA 1I2CA 1UXIA 2V6FA 3V1YA 4E30A 3CZMA 3TQHA 4B4UA 4OAQA 1A7AA 1M67A 3SJUA 3VPXA 5JO9A 3WJAA 1Q7GA 1HDCA 2Y0DA 5I9MA 2FN7A 1P3DA 2JL1A 2WD8A 3ZI0A 4CL8A 1YGYA 5DBGA 1KVTA 4XWYA 1YL6A 2IEBA 2BLLA 2P91A 5IG2A 5KNLA 4BO5A 4BNJA 1GD1O 4PZCA 1ZK1A 2RH4A 3GMSA 3L9XA 5CAEA 3ZN2A 1QLJA 1XIVA 3E8XA 5JFOA 1XKQA 4L75A 4OOFA 4R68A 3WGGA 3ADOA 3DQPA 5FF9A 1GZ6A 4A5OA 1EUZA 4FPXA 3SC6A 1LA2A 4EEXA 2X1HA 1G0NA 3PRJA 3PJDA 4R16A 4O63O 4YAIA 3N74A 3O03A 4TKMA 1MFPA 1XYGA 4BKRA 4A26A 1Y8QB 1E1NA 1E0DA 1A5ZA 1LLCA 2C2XA 1QSGA 1U7HA 5EQFA 2PKQO 4U5QA 1XU7A 2X0IA 3R3JA 1PJTA 1NQOA 4XRGA 4GX2A 1KS9A 3KYBA 4B79A 4AJHA 1DFHA 2CMDA 5ER9A 1HZZA 2XAAA 3JSAA 3H65A 4MVJF 3PJEA 3PGXA 3PLRA 3Q1LA 5F1KA 4Y9DA 2PZLA 3HDJA 4HADA 1YQXA 4C7JA 5B12A 2IXBA 3PK0A 5G0UA 3RAJA 4AVYA 1YOVB 2V6BA 1KETA 1GPDG 2FHSA 4E12A 3KUXA 5A3JA 3FN4A 2FPPA 1Z82A 2EKPA 3L0DA 5JW6A 2PD3A 3AOGA 3MZ0A 4JIGA 5DULA 3RQSA 4CMKA 4KUGA 4D3FA 1Z45A 4CM7A 4DRYA 1FJHA 1EMDA 4CQMD 1I3LA 5JLAA 1KEVA 1ZK2A 3GEGA 5A9RA 1I0ZA 1I8TA 1B15A 4J1NA 3NTRA 1NQ5A 1PEDA 4GWGA 5TLSA 1RM5A 3C7DB 2NLOA 3UFXA 2NU7A 2Y05A 1LRKA 5KVSA 3HHPA 1U4SA 2E4AA 1SO8A 1Y9EA 4Y8VA 1B3RA 3JQDA 3C7AA 1U9JA 4E5NA 1B16A 5EERA 1Y5MA 4EUFA 1OC2A 3I4FA 4GPD1 3WQSB 3WTCA 3GRPA 3ETGA 3INTA 1T1RA 1BTOA 5CFZA 3LT2A 6LDHA 4LCEA 4BO2A 2ZCUA 3GDFA 3AI2A 3E48A 4NIMA 4II2A 5KWEA 3RJ5A 4OXNA 2GRAA 1LC0A 1LLQA 1JAYA 1UR5A 2PH3A 3ETEA 1B8UA 4OSOA 2C82A 2VUUA 1RKXA 1PJCA 1VE9A 1B0AA 1W0CA 4YJDA 4CLDA 3OA0A 4BIIA 1NXQA 3NKLA 2HK7A 2DUUA 1HE4A 2AG5A 2VTDA 4WCFA 4GVXA 4BNKA 1GYRA 5K0ZA 2YUTA 1NP3A 3V1UA 4D79A 3QVXA 1ML3A 3ZWXA 3DAFA 1ZBQA 3UHAA 4R1UA 1UAYA 3VZRA 1ZW1A 2WDZA 4WLOA 5JDCC 3ZWNA 1PGPA 4WNIA 1BVUA 4XIJA 3FBGA 3IP3A 4N5LA 3AU9A 4IJKA 4CQMB 3I9MA 3AM5A 3IQDB 2ZTLA 1ZXBA 1MXFA 1VM6A 3ADPA 5JY1A 2HQ1A 3JQ6A 3WYCA 4C4OA 4NU6A 2I65A 2OUIA 3FWNA 1CIVA 1X14A 4IJVA 2YV1A 3ORFA 2E49A 3EAGA 4DPKA 2GDZA 3ONEA 3U62A 1J6UA 2NU9A 4J4HA 3GVXA 1P33A 5DBFA 4IS3A 3RBVA 4CM8B 4E21A 2FWMX 2CF5A 4KOAA 5JC8A 1U2GA 1GQQA 5GZ1A 2J5KA 3FPCA 3E9MA 1M6HA 3K73O 4OOEA 3WIEA 2BFAA 3GFGA 3F47A 3LU1A 1HE2A 2PD4A 4K28A 3NT2A 4ZRNA 4E5KA 2P4QA 3FD8A 3OIDA 2O48X 4MKXA 2X5OA 4RPKA 1PJLA 3VH3A 1DLIA 1NQTA 4ONEA 2IEDA 3PZRA 1P74A 1V3VA 3MEQA 3AI3A 4B3IA 1H9BA 3DBLA 4CUZA 4W7HA 1BG6A 3B20A 1I30A 4BO0A 4YXFA 2CY0A 3JYOA 1YS4A 3DDNA 3DTTA 3HFGA 4Q39A 4LCJA 1Y5RA 2OO5A 4DLBA 1TA4A 3FNHA 3B1KA 1HSOA 3V2GA 4DQXA 1F14A 3FRJA 5EQDA 5CDYA 1ZCJA 3PHLA 4HY3A 3WGOA 3ULKA 3H9UA 4M8SA 3K92A 4JQCA 3CE6A 3VDRA 2UVDA 1H2BA 2EP7A 4J90A 2GZ3A 5GZ3A 3M1AA 4KDEA 4ZQBA 2GPTA 3IJRA 5IF3A 4IS2A 3ANNA 2D8AA 2I6TA 2IXAA 3OECA 4A7PA 2ZCVA 2POQX 3LF1A 5T57A 3AW9A 3MJ4A 2NSDA 1NR7A 3HB4X 3RASA 1E6EA 2XOXA 2BGLA 3PQEA 1DC3A 1ZZEA 3WG9A 2XF8A 4ND4A 2PY6A 3TZ6A 2QIOA 1HXHA 2VZ8A 2GN8A 1O89A 5KCZA 4OJNA 2PNFA 2JFHA 3KM0A 3WGYA 3OF2A 5DOVA 2YHUA 4EUEA 4OGWA 3GUCA 3ZDFA 4ZJUA 1B7GO 3AWDA 2UUPA 4GLOA 2VHWA 4YJHA 5THKA 1H6AA 1KVQA 3ZNOA 2OBNA 2P9CA 2DBZA 1WP4A 5L4NA 1Z75A 3D7LA 1A4IA 3NDRA 1BVRA 1X7DA 1YBAA 1UP7A 4Z6KA 5K6AA 4FOSA 3E1KA 4DUPA 4O59O 2IZ0A 3F1KA 1ONPA 3UN1A 1QYDA 3JQBA 3MJSA 5COQA 3MOGA 2YDYA 4K1LA 3NTOA 4RVDA 2CVOA 5COAA 2NTJA 2FR8A 2EKLA 1KVSA 4J0EA 1KVUA 1OBFO 2NVUA 3QE3A 2JCVA 2PGDA 3LK7A 4ZQHA 3F5QA 2C07A 1E5QA 4GX1A 1DFGA 3ENKA 5L53A 4G2NA 2D1YA 2Q45A 3KSDO 4TMFA 5JDIA 3JTMA 3PDJA 3CUKA 2GUGA 3F46A 1S7CA 2YHIA 3C8MA 1MX3A 4BNMA 3BAZA 5KTKA 3RKRA 1D8AA 3GRKA 5L4SA 3VAZA 3ZNQA 2X0RA 4YT4A 1T2FA 2ZK7A 2X6TA 2AA3A 2PH5A 3GG2A 4WLEA 3HWRA 3U09A 1X1TA 4KWIA 3OQBA 3D3WB 2FPGA 3C1AA 2EEZA 1UH5A 5EJ2A 3KYDB 4NDNE 4QQRA 4U0JA 3VVBA 1ISGA 1DHRA 1DO8A 1BXGB 1PSDA 4GSLA 2DBRA 3AI1A 1D7OA 5C5IA 3DL2A 4CLHA 4JJFA 1E3WB 5G0SA 3NX4A 4II3A 3PYMA 1HDZA 3RVDA 2W90A 3KSUA 1N8KA 1XWFA 1C0KA 3I52A 3K8ZA 3AM3A 3G3EA 3X2EA 1E3JA 5CDSA 5I7EA 3SEFA 3FHLA 2PK3A 3VH2A 4BB6A 1ENOA 4DQUA 4PG5A 1SBYA 4OH1A 1YB5A 1PL8A 3PWKA 3ITDA 4FQ8A 3A1NA 5DP2A 4Z9XA 1KEUA 3C1TA 1SOWA 4INAA 1EFKA 1YJQA 4BNVA 3VH4A 1C14A 3DOJA 4M87A 4ALIA 1UP4A 4FGSA 2AW5A 4DBZA 1U8XX 3GNSA 1JDJA 1WZIA 4JP3A 3ZV3A 4CLXA 1HTBA 1HT0A 3TOXA 2WMDA 2D0IA 5ENVA 3V5NA 2YY7A 5A05A 3TRIA 1J0XO 1CEQA 1UXJA 1XU9A 2E48A 3S55A 5DN9A 3HN2A 5JS6A 1B8PA 3A9WA 1WZEA 3W8DA 3WOHA 5THQA 1HE3A 2A94A 2BFPA 3AY7A 4BKQA 4OXKA 5CDGA 5A02A 1E7RA 4FD3A 3T7CA 1CF2O 1KBZA 5AYVA 4AL4A 3ZWAA 2FY8A 1IHYA 4IDAA 2JAHA 2Q1TA 7MDHA 1QMGA 1WWKA 4RLHA 1R66A 3W4KA 2BH9A 1FDWA 3ANMA 