1BWSA

Crystal structure of gdp-4-keto-6-deoxy-d-mannose epimerase/reductase from escherichia coli a key enzyme in the biosynthesis of gdp-l-fucose
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
314
structure length
314
Chain Sequence
KQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQNAPDVVVWGSGTPMREFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCTIRDLAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVTRLHQLGWYHEISLEAGLASTYQWFLENQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (GDP-4-KETO-6-DEOXY-D-MANNOSE EPIMERASE/REDUCTASE)
publication title GDP-4-keto-6-deoxy-D-mannose epimerase/reductase from Escherichia coli, a key enzyme in the biosynthesis of GDP-L-fucose, displays the structural characteristics of the RED protein homology superfamily.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 104
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 1998-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1bwsA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1bwsA02
1CJCA 2IEBA 3AFNA 3H9QA 4M86A 3O9ZA 5MDHA 3V2UA 1HKUA 4YAIA 1I32A 4P4NA 5EJ2A 1XYGA 1BXKA 2IODA 5EQDA 3BA1A 3ULKA 4M55A 4DQVA 2OORA 4IINA 5JW6A 5KVCA 1N7HA 1S7CA 1DIRA 4A03A 2HDHA 4CQLB 1A4IA 3DTTA 3DEYX 3WFIA 2BRUA 2C59A 1WXDA 3VOSA 3Q3CA 1J5PA 1B14A 4JK3A 1HDZA 1PR9A 5K9ZA 4PG7A 3RC9A 5JY6A 1R4NB 3H3JA 3L6OO 3WGGA 3U9LA 1P77A 1PZGA 1V8BA 3JQ9A 4Q3CA 4RLSA 3W4KA 2EW8A 3FF4A 2X22A 1EE2A 1QLHA 1VL8A 1E3WA 1W8DA 3E5RA 3ZHBA 4A5OA 1E7WA 3GUCA 3PI7A 4J7CA 4KTTE 1L7EA 4IMRA 4TQGA 4WCFA 4CM4B 3C7DB 4LSMA 1VSUA 3SC6A 2BFPA 3DBVO 3RUCA 1ZSNA 9LDTA 4OXNA 5AYVA 4GX1A 4R16A 4W82A 2VQ3A 4A27A 4RPHA 1H6AA 1S6YA 5J23A 1I3MA 1YS4A 1U8FO 