3WSWA

Crystal structure of minor l-lactate dehydrogenase from enterococcus mundtii in the ligands-bound form
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
316
structure length
316
Chain Sequence
KTSRKVVIVGTGFVGTSIAYAMINQGVANELVLIDVNQEKAEGEALDLLDGMAWGEKNVSVWSGTYEECQDANLVILTAGVNQKPGQTRLDLVKTNATITRQIVKEVMASGFDGIFVVASNPVDILTYLTWQESGLPASRVVGTGTTLDTTRFRKEIALKLAVDPRSVHGYILGEHGDSEVAAWSHTTVGGKPIMEYVEKDHRLEENDLTVLADKVKNAAYEIIDRKKATYYGIGMSTTRIVKAILNNEQAVLPVSAYLNGEYGEEDIFTGVPSIVDENGVREIIDLSITPQEKAMFHQSVSELKAVLDTVRLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
publication title An alternative allosteric regulation mechanism of an acidophilic l-lactate dehydrogenase from Enterococcus mundtii 15-1A
doi rcsb
source organism Enterococcus mundtii
total genus 105
structure length 316
sequence length 316
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wswA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 3wswA02
1XU7A 2GZ3A 3GA0A 2O3SA 3A28A 4N5MA 4RZIA 5JAZA 1LLQA 5TSDA 3GNTA 5IN4A 4O5OA 5MGBA 1EE2A 4F6LA 2NV6A 1YL6A 3ROPA 2D3TA 3BMCA 1U1IA 5JCXA 3T4EA 5A9SB 1YL7A 4Q3AA 2VZ9A 1E5LA 3HNPA 4HFNA 4P22A 1HDXA 4Z3DA 4CLEA 1BWSA 3G1TA 1EVJA 3QWBA 4MKXA 1YKFA 1GEEA 3TZHA 1E6EA 4FFOA 3VPFA 4E4YA 1E0DA 4DA9A 2D1YA 3CKYA 3QQPA 4MOWA 5I8WA 5DN9A 1LU9A 3U49A 4DLBA 2HMSA 3VHRA 3ZNOA 5DCYA 2P68A 4M86A 1NPTO 2QRLA 2WYVA 1GZ3A 3MJ4A 5AXBA 4ALLA 5BR7A 2AHRA 1B8VA 2AQ8A 4E2WA 3D3WA 1ENOA 1U5AA 4JXKA 1T26A 3ITDA 4XA8A 3KTDA 2VUUA 1RM4A 3AM5A 4BB6A 1LSUA 2CSUA 1U4SA 1J6UA 2J5KA 4NU6A 3UH1A 1NASA 2YDYA 3SLGA 3DC2A 3E03A 3O26A 4H15A 2G0TA 3IUSA 4MIOA 3UN1A 1P1JA 4W9NC 1ZIDA 3MWDB 2OZPA 3D4OA 4BS9A 5KVVA 3P2OA 3B20A 1KERA 1X0XA 3OJLA 2XXBA 3ROMA 3TSCA 2FR1A 3WGQA 3JQFC 1K89A 1UXJA 3OQ1A 1E3SA 3W4JA 5TT0A 4WK6A 3SLKA 1KETA 1KIFA 1PJBA 3RUCA 1PGPA 4NMHA 4RGBA 3JD3A 3IJPA 1YL5A 4YCAA 3PEFA 4LGVA 4TZKA 2GO1A 2YQ4A 4Q3CA 4YVFA 2XOXA 2BFOA 5COBA 3W8FA 5JSFA 3ZWCA 1IB6A 3AW9A 4PLWA 3ADPA 3F3SA 1Q0LA 4L4RA 5F5LA 2RBEA 4PVCA 4YA6A 1PZEA 1QG6A 4GVLA 3IAHA 4UVDA 3JYLA 2Y05A 3GRPA 1DAPA 1PWXA 1XA0A 1PGJA 2B5VA 2F00A 1R66A 4BNWA 4CMBA 1C0PA 1T1SA 1GD1O 1XYGA 1GTMA 4BO7A 1YVEI 1I33A 1TT5A 1LXCA 2FMUA 2ZTUA 3KVOA 4PLPA 3IKTA 3OMLA 3DTTA 3JQ9C 5LDHA 3EUWA 3PHJA 5CEFA 4IDDA 1VSVA 1F17A 3NJ8A 4QT0A 2BHLA 4PG5A 1XWFA 4E21A 3NYWA 4J4BA 5BSFA 1JAYA 1NAIA 2O4CA 3KM0A 1IE3A 1J49A 1P0CA 3RUHA 3FPLA 2Y1FA 4IDAA 9LDTA 5JDCC 4CL3A 3GOHA 3QVOA 4J43A 2VYND 1E3IA 4G2NA 1FF9A 2DU8A 2ZCVA 4EUHA 5C5IA 1FDWA 1Y8RA 2V6GA 4PLYA 1H2BA 5JCJA 1ONOA 1A71A 3JQBA 1CYDA 1DPGA 1SOVA 2R6JA 3BTSA 2NSDA 4JLWA 1I24A 1G0OA 1GQ2A 1UR5A 5GY7A 2J6IA 4YQYA 2NU7A 3KEQA 3Q2IA 5LCXA 3RVDA 1O5IA 3MJCA 4BO8A 4ZA2A 3AI2A 5IN5A 1WP4A 3TDKA 1SEVA 2PZLA 4YR9A 1UDCA 5JNLA 1BHSA 1A4UA 1XKQA 1CQJA 5C7OO 1SOWA 3WIDA 1QYVA 3DHEA 2GN9A 4O0LA 4ROSA 5G0TA 3EK2A 4U5QA 4FOSA 4R4JA 4BO1A 5KJ1A 3ZV3A 4IQGA 1MXHA 2FSSA 3DOJA 4U0JA 2YW9A 4G81A 4HWKA 5JY6A 3P19A 2CF6A 3TZCA 1XIVA 4LCEA 4FSHA 5L4LA 4KTTE 1E3WA 2WD7B 1GFSA 4MP8A 3DONA 2VN8A 2DUUA 3EC7A 3HDYA 3KYBA 4CMEA 3VH2A 4M54A 1E7MA 2X4GA 3UFXA 4F45A 1SBYA 3OJOA 3CZRA 3E9MA 4P4GA 2HCTA 1GUZA 4BNJA 1PWZA 1JDJA 2VWGA 3BMCB 3NX4A 4PLZA 5T67A 3RFVA 2C5EA 3G1UA 3JQAD 2UUOA 4R54A 1M66A 4DTIA 2Q2VA 4MINA 1LEHA 5B4TA 4GLLA 5HS4A 3I83A 1GV0A 1M2WA 4ND4A 4CUZA 1KEPA 1B3RA 1U3TA 1BXGB 4EGFA 2DBQA 3HB4X 5BNFA 3TF5A 4IJWA 1R16A 5T5QA 2G17A 2EG9A 5EMHA 3C1OA 2EIHA 4B7CA 5JAIA 1AE1A 2JFFA 4HP8A 3AOEC 3RIHA 2ZB8A 2TMDA 4MVJE 4JJFA 4YT2A 3LT2A 4ZHSA 2GZ1A 1JA9A 5CDSA 4RQUA 4NHEA 3UHAA 5F5NA 3UUWA 3D4NA 2CDCA 3GUCA 4CV3A 2I99A 3D3WB 3CXRA 4M89A 6LDHA 1PZGA 1J5PA 1ULUA 3WQSB 1VE9A 2GSDA 3GDGA 4YRBA 5ICMA 3WGHA 3FI9A 3AK4A 3EDMA 5U4QA 3JQGA 4AL4A 5IZCA 3ADOA 3I9LA 4M55A 3VZQA 1ZK4A 5B37A 1U28A 1LRJA 4H3VA 4WCFA 4BIIA 2C2YA 1PJ2A 1K6XA 3WNVA 5G2OA 1HL3A 2Q1TA 1YOVA 3AI3A 3PRJA 5JFOA 2H1SA 1ZJYA 2IZ1A 3H2SA 2A92A 2DKNA 5AYVA 3ONDA 4CM5A 4Q3DA 3L4SO 1AXEA 4TVBA 1QV6A 5T57A 2IRWA 2PGLA 4Q9NA 4B3JA 2EW8A 3VPGA 3VTZA 2YV3A 3INRA 4L4SA 2R00A 1ISFA 4XIYA 5CEEA 3E82A 1UZMA 2JL1A 5IJZA 2NLOA 1ULSA 4HV4A 4ZU3A 3MOIA 2P9GA 3JQ7A 3QVSA 5GZ1A 1K5HA 2OO5A 2C59A 3JD4A 1EQ2A 3UAGA 4QECA 4KZPA 2H9IA 1H93A 4E5MA 1U3UA 5I7SA 2IEDA 3BZUA 1EE9A 4K6CA 4RF5A 3BTOA 3PYLA 4LMRA 2YHIA 1F12A 3RUDA 1Y5MA 4R9SA 4BNTA 1TT5B 4ITUA 1LBEA 4EITA 1IYZA 1A9ZA 1K2WA 4J49A 3DZKA 1VC2A 1NYTA 3TOXA 4OAQA 5A4DA 5KJCA 1QKIA 1CETA 2ZATA 4U8GA 2FP4A 2W90A 2HLPA 2O7SA 4CMGA 3AM3A 3ZNNA 4J91A 2NWQA 2GDZA 3PHHA 1C0IA 1CDOA 1LX6A 3BMQA 3KZVA 1PJ3A 3BIOA 5B4UA 2Q2WA 4Z3KA 3GMSA 4AG3A 3AM4A 5I7VA 1ZEMA 3WFJA 3EY4A 4DQXA 1LLCA 1Y8RB 3EZYA 3U4HA 2C82A 3BA1A 1U3WA 5F1KA 4XYLA 2DFDA 1T2CA 4DPMA 1LUAA 3OQ6A 2AEFA 1UXKA 5H82A 1CEQA 3I4FA 4OSOA 1DFGA 3U0BA 1CIVA 4RV9A 4Q3EA 1I5RA 4GGPA 1NHGA 3FR7A 1TLTA 4J6FA 5ICSA 2Y68A 4D7AA 2EF1A 5A02A 3D7LA 4ALJA 1EK5A 2IXBA 1R15A 3ST7A 1PS0A 3OSUA 4CQMB 2PTGA 5I7FA 4BKPA 4MKRA 1YONA 3JQ6A 4BHTA 1NM5A 2Y1EA 1LJ8A 1E77A 4XRGA 5L51A 3V2GA 4YWJA 4DBZA 5TIIA 1H6CA 1I2ZA 3I52A 4NBWA 3QP9A 3WTCA 1WNTA 3PFWO 1N7HA 1YE3A 4BO4A 1ZO8A 4DQUA 1A72A 2BGLA 3ZU3A 