1YJ8A 5BNIA 1GUFA 2ZTVA 4MPDA 3QVOA 1JN0A 3H7AA 3BMCA 4YAJA 3PXXA 2AXQA 2AMFA 2NNLD 3PHGA 4H15A 1VKOA 4Z0HO 4BV9A 1XELA 4I9NA 4QECA 4A27A 3RC1A 4O6VA 2O7SA 2QRJA 3ZWVA 4AJEA 2HJSA 5I9NA 2VT3A 2Y67A 2PLAA 4RVHA 3PWSA 5J23A 1H94A 4B3JA 2VN8A 2DAPA 1TXGA 3WNQA 4CMAA 9LDBA 3VHRA 2VT2A 4PLWA 3IL2A 2QHXA 4JP2A 3GVHA 4DGSA 4Z0TA 2FZWA 4C7KA 3UW3A 4G81A 2GSDA 2JFFA 2FMUA 4IZIA 4YTEA 1DRWA 4IDFA 3T7EA 3UVEA 4TRNA 3H6KA 4XYLA 3QJ5A 4CQLA 1BXZA 1P9LA 1U5AA 2DPGA 3LT0A 4N5NA 1ZIDA 4HXYA 2VRCA 3JQGA 2V6GA 4BKOA 4TZKA 4YBZA 5TT0A 4BNTA 4UUOA 3OFSA 1VPDA 5G0TA 5HS4A 4ID9A 3JCZA 1ZSVA 3L6EA 5L7TA 3DHNA 5JE8A 5JY6A 4MIOA 1Y81A 1PR3A 3ZHYA 5BR7A 1V35A 4B4WA 4I5GA 4IIUA 3CSDA 2G5CA 3HQ4O 2OBYA 1WXDA 1DAOA 3JQCA 3WFJA 1XQ1A 2ZKLA 4R3NA 5BQFA 2GZ2A 5G2OA 3H5NA 4BNWA 2P4HX 3MJCA 1CRWG 1HF3A 5C7IO 3DBRA 3FWZA 1LRLA 3L6OO 4B3HA 4RVUA 2JCYA 1U1IA 3FNFA 3NT5A 1K6XA 3DXFA 1PJ4A 2C0CA 3GZNA 3LLVA 2O3JA 5TC4A 3DAGA 4H3VA 2CUKA 3WGIA 1JAXA 3GGPA 5I7SA 2QRLA 1ORRA 5MGBA 3DBHA 4FW8A 3V8BA 2IDZA 1PZEA 2Y1GA 5HM8A 1NFFA 1PU2A 1ARZA 1MFZA 4MVJA 1UZLA 1UDBA 2Y1CA 4CV0A 3RFXA 4Z3DA 4YJGA 1NNUA 1EE2A 4J7CA 1JTVA 5CG2A 2ZJ0A 4RDHA 1MC5A 1HEUA 3PYXA 4PLTA 1PJ2A 3ZU5A 1YVEI 2HUNA 1Q1NA 4RF2A 5HA5A 4XQGA 4WLUA 4A0SA 3DMTC 3ON5A 3Q11A 1DLJA 3ETDA 3SLGA 4AJLA 1V9LA 1XEAA 3D64A 3K5PA 1PTJA 6ADHA 3RCBA 5KJ6A 3WQQA 5L45A 1I3KA 4MP6A 2O7QA 4GL4A 4IDDA 5BSEA 4F6LA 4LVCA 5EINA 4NNJA 1ZMTA 3UCEA 5ITWA 3OP4A 1XG5A 2WYVA 4KQXA 1QYVA 2OOSA 5DP1A 1JU9A 1P1HA 3UF0A 2BHLA 3I9KA 2BD0A 2FOIA 2QYTA 5F5NA 1LEHA 3NTQA 2WD7A 3NT4A 5H82A 1X13A 1ISIA 2ILTA 4ZICA 4DYDA 4AJKA 3PJGA 4FFOA 7ADHA 3DOOA 3KO8A 1NWHA 1RWBA 3PZBA 4ZGWA 4URFA 2CNBA 3KSZO 4WCFB 2JFGA 4WCFC 5KJFA 2Q4EA 3BMQA 3PIIA 5TX7A 3QVWA 5L40A 1H0KA 1GZ4A 1G6KA 3HUDA 5T6BA 5JSFA 3QWBA 1IULA 4WLVA 4CPDA 4MVJE 1XSEA 3D1LA 3W6UA 1PX0A 1S6YA 3MJTA 4BNGA 5A5FA 3D4NA 4FB5A 4RV9A 4NJMA 2HLPA 3DMYA 4UVIA 5KVQA 3WQRA 3A28A 1U3UA 3JD0A 1VSUA 4XQCA 3P5SA 1Q0QA 3IKVA 1MA0A 3Q6IA 1OI7A 3IUSA 5IN4A 1PL7A 1U3VA 2X7HA 5L7WA 1NTOA 2W2LA 2PZKA 1O0SA 1HLDA 2D4AA 5JMPA 4KTVE 4TRRA 3RROA 1AUPA 3LZ6A 4CV1A 1J49A 1N9GA 1TT7A 2RHCA 1YB1A 5JMWA 3NEPX 4J6FA 4YVFA 5A04A 3QRWA 1F8GA 3B1JA 5F1PA 2I67A 1NASA 3DEYX 5B1YA 3PDUA 4ALKA 4I1IA 3ZNPA 1DPGA 4FCCA 4JJIA 4FOOA 1B26A 4D45A 2WM3A 1YRLA 2X9VA 1QR6A 4YRDA 4K6FA 1J4AA 2RCYA 4YRAA 1JLLA 2FR1A 2PA3A 3QP9A 3VPFA 4WEOA 4KTTE 1ZUD1 3KXDA 5ILOA 4HWKA 1GYQA 2J6IA 3DBLB 4JBGA 4JNKA 5G0VA 4RVGA 3IOYA 4YT8A 4R9SA 4A03A 4EW6A 5CPBA 1XA0A 4AG3A 1P45A 2CDCA 1WDKA 4BO3A 3RU7A 4AJJA 1YWGO 3JQ9A 1WW8A 4D3SA 3K2BA 1CQIA 1NAHA 3PWZA 5MDHA 2VOJA 4UVEA 5CEJA 2XXJA 4YAEA 1Y7TA 3GY0A 2DQ4A 2IRWA 3E9NA 1N2SA 2RBEA 4AJ2A 4O0LA 1HSZA 3DZIA 1NHGA 1SCUA 4MINA 5DCUA 5JAIA 2CFCA 1NPDA 1GPJA 3GUYA 2I3AA 3RI3A 1K3TA 5IDQA 3DFUA 4CM1A 2J3HA 1GR0A 4PZDA 2O23A 2BGKA 4HX5A 4GGPA 4WOJA 4BGEA 4CMIA 3EYWA 2WTBA 1PQPA 1V3UA 1GAEO 1F17A 4W9NC 4KZPA 4HV4A 5F3RA 3G1TA 2HMUA 3T4EA 3CXRA 1K89A 3MTJA 2EKQA 1HE5A 4NK4A 5FI5A 1PGJA 1SB8A 1WVGA 1P1JA 3QQPA 4IMRA 3VOSA 5LDGA 3I83A 4F45A 4YJHB 4UAGA 1PJSA 1MG0A 3IJPA 2DTEA 3NJ4A 2Z1MA 1QLHA 1V0JA 2EV9A 1ZXLA 2PGLA 3W6ZA 1TB4A 3H4VA 3GHHA 3Q2IA 1SZJG 1Y6JA 3E5RA 3BXXA 5K6AC 3PHJA 3KB6A 1M2WA 1V3TA 3DMTA 2EF1A 3JQBC 1W8DA 3ZWCA 4RF5A 5KVVA 2CVZA 2BELA 3WLEA 5JCJA 2DUWA 2BFOA 4OQZA 3EHEA 1N5DA 3GVIA 1QKIA 2CDAA 2Z5LA 5ICMA 4L73A 4QFCA 2NVUB 3G1UA 1SC6A 2DFDA 2ZTMA 3O38A 3PI7A 3VPGA 3ZU3A 4TROA 3FNGA 4DMMA 4BB5A 3VZPA 1Y1PA 1YQGA 2BI8A 1PZFA 3GOHA 5JDIC 2X0JA 4YQYA 1GY8A 3E82A 1M6WA 4FSHA 4TRJA 1T26A 2YHIB 3UGKA 4NBVA 3GA0A 4TQGA 5L51A 3HNPA 4NZ9A 4W4TA 4XDYA 4XZ3A 4KMSA 1ZSNA 1HYHA 2VRBA 2C2YA 1NWCA 5IDXA 5JAZA 3UUWA 3U5TA 2G76A 3B1FA 4XGNA 4CV3A 1BWSA 2EXXA 5KJEA 2B4RO 4OIMA 1HDYA 1Y9AA 2QW8A 4NQZA 4BKPA 3V1TC 3GDOA 2NVBA 5COBA 1NR1A 4LK3A 4YJFA 1A72A 1IE3A 4IINA 2AQHA 5HBRA 2ZB4A 1NQAO 1FF9A 2QQ5A 2VYVA 3BHMA 4HNGA 4J3FA 3MTGA 3DAPA 4PLCA 3I9JA 1C0IA 2B35A 3IAHA 4UUPA 1LNQA 3H9JA 4EUHA 1VLLA 5G4KA 4J2HA 1Q7CA 1U5CA 1BDMA 2ZJ1A 4L4RA 4E3ZA 1LUAA 1ENZA 5ILGA 3ZNNA 3JD1A 3NDJA 4CODB 4B7UA 1U8FO 2X9GA 1HL3A 2HAEA 1C0PA 3OEYA 1X0VA 2PV7A 1CJCA 4DTIA 4WPGA 1ZK4A 3IS3A 4O1MA 4UEOA 4N18A 1N7HA 4XGKA 5BSGA 2CVQA 1YDEA 3GNTA 1XGKA 2AQKA 2W4QA 4PG4A 1UUFA 2VRCD 4E32A 2AG8A 3H3FA 5BSFA 1EUDA 3IC5A 1BMDA 4PRKA 2X23A 4RF4A 1N7GA 3L6DA 3H5RA 4Q3EA 5IXSA 4XR4A 4BO8A 4XQ9A 2W2KA 2PD6A 2X9NA 5G0WA 1KY5A 2Q2VA 4XEHA 5LDHA 