1BWSA

Crystal structure of gdp-4-keto-6-deoxy-d-mannose epimerase/reductase from escherichia coli a key enzyme in the biosynthesis of gdp-l-fucose
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
314
structure length
314
Chain Sequence
KQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQNAPDVVVWGSGTPMREFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCTIRDLAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVTRLHQLGWYHEISLEAGLASTYQWFLENQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title GDP-4-keto-6-deoxy-D-mannose epimerase/reductase from Escherichia coli, a key enzyme in the biosynthesis of GDP-L-fucose, displays the structural characteristics of the RED protein homology superfamily.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords PROTEIN (GDP-4-KETO-6-DEOXY-D-MANNOSE EPIMERASE/REDUCTASE)
total genus 104
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 1998-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1bwsA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1bwsA02
5I8WA 5BQFA 1QV7A 3GGOA 4OOEA 3W6UA 1C14A 2V6MA 4L73A 1YBVA 1QYXA 3WGOA 1LI4A 5JAMA 1FDWA 3JD1A 4M8SA 4XRRA 1H5QA 2ZYDA 5KNLA 4CMBA 4CV2A 1P77A 4CODB 2GN4A 4U6SA 4XB2A 2PGJA 3FNEA 4WCFB 4NFYA 4IY1A 4WNCA 3GDFA 4H7PA 4MVJA 4PG7A 3FBGA 3T4EA 4BUCA 5C5IA 3Q2KA 4ZQBA 4CLRB 3LDHA 4FIZA 1MFZA 3FPCA 4FPXA 3RKRA 3VKUA 3QA9A 2C5AA 5JPIA 2J3IA 2Q45A 4EJ0A 2Q3EA 3ZHBA 4BKRA 1U28A 4AJOA 4E30A 3BMQB 4GL4A 2YDXA 4BNYA 1P0CA 2NUAA 3PHJA 4WCDA 4ROSA 5DCWA 1Y5MA 4R4JA 3FI9A 2GGSA 3A28A 4K6FA 1UXHA 3RFXA 1FF9A 3L4BA 5FYDA 3VVBA 3A4VA 2O3QA 1HLPA 3OJ0A 4RLHA 1FK8A 3HHPA 2CNBA 4ZRMA 4K6CA 2P5UA 1DXYA 4XQCA 2C59A 4D3FA 1KS9A 1LQTA 2ZB7A 3TZQA 1HYHA 4MIYA 4D7AA 1NTOA 3ZWVA 4IZIA 3ZHYA 4CMAA 2EGHA 3JTMA 1N1GA 1J4AA 4YJDA 5ES3A 6ADHA 3VOSA 1LC0A 2X86A 1NPTO 1ZH8A 4AJHA 1YWGO 4HFNA 2C29D 1UR5A 1F8GA 5DBFA 4H3VA 5EPOA 4U0KA 3GVPA 3RD5A 1JWBB 2XXBA 1BRMA 2PZLA 1MG0A 5JDCA 5TC4A 1HWYA 2WD8A 3KLMX 4DBVO 4WPGA 3KYCA 4I08A 2WSBA 2QZZA 3COSA 3IS3A 3I5MA 3RROA 4TWRA 2X0JA 1TT5B 1YL6A 2V6FA 2Y1GA 3NTOA 3RCBA 4CQMB 3U09A 3WGGA 4Q3CA 3TOXA 1YBAA 1H6AA 4O6VA 4RVSA 1Y6JA 3OIFA 4AJNA 3WNQA 2NQ8A 3JYQA 2OXIA 5IXSA 3MOGA 3PWSA 1R4MB 1WW8A 4J16A 2NNLD 4FBGA 1XA0A 1WVGA 1O6ZA 2R00C 1FDTA 2WE7A 2B36A 4IGEA 3QV1A 4OIMA 4Q39A 3UW3A 4BQPA 3O8QB 1EBFA 2QW8A 5K0ZA 1EVJA 4AJ1A 2J3JA 4KUHA 1F17A 3RJ5A 2D3TA 2PZMA 4CMHA 4KP7A 4WLOA 3ETDA 3FNHA 4WK6A 1P1HA 3H7AA 5EQDA 1EE2A 1V0JA 2DVMA 3UN1A 4YVFA 3OJOA 3JQ7B 3KSDO 4G2NA 1IPEA 4JLWA 1LQUA 4A0SA 3WSVA 1ZK1A 1VKOA 1YQGA 4RDIA 4JGBA 3CH6A 3NT5A 3ZDFA 4MP3A 5KCZA 1ZNQO 4NQZA 4KZPA 3KVOA 5DOZA 2AW5A 3GGPA 3DBHB 3QWBA 3QWHA 3I83A 5HBRA 1MUUA 4EEZA 1JKIA 3KRTA 2ZJ0A 1GYPA 1E77A 2E37A 2EV9A 4ALJA 1ZUD1 2B83A 5U1PA 3BTSA 4A2CA 1X1TA 3PK0A 5FEUA 3OJLA 1KIFA 3E9NA 3WGYA 3IP3A 1U3UA 4PN3A 3QE3A 3AOGA 2QRKA 2EG9A 3C7DB 5B12A 3TZHA 1LUAA 2VNAA 3PFWO 2HJRA 3N74A 1LSJA 2IRWA 2GR9A 2ZQYA 3OHSX 4OMUA 4IDDA 2ZB3A 2WDZA 1M75A 4MVJE 4MO2A 3DBRA 4AJJA 2DBRA 1X1EA 2HQ1A 1PJQA 1YB4A 3QLJA 4TMFA 5ADHA 4AJLA 3DFZA 3ROQA 5A3JA 2DPHA 2O7SA 5A06A 2ZTLA 3MEQA 4CMIB 1D8AA 4XQEA 3SJUA 5G4KB 1T25A 2ZK7A 3E1KA 3PLNA 1IZ0A 1C3VA 2UAGA 1ENZA 2VYND 3IMFA 4UEKA 1O0SA 1S6YA 2O4CA 4AJPA 3A1NA 3M2PA 9LDBA 1TI7A 4XZ3A 3C7AA 1WMAA 2VWHA 1ZK2A 1Z82A 1PS0A 1EUDA 3QHAA 3HDQA 4J9VA 3VZSA 1ORRA 4RV9A 4YJGA 5A02A 4ZVVA 4IQGA 4R9RA 4RGBA 4YJHB 3I9NA 1HETA 3ICPA 1Q0HA 1DRUA 3H9UA 4ITUA 2HK7A 1H93A 3HN7A 2VZ9A 4OAQA 2ZCVA 4GLOA 1U5CA 3UH1A 2Y1OA 4R1TA 2OFPA 1EZ4A 3H2ZA 3LT0A 5GY7A 4R1SA 1YDWA 4D79A 2RAFA 4D0SA 5I9NA 3DAPA 4AG3A 1ZZEA 3DTTA 3JQ7A 3INGA 1BXGA 4DL9A 2Y93A 1LDNA 4Z6KA 2BFPA 2P68A 3ZNQA 1E6EA 2GZ1A 2NM0A 5GZ3A 3AW9A 1GYQA 2YV3A 3TPCA 4U5QA 3ZGYA 2PTGA 4CM9D 2QYSA 3ZH2A 4JX8A 3PHGA 1GEGA 4Z9XA 3F9IA 4D0RA 2X9GA 5IXYA 4PLVA 5CFZA 1HYGA 2BH9A 4OQZA 3UVEA 3PRJA 2DKNA 1HSOA 4DXHA 2FZWA 1XLTA 4IJWA 4J4BA 3R3JA 4CLXA 3WGHA 3IOYA 3GGGA 3CE6A 2AEFA 3VZPA 1A9YA 1RYEA 3FWNA 4ZQEA 4IJVA 4FJ1A 6LDHA 4JN6B 1Y1PA 2PH5A 3VC7A 3U0BA 1MB4A 2EEZA 1LA2A 3KSUA 1NQOA 3WFIA 4XQ9A 1BSVA 3GFGA 4DGSA 5CDGA 1JAYA 4YAEA 3PHLA 4LN1A 5TGDA 2O3TA 3PVZA 1EFKA 5THQA 1MLDA 2DTXA 5ER6A 5EL0A 2Y66A 3RBZA 3W4KA 2UV8A 4A5OA 2GN9A 1GPDG 4XYMA 3GUCA 3D4OA 3HWRA 1VLLA 4WUVA 1BGVA 4IDEA 5BT9A 2GZ3A 3GMSA 1E6WA 4QO8A 3DMTC 2OO5A 4TVBA 3DZGA 5DDIP 1IYZA 4JXKA 4O59O 3W4JA 1E1MA 1DLJA 2JJYA 1XEAA 3QVWA 1E3WB 2B5WA 3QW2A 3WB9A 4YPOA 3E5MA 3LT1A 3WICA 1B3BA 2VUUA 3QP9A 2F00A 2Y1CA 4ZN6A 2I76A 2PGLA 4CPDA 2VRBA 1ONPA 3P2OA 1UXJA 3L4SO 1Y8QB 4RDHA 4ZD6A 4CR7A 5COAA 5DBGA 4YAIA 1E3IA 2DT5A 3IUSA 3GFBA 1E3EA 1Q7CA 1U9JA 4RQTA 5IDYA 1HXHA 3FD8A 5DCYA 1GUZA 3UFXA 3T7CA 1LSUA 4IZHA 1LTHR 2YHUA 4KQWA 4Y67A 4PLYA 2R6JA 5AOVA 4ZICA 3JQGA 3AUSA 5IDQA 1ENYA 4NG5A 3A06A 2EKLA 3GMDA 4N5MA 5C7IO 4D3DA 4RPHA 2CD9A 3DWFA 2DFDA 3BMCB 3D0OA 1JDJA 3PWKA 1DLIA 2E82A 1DIAA 2DFVA 4K26A 1KEWA 3HDHA 3GVHA 5TJ9A 4O1MA 4GI2A 4NDNE 3FRJA 3U3XA 2Q46A 2Y0DA 4UVIA 3I6IA 1HE4A 1I0ZA 1QR6A 3I3OA 3K5PA 2AG5A 5C3MA 3ZWPA 5L7WA 5TS3A 1QYDA 1PR9A 4XYGA 3KZVA 2P2SA 1DB3A 2GO1A 4EW6A 3RQSA 1PJBA 4CM9A 