3K31A 4J2OA 1E3WB 1AXGA 3BHIA 4UVEA 4A73A 5DULA 5JYEA 3W4IA 4PGFA 1XU9A 3WR5A 2I76A 1V35A 4IINA 3OEWA 4RF3A 5CEJA 3GEMA 3H6KA 2QYSA 1UUFA 4JBGA 4UUNA 2VT3A 4HBGA 3EVNA 1U2DA 1X7DA 3NUGA 4BNXA 1YGYA 3H4VA 3GMDA 3OJEA 1GQQA 4S1VA 5T8KA 4LISA 4UEOA 2HMWA 2WYWA 3E5RA 4CLDA 4EEZA 3C3XA 5L4SA 5A3VA 2OP1A 1EFLA 2FSVA 3DMTA 1R4NA 2CVZA 4IXTA 5K9ZA 2D5CA 1XQ6A 2WDZA 4AJJA 2BMAA 2J3KA 2DTXA 1QYWA 5EQDA 3DAGA 3LQFA 2WMDA 4WASA 3CSDA 3DWFA 1E3LA 1JAXA 2PKRA 3I3OA 3PQDA 4E5YA 1D4FA 4FC7A 4I5DA 3RBVA 1QLJA 2DBZA 1HDZA 2A4KA 4W99A 2O3RA 4CMHA 4XYGA 3FR8A 5BSEA 5AVOA 4GKVA 1PR9A 1NFQA 1XELA 2O4UX 1FDSA 1GZ6A 5JDIC 2E48A 2J5RA 1LLDA 3QW2A 4BNUA 3F6YA 3OJFA 4PG4A 4DMMA 3R3SA 2EJWA 2A94A 3PFFA 4JP3A 4WECA 4E2ZA 4WCFB 4ILKA 3IL2A 3GN2A 4N5LA 3ZWYA 1X7GA 4IDCA 1R0LA 1VL6A 3PLRA 4BNHA 1YOVB 3ANMA 4MO2A 4PZCA 3PLNA 4N7RA 1O9BA 4BMVA 1ZH8A 2AG8A 4P4LA 5IDXA 3ETEA 3W8EA 1UH5A 3DZHA 1QMGA 3ZW9A 3ETGA 4QSMA 2CNBA 1DC6A 2HMVA 1G0NA 3AU8A 5KVQA 2D2IA 2LDXA 4YT4A 4UEKA 5L45A 3JQ7B 1KBZA 1H2HA 3PJGA 4J1NA 3E9QA 4NFSA 4OSPA 3AWDA 2BLLA 3UXYA 5I8ZA 3L4BC 1Y81A 2IEBA 2O3JA 1FDUA 1KEWA 5A05A 5FWNA 2NQ8A 1DC3A 3DBRB 1XLTA 4LSMA 4XGNA 2YHIB 1NFFA 4RPJA 1FDTA 2D0IA 3EMKA 4P4NA 4YT5A 4A5OA 3ETDA 4AJOA 4OHUA 4OO3A 2I67A 1PJ4A 1EUDA 2PD3A 2POQX 4UUPA 1YS4A 4RVUA 5F1PA 1GDHA 1IUKA 5G4KA 1YJQA 3WYEA 5ENDA 3ZWAA 4CV2A 3GEDA 1HETA 1N92A 4HFRA 3U9LA 3BMQB 4GLOA 4OH1A 3PPIA 4ND1A 1MLDA 2NACA 1RM5A 3JSAA 1E6UA 3ZNPA 4CMJA 2A9FA 1HKUA 3V1YA 2H5LA 4L8VA 3JQCA 3H7AA 2W2LD 3QWHA 1M76A 2ZTLA 3D0OA 4MVJP 5JC1A 4ZQFA 1RYEA 2I3AA 4XB2A 4CLRB 1GYPA 1Z74A 2XAAA 4B79A 3LF2A 4FGSA 4J2HA 1R6DA 2X58A 2VZ8A 2IDZA 3OH8A 1NNUA 4AJNA 4D3SA 2X5KO 3GVCA 4GAEA 1W0CA 4OXNA 4F6CA 1JVSA 3DDNA 4DUPA 4L73A 1O89A 3MZ0A 4Z0HO 3TZKA 1UAGA 3H8VA 3OETA 2RAFA 3QRWA 1JWBB 2FN7A 5TNXA 5A06A 1T2EA 2IZ0A 2FR8A 1TA4A 4YJFA 3KETA 1WDKA 1ENYA 5FI5A 4WNIA 5FYDA 4NFHA 1J4AA 3GEGA 5DP1A 2CY0A 2HO5A 3GN1A 3WJ7A 5A3JA 5IXYA 1CQIA 1HLPA 4W9NA 4XYBA 4K28A 2NU6A 1FMCA 3OM9A 4B4OA 2YYYA 3JQ8A 3GR6A 4DC1A 1Z82A 4D3FA 1CERA 3JQFA 4CJXA 3GLQA 1R4MA 4FN4A 4LSWA 4TRNA 1KC1A 4BOYA 1RWBA 3SC6A 3RSHA 2EEZA 3H5AA 2I66A 1DC5A 1N7GA 2FZWA 1B15A 1QLHA 2QHXA 4D3DA 1I2BA 3N7UA 2FHSA 4MVJG 3S2FA 3O03A 2CF5A 5BSGA 1P1HA 1PSDA 1P0FA 1R4NB 2O2SA 3E6AA 5IXSA 2BGKA 2ZB7A 3WGYA 3FWZA 2QYTA 1F06A 1LC3A 4D0RA 4XGIA 1FJHA 4HUJA 2BF7A 2WEKA 1WPQA 1HRDA 3M6IA 4R5MA 2J3JA 4M8SA 4QQRA 1X1EA 4RPLA 2PLAA 3C7AA 1GEGA 4UUOA 3JQ9A 1BW9A 3JYNA 3C7DB 4PG7A 1XR3A 3WSVA 4WLOA 1F0YA 1YH3A 2QX7A 3H3FA 1GUFA 1DIAA 1BGVA 3VC7A 1MX3A 1PQWA 1ONNA 3MTJA 4YJHA 4AJPA 4ZQHA 1LRLA 4GX2A 4J0FA 3VZRA 3ASUA 3HDJA 1A9YA 3ZWWA 1ML3A 3E9NA 5JDCA 2Q99A 1YB5A 4XR4A 2A35A 3ZV4A 4Y6PA 1WZEA 5DCUA 3RCBA 1A4IA 3OJ0A 1QP8A 3ZGYA 3JCZA 3LK7A 3RD5A 4YAKA 1B14A 2GYYA 2IXAA 3STHA 1CJCA 3EYWA 4RORA 3PQFA 2Y1CA 2DBRA 2G82A 3MWEB 3WLFA 5BNIA 4RCVA 5EINA 1DHTA 2XPCA 4GWKA 3FN4A 1LQTA 3AU9A 1E7YA 1GAEO 1Z6ZA 2FPGA 4OJNA 3L6EA 2HKIA 4PLVA 1GYRA 3NTQA 3HADA 4IPTA 3PWSA 4CR7A 3PWKA 3VTFA 4OQYA 4L75A 1KVSA 3ZV5A 4RVFA 1TT7A 4DIBA 4ZGWA 3E5MA 2QQ5A 4HNHA 1BMDA 4MVJF 1X13A 1YXMA 2X9NA 5T64A 4TQGA 4XRRA 1ISMA 1DAOA 1DB3A 4PFJA 4IQ0A 1PL6A 1OZAA 4XQGA 3O9ZA 1E1NA 3GG2A 1DDOA 1NQ5A 2Q45A 5JAQA 1U5CA 3GHYA 3ENKA 4TWRA 2X23A 5J23A 1GPDG 1NVTA 5F21A 5IF3A 1UZNA 2C7GA 4D42A 3NGLA 3EW7A 1PJSA 3EHEA 3DZGA 3FNEA 3KLMX 4E0BA 3RUEA 1IULA 5G4KB 1LDMA 3F46A 4BGUA 3UCEA 4E30A 3C1TA 5A9RA 4D0SA 4KWHA 2PGJA 2X5JO 2BGMA 3DZBA 5B4VA 4J9VA 3PP8A 3GGPA 4WNCA 2EGGA 3GPIA 3GZ4A 1HEUA 4R3WA 3TZQA 1V6AA 1Q1NA 4EUFA 5KCZA 1ZK1A 2P9CA 5TGDA 2WWRA 2XF8A 4BMSA 3C24A 4GBJA 1J0XO 3MCVA 2OUIA 3LDHA 1PR3A 1C0KA 3KEOA 4LCJA 2JFHA 4CQMD 1LSSA 3NT4A 4B8WA 5A5EA 1N9GA 5L53A 2X6TA 4GWGA 5GZ6A 3L07A 4RO0A 1LNQA 4JBIA 4DYVA 2DPHA 1NVMB 3AUUA 4J7CA 1QV7A 4EBFA 4DLLA 4E6PA 2NADA 2VYVA 3RBZA 2GPTA 1BVUA 4QUKA 4BNGA 3K96A 1JVBA 1PJLA 5C7IO 4QFCA 3RBXA 3FBGA 4M1QA 3AOEA 1IPEA 1N2SA 1YO6A 5A1TA 1IPFA 4BNLA 3VPSA 2NTNA 3KO8A 1DRUA 4IMRA 5EQFA 2C20A 4R9RA 1VM6A 4BQPA 4EJ0A 1E1LA 1DJNA 4URFA 4KDEA 3TRIA 1D1SA 3W1VA 1DLJA 3KRTA 1UP4A 1DRVA 1NX6A 5MDHA 2VNSA 2VQ3A 3F4BA 3GY0A 2HJRA 1I2CA 3D5QA 4N5NA 4U0KA 3IUPA 1YRLA 3TFQA 4Y98A 3K92A 1K6JA 3JQ8B 2I6TA 4R1SA 1QYDA 4PZEA 4RDIA 1FDVA 2V6BA 3R3JA 5EPOA 5HS6A 3L9WA 3LT4A 2W2KA 4PG8A 1ISHA 3F1KA 3LVFO 4CM6A 4XD2A 1K3TA 2PWZA 2DFVA 3NTRA 4BO6A 3GC6A 1PU2A 4RLHA 2Q1WA 1NR1A 4NIMA 3WBBA 2YQ5A 3M2PA 4UEJA 2HRBA 5BNTA 3KSDO 1CWUA 2EGHA 2DTDA 2GD1O 4L4XA 2QW8A 4BMNA 3ZHXA 1HWYA 3E1KA 4CM8A 1T2AA 4F3YA 3CINA 3PHLA 1I3LA 3GGGA 4DBVO 1WW8A 1U9JA 1GPJA 3ZU2A 5CDYA 3KYCA 5CPBA 1HDOA 5TF4A 4A7PA 3ZHYA 3OF2A 5THKA 1HE3A 4KQWA 1H94A 3RI3A 4H16A 1O95A 5U9CA 1I01A 1RYDA 1BW9B 1NWCA 1VJTA 2C2XA 5A03A 1QSGA 4HY3A 1ZW1A 2C07A 2EP7A 5H83A 4NI5A 1P74A 4YJHB 1NHWA 2VHXA 2HDHA 4MP6A 1GL3A 2PD4A 3H9QA 5CDUA 3FBTA 3FPCA 3WGZA 3TN7A 2VWHA 3HQ4O 1Y8QA 4ZQEA 3KSUA 1GR0A 1MV8A 1ONPA 3TZ6A 3ASVA 2J3HA 3OIGA 2OHXA 4E3ZA 3L6DA 4RPHA 4FDAA 4HXYA 3QJ5A 2OBNA 3PXXA 1G6KA 3EGOA 3OP4A 3QSGA 3I9NA 3ICPA 1LSJA 3PDJA 4D43A 3AOGA 4XKJA 2Q4BA 2H63A 5JAMA 4BVAA 4BV8A 3HB5X 1XGKA 3GZNA 