1X1EA 2H9IA 3SJ7A 1CYDA 2JJYA 4ROSA 3RFTA 4NMHA 1BHSA 2GZ1A 4RZHA 5ER6A 1O95A 4OO3A 5HRUA 1C0LA 4Q3AA 4DBVO 1L7DA 4U6SA 4BKUA 1EDZA 2G17A 2PZJA 4JGBA 4ND2A 4BQRA 5U9CA 3OEWA 4MDHA 4MKZA 1QYXA 3GFBA 1ZKMA 4M1QA 1IB6A 2EG9A 2HDHA 1PS9A 1VJTA 3VPHA 4E5PA 3TN7A 2BRUA 4BO4A 1KOLA 3AFMA 3BMCB 4XYEA 2I3GA 1FDVA 1WDLA 3OHSX 4IM7A 5KKAA 2Y0CA 3I6QA 4OSPA 5EESA 1KC3A 1DC6A 2HMVA 5TSDA 2BI7A 4D0RA 1U4OA 1YQDA 2GASA 2B83A 2A4KA 3K30A 2B5VA 2P9EA 2Y0EA 4F6CA 4EITA 4DIOA 2I76A 4L0QA 2J8ZA 2C7GA 2V7PA 4BL5A 2VUTA 1E3LA 4KUHA 1B2LA 3RUAA 5IZCC 4QO7A 4JJGA 5AVOA 3E03A 4Q3NA 2VHYA 4RVFA 4DREA 3GN1A 5KOIA 4CM5A 1ISHA 3GH3A 4YR9A 1BDBA 4BQPA 1I2ZA 3RBXA 4CQLB 2GN4A 2HJRA 2PFGA 1DBVO 3GGOA 4W9NA 4MVJI 4MVJH 1SOVA 4ALLA 1X0XA 3G49A 3JQGB 2Y93A 2J5RA 3DZGA 3DHYA 4CM9D 4EGFA 4BNXA 3PGJA 3NGXA 1W6UA 3NDIA 2RAFA 5A9SA 1ONNA 3W8FA 3S2FA 3TJRA 1GCUA 1ZFNA 1ZEMA 3DC2A 2GNAA 1ADCA 1GL3A 1Z73A 2F1KA 5C3MA 1OFGA 3STHA 5AXCA 1P1KA 1PJBA 2JHFA 4I9UA 3L77A 3W4IA 4XRRA 1GQYA 4YRBA 4PRLA 3GG9A 4D46A 5KJCA 1HWYA 3A14A 3BA1A 3GLQA 1KEWA 4J1QA 5CHEA 4WLNA 4BNZA 1LU9A 2PGJA 3DBRB 1TT5A 2YZ7A 1DDOA 4XYBA 5ENDA 3VTZA 3AU8A 3GZNB 3CEAA 4FFPA 3JYQA 4HUJA 2GF2A 1MB4A 3HN7A 4L9RA 1HRDA 2Q3EA 3WB9A 9LDTA 4XJTA 3DBHB 3P7MA 1NYTA 1DJNA 2Q49A 3GDGA 4HFJA 3F6YA 4FN4A 3GMDA 4RQUA 3U9LA 4IJUA 3QV1A 1LX6A 2C5EA 3BMNA 2W2LD 4YJGB 4QFDA 4NFSA 3S2IA 3H9GA 3RUCA 4Q3BA 1AN9A 1EQ2A 1NBOA 4JN6B 3BTVA 3ASVA 3MWDB 3PPIA 4M49A 1D1TA 1GADO 4FDAA 3GNQA 2G82A 2HSDA 2C54A 1XHLA 1NVTA 4U7WA 3JYPA 4MP3A 4PG7A 5F5LA 3LQFA 4DC0A 2HU2A 2D5AA 3L4BA 3WMWA 3Q3CA 4Z3KA 3A4VA 3ZHXA 1Z7BA 1SPXA 3HSKA 4P4LA 4E2XA 5LCXA 2VZ0A 3LC2O 3RUFA 4E33A 4RVSA 2X4GA 1E3EA 1F0YA 3CIFA 3WGZA 3BZUA 3EUWA 3H5AA 4PZEA 1QG6A 4EJ0A 4BV8A 3D4OA 3IUPA 4HP8A 4IY1A 3DHEA 1QXSA 3A06A 3FCOA 2E6UX 4NG5A 3DTYA 1LDEA 1SB9A 4GX5A 3INGA 1ADFA 1GCOA 1MP0A 2IZZA 2QZ9A 2WD7B 4P8RA 5IAAA 3HDHA 1UP6A 1LSJA 2C7VA 2GR9A 4NU5A 3OMLA 4R3WA 1T2EA 4I5DA 2AQIA 3WGTA 2AE1A 4FFNA 3ZWWA 3ZV6A 5L7YA 1EK6A 3UOGA 3BMQB 1BW9A 3JQFA 4AJOA 3GHYA 4DIFA 5TF4A 2Y1DA 1DC5A 1ZEJA 2HK8A 4P4GA 4FIZA 4EJ6A 4FJ0A 3PIDA 4XYMA 2F00A 1I2BA 1HLPA 4NJMB 3HB5X 3HJAA 2WJPA 4WK6A 1EVIA 5DZSA 4RF3A 1TEHA 3GT0A 4BO7A 1U2DA 4BO6A 2TMDA 2NM0A 2QZZA 1NX6A 4NJOA 3W1VA 2QYSA 1PWXA 2ZYAA 2BMAA 3D5QA 4ITUA 4LMPA 4UEJA 4DPLA 1KC1A 3C85A 4PLGA 3JD2A 1A7KA 3AY6A 1RM4A 3NGLA 5A9TA 3AUUA 1YL7A 4Z0PA 5TRTA 4B4OA 1I33A 1C1DA 4CM4A 1EK5A 2GN9A 3ICPA 4M54A 1PJQA 3KVOA 2BGMA 4IGFA 1E3SA 2X5JO 1N9GB 2YQ5A 1B3BA 3ZWPA 2TMGA 5I9LA 3RUEA 3MWEB 3FF4A 4OKNA 1MUUA 3P2YA 3RC9A 3I23A 2YJZA 4PLFA 3U4DA 3ZHBA 3PFFA 4BMVA 4CV2A 3IIEA 4IGEA 5TS3A 3ONFA 3D5TA 3MJEA 1MV8A 3EK2A 3ZWBA 3BIOA 1NPYA 3NV9A 5TNXA 4PFJA 4BMSA 1F8FA 1Y8RA 4FFLA 4EZBA 1I5RA 5TT1A 5JCJD 1E6UA 3TOZA 4UULA 5B4TA 5IDWA 3RKUA 3VTFA 2Y68A 3EDMA 3RIHA 5IZCA 4RGBA 3K9QO 1KEPA 1QP8A 3ROKA 5BSHA 4MVJM 1IUKA 2B4QA 3O8QA 2YW9A 1WLYA 1R4NA 4NBRA 4UUMA 5JAQA 3ENNA 3PP8A 2C5AA 1E7QA 2B0JA 2VUSA 3VPSA 3TSCA 3JQ9C 3QWHA 1YBMA 2VQ3A 1H2HA 4RZIA 1EE9A 1UDCA 5A3VA 4J43A 4IZHA 3WNVA 4CL3A 4YPOA 3JQ7A 2HMSA 1A27A 2HMWA 4QXMA 3VZSA 4PCVA 1ID1A 4PLHA 4ILKA 4CUKA 2BF7A 1JQBA 1DHTA 1IOLA 1D4FA 2Q2WA 5TJ9A 1P31A 3OH8A 3UCXA 2DVMA 3PJFA 4RQTA 2QX7A 2UDPA 3KYCA 1JKJA 5F1OA 2O3SA 1PJ3A 3DONA 2VYVD 3B70A 4Y6PA 4BMNA 1HDGO 1GTMA 1PIWA 2P5YA 1AHHA 1EUCA 3H2SA 4MP8A 1WDMA 4CMIB 1VSVA 2XXBA 3WBFA 3RUDA 3AY3A 3TZQA 2O2YA 3LVFO 4J0FA 4LGVA 5C7LO 1KIFA 4YWJA 3WS7A 4DXHA 1IYZA 4E5MA 2V6MA 3WJ7A 1ZK3A 5G4LA 5T8KC 4CR8A 2EIHA 5A03A 3FBTA 3ZU2A 4YAKA 4L74A 3O26A 3E9QA 3LT4A 4IDEA 3K96A 5DDIP 4GX0A 1UZMA 4ND3A 1T2AA 1O6ZA 1R0SA 3GR6A 1EBFA 1GV0A 3S1LA 5L9AA 3H2ZA 3WMXA 4JK3A 4U6QA 1LQTA 4FJ1A 1GEEA 2GD1O 3L07A 5TGDA 2G1UA 1E1LA 3EY4A 3GEDA 1DAPA 2FZEA 4WJZA 1H9AA 4J16A 3I3OA 1H93A 1FMCA 4PLYA 5AXDA 2YYYA 1EFLA 1R15A 4BNYA 1DIGA 1EDOA 4CMEA 4CLOA 1T1SA 1UJMA 1Z7EA 2IODA 3DO5A 2IYPA 1T25A 2DBQA 2ET6A 1DB3A 5T5QA 4GKBA 3RUHA 4Z9FA 4RJTA 3LF2A 3HDQA 4QTZA 5CEEA 4I5EA 5ICSA 4IPTA 1E6WA 4IIVA 3PHHA 4HFRA 4AICA 2ZB3A 3UICA 3WDSA 4IDGA 1JKFA 2JD0A 2VOEA 4WUVA 3KEOA 3WSVA 2FR0A 4YJFB 5CEFA 4EBFA 3JQAA 1EVYA 4A73A 2YFHA 4GH5A 4TVBA 1NPTO 1ZO8A 4XB2A 5JXWA 2VYNA 5K9ZA 5TIIA 5DBIA 2YV3A 3QLJA 4F46A 4AJ4A 1IY8A 2B69A 2ZQYA 2EW2A 1H5QA 5G4KB 1CETA 4R1NA 5T64A 1A9YA 4YYZA 3CTMA 1P1RA 1YONA 2D2IA 3H8VA 4LRTB 4YACA 3WSWA 1YL5A 1QV6A 3K6JA 4W7IA 1N1GA 3MJVA 2DTDA 4JCOA 4UEKA 1P1IA 4RLSA 