1BWSA

Crystal structure of gdp-4-keto-6-deoxy-d-mannose epimerase/reductase from escherichia coli a key enzyme in the biosynthesis of gdp-l-fucose
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
314
structure length
314
Chain Sequence
b'KQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQNAPDVVVWGSGTPMREFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCTIRDLAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVTRLHQLGWYHEISLEAGLASTYQWFLENQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (GDP-4-KETO-6-DEOXY-D-MANNOSE EPIMERASE/REDUCTASE)
publication title GDP-4-keto-6-deoxy-D-mannose epimerase/reductase from Escherichia coli, a key enzyme in the biosynthesis of GDP-L-fucose, displays the structural characteristics of the RED protein homology superfamily.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 104
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 1998-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1bwsA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1bwsA02
3I9MA 2V6FA 4DPKA 1PJLA 4YAEA 2J3KA 3FD8A 3D5QA 3QVXA 1NM5A 1EFKA 5JYDA 1P3DA 3DZIA 4MVJA 2I67A 2PGLA 4HADA 3OQ6A 4RCVA 4PZDA 3TN7A 4TRNA 2DLDA 1GUZA 2ZCVA 4CR8A 3DTTA 4E0BA 1LEHA 3M1LA 2CZCA 3ITDA 2AQIA 4UREA 4PLYA 4KOAA 3AY7A 2CMDA 2RH8A 3EW7A 4DPMA 1IULA 3LVFO 3WNQA 4EUEA 4PCVA 1U7HA 5FI5A 3AWDA 1YS4A 2V6BA 4I5EA 4GX0A 4CLOA 3WGQA 1ID1A 3I9KA 3F4LA 2D8AA 2I76A 2QW8A 1NR1A 4U5QA 3KXDA 5JC8A 3ICCA 4BB5A 1GUYA 1GV0A 4J7UA 2GR9A 1KEVA 3GDOA 4IINA 4DMLA 4M55A 3VKVA 4YAKA 1RYEA 4PZEA 3VAZA 3GOHA 3PQEA 2P9CA 4NU6A 2DFDA 1HLPA 8ADHA 3PPIA 3EK2A 5CDYA 1ISJA 3PRJA 1WNTA 1K6JA 3I3OA 4MVJE 5U1PA 2EW2A 4E30A 2GNAA 3LT0A 3OP4A 1GCOA 3LQFA 2OORA 4BNHA 2JD2A 1E1MA 5IDQA 4EEXA 3H9JA 3U4CA 4BGUA 1IPEA 3K2EA 3DZBA 5JDIC 2VHZA 4O63O 1DIGA 5I8WA 4ZHSA 2B5WA 4LRSB 4L0QA 4WLOA 3ZHZA 4BO1A 2B4QA 2Y93A 1PL6A 3I52A 1B16A 1CDOA 3ITKA 4WEQA 1ENOA 3PJEA 4AJIA 1L7EA 4IS3A 3WSWA 4I9NA 1ENYA 4XIJA 3ROKA 4YJGB 3NTQA 5K6AA 2IDZA 4AJ2A 1ZSVA 3S2GA 1C0IA 1ONOA 1LU9A 3KYBA 2Q1UA 4P38A 5BNIA 4GX1A 3KLMX 3OIDA 3EZYA 1BW9A 2OL4A 1JKIA 1HZZA 2ZJ0A 4GI2A 4CJXA 4E12A 4JX8A 3E03A 3PHIA 4XB2A 1H6DA 1KEWA 5G0SA 4CQLB 3PHGA 5AVOA 2QHXA 4PVCA 1JKFA 1GQYA 2GF2A 5CG2A 5FYDA 3ZWCA 1ULSA 3U0BA 3RI3A 4GL4A 4NJMB 2UVDA 1P31A 4LGVA 1KVTA 1GAEO 2D5CA 1T1RA 2X7HA 4EW6A 2NM0A 1PR3A 3DC2A 3ZNNA 1U9JA 4IJWA 4CMEC 3PHHA 1U2DA 2O3JA 3CINA 4BHTA 2VT3A 2VRCD 3LF2A 1LC3A 1K6IA 2BKAA 1NQ5A 1SMKA 3BTUA 2CVZA 5ENVA 2EERA 2I9PA 4ZU3A 1EFLA 2Y1FA 1WAMA 2I65A 1EMDA 4ITUA 3UN1A 3VH3A 4GLLA 5EQFA 2GN9A 1ZO8A 2IZZA 3OA0A 3L4SO 1KYQA 4KWHA 1D3AA 1B3RA 3BIOA 2NTJA 2HCTA 4GH5A 1BRMA 1GYRA 2Y99A 3GGGA 4ZQHA 4WK6A 5AYVA 1O5IA 2ZATA 2BGMA 1Y8QA 3GT0A 2YYYA 5MDHA 4OL9A 1BVRA 1K6XA 3QW2A 3D1LA 3IKTA 4LMRA 1ZK1A 1IZ9A 3UHAA 2W8ZA 3JQ8A 4BV8A 4XGIA 1JWBB 1Q7CA 4IDAA 4EEZA 4J7XA 3IDSA 4IJKA 3EYWA 5AQ1A 2NUAA 4NBRA 2O3UA 1UZNA 4OYRA 3FWNA 1CETA 1PS8A 3EAGA 4I08A 2VUSA 1DFIA 1Y8RA 3F5SA 1Z7BA 1U3WA 3Q2KA 3MOIA 5CPFA 5DN9A 3VPHA 4CLRB 3ANMA 1GD1O 2VWPA 3GNSA 5KJ6A 1CERA 4KWIA 1FDWA 3JD3A 4BNKA 1QYDA 2X0NA 2X5JO 3B1JA 1PSDA 4KQXA 3QVTA 3Q3CA 4MP8A 5JMPA 4W9NA 3VZQA 2GZ1A 3TOXA 1N7HA 3GPDG 4NK5A 1NFRA 2Q1TA 2PFGA 1NAHA 4ID9A 3ZCXA 2F1KA 4CM6A 1GV1A 1HE5A 4PG5A 4JCOA 1I3LA 4UVDA 4FFNA 2C82A 3T4XA 1N9GA 5IZ4A 1WP4A 4FJ2A 1E1KA 4UEKA 4AJEA 4XQGA 4YJHB 1HYHA 1CQJA 3CSDA 1QR6A 4IQ8A 4R41A 3KYDB 5A06A 3AI2A 2DKNA 4B7UA 3L6EA 3LC7O 1QYWA 4XIYA 1E7RA 4MVJG 2FPGA 5K9ZA 1DBVO 4NK4A 1B26A 3G79A 5IXYA 2O23A 3RUEA 5TF4A 3GAFA 2VHYA 3SXPA 4ZN6A 2YQ5A 4TMFA 2CVOA 1GTMA 3QSGA 3TL2A 5GZ6A 1ISIA 2G1UA 5EESA 5ILGA 2Y1GA 3A28A 2VWQA 4A26A 2NQTA 2GERA 4WGGA 5BNTA 3QRWA 3JQAA 2YQ4A 5EIOA 1WVGA 3DQPA 1VPDA 3SC6A 3JYOA 3IMFA 1P0FA 3GFBA 4CLEA 1AHIA 3INGA 2B5VA 2CUKA 3WGTA 2WSBA 2GASA 3VH2A 2YY7A 1BXZA 3DZFA 1T2DA 1G1AA 3NGXA 4TQGA 3RQSA 2P4HX 1SPXA 5JCJA 4BGEA 2PD3A 4YA6A 1R37A 1N5DA 4R1SA 4NIMA 4UUMA 2OGUA 4P4NA 5TSDA 3UVEA 5JNLA 3BTOA 4UULA 4WASA 4EZBA 1HDRA 3U4DA 5CEEA 1FF9A 2A92A 1CWUA 2ZK7A 4GX2A 1MG5A 2JAHA 4WOJA 4Z6KA 1R4NA 1C1DA 3P5SA 2QRKA 4RQUA 2PD4A 3OICA 4MIEA 5ITVA 2A4KA 3DZKA 1X0VA 3K96A 4M87A 2VOEA 2O3QA 5CDGA 1CEQA 3EVTA 4DIFA 3F4BA 4H16A 5I7SA 3GEGA 3PDJA 2FN7A 4OIMA 4R1NA 5EMHA 1R4MA 1EZ4A 4GPD1 3X2FA 5K6AC 7MDHA 3T4EA 3B20A 3PEFA 4FJ0A 4IM7A 1ENPA 2EW8A 3GVPA 3AI1A 5TNXA 1QV6A 1ADGA 1OC4A 1YOVB 4PIVA 4FB5A 4CM3A 3RUAA 1U3UA 1P1IA 2XXBA 4K9DA 3UUWA 3GN2A 4BO3A 5L9AA 4UAGA 4NQZA 4BO8A 4KDEA 1LRJA 3CMCO 4R5HA 1UXKA 1ORRA 1ISHA 3G3EA 1SOWA 3FF4A 5JDCC 3ZV3A 4AJJA 1ZKMA 4J1QA 4OKIA 4WLVA 3NTOA 4P4LA 2P5UA 2D59A 3NTRA 1DAOA 4LK3A 3ZH2A 4R4JA 3NT2A 5A04A 1VL6A 4BKQA 3WG9A 4PLTA 3WOHA 3TWOA 2H1SA 3MJEA 2DBZA 4CR6A 3IOYA 5CFZA 1B2LA 1UUFA 3Q0EA 4HFNA 4U0KA 3D3WB 4D44A 4FFLA 2Y68A 3HN7A 3OM9A 4JJFA 1NPDA 4GMFA 2W2LA 2BGKA 4UUNA 1B8PA 1PWXA 3L6OO 4LVCA 2Y0DA 2UV8A 2RBEA 1EVJA 1DIAA 1ZJZA 2ET6A 5ITWA 1NR7A 1D4FA 4MVJF 1RM4A 5T8KC 4Q39A 3W8EA 2AEMA 4TVBA 2YW9A 4YT5A 1ZXLA 1ZH8A 4G2NA 3G1TA 5JCXA 4AJHA 3WYCA 3KSDO 4LMPA 3TL3A 1NWHA 4DIOA 4B4OA 4Z9FA 1YBVA 5FEUA 4KUEA 3UF0A 3IIEA 4IGEA 