4AJ1A 3SXPA 3O38A 4XB1A 5L7WA 4KUEA 3IS3A 3K8ZA 3CEAA 3U09A 5ILOA 1MA0A 4ID9A 4NBTA 5ES3A 3LLVA 4MDHA 1PZHA 4GVXA 2PKQO 3HWRA 3GNQA 2BI8A 2V6FA 1ZK3A 2X7HA 3K2BA 3Q3CA 1D7OA 1R0SA 4EDFA 2VTDA 4PZDA 2OORA 3ZWOA 1RPNA 2EKQA 2Z95A 3R6DA 1VJ0A 4ND2A 1T2DA 2GR9A 1HT0A 2WTBA 1F14A 3UW3A 3EVTA 4FCCA 5BSHA 2JFGA 1SEPA 3NT2A 3B70A 4BNVA 2E4AA 1DIBA 3WGIA 4L9RA 1U7HA 2VZ0A 4UAGA 5CP8A 1H6BA 5I9MA 4B7XA 4K1LA 1EVZA 3HDQA 1KS9A 1H9AA 5DP2A 1OAAA 2P5UA 4Z9FA 3GFGA 2OXIA 4B4WA 3A1NA 2VYNA 4R51A 1NPYA 4AJEA 4MIYA 5I7EA 1NP3A 3VZSA 1W6UA 3SC4A 2VOJA 1ZSVA 1MG5A 3A06A 3KLPX 1YB4A 2BFMA 3NJ4A 4JCOA 1LDGA 1P1IA 3I4CA 3IIEA 1T25A 3ROKA 1E1KA 1S6YA 3JD2A 2PV7A 4IS2A 3LC1O 2VNAA 3HHPA 3MJVA 4JK3A 1YDWA 1NBOA 2C7VA 1X14A 3H9UA 2JJYA 3Q9NA 4KQXA 3WYBA 1HSOA 1I10A 2GNAA 3RUIA 4BB5A 2RIRA 4QO8A 4DREA 5JMWA 2BELA 4AICA 4BKOA 2CMDA 3PTZA 1N5DA 4FB5A 2FY8A 4YDRA 4FGWA 3ON5A 2BFAA 4ALMA 4CM9D 2Q2QA 2CUKA 3A14A 1Q0QA 1PL7A 4A0SA 2P9EA 4J7XA 1KVTA 1FK8A 3JQEA 5ILGA 2NU8A 7ADHA 4UUMA 3FF4A 2FPIA 4YAJA 3L6OO 3FNHA 4R1NA 3NKLA 3U4DA 4ESOA 3E18A 5JDIA 2G76A 4O63O 1V9LA 1UJMA 3BMOA 3WJAA 4W6ZA 3OIDA 4TKLA 3V5NA 4E32A 4B8ZA 1XEAA 3C7CB 4DC0A 4BV9A 3JQBC 2SCUA 1Z45A 4TRRA 1ADBA 2DAPA 4BGEA 1WMAA 1Y9AA 1ISGA 2ZQZA 3JQAA 3GGOA 1JWAB 2W2KB 1E5QA 4WLFA 3D4PA 4HFMA 3KB6A 4L76A 4YRAA 1MC4A 3FHLA 1U8FO 3PVZA 4F46A 2CVQA 4TKMA 2PFGA 4WEOA 3C8MA 4TROA 1Z73A 4Y67A 1O8CA 1VI2A 4GX0A 1V3TA 5DZSA 5AXAA 2YV1A 4I5GA 2B5WA 4J90A 4JROA 3ZCXA 3P5SA 2O23A 1RJWA 3ZI0A 5K6AC 1DFIA 2P91A 4FW8A 2E82A 4XQ9A 4CM8B 4FFLA 2QRKA 3UCXA 3L4BA 2X9VA 5ITWA 3NT5A 2DT5A 2J5QA 2EXXA 5DT9A 4CLXA 1MFPA 1ISIA 5T6BA 3FNFA 1DSSG 2PZKA 2ZCUA 1LDNA 2JD0A 4HX5A 2LDBA 5EL0A 1PGQA 3RC2A 3BTVA 3IKVA 3MOGA 2VRCD 3U5TA 1Y7TA 4PLGA 1NFRA 2PA3A 4OOEA 4E2YA 3LT1A 5L95A 4YYZA 3COSA 3PIDA 3VVCA 4OL9A 4WLVA 1R0KA 2ZTMA 2AEMA 1Y8QB 3NEPX 3DZIA 4P38A 5GZ3A 4XYEA 1ADGA 3BXXA 4PLHA 3KUXA 5EJ2A 3WLEA 4ONEA 1N8KA 2HMTA 2JHGA 4BL5A 4YPOA 2B0JA 2EJVA 4G5HA 2AMFA 2VHWA 5ITVA 3L77A 5KJ6A 3VPXA 2B35A 4FJ1A 2CDBA 4EZBA 1YQDA 5JO0A 3ROQA 2NVUA 4J0EA 1EFKA 1HE2A 2OOSA 3OBBA 4CMCA 3WGGA 1VPDA 3M2TA 1E7SA 3WTBA 5IFLA 2FPPA 3JD1A 2ZYAA 2C29D 3ZU5A 3NRCA 3KV3O 3P7MA 3WX0A 4R69A 1B8PA 4W7IA 2GRAA 2PH3A 1WWKA 1I32A 2EERA 2FR0A 5I9NA 1BTOA 2VHVA 3VDQA 1D1TA 1Y1PA 3T7CA 1YDEA 4JGBA 3ENNA 1NVGA 1ZEJA 1KVUA 1Q0HA 1ZXBA 2YV2A 3NDRA 3PI7A 4MJLA 4NDNE 5HWSA 5KJEA 2VUTA 3PIIA 1V0JA 2UUPA 8ADHA 4NBRA 3PDUA 2JCVA 3O8QA 3QHAA 4IIVA 1DLIA 3ZDFA 3JQGB 1NAHA 2Z1MA 2X1HA 1QXSA 4RVHA 2HK9A 1MG0A 1BVRA 1DBVO 5GMOA 1P9LA 3PYMA 3D5TA 4JJGA 4ALIA 3GT0A 3A9WA 3K6JA 1NQOA 2C0CA 2JCXA 4Q3NA 3S1LA 3F4LA 3L9XA 2WSBA 3DR3A 2OP0A 5HBRA 4DIFA 4LRSB 5JE8A 4EJ6A 3PGXA 1I0ZA 3LU1A 2CD9A 3I9KA 4YRDA 1GCOA 1Q7CA 2D59A 3QWFA 1GU7A 5JPIA 1ZK2A 4IDEA 4BO0A 1F8GA 1ARZA 2PK3A 4R41A 3RWBA 2FRDA 1EMDA 1H0KA 1Y6JA 4I8XA 4BKUA 5AQ1A 2DM6A 4GPD1 1M6WA 1PZFA 2HRZA 4NBVA 1HE4A 4FFRA 1AN9A 5BT9A 5CHEA 3OA2A 5ADHA 3ZHZA 4J1TA 3JV7A 2GZ2A 1LSOA 3BMOB 3TNLA 5IZ4A 3S2EA 1B2LA 3N74A 4CL8A 2ZIZA 3WNQA 3V2HA 1WZIA 1H5QA 1PX0A 2Z1NA 4JNKA 2JAHA 4J4HA 1JW9B 3OA0A 3DZFA 2CDAA 3GVHA 4GX5A 5ER6A 3RC1A 5K0ZA 5AXCA 3JQAB 4QFDA 3VAZA 1NR7A 4II3A 1BDMA 3U4CA 1DXYA 4OXKA 3AY3A 1U8XX 4YT8A 3WGOA 4TMFA 5JC8A 1C14A 3S55A 4TRMA 3INTA 2GN4A 4EYEA 3UF0A 2ZJ1A 3GDOA 1ENPA 2DQ4A 4KUGA 3RROA 2B69A 1NPDA 1WMBA 1I30A 1PGOA 1P1KA 3BYZA 1EZ4A 2E6UX 1SNYA 1ZVMA 3ZWVA 5JW6A 3JYOA 4WPGA 4R01A 3HJAA 4K9DA 4Y6RA 4ND3A 4MIEA 2NU9A 1D3AA 4FJ2A 4AJKA 5TC4A 4CMIA 4NZ9A 3GAFA 1E7WA 1HLDA 4R5HA 2Q3EA 4IY1A 4J4TA 1TEHA 2WM3A 5COQA 2B36A 3GQVA 4AVYA 3W8DA 3JTMA 1HZJA 3QLJA 1I3KA 4LRTB 3RJ5A 1ADFA 4CV1A 5KVSA 2UVDA 5TT1A 1N1GA 1T4BA 4RLSA 4Q39A 1M6HA 4AJHA 3Q0EA 1EBFA 1DRWA 3RUAA 5TJHA 3X2EA 1ENZA 1XSEA 4MVJA 3WG9A 5EN4A 1BXZA 3PYXA 3Q9UA 3F47A 4LMPA 2UAGA 2HU2A 4C4OA 3BHJA 1OI7A 5HTOA 2PGDA 1RKXA 3U4IA 1SMKA 2JAPA 4WCDA 3G79A 2QZZA 1HDRA 3TJRA 2X8LA 4J16A 3U3XA 3FSRA 4A03A 4NK4A 3UVEA 4CMKA 5JYDA 3H2ZA 1JKIA 2V7PA 1HYHA 2YFQA 2BH9A 2DC1A 3FNGA 1XG5A 3T4XA 4YAGA 2IYPA 2NVUB 3H9JA 1X0VA 5B1YA 3PWZA 4I5EA 4BGVA 3MEQA 2GLXA 1BSVA 4NR0A 3GRKA 2H6EA 1S7CA 4FQ8A 4CV0A 3WQRA 1GY8A 3LSYA 4WOKA 4KWIA 4DMLA 4RVSA 3VOSA 5KTKA 1YBMA 4OM8A 3RJ9A 1MGOA 1ID1A 2QIOA 1KEVA 2RHRA 1Q7BA 5TRTA 3VH3A 5DF1A 1WLYA 1ADCA 3VVBA 3WYCA 3DBVO 1VSUA 4ZD6A 1ORRA 2O3UA 2GERA 4LN1A 5LDGA 4D79A 2Y93A 1HYEA 1B7GO 3PJEA 4XR9A 4UULA 2FWMX 1SC6A 3IDSA 3O8QB 4XZ3A 4IGEA 3HN7A 1ZK0A 2IZZA 2FOIA 3HE3A 3GVPA 4KP7A 1SAYA 3E48A 4ZRMA 1A5ZA 1BXKA 3UICA 3D1LA 5F1OA 3GF4A 2RH4A 1HDYA 4B4UA 4JJIA 3QWAA 4JBHA 1MP0A 4LVCA 3MJSA 5F3RA 4OQZA 2VWQA 3DTYA 4XJTA 3JD0A 2EWMA 2BRUA 4K6FA 2E49A 1C1XA 3M1AA 4BO3A 4GMGA 4DGSA 3SJUA 3UKOA 4FFNA 2RH8A 3ANNA 4KUHA 4PCVA 4DPKA 2VT2A 3HFSA 3OECA 7MDHA 5CG1A 1DIHA 4NQZA 4AJ4A 4P8RA 1L7DA 4BKQA 5B12A 1PGNA 5KKAA 4XQCA 1MC5A 4FFMA 2UV8A 3ZU4A 1KC3A 2PZJA 4RDHA 3FTNA 4OGWA 4RVDA 3WB9A 4CLOA 4W7HA 3NGXA 5L7YA 3DHNA 1P31A 2B37A 1EDOA 1MB4A 1BXGA 3QVWA 4MVJI 2Z5LA 2E37A 3I9OA 9LDBA 4CQLA 4DXHA 5JCJD 2WE7A 5DOVA 3VZPA 5KNLA 1YBAA 1ZMOA 1UDAA 2JD2A 3IQDB 3LC7O 4RL6A 3R1IA 3CUKA 4GMFA 3WIEA 