4IDFA 1D1TA 3HQ4O 1BVUA 3RSHA 3PYLA 2A94A 5G0VA 2OMEA 3V5NA 2OBYA 4U7WA 4JJIA 2GPTA 3GAZA 3G3EA 4PFJA 4N5NA 4INAA 1MXFA 1TVEA 1CQIA 1HDXA 3WBFA 4DQUA 4BO0A 2CVQA 1X0VA 5F1KA 5K9ZA 3L4BC 2NU7A 2O3RA 3DAFA 2GN8A 1JTVA 1PR3A 2YQ4A 4WNIA 4E21A 4CL3A 1TB4A 1LDYA 1UZNA 2NWQA 4DYVA 5AQ1A 5CAEA 4BO8A 4YT8A 3HB4X 4KUGA 1E92A 3F47A 4RL6A 1MP0A 3VPXA 1PGQA 1QLHA 3FBTA 5B37A 1YB5A 2QX7A 4FGSA 1QP8A 3S1LA 1GD1O 4ONEA 4J91A 3RVDA 3TZKA 1ENOA 2UUOA 4JP2A 4XGNA 4BKQA 1BTOA 2X5JO 4D3SA 4HY3A 3Q2IA 2YZ7A 3F4LA 3OH8A 3GOHA 5I9LA 3ENNA 4AJ2A 1A71A 1DBVO 1D4FA 1L7EA 2RIRA 4Q3DA 4PG6A 4TVOA 4WLEA 1DAPA 3HN2A 3KM0A 5DNAA 4AICA 2O50A 3CTMA 4QTZA 3RI3A 5JMWA 3PZBA 3WBBA 2EIHA 5T67A 1WXDA 1KC1A 3H5NA 5G0UA 2YDYA 4BNXA 4YWJA 4GKBA 2D2IA 2CF5A 3GR6A 4ALIA 1XDWA 4G81A 3PFFA 5KKAA 2YFQA 2EJWA 4L0QA 1GQ2A 1OC2A 1UJMA 2GN6A 3K31A 3I1JA 1BW9B 4HUJA 4XWYA 1K6JA 1ZJZA 1GZ3A 2EP7A 2I5PO 2DBVO 4Y98A 4OXKA 4P4GA 3OA0A 4B8ZA 4FB5A 1I5RA 4BNUA 3ITDA 4CLOA 1YONA 2FRDA 3KEQA 4NNJA 5F5NA 3WDSA 1VL8A 3LF2A 1T2FA 3UCEA 2FZEA 4LVCA 1VC2A 4TSKA 1B7GO 2ZCUA 1F12A 1BXGB 1NHGA 1IOLA 2W2KB 3E9QA 3TWOA 2NLOA 3VPGA 1DHRA 1WDKA 4NIMA 4BL5A 2P9GA 1HF3A 3H9EO 3C1AA 4J0FA 4NMHA 1JLLA 4DLBA 3JQ8B 2AQ8A 4NJMA 3KEOA 4LCEA 1ZXLA 2JCXA 5L40A 2CFCA 3N58A 4HXYA 1KEPA 2BFAA 1H0KA 4UUOA 3MTGA 3WIEA 3HZZA 5CG1A 3VPSA 2O3SA 3D3WA 4Z9FA 1GEEA 3B70A 1HEUA 4LGVA 3NEPX 4WECA 1PWXA 2HK8A 3JD0A 3LSYA 4J1TA 4GX1A 4P8RA 3D5TA 3HFGA 4NI5A 5JYEA 3L6OO 4IQ8A 1SB9A 1GV1A 1SEPA 3HADA 2NVUB 3HNPA 3MWEB 4M1QA 3WX0A 2OUIA 1BG6A 2J3KA 3MJSA 2P4QA 1ONOA 1ZK3A 2HJSA 2BGLA 4J7XA 3WNVA 1UDBA 4XGKA 2G82A 2AQKA 1U5AA 1CJCA 3KBOA 1E7RA 3DO5A 3DHEA 2EKPA 3EGOA 3W6ZA 3M2TA 4NK4A 3S55A 2DC1A 4YXFA 1ISGA 3LU1A 3AJRA 4FFLA 2VNSA 4D43A 1EVZA 1GUYA 1JWAB 4YA6A 4H15A 5T8KC 3TOZA 4E6PA 3M1AA 1A9ZA 2NACA 1GPJA 4GSLA 5DOVA 3SLKA 4GPD1 4YQYA 4B4WA 1P1RA 4J7UA 3PTZA 4HWKA 3DC2A 5BR7A 1DC4A 3MJVA 4IINA 1VKNA 4IMRA 1VPDA 2HRBA 3NYWA 4OJNA 1YO6A 3NUGA 2VHVA 3DDNA 1E3WA 5EERA 4F45A 3CINA 1PZHA 4CM1A 4DBZA 3K2EA 4WLVA 2I65A 4QUKA 3WWYA 4NFSA 1H6CA 1R4NB 3GT0A 3WFJA 2QZ9A 1SAYA 5IAAA 5CEJA 4R5MA 3ADOA 1XGKA 2YQ5A 3T4XA 4L8VA 1WP4A 5AXDA 1XR3A 1ID1A 4GSKA 2A92A 2NSDA 3IJRA 4J4TA 1I8TA 4CMGA 4DC0A 1Z6ZA 3K73O 4JIGA 1OI7A 4YR9A 4ND5A 1I2ZA 1YKFA 1MGOA 4JCOA 4NK5A 2PZKA 1KC3A 1WZIA 2Q99A 1IL0A 1BDMA 2GRAA 3G17A 2FSVA 3JV7A 2EF1A 3H4VA 1H9BA 2IXBA 3PQDA 2CZCA 2FSSA 3HDJA 1SB8A 1FMCA 1LLCA 2XXJA 4A03A 3PQEA 4OOFA 1C1XA 1N9GA 5T5QA 4NBRA 3LVFO 3RASA 4B4UA 4PCVA 3KETA 4TZKA 4B8WA 3PHHA 4W6ZA 5F5LA 4QXMA 1I33A 3TZ6A 4EEXA 3MZ0A 4UUMA 4UREA 2WTBA 5FI5A 2PD4A 3WQSB 1R12A 1EUCA 3VDQA 4DTIA 3IL2A 3B20A 3KYDA 3JQDA 3L0DA 5A9TA 3CMMA 3OSUA 2ZATA 4CMCA 2CUKA 5F1OA 3C1TA 3R0IA 1JKFA 1Y81A 3BMQA 4GWGA 4Y6RA 1F14A 4XR9A 1T4DA 3BIOA 3X2EA 1B26A 3ZWAA 9LDTA 2H1SA 3F6YA 1ADFA 3KXDA 5JDIA 3BYZA 5L7YA 2IZZA 1DO8A 1PEDA 4J7CA 3VH4A 2YV2A 3EYWA 4WLUA 3STHA 5L4SA 1UZMA 3O38A 1NPDA 3I9LA 3GC6A 5G0TA 1QYVA 3WYBA 4HX5A 4KMSA 2IXAA 4NU5A 3MJCA 1DFGA 4GX0A 3GVXA 5HRUA 4JJGA 1ZFNA 4FDAA 2JL1A 4Y9DA 4D44A 4WJZA 3OA2A 4W82A 4BNTA 4TROA 1J0XO 4BB5A 1DHTA 1OAAA 2JHGA 4E13A 2EHDA 4BNGA 1PL6A 1LEHA 2ZTMA 4Q3BA 1YOVB 5FI3A 3WWZA 3ZNPA 4BMSA 1ZKMA 5TIIA 2J6IA 4AJ4A 2GASA 4K1LA 2YY7A 3D5QA 4IXTA 4P22A 2HMVA 2ZQZA 4PLTA 5IJZA 4P4NA 3A14A 2QRJA 1UAYA 2CF6A 1ZMOA 3ANMA 3PIIA 1ISFA 2EKQA 3ASVA 4QFCA 4CQMA 1LRJA 2VUTA 1HDGO 2CDAA 3NRCA 4B4OA 2DLDA 1K6IA 1R0KA 3GN1A 4ZA2A 1AGNA 5JYDA 1Z7BA 3GQVA 3ICCA 2VWPA 2O7QA 3ZHZA 3QSGA 3JQ9C 4QECA 4RF4A 3PYMA 2I9PA 4TQGA 1ZCJA 4YJFA 5H81A 3DOOA 1XSEA 1IY8A 2AHRA 2J5QA 3DAGA 1KETA 1NM5A 4KTTE 3UUWA 3DZIA 4BGEA 3DBHA 3DR3A 5CP8A 4EYEA 2HKIA 2O2SA 4IS3A 2NV6A 3PJDA 4DREA 1ISMA 4DUPA 1Y8RA 2AA3A 1TA4A 4IM7A 4Q3AA 1NYTA 1ZJYA 3Q11A 4PVDA 2CVOA 4R51A 2WWRA 3RJ9A 1HE2A 1A4IA 5DF1A 1U4OA 2DQ4A 1QORA 1Q7BA 2VWGA 4PLFA 3GVCA 4RVUA 1LSOA 2QRLA 1M6WA 2C82A 3GG9A 1M67A 3JYNA 3K6JA 1W73A 4CLOB 1R0LA 3KYDB 2EW8A 1DDOA 1S7CA 2QHXA 4D46A 4Y8VA 1E5LA 2IE0A 2LDBA 2TMGA 3FPLA 1VSUA 4UUNA 3KSZO 4YEDA 3O4RA 3PJGA 3ZU2A 4WOJA 3N7UA 4J43A 4Y6SA 3D3WB 4KQXA 1GCOA 5CDUA 3OQ6A 1X7DA 1E7SA 1XHLA 1GY8A 2JCVA 2X4GA 4I1IA 2WE8A 3OICA 2O3UA 4YCAA 3WGQA 4KDEA 1QSGA 5TT1A 4MINA 1QMGA 5JAQA 3ZWXA 1P1KA 4MVJP 1SMKA 1F06A 1L7DA 1VJ1A 3CZRA 3L77A 4E4YA 2X6TA 1NFRA 1HDYA 4FJ2A 4L74A 4PRKA 3MCVA 4URFA 2EERA 2P4HX 2AE1A 4CR8A 1PS9A 3FNFA 1C1DA 2Q2QA 3IAHA 4LISA 4I5DA 4J1QA 1I30A 3RU7A 3B1FA 2YHIB 1E6UA 5COQA 3F3SA 3RC7A 4YACA 1ENPA 5CEEA 1JU9A 4CQLA 3NX4A 3FN4A 4U6QA 1SBYA 2WD7A 1NVTA 4J0EA 1ADCA 1PQUA 4FFOA 4OKIA 1T2DA 2P91A 4E5PA 2JHFA 5CDYA 1KY5A 3H9GA 5JS6A 2GZ2A 1E1NA 2PH3A 4DPKA 3OEWA 1E5QA 1U7TA 4MDHA 4BB6A 3AUTA 4IIVA 3LLVA 4DRYA 5KJFA 5CPBA 1R37A 1CYDA 3TFOA 1OZAA 1K5HA 4RLSA 3Q1LA 5KWEA 1JN0A 3GHHA 3TL3A 4TRNA 3L07A 2EP5A 1CWUA 5JC1A 3NDIA 4PIVA 5KJEA 2ZB8A 3IUPA 4F6LA 1PZFA 1P31A 5IFLA 2C5EA 4A26A 3KO8A 5A3VA 4Z0HO 3TDKA 1YQDA 1AUPA 4J4HA 4MJLA 4JNKA 1UXGA 4UVDA 2PGDA 3WGIA 4D45A 1W6UA 1E7MA 3PPIA 3ETGA 5KKCA 4HBGA 4W7IA 2IYPA 4DIFA 5L7TA 2Q49A 2WM3A 3ITKA 1XU9A 1SZJG 2HAEA 4EZBA 5JE8A 4FCCA 5JCJD 1BHSA 3WLEA 1P1JA 5I7FA 2H6EA 