2Q4EA 4R01A 4BMVA 2DC1A 2WYWA 4CPDA 4MKRA 1HEUA 2DTDA 3L6DA 3KYCA 4DBVO 3RSHA 5KVQA 4KTVE 2ZYGA 1GU7A 1P1KA 2QZ9A 4CLXA 4E6PA 3DOJA 3K30A 1FDVA 1F06A 2B83A 1WLYA 3BTSA 3TF5A 1RKXA 2YDXA 5H81A 1U3VA 1ZEJA 5DF1A 4B8ZA 4R3WA 2O4UX 3OJOA 4PG8A 3BMNB 4UVHA 1NP3A 3CKYA 4ND5A 4U6SA 4OGWA 2EWMA 5JAMA 1ISGA 4OJNA 1ZFNA 4DYDA 1HE2A 3QQPA 4XKJA 4LSWA 4YJGA 2VZ8A 1PJCA 3V1TC 3QLJA 5DBFA 5A9SB 4OSOA 3D7LA 3FTNA 1WDLA 1X7GA 4CM5A 2GGSA 1KIFA 1BDMA 4GAEA 4FW8A 1SBYA 1UXJA 3DAGA 3NT4A 3RC7A 1MP0A 4PVDA 2VRCA 4TROA 4BOYA 2IODA 3O9ZA 1LRKA 3WQSB 3WIEA 3G49A 3UFXA 4BNIA 4UEOA 2PKQP 3KETA 2ZB7A 4CQLA 3WMXA 3BTVA 1KOLA 5C3MA 1ZSYA 4IJVA 5BNFA 4CQMA 4F45A 1FMCA 5L7WA 3HJAA 1U5AA 3FRJA 3ZWWA 1H6CA 3GVXA 1GADO 3BMOA 1NQTA 1W0CA 1A4IA 2Q49A 2EV9A 3FNEA 4ONEA 3E5MA 5JAQA 4Z0TA 4YPOA 1W4ZA 3C8MA 2HQ1A 3MJCA 3QWHA 4QUKA 2EIHA 2AMFA 2OFPA 2W4QA 5IDWA 4R1UA 5MGBA 1PQWA 1ZUD1 1L1FA 4DIBA 1U7TA 1WXDA 1SCUA 2Q2VA 2HU2A 3IC5A 3ZWMA 5L3ZA 4AJ4A 5JDIA 3OA2A 4E2YA 5T67A 1Z45A 1QG6A 1VC2A 2DVMA 5B37A 2Q2WA 3JD0A 2O50A 4NJOA 3ZWYA 3ZWXA 4CM4A 2PGDA 4AJLA 4D41A 1HDGO 1DRWA 1N7GA 1WMAA 1JAYA 4XGNA 2JD1A 4WCFB 1MUUA 4E5NA 1EQUA 2FPPA 4DVJA 4YRDA 3QV1A 3GHYA 4PG4A 1SO8A 4AJOA 4YBZA 3LLVA 1NVMB 1UP6A 2A94A 4CM7A 1VLLA 1M75A 2HUNA 2JCYA 2LDBA 4XYGA 1XQ6A 4P4GA 4GBJA 4NFYA 4PFJA 3H9EO 5B4UA 1ZK4A 4ND2A 4J1NA 3LF1A 5I9LA 3DL2A 1V35A 3RASA 2DBQA 2DBRA 4TRRA 3MJVA 1V3TA 5DCWA 4ZA2A 3GZ4A 3NT5A 1D1TA 3VH1A 1PGNA 5COQA 1JW9B 1NFFA 2Q1WA 4XB1A 3V2UA 1E3IA 3HDYA 4OSPA 2ZIZA 5CDUA 4NMHA 1XLTA 5T64A 4NBWA 2H6EA 1JVSA 4CMEA 1E3JA 4KDFA 4BNNA 4IGFA 1HLDA 4ILKA 1KEUA 1ZSNA 4N5LA 3WFIA 4FDAA 5C7LO 2H5LA 1CYDA 4BNXA 1XHLA 3DZHA 1R0LA 1P44A 4L4SA 4M49A 4E2XA 5KVSA 3GRKA 4F3YA 2HJRA 2EXXA 2HMSA 3ZNOA 1JTVA 4K6FA 4YJHA 1LLQA 3GNTA 4E31A 3L9XA 5IF3A 4Z9YA 3HN2A 3KYDA 3DOOA 1R6DA 1A4UA 4G5HA 3WJAA 3ZU2A 3OMLA 1NBOA 4CMGA 4BNYA 4Q9NA 1DC6A 4KP7A 3DBRB 1RM5A 2HLPA 2Q3EA 1P1FA 4FOSA 2VUUA 2VTDA 4NBUA 3D5TA 3EVNA 4BO6A 3Q2IA 2JKVA 1K0UA 3LLSA 4QXMA 1P33A 3HQ4O 2Y1EA 3JQBC 1EVZA 3V2GA 2EKPA 5IN4A 1YGYA 4IZHA 2FP4A 5TGDA 3SX2A 1V0JA 4WPGA 4MIYA 4A7PA 1V3UA 5AXAA 1EE2A 3VTFA 5EINA 1CJCA 3FR7A 4NFSA 2C5AA 2BI8A 3LZ6A 2FOIA 4XD2A 5I7EA 5HRUA 3GQVA 3S55A 1NXQA 3CZMA 3A9WA 4E33A 2J5KA 1DHTA 4IBOA 1NQAO 2YUTA 1J5PA 1TB4A 1RYDA 2HMWA 1UDBA 4U8GA 1MXHA 2V7PA 3L0DA 3JSAA 4MKXA 2HSDA 2NVUB 1K5HA 1NQOA 2E49A 2NU6A 3LK7A 3AM5A 2EG9A 4MPDA 3B1KA 1EK5A 1SNYA 5JAIA 4OQYA 3WGGA 2GDZA 4CMKA 1EBUA 4QEDA 1GZ4A 1QLHA 5AXDA 1VSVA 3DTYA 3GDGA 3AFNA 4IQGA 2AHRA 3WLFA 1UR5A 1UDAA 1Z73A 5CEJA 3ZW9A 3U62A 3C7AA 4XYLA 2C29D 5GY7A 5L7TA 3SLKA 3TZKA 3BMQB 1XDWA 4JBGA 1YO6A 2JAPA 4ALKA 1UAGA 3JYLA 1PL7A 4LCEA 2VRBA 4Y6RA 3ZU4A 4YT8A 2OXIA 3OETA 4WCDA 3TOZA 3Q11A 3IAHA 5FWNA 1QXSA 4AG3A 1PJ2A 3WTBA 5A02A 3O8QB 1UJMA 1YQGA 3O38A 3K6JA 2WDZA 5EN4A 2FY8A 1J0XO 4GSLA 3TNLA 4J0EA 1YOVA 1KETA 4XA8A 5HBRA 1GQQA 4GX5A 5JC1A 2I66A 5F3RA 2ZTUA 3FPLA 4BUCA 1P1HA 1KY4A 5ILOA 1T4DA 1UP7A 2WEKA 4YT2A 1ZIDA 4D7AA 1CQIA 1VJTA 1JDJA 3WSVA 4DREA 3FCOA 3E5RA 1YDEA 3GFGA 5JW6A 4YQYA 3NDRA 4XX0A 3GG9A 4F46A 1B7GO 2PH5A 3OFSA 4OHUA 4ZRNA 5B12A 3TFQA 3VKUA 5CEFA 5LC1A 1HDYA 3AUTA 4FFOA 2C5EA 4JROA 4MIOA 4W82A 4W7IA 5G4LA 1JN0A 3M6IA 3HWRA 1ZW1A 1QKIA 4LSMA 4XQCA 3D3EA 1Y9EA 3V1YA 5A9TA 3WGHA 1N1EA 1E3WB 3FBGA 4Z0PA 3TQHA 2VYVD 1P1JA 4FGSA 4C4OA 3WS7A 4ALIA 1I33A 2ZCUA 1R0KA 2UUPA 2YHIB 3FTPA 2G0TA 3HDJA 3K2BA 2I3AA 3BMCA 2VZ9A 1T2FA 1BXGB 3I6IA 4HFRA 3I83A 4FBGA 4ROSA 4HNGA 1M67A 4OQZA 2Y0EA 4LW8A 1IB6A 3MZ0A 3QY9A 2NTVA 3VZSA 3NUGA 4HNHA 4YDRA 4RPJA 3RUHA 5I9MA 4B79A 3EDMA 1N92A 4NBVA 4CUJA 3G17A 2GD1O 4DC0A 1Z75A 3M2PA 3QVSA 4MVJI 2C2YA 2NVBA 4D3FA 1JKJA 1IE3A 2IRWA 4EYEA 4IY1A 4E13A 3FNFA 3PZRA 2PWZA 4TKLA 3PIIA 1SC6A 4CM9A 3W4KA 4ZGWA 2HK7A 4YB8A 1O0SA 3M2TA 3ZV5A 5JXWA 5HWSA 3PWKA 2E4AA 4FJ1A 3A14A 3DMTC 2NQ8A 1I3MA 1SZJG 1YBMA 3NKLA 3I4FA 2V6MA 1H9AA 1KERA 5JDCA 1I0ZA 2Y67A 5CP8A 3A06A 2C7VA 2B4TO 4B3IA 1QMGA 1ZK2A 4MP6A 4II3A 3ZWAA 3PLNA 3DFZA 4ZICA 5KKCA 2C0CA 1X13A 1DLJA 3IJRA 5AXBA 1PQUA 4OH1A 2W2KB 2DTXA 5HS6A 1Q1NA 3TZ6A 4W99A 2E82A 3ICPA 1YB4A 3OBBA 4TWRA 3K73O 1QSGA 1DHRA 2X23A 1GDHA 5A9SA 5JMWA 3GN1A 3WFJA 4M8SA 2W90A 4W7HA 3GAZA 4HFJA 4JP2A 1HDCA 3L77A 2WE7A 1SB8A 4D43A 1DOHA 4AICA 2J5RA 1EBFA 2CDCA 3WQQA 4RVGA 3ZWVA 1ZK0A 3PZBA 3T7EA 1H6BA 4Q3BA 3ETGA 3E18A 2Y1OA 2Y1DA 4DPLA 1EVIA 1VKNA 5T8KA 3RC1A 2WTBA 2ZTVA 3IKVA 1WDKA 1XEAA 2EJWA 1UXHA 3IP3A 4PLHA 3H2SA 4BS9A 4J7CA 2ZB8A 1HL3A 1E1NA 4HXYA 3ANNA 3AJRA 2G76A 5ES3A 3WBFA 4K1LA 4I8XA 3DXFA 4PLWA 1ZCJA 1F17A 1I2ZA 3H3JA 4BQPA 3WGIA 4YAIA 3VPXA 3LT2A 2ZTMA 5CG1A 3I9LA 3JTMA 4ZRMA 5FI3A 4JJIA 4U7WA 2ZKLA 4HWKA 1G6KA 5G0UA 5GZ3A 4PLCA 3GPIA 4M89A 4RDHA 4DBZA 1XG5A 1AXGA 3ONDA 2O7SA 4ZD6A 5COAA 2PR2A 4J3FA 1C0KA 1VE9A 3Q9UA 2VHWA 1WZIA 4WLEA 4NFHA 4E3ZA 1PU2A 3C85A 4GMGA 2P5YA 1GQ2A 1GZ6A 4QO8A 5LCXA 3UW3A 2G17A 3C24A 1XU9A 1NAIA 2XPCA 1LC0A 4NPCA 4DQVA 3I5MA 3SVTA 3GMDA 5HS4A 1MA0A 3RFTA 1U8XX 1B8VA 3EUWA 4FOOA 1U4SA 3PHLA 5JS6A 4YRAA 1HKUA 2JCXA 2PGJA 4FFPA 4TKMA 1MG0A 3OJ0A 2FR8A 3I9JA 1KBZA 5A05A 3OECA 1NVGA 3QA9A 2JL1A 1XR3A 2Y0CA 2NTNA 2VYNA 