1JLLA 3UOGA 3AY6A 2G1UA 4R16A 5JBIA 4ZICA 4WKGA 2O50A 4GX1A 4YJGA 3RASA 1SCUA 4XDZA 3MTGA 1E7QA 1EDZA 3CH6A 4E31A 1U7TA 5FF9A 5DBIA 4BO9A 2BD0A 4OIMA 3ZH2A 4HADA 4DVJA 1G1AA 3RQSA 4RQTA 4CMIB 4E5NA 5CDGA 2ZB3A 2OFPA 5ENVA 1D8AA 4Y8VA 1VRWA 3S2IA 2VCYA 1OFGA 1ZNQO 3Q2KA 5JMPA 4OYRA 3BTUA 2P5YA 5G0UA 1MFZA 3KHUA 2Q4EA 3H9EO 3DEYX 4DWVA 4IQ8A 3DOCA 3KSZO 2O48X 1H6DA 4R1UA 3RFXA 4XCVA 1LQUA 3V1TC 2W98A 2Y1GA 3DFZA 4KOAA 4YBZA 4YJFB 2YY7A 3K9QO 3RKRA 1SB8A 4CUKA 1WDMA 2DBVO 4AJLA 4IIUA 1O94A 4KMSA 2NQTA 2VHZA 4CM4A 1HE5A 4TZTA 4CPDA 3ZHBA 4A27A 3INGA 3H5NA 3RU9A 3SVTA 1I3NA 4GQAA 4C7KA 3KOUA 4CODB 1Q7GA 2AE1A 1FXSA 3MJEA 1P44A 4BNIA 1R4MB 3TWOA 1YQXA 2ZB4A 3TPCA 2GF2A 4B3IA 4DL9A 3G3EA 3IOYA 1R37A 4BGIA 1EK6A 1I8TA 3DOOA 3AUTA 3RUFA 1WAMA 1X15A 2B4TO 5KVCA 3B6ZA 4Z9XA 4GSLA 5DOZA 1JN0A 1W73A 4WEQA 4IS3A 2J3IA 1GCUA 2X86A 4YXFA 4BNFA 4XQEA 5JS6A 3E8XA 4I9UA 1DHRA 1VL0A 4ND5A 3X2FA 4R3NA 4EJMA 4ALKA 2HK7A 2OBYA 4BKRA 4IJKA 3S2GA 1QR6A 3RC7A 1LDEA 3PGJA 4JP2A 2NUAA 4ZVVA 1EEHA 5L40A 3HG7A 2JCYA 1PS8A 5LC1A 2GUGA 1L7EA 2OMEA 4XJSA 3F9IA 2HAEA 3SX2A 1UZLA 2R2GA 1BDBA 5FFFA 3ULKA 3SBOA 4D45A 5AOVA 3T7EA 3U62A 1MUUA 1HTBA 2Q50A 3H5RA 3QY9A 3EAGA 2Y0DA 1C1DA 3W4KA 3TL3A 3WMWA 1LLUA 2HQ1A 4INAA 1GUYA 4CQMA 2DPGA 1E3EA 4XX0A 2Y67A 4LVUA 3S8MA 2DUWA 3PQEA 2Y0EA 2VWPA 1CRWG 3CZMA 3FD8A 1EUCA 5IDYA 4B7UA 3AJRA 4XWYA 5K6AA 4D41A 4AJ2A 1I36A 2NTJA 3O4RA 4EW6A 1YWGO 2CFCA 2EP5A 1C1XB 4BO5A 4B3HA 3VH4A 3ZWPA 3GPDG 4BNZA 1LRKA 3ZV6A 3DHYA 2QZ9A 4A10A 1PJCA 3LF1A 4XGKA 3Q1LA 3KYDA 1XCBA 1ZMTA 3GH3A 1A27A 4PLFA 1PTJA 4XYMA 3FTPA 4II2A 3WWZA 3G0OA 3K73O 5JY1A 5KJFA 2G5CA 5THQA 4IJVA 3VH1A 1O6ZA 4ZRNA 1LA2A 5DBGA 2BFPA 4CM1A 3MJTA 4AJIA 4UREA 4CLOB 3H3JA 1UP6A 4L74A 3ZWBA 2EKPA 2Y99A 1B3BA 1IHYA 2UDPA 5COAA 4NU5A 4FBGA 3PJDA 3NAQA 2C54A 2AEJA 4KDFA 5EESA 1K0UA 1O0SA 3QVXA 2ZK7A 4WJZA 3I23A 3HZZA 3ONFA 4CQLB 1KY5A 2PNFA 1EBUA 3RU7A 3DO5A 1NQAO 4NG5A 3WSWA 4D44A 2DVMA 1OOEA 1TXGA 3BMNA 3IJRA 2ZKLA 4NBUA 2EHDA 4FJ0A 4NFYA 5G0SA 1ZSYA 2I3GA 1U4OA 4YJGB 5FEUA 1AHIA 1XHLA 4GGOA 4IM7A 3QIVA 5A04A 1PJQA 2IE0A 4IBOA 1P1FA 1EQUA 1N9GB 3WBFA 2HJSA 3WFIA 4CLHA 1DFHA 1PEDA 3LYLA 2Y1OA 1EVIA 2Y66A 3H9GA 4FD3A 1PL8A 3PHIA 1DIRA 1ZUD1 2NM0A 3GVXA 4W4TA 4PIVA 1IY8A 3VDRA 3K5PA 1B0AA 3G49A 3BAZA 3DZJA 1KY4A 4I1IA 4CUJA 1E7RA 3CPSA 5A9TA 4B4VA 2Y0CA 2X0JA 4I9HA 5C37A 4FS3A 4IDFA 3W6ZA 2UYYA 3OHSX 1C3VA 3NDIA 3WS7A 5U1PA 1KVRA 3I6QA 4I9NA 2WD8A 1JQBA 4YACA 3WICA 4HKTA 1DJQA 3B1FA 1B16A 1WXDA 1OMOA 4YQZA 4CM4B 1B8UA 4WLEA 1LDYA 3I6IA 3V1UA 2IODA 3DBLA 2HSDA 5L7TA 3JYPA 2X0IA 3PZBA 4YJDA 5DDIP 4C7JA 3BHMA 3GDFA 5KWEA 4HFJA 1OC2A 1OBFO 4IZIA 5BQFA 2YUTA 2ET6A 1V3UA 3DBRA 2O3QA 4TSKA 4YAIA 2PY6A 4U6SA 2AE2A 2CZCA 2GN8A 4E2XA 2WJPA 4I5FA 4BNKA 4JIGA 3CTMA 5KOIA 5HM8A 4RPKA 3ZWXA 3CIFA 3L0DA 2W4QA 3JYQA 1ZJZA 1I3MA 4O1MA 5AXDA 1ZZEA 2XXJA 3HSKA 3LZ6A 3B1JA 3DBHA 4M49A 4CM3A 3DXFA 2ZQYA 2OGUA 5TS3A 1T1RA 5HRUA 2JKVA 3OQBA 1ZKMA 2YFHA 3KYCB 2RCYA 2HK8A 4J3FA 3OFSA 2P4QA 3PZRA 4JN6B 3GUYA 3IP1A 1VKNA 3IP3A 1TB4A 4CMEC 2AXQA 2QRJA 1TVEA 2WD7A 2BKAA 1VLLA 3WDSA 1HSZA 2EV9A 4YTEA 5TJ9A 5DBFA 4RF2A 4CLRA 1UXHA 1T2FA 3FCOA 1BG6A 5HA5A 5CG2A 3DMYA 4GKBA 5TX7A 4ZJUA 1P45A 1C1DB 1T4DA 1NQTA 1RM0A 2NVWA 2P4HX 3IMFA 3RAJA 4DYDA 4Z6KA 2D8AA 1ZXLA 3LT0A 1PJTA 3WOHA 4OOFA 1TI7A 1R12A 2I9PA 5DNAA 5A5FA 3AFNA 1YB1A 1LDBA 1U3VA 5DCWA 3NDJA 4NH4A 4DQVA 3QVTA 1X7HA 3GZNB 4R68A 4CM9A 5CPFA 4BUCA 1JTVA 1HDCA 1GV1A 5H81A 3SEFA 1ISJA 4OKIA 3GHHA 2GASA 1JKJA 4IXWA 4KTVE 1DOHA 4ZN6A 4IUYA 3ORFA 3AUAA 3ZNQA 3KYDB 5IDQA 3K2EA 4U6QA 4ZQGA 3VKVA 1YJ8A 1LI4A 4IGFA 1NWHA 5IZCC 2X5OA 3ANLA 3NV9A 4RF4A 3ZW8A 4CM7A 4L0QA 1H9BA 2WE8A 4UVIA 1HXHA 4TVOA 4WCFC 4J1SA 1Q2XA 4LK3A 1N1EA 5TLSA 3HFGA 1Z7BA 4O6VA 1UAYA 2AA3A 3DL2A 1QYCA 4K26A 3WGTA 2X22A 1EUZA 3ICCA 2EW2A 4GL4A 4PLCA 3ZWMA 3AFMA 1XDWA 1ZSNA 3HN2A 1E1MA 4EUEA 5G0WA 1ZFNA 2B83A 4ZQBA 2R00C 2PH5A 3PHGA 4CR6A 5IAAA 3F5QA 3OEYA 5EIOA 3BMNB 1A7KA 1E92A 1RM3A 2DTEA 2J8ZA 4HNGA 1Z7EA 3SJ7A 4DPLA 1A7AA 2ILTA 2NVBA 2AQIA 5CFZA 1VKOA 3I5MA 5JLAA 3C85A 3GNSA 4S3MA 1F8FA 4IDGA 4Q3BA 4YAEA 1C0LA 4NJMA 5TQVA 4NPCA 2Q1UA 1T24A 2B4RO 3W6UA 1VL8A 3ONEA 4O59O 4IDBA 2ZYDA 1AHHA 4Z0PA 1P77A 4FIZA 1UXGA 2VRCA 4I08A 4MP3A 4D46A 4W82A 1DO8A 4MVJD 3I1JA 4PN3A 3GAZA 1Y9EA 1YQGA 3N58A 2Q49A 2Q46A 4NNJA 4NK5A 1PQPA 4WUVA 4FR5A 2ZYGA 4GH5A 3EZLA 3PJFA 1JU9A 3RC9A 4CMAA 2HMUA 3GK3A 1EVYA 5JO9A 2F1KA 4PRKA 4WLNA 1H6AA 1SO8A 2O2YA 4AFNA 3AUSA 4CR8A 5A9SA 1B26A 2EKLA 4GSKA 2O3TA 3F5SA 3LLSA 2JHFA 4BQRA 5L4NA 4DIOA 3OICA 5ER9A 4N54A 3QWIA 3TL2A 2WYUA 2BI7A 3DBLB 4J9UE 2AW5A 4RVGA 4U7WA 5L9AA 4MVJH 4MKZA 1GYQA 3FRJA 3QA9A 4Z9YA 1W8DA 1M75A 3H65A 1IZ9A 4Y9DA 4JQCA 2QG4A 2VOEA 6ADHA 2ZTVA 1WVGA 4QEDA 1QYXA 1KOLA 4YB8A 4YEDA 4DLAA 4G65A 1GQYA 4H7PA 3LC2O 2Q1SA 3VPHA 3Q11A 1IL0A 2AQHA 4Z0TA 1V3VA 4NJOA 1ZBQA 4FPXA 1LC0A 2HUNA 1PQUA 4OMUA 3DBHB 4N18A 4MPDA 4WLUA 1HZZA 4RJTA 4FC6A 1HF3A 4WOJA 3IC5A 4Y6SA 4XEHA 2PD6A 1DIGA 3CMCO 1KYQA 2TMGA 3D64A 2VRBA 3TQHA 2IYOA 1BRMA 3R0IA 2VTEA 4IJUA 5G4LA 1IZ0A 1W4ZA 1HDGO 1U2GA 3B1KA 3DFUA 3KBOA 3G17A 