1OZAA 2OFPA 3TWOA 3Q9UA 3HZZA 4DPMA 1G0OA 1RM3A 1HDXA 3G0OA 3ITKA 2JAPA 2LDBA 1CDOA 3RC2A 2O3QA 3RSHA 3TFOA 4FJ2A 1JA9A 2E37A 3WIDA 3FPLA 4F3YA 4KP7A 3TL3A 2NUAA 3CPSA 5I8WA 3PTZA 3AK4A 4BNHA 1MG5A 4ESOA 5U4QA 1VJ0A 4R5MA 3UH1A 1B14A 3KLMX 5FFFA 4GAEA 2VHZA 3HDYA 3D3EA 1I24A 1PS8A 5L3ZA 3BTOA 2W2KB 1T4DA 4ND5A 2O4CA 4TKLA 3VC7A 4YB8A 1R0LA 1GV1A 2NU8A 3FTPA 3DBVO 4BNIA 4CMHA 4YAGA 1MXHA 2IE0A 4BNNA 4XCVA 4XQEA 4PLVA 4H16A 2D59A 4FGWA 2FSVA 3VKUA 4DMLA 5A1TA 3FSRA 4XJSA 1M66A 1E5LA 3R6DA 1U28A 4LRSB 3NJ8A 4NI5A 3WGHA 1ZMOA 5CG1A 1QRRA 4IXWA 2EGHA 1NAIA 3UCFA 4M86A 3F3SA 3TPCA 4AFNA 4EYEA 1ZH8A 4XKJA 2YQ4A 2VWGA 2H63A 1GQ2A 3C7CB 3U49A 1HKUA 2J3KA 2ZQZA 4ZQFA 4HFNA 3NRCA 1LSUA 4RPHA 1L1FA 2B4TO 2CZCA 1R4MA 2Q1WA 3DZJA 3L4SO 3RJ9A 4TVOA 2DLDA 1LI4A 3OIGA 1DC4A 2SCUA 4OQYA 3UXYA 5FWNA 4WOKA 2ZB8A 2R00A 3EZYA 2DPHA 1KVRA 5U1PA 4J7UA 3U4CA 3MCVA 1YO6A 4XYGA 1WPQA 4J1SA 1O9BA 3OBBA 3OIFA 1K0UA 1M76A 1RPNA 4WE3A 4E31A 3ZU4A 3NAQA 2VCYA 2OGUA 4NR0A 2NTVA 4K26A 1E1MA 5IDYA 4BNLA 2GLXA 3EC7A 1PL6A 4Q3CA 2W98A 4WNCA 1ZK0A 1UXKA 2NTNA 4N5MA 1RM0A 4RPLA 1AGNA 3AUAA 1K2WA 5DCWA 4ZU3A 4CMGA 5B4VA 4JXKA 1PQUA 5CDTA 1XR3A 3PQDA 3ANLA 4G5HA 4RDIA 4YEDA 1ZVMA 1Q0HA 2Q50A 4D0SA 3OSUA 4MVJG 4TWRA 5A9SB 1I3NA 2O4UX 3PLNA 5T8KA 3TZCA 2Q1SA 3WFIA 4E13A 1GFSA 2I99A 1HYEA 3OM9A 3QA9A 3KBOA 4R01A 2VNSA 2Y1OA 4RPJA 3GAZA 2NADA 1C3VA 1YDWA 5IXYA 1E7YA 2NQ8A 3ZW9A 3CINA 1E7WA 4DLLA 3OJ0A 1LC3A 4NPCA 3BMOA 3ZZNA 1RYEA 2EGGA 1E92A 4CUJA 1TT5B 4HNHA 2WSBA 1AXEA 3DFZA 4YA6A 4XIYA 2WYWA 3LLSA 4WLFA 2B36A 2Y1EA 3RU9A 3M2PA 1V8BA 2UYYA 4U8GA 1E7SA 1IZ0A 2DC1A 1ONOA 5BT9A 3L9WA 3BMNB 4L4SA 3WLFA 4RL6A 5GY7A 5IFLA 1RYDA 3K2EA 4MJLA 4CMCA 1GYPA 1ENYA 5I8ZA 2IZ1A 3QIVA 3ICCA 4JLWA 2VHVA 1R0KA 3KV3O 1XCBA 5HTOA 4J2OA 2NVWA 3E5MA 1R16A 2Q2QA 3OA2A 4CM3A 2JD2A 4Y98A 5JCXA 3GGGA 3OQ1A 3L4BC 4PIVA 4W99A 2OMEA 2O3TA 4D43A 3M1LA 1XDWA 4CR7A 2AEJA 3P2OA 3CKYA 1A71A 4GKVA 2AE2A 3GVCA 3KETA 4PLPA 1YE3A 2DKNA 5JO0A 1H6CA 4A2CA 5L95A 1HYGA 4D7AA 4NBWA 1V6AA 4DL9A 4AJ1A 4ZA2A 4OKIA 1YXMA 3DZHA 3S2EA 3GC6A 4IMPA 4LN1A 1R37A 2YV2A 4OXYA 3WGQA 1LDGA 5KVCA 2E82A 1LBEA 4BGUA 1D1SA 1E7MA 3GEMA 4L76A 1LDYA 1GU7A 4D44A 1OMOA 4HBGA 3IP1A 1Q7BA 4ZN6A 4ZVVA 4D3DA 2I9PA 1ADGA 3GZ4A 1VL0A 5GMOA 1LLUA 4XD2A 4LW8A 2HCTA 5KJ1A 3V2HA 1R6DA 1YBVA 2H1SA 4AJNA 2B37A 4DWVA 4PG8A 4L4XA 2Q99A 3SX2A 4ALJA 5JYDA 1BW9B 2OP0A 5H81A 3BHJA 2ZB7A 3JQFC 3VKVA 4R4JA 4WEQA 3HE3A 3M2TA 3ST7A 1K6JA 4IDCA 1X15A 1CQJA 3JQ8A 1E3IA 3KEQA 4QSMA 1O5IA 4FR5A 3I5MA 1PS0A 3BTUA 3EGOA 2UAGA 1BSVA 1I01A 5JYEA 4QO8A 4CLRA 3I9NA 3N58A 2A9FA 4GLLA 5TQVA 3COSA 4M55A 4E6PA 1BRMA 1WNTA 4O5OA 3OJFA 4OMUA 4EI2A 1ISJA 5EMHA 1C1XA 2JCXA 3Q0EA 3DOCA 2Y66A 1ZJYA 3C1OA 2OXIA 4JX8A 2Q4BA 2X58A 5LC1A 2CD9A 1ZSYA 1C1DB 1O8CA 1M75A 1I10A 4CM4B 4QT0A 2GO1A 4HKTA 3WR5A 4ZQGA 4GMGA 1EZ4A 3GVPA 4I8XA 4R1TA 2I66A
chains in the Genus database with same CATH superfamily
3UK6A 1JVSA 4G5XA 4MA5A 2ZYDA 3AETB 5C32A 4LJAA 2G80A 3ONWA 2D0PB 2EJWA 4KFRA 4WXPA 1O54A 4PPNA 4TTJA 2RH8A 5EIWA 1N5IA 1QCZA 2D1SA 2HMTA 3LDHA 5FL7A 2F43A 2R79A 3HVIA 1DIBA 1VL6A 5CB0A 3EMKA 3WIOA 1UANA 2ZE8A 5CA1A 5ITVA 2Q29A 3CRQA 1CR2A 4QU9A 1LCIA 2I7DA 1OFIA 1V6CA 1AT1A 1WMAA 2A8YA 2FRDA 2PZAA 3W3AA 2PJZA 4WGFA 4IUDS 2C57A 3C7TA 1KJNA 5JV5A 1NVGA 1KEEA 4IF4A 5F77A 1XD9A 2P2ZA 1IN8A 2QV7A 1GT91 2H2GA 4LNAA 3VHXA 4ZI7A 5B58C 3OZVA 4NDZA 1K7CA 4E2YA 5HQTA 1IUOA 4JLAA 2JKYA 1CJUC 1KE2A 1GUAA 3FLAA 1IHXA 1LSSA 4KBYA 4KXMA 4O4JA 3MAJA 4UTOA 1D3AA 3TNYA 3WYBA 5LQDA 5JS6A 2J3LA 1JT2A 1V11A 2H59A 3M82A 2OCXA 3O8QB 2I80A 4L4UA 1MH1A 4XTCS 1TKAA 5REQB 4QEDA 3TOCA 2IPOA 2CDBA 3R41A 1SHKA 4C0WA 5JBIA 2XUFA 4CMBA 5JADA 3KT6A 2BFMA 3DULA 4FS3A 4Y7DA 3E6AA 2NUPB 3ZW7A 3KZVA 3H75A 4L08A 3NORA 3R9WA 4FBMA 3W9YA 3FWPA 2DB3A 4D96A 3A1EA 3TLCA 1P0CA 1QHYA 1BJRE 5EMNA 1KQFA 4G4GA 2C3OA 3EJ6A 1I9GA 4K9DA 4L57A 1QTQA 1TLFA 5AQEA 3WA6A 3P9ZA 4WOCA 2WU1A 4OF4A 2X14A 2UVPA 4CJXA 4H27A 3VR6A 1T2CA 1Z0FA 1PV2A 2PX0A 1OILA 3F5DA 2FLKA 3K8OE 4IQ8A 4B7XA 2VYND 2HLNA 5AKGA 4XFJA 3KT3A 4MOWA 4E5YA 2AZXA 3CB2A 4RY0A 5BUQA 3VFDA 4EI9A 1A69A 3LA6A 5DK6A 3DEAA 4CCAA 3FMPB 4NBUA 3KR0A 4WY2A 1NJ8A 3LC1O 3LPDA 2BKXA 2JDIA 3AYXB 4IHJA 1WSWA 2JCGA 3GAFA 5D7BA 4BVAA 4F06A 2Y4OA 2I2XB 4PN3A 3RS3A 1OD6A 1KI6A 1A8HA 4JT8A 1ZWLA 1LPPA 2MSLA 1VJDA 2BKUA 1B76A 4OHUA 2JLUA 2Q3HA 4MV9A 2FXVA 1RQRA 3I4CA 4OQPA 1OAKA 2NQTA 