4GKBA 5H82A 3INTA 4CMIB 5THKA 1GL3A 1DEHA 3PYXA 1EK6A 1QLJA 1I30A 1PJSA 4O1MA 2FMUA 2EP7A 2GYYA 3C1TA 2TMGA 3MTJA 3KM0A 1E7SA 3NGLA 2EJVA 1ZNQO 1GUFA 5G4KA 3DONA 3N7UA 4NBTA 5IN5A 1WZEA 2X5KO 4DQUA 4MOWA 4QSMA 4DL9A 1X1TA 4OO3A 3WTCA 5B4TA 2HRBA 3DO5A 3U49A 3SJUA 5A5FA 1MFZA 3B6ZA 1LTHR 4NHEA 1PGQA 4ALNA 2PKRA 3AUSA 3N74A 4PLZA 4ESOA 1PL8A 3CE6A 3DHYA 3HNPA 3AI3A 3F9IA 4RF4A 4CL3A 3WGYA 5CHEA 3W4IA 3ZU3A 1Z74A 4BO4A 4BB6A 5IZCC 1NASA 1VM6A 3P7MA 3OJEA 3F3SA 4BO9A 1DSSG 1R0SA 5TJHA 3PJDA 3ROMA 4NZ9A 1EUCA 3IUSA 3ROPA 4R69A 1WPQA 5L4SA 2QYTA 3PXXA 1T2CA 2IE0A 3DBRA 5G2OA 3ZI0A 4CMJA 1KY5A 4AL4A 4IDFA 2HRZA 3DAFA 5I7FA 1DIBA 1LQUA 4PLFA 1VRWA 4IIUA 4D42A 4HKTA 3R0IA 1ISFA 2X9VA 5F5LA 3GZNB 2BFAA 5F1PA 4JLWA 2DU8A 3RUFA 2FR1A 1PR9A 4RVSA 5KIAA 1I5RA 4EITA 2RIRA 1OBFO 1B3BA 4EBFA 2B0JA 3JYPA 1YL6A 3GNQA 3CUKA 3W8FA 1ARZA 1ENZA 4WNIA 5I9NA 1HTBA 3ENNA 2JFHA 4J9UE 3GEMA 4A2CA 2CSUA 1P74A 1H93A 4E21A 5L95A 1IY8A 2Q46A 1E6WA 1LRLA 5JLAA 4BMNA 4M86A 1B8UA 3B1FA 4CUZA 2D5AA 1HYGA 1DRVA 2VNAA 3Q9NA 1XIVA 1DRUA 2QZZA 4DLLA 1UXIA 1UP4A 2FWMX 3DBHB 4BNGA 5KVCA 1EEHA 3VC7A 4I1IA 2EP5A 2CDAA 4IJUA 5DBGA 1C1XB 4YXFA 1NHWA 1Q0LA 3EC7A 4R54A 2EF1A 1LI4A 4RLSA 5BT9A 2DUWA 3PP8A 2C2XA 4BKRA 4XRRA 3OJFA 1DFGA 4IS2A 3UCFA 1UZLA 2BFOA 2Z95A 1G0NA 2IXBA 2ILTA 2DFVA 4CMAA 2XAAA 3I1JA 1QRRA 1N2SA 1CIVA 2PNFA 3LC2O 4WOKA 3HB4X 3RC2A 2ZJ1A 4JP3A 2GN4A 3DHEA 4UEJA 2HK8A 2X1HA 3TDKA 1PGJA 4B7CA 3RU9A 2AA3A 5GMOA 1XGKA 4N7RA 1ZXBA 3U3XA 2DT5A 3RROA 1LSJA 3O8QA 3ZV6A 4D45A 4F6LA 5A1TA 1MFPA 1P0CA 1X15A 3JQBA 3WJ7A 2JHFA 1T24A 1KC1A 4XDZA 5JSFA 2VYVA 4TRMA 3F47A 1YVEI 1I2BA 4RF2A 3KUXA 1SB9A 4YWJA 1KEPA 2Z5LA 4ZQGA 2D1YA 5F1OA 5JE8A 5KOIA 3ZWBA 4RO0A 1PZFA 3GDFA 5IAAA 3PYMA 4MINA 1BHSA 3INRA 3KO8A 2P68A 2YJZA 3ZNQA 2Q50A 1VL0A 2O3TA 4XCVA 1T26A 4QFCA 4D3DA 3ADOA 4A27A 3UOGA 3JD4A 4FD3A 3ZWPA 4Q3CA 1K89A 1LDEA 2VN8A 2NVWA 4BO7A 1HYEA 5H83A 3OJLA 1C0PA 1KS9A 2C7GA 1A5ZA 4E5KA 4MDHA 4DXHA 3KV3O 4S1VA 2RHCA 3NRCA 1XELA 1C14A 2B69A 3ONFA 3FN4A 4OAQA 3GEDA 4XR4A 3ZHYA 3E8XA 1U28A 3KSZO 3VPFA 3MOGA 1DFHA 3RJ9A 3GLQA 4CM8B 1E5QA 1P1RA 1DJQA 3S8MA 1DO8A 1XSEA 4ALJA 3JQ6A 5DP1A 4LVUA 3RC9A 4WLUA 2FPIA 3EZLA 4GVXA 4D79A 4B4UA 3JV7A 1HSZA 4RDIA 1WDMA 2B35A 4WCFC 3RVDA 4JXKA 4E4YA 3DDNA 4K28A 3GRPA 4YT4A 1PIWA 1ONPA 1R16A 1JVBA 1MX3A 5KJEA 4EUFA 2ZQZA 3GR6A 4RVUA 3ZHBA 3WMWA 2E48A 1PQPA 2P9GA 1IOLA 4PG6A 5IJZA 4M1QA 4MVJH 3LYLA 4XYMA 4BNTA 5ENDA 3UKOA 5DOVA 5AXCA 3HFGA 2OUIA 4JJGA 1LBEA 2PK3A 1I32A 4MO2A 3RCBA 2P2SA 2AEFA 1A7AA 3I9OA 4UVEA 1VKOA 2BMAA 1GYPA 3DOCA 1O94A 3E48A 2JJYA 3FI9A 3K9QO 1XA0A 4NJMA 1I36A 4B3HA 4YVFA 4RVDA 3WYBA 5IXSA 3RKUA 3QHAA 5I7VA 4QECA 5A4DA 5BQFA 2W2KA 4A5OA 4OXNA 3UXYA 4C7JA 4GWKA 2Q2QA 4BVAA 1Y5MA 5L45A 3H9UA 1MGOA 2VTEA 1LQTA 3PQDA 3PYLA 1F0YA 3BHMA 2POQX 3RBVA 4DC1A 1M6HA 1KVUA 3FPCA 2CF6A 4HP8A 1F14A 1YL7A 2Q99A 4XYEA 4DLBA 2IYPA 4Q3AA 2DM6A 3AY3A 2BHLA 4BNJA 2HO5A 1DXYA 3TJRA 2FRDA 3RU7A 3X2EA 1RJWA 1ZVMA 2HMUA 5JY1A 4XDYA 6LDHA 3VOSA 1E7WA 2AQKA 3W1VA 4MP3A 2HMVA 2BGLA 2R00C 3ZWOA 2O3RA 9LDTA 3U09A 1DDOA 4OOFA 4L74A 4WNCA 4FIZA 3CZRA 3U5TA 1PJ4A 1NYTA 1X7HA 1ISMA 3AY6A 2DPHA 4R51A 2J8ZA 3AUAA 5F21A 3OQ1A 3JQ9C 4ZQFA 2UUOA 5KCZA 1Y1PA 4B8WA 1RM3A 1GEGA 1U3TA 3DFUA 5HA5A 4BKOA 1FDSA 4GGOA 4CV1A 1PZHA 3DMTA 5FF9A 2GSDA 1LDNA 2BH9A 1YB1A 1IPFA 4J16A 4CLRA 4HBGA 1PX0A 5TX7A 2YFHA 4BKPA 3F1KA 3QWFA 5ADHA 3E6AA 1PJTA 3MJTA 3FBTA 2X0JA 3MTGA 1EUDA 3ST7A 3ZNPA 5BSEA 1NNUA 1W8DA 2IXAA 1IZ0A 4GGPA 4J49A 1UZMA 4E5MA 2FSVA 4IDBA 2OHXA 9LDBA 1GFSA 1DIRA 1VJ0A 4E2WA 4YEDA 3LT4A 3IUPA 3QP9A 1HE4A 4LISA 4PG7A 1PTJA 2NNLD 3QVOA 4E32A 2O4CA 3KEOA 3VPGA 1YONA 5C37A 3VTZA 4A0SA 3I9NA 2FZEA 1Q0HA 1LLCA 2GN6A 3BHIA 4JQCA 3PGJA 3PWZA 2OP0A 4IXTA 3C1OA 3OIFA 1W73A 4A03A 3P2OA 2XF8A 1YXMA 3C1AA 3PFWO 3FNHA 1IYZA 2WYVA 3PTZA 3UICA 1MXFA 3PIDA 3JQCA 3WXBA 5DZSA 4DGSA 2EEZA 2NADA 2TMDA 1V6AA 3B70A 1YQXA 3JQAB 4Y98A 1EVYA 3ZDFA 2O2SA 2P4QA 2ZQYA 3N58A 2RAFA 3D64A 3CEAA 4RZHA 4YYZA 2PV7A 5A03A 2GO1A 1RWBA 2PY6A 3GA0A 4GQAA 2YHUA 1L7DA 5G0WA 4BQRA 4JN6B 5L51A 1NX6A 1A72A 4DQXA 2UYYA 2VHVA 3O26A 5J23A 4R9RA 2YDYA 4BIIA 3H5RA 4BO0A 7ADHA 4Z3KA 4I9UA 2YV3A 4PLGA 4BNUA 5KNLA 3DB2A 4Y67A 3W4JA 5IDXA 2HK9A 5TLSA 1QORA 4J1TA 4EDFA 3JQAD 1O9BA 2O7QA 4ZVVA 5ER6A 2JD0A 1O6ZA 1PS9A 4I5FA 3S2IA 5CAEA 2WMDA 3TZHA 3A1NA 3V8BA 4XEHA 2ZB3A 4OM8A 4RLHA 3IJPA 3WX0A 4TZKA 1I24A 2B36A 2G82A 4GKVA 1LDYA 5JCJD 2H9IA 3MJ4A 5DDIP 1UAYA 3Q6IA 4HV4A 3H6KA 4JBHA 3CMMA 3HG7A 4IDEA 3S2EA 1O95A 2Q4BA 1YE3A 4BNFA 3NV9A 2OP1A 4N54A 1FXSA 1I2CA 3PGXA 4J0FA 1MB4A 3E82A 1E3LA 3D0OA 3Q1LA 3QE3A 4RJTA 2X5OA 1EQ2A 1YBAA 4JBIA 2VWHA 1GPDG 1XWFA 3ADPA 1PZEA 3W6ZA 3AW9A 3S2FA 2ZTLA 4QFDA 2VCYA 5DBIA 4UUPA 3HDHA 1BVUA 1R15A 2GPTA 3JQFC 4A10A 5U9CA 1HDXA 1VJ1A 2YV1A 1PGPA 4KTTE 2QG4A 5HTOA 3DBHA 1LDMA 2NU8A 1EDOA 3HADA 1P9LA 4G65A 1VI2A 4EJMA 1E7MA 4RV9A 1C1XA 1LDBA 1JU9A 4LCJA 4BNVA 2X0RA 3KTDA 4J1SA 4BMSA 2DPGA 3EMKA 2P9EA 3GMSA 4IIVA 4B7XA 4LN1A 1U1IA 4Y8VA 1D8AA 4YAGA 4B3JA 4CMBA 2NV6A 1G0OA 2WYUA 5CDSA 1V3VA 4FC7A 2WM3A 3JYQA 4ALMA 1T2EA 5IZCA 4L8VA 4J9VA 3HFSA 