1MC5A 5ER9A 3VH1A 1X14A 3QIVA 4DYDA 1JA9A 2DTDA 3FF4A 5U4QA 5J23A 1YVEI 3IQDB 4JQCA 3E9MA 1HZJA 3V2HA 1VJ0A 3SLGA 2I66A 4NBTA 4TKMA 2D5CA 4ID9A 3E48A 1ZW1A 5LC1A 3ZV5A 5A5EA 4AJKA 1UAGA 1EMDA 1PJSA 2JD1A 4OHUA 4BGIA 2RHRA 2GDZA 3CXRA 3H8VA 3INTA 1Y9EA 3B6ZA 1ZEMA 3VKVA 3ROPA 3I9JA 4R68A 2ZTUA 1C1XB 5ILOA 2BI7A 2PY6A 5TLSA 3ORFA 2QYTA 4WEQA 1CQJA 1TEHA 4XCVA 1QYWA 4HFRA 5IN5A 1B14A 1U8FO 4BNZA 1XCBA 3GDOA 4F46A 4I8XA 3ZU5A 5A9RA 3P5SA 3CSDA 1X7HA 2HMUA 3GNQA 4YAKA 1SEVA 4NH4A 4OYRA 3UXYA 4GGPA 1MX3A 5TT0A 1UXKA 3L9WA 1G0NA 4OXYA 3W1VA 3DMYA 2I3GA 3U5TA 4BKOA 5IZCC 2PD3A 2EW2A 3GRPA 5BSHA 1TXGA 2Q4BA 4R16A 3RKUA 5ILGA 4BOYA 1ZMTA 2YW9A 3GN2A 2Y1EA 1GAEO 2C54A 2WEKA 4B79A 1OMOA 4B7UA 4PLHA 4XYBA 2V6BA 2JFFA 3L6DA 4PG4A 1YJ8A 2Z5LA 3F4BA 1NR7A 3L9XA 4MVJG 4W9NA 4J90A 3RFVA 5IZ4A 3CKYA 3HDYA 1DJQA 3R1IA 1LLDA 4BNNA 4NHEA 5EINA 2G5CA 1LLUA 5FFFA 4FOOA 4I5GA 4OM8A 4AJEA 8LDHA 3F5QA 1IHXA 4L76A 2C7GA 5TNXA 1NNUA 1NP3A 2PKQP 2JKVA 3OIGA 3GK3A 3DHNA 1P74A 2JAPA 1PL7A 1QKIA 2F1KA 4RQUA 3EHEA 3BTVA 1W4ZA 4MVJI 4BO4A 4YB8A 3DL2A 4R01A 5KVSA 2Q2VA 2AE2A 5KVQA 3CUKA 3BMNA 4I9HA 3WIDA 3GZNA 4RCVA 1SOWA 3I9OA 4PVCA 3RUIA 1KYQA 1BDBA 2OGUA 2O23A 4A7PA 3C24A 3TFQA 1EFLA 1BW9A 4MVJH 3D4PA 4MPDA 3FWZA 3OQ1A 4Z0PA 3Q6IA 1HE3A 2VWQA 1CIVA 3OJFA 4C7KA 4P38A 2W4QA 2Y99A 1PJLA 3JQGB 4CLRA 3RBVA 1YL5A 3JQ6A 3D3EA 4E5YA 4EUFA 4I5EA 2QG4A 4L75A 2OZPA 1BWSA 1PL8A 3OMLA 3AFNA 3WOHA 5T57A 2YJZA 2IEDA 2O3JA 3ZZNA 4R1NA 1VI2A 1ZEJA 1YDEA 3AM3A 3BTUA 5TX7A 4PGFA 3RUHA 3GRKA 4KTVE 2AQIA 4YDRA 1PX0A 4CM7A 3QY9A 3X2FA 4AFNA 4MIEA 3ONDA 2W90A 4OGWA 5B4TA 3DEYX 2JFHA 3BAZA 2C07A 4E2ZA 3E82A 2NTJA 3NKLA 4W4TA 3RC1A 1H2BA 3ZCXA 3UCXA 3JQFC 4R5HA 4S1VA 4BIIA 1UP7A 5K6AA 4NFHA 3Q9NA 3CIFA 1CETA 4FGWA 2JAHA 1HLDA 3LYLA 4J2HA 4BNJA 4WOKA 2OORA 1V6AA 1I3NA 5JXWA 4XYEA 5BSFA 1AXEA 1TLTA 1RPNA 2HMSA 4WGGA 2C20A 3RWBA 3VVCA 1G0OA 4PZEA 3LC2O 4Z0TA 1JKJA 5I7VA 2O48X 2NU8A 3RBXA 4B7CA 3DTYA 3V1YA 2B35A 1CRWG 3KUXA 2O2YA 3SVTA 4A73A 1M6HA 4HFMA 3KYCB 4ZQGA 3DXFA 1P33A 1KVSA 1WMBA 4E5NA 3C3XA 5TF4A 2YHIA 2ZB4A 1UDAA 1E3LA 1I01A 3OETA 1N2SA 4NZ9A 5F1PA 3WTCA 2C0CA 2VOJA 4ZQFA 1P1FA 4BGUA 1WLYA 3F46A 2D5AA 5KVVA 2Y0EA 2Y68A 3AI3A 3D7LA 3WR5A 3AY6A 5AVOA 2PR2A 3SEFA 4RPJA 2OHXA 2Z1NA 2AMFA 3UOGA 2OBNA 1B2LA 1O89A 1Y5RA 1V3VA 2DUWA 3LQFA 2X0RA 5ENVA 1PGNA 4QO7A 4WEOA 3IKVA 3W4IA 3EK2A 4CQLB 4IDAA 4YYZA 4RF5A 2ZYGA 1SO8A 5GZ1A 3PI7A 4XQGA 4E12A 3JD4A 1GDHA 4MP8A 2W2KA 3ROMA 4RVFA 2B37A 4FR5A 5MGBA 1NAHA 1YE3A 1U8XX 1EEHA 4WLNA 5LCXA 2FR1A 3IJPA 3JQBA 5F3RA 1B3RA 5DZSA 4IBOA 2FPPA 1KEUA 2VHZA 5BNIA 4GVXA 1R15A 3DBLA 3PIDA 3LT4A 4LRSB 1AHHA 1KOLA 1YQXA 4MOWA 1DEHA 5F21A 4M87A 4E2XA 1YXMA 4BO9A 3LZ6A 4DPMA 3DZJA 1V35A 3GEGA 1DOHA 2NADA 3R6DA 5COBA 2BRUA 4R54A 4WLFA 1GCUA 1MV8A 4B3IA 4CMJA 4BO7A 3DZBA 1W8DA 1ML3A 2Q2WA 4IPTA 2NQTA 4BO2A 5T64A 2JD0A 3W8EA 1ISHA 3HE3A 4BVAA 1BMDA 1OOEA 1WDMA 4NJOA 4AL4A 4IXWA 1B8UA 1P44A 1ADBA 1E7QA 3PZRA 2Q4EA 1FDSA 3JQ8A 2C7VA 1B8PA 2X0NA 1IULA 3AOEA 4IIUA 4GX2A 1ZSYA 1VE9A 5KJ1A 1CF2O 3BA1A 3UKOA 3NAQA 1UH5A 3SXPA 2E48A 3QWFA 2A35A 2E4AA 3TJRA 1FDVA 4MKZA 4EUEA 1H6BA 1M66A 4B3JA 4BKPA 5A4DA 1F8FA 2BKAA 2X7HA 1XQ6A 3IP1A 3S2GA 2YFHA 5DP2A 2PFGA 3FR8A 3O26A 4JK3A 3H6KA 2EXXA 1DPGA 4CR6A 3TQHA 5BNFA 1ISJA 4GBJA 5ICMA 4CM8B 1ZSNA 1YS4A 4J1NA 4J9UE 4M89A 4F6CA 1DJNA 2BF7A 3GPDG 2VCYA 3H3JA 4XRGA 3JYOA 3EAGA 3TZCA 3JQAB 3WMXA 2X8LA 4HV4A 2YYYA 2HRZA 1HDCA 4JJFA 2E6UX 2ZJ1A 3R3SA 5JDIC 2W2LA 3PYXA 2VTDA 1FXSA 2QQ5A 2Y05A 2NVBA 4E3ZA 2AEJA 2JD2A 5G2OA 3EC7A 1WDLA 1SPXA 2Q1SA 4UUPA 4BS9A 2PLAA 2GLXA 4CV1A 4XIJA 3OEYA 2W8ZA 4FFPA 4UEJA 1HTBA 5JAIA 1DFIA 3AK4A 1K89A 3W8DA 4LMRA 1P3DA 3PJEA 3ANLA 4DMLA 1XELA 1NWHA 1BXZA 3CPSA 5A05A 2EGGA 3WJ7A 2X5OA 3V1UA 3VHRA 3INRA 1UDCA 3BMNB 1I3KA 3GUYA 5A9SA 1B15A 1PZGA 1ZBQA 4R3WA 1LSSA 1PZEA 4PZDA 4UULA 3ZWYA 3SBOA 4IMPA 1C0KA 1MFPA 3ZN2A 1A7AA 4NPCA 1UUFA 1Z7EA 1PIWA 3O03A 3I9KA 3LC1O 2PWZA 1Y9AA 4BNWA 4DLAA 1NR1A 1B0AA 5JBIA 2X5KO 4O63O 3D1LA 1PJCA 1YBMA 4QQRA 4Q9NA 2PZJA 4ALLA 3ONEA 4GLLA 5DN9A 3ZV3A 1PGOA 3ZHXA 2JFGA 3P2YA 5KJCA 3G1UA 1GYRA 1I3MA 2OP0A 4FC7A 3HFSA 5L9AA 2ZTVA 2NU6A 2VHXA 4TZTA 5DULA 2XF8A 4PLWA 4YTEA 1NAIA 2PNFA 4F3YA 1VJTA 1JQBA 5I7EA 2GYYA 1A7KA 1K0UA 3KB6A 5G0SA 2ZYAA 3NDJA 1ISIA 1O94A 3QJ5A 3WGTA 5H82A 3MTJA 1A5ZA 4E2YA 1X15A 5JW6A 3U49A 3FNGA 1RM5A 1D3AA 3K8ZA 2CDCA 4YT2A 1T1SA 2G1UA 3H3FA 1C1DB 2I3AA 4J2OA 7MDHA 1LDEA 2IODA 3DOCA 3D4NA 5JDCC 4X54A 3AU8A 3U62A 4DQVA 3A9WA 5JCJA 5K6AC 4S3MA 3PWZA 2IZ1A 4J3FA 4EGFA 3EW7A 3D64A 4B7XA 2RH8A 1XU7A 1BXKA 1XQ1A 2FR0A 1A27A 4LCJA 4GVLA 3I23A 3K2BA 4HADA 4GAEA 2DUUA 1SOVA 3PEFA 3JQAA 5AXCA 4ZU3A 5L4NA 3GY0A 4A10A 3GDGA 4RO0A 3KOUA 1NXQA 3DOJA 4BO5A 2XAAA 1K2WA 2UDPA 3K92A 4L9RA 5U9CA 1SCUA 2PA3A 2DPGA 5HWSA 5EN4A 1EK6A 3UHAA 2HCTA 3NTRA 1H94A 3T7EA 4CM3A 3O9ZA 1LDMA 1PJ4A 2LDXA 3QVOA 5DP1A 3RAJA 1HT0A 3G79A 4PRLA 3GG2A 4MIOA 4RPGA 1KVTA 4R9SA 5I7SA 2P5YA 1IPFA 5I8ZA 4YQZA 4L4RA 4XEHA 1XWFA 5KOIA 3IIEA 2YUTA 3WSWA 5KTKA 3V1TC 1P1IA 1DFHA 4R3NA 3TRIA 1ULUA 3DBLB 1LU9A 3DZKA 3E18A 2I67A 3E03A 3ENKA 4DPLA 4NBVA 1O5IA 4BNKA 