3I9MA 2GN6A 4FFPA 4PRLA 4BNMA 1UP7A 4QX6A 1PS9A 4XDYA 4OXYA 3HUDA 1E6WA 5T8KC 3PK0A 3HDHA 2AQKA 1P33A 4IZHA 5KKCA 3A4VA 4BNNA 1AUPA 1UDBA 2X9GA 3QV1A 4RPGA 2VHYA 3AY7A 1IHXA 3NTOA 3UCFA 4A2CA 5C3MA 3D3EA 5FI3A 3DMTC 1Y5RA 3K30A 4X54A 3C1AA 3ITKA 3GG9A 4E13A 2NTVA 2DLDA 1IOLA 4RZHA 3ZWNA 1X1TA 3DQPA 2CVOA 4PVDA 3AI1A 4QTZA 1M67A 1V8BA 3Q6IA 3ABIA 2AG5A 2PR2A 3WXBA 2YHUA 1Z75A 1HYGA 2O7QA 1LTHR 1NXQA 2I65A 4E12A 2ZJ0A 2P2SA 3RKUA 4R1TA 1SB9A 2PZMA 1K6IA 3QE3A 3CMMA 3GFBA 5JXWA 4JX8A 4FOOA 2GCGA 4QXMA 4ALNA 3V2UA 1ZCJA 2RHCA 1DC4A 3F1LA 1DEHA 4EEXA 1PIWA 1QRRA 2V6MA 5IG2A 5CDTA 3CE6A 1WDLA 2OL4A 3RFTA 3WMXA 4UVHA 4UVGA 5EERA 4E5KA 1SPXA 1P3DA 2Y1DA 4TRJA 1XQ1A 3OIFA 3DAFA 2PKQP 1CF2O 1GZ4A 4E5PA 2V65A 3I9JA 3JQDA 4DRYA 2YDXA 4J7UA 3TFOA 5IDWA 2D5AA 3DAPA 4BNYA 5I9LA 4LW8A 3M1LA 5G0VA 4WE3A 3ZZNA 1KEUA 4XIJA 2X0RA 4M87A 8LDHA 4PLTA 1YBVA 2NNLD 1NTOA 4WGGA 5L3ZA 1MXFA 2C5AA 2D4AA 1AGNA 2W2LA 3ZN2A 4MVJM 2JD1A 5KIAA 1SZJG 4EI2A 2VYVD 1GADO 4IMPA 1E3JA 3GVIA 4J1QA 2GGSA 2W8ZA 2X0NA 3FWNA 3P2YA 5CAEA 2YZ7A 1JKFA 3TOZA 4OKNA 3V8BA 1P1RA 4NJMB 1KVQA 1L1FA 3KXDA 5C7LO 2VUSA 3WWYA 1OC4A 1UXIA 4PG6A 1QORA 3VKUA 3WQQA 4QO7A 2YJZA 2I5PO 2B4QA 3UGKA 4BO2A 4A26A 4GI2A 4E33A 3DB2A 2FZEA 1VJ1A
chains in the Genus database with same CATH superfamily
4FKBA 4KO1S 2V0NA 4K86A 1Z07A 3PFIA 1K8XB 5FI1B 5TSDA 3GNTA 5AT1A 3K9CA 4LQDA 1CS0A 4O5OA 3TLGB 3PA8A 3PDWA 4F6LA 5KNDD 1IVNA 2NT3A 2GM4A 5CYOA 2D3TA 5IMSA 5B7QA 5EZYA 5JCXA 3T4EA 4WKCA 1NN3A 1U2TA 5ED4A 1KDYA 3B8EA 2VZ9A 4K9SA 1E5LA 3QU7A 1HDXA 4Z3DA 1SG6A 3AFHA 5ALKA 5HUQA 4HNSA 5TR9A 3G1TA 3QWBA 3DVQX 1NQXA 1GEEA 1E6EA 2DQYA 4NV1A 4BUJA 4ZWNA 4W9MC 2J32A 3DPUA 5DISB 3K4PA 5B1IA 5CDFA 2D1YA 4LRUA 4MOWA 4S35A 3NIFB 5DYWA 3UMGA 4JUFA 3ZDZB 4YCMA 3F78A 4ETMA 4UZFA 4DLBA 4V2UA 1OILA 4EW2A 1MO6A 1FJXA 1YZNA 1AIPA 2BGTA 3IXMA 1EP9A 2BMWA 3ONNA 5MFPA 4DB4A 3ZLBA 1QO0A 5C9ZA 1NPTO 2AOWA 5DYIA 4AYTA 2QRLA 4XWWA 4R2WA 1XTUA 3MJ4A 4Z2YA 3DTNA 1NMZA 4LHZA 1NUSA 1PYOA 2GJ4A 1I2MA 2Q2NA 4ECAA 3GUHA 5AKKA 4NOMA 3AVVA 3I37X 1U5AA 2R3SA 4GOND 4LWPA 2R97A 1T3GA 3EH2A 2FNAA 2FR8C 2L82A 2VUUA 2HY7A 2JGJA 2XBLA 3LPAA 3PGVA 5K8LA 3R8FA 3DVAA 4TWBA 1A8PA 3LG2A 4IKOA 1J6UA 2J5KA 1H8ED 1I4WA 1RJFA 1TZJA 1NASA 2YDYA 3SLGA 1Q6YA 1GZDA 2PL9A 4OHFA 2G0TA 3LFTA 2JJ2A 4MIOA 1H0SA 4R71A 3K70D 3PNOA 1P1JA 4L95C 4RLFA 3VTAA 4B4KA 2IYQA 2FZKA 3KXLA 3RAFC 2QROA 1YRWA 3HU5A 1U2ZA 1S2OA 3B20A 1X0XA 1V3QE 2A84A 1AB6A 3OJLA 1SVWA 2FR1A 1SXGA 4GXTA 1DO2A 4Y1EA 4COOA 1XRJA 2ERXA 2ZRPA 1BJRE 1NL3A 5FPPA 2DFTA 1B73A 4DMKA 3GXOA 4WI1A 5IT4A 1F6DA 4L78A 5E6RB 1T5OA 1MABB 1MNQA 3KKKA 1A9TA 4KVZA 4IVNA 1PGPA 5CU7A 3EPLA 3UO8B 3JD3A 4YCAA 2GA8A 4MV3A 4TZKA 4CU2A 5LYYA 1KL7A 2Y8EA 2IZ5A 1DINA 3CRVA 4BMCA 2WV9A 3WLTA 5BMVF 1U0FA 4Z3OA 3KTFA 2ZIXB 4JVLA 2GZRA 4C7OA 4IIJF 3W8FA 3AUJB 6NULA 2C58A 3FTFA 4GLJA 4G5OA 1IB6A 4H7EA 1ZL2A 3FIJA 4PLWA 5SYMA 1VFPA 5E4FA 1XRSB 1AV6A 3T4UA 4PE5B 3SSNA 2RBEA 3MN1A 5E7JA 2OFXA 1CB7A 1OI3A 3IIIA 3CZ9A 1PZEA 2G1PA 2WHPA 1M6VB 2HWYA 2I8AA 5LQUA 2O8DA 2B8JA 5KNDA 3Q8KA 1Z37A 3JYLA 2Y05A 5FOVA 4C2BA 2FF7A 1H85A 4UU7A 1XA0A 1PGJA 2F00A 2PRIA 4E94A 5B1DA 3AKZA 4CMBA 2EU8A 4LDNA 1I80A 3DWEX 3OURA 5T4BA 5BN3B 2BN4A 3ZWQA 2OFWA 3TB6A 4HJRA 1NXVA 1EX7A 2OCLA 4Q00A 2G8NA 1IM8A 1LXCA 1N2CB 4BASA 2ZTUA 4PLPA 1SIWA 4LRQA 3EOAI 2GVNA 3Q9SA 3JQ9C 4K46A 4KODA 4DOMA 3EUWA 1G8SA 1YAHA 5CEFA 1VSVA 4DR4B 3QBVA 4QREA 2JJ1D 1JDNA 4I4IA 1CUHA 4E21A 1GCGA 3HLKA 4J4BA 3WK9A 4Y2XA 6Q21A 2XBMA 4CN9A 4J0QA 3TCNA 1S3FA 4GICA 4F5ZA 1J49A 1UOEA 4UZEA 3Q7SA 3RUHA 1NVDA 2Y1FA 1I2DA 1P4JA 1JDVA 3A6KA 3C5WP 3LPCA 3QX8A 5DGCA 5JDCC 4J0IA 1L5GB 4CL3A 2QAGC 4RVOA 1YUMA 2ZIFA 2A9QA 4XOIA 4YGXB 5FA8A 3IUBA 1WP9A 4G2NA 1JR4A 1K5PA 1Y8RA 4LHVA 1RP1A 2WPDA 4PLYA 2B1IA 2BKEA 3PEVA 4B33A 1AURA 5D3ZA 5CFOA 1A71A 1EWVA 1H65A 1YE8A 3TSAA 1V1MB 2AW3A 3VDNB 4WBNF 5IWCA 1DPGA 1SOVA 1PYDA 4XX1A 1VHJA 4HYEA 3GCDA 1GRRA 4KGZA 5DHAA 1NW6A 1FDIA 2VAXA 2GA9A 4BLPA 1I24A 1ZESA 1ZCZA 3EE6A 5GY7A 3QKSA 2NU7A 3RVDA 1XCPA 3MJCA 2XWJI 2WQ6A 4LXIA 2VHTA 3ZWDA 4YASA 1WP4A 2NXCA 3GH1A 4B9EA 1BHSA 4MUJA 4ZI5A 5AVSA 3QA3E 2WWGA 5JALA 2IQ5A 4O0LA 1FX0A 5G0TA 3EXIB 3FCCA 4LA4A 4EGSA 3R9XA 3NAZA 4FOSA 3AIKA 1W85B 4Y2HA 4BFZA 4R4JA 4EB6B 4FXOA 1NXWA 2Q6IA 4FIDA 3DOJA 4H08A 2ZR0A 3QBTA 1WLSA 4LXXA 4HWKA 3V1LA 2H9AA 4BRZA 2GM5A 1GILA 3IPLA 1NX9A 2ZS8A 5CH5A 5KX5F 4RKYA 2WHEA 4Y1GA 4KTTE 2QS9A 1AHNA 4L8YA 3OBIA 1EXDA 3CPEA 4FFWA 2O5RA 2ZJ4A 2VN8A 1FU7A 1P2BA 2QJRA 2ZI3A 1JHMA 3KYBA 4FBLA 4UCXA 4CMEA 4D9IA 2VDKB 3ZGVA 4IXMA 1P5JA 3HY6A 1EK1A 1SBYA 3OJOA 2FPWA 3WE7A 3E9MA 2N9UA 2IH4A 5FV4A 1PD0A 2HCTA 1P9WA 1GUZA 2OV8A 2RGUA 3NX4A 2VWGA 4Y0NA 3BMCB 1WG8A 1KDZA 4PLZA 1M2OB 2AEEA 2W2VA 4YRSA 3G1UA 3KR0A 2UUOA 4L4UA 3TNDA 3IAS1 1FYDA 1U99A 2Q2VA 3PC6A 4BU0A 4MINA 1R6TA 2CXQA 4ND4A 2VDVE 3KT6A 4HNRA 2IUFA 5AHKA 3DS8A 1B3RA 5F64A 1VLJA 1NG9A 4IDHA 4GMDA 4FT4A 4L9AA 4EGFA 4RUKA 1QFXA 1P9RA 2VQDA 3UA3A 3LCCA 1EFVB 4KQKA 2XIJA 4J07A 3SC2A 1VE6A 1AE1A 2JFFA 1RBYA 4QE3A 3SKVA 3L7DA 2Y1WA 4TL8A 3S27A 5CNJA 4YCCA 1NIJA 4MVJE 4PYOA 4JJFA 4YMLA 2WZDA 