4TRJA 1M76A 5A9RA 1E0DA 1Z7EA 1PEDA 2BFMA 3V5NA 3WGOA 1N8KA 2VZ0A 3VPSA 5TC4A 1HWYA 4J90A 3FR8A 3WR5A 4ZQBA 1TT7A 1BWSA 3D3WA 4KMSA 1DPGA 1BGVA 1YB5A 1YJ8A 3G1UA 1ADFA 4HX5A 1HDZA 3STHA 4XYBA 5DCUA 1TA4A 3QWAA 5FFFA 3WQRA 1H9BA 1T2AA 1E6UA 1XYGA 1B15A 3MCVA 3AOEC 3JQEA 3S1LA 3FNGA 5AOVA 3RAJA 2CFCA 4JNKA 2EGHA 4CL8A 2B37A 3BAZA 3ZZNA 4DRYA 5TIIA 4R9SA 4AJKA 4PRLA 2W2LD 1B0AA 2VT2A 1PJQA 3EHEA 1GZ3A 2X22A 3RUCA 3KYCB 1X7DA 1CF2O 1GR0A 1LJ8A 2C20A 3H5AA 3PJFA 1HRDA 3C7DB 1OI7A 3V2HA 3NDIA 1YQDA 2NLOA 2Q1SA 1NFQA 1S7CA 2NSDA 1O8CA 5COBA 5DCYA 2AQ8A 4JK3A 3SLGA 4NU5A 5DNAA 5G0TA 1Y6JA 2NU9A 4E5YA 4J4HA 4AJPA 5JO9A 4II2A 4FC6A 1I10A 3GHHA 4K6CA 1TI7A 3IL2A 4DLAA 2PZKA 4GSKA 4O0LA 2WWRA 1JLLA 2P91A 5DOZA 2BFPA 4CM8A 2FSSA 3QWBA 4UVIA 4XJSA 1C0LA 4EGFA 3VVBA 3R6DA 3PVZA 1LA2A 3BMNA 3GVIA 4OXYA 5K0ZA 1FK8A 3CXRA 3VH4A 2F00A 3U4IA 2GN8A 2X6TA 4QX6A 4N5NA 4BGIA 5I8ZA 3AM4A 3PQFA 4KQWA 5L53A 4EI2A 2EGGA 3ZWNA 4CQMB 1HE3A 4KUHA 3JQGB 2G5CA 4TVOA 4FFRA 3EGOA 4Q3EA 3L4BC 5EL0A 3VDQA 5IFLA 4KZPA 3H9GA 1E1LA 1H6AA 3BMOB 2BELA 4YR9A 3KVOA 2AG5A 3P19A 4I5DA 3DEYX 3KOUA 1OOEA 5ER9A 1E5LA 3K92A 1XQ1A 5G0VA 5EQDA 4IDGA 4DMMA 5C5IA 4BV9A 3WGZA 1IHYA 1LSUA 1F12A 3GF4A 1E7QA 3AFMA 4ND1A 5F1KA 3WNVA 4WJZA 4YTEA 2Y66A 3DBLB 1I3NA 3AOGA 4XWYA 3FSRA 5KJFA 4RPHA 3HUDA 4INAA 1JAXA 3TFOA 3GVHA 3NAQA 4AFNA 3GH3A 4CQMD 3OSUA 1F8FA 1DLIA 2JHGA 1MC5A 1OZAA 4IZIA 3JQDA 4L4RA 1S6YA 4M54A 1ZK3A 5BSFA 3GY0A 2OBYA 3M1AA 4CM4B 4Q3NA 3HB5X 5ICMA 1RM0A 4DWVA 2DBVO 4LRTB 3DAPA 4R68A 3RD5A 3W6UA 5F5NA 3KHUA 3KRTA 2A35A 1AGNA 2NWQA 3K8ZA 3ENKA 3F1LA 2YV2A 4DTIA 1H2HA 4FN4A 1LLUA 4L9RA 1A9YA 2BI7A 3BXXA 2O3SA 4U6QA 3WICA 4ND3A 2W98A 3E9MA 4S3MA 3MWEB 2R6JA 3DMYA 3NJ4A 1JWAB 2I6TA 4YACA 4W6ZA 5HM8A 4XZ3A 3JQ7B 3ON5A 4WCFA 3TSCA 1KVRA 1ZEMA 4PRKA 1H94A 3AM3A 4O6VA 4MJLA 4OXKA 1YRLA 3RBXA 1YDWA 2X86A 3GUCA 2Q45A 3OHSX 4PZCA 1R12A 1XCBA 4X54A 5JY6A 3KBOA 2PH3A 4I5GA 1W6UA 1XU7A 2WD7B 3GVCA 4C7KA 3QWIA 4R1TA 3E9QA 2OO5A 3HDQA 1XKQA 1FDTA 5U4QA 2GZ2A 3W8DA 1HSOA 5KJCA 1I8TA 2D2IA 2RH4A 4TSKA 1V8BA 3ULKA 4DYVA 5T5QA 2DAPA 4J6FA 1PWZA 4CUKA 1BDBA 4R3NA 5BSHA 3R3SA 3O4RA 3L07A 3RFXA 3DBVO 3LC1O 3G0OA 4FPXA 2JFGA 4NR0A 3V1UA 2RHRA 4D3SA 1Y81A 4BO2A 3UGKA 3I23A 4CLHA 3H2ZA 4NNJA 1Y9AA 3GK3A 5DP2A 2CVQA 3R3JA 2J3IA 3UH1A 2D4AA 3WB9A 6ADHA 3F46A 1IL0A 4Z9XA 3H7AA 1Q2XA 1Q7GA 3HSKA 4YJFB 4A73A 2OMEA 2AE2A 3WLEA 1B14A 1ZMTA 1E92A 5ICSA 1NVTA 3C7CB 1BSVA 3I6QA 3OEYA 4FFMA 1PJBA 2QRLA 4AJ1A 2NU7A 2OZPA 2CD9A 1DIHA 2J3HA 2UDPA 3AU9A 1E3SA 2BF7A 4H15A 1TT5B 5THQA 1SEVA 2HAEA 5A3VA 2XOXA 2I3GA 4XJTA 5A5EA 2PTGA 5T57A 1Y5RA 3WIDA 5B4VA 2R00A 2VNSA 1LLDA 1A7KA 3AK4A 3LT1A 5DT9A 3BA1A 3ZGYA 4Z0HO 3VVCA 4OOEA 2O2YA 2PKQO 1LX6A 2ZB4A 5L7YA 1AUPA 1NHGA 2HJSA 4RF3A 1Q7BA 2C07A 5TJ9A 5KVVA 3JQ9A 3WBBA 4QQRA 3WDSA 5JPIA 2J6IA 2JFFA 1X14A 2CF5A 2HDHA 4NDNE 4QT0A 4XQ9A 2HMTA 1GPJA 4YRBA 5B1YA 1HZJA 4RVHA 3CTMA 1ADBA 2VHXA 4CV2A 2QQ5A 2Z1NA 2AW5A 3ETDA 2Y1CA 4AVYA 2AE1A 4J2HA 3C3XA 2HKIA 1J4AA 1YJQA 4RZIA 3PDUA 2GLXA 3E9NA 4XGKA 4B4VA 4WECA 4BNWA 5TRTA 4DA9A 5GZ1A 4RPKA 4IDDA 4ALLA 4TZTA 1QV7A 4D0RA 2I5PO 1HDOA 2NVUA 1U2GA 1GEEA 4NH4A 1ZJYA 4CV0A 2AG8A 2AXQA 4CMCA 1X1EA 3NYWA 1LXCA 1X0XA 2IEBA 2RCYA 4ZQEA 2PA3A 5L4NA 1AXEA 3RWBA 1F8GA 4Q3DA 1E3EA 3PK0A 5TS3A 2E37A 1EDZA 1RPNA 1NPTO 3BMQA 4CLDA 4H7PA 3RJ5A 5LDHA 1WWKA 1J49A 2D0IA 5JAZA 2CDBA 4CLOB 2Z1MA 1HETA 1OAAA 3RFVA 5T6BA 1KC3A 1LDGA 3JYNA 1U5CA 3KB6A 3CIFA 4MVJD 4RPGA 4CR7A 4FS3A 3RIHA 4UUOA 1JQBA 5TT1A 4FCCA 4BKUA 1T1SA 3A4VA 1Q0QA 1LSSA 3RUDA 4BGVA 3ASUA 4IDCA 4J2OA 4RORA 3ZU5A 3COSA 3ABIA 4PGFA 2QRJA 4Y6PA 4GLOA 1DAPA 4HUJA 5C7OO 3GGOA 4CMHA 1M6WA 4GVLA 1GCUA 1DC3A 2ZYAA 1QYVA 3GC6A 4MKZA 3JCZA 4R5MA 3LU1A 4RGBA 2QX7A 2IEDA 3L9WA 1TXGA 3DHNA 3BMCB 2WJPA 4NG5A 1PZGA 4J43A 4RL6A 3SC4A 1DJNA 1E77A 4IMPA 2V6GA 1E3WA 1M2WA 3SJ7A 5JYEA 2PLAA 4H3VA 3H4VA 1SOVA 3TRIA 2V65A 5EERA 4CV3A 2VWGA 2FZWA 2WE8A 1EE9A 3FHLA 2YHIA 2NACA 3OEWA 3RBZA 4XRGA 2IYOA 2AQHA 1BXGA 1H2BA 2GZ3A 1VSUA 3KEQA 2FHSA 3PWSA 3WWYA 3T7CA 3FWZA 4F6CA 5L4LA 1JA9A 1BW9B 1I01A 1KVSA 5LDGA 2PD6A 1HF3A 3UAGA 4IMRA 1DC5A 4Y9DA 3VHRA 1KVQA 4BL5A 4YQZA 3H3FA 4RVFA 1UH5A 3K5PA 1C3VA 3JQFA 1U8FO 3DZJA 2I99A 1A9ZA 3JD2A 2R2GA 2VQ3A 4FR5A 2X9GA 2J3JA 4G81A 5A3JA 1R66A 1P45A 1J6UA 3VZRA 2GUGA 4N5MA 4ZJUA 1T4BA 5IDYA 2PZMA 3WYEA 2B4RO 1YWGO 2O48X 5JFOA 3OF2A 2YZ7A 4RPLA 4W9NC 3D4PA 4KUGA 3LSYA 1LUAA 3KSUA 2GCGA 1U4OA 5BR7A 1DB3A 1ZMOA 1H5QA 4CM9D 2EKLA 2WD8A 4MVJP 3ROQA 3H65A 2X0IA 3PLRA 4NI5A 1AHHA 4HY3A 3PHJA 2CNBA 4O5OA 4QO7A 3GG2A 1NPYA 1DC4A 3RKRA 4J4BA 4EJ6A 3SBOA 2QYSA 2BLLA 4CODB 2YFQA 3DR3A 4WUVA 4CM1A 1HT0A 4O59O 3QVWA 4WLNA 2VUTA 3JQGA 3ZHXA 3D4OA 1CRWG 4IUYA 1K2WA 1Y8QB 1QYCA 4WEOA 1H0KA 4E2ZA 3OH8A 4P22A 2A9FA 1BXKA 3ASVA 3ZV4A 3O03A 3RUIA 1Y7TA 3IQDB 4IPTA 2BRUA 3AOEA 3HZZA 5DULA 5KJ1A 3WWZA 3JQ8B 2VOJA 3NJ8A 2DQ4A 4FGWA 3ZW8A 3GGPA 2OBNA 4AJNA 5TQVA 1UDCA 3PI7A 2SCUA 4J91A 2JCVA 5IG2A 5EJ2A 1GY8A 2DTEA 4EJ0A 4DUPA 4EUHA 1UXGA 3DBLA 3QIVA 1Y8RB 1OFGA 1E7YA 4WE3A 4BNLA 4RF5A 1O89A 1MV8A 4XQEA 4D0SA 3SEFA 4L76A 8LDHA 2FR0A 1PJ3A 1WW8A 3JD1A 