4OQZA 4RVDA 3EYWA 4QECA 4BKUA 5CG1A 2RH4A 5JO9A 2W8ZA 4LSWA 4BV8A 4RZHA 2D4AA 3JQGA 4FFLA 4JBIA 3S1LA 2UAGA 3MJ4A 2X0IA 1BSVA 4EJ0A 5JDCA 3TN7A 4FCCA 1DFIA 1O0SA 3BTUA 1E5QA 1YDWA 2HKIA 2O4UX 5CHEA 5KJ1A 1F17A 4OXYA 2G0TA 1JQBA 3ZN2A 2DTDA 4TKMA 4TVOA 1EVJA 4K1LA 1HLPA 4YJHA 3HSKA 3OBBA 3HN2A 4GKVA 3JQFA 2I6TA 4C7JA 4CMJA 4NK5A 3R6DA 1SB9A 4YDRA 3AY3A 1Y9EA 2G1UA 3I5MA 4ZGWA 1WDMA 4Z0PA 4DC0A 1EZ4A 5BNIA 2DVMA 3OIGA 4BB5A 5A9TA 3PQDA 5T5QA 1KEPA 3WQSB 1GYPA 3AY6A 2UUOA 3GHYA 1ADCA 4EI2A 3FD8A 3JQ7A 4DPKA 5I7FA 2C07A 4M54A 4BNZA 1SZJG 2QG4A 4K9DA 3PTZA 4UEKA 4FR5A 4DRYA 3GGGA 4OYRA 1QV7A 3GVIA 4RORA 4ZICA 1XQ6A 3Q9UA 5L45A 3CIFA 2DTXA 3I83A 3MTGA 3V1UA 4E2ZA 5ICMA 1LRKA 4XEHA 4ID9A 2CUKA 4IMPA 3ZNQA 1LRJA 3RSHA 3JYPA 3GZ4A 3VH1A 5A02A 3I23A 1C1DA 1MGOA 4IY1A 2EEZA 2Z1MA 1NQ5A 3RBZA 3F5QA 1NQOA 2CSUA 4BNMA 4UULA 3GG9A 3HZZA 3T7EA 5KWEA 1PGQA 1EEHA 3OJLA 3P2YA 5JMPA 5AXDA 4U0JA 4JIGA 1RM5A 3AY7A 2PKRA 4CM9A 1SC6A 1ZKMA 1KERA 3WNQA 3C7AA 5DBFA 2Y1EA 2EIHA 3TZ6A 3KOUA 1EQ2A 3C8MA 3WX0A 4E6PA 1UAGA 3U0BA 2YV1A 4HX5A 3PIDA 2VRBA 5DP1A 4R1SA 4JN6B 5JO0A 2FPIA 1FK8A 4ZD6A 1PJ3A 3PJEA 1Y8QA 3G79A 2Y05A 1HDYA 2IYOA 4UVDA 2ZJ1A 4Z0TA 4KWIA 5B4UA 1LRLA 2H5LA 3BMOB 3VDRA 2X7HA 5JLAA 1LSJA 1GV0A 3PHIA 4IXTA 2I76A 3BHIA 4WE3A 1N9GB 3DMTC 2GR9A 1ADFA 1YL7A 2OBYA 3CMCO 1YB4A 1GAEO 2GYYA 4OJNA 3FWZA 1OZAA 1KEVA 3LT1A 5COAA 2I3AA 1GTMA 4YT5A 1ML3A 3HDHA 2B5VA 1B0AA 3JYQA 1PZEA 3FR7A 1O9BA 4BKOA 1DJNA 4R5MA 3HUDA 1C0PA 5DULA 5L7YA 3SJ7A 4Z0HO 3C1AA 4F3YA 1YKFA 4WEOA 3DOJA 3JD2A 5EESA 1Q0LA 3AI1A 2DTEA 2FR8A 2PZKA 3S2GA 1U7HA 3JYLA 4L76A 5BNFA 4E2YA 4AJLA 4BO8A 4DIBA 4MVJI 3BYZA 1B15A 1E7MA 1TVEA 4MOWA 5AXBA 1VKOA 3I3OA 5TT1A 1M6WA 1JVBA 4MIEA 