3MJEA 2I6TA 1N8KA 5HS6A 1UP4A 4D42A 1HDRA 4N5LA 3JD2A 2PK3A 1SNYA 1PS8A 5JC8A 1QYCA 1XG5A 2EWMA 2IZ0A 3MJ4A 5B4UA 5CHEA 3BMCA 5ITVA 3E5RA 1Z74A 2VT3A 4G65A 1NVMB 3GH3A 1QLJA 2VQ3A 3H9QA 4FW8A 3KHUA 1PJ2A 2AXQA 1GL3A 2Y1DA 3AWDA 5DBIA 1AXGA 4IGFA 3S2IA 1J5PA 2ET6A 1RYDA 1DIBA 1EVIA 2Q1WA 3HB5X 4QSMA 2DBZA 1B8VA 4LVUA 3WTBA 3SJ7A 1U7HA 1TT7A 1LNQA 1OC4A 3M6IA 3EY4A 4GQAA 1IB6A 3EUWA 3ZI0A 5L45A 1G1AA 3LLSA 1N7HA 3NV9A 1J49A 4XA8A 5LDGA 3VTFA 1IUKA 2O4UX 4XGIA 3DB2A 4IJUA 4OKNA 3QWIA 3GNSA 1H9AA 3JQFA 2UVDA 4IS2A 3B1KA 4ALKA 4PG8A 4XKJA 4Q3NA 2V7PA 2J5KA 4PLPA 4XJTA 3ZV4A 4DIBA 3GHYA 2Z1MA 2Q1TA 4RVGA 1U3WA 1Q0LA 2HK9A 1NBOA 2Y0CA 3FTPA 2H63A 3K30A 2WD7B 1NX6A 4CM8A 1JW9B 2FWMX 4CLHA 3H5RA 3BXXA 1I3LA 3VH3A 1QXSA 5C37A 4CLEA 4L4SA 4HNGA 4O5OA 3ZWNA 2HDHA 2R00A 3DONA 5BSGA 2X0IA 4XIYA 5TQVA 5AXBA 1YH3A 8ADHA 3SC6A 2FY8A 1DC6A 2GD1O 2VZ0A 5A04A 2A9FA 3JCZA 4N7RA 1AHIA 1E3JA 2VRCA 4MKRA 3GVIA 4II2A 4JROA 1O8CA 3ZU3A 4CLDA 5KVCA 1KVRA 3MJTA 3H5AA 3QWAA 3WMWA 1E1KA 5AXAA 3U4DA 3ZV6A 1PGPA 3E6AA 3AFMA 1V9LA 1LBEA 1R66A 1T2AA 1LXCA 3SC4A 3AUUA 1EQ2A 3BHIA 3TSCA 1DC3A 3VAZA 2FR8A 3C85A 1DRVA 1ZIDA 4A27A 5HA5A 5I9MA 3JQEA 1YRLA 1E3SA 4YRBA 4ALNA 1RM4A 3GZ4A 4OXNA 1FJHA 3FR7A 1AE1A 4YT5A 4IQ0A 1T24A 2V65A 1K6XA 3FCOA 1I32A 4RPLA 4BNIA 3OM9A 1U2DA 1GV0A 3DBVO 5A9SB 4JP3A 1H2HA 4WCFC 5JLAA 1R4MA 4FS3A 3U4HA 3UAGA 4ESOA 4CV3A 1V3TA 2BFMA 3BMOA 4EDFA 4MKXA 4RF3A 3F1KA 2C2YA 3VZQA 3KTDA 1SC6A 4LSMA 2Q1UA 5JAZA 4ZGWA 1R16A 4TKLA 2HO5A 1U1IA 3HSKA 4CM6A 3WXBA 1ZSVA 3NDRA 1C0PA 3PQFA 1B16A 4ZHSA 5IF3A 5IDXA 4CUKA 4LSWA 4MP6A 4RZHA 4LK3A 3ONFA 2D1YA 1P0FA 3EZYA 1K3TA 1WPQA 1M76A 4WKGA 3JQBC 4CMIA 4E33A 5C7OO 4HKTA 1T2EA 5G4KA 5CPFA 4L4XA 3IC5A 4J49A 4IJKA 4W9NC 1PJ3A 1T1RA 4FC6A 1MC4A 5JO0A 2OOSA 2ZIZA 4NJMB 3TNLA 2W2LD 1RJWA 5EQFA 3EDMA 3RUFA 1Q1NA 3DBRB 2EJVA 1GUFA 4HNHA 3CEAA 1LC3A 1X0XA 2Y67A 4PLCA 4CQMD 2UYYA 4Q3EA 4YJGB 1OFGA 2HMWA 5IZCA 1PJTA 2SCUA 4N54A 2RHCA 4YJHA 4XD2A 3JD3A 1N7GA 3OP4A 4BO3A 1R4NA 3GEDA 5L3ZA 2VYNA 3UF0A 4XDYA 4GX5A 3JYLA 3PDUA 3WYEA 3B1JA 1N5DA 5DCUA 1A4UA 1JVBA 4BNHA 1VM6A 4KWHA 5EESA 4CJXA 2CDBA 5L53A 3EVNA 4DMMA 1CEQA 1NASA 2E49A 2D0IA 4JBHA 4R1UA 4EUHA 2D59A 2BHLA 4J1SA 4K28A 4NBUA 1I10A 4N18A 3HJAA 4U0JA 3ZWMA 2D4AA 4BMNA 2RBEA 1CERA 4RVHA 3I6QA 1YJQA 2G17A 4FFRA 3PP8A 2XPCA 4WE3A 2B5VA 1QV6A 4RVDA 1C0IA 1Q7GA 2GNAA 3AOEC 3VTZA 3OFSA 4E5KA 4M54A 5JCXA 3FTNA 4OSOA 3DHYA 3GZNB 1L1FA 4UVHA 4YBZA 3RU9A 1U2GA 1NQTA 3VPHA 1NWCA 1GFSA 3RUDA 4K9DA 1GZ6A 1WAMA 2D8AA 4DWVA 3F1LA 1A72A 2VT2A 4XX0A 3AM5A 1BVRA 4Z3DA 4QEDA 4BMVA 2FPGA 1NQ5A 2HMTA 1ULSA 2B4TO 4II3A 2X9VA 4XYLA 1NHWA 4GWKA 1T4BA 1NPYA 2A4KA 3U4CA 1MXHA 1ZVMA 3G1TA 2B0JA 2IEBA 4DVJA 1G6KA 1XYGA 1VL0A 4I5FA 4YRDA 4GMFA 3Q9UA 3KLPX 7ADHA 4QFDA 5JSFA 4YAJA 3Q3CA 1I24A 4PZCA 1HRDA 3I9MA 1T26A 4RORA 2JCYA 3NJ4A 3U4IA 1NVGA 1UZLA 2H9IA 2VYVA 4E5MA 5A5FA 3VH2A 2GF2A 3NGXA 1IZ9A 2WMDA 3P19A 4FFMA 3FSRA 1W0CA 2FMUA 1D7OA 1O9BA 4FSHA 1D1SA 4I9UA 4PG5A 4GKVA 2X22A 3ZWBA 3SX2A 1LDGA 3PJFA 1AN9A 2PKQO 1DSSG 1WZEA 3LF1A 3BHMA 1GQQA 4D41A 2G76A 1PU2A 3TL2A 2RH4A 3RC9A 1PQPA 3MWDB 4LMPA 1U4SA 1YOVA 1V8BA 2DAPA 5BNTA 3ABIA 2TMDA 4Y6PA 1EVYA 1FDUA 2V6GA 5JFOA 4Z3KA 5CDTA 1Y8QA 4DC1A 4CM4B 5KIAA 1ARZA 4P4LA 4FD3A 1HDZA 2BGMA 5B4VA 4ND2A 4BNLA 4CMEC 1CDOA 4M55A 1I2CA 3RUEA 1R6DA 2P9CA 4XB1A 4GGOA 1GR0A 3S8MA 3W8FA 4QT0A 1Q2XA 4KWIA 4ZQHA 4IDBA 3LT2A 4ILKA 3HG7A 3AI2A 5G4LA 4RZIA 3GF4A 1HDOA 3AY3A 5G0WA 3EZLA 3P7MA 2HSDA 4CUZA 5GZ6A 3QVSA 3S2EA 4ND1A 3M1LA 2VZ8A 5HTOA 3ZW8A 1JAXA 4GH5A 2XOXA 3JYPA 2UUPA 2VOEA 4RPKA 3ZW9A 2AG8A 1YB1A 3ZNNA 3DFUA 5T6BA 1C0LA 3PGXA 4EJ6A 5A1TA 3JQ9A 1LDBA 5FF9A 3H65A 1PTJA 1HE5A 2X58A 3NGLA 5FWNA 4CUJA 4RJTA 5H83A 2PV7A 4LW8A 4XDZA 4BO1A 2VN8A 4CMKA 5CDSA 4XR4A 5THKA 1LRLA 4TRJA 2BLLA 1Y7TA 4UAGA 5AYVA 4ND3A 1MA0A 4B3HA 1EDOA 5TSDA 3UICA 1RKXA 3GPIA 2HUNA 4RF2A 1P45A 4HP8A 2G0TA 2X23A 4E32A 1KERA 5LDHA 3MOIA 3WQQA 1Z45A 4WCFA 3ZWCA 2B69A 1GQYA 2HU2A 3C7CB 1ONNA 1LLQA 3E8XA 4KUEA 3NTQA 2DTEA 4YJFB 5ENDA 5EJ2A 3RC2A 3ST7A 5HM8A 4LRTB 1RM3A 2FPIA 1ZK0A 2WYVA 3GNTA 4J6FA 4EBFA 3QVXA 3IDSA 1HYEA 2B4QA 3NT2A 1Y8RB 4W99A 1XIVA 4IDGA 5JY1A 3GLQA 1VSVA 5IDWA 1O95A 2DU8A 2POQX 4M86A 3AU9A 3BMOB 3GAFA 1UP6A 5JMPA 2B4RO 3PDJA 1DIGA 3OQBA 4ZRNA 4E0BA 5A03A 1IHYA 2VHWA 4R41A 1HZZA 1MG5A 3ZWWA 2NVWA 4KDFA 3HUDA 2BELA 2ILTA 4BNVA 2H5LA 3LK7A 3DZHA 3PLRA 5JO9A 4OO3A 2VRCD 2FHSA 1GADO 4CM4A 3GA0A 3ETEA 5CEFA 1ZO8A 1N92A 2GSDA 1X13A 1X7GA 2VYVD 1EBUA 4OSPA 3OF2A 4BHTA 1DIHA 2CVZA 4IDCA 4UVEA 1P9LA 4PLZA 1YL7A 2BI8A 3BTOA 1KVQA 5GMOA 3KYBA 3WG9A 3V8BA 3VPFA 4BV8A 4BGVA 1F0YA 1H6DA 1DIRA 5TJHA 4C7JA 3KV3O 3NT4A 4MVJF 3AY7A 2AQHA 2R2GA 5TRTA 3UCFA 3ZU4A 2FN7A 4BV9A 4YRAA 3OBBA 1TT5A 5IN4A 3DMTA 5L95A 1E7YA 3OECA 3O8QA 3UGKA 1LJ8A 5B1YA 2NU9A 5IG2A 1U3VA 1R0SA 2GUGA 3F5SA 3LC7O 1T2CA 3PXXA 4CV0A 4G5HA 3AI1A 1YGYA 2VHYA 4O0LA 3V2UA 2Z95A 1U3TA 2CY0A 4BO6A 3ASUA 3Q0EA 2BFOA 2X1HA 2C2XA 1Z75A 1KY4A 4BKUA 1KEVA 4TRRA 5CG2A 4OL9A 3K9QO 4E31A 4BQRA 1OBFO 1LRKA 1E0DA 4DLLA 4JBGA 1JVSA 4FFNA 2WYWA 5JY6A 2WJPA 4PLGA 1HSZA 3K96A 1PQWA 1DAOA 