4L75A 5JO0A 2X8LA 3ETEA 3AU8A 3F6YA 4ND4A 4WKGA 2C54A 5C7IO 1OC2A 4URFA 1IUKA 4P8RA 1BMDA 1FJHA 1PS0A 1BG6A 4JGBA 5KKAA 4R16A 2BD0A 3R1IA 1VL8A 4MVJM 4OKNA 3OIGA 4PLPA 4RQTA 1K3TA 4PLVA 2PZLA 3ANLA 5JBIA 1N9GB 4BO5A 3K31A 2IZ0A 1QYXA 4UVGA 3GUYA 3JQ7A 4GWGA 1E6EA 2X9NA 4L4XA 3NEPX 5KTKA 1IHXA 3H5NA 3L4BA 4YJDA 4L73A 5G4KB 3H9QA 3U4HA 5BSGA 1HXHA 2J5QA 4D46A 1D7OA 4CMIA 1AN9A 3U9LA 3MWDB 3E1KA 2WD7A 3OQBA 3MEQA 1YKFA 3IS3A 1ZZEA 4E5PA 1TLTA 1OMOA 1TVEA 4HFMA 4I9HA 1BTOA 1I3KA 1TEHA 2VYND 3EY4A 4FSHA 4Y6SA 4N18A 2EHDA 1D1SA 4JIGA 4YAJA 1A27A 3UCXA 1EUZA 3F5QA 4YCAA 2H63A 3IP1A 5TT0A 4BNMA 3H8VA 3AUUA 1ZBQA 4IQ0A 1T25A 3KZVA 1AE1A 2QIOA 3PJGA 3QJ5A 3ZN2A 1NTOA 1ULUA 1V9LA 2LDXA 3CH6A 3D4NA 1M66A 1ONNA 2E6UX 1SAYA 5CPBA 4OMUA 4YJFA 5KWEA 3ONEA 4FQ8A 5L40A 1ML3A 1YH3A 4Z3DA 1LNQA 2UAGA 1P77A 2X58A 3DZGA 4BNZA 3NX4A 2DUUA 4QTZA 3TZQA 1Z6ZA 1QP8A 1TT5A 1R4NB 2ZYDA 4U0JA 1C1DB 3CPSA 3NDJA 1N1GA 1WMBA 1GYQA 5EPOA 1A71A 1NWCA 1LSOA 2EKQA 2OOSA 2CY0A 3I4CA 1R4MB 3P2YA 4W4TA 3KLPX 2C59A 3HHPA 3GZNA 3BYZA 1MC4A 3TZCA 3TPCA 4B4WA 1ADCA 2XXJA 5CDTA 1PGOA 2AEJA 4J4TA 1Z82A 2PZJA 3DWFA 3UCEA 3MJSA 2IZ1A 3LDHA 2X4GA 4IXWA 4PN3A 3VDRA 4K26A 3BZUA 2D3TA 4WLFA 2GRAA 3HE3A 3VZPA 1MLDA 1FDUA 3PFFA 4XR9A 2Y05A 3ORFA 1SEPA 1YL5A 3BHJA
chains in the Genus database with same CATH superfamily
2Z98A 3I9MA 4KK4A 3I6ZA 1FTQA 2V6FA 2R6R1 2Y27A 4DPKA 3T3NA 1OGYA 3K9WA 3D5QA 3W8RA 3HO1A 1G63A 2PJRA 1QOQB 4TL9A 2GB4A 1CZKA 3REQB 1A9XB 1EIWA 1P3DA 1VPTA 1YNOA 3KHTA 2PGLA 3OQ6A 3CNLA 3AJEA 4EO9A 4WKNA 2ZCVA 5IF9A 2VP5A 3CZPA 3OLXA 5E4TA 5CH3A 1BQ3A 4JY7A 4LV5B 4R2HA 1LEHA 5JAOA 2QUBA 1O96B 5LQUA 4NMWA 5ALGA 1TK2A 3D6AA 3ANSA 3MF4A 1AK2A 1IULA 3AESB 3LVFO 1KGDA 1FRVA 3PL1A 2RGNA 3CT4A 5FWXA 5IT4A 1MPXA 4HH4A 1SKQA 2DHQA 2LRHA 2ZYRA 2V1UA 2PCLA 3ZIDA 2ISSD 3F3KA 1GTL1 4GX0A 1ID1A 3I9KA 3STUA 2D8AA 3D59A 3GEEA 2ZAOA 3AHCA 4U5QA 3KXDA 5CYFA 2L82A 5D2CA 3U37A 5JC8A 5K0CA 2GPJA 4Y1EA 1OR8A 4BB5A 5LQAA 4AJ9A 4JXXA 4BMOB 1S7GA 5A4IS 2XZTA 4B2LA 1VLZA 5I4KA 4B46A 1N0IA 4QQNA 4MYDA 3KTFA 4YAKA 2GPNA 3KCQA 3W3AD 1D4ZA 4PZEA 2D3WA 3GOHA 3CR7A 2DFDA 3R6WA 4AZWA 2VCEA 3PPIA 1U1DA 1XOIA 3EK2A 4U7FA 1C5KA 4MVJE 1J39A 5B1IA 1AF7A 2QYOA 3ORHA 4JLNA 4ER3A 1D6NA 3IPLA 3LT0A 4TT3A 3SBEA 3SZOA 1YGPA 2C2OA 2ZE6A 2OORA 3WMEA 1T3TA 3FXAA 3SHOA 2YHBA 1WUYA 1C0EA 1Y3DE 3GFPA 1BVHA 1P2UA 4ZO7A 5CM8B 2MJLA 3HCRA 2BVNA 4HQNA 5DTEA 4G24A 2WUFA 3PPVA 5I9TA 4ZHSA 2QNBA 1RBZA 2CLHB 4ODIA 3EGIA 4K0KB 5KINB 1E2LA 3I52A 2JPDA 1B16A 5DM60 3GJZA 1MABB 4MYHA 2XDYA 2G8LA 3R4CA 5ABPA 1ITZA 1ENOA 1ZISA 2HADA 2ZG6A 3MERA 4PXAA 3OM8A 4PYRA 3SYTA 5KYXB 4BX2A 3BBPA 5REQB 4LY0A 4YJGB 2IDZA 1X9IA 3LY5A 1SH7A 2AG0A 2XE8A 3S2GA 1C0IA 3UQZA 1NVBA 1I4TD 3RSSA 3BOSA 4YMHA 3AV0B 1P7YA 3KYBA 5IDVA 4EG4A 2WU8A 5IWCA 5AR1A 2ODTX 1H8EA 4BUJA 4KO1S 1JKIA 2SKDA 4V24A 1VI5A 4JGIA 5AJTA 1SVKA 3UMCA 2RBGA 3VHLB 2ZJ5A 3HXLA 3IMKA 4GI2A 4J94A 4JJ4A 4CJXA 5EJ8A 1N6PA 2BBWA 3WA7A 1ECFA 3O84A 4RQAA 5G3ZA 5F9HA 4JX8A 4KGXA 3EZXA 1KEWA 4CKYA 4MPJA 5BW8A 1M2FA 1EGMB 3QENA 3HM2A 4BBZA 4EPWA 1Q1ZA 2CCJA 4PVCA 1MR3F 1Q0PA 4N76A 1CHDA 10MHA 1U8EA 4ANFA 2EARA 3SXUB 4IWYA 1U90A 1W6RA 2A78A 3RI3A 2H0AA 5C4MA 2MIIA 4G1BA 2PL1A 4GL4A 4NJMB 1KAQA 2XNKA 3PPYA 1OYVA 2XA1A 2ZWPA 1QO0A 1QHHB 3AHEA 1FIUA 2D5CA 1JG4A 2W93A 5KPDA 2B61A 4PNHA 2X2OA 3IMEA 3AB3A 4WK2B 1U2DA 2O3JA 2ANCA 3A3YA 4LNUB 3W5HA 3W2TA 3WADA 2VRCD 1HR0B 3RRZA 2FCAA 4RWEA 1GAXA 1LC3A 3LP5A 4JKIA 2QTMA 3UK6A 3P9CA 5IKPA 2GHTA 4FI3C 3EEOA 2EERA 1EFLA 2I1QA 2Y1FA 3H6HA 3JATA 4ZOQI 4Q0MA 2I65A 2ZSEA 2C04A 1NJ2A 3EDYA 5E9JA 5KC8A 4COOA 2QRHA 1AUVA 3AUXA 1ZO8A 2DECA 2IZZA 3L4SO 4NOLA 4KWHA 1D3AA 4HCJA 1RQ2A 1XZHA 2NTJA 1DQNA 2HCTA 2R86A 2ZRKA 1BC5A 3BGOS 3KQQA 5DI3A 1EINA 3PC8C 2V5AA 2LW7A 3ELBA 3AKEA 1FUKA 3E7FA 4KO2S 4WK6A 3PDIA 3VR3D 1TVKA 1O5IA 4ZVOA 2O5RA 1Y8QA 1ZJJA 5MDHA 2JLYA 3T4PA 1CUJA 2YX1A 1BVRA 1K5PA 2XMRA 3ECSA 2YYAA 3D1LA 3ITNA 3IKTA 3HKBB 4F4FA 2J4FA 5CJ2A 1O54A 1IZ9A 2GJ8A 3OT1A 4Q9LA 1CDEA 3JQ8A 1MEEA 4V03A 4IDAA 4XGIA 3EHDA 4G5SA 4J7XA 2YRXA 3E1GA 1IIRA 3IDSA 1XV5A 4IJKA 3ILXA 5JJKA 1FBNA 2NUAA 3STXA 2O3UA 1UZNA 4TOIA 3VKHA 1ZD8A 4OYRA 1I5OA 2VDWB 3EAGA 3PJRA 4I08A 1KY3A 4BAZA 4EHAA 5EJGA 1WF6A 1ZONA 5C8VA 1Y8RA 2J3EA 3A3KA 3KWLA 1W44A 2J67A 4IJSA 1M34B 2H31A 1IBCA 4UASA 4Q9JA 3Q2KA 3IVCA 5K8LA 4BWFB 3MOIA 2HU8A 5DN9A 4CLRB 3AINA 1MB9A 4RE5A 1T15A 2O0HA 4X1IB 4DR2B 3ABQB 2VWPA 3CFYA 5KJ6A 1UFQA 1G6Q1 3UAWA 3DE2X 1FDWA 3JD3A 4R1LA 4BNKA 2V45A 1SOUA 4RA6A 4F0JA 1G4AE 1PSDA 2QE7A 4B80A 3LDAA 3Q3CA 2JFUA 3FM9A 5JMPA 3FRHA 3QH4A 3VZQA 3FGZA 1R9NA 3TOXA 2BM0A 1N7HA 1NKSA 1ZD5A 2GD6A 3W5CA 1J20A 3ZCXA 4ID9A 5IMSA 1OBCA 3OE7A 4YRTA 4CM6A 4YRZA 3NMUF 1UBEA 3GRUA 3I2FA 4V0SA 1IMOA 5C81A 4UVDA 1GZ7A 1VL2A 4DG8A 4FFNA 1YRBA 4BCDA 3FZEA 5IZ4A 1NBIA 3UW3A 1E1KA 1VE3A 2XQJA 4YJHB 1IQUA 1QCZA 1FFXB 2GBLC 1YULA 2WJVA 4IQ8A 1II8A 4F9FA 1R9MA 1FSGA 5JWRA 3L6EA 3LC7O 4Q1CA 3UK1A 5B36A 2MSEB 1I14A 3J80A 1TQDA 4EJSA 3AR8A 2MSKA 4IR7A 1X7XB 5IXYA 2VDQB 3A1TA 5TF4A 1E9BA 1QF7A 3UJ6A 1DBSA 1UZUA 1Z5WA 5ANRB 3HB9A 3DMNA 4H7IA 5DW0A 3QPUA 4G07A 3OD1A 