1CQIA 3PWZA 1IULA 3H9JA 5TC4A 3PQEA 4WCFB 2PY6A 4LCJA 5A1TA 2H63A 3TOZA 2I65A 3E8XA 4FJ0A 4XGKA 1IYZA 5G0SA 4BKQA 4FFOA 2XXJA 4D46A 1A7KA 3AI2A 3QE3A 3HDJA 1YO6A 3AI3A 2YFQA 4J7XA 1HT0A 1KVSA 3WLFA 3HNPA 2JFHA 5ITVA 1NP3A 3DMYA 3P19A 4AJOA 3JQGB 4GX2A 1PGNA 1R4MA 3KZVA 4TRJA 2VWHA 3WICA 2P4HX 4IM7A 3U3XA 1LI4A 1QMGA 5L3ZA 2AE2A 2ZTMA 3SC4A 4U7WA 4EUEA 5IZCA 5KJ6A 5L9AA 1B3BA 4LVUA 3CSDA 3FBTA 5A05A 1U3VA 1LTHR 4YRAA 4XKJA 5CP8A 1GPJA 2O3JA 4WLEA 4UUPA 3ZH2A 2VOEA 1RM4A 1DC5A 2HRZA 3UCXA 1VSVA 3E18A 3GEMA 1NVMB 3WQRA 1UDAA 2CVZA 2J5QA 5I7EA 4HFMA 4L74A 2VHWA 3OHSX 2WE7A 1OFGA 4YAKA 4MIOA 3I9OA 1R6DA 2DU8A 4YT8A 1GU7A 2GN6A 3PDJA 4RF5A 4IIVA 5G4LA 4PLGA 2ZTVA 1UP6A 3EC7A 1CWUA 3GLQA 3H9GA 4TZKA 2VHXA 4IQ0A 4BGIA 4WOKA 1LDBA 4TRNA 1P31A 3JQ7B 1Q7CA 3EW7A 1AHIA 1QORA 1EUZA 3RKRA 1QKIA 3COSA 4JJIA 1YDEA 4IS3A 4U6SA 4AJ2A 3PHJA 1JAXA 4R3WA 3GRKA 3N58A 4DVJA 4LVCA 4PVDA 3VPFA 7MDHA 2Q46A 3ZWOA 1E3JA 2PZMA 3NJ8A 4XB2A 3RJ5A 3TRIA 5T67A 4BO7A 5DBGA 3ST7A 2DUWA 2ZYDA 4AVYA 2DLDA 3UUWA 1YVEI 2X0JA 3ZWMA 1C1DB 4R4JA 1YWGO 1GDHA 2PLAA 2AG5A 2VZ9A 1UZNA 5B37A 3QP9A 2OZPA 4YAGA 3WWYA 3LC1O 1ISJA 1AE1A 1VL0A 1I5RA 4MVJP 5CDSA 1C1XB 2WM3A 3HWRA 3BHMA 5IN5A 3ADPA 2E48A 3DMTA 4IJWA 1P1IA 3F4BA 3JQDA 3U4CA 2D3TA 4OQYA 3DAGA 4XR9A 5CEJA 6LDHA 4GSLA 1LSSA 5BSGA 4ALLA 2WE8A 1UXGA 2FR0A 5CPBA 1FDWA 1FF9A 1KOLA 2GDZA 2E4AA 5TIIA 1YL5A 1IZ9A 1MC5A 2VCYA 4IXWA 3VH3A 3SBOA 1Y8QB 1M66A 1BRMA 1WP4A 3L4SO 4B4UA 2PZLA 3KXDA 2Y66A 1OOEA 4CMEA 2HAEA 4NPCA 3HE3A 1H2BA 4QEDA 4Z3DA 3E9QA 3ZV4A 4KOAA 3QWFA 4GGOA 3CTMA 4PLTA 1H6CA 4E5KA 4OOEA 3Q9NA 1AN9A 1M76A 3EVNA 4MIYA 4MVJH 1PJ4A 3IP3A 2WWRA 5IFLA 3FBGA 4TRMA 1CDOA 1T1RA 2D0IA 2YV3A 3NT4A 1P1HA 3WTCA 4J0FA 