1ODCA 5CNMA 1T5BA 2PUDA 1MJ5A 4F97A 1P72A 2P9BA 2BE7A 1ISMA 2ORYA 1QQAA 3G89A 1WB9A 4J94A 1ZNXA 4TYNA 1GPYA 1N0HA 1IQPA 2VHQA 3OPYB 2UYOA 3KOUA 4IV8A 3ZLUA 1EEHA 1G1MA 3BREA 3H0EA 4J1TA 4MITA 1S9HA 2QYHA 2HXYA 3C5VA 3JXEA 4V0SA 3PUIA 3OU2A 4U7GA 5CMLA 3WWZA 1GPAA 3QWAA 2X22A 2NYAA 1OIVA 4PVCA 3W06A 2E4YA 5D1HA 5L6MB 1O9GA 1O08A 5I7RA 2VNAA 3I5XA 4NFLA 3S2YA 5CP8A 4YT2A 3HZRA 4UARA 2CEAA 2C5SA 1IN4A 3L0PA 4C22A 1IY9A 2JFOA 3L7DA 2Q6VA 1LVUA 1P44A 2H54A 4B34A 1DCTA 1XTZA 2JJ1D 1O94A 3ABRB 3LTEA 4CLOB 4LQ4A 4CMEC 2XQFA 5F52A 4DDWA 1CZRA 3TZKA 2YN0A 4F91B 2ZIEA 1OC4A 1AE1A 4XDZA 5DX1A 2V03A 1NBAA 2TMKA 2H4HA 3L82B 4MIYA 5CX1A 3WIUA 1GQOA 1RKBA 4RD4A 4BRZA 4JB0A 1BD4A 1UOEA 2K7ZA 4PZLA 5IYZB 1BGVA 3WGNA 3CH6A 1SJ9A 1KZ4A 3DM5A 2Z30A 5CW1A 4TMTA 4F3CA 2OBXA 3BF7A 5DW0A 2RIRA 3BJZA 4JDUA 4BX3A 4GM1A 1PYDA 1EZ1A 4QPZA 4WV3A 2DT5A 2WU3A 1C2YA 1UKVY 2VNKA 4CKCB 1I7NA 1XRNA 5FI3A 5AXBA 4C0LA 1JFVA 1NVVQ 1I36A 4G5QA 4MJ3A 5DM60 1VIVA 4FFBB 4X1YA 1G21E 3PNYA 3X1ZA 3N2KB 4WXHA 2CLFB 5ICEA 2AEFA 4DLAA 1DOHA 1H23A 1OXUA 4BXOB 1NNLA 1PGNA 1SMKA 3ANXA 1GN8A 1PP4A 2C2MA 3HADA 3WBBA 3ME5A 2BGNA 1CUVA 4OXRA 5BQXA 2F62A 3EY9A 1ZM3A 1UDAA 4Q7JB 3RTGA 3R8FA 2FOLA 3NWEA 3RYHA 4Z51A 3DPSA 3CZ9A 4C89A 4XWWA 5CLJA 3G9ZA 1PQWA 1YU9A 1ZQ1A 3QMMA 2W6JD 3PITA 4QUGA 7REQB 2VWQA 4JZKA 3IP8A 2AEMA 4EGCB 3HUEA 4TS4A 5K4AA 4JB2A 1CUCA 4OL9A 2P5UA 2HRBA 3MT7A 3UT6A 1B74A 1J2JA 3C16C 4RZUA 1G38A 1PR9A 3STVA 5IC4A 5FUBA 2AOUB 3RV3A 2EP5A 2W11A 5FORA 2WKSA 4DWWA 4IKEA 3AUSA 2G0AA 3BH7A 3PL5A 2R6JA 1GCAA 3IESA 5EG5A 2EERA 1ZUIA 3EAQA 5AJHA 1AH2A 1BD3A 3O84A 1K92A 2CB0A 2PMEA 2P67A 3KKQA 3OZAA 5AOAA 4YAOA 5CUQA 5JJCA 2I6UA 2VRNA 2DBVO 2RHMA 4FYWA 2QZPA 3SC4A 3AVWA 3EH2A 1XLVA 3SVTA 3OFND 1QKJA 1F06A 3IR6A 2UYHA 4PSKA 1RJWA 4NBTA 3BRWD 1I2AA 2IP4A 3HG7A 2NU8B 3FX2A 2JLZA 1X7GA 2VA9A 3ZCXA 3NI2A 3PQCA 4ZD6A 1XV5A 2TYSB 3CEPB 1RBQA 4FFMA 4YQZA 2ZPUA 1DMSA 4H1TA 2H1VA 1CLEA 1FNBA 2WE8A 5M34A 1TEVA 4KIUA 2V7GA 4UQOA 1Z37A 4PVDA 4R41A 1YIDA 3OE7A 4OMDA 1A9ZA 3Q7EA 3B2EA 2B99A 3DWIA 3RSSA 2FW6A 4ENRA 5HS6A 1RE0A 1WKVA 3JWIA 3EVDA 5A06A 3QMWA 2JK1A 1G2IA 1YDFA 4DLWA 2GX6A 5JRZA 5BWLA 1KI3A 1GM5A 4HS4A 2WF8A 2G9NA 3IAS1 2PGOA 9MHTA 3LGAA 4ZZ3A 1AA9A 3VU8A 4E0BA 2IYYA 5CVDA 4DR2B 1UZAA 4DS3A 3M0EA 4MWGA 1M54A 1X9GA 3RUIA 2OK7A 3W5JA 5AQ1A 1NXWA 3EMDA 5JLJA 2C98A 3AHDA 4J91A 4G5YA 4JC8A 3U4HA 4BCBA 2FQYA 2EQAA 2FUNB 1SHUX 1QGZA 3B2QA 2R6ZA 4WKNA 4PC1A 2O3RA 3R0IA 5BMVA 1GUDA 4WKGA 1R12A 1IK6A 3G5UA 3DOIA 2J5XA 1Z6ZA 4HDRB 2X0NA 3HCRA 4E46A 2TRSB 1HBJA 1KZ7B 3E7PA 3PFWO 5HGXA 1R18A 5E2AA 3M6IA 3HBNA 4P22A 2O8FB 4V0NA 1CUGA 4KFSA 2AUTA 2PO5A 1QF6A 2FPUA 1DT5A 2P2SA 3GN2A 2R8BA 4B6RA 1CC1S 1NF2A 3PNVA 1I9CA 2J08A 4JU9A 4NNOA 1TAQA 5BOVA 4W1PA 3GU3A 4TLDA 3HP7A 4OJMX 4QUAA 1URPA 2FPIA 5DF1A 1HRKA 3L79A 2Y9PB 2D7DA 1T5LA 5EL0A 2C59A 4TMYA 4NXMB 1L0BA 4C4TA 1DIHA 4RZ3A 3I1IA 3QVGA 4MICA 1AUVA 2HK9A 1CNFA 1GKUB 1NVMB 3A4TA 4BKMA 4KQ6A 3ZYCA 5MHTA 1BCRB 2VP2A 3F7NA 4KQGA 3NHSA 2WNHA 1LDNA 2IEIA 2OO3A 3KTDA 3QWIA 1EEXB 1E1KA 1YAHA 2IEAA 5KEIA 1RFGE 4NV1A 1BX1A 2GKGA 5JQGF 5JS8A 1ZH6A 3AC0A 5CURA 1SCJA 2C1ZA 1TTQB 1M2VB 5AKKA 1CY7A 1MO3A 2VPXA 1XTKA 2WOJA 5J4VA 3G79A 4DNPA 3H9EO 3F6RA 1AKMA 4IXTA 4D74A 4HGPA 1FFXA 2PNJA 5DM4A 3UKOA 3THXA 1AKUA 2I2CA 3KQVA 2O2ZA 1C9EA 3NG1A 4IQGA 4UVHA 3FZEA 2EW8A 1XZAA 1YNOA 2HN9A 2UZ1B 3Q8XB 4QICA 5AKLA 4Q7QA 4KREA 4EI7A 2YBDA 2YR0A 1KDVA 2WMNB 3P0EA 1JEYB 5GP1A 1KYQA 4YFYA 3S5JA 3V2UA 4FGJA 4ZI2A 4KQKA 4MI9A 3W2FA 1NUPA 2QM7A 3FKJA 3C43A 3TQIA 3W5HA 5CPFA 3ZGYA 1COWD 4QL3A 4ZYWA 3AT1A 2A59A 1T91A 5JZOA 4UASA 1YI1A 3D4PA 1VL5A 2ZDHA 1ST2A 5BV1A 1WS6A 1MW9X 3LPCA 2VAPA 3TFQA 4ARCA 2Z5GA 3AJDA 4UJ3A 5F21A 5AVKA 2XB4A 1SU6A 4IXNA 3VNSA 2GS9A 4CKYA 4HB3A 4L02A 1KERA 5AM2A 3HCEA 2J32A 4B3RB 3QVSA 1BXGA 2Q9CA 4OSEA 2R1VA 4BMPB 1RP7A 2FP4A 2IEZA 2QMQA 2NAFA 3HKBA 3JWJA 3U39A 4JP5A 4TRMA 2OCIA 3UOWA 5IZ4A 2ZRQA 2L42A 4JLNA 3SBOA 2PFKA 4GWKA 1Y4SA 3P9IA 1AC5A 5AK6A 2V7QA 1F6BA 5IW8A 2GXUA 3I2FA 4P86A 4CKZA 4CLEA 1HE8B 1VJ1A 4R2MA 4FZ3A 4U7HA 4S24A 3I2IA 2GJ9A 3B6ZA 4DSUA 1WW2A 3BB3A 5C4GB 3FMOB 3W4JA 1Y37A 4MROA 5J9FA 2XCIA 2VF2A 4RJJA 3SWWA 1YFJA 3G2HA 2JLAA 1VSBA 5GZ6A 4HJRA 2UV8A 3U3OA 2PSDA 4RXTA 2XDAA 1U1FA 2OL4A 3AILA 3K9NA 3OT4A 3HM9A 2WPDD 5EMMA 4MVWA 3T4XA 4XPIA 5I4CA 4JHLA 2PKRA 1T8PA 1Z5WA 4OK3A 2Q1YA 5T4HA 3UK2A 2C2WA 2N47A 4CGYA 4OMFG 3EBPA 3PGVA 