2GERA 3ULKA 1QRRA 2VTEA 1NQAO 3ROKA 5ICSA 1PWZA 1WWKA 4MVJD 3RFTA 4FOSA 3TF5A 3ZNOA 2Y1FA 2J5RA 2PKRA 2YV1A 3RIHA 4E2WA 1PGJA 2OP1A 1V3UA 2RCYA 2CSUA 3I4FA 3C8MA 1ZXBA 3U9LA 4YT4A 1UXIA 2NVUA 2DM6A 1GTMA 1KVUA 4FN4A 3JQAD 3PHIA 3S2FA 4NU6A 1RWBA 1Q0QA 3H9JA 2BGKA 4FJ0A 4ND4A 4QX6A 4EJMA 2FOIA 3DQPA 4DA9A 5L4LA 1KBZA 3I52A 4EITA 4UVGA 3EMKA 2NTVA 3RUAA 2AEMA 4YAGA 1GZ4A 1NFQA 3AM4A 4M49A 4OQYA 1WNTA 2J3HA 3C1OA 5DT9A 4CL8A 3G0OA 2NTNA 1EDZA 1EK5A 1N1EA 1QG6A 3H2SA 2FP4A 3ON5A 4NR0A 4AJIA 4ZJUA 5MDHA 5JNLA 4DIOA 1J6UA 2BD0A 3VDRA 3OJEA 2I99A 4B4VA 5KJ6A 3QVTA 5T8KA 3WGZA 1Z73A 3CZMA 1VL6A 2CMDA 3FHLA 1HL3A 4BNMA 3NJ8A 3BZUA 1GU7A 3BHJA 3WYCA 3G49A 5C7LO 1DRWA 2WYUA 4R69A 3ANNA 5ITWA 1ZK4A 1HKUA 4IUYA 2PD6A 3EVTA 3IKTA 2P9EA 3WJAA 3WLFA 4ALMA 3VZRA 2BMAA 3WQRA 5L51A 1E1LA 3RUCA 2HLPA 2IYOA 4FQ8A 4GMGA 1NFFA 4OH1A 4BNFA 3OIDA 4U8GA 4NBWA 4XJSA 4EI2A 5HS4A 3DZFA 1E7WA 2OL4A 3WS7A 4AVYA 1EE9A 1IE3A 2GCGA 2IDZA 3TN7A 3V2GA 4Z9YA 4CM5A 3QQPA 1EUZA 1I36A 2QIOA 3JQCA 4DQXA 4MVJM 2J8ZA 2W98A 1XKQA 5EIOA 3QRWA 1PSDA 4JBIA 4KOAA 4TRMA 4W7HA 4C4OA 3CMCO 3AUAA 1DC5A 3ADPA 3ZWOA 4H16A 4WASA 3JSAA 1ADGA 3GEMA 1N9GB 3L6EA 2VUSA 3I4CA 3PGJA 5EMHA 2DBQA 4I9NA 5BSEA 1RM0A 1LX6A 2Q50A 1I2BA 1VRWA 4HFJA 1M2WA 2ZKLA 1EQUA 2X9NA 4UEOA 4CMEA
chains in the Genus database with same CATH superfamily
1TU4A 1QV7A 10MHA 1EUCB 5EVJA 2ONKA 3C5VA 1FY2A 1LPAB 2MTBA 3CNEA 3IMGA 1QYXA 3Q3EA 3UNXA 1C7IA 5JAMA 4XRRA 3DMPA 2Y6VA 1MNAA 1QPBA 2P0EA 3VJRA 2XXAB 1G5FA 4CMBA 1YK0A 1RCUA 7REQA 1E59A 4U6SA 2H2FA 2NP7A 2WQ6A 5ELLA 3PL5A 1RR6A 5DRTA 5C35A 1FZQA 3FF1A 3KELA 4H7PA 2J67A 2Q5OA 1WE2A 3MXOA 3Q2KA 4H1UA 1E99A 1MFZA 1T91A 4FPXA 2OCKA 1N5IA 4RIFA 3JTEA 1GT6A 1ZVVA 5H02A 3F2IA 5K0TA 1ESMA 2C98A 4G4SO 4W5JA 4HNRA 1OI2A 4HH4A 4EJ0A 2WKRA 2Q3EA 4GR5A 2IS2A 3DEHA 1U28A 1QAOA 2GZMA 4TN1A 4AJOA 1UFOA 2YXLA 3MK31 4GL4A 4BX3A 2YDXA 2UZ4A 3PHJA 4WCDA 2RG1A 3PDIB 1XX6A 4R4JA 4AKHA 2I3ZA 3DPSA 5AK6A 3L7IA 4Y2VA 4JSTA 3UH0A 1UXHA 1ZX1A 2IHTA 4YP0A 2G72A 1Z6GA 2O3QA 1BC5A 1AB5A 4OHRA 4EIWA 3LWNA 2CNBA 5EUMA 3TEJA 4OI4A 2C7QA 5IBPA 1S1MA 2R8YA 3K8YA 3D5EA 1IQUA 3KHSA 1NBMD 2ZB7A 3IIKA 3Q4GA 5FNZA 1NTOA 1CFZA 4FUTA 2CFRA 3B38A 4OPMA 4C0SA 4BFTA 1OYWA 4N1AA 4ECEA 1BH6A 4X71A 1Z88A 3KD3A 3JTMA 4QPJC 1N1GA 2VVTA 2ZRQA 1Z4MA 4YJDA 3SIPA 3FW1A 4QEZA 6ADHA 1N78A 4X8OA 1XRRA 4G26A 2G28A 3BDAA 1EB9A 4DLPA 1PWEA 3ZHOA 3HEMA 1UR5A 1TC1A 1SU4A 2GN1A 2J3LA 2WAXA 4ZCIA 4HZUB 4U0KA 3RD5A 1E94E 2WZDA 1ZD9A 3EEYA 3KEFA 4OD0A 5K6RA 2WP0A 3INNA 3OC0A 3TCKA 5JDCA 4DUZB 1T2VA 4U7GA 3TRHA 1LF5A 3SHQA 3DTNA 5TC4A 1WHSB 2H0AA 2D00A 3KLMX 4BGDA 3LLUA 5JXHA 2J30A 1M2EA 1QRAA 3KYCA 5H9VA 4R0MA 4OA8A 4PYRA 2QZZA 4JC5A 3MWJA 4MKGA 4OLJA 1VJDA 1J8VA 4QOFA 3RROA 2D5IA 4L4ZA 1WPGA 2Y1GA 3ZZ0A 3JX9A 1U0EA 1JIKA 4HDCA 2UUCB 2F8LA 5BWMA 2C84A 2BMVA 1IHPA 1QE3A 3K0AB 1NQVA 1YR7A 4RVSA 1Y6JA 3WMEA 4AJNA 2X8JB 3EGEA 4PGGA 5JJKA 3PEUA 3CKLA 2QZSA 2NZXA 5J2UB 3PITA 2PX0A 4DMFA 1R8YA 2XUQA 3PWSA 4XSHA 1YC2A 5C3UA 1S8NA 1SKUA 3WLSA 2NMVA 4TS1A 1N5MA 3AHCA 1DZIA 2FPGB 2OEPA 1GNQA 3FHJA 3H4IA 3PFIA 2CXOA 1QHYA 2CUTA 3QPWA 3QV1A 4Q39A 4UPDA 3O8QB 2P6NA 5B58T 2ZVDA 3EXG2 3ISVA 3KKNA 2J3JA 3DD5A 4KUHA 4WQMA 4D9NA 1H4SA 1NATA 2D3TA 5LBIA 1J5XA 4W1QA 5M3BA 3QXSA 2ZUTA 1QZZA 4EFNA 4KP7A 1KQ3A 2PMFA 4E1AA 3OP1A 4QDZA 2QF7A 3ETDA 3NOXA 4WK6A 1H2AS 1P2UA 2AKYA 2DVMA 2EJBA 1MENA 2BDEA 3TSOA 3OQMA 3BJRA 3BCHA 1ZK1A 4YMIA 5LSAA 2O5CA 4RDIA 4BMOB 3MBIA 2JGKA 4MP3A 5KCZA 4PSKA 2MSNA 1HYQA 4FBLA 4NQZA 4QNRA 4NXMB 3KVOA 2AW5A 2B7CA 4ZAZA 5FXMA 1AHPA 5DB4A 1DMRA 5E8JA 2ZJ4A 3QF7A 5HBRA 1QWSA 5CLQA 3T1TA 1MUUA 2BEUA 4HDKA 4EEZA 1JKIA 1FPMA 2Q28A 4XVQA 3JZAA 4RV4A 4QIHA 5E0KB 1E98A 5AKKA 2APJA 3EARA 1GYPA 2NYVA 5GONB 2YUIA 4ALJA 1CF9A 1EE1A 1D0SA 3UKDA 1X7ZB 3BTSA 1MQAA 2YJGA 3ROGA 1FNNA 2ZAMA 3WFZA 5IRCD 1ACMA 3E9NA 3HTXA 2LIPA 4LYYA 3AXSA 4FOPA 4OQEA 4ZV9A 2E2WA 2QRNA 3Q5DA 4L57A 1ONBA 4R83A 2P6RA 2C4UA 1UBMS 1DDIA 2IOYA 1W1UA 2HY7A 3E58A 4JITA 1LUAA 2VNAA 4OK6A 3TZHA 3AF2A 3F6PA 2QM7A 3PFWO 2HJRA 2XITA 1FQWA 1NKVA 5E4JA 4F96A 1H8ED 3DC7A 3QKRA 2GZDA 1XP8A 3L8CA 2G9NA 4IDDA 2ZB3A 3ZHTA 4YAOA 2M9MA 3DBRA 3CUTA 3S2SA 1PJQA 1YB4A 3AGQA 1PEKE 1MB3A 2BBTA 4AJLA 2I55A 3L7OA 5BUCA 3E1SA 2Y4OA 1KZHA 2O7SA 3REOA 1JHDA 1D8AA 4CMIB 1L7VC 2QGNA 2PXHA 4MS3B 2W83A 3E1KA 3PLNA 5I45A 4TKUA 4NMLA 3OIVA 2VYND 1USGA 4UEKA 1O0SA 3FKSD 2O4CA 3M2PA 3HXTA 4XZ3A 3C7AA 1PE0A 1WZNA 6REQB 5FBLB 2IHVA 2JK1A 4CE6A 5AJZA 1EUDA 2QE6A 4EKGA 5HNKA 1VI6A 4D97A 2GNPA 1LBTA 1YJ5A 3HDQA 4J9VA 1ORRA 4C4YA 2MMCA 3UM9A 5JXGA 1YE8A 2VCEA 4YJGA 3FOEC 2WVJA 3L6RA 1PAUA 1ZITA 4BZPA 1T10A 1E5VA 4V38A 1RQPA 5EWLA 1DRUA 5IP5A 1QGUB 2JIOA 1U3DA 5CK5A 5IKMA 4GM1A 4A0QA 4I6EA 4QOSA 1ORVA 1A9TA 3UK6A 2P2NA 4CI9A 4HYEA 4XASA 2CBXA 4HPJB 1U5CA 3UH1A 3UFXB 1RPAA 3BQNB 3D1VA 1PZNA 2FEOA 3BILA 3KR9A 5JRZA 5J4LA 3C3KA 3H2ZA 1N2JA 5GY7A 2O07A 4LQLA 3UJ7A 1AQLA 1MAAA 2WF6A 1ZICA 3DTVB 1QIMA 4TKZA 3IQEA 3NQ41 1PR6A 3PLAE 4PV7A 2SKCA 5I9NA 1PR2A 1R0ZA 3K9HA 2V1XA 4UM9B 1L1EA 4JR1A 4AG3A 3PFBA 4XUDA 2XOEA 1G1MA 3DTTA 3CX4A 8OHMA 3INGA 1BXGA 2DF8A 1SBQA 2OD9A 