4YVFA 2CMDA 4ZQHA 2X9GA 2R00C 3HFSA 1P74A 2Y1CA 3RVDA 5CAEA 1PSDA 3INTA 1WLYA 1D8AA 4BNLA 2EGHA 3LT2A 2VZ8A 2YZ7A 3DZGA 4FD3A 4HY3A 3FNHA 2XF8A 2OO5A 3KVOA 1BXGA 1M67A 1LC0A 4ND1A 3WGHA 4ZA2A 1F8GA 1DIHA 1EVZA 1YOVB 1WPQA 4CODB 4CLXA 1LUAA 1NPTO 3WOHA 2Y1DA 2O50A 3BXXA 4UUOA 2BH9A 1HE3A 1PL7A 5C3MA 3UGKA 3Q2IA 4HUJA 5HBRA 4CM1A 3F1KA 3IAHA 4BO6A 4YJFB 3RBVA 5JY1A 1ZJZA 3PGXA 2HUNA 4XWYA 3P7MA 3IIEA 4CMIA 4J7UA 1N1EA 4UREA 5B1YA 1XU9A 4Z9YA 1LJ8A 1Y8RA 5IZ4A 4CJXA 1AXGA 3PJFA 3FSRA 3KV3O 2YYYA 5IDYA 5C37A 2GZ1A 5IDXA 2Z95A 2A9FA 4AJEA 3GY0A 1HF3A 1G1AA 3GF4A 2YHUA 4ZQBA 4ND3A 4BNIA 3WYEA 4XYEA 3HQ4O 4CL3A 1C14A 3AOGA 2QRLA 3MJTA 3GDGA 4P4LA 3KSZO 2J6IA 5L4NA 2VUSA 2EHDA 3KTDA 1DEHA 1R66A 3C85A 4X54A 1GADO 3RAJA 4LISA 1UR5A 3ZWNA 1DPGA 1VRWA 2VUUA 5FFFA 2IEDA 1GL3A 4G5HA 1PGPA 4ZRNA 3JQAD 3OSUA 1DFGA 5ILOA 1JWAB 1R0KA 1XG5A 3H65A 2D5AA 2HK9A 4K6CA 4MVJG 2C7VA 2VT2A 3Q0EA 1U28A 1I2CA 3H7AA 4XQEA 4E33A 3GZNB 1PZHA 2CFCA 3AK4A 4NZ9A 4XD2A 1UAYA 2UV8A 4CL8A 1SOWA 1UP7A 1X7DA 1Y9AA 3VPHA 2HJSA 1CRWG 1K89A 1JDJA 5IJZA 3JV7A 4GL4A 2Y1GA 1IE3A 1R4NA 3ZWPA 4B3HA 2BHLA 3A9WA 3WSWA 2NU8A 3ZV6A 1Z45A 2X4GA 3MWEB 1IUKA 3DBLA 5IXSA 1YH3A 2PFGA 1K3TA 2PR2A 4E31A 4BMSA 1YXMA 4CM4A 3MZ0A 3DZIA 1K6IA 4J1QA 5A5FA 2Q2VA 3NGLA 5BSHA 1JA9A 3FNEA 4OSOA 1XIVA 4UEOA 1X7HA 5CEFA 4IPTA 1EBUA 3TOXA 1X13A 3I4CA 4ALIA 8LDHA 3QWHA 1I2ZA 3RJ9A 4ZU3A 4DQXA 5TLSA 3SVTA 2DC1A 1DDOA 3HB5X 2FN7A 1VI2A 3SLKA 3V1TC 3ZV3A 4WLUA 2QZ9A 1UZMA 2NNLD 3GFGA 3NTQA 4Z9XA 3DHNA 2FOIA 1XU7A 5DOZA 4B8ZA 1LDYA 3JQ9C 3W6UA 2X5JO 3NTRA 4IS2A 2Q1TA 4P8RA 3IJRA 4MJLA 3OJOA 5G2OA 1E7RA 1BW9A 4MO2A 4WCFC 3CPSA 1ARZA 1I8TA 3FWNA 4G2NA 4BL5A 1LLDA 4R1TA 4ZJUA 1HYGA 1PQUA 4TZTA 2C7GA 4IUYA 