4TUYB 4NONA 3PGKA 3QSGA 1RRKA 2I6QA 3H1AA 3ZWKA 3FUXA 4DR4B 2H2HA 5K8IA 2VYCA 2FUKA 4GMHA 1XT6A 821PA 5ILGA 1JG3A 3EWIA 1FA9A 2AZDA 2IOQA 2VWQA 2NQTA 4H35A 4KFRA 2YTZA 4Q05A 2ZZKA 5F3WB 1PEYA 2O7RA 2VP3A 1SXJA 3E0XA 3NNNA 4NDZA 3QRWA 3JQAA 5IWAB 3HKDB 5EIOA 2JEZA 3ROFA 4OREX 4UTXA 3GXBA 2OA0A 4J7AA 1B6RA 3IMFA 1P0FA 2Z2JA 2C5SA 4UOEA 2UXBB 3ETJA 4UHEA 2V03A 1OTHA 2BV3A 4TQ9A 2B5VA 4H9GA 3TOSA 4P3NA 1CZHA 4MYSA 4KCGA 2GCIA 2FDRA 5EFOA 1E8DA 2XSZD 4TQGA 3RQSA 4BGEA 3TDNA 4Q03A 1CJKC 2BGWA 1E2UA 1G9TA 4L9WA 4I4LA 3SSNA 1OROA 4BJ3A 5JJCA 1HK7A 2OGUA 2GBIA 4P4NA 1HQKA 4BVKA 5JNLA 3ZCRA 4EZBA 3D6HA 1C4XA 2OZLB 4AYTA 2A92A 3NBFA 4LDQA 1MIHA 2B8JA 1VBFA 5AHXA 5AKYA 4Z6KA 4Z5XA 1S3FA 2QL7A 2DFTA 4JJ8A 2QRKA 2R6ZA 2AJTA 3OICA 2X6QA 2PO7A 2ZEJA 3K96A 5CDGA 1J2EA 1CEQA 1FEZA 1QH9A 3EVTA 1OZ0A 1XYVA 3ENZA 1W5SA 3F4BA 3K8QA 1U9IA 3QBJA 4HXEB 2OV4A 5KYUA 4GXRA 5G1OA 1JQ5A 3COZA 1AO3A 3KL2A 1BZYA 2NV0A 1GGJA 4JVSB 4QDKA 4Q24A 2I54A 5K6AC 4FE7A 1XROA 4QYIB 1N2EA 1SXQA 3T4EA 5JXIA 3RSGA 3W90A 1UODA 3OMWA 4IM7A 2EW8A 1JFTA 3GVPA 3GL9A 5TNXA 1F2DA 1T13A 3COVA 3QIAA 1IG3A 4IQFA 1ADGA 2R5WA 5DTRA 3WG9A 1OC4A 1RRCA 4PIVA 4LC1A 1N2IA 4M9SA 3D6VA 3RUAA 3I6BA 3ZY5A 1P1IA 1HG1A 2YS6A 3WIUA 4UAGA 3HVIA 5CXQA 5TQJA 1KFKB 3IEMA 1VLJA 4BO8A 4KDEA 3JALA 4OBBA 1G20A 4R5HA 5HIKA 5JMOA 1EWTA 3AETA 3TIFA 2VFAA 3G3EA 4JYBA 4JOBA 5CURA 3T99A 3GP8A 2QL9A 1SQ6A 3PRKE 5JDCC 1ZKMA 5CLLA 3NTOA 4P4LA 4XX0B 2E5WA 2WWIA 3H0CA 3NTRA 4LK3A 5AOBA 4Q93A 3REQA 2ZI7A 3FMGA 1KSHA 1NTRA 1RYFA 2Q1YA 5A6SA 2C8KA 1C9MA 1NVKA 3LVRE 1CB7A 2IPLA 4H7DA 4PLTA 1UJCA 1Q95A 2ZUUA 5P8WA 5GVSA 1Z4NA 2PVCA 2YVUA 4BN4A 4JUIA 2YMQA 3QOXA 5J43A 1NLYA 2CVHA 4HNAB 5CFZA 2W2TA 3Q0EA 4HFNA 5EY5B 3D3WB 4GM1A 4UMDA 1O96A 3Q3JB 3QPAA 1YZQA 3M6WA 2W2LA 1Y63A 2QSZA 5LA6F 3GP3A 3X44A 4B3SB 2ZIUB 1JSRA 2IXEA 1U1CA 2E2WA 3S28A 4ZVTA 1ODTC 1H1TA 1R4AA 3AIOA 5ENZA 2WMYA 4A36A 4POAA 3D43A 5HCNA 1NR7A 4EPVA 1WB9A 3W8EA 4Q39A 1A04A 1TZ2A 3JQQA 1Z16A 2M6SA 4IKEA 1A9SA 3RM3A 2YW9A 3CJTA 3CB2A 3A4LA 3P9RA 4P3OA 4YT5A 4GKKB 1ZH8A 1Q21A 4LC9A 3EZ6A 3W77A 1FXWA 4LZZA 1FQKA 1EM6A 1SBZA 5FR1A 3EPKA 3FDZB 4H4DA 4AIIA 2G0AA 1VIVA 3KX2A 3NHJA 3PDWA 1DQSA 1NVFA 2RI0A 3TEMA 4AWBA 4KUEA 3UF0A 1E18A 3IIEA 1K6EA 3MUFA 2DC1A 3BUSA 4GS5A 5MHTA 2DTDA 5K4GA 2PS0A 4DBVO 1EDEA 4YUWA 4P33A 4JT9A 4QUEA 3CNHA 4YRQA 1M8GA 5AVTA 1GU7A 1P1KA 1ZMXA 3PR2B 3HZOA 3EVAA 1U0FA 1L7QA 1SBCA 5LZ8A 1ZQ9A 1FNNA 3K30A 5C2JB 3QBTA 2B83A 1F06A 4OI1A 3EMDA 3Q8MA 3G88A 3EAQA 3C3MA 1FW6A 2ZYVX 1SXHA 5KYYB 2O4UX 2GM9A 1E1RD 3PUWA 4F8EA 5ALJA 1XK6A 4UVHA 4YGYA 4BVLA 5JPDA 4KG7A 1ZP6A 5TPWA 5CB8A 1UBTS 3HBNA 2XBUA 5KYXA 3ZDCA 1UC9A 3KZMA 2QV7A 3F6CA 4LSWA 4YJGA 3WL6A 2NT4A 1W5AA 3G2LA 2FW6A 3B7PA 3IXMA 3GEHA 1LKZA 3L8YA 5A9SB 5B1DA 3D7LA 2QKYA 4WGFA 2O6HA 4OUKX 4R2IA 2E87A 2UZ4A 1SQ0A 2A57A 4MMXB 5JG7A 5LIPA 3OI7A 2QN7A 4NQRA 4ESHA 2AKEA 3NT4A 3PKJA 1MP0A 4PVDA 4BCBA 2RH9B 1LRKA 3WQSB 3OY7A 3OT4A 3WIEA 1H4SA 3LO5A 5CB4F 4BNIA 4DYHA 5AUOB 2OM2A 1ND6A 3HFRA 3KETA 3K9CA 1MNAA 3HEAA 4YUVA 1WE2A 2OXFA 5C3MA 2F3QA 4CQMA 4BVEA 3AHIA 2WU4A 1K5GA 1UEXC 2APJA 1SBQA 1FMCA 2YNMA 3A1CA 4JEIA 2CGEA 3HJAA 4MI3A 1GGVA 2V4ZA 3I76A 4P53A 1H6CA 2HDOA 3BMOA 3K6RA 2Z5FA 4GMKA 1QHHA 2VXCA 3E5MA 1YSCA 5JAQA 3OCZA 3FGNA 3U3OA 4UTOA 2WFZA 3QWHA 4QUKA 2WSMA 1OV4A 4YX9A 1G38A 5IDWA 3L0IB 4R1UA 1M0WA 1QE0A 4UM5A 1ZCAA 4TWIA 3FAZA 1WXDA 1SN7A 2H17A 4F9TA 1O7JA 4KIUA 1SOMA 5HIJA 5TXGA 2V9PA 3LJKA 3HJTA 3SYMA 3VX4A 3W0LB 3PSAA 1QHEA 3N05A 4ZOLF 1ZIPA 2B2NA 3ZDZB 3ZVLA 3CX7A 3WBJA 3QVKA 2ZIEA 4TYNA 1VC2A 2AJ8A 2VP6A 1H2RS 4GXQA 3T15A 1MIOB 4M3NA 3UZUA 3H17A 2WPNA 3ZWXA 1Y7LA 2PGDA 4K40A 4MZDA 2Z8XA 4N03A 1XQXA 4ND8A 1O08A 1YCHA 1A5TA 3R0ZA 1P2GA 3L49A 4XGNA 4EVQA 1U0SY 2IU3A 1MUUA 3Q1KA 3T5GA 4E5NA 2G8NA 2RSLA 4P0QB 3KJHA 4M53A 4IYJA 1F1BA 4YRDA 3QV1A 5EZSA 2ODNA 2DY0A 5CT4A 1NQVA 2I55A 4PG4A 5HILA 4P7KA 1S5PA 3OE5A 2N46A 3K94A 3OUZA 3RSFA 4PXSA 1CY2A 1WQ3A 3LLVA 2J3LA 3FPEA 5B3KA 2VDWA 2FPMA 3I04M 1C7ZA 4YP0A 4CM7A 4E6EA 1M75A 3I12A 5ADVA 2QDKA 2HUNA 3UJ8A 4AAYA 2XCOA 5HBGA 5I7HA 1Z8NA 2A9RA 4ND2A 2GCEA 4QQ8A 2ZWOA 3LF1A 3KXKA 1F4PA 1M34A 2QVBA 3DL2A 3STYA 1XEXB 1PNQA 4MS4A 2DBQA 5EQJB 3P4UA 5K3CA 3RASA 3IIJA 2DPYA 1K4YA 4TRRA 4G25A 3FGOA 4ZA2A 3CO0S 2HJGA 3NT5A 1D1TA 2YBEA 4X1IA 4V1CI 5TQ0B 3FTFA 4C0LA 3EULA 2Q1WA 3M5WA 3KYIB 2BI4A 4KVGA 2ZUWA 3DGFC 4BBPA 2BFWA 4KAJA 4MW0A 4ZTBA 1J9ZA 4HAOA 3HDYA 4HMOA 3VJKA 2ZIZA 4FNAA 5BVHB 5JI2E 3OVMA 5EJ5A 2H6EA 1ECPA 1PNTA 4ILKA 1ZSNA 3QPCA 3QFSA 2FPXA 1D9ZA 4GGMX 3WFIA 5AFSA 1SCAA 3QGMA 4FDAA 5C7LO 3RT7A 4CVNA 4DPMA 1N36B 1J2RA 4OQLA 2VQ6A 2E21A 1V11A 5KVSA 1ADJA 2ASEA 3F7OA 3EOBI 4JT8A 2EXXA 2HMSA 4N12A 3PQ3A 4K6FA 4YJHA 4DDUA 1FFXA 3L9XA 3TH5A 5EE9A 3TS1A 5IJ0A 2JW5A 5JASA 1A4UA 3H87A 3ZU2A 4UBKA 1NBOA 4P6VF 4U02A 1ZG3A 1I1OA 1ZZGA 2OILA 2WFLB 3CGWA 4JX9A 4DSOA 5I7OA 5K0FA 1NU8A 2HLPA 3FCYA 3KXIA 1OWLA 1VHQA 4BO6A 3EVNA 4JR0A 4HDSA 4CF6A 3QSYA 1GR1A 3LLSA 5BO5A 5FB3A 4JODA 4TUYA 2UU9B 1DAKA 3JQBC 3OJCA 1G60A 1E3QA 4LY9A 3AL3A 3CVXA 5TGDA 3PPXA 1DE0A 3OX1A 5C7YA 3MMSA 4WPGA 4MIYA 2FZLA 4F60A 5J4YA 1J8FA 