1E6LA 1TCCA 2QM0A 3N0VA 2OPBA 3WWOA 1OI2A 3M6FA 4OBWA 1K6IA 4HN4B 3PVSA 3V97A 4V0OA 4A0QA 5B37A 2OHGA 1RXUA 3TG8A 2ZXUA 1M1YA 5A5EA 4RJLA 1A5TA 3L1KA 3VNUA 1I32A 3W3AH 1R6BX 4ZRMA 5FL3A 1NIPA 5AJWA 2GUWA 1M1ZA 3HWWA 4DVJA 5KX5B 3IVAA 2QIPA 3IQFA 2PR2A 2DH5A 3H87A 4MRVA 5IM5A 3Q5GA 3CN7A 1KAEA 1OTHA 4B43A 2WOOA 2GARA 4YLYA 4G3XA 1YH3A 4KQFA 1C1XB 1J5EB 3DTVA 2JFZA 1ADBA 1E20A 2P2DA 1A9QA 5A3SA 3GPDG 4NBLA 4DJEC 2K4MA 4R69A 2FX5A 4RCVA 1SBNE 3V1YA 4E30A 4C0SA 1CDDA 1UDRA 4M8IA 4MR7B 4P83A 4REMA 4AURA 4IYRA 3HR4A 4MRMB 1OH6A 1MGPA 1PBNA 1ZD4A 3KOWA 2FU5C 1TQ6A 2ROQA 1GILA 3ND9A 4OAQA 3MVEA 4EHIA 1A7AA 1M67A 4CL2A 3T1OA 1ZD2P 3K71B 4QXPA 4N48A 3EDYA 3U17A 3KSBC 1HDCA 1SXJB 4RK7A 5H02A 2PZFA 4D4HA 1V25A 5I9MA 2GZSA 2JL1A 3ISJA 1YGYA 1Q0UA 2AFHE 4OL0A 1XVTA 5H4GA 3LVQE 3CEHA 1BMQA 3NUQA 3QMPA 1M2KA 3QBEA 3TSWA 3WKAA 4FGKA 4BNJA 1GD1O 3E2PA 4PZCA 4W5JA 4DLYA 2XJ9A 3RS7A 4Y1FA 2OCGA 5CAEA 3F7MA 3T12A 1QLJA 2F1HA 1TUBA 1XIVA 2A6PA 2H51A 3O3NB 3E27A 1BOOA 4YCJA 1K5GA 3VR6H 3HA5A 2LP4Y 4AD8A 1IATA 1CUHA 4LX0A 3WGGA 4ZT6A 4RVNA 4KXNA 1T6YA 3AF6A 4O2AF 4UXJA 1LA2A 3OD1A 1XCLA 4BUJA 4CYMA 1EXWA 3ZHQA 2JIMA 3M3PA 4K46A 3PJDA 4MHSA 3SI7A 2C7OA 4TKMA 4PGGA 3R76A 2YMPA 1XZKA 1GXSA 1K6MA 1MFPA 1QGOA 1XYGA 4P53A 4Q82A 3O8OB 2C2XA 2C2BA 1GIAA 2AG6A 1A5SB 4AZVA 4PFSA 2MINB 2RHLA 4HEA1 3ZHCA 2X0IA 1X1BA 3ZE8A 1L8OA 4LVNA 1J9GA 1U3GA 1DBPA 4H6PA 2DXIA 5ER9A 2V1XA 4FXPA 4HJXA 4ND8A 4O2LA 2X7JA 1YD7A 4CNBA 3H65A 1YA8A 4H59A 1NXVA 1SUSA 3PGXA 5EHXA 3VSCA 4J0GA 2F55A 2V3VA 3SJBA 1YS1X 4G0WA 3S68A 5EGSA 2A9RA 4DCJA 5HKBA 5K99A 3FUCA 4M4SA 1E4OA 4BFLA 1KYIA 3HCFA 4UQLA 3PXEA 1YOVB 5ALXA 4QEKA 3PFHA 4AVYA 3HACA 3TFWA 1KETA 4E12A 5A3JA 3JATB 3QOWA 1R2QA 3OOHA 1S01A 2OG2A 3OPMA 5DULA 4CMKA 2ZWOA 1N2ZA 4INZA 4OI1A 4D3FA 1Z45A 5EYPB 4CM7A 1FJHA 1NW3A 4LDRA 3EXG2 1QO0A 4QQNA 2IUUA 3MS2A 3TZEA 3TQFA 4GZ6A 3U1TA 4XX0B 4X8OA 1NI4A 4K2AA 2B1IA 4LOLA 1PFGA 4K9KA 4J1NA 3NTRA 4LY0A 1ZIPA 4S1NA 4OQXA 1I7DA 1PEDA 4GWGA 3PCXA 3C7DB 1QC5A 2DHQA 2NLOA 3N70A 5JIBA 1Y1RA 3CVUA 3VNRA 2F48A 1XMJA 2XKAA 3G6KA 4G8DA 5AICA 3KEFA 2OFXA 5LIPA 3ZXUB 2UUCB 2OZKA 5DIFA 4FGZA 2E4AA 1RQ2A 1BROA 5TPWA 1OBCA 4P5PA 4EG8A 5H9WA 1EUYA 5K0GA 3AF4A 3EXIA 3JWHA 3LXRA 4EAAA 4QOIA 3ITNA 1EHYA 1U9JA 2AJDA 4M37A 4OB8A 4J1TC 4GI5A 5TQ2A 1Y5MA 5FOWA 1OC2A 4KHPB 3I4FA 2XYPA 3EEOA 2C42A 4GPD1 3H17A 3GRPA 3JX9A 3OIVA 1BVHA 1BTOA 2E4XA 5DMXA 5A5GA 2X1VA 4LCEA 1B00A 3WGMA 4E1BA 5TQ0A 2ZCUA 2DCUA 3SEAA 5FAKA 5FCDA 1PVOA 1JR4A 1BXRA 5JZBA 1CJVC 3FZNA 3GJQA 4GYYA 4II2A 2IYTA 4MJXA 3RJ5A 2Z04A 4OXNA 5KWEA 3TSAA 4S1PA 5EHQA 3CBGA 3QXJA 1COZA 4Q7KA 2CNOA 4CTOA 4TPKA 3PFGA 4IGAA 4AP5A 2C82A 5KNDA 1MMFB 1JLKA 2VUUA 4RZSA 5EKDA 3IUJA 5JPCA 4HYTA 1K8RA 2IDJA 2JZOA 1F4LA 4AX4A 4KLZA 1W0CA 2AD1A 1OKKD 1M2JA 4J7AA 3TIIA 4YDSA 4UMEA 1NXQA 2GLUA 3R9XA 4JLBA 3AHGA 4RY2A 4E14A 3EQ7A 1EQAA 1HE4A 2AG5A 2BHRA 2R4QA 2PPLA 4WCFA 5ESWA 3C6KA 2PT9A 3HDTA 3OTQA 4KU4A 1OBHA 5AK0A 1C0EA 5K0ZA 1E2UA 2P75A 5DM2A 3ZCVA 3EZGA 3V1UA 4D79A 2W2TA 1ZM4A 1WHTA 1KK2A 2G9VA 2FPOA 2R96A 1I5OA 3UHAA 3ND6A 5ALSA 2FPLA 1NXXA 2GZMA 3OQOA 1I4EB 2CVFA 4D9HA 2WDZA 3ZWQA 1FLVA 5K03A 3T7KA 1BVUA 1PYGA 3HLKA 3PGA1 4DCMA 4N5LA 1DQZA 4Y6QA 2WFLA 4CQMB 2JLYA 1MEEA 3PXBA 2ZJ8A 2DQKA 3IQDB 3SYMA 4F3KA 2R8ZA 1ZXBA 3JWPA 1MXFA 1ZH2A 1RPJA 3ADPA 3KB1A 2HQ1A 3AMVA 1XX6A 3VTAA 5CFPA 3BILA 1P5RA 2CWWA 2I65A 2IGTA 4RHUA 3E2IA 1FYEA 1X14A 4ZEVA 2GYUA 1QVAA 5AI4A 4Z99A 4OP3A 5AI5A 4BVLA 1WO8A 1XVVA 5JYCA 3VPDA 2YINC 4UUQA 3ONEA 4C0XA 3KL4A 1J6UA 3FOWA 3PFNA 3X1WA 1SC9A 2Q6LA 4GOOD 1O77A 3D1JA 1WZUA 1JBQA 4IS3A 3G2NA 3RBVA 2ZBQA 4KR0A 3HGMA 1EP2B 3DDWA 2FZ4A 2R1ZA 2CF5A 4H0FA 4UEWA 3WGKA 1H22A 2P35A 1JE0A 3E9MA 4GL2A 3WIEA 4F7WA 3OJWA 4H18A 3SFZA 2O2EA 4KG7A 2F3TA 3LU1A 3BBLA 1F4VA 1W34A 1Z34A 2PMFA 2ECKA 2W6IA 4JUFA 1ND5A 3OIDA 2O48X 2OYRA 2YUIA 1Z39A 3VI3B 3M5CA 4JI3B 5AJZA 2Z4SA 2XNSA 2NO4A 3CLSC 4UBOA 4NEGA 4F8YA 3ZI4A 3M3HA 1MZVA 1E32A 1P74A 1TTPB 3MEQA 4ME6A 2VJNA 4LTDA 4P4SB 1KI8A 2D5BA 1P60A 4HNAA 5DK4A 1W4AA 1BG6A 3H8SA 4CUZA 5K3OA 3IOMA 3NMUF 3S5UA 1XBTA 5LWQA 4ZVTA 1JL3A 1VCOA 4M83A 4X1IB 3ES9A 2P90A 4EVQA 1Y5RA 4X93A 4CG0A 2BM8A 1JG7A 1TA4A 3B1KA 3V2GA 2BW0A 3W5UA 3QUSA 3VZCA 1F14A 1QK5A 1C50A 4F4CA 1E64A 5JH7B 3KXKA 3FHCB 4HY3A 3H5LA 4H4DA 3ULKA 3EEYA 1YE8A 3V6MA 2PSEA 2TSYB 1XA3A 4BV2A 5KINB 3NHZA 3INNA 1THTA 2HTEA 4R9UC 4J90A 1WCWA 1ZW6A 4LX8A 