3L9XA 5I9MA 4I5GA 1T4BA 2IXBA 3S55A 1NPYA 2AQ8A 2DFVA 3CUKA 4N5MA 5JDIC 1T1SA 2RCYA 3Q1LA 1QR6A 4LMPA 1UXJA 5DDIP 2EGGA 1FMCA 1UZLA 1PL6A 1WNTA 1TB4A 5JDCC 5CG2A 2DQ4A 1DIAA 3FPCA 2ZKLA 4JBHA 4LK3A 4U8GA 1ID1A 2GSDA 4OM8A 3PGJA 1H6DA 3CINA 3VKVA 3OQ6A 4RV9A 2E37A 4OHUA 2B4TO 1R15A 2WYUA 2DBRA 4NQZA 3PDUA 4XRGA 1X0XA 2DBZA 2D2IA 4RPGA 3JQFC 3QVOA 4BO5A 3ITKA 5CEEA 4IDEA 1Y5RA 1HXHA 2BLLA 3PYLA 4DBZA 1BXGB 2EERA 4QXMA 2IRWA 2DM6A 3DFZA 2JAPA 5TNXA 2OUIA 3AU8A 4CM9D 1ENPA 4AJJA 4RPKA 1JAYA 4B7CA 3NYWA 1DJQA 5BSFA 4PLPA 2BGKA 4IJKA 4DLBA 4GWKA 3ZI0A 2VYND 1LQTA 2JFFA 5CDTA 3E6AA 5HRUA 2IXAA 3L6EA 2HRBA 1DXYA 4PLYA 1H2HA 4CMIB 4ILKA 2X86A 3TWOA 5CDGA 3S8MA 1Y6JA 1JTVA 2OL4A 2AHRA 1OMOA 3OP4A 1CIVA 1NQTA 1DHRA 1CETA 1YBMA 4NJMB 4ZQGA 3UW3A 1A71A 3N74A 4YTEA 4CUKA 3SLGA 2X8LA 1HDGO 5TJ9A 1WDLA 3ANMA 3ZZNA 1AXEA 1HETA 1ZJYA 4A7PA 4HXYA 1L7DA 3UOGA 2XXBA 4EEXA 5HS6A 4BNNA 1Q2XA 2ZB4A 3BMQA 1WW8A 1NAIA 2EP7A 3NRCA 4E2WA 1U9JA 4YCAA 1IY8A 2NU6A 2PA3A 4LN1A 2Q2WA 3IUPA 1GUYA 2PKQO 4WK6A 1R16A 1HZZA 4WLOA 4WEQA 1C0KA 4K28A 2O7SA 3KSDO 3O38A 1QG6A 1SNYA 5BQFA 2OGUA 4BMVA 4C7KA 1H5QA 1PL8A 4TMFA 1ISHA 1XSEA 5KTKA 5TGDA 4YA6A 3KLMX 2IDZA 3JQBA 4DXHA 3RUEA 2NU9A 3KYCA 4KP7A 2W98A 4Y6RA 1XQ1A 4W9NC 1N2SA 3PJGA 2IZZA 2DBVO 1YJQA 3VTFA 5KJEA 3WJAA 1B8UA 3T4XA 1K6XA 4B4OA 5I7SA 1SO8A 1HDRA 4YXFA 4J4TA 2BI8A 3S2EA 4B79A 3PXXA 3INGA 3JQAA 3L77A 3AUAA 3M1AA 5T6BA 3TZHA 1EFKA 1SB8A 2Y1FA 4MVJF 4UUMA 5A9RA 2ZB7A 3DBLB 2EG9A 4YRDA 1MXFA 2JHFA 1X14A 2YDYA 3A14A 4HFJA 4E5PA 2ZCVA 3ANLA 3IP1A 3DOOA 5AVOA 4WPGA 4YPOA 1I33A 3ZW9A 4ZQEA 4L8VA 3LZ6A 3NDJA 4F6LA 3VDQA 1ZSYA 3DBRB 3FPLA 4FGSA 4DLAA 3VAZA 1LNQA 2WTBA 3GVPA 5JDIA 2OBNA 2NLOA 4A26A 1UUFA 4L4RA 