3OM8A 2GZ1A 2HIAA 4QPZA 2P6PA 2JFOA 4RZ3A 4BTLA 4EGCB 3MPUA 4NHEA 2ZS7A 5I9IA 3P0FA 3WLMA 1QVZA 4QOIA 2DGDA 3D4NA 1O87A 1KYVA 1V5IA 1ZGAA 3GUCA 4CV3A 1HT3A 2OGWA 3A04A 4OJTA 3BSSA 1JPJA 3LO8A 2XWSA 3ZHUA 1C41A 1N8NA 4BDSA 1ULUA 5I4CA 3WQSB 4JUCA 2GSDA 2L19A 1JHUA 2XF2A 4L0DA 2AGVA 4XGQA 2JJ8A 5IKXA 4YMUA 4PQRA 2NUTA 5GJVC 2QOEA 4AL4A 1G5QA 5IZCA 1XEFA 4M55A 1ZK4A 4NCKA 4PRYA 4GBGA 5B37A 4RSMA 2WFLA 4ENUA 3LW8A 2YJ4A 4ZYYA 5A5DA 1LLFA 1T15A 2O0LA 2C2YA 1K6XA 2GXUA 3LUJA 1A7JA 5ESWA 1O57A 5G2OA 3WOVA 2JIDA 3M6MD 2FK7A 2RHLA 5LU8A 2HGZA 1XL0A 2Z1DA 3W77A 5JZOA 4IEFB 3ONDA 1S8NA 3CVVA 2Y3IA 4ARIA 2GUWA 1YJAA 4R7ZA 5CVUA 2CNDA 2OBMA 2IRWA 3NRBA 4K81B 4U7PB 3VPGA 2GPSA 3VTZA 4YI5A 3F6PA 5IYZB 2VKQA 1KDRA 4L4SA 1TYBE 4UDNA 4ESHA 3H75A 1ATZA 4XIYA 5AKXA 1UZMA 2JL1A 5IJZA 1YC2A 4RE5A 2NLOA 3WDKA 5IASA 2IYSA 4AF7A 2YHAA 5K0GA 3ZVRA 4MV6A 1T8PA 3P9IA 3JQ7A 5CCEA 3L0IB 4KWEA 5GZ1A 5CTAA 2C59A 1M34E 3E5NA 1KSFX 1ULHA 2QVZX 3UAGA 1M1NA 1VSTA 4B83A 1YK0A 4C06A 3TLZA 4BXOB 2Q0HA 5EZQA 2H9IA 4KYVA 2RGRA 1GPBA 2BR3A 5IJ0A 2WILA 3AF5A 4EY4A 2FJUA 1XN1A 4K6CA 4BQEA 4NZYA 4MV1A 3TQRA 2PMFA 1Z7YA 2YHIA 7REQB 5GTDA 3RNLA 4HEA6 4QBTA 4EITA 3MCTA 3CUYA 1A9ZA 1R9NA 2F3SA 2R62A 3CKKA 4JGGA 1LK7A 1ZP6A 1QKIA 4L15A 5J2UA 2G5GX 1DC8A 2JATA 2ZATA 3JATA 4U8GA 2BJWA 4X1OA 2OYRA 3RABA 4MKIA 4ZTUB 2X7JA 1CE8A 4ZZ2A 4C0HA 5ABPA 5T6MA 1CUUA 2O7SA 1N2GA 2XUFA 2YZ2A 4YAWA 2BMDA 2XNHA 3RTEA 1OUMA 3ZNNA 1KPGA 1T3LA 3PDIA 1OHHD 2GDZA 2F8SA 3LA6A 1P6XA 4RIGA 1BN6A 1NVAA 4DM3A 1R00A 5J47A 3BIOA 4C03A 5LZ9A 2WSSD 4H27A 4Z3KA 5L3SB 2CCJA 4R8MA 3TEMA 2UU9B 3AL0C 1Z4QA 1LLCA 1GCIA 1V11A 3ET5A 1SRRA 4LJ5A 1E2JA 3BA1A 1L4LA 1U3WA 4JL8A 2JAWA 1RWPA 5JD3A 1T2CA 3K0KA 3UAWA 5IVPA 3CU5A 3I1YA 3TVDA 5BQ3A 5LQMA 2Z6VA 1UFQA 5HJ5A 3PE3A 3R0QA 5H3HA 5H82A 1EWQA 1DFGA 3U0BA 4LJ7A 2DSTA 1UM8A 4GPAA 2Y68A 2OFFA 4MWDA 3C0KA 1KSJA 2QMHA 3KU1A 1KQPA 4HWSA 3TZEA 4ALJA 1U0NA 3F49S 3IBCA 1ORVA 1PS0A 3FROA 4X66B 4BKPA 4RA9A 5AHRA 4D4IA 3A05A 1P2UA 4Y0VA 1LJ8A 1U7XA 1X7WB 5JT1A 3SXJA 4D8XA 1UQRA 4C07A 5ICGA 1XPRA 4JLMA 4EWLA 2AKAB 3CCCA 3G2OA 1ZVJA 1D5WA 2OQ2A 3ESZA 3I52A 4EF5A 3BILA 2OFOA 3GLRA 3G2IA 5BVHA 5TEVA 2JBAB 4NJEA 4D4KA 4HH1A 3NMUF 5CW2A 7MHTA 1YE3A 1VTKA 1ZO8A 4U5XA 2C4MA 3N6RA 4US2R 2BGLA 2F48A 3IKMB 3KWJA 3ZU3A 1X74A 1R0ZA 3PQ6A 3KVYA 4I14A 2QTMA 4OVKA 5JSZA 1B6RA 4PO1A 3V3TA 3CEPB 3OFJA 1ULZA 3ZEIA 4DLPA 5FFMA 4PGFA 2V1UA 2JH3A 3OLVA 3UFXB 5A3RA 4IWYA 1V35A 4Y1RA 3NBYC 4KAJA 4Q4CA 2VO1A 3GEMA 1UFRA 4HQNA 3KHSA 2PXAA 4FU0A 1QF9A 1Y3AA 5JQWA 3BF7A 3QKRA 3D7RA 2M1ZA 4G4GA 3VYWA 2CMGA 1QWOA 5IHPA 4BNXA 1MH1A 3GMDA 1J2RA 1GQQA 4CLDA 4DMRA 1LNZA 2WYWA 4EEZA 3GPBA 2ES4A 1R0BA 1W9HA 2O2EA 4G8BA 5CA1A 5I9BA 1WSWA 4UASA 3IUNA 3DMTA 5AHWA 1IAVA 3ITNA 2FU5C 5C4IA 3JQQA 3DP9A 1XQ6A 4DIDA 3VO8A 1CVLA 1TZ2A 3AFIA 3GLHB 4AJJA 4TV9B 4WH0A 2DTXA 1Y6RA 2E4WA 2QR3A 1NDHA 5AW0A 4B8YA 5I47A 1E3LA 1NVKA 5DXJA 2B82A 1KI7A 1CZHA 1Y63A 4J7AA 4XW2A 3NOOA 1QLJA 1HFJA 2HUPA 4W99A 5LLSA 4DIUA 5KHLB 4HSGA 5AVOA 1WMSA 1RRKA 3HM2A 4U9HS 1TA9A 4MWEA 1M8JA 1YZKA 3FAKA 2JEZA 1GZ6A 3PFBA 2ZJFA 3W05A 4QXQA 3F97A 4M0MA 5JDIC 3BXOA 5CNKA 1LLDA 2B7CA 3W9SA 2IHKA 4BNUA 2QRHA 4DMMA 1L7RA 4HDSB 4UNPA 4GXRA 2A94A 2PJUA 5B3LA 3LQYA 3ZWYA 1FFDA 2IH5A 2P4UA 1R0LA 1U90A 1VL6A 5B36A 1YJBA 1L5WA 1YOVB 2CNLA 3IUQA 2HIGA 4BMVA 1HMYA 3AR4A 1ZH8A 3D8HA 4MZDA 5E1DA 1RQRA 2C9OA 5ED0A 1JSLA 1GLNA 5JSYA 3TM4A 3NHUA 4RMGA 1UH5A 2J08A 1MO2A 4QUAA 4WZAA 5BWMA 3DZHA 2HRRA 4R6WA 2R86A 2ZRMA 1F8XA 3RHFA 1CJKC 2A9KA 1RYYA 2LDXA 2PMKA 3MMXA 1AV7A 1AZTA 5L45A 1UPTA 4KE8A 1A76A 1Y1LA 1T6NA 5DMXA 4RENA 1TD1A 3EA4A 4QUBA 1E58A 1UMCA 1H2HA 1TIKA 5F35A 3BIWA 3ROTA 3E9QA 1EG7A 9LDTA 3QSYA 1FMJA 3KPVA 1RC1A 3GJ8A 2IEBA 1OXXK 1L7QA 3L4BC 5HKLA 2EX1A 1QPZA 3CT4A 1VLMA 3UGQA 5C80A 5FWNA 1DC3A 2ONYA 4BNDB 2AYXA 4WKOA 3BBLA 3JRXA 2VH5R 2XVAA 1PT5A 4YT5A 1AMUA 1KZ9A 4AJOA 1VPTA 4ARUA 4OHUA 3EIQA 2WW8A 1GR1A 2I67A 2R7KA 1OGYA 1PJ4A 1EUDA 2PD3A 4TKZA 4RVUA 2FPUA 5F1PA 1IUKA 1JTEA 1M10A 1U8EA 4GI5A 1JI0A 1NT2A 1RLUA 1UPBA 3PR1A 4MR9A 3I92A 3HVKA 1H4QA 4B0OA 3FI0A 1ODIA 2RGBA 1X7YB 9MHTA 3GEDA 1HETA 4PZZA 2X8AA 4FX2A 2CEKA 4FYIA 2BDUA 2V0GA 1MLDA 3FWKA 1W0KA 1RM5A 3EASA 2H17A 3JSAA 3ZNPA 3C6YA 5FA5A 3RVNA 2AX4A 3UMRA 2H5LA 1HQCA 3H7AA 4YUXA 1YZGA 4G97A 4EG8A 1UKEA 2VNJA 1Y5LA 2W6CX 1E2NA 3LDGA 3DHWC 2REBA 4MVJP 3C70A 1RYEA 4HX9A 4XB2A 4AKSA 1ZAYA 1YK1A 4HAOA 4OEHA 1YB7A 4LJYA 4DBLE 4Y3UA 3MUFA 1A04A 2VZ8A 3JU3A 1ZOSA 1FRZA 5F4BA 2Y6VA 2CNNA 2MSEB 2X5KO 4EMSA 5REQA 1W0CA 4OXNA 4CGYA 3MILA 2WWFA 2I2XB 3IEUA 1JVSA 3ZTWA 3NYIA 1OT3A 5HKKD 4CCYB 2ZTSA 3L43A 4L73A 2BCJQ 1E3TA 4KDCA 4NE2A 4Z0HO 4BMYA 4ZHQB 1PYGA 2WF9A 1YCHA 4D0NA 1X2EA 2RH9B 4DS3A 5D86A 1LF0A 3TNJA 3DKKA 1WDKA 3NHSA 1ENYA 3GO4A 2R1VB 4ZO8A 3H2BA 1E5XA 2PAAA 4EO4A 3JY6A 3IOCA 3GEGA 3KE8A 2E4YA 4L28A 1LNSA 3Q3VA 3EQ6A 4Z1OA 1HLPA 5DYNA 1Z5NA 2NU6A 1Y1RA 2G4CA 3OM9A 5E95A 4B4OA 4H7JA 3SM9A 2GN1A 4DM4A 3QOXA 1ZN2A 2ROQA 1U9ZA 1NI3A 2HIMA 2P40A 3JQFA 4ZJPA 4LF9B 4EMTA 3ZUPA 1KQGA 4JOCA 3PNBA 5I9TA 1QH1B 4JEUA 3VZDA 1WXWA 2EEZA 2GHRA 1VJ5A 4QDTA 4YREA 