3T7RA 1D5CA 5JJBA 3M1AA 3SIXA 1X38A 4WSOA 4ZQBA 3OFVA 2GPTA 4QXQA 3BL5A 3IJRA 4QOGA 4MKFA 1JDBB 3BIXA 4RCZA 5EHGA 4QYTA 2JGKA 3AEKB 3ANNA 3AUFA 4MUXA 4NAUA 4PSUA 4DCVA 1P5JA 5IHXA 2QTVB 5K6TA 5CXSA 1QZZA 3EPRA 4ARSA 4URYR 5LZ9A 1J0EA 1YIAA 2YKGA 3T5BA 3LF1A 1SCDA 1P8JA 1VFPA 3B82A 1JTFA 1XRRA 4OX9Y 1NR7A 1QRAA 5EKUA 1WX1A 1TZJA 2XAUA 5FNZA 4QBTA 3AR2A 3IEKA 3PFKA 3X1KA 2BFEB 2XOXA 1KAQA 1DC7A 1QDUA 3KWLA 3DGFC 2X4LA 4K3VA 4DA7A 2QY9A 2PY6A 1JRLA 1TQHA 1FJGB 1DXQA 2BP7B 1HXHA 2VZ8A 4FYIA 1NZFA 5BN1A 1MU0A 1L4LA 1WVIA 2PNFA 4OJNA 2ZI5A 3KM0A 2DFTA 3TOSA 3DL0A 2O5EA 5KKNB 4E3WA 2PKYX 4OGWA 1UPUA 1E4YA 3I0ZA 2VP3A 3IJEB 4OUDA 4PTZA 2OXFA 4YJHA 2VHWA 5DNVA 1H6AA 1US8A 3CLRC 4IHAA 3EVAA 3GNLA 2QJOA 3S1AB 4I36A 3U31A 3FNBA 5EFZA 3ZBQA 1ULBA 2YV5A 5L4NA 2CLKB 3OCXA 5LKAA 4PQFA 1E79D 1LJLA 3F4KA 1BVYF 4FI3F 1QS0B 5FNVF 2HXSA 5HZKA 2GB4A 4HLUA 4X91A 2YXDA 4LYDA 2IZ0A 2YJGA 1K8ZB 2JBAA 3FVVA 3O1LA 5COQA 5F1YA 1TYDE 3M5PA 4ZO9A 3BGOS 4ZCIA 1TNDA 4NICA 3UWSA 2AK3A 2YY5A 1AMNA 5LM3A 1IUNA 1RLUA 2C9YA 4E5SA 2EKLA 1GG2A 2QT1A 1QCCA 2Y71A 1KVUA 1R74A 1WBBA 4XWAA 3GCXA 4EI8A 4LC0A 4DR5B 3C8HA 3QE3A 2PGDA 3F5QA 4BMDA 1CIJA 3WQBA 2ETVA 2AI3A 1ZLXA 1PLLA 3CLTD 2Z8XA 2C97A 2GK4A 3DPUA 3ENKA 2JFPA 3DT6A 2A58A 3H1TA 1U8YA 1U94A 2DFPA 3I42A 4Y6GB 4D25A 4L27A 1CEEA 5JDIA 1GU1A 2J30A 3UKJA 3CUKA 4N1AA 3VR4D 1V2GA 2YHIA 3C8MA 4RAQA 2HD4A 3INYA 1D8AA 1TA9A 3LMKA 1NNI1 3Q3JB 3KDSE 1IU9A 3NDBB 2FK8A 2YN2A 4ERXA 2X0RA 2VDMB 2ZK7A 2AA3A 4PAWA 1ODTC 1IG3A 3HWRA 4M1WA 5JQGA 1XT6A 5KZMB 3D3WB 2P1RA 3EF1A 3AF5A 1E99A 4JAVC 1G98A 3V7UA 1JI3A 4ZDKA 4EVIA 3LKDA 3RABA 3U3ZA 1DO8A 1H8EA 4LYJA 2OVBA 1FBNA 4K5QA 5K0FA 3BA6A 3DL2A 4LI3X 3QPUA 2VXBA 2VDKB 5BP7A 1SHLA 1PX2A 1QPGA 4UCWA 5DNEA 4Q34A 1GTJ1 2HV9A 1L5KA 1C0KA 3IVMA 5FFNA 3KTAB 4IO0A 5LP6B 3X2EA 3WRVA 1E3JA 1P2UA 4EQ6B 3SEFA 3R0JA 2PK3A 3R23A 1FBTA 4HDCA 3IKJA 3PQ3A 2Z08A 1QGAA 2ZU6A 2DPLA 4G0YA 5LPNA 2CMGA 1C9NA 3NGMA 2X0DA 4OH1A 1JSZA 3ISTA 3STXA 3U26A 5DP2A 4OK6A 2K2QB 4OREX 2XMDA 3RLIA 1W44A 1XUOA 1D2MA 2GBPA 4TV9F 1C14A 3DOJA 4IP0A 4TV8F 3MWJA 4Y9UA 4ALIA 3HXQA 2PN1A 1J42A 4LZJA 1J1IA 1MIHA 4MUJA 4OHCA 4JI6B 4C08A 1D2CA 3GJSA 2ZUTA 1U8XX 1B6GA 4ECAA 1GNRA 5DI9A 4KC0A 2ZWPA 3FJYA 1JDJA 1WZIA 4C7BA 4CQNA 2GRJA 1HTBA 3DW1X 2SNIE 4MVCA 4TS9A 3GZTB 2GZRA 2WZDA 3ZIAA 2R8YA 3OEEA 2WMDA 3A4MA 2P5SA 3ILYA 4PQYA 1FFAA 1OFUX 3WKBA 4FEAA 3OQMA 1J0XO 1YS9A 1CEQA 4PYLA 4DJ5X 4DLVA 5DN9A 2O19A 3UG7A 4WAUA 3LLCA 1HE3A 2A94A 4HMQA 1Q17A 3SHOA 1RZ3A 2NT3A 2OHIA 3A8TA 5AYVA 4DB4A 2QR3A 3ZWAA 2WU0A 3OTWA 2P6UA 1NGSA 1VA4A 4IWNA 5F35A 3V8MA 4BFVA 1U7WA 1HURA 3MCZA 2QXYA 3CVWA 2Q1TA 1QMGA 1I51A 3MYYA 4RLHA 4BLOA 1R66A 3F6SA 3W4KA 3N8NA 4KGVA 4XJXA 3EEQA 3GCDA 1TQ2A 4JUDX 2GJ8A 2YFKA 4KSCA 4DJDC 1C3OB 1U02A 5BNIA 5IKOA 4U2FA 3PPYA 3WZ2A 1JN0A 1KOGA 2A5LA 1RBYA 3CVXA 3BERA 2AMFA 2NNLD 3D6HA 2PS1A 2YW2A 4Z0HO 1WPGA 3UGJA 2I7VA 1EDDA 1M7GA 2A5FA 1KBQA 1EUQA 4QECA 3ZJYA 2O2HA 1G4HA 3G8CA 3PWTA 3FTDA 4Q03A 3VX4A 4NJEB 2IYRA 1T1IA 4O6VA 1EK0A 3QYPA 4HC4A 1XP8A 4X62B 1T8WA 3K9CA 1RC8A 4N9WA 3Q3GE 3PWSA 2F90A 4P2BA 1H94A 2QQ0A 2VN8A 2OQ2A 2ZJ2A 4CMAA 4YRSA 4UU1A 2VT2A 4PLWA 4JP8A 4HTFB 3VHRA 4AG5A 4IEIA 2ZE5A 4AP9A 5FV4A 1GPNA 4TWAA 1JX6A 1F51E 3EDQA 1KJZA 5B3KA 1ODKA 2FZWA 3WKDA 4B35A 1EXDA 4G81A 2GSDA 3RYCA 2FMUA 4IZIA 3UVEA 1WKCA 2YWEA 1X86B 2OGWA 3G9TA 3WKCA 3VYVA 4AT1A 1BXZA 1P9LA 2IVFA 4C6TB 4EAQA 1N5LA 3AEZA 4PPFA 4CNQA 2H2WA 3VU0A 4MPPA 7GPBA 4ZFNA 1ZIDA 5CJ2A 4EA6A 4TZKA 2FGJA 2C4WA 2WU4A 3QPAA 1RVV1 1MCZA 4QAJA 5G0TA 2BJWA 1AKTA 1T9DA 2J46A 4TLEA 1V8PA 5L7TA 1GZDA 1YUNA 3DHNA 3SZGA 4Z8XA 1JFFB 5JY6A 2EZ9A 4MIOA 2YY6A 2XCOA 1NNSA 2H2DA 5CLGA 3T99A 1AO3A 5TEWA 3VR3A 1AGPA 3ZHYA 1YR6A 3ET4A 2ZCJA 3OLWA 4RIFA 3T9DA 4PFKA 4O2AA 3QKSA 1G6OA 4OBBA 2RHHA 4BASA 5KOHB 1II8B 1DAOA 2II6A 2HX1A 4JLVA 5G2OA 3LUBA 3H5NA 2P4HX 1SKBA 2P30A 5HGJA 3UMJA 4D5GA 5C7IO 3AZOA 3FWZA 5MFZA 2EZUA 2FAXA 3IJ5A 3DXFA 1T4CA 4JMPA 5TC4A 1A7UA 1M6YA 5I7SA 3GGPA 1AY0A 2QRLA 3UUFA 2HCRA 4FYVA 2FRVA 3DBHA 2E5LB 4MH0R 2PKEA 1PZEA 2JI9A 3IHWA 5K3EA 1X77A 2FFRA 4E5VA 3KPUA 2HA3A 4PSCA 1NFFA 3PVCA 2ONKA 4D92A 1PU2A 4LBVA 3T41A 3ROXA 4CV0A 1XFAA 2GBLC 3FUXA 5K5EA 3VKGA 4W1RA 2HIHA 4Z3DA 2I2AA 4QGSA 1TAUA 1KRWA 2FWBA 4URXR 2MJLA 3MGBA 1NNUA 3KB2A 4J7CA 3SVZA 2JASA 3LHKA 2XVZA 3K1AA 4HUQA 3RTEA 5FUMA 2D1TA 3MWDA 3B12A 1PJ2A 4PLTA 2UU9B 3KDPA 1V6SA 1Q1NA 5HA5A 4M1MA 