4BQPA 1NWHA 4OAQA 2C82A 4QO7A 3LC7O 1SCUA 1SOVA 1NX6A 3KEOA 2R2GA 4YRBA 2UDPA 2AA3A 2V6FA 1BW9B 2RHCA 5I8ZA 3WLEA 2POQX 3AUTA 3E9MA 3I9NA 3VZPA 4B8WA 3DXFA 3TL3A 1HDCA 4R3NA 1AHHA 1G6KA 4A2CA 5JAZA 3MWDB 4N5NA 2NWQA 1J49A 1VJ0A 3FTNA 2H6EA 1UXIA 3AJRA 1T2CA 2Q50A 2QZZA 3DZJA 4NDNE 1EVYA 2Q45A 1ZH8A 1EDOA 3DZHA 1M75A 3IC5A 5ENVA 4BO0A 4CR6A 3P5SA 4Q3EA 3QSGA 4HBGA 1NPDA 3W6ZA 3WSVA 5U4QA 3DB2A 4CLEA 2VRCD 4WLVA 5L7TA 1VLLA 1R0LA 2A92A 2QX7A 3WS7A 5BSEA 2QRJA 3NAQA 3HFGA 1KS9A 2DUUA 5IZCC 2HK8A 4BNYA 3WBFA 3GVHA 5G0UA 4GWGA 2HMSA 4JBGA 2P5UA 4WKGA 2G5CA 4Q3BA 2QHXA 3C1OA 4FJ2A 3DTYA 4JQCA 4MINA 4BNGA 3O8QA 1E1MA 1N7GA 3OJFA 3U49A 3VPGA 5JAIA 2FSVA 2Q1SA 4E32A 4WNCA 3RFTA 3M1LA 3QY9A 4RQUA 2E49A 2X5KO 2Z5LA 4OMUA 5DOVA 5L4LA 1ENZA 3LT4A 1NM5A 2NQTA 4XZ3A 3RU9A 3GDFA 1ISMA 1V3UA 4GVXA 4Z6KA 2NUAA 4R01A 3ROMA 2Q49A 4CLDA 4BKPA 3SEFA 1CERA 3JD1A 3QWAA 4AJIA 4GQAA 5IXYA 1Z73A 1HLDA 3UHAA 3ZU5A 1Q1NA 3ZWWA 3DAPA 4D3DA 1C0LA 4O0LA 2YW9A 1RPNA 4DMMA 1C1XA 1BTOA 4YR9A 1OC2A 1ZEJA 4J49A 4I5DA 3WNVA 4EDFA 3VHRA 3K30A 2ZQYA 2A94A 5KIAA 4TSKA 4TWRA 2LDXA 4WNIA 3AOEA 4IZHA 4GSKA 4BVAA 2VYNA 3BTOA 3BAZA 2P9CA 1QSGA 3V1YA 3R3SA 1PJ2A 3BMQB 4BNXA 3LF2A 5EERA 2HSDA 1FDVA 4W9NA 4BV9A 2J3JA 1BMDA 1U4OA 3STHA 3K8ZA 3EZLA 4HWKA 4L4XA 3M2TA 4FN4A 2XAAA 1D3AA 3V2HA 4F46A 3OJEA 1T2EA 2PTGA 3WGTA 4CMHA 4ITUA 1Y1PA 2DPHA 2O3UA 3ICCA 1V9LA 3UICA 4N18A 1ZFNA 1UH5A 5FWNA 2JAHA 5H83A 5CPFA 1DLIA 3FR8A 1P44A 2FY8A 4JROA 4FOOA 1NWCA 2FZEA 2BF7A 3QQPA 2C29D 1L1FA 3VPSA 3KYCB 1QYXA 3TZCA 2FMUA 5EN4A 1TT7A 2RIRA 1LBEA 4M87A 4XRRA 4CMEC 3BMCA 1YQGA 1YOVA 3HB4X 2BGLA 1HSOA 1DC3A 3KO8A 5F5LA 1A4UA 2VHYA 4XDZA 3H9EO 5CDYA 1T2FA 2YUTA 1CQJA 1IHYA 3JQAB 4DUPA 5L4SA 