4DL9A 2NU6B 4MV6A 2FEWB 4XWWA 4Z6KA 3PPVA 1JFTA 1R8QA 2MR6A 3FUXA 2FSPA 3ACDA 2P68A 4MA5A 3GLFA 1TF7A 3R9XA 2HJGA 1T1IA 2GZ1A 1XTVA 2HDWA 4Q03A 3ED5A 2DY1A 2HV8A 4GUAA 3ZXSA 1QCCA 4CFYA 4MS4A 3TBFA 3OHMA 4RCYA 4MDEA 3ZH2A 4D8TA 1MZVA 4PAWA 1QDUA 1L5GB 1T4MA 4FWTA 2AKEA 2JAQA 3NNNA 2H2IA 2Q9AA 3NYRA 1M54A 3ET4A 3PHGA 3VKHA 1GEGA 4Z9XA 3SS8A 3PQ6A 3Q0TA 5IXYA 2J7KA 3C70A 5K51A 3VSBA 5J4YA 5ICCA 4GI1A 3OWXA 1IBRA 3L7NA 1XLTA 3MRXA 4UNNA 4CHGA 3R3JA 1XMIA 2WLTA 4OHOA 1KDTA 3CE6A 5FA6A 3RRYA 3VZPA 1XMXA 1RYEA 1E60A 2Q3FA 4GZLA 3O1JC 2PVSA 4ZQEA 3FYUC 4IJVA 5F3WB 1NNEA 3CNQS 2PH5A 2EBFX 1ZVQA 1P1CA 1WV0A 1BSVA 3ELUA 4M38A 4XQ9A 4BLOA 1GTSA 5CDGA 3H83A 4LE0A 1OLUB 4XPIB 1S3FA 3OQNA 4KXMA 1ZUNB 2O3TA 4ZMSA 2Z3ZA 5THQA 5BP7A 5E7IA 1DQSA 2R4UA 4MTLA 3RABA 3QLEA 4CVNA 2Y66A 1AN0A 5LDDC 4WN9A 3MINA 3UJ6A 4UTVA 3CLTC 2O7NA 5AJYA 3RIXA 4AB1A 5DM70 3RBAA 3LPLA 1VLLA 4WH0A 2D7DA 1ECCA 1ZU5A 2IHBA 4TVBA 1QCYA 3DKVA 4CIXA 2WDPA 5IUJC 1T2NA 1B6RA 2OSVA 4JP1A 2YOFA 4O59O 5CVEA 5T3YA 1VE6A 3KQUA 1E1MA 3ADDA 2R25B 5EXPA 3PRKE 1XLUA 4YUVA 3QF4B 5ADVA 3GT7A 4V0OA 5FNVB 4MLZA 4PC2A 2XQIA 5HZGA 3C6ZA 1OFUA 1WR8A 2XBUA 2F00A 4IGEA 4ICIA 3N2KB 1TTPB 2PGLA 2XSZA 4CPDA 1ZM4A 2JVJA 1HA3A 1JECA 3P2OA 3UMVA 1II8A 3NONA 4ZP1A 4IAOA 5COAA 4E03A 3DVLA 3OTWA 4QPNA 4ENSA 3IUSA 4PICA 1PUXA 1E3EA 1Q7CA 3GROA 4X1IA 4DCOA 3N3BC 4EHKA 1ATZA 3I2KA 3UATA 3UFXA 3T7CA 4ZVQA 2D4HA 2J9RA 4IZHA 5DVZA 1HFWA 3H2KA 3Q7IA 4MV1A 4JI6B 2VRNA 1LTHR 3WLNA 3HUEA 2YHUA 4H1TA 4GGMX 1WM1A 4MUYA 4YRTA 4Y67A 1J0DA 1N3BA 1XZFA 1ULHA 3ILHA 2C2MA 3AUSA 3PNBA 4PLYA 4RGVA 4BE4A 4MUBA 4NG5A 5EKTA 2A0KA 3S2ZA 2H85A 1MJ5A 3GLGE 3R20A 1VMKA 2LCFA 3RTAA 2VH2A 4N5MA 1BA2A 5DISB 5C7IO 4FFBA 4TMVA 2W58A 4D3DA 1D2MA 4FHGA 3KFLA 4TV8B 3PGLA 4QHSA 4Q01A 5IJWA 1Z7GA 1D9ZA 3ZLVA 2E82A 3PG5A 2O6LA 3SAJA 2XNHA 2VSOA 4QGSA 3FZYA 5CFLA 2BUCA 4DSAA 3VBEA 4K26A 1KEWA 3CLUD 3SJBA 4S1PA 1W94A 2C2OA 3ORYA 1T3GA 4O1MA 3FI0A 4GECA 4RY0A 2FVXA 4UVIA 4RJ2A 3I6IA 2QVXX 4GSYA 2AG5A 4D6XA 2ZI5A 4Y9TA 3VVLA 5HE8A 1GTRA 2G3YA 5CNMA 1JHQA 1D0VA 3HP1A 3LKDA 4R81A 4RA6A 1CX9B 4L2IA 3L7JA 1CUXA 2ZYIA 1L5HB 4UMDA 1G7SA 3DOUA 3WLKX 4ZVKA 1PJBA 2QX6A 1ANKA 4XH9B 2FFAA 3X1WA 4QYXA 3FCAA 3C48A 5KNBH 3TLMA 4CKZA 3RYIB 3IAM6 1E4EA 4YH1A 1MO5A 1NX9A 1WF6A 2AYYA 3GUHA 2AB0A 5CLLA 5IBRA 4JJIA 1CUEA 3KDSE 2GARA 4INAA 4LFCB 1RTKA 3TVDA 5DBHX 5E2IA 4OG2A 1CQIA 2B3TA 2C5SA 1YIAA 3WBFA 2F4NA 4DQUA 3DVQX 4A2WA 1MABA 3QNWA 4FMDF 5F1KA 4FYMA 3F97A 3DMRA 3FHCB 5CA1B 2FW1A 3DAFA 3SJAA 4G1FA 5EPUA 2BEUB 1PR3A 1KMQA 1JSXA 1UCFA 2YQ4A 4XPIA 2AR7A 3ZTYA 4E21A 5AKYA 1FRVA 1PR5A 2CYCA 1TB4A 5CYFA 1W6RA 1RIFA 2JIMA 2X7XA 3CO0S 3EHDA 3LA6A 3P32A 4ZEOA 3ZTTA 1IXKA 3HB4X 5FD8A 5IT0A 4RTQA 1E92A 3IUJA 1X8LA 2YWJA 4QAQA 3I39X 1DCTA 2XNDD 3R44A 2XB8A 5JWOA 1G55A 5FR2A 4Z4IA 1J39A 1KGDA 1QP8A 2H2WA 2ZSFA 1I4WA 1GD1O 4J91A 3RVDA 1T5OA 3LY9A 5CIWA 3A4TA 2GH1A 3BWBA 1T0UA 4IUBS 3WWOA 1XQYA 2J45A 4TUYF 3STTA 2X5JO 3ZKAA 3G5TA 4BKQA 1NVEA 2WHPA 5GOZA 3OH8A 1TQ6A 1DZ3A 3LH5A 5EZQA 1A71A 1YQTA 4KMRA 3CNHA 3QLTA 1D4FA 1QHXA 2CNWD 1PYGA 1VIDA 1JTFA 1JDBC 1T34A 4PG6A 4EVRA 5IABA 3S7ZA 4J0KA 1DAPA 2FETA 4WACA 3FGNA 3V33A 1FU8A 1GCGA 1WHTB 1YZGA 3R7BA 2EIHA 1QX4A 2G4CA 1JIJA 3HUUA 1L5YA 2Z4SA 1KC1A 3O31A 4GRAA 3QM1A 4Y2SA 5HMMA 4A5SA 2HBYA 3F67A 2GN2A 5E38A 3UT6A 4BNXA 2AN9A 4DZTA 1MQSA 3C1UA 3WMRA 1IG3A 3WZMA 2Z6AA 1AA6A 3KJHA 1XDWA 1AQUA 1L4BA 3X1ZA 5KSZA 2RK4A 2YFQA 4OHWA 3HJGA 2EJWA 5D3MA 1EWVA 5E4YA 1UJMA 4KAFA 3K31A 2GN6A 1ZAYA 2L0XA 5LZ5A 2Z8ZA 1GGVA 1C9DB 1QQ5A 4XWYA 1K6JA 1ZJZA 4O02B 3ZUGA 3VKGA 4K9SA 2AMYA 4Q47A 2HMYB 1KPGA 1YFZA 3BWDD 3VUFA 1IJBA 1ZNXA 1R3UA 3TR5A 1XTPA 3HRIA 4G4SP 3LF2A 1E18A 2I2BA 4NYMR 1TFRA 1T2FA 4MW9A 4UW9A 3UCEA 1N6LA 1VCOA 4YUZA 4Z4CA 5KQPA 1O8BA 1KFCB 1OWLA 1FA9A 3CFYA 5CJPA 4TSKA 3ZBQA 3PD0A 1NHGA 1IOLA 1NUTA 1X39A 3BXHA 2NLOA 4ZYUA 2D0PB 1D2RA 1GRQA 1KL7A 1WDKA 3T1QA 2ZI6A 1O96A 2F67A 1KI3A 2A2ZA 4TGLA 1J23A 1DS6A 3U3RA 2WMOB 3H9EO 2BGTA 1I6KA 3C1AA 3G0BA 3L7KA 4L8WB 4V0RA 1GNSA 1JLLA 2W6MA 3HVHA 1XZMA 4G63A 2OXEA 3OESA 3B7GA 5TEWA 2FEKA 1RFLA 3CRZA 3PC8A 1KQNA 4XCXA 1AH2A 2C2GA 3TX2A 5KTNA 5L40A 1IXZA 3G7SA 2BFAA 2GK3A 2YS6A 1LV8A 3MTGA 2J85A 2Q6LA 5CG1A 4CQNA 1Y3AA 1C7FA 3NBUA 3K7EA 3BPSA 3PKJA 4FT2A 4JU8A 1HEUA 4LJKA 2OYRA 3GBSA 3ND7A 5BMVA 3TECE 4RHEA 4WECA 2DSTA 2WWYA 5JZSA 2HK8A 3GYBA 4P9NA 4DT1B 3HFGA 2F1HA 4NI5A 2FZGA 2HJ9A 5IJXA 4F9TA 2Z9CA 1IZ8A 1LD3A 3B9PA 2H31A 1SUDA 5D85A 4MV7A 4O4LB 3VHXA 3MWEB 2H29A 1P7WA 2O05A 2X5XA 1ONOA 1XNHA 5IKOA 2HHHB 1FRNA 1ZK3A 2BGLA 4RKWA 2PUJA 4U63A 4XGKA 5KOJA 2AQKA 2C94A 1CJCA 2QMZA 4R2KA 1KPHA 2WTXA 3FCSB 1KQPA 1O4VA 1H3EA 3K6SA 4NK4A 1J09A 3LXUX 5ESRA 5BYBA 4YXFA 3I8SA 4QBGB 4Q6BA 1JV2B 2IYUA 2DWCA 2QL9A 4WN9B 2PBLA 2PJUA 4H15A 5E6RA 4FI3F 4F4IA 4QTUB 3WRYC 5A71A 3C8UA 4LVOA 4RGYA 4B4WA 4EX6A 5EZSA 2VNIA 1OGIA 3NFRA 5DEOA 4ASUD 3OOHA 3LAWA 5AIBA 4U2GA 3GELA 4QYIA 3LP5A 3ZDZB 1W2GA 3UMMA 1P5RA 4IINA 4YJ2A 1VKNA 4NRDA 1VPDA 3T7TA 2H2DA 3NYWA 2BV3A 2IYXA 3DDNA 5EERA 3OTQA 2C95A 4KYIB 1CQPA 4CM1A 5KWJA 3DVRX 3OAAD 2ONJA 3K2EA 4IQ4A 4WLVA 5L8VA 3U16A 1YQEA 