5BWOA 2HNBA 2HGSA 3FYUC 1GQOA 4MPTA 3OPNA 1Q1ZA 3G8YA 1XD2A 3CFYA 1U98A 4C3ZA 2OBXA 1ORIA 1CVIA 2ZLBA 3HKDB 1I2BA 1GNVA 4FGKA 2FHSA 2J7PA 3ICWA 1E63A 2ID4A 2QRVA 3OG9A 4BTEA 1GGNA 3BX1A 1QOQB 2CF5A 5BSGA 221PA 1P1HA 1PSDA 4UE2A 5IW8A 3SC3A 2BKUA 1MOZA 1R4NB 5C5EA 5G40A 2O1SA 1U8CB 1TTHA 2DHRA 2ZB7A 3O73A 1K5GA 2XZPA 3CJRA 2QYTA 3OTIA 1DKRA 2Q5HA 4XGIA 3LBAA 1YR2A 2VK1A 2WEKA 4JZKA 3DDCA 1L6RA 2J3JA 4QQRA 2QP3A 3MLAA 1IWPB 2P6NA 5J5CA 4TYWA 1FMLA 3SZMA 3SNHA 4BCCA 3BGWA 2PRSA 4PC7A 1WABA 1BW9A 2FH5B 3JYNA 4LIPD 1XR3A 4PG7A 10MHA 4WLOA 4B2YA 1DWQA 1ZGZA 2C2HA 3D6HA 1T5DX 2P3OA 5D87A 4O3MA 1PQWA 1Q1GA 1ONNA 1NU8A 1JBKA 4ZQHA 3H8SA 2VFAA 2JGMA 1UM9B 3HDTA 4RFSA 1ML3A 3K1AB 2WTNA 4JWKA 3NM5A 2EZ9A 3QK7A 1VECA 3E1GA 3N8DA 2IV2X 1QP8A 1SVIA 2O0KA 4N65A 3SZUA 2CLEB 4L02A 1FS5A 4NCHA 5JSHA 1WX1A 1MOSA 4WN9B 3PQFA 3WHIA 2MIIA 2QRMA 1ZH4A 4M1WA 2C8LA 1J09A 4FFBB 1GKUB 2IS2A 5C8YB 2IZ7A 2UZ3A 3FIUA 1VPVA 2WLSA 2ZIVB 1LQTA 2BR5A 3FMGA 3MS2A 5ANRB 1YRYE 2EVWX 2FPGA 2FFHA 2RI6A 3LCVB 4MKFA 4OJNA 4RK1A 3UK0A 4C5BA 4ND8B 1MJ5A 4CKBA 1GYRA 3PC3A 3HADA 3EPPA 3G7NA 4C4PA 3PWSA 2XQKA 3UJ8A 1UJ5A 1TECE 1J2UA 1KVSA 2QY9A 1TT7A 3LKDA 4I3FA 4EAAA 2ZJ8A 4NYJR 4ZZ1A 4FMBB 3COPA 1X13A 1YXMA 4MVJF 5T64A 1OLXA 4X41A 1DAOA 1DB3A 3MQ2A 1CW2B 4XRRA 4IQ0A 2PL5A 3X1YA 1OZAA 4XQGA 4PQYA 5AM0A 1E1NA 1ZUNB 2FX3A 2O7NA 2Q45A 5JAQA 5TS2A 3LA8A 1PV4A 2FWNA 2JFPA 1HFWA 2EIXA 3ZY4A 1AKEA 2D74A 4B6RA 4GSYA 2R8RA 2AR9A 2C7GA 3RAEC 4D42A 3PXEA 2LWIA 1PJSA 2CNOA 2O6LA 3AHCA 3EGVA 5E6UA 2QMEA 3D6NB 4LFAB 1A4XA 1FP6A 1INLA 4Y9SA 4CIBA 1Z38A 1LDMA 3F46A 4E30A 3UCEA 2ZE5A 4GYWA 1Q3TA 4KQFA 4F9EA 5A9RA 3K0SA 1GGFA 3UTDA 1GU1A 3G0BA 1Z56C 4GG1A 3C4QA 4LOKA 4F3NA 4BPBA 3S5JA 4GC5A 3PP8A 4X84A 1RQLA 2PH1A 3HB1A 2G3YA 2OKCA 4KNVA 4R3WA 1OXSC 1HC7A 1V6AA 2PT5A 4G8JA 4EFLA 3K6SA 2A59A 1SC9A 3BCHA 3JAWA 3M3HA 3OLQA 4P82A 4REQB 5TGDA 3T5TA 2XF8A 4GBJA 4ZT5A 3DUWA 8AT1A 3OQMA 2BSAA 3MCVA 4Q4LA 4YMSA 1BX3A 4JI0B 3I6MA 4A0QA 1BFDA 2G04A 3EXHB 3NT4A 4B8WA 4GGMX 2GCPA 1N9GA 4DLZA 2JS7A 1OASA 1V7PC 1WHTB 3IA7A 3F3YA 2VHEA 4OFWA 5J2TF 1NVMB 3IUJA 1QV7A 3BK2A 4A6EA 4DLLA 2NG1A 3OFKA 3RBZA 4EBFA 1ZNWA 2GPTA 2WSMA 1BVUA 2O7RA 3K96A 1DWPA 1JT9A 3RBXA 4V0RA 3AOEA 2DMRA 2PFSA 4RGYA 1IPEA 2WWVD 4YCLA 2HREA 2C5FA 1G2IA 3QF7A 4W1SA 1YO6A 2X3YA 5ISMA 2G88A 1IPFA 3BXZA 4MV4A 4DIEA 4LJRA 3I2IA 1T8UA 2NTNA 4GPIB 1FS6A 3TE7A 4IMRA 4Z53A 2C20A 4ID3A 5CIQA 1RXUA 4BQPA 3KB1A 1E1LA 4EJ0A 4FMDB 3TRIA 2BTQA 1D1SA 4YH1A 3T99A 4GRAA 3ISJA 4ZYZA 1UP4A 2NZXA 1P7YA 2X6RA 3U48A 2P9QA 3WQHA 2AZTA 3EGIA 5B64A 4QTXA 3NFRA 4K6KA 3HWWA 5KYGA 3UAZA 5J4LA 4YCBA 3CR3C 1IQUA 4DR6B 4BYGA 3OT4A 5LM3A 3KFXA 1U0RA 5BW6B 4FOTA 4C7MA 3CCFA 5HJEA 3JQ8B 3LRPA 2XDQB 4X6LA 5KKNB 2TS1A 2QF7A 4RDIA 1V6SA 2V6BA 4S1TA 3FYDA 4X1YB 5EPOA 2BCGY 2YZMA 4ENTA 7GPBA 3L9WA 3LT4A 2ZPAA 2B7BA 2JLCA 4PG8A 4JS0A 1ISHA 4CI9A 3G68A 1GTZA 1TEVA 3DLAA 4LV5B 1S8FA 3NTRA 2DFVA 4ZIRB 3DZDA 5A62A 1QRAA 1PR2A 3LFHA 5EC8A 4YV1A 4Q1CA 2WSLA 2ANCA 4NIMA 2R47A 3MT8A 1NMEA 3NTUA 4WASA 3KSDO 2EGHA 1QCCA 4PBSA 4AUMA 3ZE7A 4J29A 4H60A 2VAVA 2C2MA 3KZNA 1HWYA 4DR3B 2GYVA 3E1KA 3HBFA 1S2LA 4GM1A 1SQ5A 3WLOA 4EJFA 4AI6A 4AQ7A 2REQA 4PZ9A 1G7TA 1GPNA 1K98A 3GGGA 3L5OA 3ZVMA 2JLBA 4TUYB 5CDYA 2XNDD 4X64B 3ESXA 1JIXA 2MSKA 3OMXA 4WESB 3I62A 3SJCA 4A7PA 4IXDA 1XMPA 1TEZA 4CEHB 3OF2A 4EUNA 1HE3A 1WPGA 2E9SA 2OD2A 2WJAA 2ORED 4OPMA 5DNEA 3RI3A 1Z8FA 4F6RB 2GBPA 1O95A 5U9CA 1SXPA 2MSWA 4HDRA 2W4MA 1I01A 1S2GA 1SXJB 1GDDA 2IS6A 2CZGA 2C2XA 1VJTA 2P9ZA 2IWRA 5A03A 1VBFA 4RA6B 4MW7A 5BQPA 1HA3A 3M81A 3ORHA 4I1YA 4NI5A 1RI3A 2XUJA 2HBZA 4B6SA 1J0BA 3LUHA 1P74A 2C2BA 3NEYA 1NHWA 1UPXA 3GA5A 4FK8A 4MP6A 2PD4A 2A7QA 5EE9A 3RVPA 4C2TA 4Q47A 4U9IS 3HQ4O 3PNSA 4RTMA 3KSUA 4FONA 3WJ2A 1KMIY 3L6BA 1UBRS 1BE0A 3GIWA 1IOVA 2OECA 4L2IB 3C6XA 1T9ZA 3OIGA 5EKSA 3LY5A 3U3ZA 4CTMA 3L6DA 1HEYA 4P9NA 5LPNA 1YJXA 3OP4A 3C6KA 1BYIA 3KQTA 3QSGA 1SA0A 5C1IA 4BTVA 2X40A 3AOGA 4XKJA 3SAJA 4CU5A 5ES4B 2XYRA 5JAMA 3OLYA 1Z17A 4LKRA 3BKWA 1Z3CA 3K0FA 4AJ1A 3CW9A 3O38A 3UATA 5LJLA 4YP7A 5L7WA 2SICE 3K8ZA 3CEAA 1LBHA 1U3GA 2GEBA 1JAZA 4BCDA 1YAJA 4EH1A 5ILOA 4ID9A 1IBCA 2WWYA 1EUYA 1E62A 3UJNA 1IWOA 3Q15C 2Z04A 5ES3A 4WXPA 3RGGA 4D9HA 2O5CA 4PFKA 1TUBB 2FA9A 2N0SA 2BI8A 5IHXA 1SUDA 1DV1A 4MIKA 1QONA 1ZK3A 2V6FA 3COZA 1I51A 3E2IA 4HN2A 2OORA 1B8OA 3H0EA 2BMEA 2EKQA 1OIXA 3TUIC 4F9GA 1VJ0A 2BV3A 4PTYA 2FAXA 4S04A 3C3CA 4H18A 3FPAA 1NNI1 4KWCA 4EG3A 1MTOA 3FSGA 2CXOA 2MU1A 2VTVA 1AKNA 1QBKC 3TM5A 5EIHA 1DIBA 4A6DA 4BNVA 1JJVA 3P9XA 4UAGA 5CP8A 2VRWA 1M73E 1E1RA 2JLSA 1H6BA 3BIFA 3ED1A 1Y3FE 3GBSA 4LJ4A 4K1LA 1N57A 1SH7A 4EI9A 2QJWA 2QQ0A 1DWOA 3HDQA 3L01A 4PGGA 5DP2A 3WMEA 1OAAA 1M74A 1TYCA 2V58A 3C5HA 2HA2A 1W30A 3CUEF 4Z9FA 2OQRA 4YCDA 4BP3A 1AZWA 1NDQA 4TV8B 2YFYA 5JH7A 2VYNA 4RZUA 1NPYA 3K3PA 4AWAA 1F3OA 5CITA 2G77B 4AN4A 1W6UA 4OKSA 3SC4A 2VOJA 3KKMA 1FYVA 3FDFA 3IPYA 4MULA 4O4JF 3KLPX 5IKMA 1NNEA 4Y0AA 5A1JA 2XVZA 3AR9A 3IBTA 3K94A 4JLNA 1DQPA 1J9EA 2XE8A 4RPIA 1P1IA 5AOAA 4YAOA 3ZHTA 4DJAA 4HQRA 5D1NA 2V7UA 4X8HA 1IZ8A 3JD2A 4PYQA 3T9CA 3LC1O 4YRNA 