5EHZA 3WL3A 2OCKA 1CJCA 2HSZA 3OP1A 5BVGA 3L1VA 5FEMA 4UBMA 3HKDA 2BI8A 3ZZMA 3UG7A 2FOIA 2VLBA 5HRUA 4HB3A 1GU1A 3S55A 2R1VA 3CZMA 1N75A 3A9WA 2YXLA 4YP1A 2O8FB 1PFKA 4HG2A 4Y2UA 2J5KA 1DHTA 2V8BA 2ORED 1IXRC 1Z5ZA 1CZLA 1J5PA 1TB4A 2FW7A 4MCAA 1QQ5A 3I8OA 3JS5A 1YA6A 5HHTA 2F2TA 3WKAA 2VTKA 4Z7QB 1F9EA 3KOOA 4DDWA 2B3DA 3QLVA 5HOQA 2O8EB 3B2NA 2V5UA 4J76A 1VOTA 4IIDA 3Q9SA 2EG9A 2B99A 4PO3X 4EB8A 3DEJA 5GJBA 4PRYA 1TCBA 1P61B 4CMKA 1HL7A 1GZ4A 2HLDD 1GN9A 3GUHA 3T9CA 5AXDA 3ACDA 4DRZA 1MBZA 2OZLA 3PITA 4RMIA 3B38A 4BRSA 4E7OA 3ZVNA 1RYMA 1EDBA 3HFJA 3MSXA 4G0VA 1V25A 1BX3A 3KV1A 1UK9A 4MROA 4IDNA 4P7BA 4ZEMA 3EC2A 4AKTA 1BCSB 2Q5OA 2NSHA 3C7AA 3R5XA 2ZSFA 4MV6A 3UPDA 3VR1A 5GY7A 5CCDA 1T6YA 5EZYF 1YO6A 4DXDA 1OKKD 1QB8A 2Z4TA 3NRBA 1P18A 1V8ZA 2Q5EA 5HGXA 1GGHA 1TUBA 2IVFA 2OXIA 4TTJA 3TOZA 4L02A 5J4KA 3Q11A 4QYIA 5FWNA 1QXSA 3D5EA 5TVGA 1KMNA 2OG1A 5B6PA 3MLEA 5BRNA 5I6DA 3B6IA 3C1UA 3E0QA 3I0MA 4BYGA 5ISMA 2B7BA 5THXA 3O8QB 1X80A 4P81A 1UJMA 2X0EA 4PX3A 4TMZA 2REXB 3K0EA 3HVJA 2HF2A 3PFIA 1KZ6A 3VMFA 1AVTA 2WKPA 2AD1A 4IIHA 1JHVA 5FBQB 4JU8A 4EX6A 5EPUA 1QPBA 3K9NA 4PQEA 1LZKA 1SC1A 4GX5A 4N9WA 2I66A 5JC1A 1LS1A 2ZTUA 3B8EA 3NWEA 5F3RA 3NW9A 3VKFA 1ABFA 3BB3A 5C1IA 4BUCA 5ILOA 4RLFA 4EHIA 2FUG1 4WBNB 3VQTA 1U2TA 4D7AA 1CQIA 1JDJA 1OSNA 3P0EA 1FP2A 3TTSA 2PMFA 3FCOA 4UHHA 3E5RA 1C9YA 3EIXA 4PPYA 3Q5DA 1PNRA 5H0IA 3ZHQA 3C16C 4MITA 2JVJA 1O94C 3NDRA 4XX0A 4F46A 1B7GO 4M46A 4ZRNA 3TFQA 2IUUA 1S3SA 5LC1A 5G4LA 5IASA 2JJQA 3L84A 1N78A 4EKDA 5A5VA 4Q1AA 1JQ3A 4JA0A 1XNJA 1QKIA 1V39A 1E20A 1JR3D 1XTIA 1YOBA 3D3EA 4X1KA 3WGHA 2UZIR 3UC5A 4HNAA 1M72A 4RPCA 5LZ5A 4FEAA 2MWMA 1P1JA 4KN6A 3RKSA 2AF4C 2QZPA 3LWNA 3WS7A 4ALIA 4V39A 3UA3A 4YRCA 1I33A 2DUJA 2ZCUA 2YHIB 3FTPA 4IH4A 1XVLA 2G0TA 3HDJA 3K2BA 1BX0A 2ARKA 2I3AA 4MW5A 2B7LA 3BJRA 4BQOA 1TQ2A 1NVEA 3VR5H 4RTPA 2CLIB 2Z2KA 2H3HA 2FRDC 2QY9A 1CUEA 3BSFA 4HNGA 1UQRA 2G9RA 1H8HA 4ROSA 5K8UA 2DRIA 2NTVA 3GIWA 2OO3A 3VZSA 3Q7TA 1O6GA 3FHJA 1F20A 2OCPA 4YDRA 4IJ6A 3KQKA 4CKZA 4RPJA 4X00A 3W3ZB 3FJOA 1PG0A 2BR3A 2NX2A 4J75A 1N92A 1ODIA 4NBVA 4IRUB 3RFCA 4IUDS 1L9XA 1O1YA 2GJ9A 5C34B 3M2PA 1B1AA 3QVSA 2EW1A 4Y9RA 1HTTA 1QG2A 2C2YA 2WA1A 3OFKA 2F9LA 3JPWA 1OILA 4K0RA 4YJ3F 4EG7A 5JH7B 1TAQA 3DQZA 2WWYA 1IXZA 2HCBA 4JB2A 2C9OA 3PLAE 4ZEWA 2G25A 1Z0FA 1DT5A 2IRWA 4NE7A 3RTBA 4CRWB 5KZMB 4OI2A 1CU1A 2FH5B 3PZRA 5I9BA 1SC6A 1I7SB 3TECE 4YB8A 4D4MA 4LXGA 4F3KA 2GAIA 4BU0A 5JXWA 2M1ZA 3D8UA 4NU8X 4DDKA 1DKQA 4HSEA 2ZWMA 3DMTC 3C87A 3FDIA 4IEEA 1H4TA 1KARA 2DFKB 4KDCA 2BISA 3X1XA 2V6MA 3NBUA 5BUCA 1IBKB 2P4SA 1H9AA 2QUHA 2W6CX 5JSZB 4I9FA 4YASA 2FSPA 4UUBA 5CP8A 1XHEA 5LBIA 3VO8A 1OAKA 2XY4A 5C5EA 1M2OA 3NWOA 3OIWA 1N8NA 1NN1A 1QH8B 5J1TB 4UM9D 1EJBA 4M0LA 3ZDYB 4UE3S 4DY6A 4D4KA 4MP6A 4II3A 2AJCA 3S44A 5KKCA 4ZICA 1QGOA 1DLJA 1B0PA 5AXBA 2O20A 5A3SA 2XGJA 3T3HA 2OFWA 2PUHA 2DEUA 4GOXA 4E08A 4O2BB 2E82A 3G13A 3FOZA 5AI5A 2R6DA 4Z4EA 4R83A 5A9SA 4NPHA 3GN1A 2O05A 4RETA 1GRVA 5AKLA 1G5RA 1RYNA 1TM7E 4NENA 4D43A 5DGXA 2HT1A 2J5RA 1W76A 2HF8A 2IIVA 3DMFA 3ZWVA 4BFZA 4FCWA 3PZBA 2H1VA 3T7EA 4Q01A 5KYVA 4PFKA 1C9KA 2B1RA 2Y1OA 2XT0A 2UVQA 4FYYA 4BRZA 2W5UA 2MSLA 3TR6A 4I1PA 1VKNA 2HJVA 1XP8A 2J7PD 5ECDA 2ZTVA 4K1XA 4KSYA 2H3EA 1NVUQ 2CB9A 2PHZA 1N2JA 2XCUA 3BIFA 4PFSA 3BFVA 4QOHA 4BS9A 1L1QA 1FYDA 3MAGA 4HXYA 5FOQA 3DMHA 2PXHA 2JG3A 1GZDA 4U2EA 4U2KA 1NVVR 3DXFA 3EXFB 1I2ZA 3IAS6 3LRPA 5CVCA 2JLRA 4X93A 3VPXA 3WDLA 5CG1A 2ZTMA 3IAAA 5DV9A 9ATCA 1M6EX 4RABA 4ZRMA 1YB6A 1DP4A 4G4JA 4IG4A 4JJIA 4CHTA 5G0UA 2F6RA 4EB6B 4L5AA 3GPIA 5LZ7A 1XAIA 4M89A 1XG5A 1AXGA 1FLNA 1OFUX 1UK6A 2GXQA 2EDCA 2O7SA 2FKNA 3ONDA 3PUJA 5SYMA 2VSQA 5AJVB 3LT5A 1XPJA 4ARAA 3P9PA 4J3FA 3QXSA 1C0KA 5K0GA 1H4VB 1R8XA 2EQBA 5J4HA 2VHWA 1EJ0A 2BFFB 1S89A 2I2DA 4WLEA 1FFBA 4NFHA 4PSAA 4E3ZA 3TTVA 2V0GA 2X0DA 3C14C 2IZ6A 1A5AB 4PC2A 1VFPA 2F7SA 1MIOA 1E2MA 4UCXA 5HFJA 1MHTA 1PQYA 3C24A 3IGFA 2IUFA 3QYJA 5IVIA 4Y1GA 4EGCB 3AF6A 1J5XA 4DQVA 2GPYA 3I5MA 1DJOA 3LHIA 3ZE2B 2ZBVA 3ENVA 5DHQA 3BH0A 3HYCA 3TIXB 4LPKA 1Q6ZA 2VSFA 4JBNA 1AY0A 3PD0A 4IJ5A 5JS6A 1PNVA 1HKUA 2FGKA 1M7BA 2PIAA 3T0FA 5FBZA 3EFHA 3S8YA 3OJ0A 3I9JA 5U4XA 1SVSA 2WAXA 3ROEA 4E2FA 1IN7A 5B2ZA 4WL0A 3QA9A 1PV1A 1ULZA 2OZEA 3AR3A 4TMYA 3N8NA 2R4TA 3HI6A 3INTA 4E1BA 3ET5A 2C7OA 4IEIA 1GL3A 1DEHA 3ZXIA 5LP6C 2HBRA 3SIRA 5IVKA 4UTZA 4O1MA 1HA3A 3V4SA 3BQ9A 5HG0A 4UNQA 2EP7A 3VDXA 1XEXA 3MTJA 3KM0A 4PY2A 1YZHA 1E7SA 1IK4A 1MENA 1H23A 1TZBA 1AG9A 1VB5A 4ZZ3A 5KTNA 4JB8A 4MV9A 4EELA 2XGOA 3RADC 2HA3A 4G2TA 3EASA 4UEWA 3D6TB 3DL4A 3EIWA 3OC0A 3TQFA 4BFCA 3I2JA 2OCBA 1YBHA 2GA9A 2ZUFA 2J9RA 3I1FA 4EI7A 1Z15A 2HRBA 2G88A 5B4TA 1HMYA 5BVHA 3R20A 3CX6A 1P72A 3I72A 3N0XA 5A5FA 3B6ZA 1LTHR 1M5UA 4NHEA 1R10A 5AHOA 4GMDA 3IQHX 3TCXB 3BL8A 4QE3A 1JHAA 1YCFA 3WK6A 4ESOA 3CE6A 4PR3A 2UZAA 4RFLA 4ETNA 4F4DA 3F9IA 4II7A 3ZHUA 3UMRA 6PFKA 2OCDA 4EMBA 3DVRX 4PC6A 5CHEA 5AM5A 1Z74A 5F77A 4J3NA 3OJEA 3AR2A 3NBMA 2BTOA 5TJHA 3TG2A 1Z13A 2EP8A 4NMXB 3R3ZA 1P3JA 4JJ6A 2EGUA 1R6TA 3PXXA 3P0IA 3A32A 2WFLA 1FY2A 1A2KC 2IE0A 3BWVA 4PQFA 1W9HA 4CT0A 1W36C 1K7YA 1YQ9A 