2CHUA 1H6CA 3GT0A 1G9SA 2V0GA 4M6WA 2ZU6A 1LNSA 3FE2A 1VDMA 3UJPA 3QXJA 4X5OA 5DBOA 1A77A 2I2WA 3DVSX 3VO2A 4P54A 5CEJA 5CYGA 1JYEA 3EPPA 1EA7A 1DAMA 3NB0A 3OJWA 1FNCA 4F5DA 3K9GA 3LPCA 1J1UA 3WZ2A 4PHHA 4CNBA 1GZSA 5CD1A 2XX3A 4L8VA 3EG9B 1XR3A 2ARKA 2VHTA 3PVCA 1DE0A 5DKFA 5GJCA 3OHPA 2C92A 3EIXA 3PFCA 5DNVA 3KJNA 3N0RA 4IZOA 1NJ1A 1O7JA 2A92A 2XCLA 4GSKA 4PGMA 3BQ9A 4RHXA 3PGVA 4TMYA 5ED4A 1O0CA 1WQ1R 4DC0A 1Z6ZA 3TEMA 2F1JA 3KPVA 5E0OA 2BYTA 1OI7A 4QQ8A 1DUIA 2VPYA 3IEUA 4YR9A 2X40A 2PQ2A 1MGOA 3UGQA 2CNNA 2FXVA 5CVCA 1T9ZA 1KC3A 4OYLA 2FN8A 2Q99A 3GRRA 1IL0A 5K05A 5J2TF 2GRAA 1AUOA 1VHTA 3G17A 1I2AA 2ZP1A 2PGAA 4LBWA 4D26A 1JMVA 1UMDA 3JV7A 2HBZA 1H9BA 3HDJA 3C8ZA 1MIHA 1SB8A 3EFBA 5AO9A 4HL6A 4MLCA 3ZCUA 4A03A 1R6VA 4OOFA 3LVFO 3A31A 3Q7EA 4PCVA 4B4UA 1GHTA 2ISSD 2IHJA 4LNHA 4W5QA 2R6CA 4G67A 1E8NA 1FC0A 2XHEA 4YUWA 2REOA 2ZDHA 5LA6B 4G5XA 4QXMA 2EX4A 1OVGA 3O0TA 4HN9A 4BB0A 2FSVC 4EEXA 4PN7A 3WMFA 3MZ0A 3B53X 4MKHA 4C0XA 1G8MA 4DLTA 3TJZA 2E89A 4UREA 1HLGA 5FI5A 2QZJA 3PF8A 4L2IB 2F43B 1GNLA 1EUCA 2F3QA 4L9SA 4X7MA 1KU0A 4Y2HA 5GONA 4K5QA 4DTIA 4EG4A 4C2UA 3UG6A 2VAVA 1CLEA 2HHCA 5A9TA 4CIVA 3CMMA 5FDFA 3RYCB 5HILA 2OFXA 2ZATA 1PX2A 2CUKA 3C1TA 5HF6A 1T3TA 4C7XA 5MFPA 3LDAA 4ME6A 4GWGA 2JKYA 2UZ0A 4HUQB 4AULA 2H1SA 2P40A 1ADFA 2OQ2A 2FR8C 1PVOA 2GRUA 1TECE 1DVRA 1DO8A 1PEDA 1QHHB 1RXWA 4BFLA 1MDFA 1Y89A 2WBLC 2EU8A 3STHA 4MZXA 4D8XA 3IJEB 3QE0A 5ERGB 5KYKA 2F9LA 3X43A 3MGAA 5IVDA 2NQ2C 3QEMB 4DCUA 2ZAIA 5G0TA 2DUJA 2FQWA 4TTSA 3GYGA 5DM0A 3BGWA 3IDZA 1W9MA 2OFOA 4HEHA 2OVBA 5C9ZA 2HSZA 1YZ3A 5HRUA 5TQ0A 1J2YA 1IEXA 1KAQA 3FLEA 4HQLA 4II7A 1XA4A 2EL7A 3UW1A 1EX6A 4GZMA 4D44A 3D6TB 5B7QA 4M1ZA 4I1VA 3P52A 1WA5A 4KLNA 2YZGA 2JHGA 4BB5A 4ERNA 3OY7A 2QMYA 2C3UA 4QQKA 3C3YA 4IIHA 4Q3BA 2DOKA 4KGXA 1HQDA 2PUFA 3PEEA 5JZBA 1ZKMA 1V5GA 3K94A 2D5LA 3O8OA 3PE6A 4FE3A 4P36A 5FYQA 4AJ4A 5HIJA 2YWBA 4IXTA 4P22A 5LUAA 4UJ3A 1V7CA 3V4RA 5EJ9A 3A70A 3LY8A 4LDQA 4KQKA 4PLTA 1YVUA 5IJZA 4CGZA 3RFCA 4AZ3B 2ZJZA 3PFNA 5AOCA 3IHTA 1N2CE 3T41A 4CT0A 3S6JA 2B0CA 3DE4X 4UAVA 1ZMOA 2WPDA 1ISFA 2EKQA 2ZUCA 5IEJA 5D5HA 5GPBA 2VUTA 2ID9A 2ZSUA 3C0KA 1D2NA 1XKXA 3SPXA 1K6IA 4NP6A 3K0CC 3QFTA 1ZIYA 3ANSA 4JR2A 4B6PA 4QBHA 4D0GA 1G4AE 1Z18A 2VWPA 2O7QA 1BWRA 4FNGA 3ZHZA 3AVQA 3QSGA 4AWAA 4RF4A 5JXIA 1Q15A 1ZCJA 4TV9F 5LP6A 2VBIA 3RS9A 3F96A 3DAGA 2WSIA 4OKSA 1NM5A 1H23A 2JAOA 2BBWA 2GHRA 3DZIA 1EDDA 2Z6VA 3ZOKA 3AR5A 3WKBA 4BGEA 3TKAA 1IZYA 4ML3A 2HPZA 1FBTA 2QBYB 1D6NA 5IH3A 5I9BA 1TUBA 4BWGA 3VFDA 2VK1A 4DMRA 4F9FA 3B7PA 1DX6A 2JIPA 4P6VF 4DUPA 1Y8RA 4IKEA 1E1CB 3OURA 1MT0A 1NYTA 2WQ7A 1AO3A 1VL1A 5EIHA 4LZWA 4Q21A 4XPZA 2HEGA 1I7SB 2HCRA 4KDCA 1VZ2A 1U4OA 5DF1A 3ZY4A 5CCXA 1QORA 1L5RA 3GVCA 3IOCA 3KDPA 2QRLA 3L0ZA 3PC6A 4TS3A 4FZRA 4E14A 3HPQA 3IMEA 3WADA 5HYVA 1M67A 5ECGC 1PR1A 4TVSA 5H1YA 2DP4E 1K7EB 1S7CA 2HTFA 3CR7A 3IP8A 1B74A 2QHXA 3ZBUA 3MJHA 2PKWA 2QUIA 5FX2A 2OHIA 4F1KA 3QFHA 5CHYA 3GEIA 1IIBA 4ZI7B 4WOJA 3K1JA 4LKRA 4Y6SA 4TWBA 5CUQA 4PQFA 1GCOA 1GGMA 3HY4A 3LUCA 3OQ6A 4S12A 4JEMA 3TSWA 5CDUA 1EVLA 4G85A 1E7SA 3RVNA 4UQOA 1RWKA 4ZQIA 4I1SA 1XHLA 1C30A 3OICA 2HF7A 4TM7A 1QMGA 4HB3A 2WMYA 2HRQA 4HD8A 3CZRA 4OK3A 4ZT2A 1ZRHA 3BXOA 2AFIA 4KHZA 1GGEA 1QR2A 2H08A 3K0HA 4JDUA 3VU9A 1CU1A 3OWHA 4TTTS 4EHNA 2V5AA 1QU3A 3LQKA 4MRPA 4PRKA 3O9VA 3LPNA 1VHDA 1Z5NA 1X86B 1BEZA 1UBFA 2ON6A 3DHVA 3OEEA 4ERXA 1C1DA 2VJMB 4KH0A 5JEEA 5IVHA 3IAHA 5AUQA 2W2NA 2B9EA 3CWQA 3AYZB 3LUGA 3H13A 2QVZX 3LKBA 4MUXA 1F5NA 1ZKDA 3FPHA 3ROXA 5CEEA 4NICA 2GBGA 3WYDA 2P9FA 4U6QA 2WD7A 4CDNA 4QPZA 5BPHA 5E6RB 4XOUA 1PO7A 2ENUA 5B64A 2POCA 5AW7A 3L92A 2R97A 5TMBA 1KY5A 5JCOC 1YVDA 1B1CA 2IDKA 2GZ2A 4F11A 1NDUA 2FK8A 3B5JA 4DPKA 3ZY6A 3MS7A 1U7TA 4BB6A 3AUTA 5AI4A 5KJFA 2C9CA 1FTSA 4MCJA 1CYDA 2ZWPA 2JGLA 3NRBA 2MYPA 3P2EA 1BS2A 1K5HA 3GLIE 4FW9A 3C3CA 4RLSA 4QU5A 1N2BA 3GHHA 1NKSA 5ALIA 1ILWA 4F4HA 9ABPA 1PV1A 1ZUWA 1I9CA 2EP5A 2GBIA 2IYWA 2WIDA 1S2LA 5AK4A 4FHCA 4JASB 1J2UA 1ZESA 4PIVA 5KJEA 5C7YA 1GAQA 4L3OA 4X8MA 3RARA 1CXZA 3RTEA 4KNVA 1G8FA 2TS1A 4MJLA 1QGDA 5C1IA 3HA2A 4FYVA 5CURA 1UPFA 2B1JA 2PGDA 1XTUA 2NV2B 3ZDDA 4Q6WA 2FX3A 3PPIA 3A7DA 5J58A 2IYPA 4DIFA 5ISMA 2FUCA 2Q49A 2N0SA 2WM3A 1K7SN 3EOZA 3ZGLA 4IV5A 1SZJG 3FPAA 4S2UA 1W35A 4BZXA 2P1ZA 3SGLA 1J2EA 3DT6A 3K9BA 3AW8A 4MQEB 5KC9A 4FFDA 2ZIXB 5I7FA 5EPEA 2GCIA 3C5WP 1SCAA 3OUZA 3TCXB 3GLFE 2VDWB 4BFCA 4PM4A 1X14A 2PYZA 4JKOA 1HT1E 2GF0A 3RYTC 1XVVA 4CKBB 4RVOA 2O8FB 1I7LA 1N1MA 1VJ0A 2CCJA 3TW8B 3I34X 1Y1TA 5C46F 1ZHOA 2I66A 1IEVA 2VL7A 4RWEA 3EXIA 3MGCA 3CKKA 4EY7A 1D4ZA 3ZYCA 3NMUF 1ZW1A 2OMKA 2B5OA 4DV2B 3FDXA 3QTLA 4NLLA 5CNIA 4Z5XA 2CHQA 3L0CA 2JD1A 2O8CB 4XX1A 1T36A 2JDID 2VYQA 4HCJA 2ILVA 1MIOB 2TYSB 1FUYB 1CJBA 1CUDA 3TMKA 4TXJA 4RY2A 1E3QA 2BM1A 3I9JA 2ZTUA 3AHDA 4IILA 1PJ8A 3ZDCA 1C1XB 3O1LA 5ILOA 5LYYA 5EZ6B 1KZ7B 3QEBZ 1CR4A 1U6IA 1UEIA 5TLSA 3ORFA 2KX7A 2MINB 2QYTA 1QYWA 1W9HA 1LTKA 4HFRA 2FLWA 3KT8A 4NCAA 4LOAA 1XCBA 5TPZD 5BN4B 3OVMA 4I8XA 4F4JA 3LQ2A 4M4SA 2HMUA 1SEVA 4OYRA 3UXYA 2X5NA 4GM4A 4ZI2A 5AKXA 3KZMA 4ZAXA 1GA1A 2J4CA 3DMYA 1XTRA 1AX9A 3MMSA 