2DZDA 2CBZA 1G4AE 2C57A 3LTNC 2C0PA 1CUVA 1K4MA 2CNWD 2JJYA 5BN4B 1TM7E 3CB2A 3Q9NA 3EF1A 2OLJA 3QOYA 4O1HA 2GHIA 4XLZA 1E9RA 4MRSA 1QFYA 3WYBA 5JRJA 1RD4A 3F7MA 3PTZA 4KHZA 4DWWA 5LZ4A 4FGWA 1T1JA 3ON5A 4ALMA 5D5QA 3VR2A 4YQFA 1CQWA 1KMHA 2Q2QA 2RHMA 3A14A 5E3HA 1VMDA 2J0SA 3RYCA 5IT9A 3IP7A 5TVGA 4CNBA 1PG5A 1UBUS 1UQTA 2OOKA 2P9EA 4NKRA 4YDQA 2QG6A 2NU8A 1F4LA 2UUCB 4U2KA 1K0FA 5JOQA 5J4VA 3QUSA 4D9MA 4R1NA 3UV3A 3U4DA 3AG5A 4HQ0A 5EGSA 4ESOA 4ZYWA 1C50A 1QHSA 2EBHX 3WWPA 1V9LA 3AEQB 1RRVA 3WJAA 4TKVA 3DAOA 3EXAA 2NO7A 2I7VA 4OYYA 3UJDA 4NCIA 4AJ9A 5B7PA 3JQBC 4BWYA 4DLNA 1SXIA 1ADBA 4BGEA 4FILA 2UZ1A 1WMAA 1ISGA 5D3MA 2VAPA 4L85A 2ZSDA 3JQAA 4Q3OA 4RFLA 1KEKA 1JWAB 5CX1A 1UJBA 3QNWA 3FNQA 5ALNA 5A4MS 1E5QA 1PJRA 1LW6E 3LQ4A 1QRDA 4N9WA 1XNQB 3KZ1E 5M3BA 1VMAA 2CLLB 4YRAA 3FHLA 2FTKE 2Q1YA 4WX2B 4JB8A 2F8TA 1O58A 1U8FO 1QAQA 1O08A 2BF4A 2LP4Y 2VQ6A 4I1RA 4TKMA 4MQMA 4X00A 3VU0A 4FLEA 1RWVA 1Z73A 4JQSA 3UUFA 2C1EA 1VI2A 1UKVY 1RZRA 1Q16A 2YV1A 1FQJA 3WIOA 1L3IA 2CVPA 2ZSBA 3IE2A 3LX5A 4IJ6A 3P5SA 3HS3A 1RJWA 4EMBA 5CFPA 2QBYA 4I4NA 3MRXA 4AD8A 2IHUA 1YTUA 4LX0A 1ZITA 4XQ9A 5D5HA 4D4HA 3I2GA 3FLAA 2GZDA 1Z7GA 1RFGE 2QRKA 1PK9A 3SYTA 4C0XA 4D97A 4UFPA 4WKNA 2W2QA 1Z25A 4W8OA 4FR2A 5K4GA 2HHHB 3S1AA 4BFWA 1KKLA 2DT5A 2J5QA 3GFPA 1I7PA 2C99A 2EXXA 2I7XA 3DSRA 4NICA 4XOUA 5DT9A 4A8TA 3JWEA 1WR8A 2OY0A 4DNQA 3ZJUA 2JIMA 2Q3HA 2Q6TA 4HX5A 2LDBA 5EL0A 5EP4A 2AFHA 4G5SA 4OBWA 3BTVA 1I7LA 1XRMA 3MOGA 4P34A 5CX4A 3R5SA 3U5TA 1Y7TA 2F1IA 1NFRA 2GH1A 3AKYA 4PAMA 1GUDA 1BJTA 1CQJB 3LNCA 3OTGA 1W2WB 3GWZA 3WGTA 1UK6A 3GLSA 4YJ2F 4A8JC 1WHSB 2Z2KA 4UXJA 3PIDA 1ETHA 3CW2A 5A71A 4OL9A 3OTQA 1RAFA 2BEUB 5IP5A 5CDFE 1WU8A 3RJZA 4OU5A 1JHVA 1QO7A 2AEMA 2QK4A 3WP0A 2ODWA 3NEPX 1QIGA 3BRCA 3ETHA 3F6RA 5GZ3A 9ABPA 4MUIA 1DELA 4LC9A 3GLFB 2J6HA 3D7KA 4I46A 1X80B 2WM2A 1Y82A 2PZ8A 1MJHA 3DFKA 3QITA 3J81A 3TQCA 4BBAA 1VZ3A 2ZYUX 1Z3IX 3IBFA 4GLBA 4I55F 4K8RB 4UNSA 4YROA 5DW3A 5EHGA 3T9BA 2HSGA 3TLAA 1IZZA 2B0JA 2EJVA 4GOOD 4MS3B 4QGFA 2FDCA 5ITVA 3L77A 4CCWA 4F93B 4RKWA 3VPXA 4FJ1A 3NOXA 1XEXA 2CDBA 1YQDA 1VMIA 2XH8A 2X2FA 4PAGA 2H00A 1EP3B 2C2GA 1EFKA 1JP7A 2IITA 3D8SA 1AUQA 4LMAA 4WA8A 1JFLA 3L8GA 3K5HA 1QRTA 3FVWA 2AS0A 3AJEA 4GXNA 4CMCA 3WGGA 1VPDA 1Z6XA 3VHXB 4CDGA 1B41A 2LBPA 3TBKA 5IFLA 3OI7A 3UMBA 3GT3A 3P7MA 1HORA 5BURA 1T2VA 4NEGA 3HVJA 4OLFA 4IV5A 4YN3A 4AMBA 4DDUA 1B8PA 5CVTA 1OH6A 4CKEB 4I0WB 1H2WA 1XYVA 2GRAA 2PH3A 4LDRA 5AWFC 4ADSG 1WV0A 1BTOA 1CLUA 3BK7A 3HY3A 1AD2A 2PGAA 1Y1PA 1TMYA 5HE8A 3T7CA 3TIGA 1UKYA 1E2UA 2W6QA 4OCZA 1E4EB 3DG9A 3CJTA 5M2QA 4BP8A 2YV2A 5HWSA 3PI7A 4XD7D 1Q1EA 3H04A 3PC4A 5KJEA 4ASUD 2VUTA 4UHBA 1V0JA 2UUPA 3WC4A 1G17A 5CB4F 1G5TA 2R8ZA 3CNQS 1G38A 3O95A 1BU5A 1NIPA 3FFBA 4IIVA 1JA0A 5E38A 3T7RA 1DLIA 3ZXUB 1JMYA 2H3HA 2HTEA 5GIPE 1XZLA 1NAHA 2JLVA 3BRQA 2XRZA 1IPHA 1NZJA 1EP2B 3DNFA 2HQBA 4G8DA 4RVHA 1BVRA 2FUG1 3KB8A 1DBVO 5GMOA 1E3MA 1AQYA 1ZW6A 2C77A 2D7JA 4JFRA 4LE0A 5KAPA 1X8XA 4YV0A 4JJGA 4ALIA 4ER7A 2P0YA 3A9WA 3K6JA 1MC8A 1NBEA 1ZN8A 2C0CA 1YFJA 1G63A 5SY4A 2BFBA 3CEHA 1Y7IA 1K4YA 1IC6A 3QLVC 4NCXA 5G3YA 3WLKX 1A9SA 4Y2YA 5KU7A 2OP0A 2VDUE 4EHAA 1N75A 3G0IA 1GXSA 2QVYX 3KOOA 4LRSB 3S7ZA 5LP6F 1BQ3A 3LU1A 1R0XA 2CD9A 4IGAA 2IDKA 3THSA 2FEMA 3GLKA 5JPIA 4X65B 2MHCA 1RRGA 4O2LA 2XQGA 4DY6A 3DLPX 1YACA 1EH5A 2Z09A 4KQGA 4QQNA 3OPYI 3BCSA 4AMZA 1Y6JA 3VZBA 2BMJA 4ZP1A 3O5AA 2LPMA 3H4TA 4QUIA 3WO0A 5AQ1A 1JG3A 5LA6A 3CYFA 3I12A 4N0DA 3VPCA 1YV9A 1UEIA 1O6BA 3CWZA 1PVVA 3I04M 2FPIB 3CRMA 2P75A 1W6RA 3SS9X 1T9AA 4XIIA 1HE4A 1OTYA 4IVQA 1FNBA 3WGLA 1YZYA 4C0JA 1M7HA 1QIDA 3OA2A 4IDOA 1U1CA 4HWRA 1YHZA 1Z08A 2ZWIA 2C98A 1ZA1A 3BMOB 3H2IA 3BJIC 3A1CA 3B78A 3QYFA 1UPCA 1B2LA 5BOVA 3WV5A 2C7RA 2YWJA 3PF8A 4HUQB 2VPZA 4AB1A 3O9VA 2SCUB 4MQ5A 3W6PA 3AUYA 1BMFD 3WGKA 3NNDA 2ZSEA 4JYZA 2Q5CA 4QFDA 1NR7A 4DY4A 3IDQA 5C4MA 1PTKA 4O4LA 5DYTA 3NANA 4MVCA 1VJDA 1JHOA 1E1QA 2HN9A 2Y4OA 3S55A 3L2OB 2GN4A 2Z3VA 3UF0A 1A4RA 4ETWA 1AXRA 3RROA 2B69A 5E7MA 2ZULA 1WMBA 1XTPA 4L51A 5K3FB 1MGPA 2A0UA 2EEPA 2QUHA 3OPYB 1NVVR 2AF4C 4WPGA 3M4ZA 3LCMA 4K9DA 4Y6RA 4REMA 4MIEA 4JI3B 5EIBD 4AJKA 2ZR9A 2VVTA 4CMIA 5FUQA 3ME5A 4NZ9A 1GT6A 2Q3EA 2VQEB 3LBYA 2NYVA 2X4IA 3O91A 2UVPA 1Z2EA 5IBRA 5KNCH 2WM3A 3AJDA 3CBQA 3FOCA 3MWDA 5FCDA 4KYIB 5DWVA 1J70A 4DUGA 1YZFA 4EPYA 1H1LA 2KQUA 3I01A 1BRTA 1CR2A 1UC9A 3TK1A 3W8DA 5JCOC 5F78A 4KR7A 2VRNA 2WVGA 1X9GA 2BFFA 2UVDA 3N8KA 3UANA 4B34A 4D5GA 4II7A 3L7JA 5DSZA 3ADCA 4B0PA 1YOBA 3OCCA 5BUSA 1GNLA 3X2EA 5TJHA 5KOYA 1ENZA 1FP1D 1P7ZA 1NRIA 2B20A 3VTKA 1TLLA 4MCIA 3WG9A 1Z5GA 1YE5A 3CGWA 1J1IA 1Z62A 1Q7EA 2FEWB 1T4MA 2ZRQA 2IOQA 2ZWMA 3WFZA 3G9XA 3F47A 1K86A 1TM4E 1ZM3A 4LMPA 2OQIA 5JS1A 3NIWA 2NN3C 1F0PA 4O2RA 1OI7A 1QPBA 2OZLB 3ECSA 1W46A 3ANXA 1DTWB 1WZNA 1KIAA 3W5HA 4IH9A 4WY8A 4AF6A 1TLFA 5DMHA 5GP1A 3V4RA 1KGSA 5HCNA 3GMTA 4KYUA 1GU0A 1BFUA 2EWWA 1U65A 3G9TA 3G79A 2X8LA 2EZUA 3NBFA 5SZKB 3FSRA 2WWHA 3U81A 4NK4A 3U3XA 3UVEA 3H2ZA 5HIMA 2V7PA 4RABA 4FGZA 2BH9A 2YIDA 3FNGA 4Z0NA 1XG5A 1JEQB 4PBRA 5LBIA 2NVUB 3ZJ4A 3RSGA 2H2FA 4O2AA 4I5EA 4ED9A </