2HI0A 3PNLA 3RQIA 3VTAA 3WLJA 4QYSA 1UQTA 2J0UB 5I7FA 1OT3A 2FFJA 2XWQA 3K72B 3T5TA 1VRWA 2P41A 2PA0A 1OXBB 1J00A 3EJWA 3IR5A 4G5XA 3HJUA 4IIUA 4KV7A 1DUSA 4YJKA 3FIJA 1X8XA 5D86A 3EVFA 3ZQ4A 3N5CA 3CRVA 3KB1A 5I4IA 3NHLA 1P9OA 2DU8A 2FR1A 3K9LA 3RUFA 1HLGA 3N0RA 5AJZA 5I51A 5LOVA 2IYVA 3VAAA 2WIKA 2Q1XA 3TLXA 1B3BA 3JZIA 4V0NA 1WTCA 4FFVA 2Q7OE 1SZDA 1D04A 2H07A 4MZXA 2GPSA 4PO9A 3SMQA 5CUQA 1PVDA 2W8BA 3UJHA 6YASA 1GTRA 4Q1BA 1Z2DA 4A2CA 2BBTA 4WZAE 1YK1A 2HO4A 1AUOA 2CLMB 2Q46A 1TZMA 2WTXA 5DM70 1Q22A 2VAVA 4BMNA 1YF3A 1D03A 1TU4A 5EKUA 4DLUA 1OAOC 2D5AA 1VFNA 3X1DA 1L5FA 5TMPA 1O03A 3H2IA 5BN3A 2AG1A 3O47A 2WJYA 4XTCS 2ZE8A 1KQOA 1DRJA 2FWMX 3MWGA 2ZJ4A 4BNGA 4U2BA 3VC7A 1TTPB 2O8EA 2EP5A 4IJUA 5DASA 1N2CE 2ZW9A 1NBHA 3EC7A 4HDKB 5EIEA 4OLBA 1SCDA 5H68A 1K3FA 1BE8A 4LJ4A 1WXWA 1K63A 1LI4A 5AW1A 4EG6A 4GP9A 3MA0A 2DUWA 2NYVA 1SVUA 3AF2A 3N2YA 1Z26A 2L69A 2CYCA 3PP8A 3OJFA 2V98A 1RVV1 4RAOA 4AS3A 4DSZA 1UZLA 2C4UA 3BSWA 2Z95A 4R40A 1D8TA 1BCSA 2DFVA 4LMBA 4CMAA 4F9GA 1JMVA 2F3PA 3HLKA 2QMZA 1T36B 1CIVA 4OB6A 4WOKA 1JMKC 4BLOA 1NW9B 2GN4A 1C80A 2PX8A 2WWHA 1QHIA 3GA5A 2W0MA 2E5FA 3G5LA 5IC5A 4LQ4A 3RV3A 4FWBA 1FYFA 1PGJA 2BN4A 2WSIA 4B0PA 1DX4A 5GMOA 1EZ1A 3P5BA 4HGRA 1AKYA 3OCUA 3PNBA 2A5GA 4FB4A 1RXSA 2DT5A 2ZGVA 5AP9A 3O8QA 3YASA 3ZV6A 4KODA 1MFPA 4WW0A 3EA4A 3VR4D 3BFKA 2K7FA 2I9KA 2XF2A 2B4YA 1X15A 4GE0A 1XZAA 1KQGA 1YD7A 2WT9A 3ZH9B 3I01A 4XDZA 4X66B 1CR2A 1W85B 2O2EA 1C3EA 3PHBE 2VXOA 2JFVA 1NDUA 1XMQB 1SB9A 2D1YA 3V8PA 4UHKA 4YAFA 2F8MA 1W34A 3NM5A 4PO1A 3ZWBA 1F9AA 3B6JA 2BKXA 1W93A 4KH1A 3QUAA 4LSGA 4O4IA 4JB0A 2QAGC 1NV8A 2MHCA 4K2HA 5MFPA 2P68A 2XUQA 4MDEA 1XDUA 2JAUA 5I7AA 2VDOB 2BDUA 5K3EA 3AFOA 2Y76A 4DIEA 1ZU4A 2AOUB 4QFCA 5I4CA 3A8TA 2UYQA 3ADOA 3TD9A 3V7YA 1DDIA 5KNDA 4Y2JA 3JD4A 3I3SR 4IXDA 3HDTA 4ZQIA 3UOGA 4FD3A 3GLUA 3LC0A 5DFAA 4GOOD 2P9HA 4KIWA 1Z5PA 1K68A 1JEDA 2X3FA 2NU9B 4N82A 4U3JA 1A5ZA 5HJ5A 1Y4DE 4E5KA 5HM6A 4OYLA 3AW8A 3MAAC 4RHXA 4YO8A 3RYHA 1XELA 4OAQA 4XR4A 2VA9A 3Q41A 3KSZO 5IYZB 2ODWA 3MOGA 1JG7A 2J6BA 4ZOAA 5MGNA 4JJKA 4LF5B 3A2MA 1ACMA 2BLNA 1P1RA 1RLTA 1A96A 3S8MA 1PR2A 2C9DA 3SGLA 4JLPA 4ALJA 5CB0A 1AV6A 3KVVA 2HIHA 3G9QA 1FJGB 2HJHA 2VNIA 2W4IA 4I1SA 2ERCA 5JROA 4IIYA 5I9IA 1JEYB 4EY5A 2R8OA 1WZCA 2C4HA 1IN8A 3DXZA 4MB6A 5ECWA 4D9MA 4ZJYA 3JV7A 4DQ0A 4D5GA 1HSZA 2PSSA 2DR2A 1V2GA 2P79A 3L6BA 1UMDB 4EHLA 4MUYA 4Q3LA 2LCQA 4PV7A 5CM9C 2C3OA 2AKYA 4GI1A 4BC1A 4IDXA 2EQAA 1JVBA 3EMBA 1MX3A 4MV1A 2D4HA 1NUPA 2BMJA 2QZJA 1U7UA 4KX5A 4RKFA 2Q0QA 1FFDA 4C43A 1FU7A 1O2DA 5IJZA 2WJAA 5K20A 4MVJH 1IUNA 3MWKA 3P9IA 1XXLA 3LYLA 5FADA 4F2PA 4BE7B 5AUPB 1RQNA 4FEEA 3GRFA 2BFDB 3HMKA 2JIPA 4FSDA 5DOVA 3HJHA 3HFGA 2OUIA 1I32A 3RCBA 5JHHB 1L5KA 1H8ED 2XA2A 1N5LA 1GQFA 3D7NA 3VBEA 4DLSA 2O7NA 5JQWA 2Z5VA 2QPAA 1RJ9A 5JSZA 3HWSA 2C2KA 3DWGA 4V0LA 3FZGA 2GNPA 3KELA 3SFTA 1HLFA 4Y9UA 3FI9A 2Q7XA 3R40A 4FMBB 1QH8A 2CNWA 4B4KA 4RVDA 5CVDA 1VE6A 3WYBA 2VJKA 3EJ6A 4XDHA 4EA7A 5K0TA 3QHAA 1TVMA 4QECA 3AR4A 4OQQA 3FKSA 4OXNA 1XTVA 4YP5A 3UHJA 3OOYA 4C7JA 4BVAA 5CCEA 1Y5MA 2VDUE 5C0OE 2Z57A 4O2BA 1OX5A 3PQDA 3EWSA 1F0YA 3BHMA 3E84A 4OHZA 5E1OA 3RBVA 4DC1A 4P35A 1AUQA 3FPCA 3S2ZA 3FIUA 2C8JA 1F14A 1U9CA 2VK4A 2IYPA 4LF4B 4KXUA 1US8B 1UT8A 2PZ8A 3AY3A 3A4TA 4BNJA 1VMIA 1QZUA 2J9FB 5ETJA 4IRMA 1KJIA 1APBA 5CA0F 1U31A 2Q6IA 3NQ41 3CZ5A 3CEJA 3OU7A 4OFZA 3RU7A 8AT1A 4X62B 2IV7A 2KHZA 4MV5A 4QOJA 4XTRA 1OFVA 1RJWA 3BC1A 3KR2A 1KH3A 2HMUA 4V3BA 4XDYA 1IEQA 6LDHA 4EA8A 2C5BA 4MP3A 1ECBA 1XAJA 3Q10A 2HMVA 2MOKA 5IHPA 3U5ZB 2V9CA 2VHUA 2TS1A 2VPQA 4MA5A 2ZJZA 3HTXA 3CLUC 4KQFA 1RRVA 2RGBA 3MTAA 4HK4A 4BFTA 3U09A 3EXFA 1DDOA 1XMOB 4N41A 1WCXA 4JC5A 4L74A 2OB2A 2P4UA 2QE6A 1NXPA 3BJMA 3CZRA 2AOVA 1YVDA 4Z9AA 1X7HA 4LJAA 1ISMA 1M1YB 3KZOA 3RG8A 4EB6A 3RSZA 1GDTA 1QMPA 3OQ1A 4P36A 1HQYE 1N1MA 2UUOA 1X9HA 4B8WA 2UXDB 1V16B 3I2KA 4IH9A 1KZGB 4GT1A 1U7WA 3KIPA 1PZHA 1V5FA 2HA5A 2I8LA 3EIFA 4MLPA 5FF9A 3FYHA 3RUPA 2OBLA 1J9GA 5K0JA 4HDMA 4NZPA 4WZ6A 2BFFA 3N3AC 4XEUA 3AB7A 3N2LA 4MYRA 1DBIA 1Z7GA 4YQFA 3QWFA 1ISPA 2JBAB 5ADHA 3THYB 1HOXA 3E6AA 2XKBA 3G2QA 5M2QA 4GZLA 5BSEA 4NG4A 1UZMA 1HBJA 4IDBA 5ALXA 5ERXA 2XTZA 3S3TA 3DT8A 4AD8A 9LDBA 3RAEC 1DIRA 1NV9A 4TQAA 1VJ0A 3SPXA 3ZDDA 3LT4A 3R74A 3QP9A 3VYWA 1W7AA 1HE4A 2WK1A 3PUHA 4NBSA 2LIVA 5KMGA 4FHGA 4DDTA 2QE7D 3FWKA 3I9NA 3BFPA 1Q0HA 1CSEE 1L5RA 1S3GA 3IAEA 5EI5A 8OHMA 3PWZA 1RAGA 4KPUB 3H9CA 3V00A 3GJ0A 2BGUA 3MGAA 2DZDA 2HQBA 3C1OA 3FYSA 3BWEA 4DCMA 4JOSA 4OM7A 4X71A 3OE7D 2QN9A 3P2OA 1FUIA 5DMHA 1XN4A 2P62A 2OV2A 4AY3A 2CNDA 1BS9A 1UOQA 1ZGAA 1QG0A 4U5XA 5JBNA 4C0KA 3ZD6A 3AVYA 1OUMA 3UICA 2QLJA 1ZCZA 3PIDA 4H27A 1AJEA 3H83A 5JNSA 5DZSA 5C1PA 4CE6A 4FD2A 2EEZA 5JWHA 3ZJ5A 4BHHB 2PCJA 1L5HB 2PUEA 3HUUA 1SUSA 1YQXA 3OZRA 5LQSA 4BGPA 1I5EA 1Z88A 4UC0A 1U65A 1KKMA 3PUIA 3QI7A 5JD3A 2J5BA 2QPOA 4LMAA 4KLZA 5DSTA 3RK1A 1QO7A 2JCGA 1G8FA 3TQOA 4YYZA 2N9UA 1WMSA 2HHCA 1NQXA 1U0TA 5D00A 2C5GA 1C8LA 2G70A 2PY6A 4C03A 4BTLA 3NONA 4I1OA 2OYCA 4X97A 2VHCA 1YMUA 4Y2GA 3HJFA 1Z0SA 5EFZA 3IIKA 2YWXA 4Q7EA 1A72A 1RJDA 4ZCLA 1Z18A 4RXMA 3K4QA 1JUDA