4R8LA 2EW2A 3GRPA 5KYGA 2ZBQA 3CH4B 3IR5A 4R16A 1C8VB 4O8CA 3RKUA 3VU8A 5E6UA 4BOYA 5K8VA 2Y1EA 1Y4SA 3NWBA 1G6HA 2PV0A 5I7AA 5AW0A 4UFPA 3EC1A 1DQPA 1PSZA 5FULA 3WIOA 4ZK2A 3AP3A 3L9XA 1BKYA 3RFVA 1TAQA 5G1NA 1CNFA 3HDYA 3UYLA 1I5OA 4FGJA 4BNNA 4BLWA 2XYQA 5AVZA 3OTOB 1Y3BE 2PWYA 3H18A 2GBLA 3MSCA 5EE0A 3F5QA 5M04A 5TNXA 3TRDA 1J21A 4RXTA 5LQNA 3BD6A 4C6HA 3E22B 4MUGA 2P7HA 1P74A 2I0FA 2JAPA 1QKIA 2HWYA 1TO1E 1OROA 3BTVA 1Y6ZA 4R01A 5KVSA 3TEFA 2JG3A 1GLNA 2PMKA 1JSRA 2R6HA 2XA1A 3BMNA 3OZAA 1SRQA 1XEFA 2VXBA 5CVUA 3A58B 3I9OA 2PH1A 2VJKA 3N2YA 3CISA 3FMOB 2GXQA 2ALJA 4POAA 1KE1A 4A7PA 1NVWQ 2GCNA 3NIGB 4WKCA 5D2CA 2MSWA 2XUPA 1K4MA 3OQ1A 3L5KA 4KXLA 1ACJA 3Q6IA 1H22A 3RVOA 3EQZA 1Z22A 2W4QA 1F8UA 1LV7A 2Y99A 1SELA 3AJEA 3RBVA 2CDNA 2ZKIA 4OIFA 4TN5A 2I9KA 1QF9A 3TM4A 4MJ7A 2OAGA 4E5YA 4EUFA 4I5EA 5K1ZA 4L75A 3L79A 4HGYA 1BWSA 1PL8A 3AB7A 4S1OA 3WOHA 1FFGA 5T57A 4CCYB 3WV5A 4R1NA 3AUJB 2ZEJA 3OZWA 2GVNA 3BTUA 2XEDA 1TYZA 2QOEA 4GOMD 4ZXFA 2PN1A 3TQFA 3QEJA 2CLKB 3GRKA 2DQSA 2CJWB 4KTVE 2IU4A 4YDRA 5DIZA 4FSXA 4AU1A 2WKWA 3BL5A 4HGPA 2FLKA 2R8XA 2ZI9A 2ZROA 2ACKA 1DNPA 3MT7A 2CGEA 5DW3A 4CM7A 3ZHQA 4AFNA 5HTKA 1E2NA 1P0PA 2IHKA 3CLKA 4MIEA 1JFFB 3A04A 3RVKA 2XMGA 2I78A 3DEYX 5D1NA 3WGNA 2B94A 4HSGA 1EZ1A 2QBYA 1RRFA 1U0BB 4O2BA 1X38A 1INLA 4AZVA 5AD1A 3RC1A 1AKVA 2GKGA 3ZCXA 2YYSA 1US8B 4H4DA 2B1QA 2BHRA 4EK9A 1C4OA 2ZYUX 4YI5A 5IH7A 2E21A 3HNOA 4IFEA 3DG9A 4TV9B 3T1NA 5BSUA 4DSOA 2OGZA 2VNHA 1CETA 2ZANA 5CMLA 5ESXA 1OZFA 2Q3JA 3BK1A 3V1NA 4KPUB 1E62A 1I3NA 1QIGA 3D8BA 4UDYX 5BSFA 2V7UA 4WGGA 4MYRA 2VP6A 4H3HB 4HYYA 1YJAA 4JL6A 1E3TA 1CRLA 3DZCA 5EIAA 3LC2O 5KNBA 1E8MA 1JWLA 4L1KA 4IRXA 4KQ6A 1O9GA 3QPBA 3RBXA 3V1YA 2WWTA 1E2GA 4UHBA 3SC2B 4A73A 2RKWA 1W0KD 3LBYA 4HFMA 4QBTA 4ZQGA 1ZAKA 3DXFA 2QVBA 5EIBC 1O6BA 1QVAA 5F7ZA 3OTIA 2FPWA 2GZSA 1OV6A 3C3XA 4A6XA 5FIUA 2B34A 3PUYA 2L69A 3AR9A 2ORIA 3KKPA 2CN1A 1IHDA 4NZ9A 5EXXA 4BVJA 4ZQFA 4Z1MA 1YVRA 2GXUA 1JIUA 3IMCA 3GUUA 2JJ2D 3HB7A 3ITEA 4P2GA 2Y68A 5DYIA 1YMQA 3ETCA 3WR5A 3PNSA 5AVOA 3SY8A 4RPJA 2WHPB 3PUWA 1AD2A 3IULA 2MYTA 2OBNA 1GTJ1 1B2LA 2BM8A 2J08A 2BI4A 1UK7A 1Y5RA 1P2TA 3MD9A 4FYHA 4G41A 1NLZA 1HDIA 3TW0A 4LYDA 2FMIA 3L8EA 4ZI3A 1QDEA 3LQFA 4D4LA 2ZYRA 1DKOA 1U31A 3UMSA 1R9GA 1KFJB 1PGNA 1XA3A 4QO7A 3W4IA 5EJ7A 3QUCA 3HLYA 2P9TA 2RH9B 1SO8A 4IR7A 2CW5A 1E9EA 2P62A 1C41A 2P3OA 3F3KA 3IV9A 4MP8A 4OEHA 1K3UB 5C53B 2X2EA 5BW8A 4C0QC 4IUDS 3ROMA 4IX1A 3WC4A 1LS1A 1BE6A 2B37A 4DN6A 5MGBA 3NS7A 5D86A 1NAHA 1OWOA 3S68A 1EWKA 4QT4A 1EEHA 4WLNA 3RSGA 2ZI7A 3P2JA 1EHYA 2H4FA 4YRJA 3DMGA 5JT1A 2YH2A 3L3BA 3H5LA 3MTBA 5AUNB 4JV5B 2VHZA 1QYRA 2PL3A 2V8OA 4GVXA 3M3DA 1NXWA 4CEHB 1FYVA 4I4NA 3DBLA 3RVBA 3H8JA 1JPJA 4X41A 2OXFA 4ZYTA 1D04A 1Q6YA 1FS4A 1W46A 3OPMA 2XD4A 4RL4A 5EIWA 2GKOA 1VFNA 2XGGA 2BGJA 2FRXA 4MHTA 3SFTA 2QUJA 4BO9A 1T8WA 3W06A 3T4UA 3SWWA 4IDXA 1X7YA 2BP7A 4TLMB 1KYZA 2D1SA 1O96B 1RXVA 2ZRPA 4HZIA 4PCUA 1NONA 3W04A 3O9MA 1G7TA 3EDQA 1CR1A 1ULAA 3DZBA 3LRXA 1XZIA 1HI9A 1YR2A 3UZUA 1MKYA 3VR1A 4BO7A 2ZJYA 3LUPA 3K0CA 1C3EA 4R1MA 2WFZA 3RAFC 2C7RA 1ML3A 4TZ6A 1JSCA 3AHEA 2NQTA 3H7IA 4BO2A 1F9AA 2BJWA 2DWPA 2Z8YM 1V5IA 3P45A 5T64A 3QEAZ 5I3ZA 3EXHB 4NBLA 3AF5A 3SSMA 2A78A 3REQA 4GVPA 1B8UA 1BU8A 4YP5A 5LBTA 2JH8A 1PR0A 3PL1A 4GDFA 1S2NA 2IY8A 4K03A 5THXA 1WZUA 4BX8A 2C7VA 4XW2A 1B8PA 3W5JA 4UNPA 2P9JA 4IIUA 3GAAA 3W9SA 2OO3A 1HEYA 3DXXA 2KLBA 1T5TA 1CF2O 4KNWA 5HJ5A 5DW0A 1Z08A 3UK0A 3H11B 3H87A 1WP9A 1GAJA 1TW2A 2A35A 3HCFA 3E81A 1FDVA 2NUBA 3KEMA 5IARA 1M66A 3MA0A 4FDUA 3LVBA 4LBYA 4WFJA 5B1HA 5FPYA 2X7HA 4R0NA 3SZUA 1DC8A 1XQ6A 3S2GA 3BE6A 3WGKA 1OTXA 2J3QA 2YFHA 3PBKA 3C39A 1L7NA 2PFGA 2O5RA 3O26A 1M6NA 1T5DX 3EMBA 3ESZA 5JVDF 1DPGA 1IONA 3MWEA 1ISJA 2A9PA 2P3SA 2VLBA 1OQAA 4J1NA 4RWZA 5H80A 2OA0A 5ALZA 1MO3A 1Q1AA 2C99A 4MQMA 4DQDA 621PA 5K5EA 1JJFA 1DJNA 3A4MA 1MC8A 3L6CA 1N5OX 3PKIA 3N5KA 2QTBA 4IHJF 4UDXX 1SURA 1CEXA 2XADA 3Q7PA 3EAGA 2ERXA 1EVEA 3HU5A 2X8LA 2XQGA 3WAJA 3AV3A 1NI3A 2HRZA 2YYYA 3MFYA 1LVHA 3K4HA 1MT3A 3HI4A 3R3SA 1FXSA 2RB5A 4UNSA 4UU1A 1R7RA 4CG1A 2NVBA 4J3NA 2AEJA 4DLYA 4DC9A 2BVNA 2GFHA 3S1AB 1QAMA 2O0JA 4LF8B 2QU7A 1DOZA 1K7XB 1RT9A 1YNOA 1Y82A 2PT5A 2NSLA 4TYQA 1SCUB 5G2OA 4FEEA 2CJPA 2DPXA 3MB8A 5CCBA 1OVMA 1Y5LA 3MMPA 4G1CA 4MLPA 4CV1A 2N1BA 2ODPA 3H5TA 4V0MA 1EJ2A 1PWYE 2BUAA 2W8ZA 3OEYA 2R7KA 3I53A 3L7MA 4YIKA 3V4LA 1GPBA 4G1UC 3D3JA 5SICE 1J5EB 1UEXC 3NHLA 2WQZA 4CIWA 5JAIA 2NNWB 1RU3A 5KYYB 1COWD 2PQ6A 1DFIA 5FNVF 1QGYA 4BHHB 4QJIA 4YV1A 1Y7IA 3W8DA 4LMRA 4MPRA 1CUGA 5I4CA 4JQZA 4G5YA 1RZ3A 2JLCA 5EXEA 2NV0A 3TQQA 2J31A 1LBSA 2YXDA 1F1BA 1U6JA 5LOVB 1NWHA 4LJ9A 2CMFA 2OV2A 1J1IA 2EGGA 3RAPR 3TLXA 2W70A 3V1UA 4FQ7A 3INRA 3OX3A 1I3KA 2GT1A 3II6X 4ARSA 1PT5A 5AVWA 3RPEA 1PZGA 2Q3LA 3I9V1 4F04A 1PZEA 4I3FA 1X1CA 3R3WA 4IGIA 1OYOA 3HYSA 3SBOA 1TD1A 2NXJA 1U0OC 4QRHA 2AFHE 4NPCA 1FMFA 2JI4A 4H59A 3MM4A 2A9OA 3IT1A 3RLFA 2PWZA 1Y9AA 4BNWA 1NR1A 3O3MB 4O63O 1QIEA 3OOWA 2Q5IA 1YUNA 4L51A 2PZJA 3ONEA 3KPJA 4OTZA 1C2TA 1GA6A 2NZYA 3EQ6A 1PGOA 4IHQA 3N2LA 1OXSC 4OYHA 1X80B 4KJZA 4BV3A 5K4HA 3P2YA 1IN7A 1FLDA