1HOXA 3BSWA 5K0EA 4MULA 4EY4A 3DMTC 4UFOA 2QTCA 2HF2A 3JWEA 1DLJA 3EIXA 3HHEA 4AZTA 5AW5A 4O2RA 3SLGA 3D64A 3OZ7A 4WXEA 1QHSA 1R0BA 1WEHA 3I58A 4V03A 1MHPA 5L45A 1QE0A 1I3KA 4GL4A 3AJEA 4IDDA 1U0GA 3PE4A 1J2TA 1D9ZA 2PS9A 1GSAA 2HXGA 2IHJA 2IOFA 4PPYA 4O4IB 5GONB 4BP9A 2OYCA 2ZOSA 2YVQA 3G13A 2AX4A 3CU5A 1PUJA 4H9GA 1P2VA 1JEQB 2H2FA 3AY0A 4JBNA 2CNNA 3NATA 4KQXA 4S1WA 1QYVA 3HVJA 4UNRA 2WQ6A 1HK7A 4CFYA 1P1HA 3UF0A 4Z49A 3NS7A 1MTOA 4FNMA 4YRIA 2FFJA 1QKKA 4LFCB 3HTXA 4LHSA 1NC1A 3H0CA 5BXQC 5FOXA 3UK7A 1WW3A 4ARZB 1LEHA 2QSZA 4X45A 1PI3A 3NT4A 4W1SA 2R8OA 3HLTA 2AFHA 2DUMA 3WMGA 2VP9A 3IAFA 1GU0A 2YWXA 1XD2B 4DYDA 1KO7A 3R7AA 3N7AA 1ZHOA 2P0YA 1BEEA 3IXLA 2VJMA 3MGKA 4LRXA 4PBSA 4X61A 1E89A 7ADHA 3E5NA 2P2CA 4MGYR 1RWBA 3PZBA 4AO6A 2YS6A 3IPRA 2CNBA 2ZVQX 1C5KA 1E58A 1TJ3A 4WCFC 1IQUA 2Q4EA 1P7ZA 4P33A 4PX9A 3A6DA 3KT8A 4RACA 5A71A 1EK2A 2R47A 1H0KA 1M1XB 3BUSA 3RUEA 3R77A 2PSHA 1UODA 3IURA 4RXMA 1IULA 1KSFX 1U2EA 3N2NA 3DZDA 2ZJ4A 4BNGA 1ECJA 5A5FA 2M1ZA 2VFAA 3CTPA 4RV9A 4NJMA 4Y2QA 1WP9A 2KPOA 1Y80A 5KNCD 1EM8A 1U3UA 1T2VA 1Z12A 3GXBA 3JD0A 3K94A 4XQCA 1NN3A 3TAXA 3EWNA 3VU9A 2ZQ5A 1Q14A 3IP5A 2VSQA 3LBFA 3NANA 3B85A 4G1EB 4P3OA 3GJ0A 1YFLA 4JKIA 1Z2PX 2VSOA 3AFIA 3HU3A 2DR0A 4L5AA 5CHYA 3REQA 3HC7A 1ZU4A 3LV8A 3Q1KA 1AS2A 3SKVA 2WUWE 1U0BB 3IYLW 1H66A 1XJ0A 1O0SA 2D4AA 1FPQA 3A4NA 3L7OA 3O8NA 3O0DA 4L0MA 4Q24A 4EFNA 1LD3A 1XZPA 4CT5A 2VAXA 1PAUA 8OHMA 3WNZA 2FVYA 4ZV9A 4A8PA 4D0NA 2D8MA 2JGNA 3IBTA 3IUQA 2NU9B 4CV1A 4EG4A 1E0KA 1X2EA 3NEPX 4J6FA 1N2CA 1T9HA 2AVDA 4YVFA 4AP6A 2AN1A 4RTPA 2XCRB 3CUWA 3GPCA 4UHKA 4WNAA 2XE6A 1YSCA 3CX7A 3KPYA 5J59A 4CTMA 5A0VA 1JAZA 1Z3CA 3GJ4A 2XNKA 3QELB 5J58A 3ZX5A 4ALKA 2B6NA 4FCCA 3OE4A 3ZDDA 1B26A 1I5EA 1DQRA 2P62A 4JJEA 3LXUX 3BOSA 4D45A 1RRFA 3DXXA 4MRPA 1QGUB 1M2HA 4JCCA 3N2ZB 4K6FA 3R7WA 3V7FA 3KTFA 4YRAA 1SZCA 3OFKA 1X39A 2AFIA 1WUJS 2JJ1A 2GHIA 5DGCA 2PA3A 5I4IA 5JXGA 3MTAA 3Q7SA 4EM6A 4ER5A 1ZUD1 4C2TA 2I4LA 5CJPA 1KY2A 2HDWA 3KXDA 4N76A 2Y77A 3R9IA 1RRKA 3DBLB 5MN4A 1UPCA 5L3QA 1N2EA 1O7JA 3CCCA 3P20A 3V7NA 3ESYA 3ZGLA 2Z6QA 2FN8A 1U2SA 3IUNA 5CPBA 1AOXA 1OLUA 4ZO7A 2FXIA 3DKIA 4D82A 2QP4A 1MO2A 1QX3A 4AG3A 3FGZA 4MMZB 3L6BA 4RTNA 1EFTA 3DZ8A 2JLVA 1Y42X 3EZ9A 4ZC8A 1WDKA 3IIKA 3R09A 3RU7A 1BZYA 1YWGO 3JQ9A 4X63A 2D13A 1CQIA 2LNDA 3EASA 3K2BA 3P1JA 1RADA 1XDSA 1YR3A 1A50B 2WF7A 5DNWA 3U7QA 4F2DA 3W5BA 4ZYLA 4B3SB 2WLTA 1U7ZA 2XXJA 3NHYA 1LV7A 1M0TA 1DAHA 2ODBA 2WMOB 3K35A 5T41A 5EZ6B 3V9PA 1XCJA 1LWNA 2FUCA 1OWMA 1NHGA 2V58A 2OV2A 1TEXA 1UOOA 4RHXA 5FJIA 3R7SA 3QJYA 4UDOA 1JZTA 1VBNA 2AJ8A 4LSGA 5DCUA 3V2IA 3WO1A 5JAIA 2I3AA 2C3UA 2HGSA 1KXJA 3SY8A 4MDFA 3SOPA 2J3HA 1GR0A 3NUZA 3R4CA 5ALQA 1ORVA 5KCMA 1J09A 4HDNB 3LCCA 3AR7A 1U0NA 5E8RA 2Q6IA 4G2TA 1EWRA 3PC7A 4GGPA 3P9YA 4HWTA 3DAYA 1OLSB 2WHQA 4V1CB 4QLBA 1JJFA 5ITZA 1JQJC 1U98A 3F67A 3NIGB 4L9SA 5C81A 2W2QA 3P9PA 4P92A 4W9NC 3O8LA 5CVEA 4OXQA 1SVNA 2KYRA 2EKZA 4U3JB 5DN6D 1K89A 4V0LA 5EJEA 3O8BA 2FKAA 1QH9A 1AVTA 4NK4A 2RG1A 1UPTA 1JALA 1PGJA 1RZUA 5EI5A 5FI5A 4ABYA 4AC9A 5FPKA 3GLFA 4ARIA 1XALA 3LP5A 1QIFA 4UAGA 4ADSG 1VRVA 3C4QA 1E5TA 4ZKDA 3BXPA 1Y1TA 4AXBA 4PZAA 4QOSA 1HQCA 3DGEC 2A9VA 3TUZC 2EV9A 4RKWA 2RBGA 2REOA 3HXPA 1TB4A 3T5TA 2IY8A 3A7EA 2C4MA 3IKMB 1SZJG 4MGZR 3BXXA 3NPMA 3KP1A 1WCXA 3V7YA 2XB9A 1V3TA 2LPMA 4X3OA 2EF1A 3PT5A 4FHGA 4G0NA 4FB4A 5KVVA 2CVZA 1F2UB 2HL6A 3AF2A 4M9ZA 5JZMA 3MERA 1D5WA 3RPEA 4R31A 1KGSA 2XUGA 3EHEA 4KI7A 1SC3A 4MK4A 2ZSUA 3Q7IA 4L73A 2NVUB 2ZTMA 3ZU3A 1FTNA 3PI7A 5G3YA 3AX6A 3H4MA 4LZLA 3F6EX 1GN9A 2FP3A 1L9XA 4V0ME 3UA4A 3FVTA 1QQ6A 2X8JA 2WJYA 4D5EA 2W9XA 3V8VA 1S3SA 1S8NA 5JDIC 4YQYA 4JV5B 3FLBA 1M6WA 1RMYA 5BRJA 5FNVA 2BEWA 5L51A 4TQGA 2HA7A 1ZNYA 3HNPA 1LS6A 4H7KA 4W4TA 5HF5A 4DSNA 4E1AA 1ZSNA 4D80A 1NWCA 1O96A 5IDXA 4KAFA 1HR0B 1TMGE 4JI7B 1NVVR 1LI5A 2OC9A 1CUJA 1ECGA 1BWSA 1OYVA 2HO4A 1NN0A 2B3DA 3MINB 3DFFA 3QXXA 3H83A 4OGFA 5FJJA 4YPVA 4ZJPA 2ATEA 1RMTA 4JU8A 2IU6A 1FX1A 1XZJA 4H31A 2WA2A 4G8BA 1NR1A 1L1RA 1A72A 1OA1A 1KU0A 1VGQA 3MXOA 1N6NA 3O4HA 1F3OA 2ZB4A 4KAXA 5HIMA 4MEJA 4EMTA 1HNWB 2RFLA 2XMCA 2JI4A 3RNOA 1POXA 5AVUA 4PLCA 1FNDA 1E5XA 2XVAA 3I9JA 4G0PA 3MLEA 4ZVMA 4EQ6A 4HXFB 3BKXA 3LP6A 4UUPA 1LNQA 1T5SA 3HSYA 5CT6A 4ZGGA 5LOVA 3IT2A 2R60A 1VLLA 4YCSA 3R7NA 3H5TA 1Y98A 4J2HA 2O07A 4DDVA 2AOVA 4RPCA 1W5BA 1JMVA 4L4RA 4E3ZA 5CBPB 3KKZA 1X1AA 4OB7A 3KQUA 3H86A 4JXZA