4R1UA 2ZIZA 1CYDA 2J3IA 1I3NA 2P9EA 4YJFA 1Z74A 3RWBA 1C0IA 3W8FA 1HTBA 2B0JA 4RF4A 4DIOA 1DFHA 4MVJE 4DWVA 2EV9A 4F6CA 4YBZA 5LDGA 1Q7GA 2CZCA 5JNLA 2GF2A 3GN2A 4GGPA 4XIJA 1N1GA 3ENNA 1DRVA 1T25A 3FNGA 3D4NA 3IQDB 1XWFA 3TSCA 3NX4A 4FJ1A 1UXKA 1PJQA 1O5IA 3WQQA 1GPDG 3DBHB 4L73A 1G0NA 3PHGA 1A9ZA 4NU5A 1JN0A 2HMUA 1H94A 1DHTA 3GEDA 5F21A 2V6MA 1BG6A 4PZEA 3WWZA 3WIEA 3FN4A 1GV1A 5G0WA 3ZNPA 2D5CA 3OA0A 1GR0A 5DN9A 4NJOA 1B8VA 1PJSA 2Y68A 3T4EA 2C2XA 4FPXA 4FDAA 2WD7B 3SXPA 4CLHA 3BTSA 7ADHA 1JKJA 4R69A 2B83A 4RPJA 1YRLA 4U5QA 3EGOA 1LDNA 4E30A 1UJMA 2FR1A 5I9NA 3I9KA 4J2OA 3WBBA 1I3LA 4N7RA 2ZATA 3BMNA 1CF2O 3GZNA 4J6FA 4ZQFA 1NFRA 3KB6A 3NT5A 3ZNNA 4J4BA 4RL6A 3CZMA 4LW8A 1JKIA 2F1KA 3N7UA 1ISGA 3AUUA 3PHHA 4NG5A 5F1KA 1O94A 4DPMA 1YBVA 4NFYA 3CEAA 3VVCA 1XR3A 3RUHA 1DAOA 5JCXA 4IDBA 5C5IA 1E1NA 2EWMA 2AEFA 2E6UX 1Z75A 3OM9A 3W4JA 4OKNA 2OHXA 4CUZA 3O8QB 2J3HA 4BOYA 1X1EA 1ZXLA 2VRCA 4WLFA 3OMLA 1ONNA 3ROKA 4TKLA 2ZTUA 3L4BA 2G76A 4PCVA 3RASA 2NU7A 5DF1A 4E0BA 1KEUA 3EZYA 3X2EA 3ZU2A 3GC6A 3QVSA 3ZWYA 4XYLA 1B7GO 2UVDA 4FC6A 4Y9DA 3EUWA 4I9UA 5KNLA 2PGLA 2Y67A 2EKPA 8ADHA 2GASA 4RO0A 4XA8A 2EKLA 1NTOA 1RJWA 4OSPA 4RVSA 2HQ1A 1T24A 2AQIA 4CM6A 3DL2A 2VN8A 2YDXA 1B26A 1KY5A 1LDMA 2I66A 2I3GA 4UAGA 5JAQA 3F9IA 3LDHA 3HN7A 1EUCA 2Q1WA 4OIMA 1GQQA 2PH3A 3KBOA 4D41A 2AG8A 3GMDA 1NFFA 3M6IA 3G3EA 2BI7A 1ZMOA 1KY4A 4YJDA 4PRKA 2AXQA 3WDSA 1A72A 1ISFA 5A3JA 1PWXA 2OP0A 3GT0A 2WYVA 5AXAA 3GNSA 2UYYA 1MA0A 2NTVA 3OQ1A 3BIOA 4HADA 2X9NA 4MVJA 2P68A 1PJBA 4OXKA 4OO3A 3K96A 3TDKA 1V6AA 5KVSA 1ADBA 1O8CA 5F5NA 5JAMA 1FDUA 4S3MA 3WYBA 1EQUA 2O3SA 3BMCB 4BNKA 2G82A 3PYXA 1TA4A 3NV9A 2CVQA 4NBRA 1HE5A 3QWIA 4J43A 2FP4A 2PKQP 3GAZA 3K6JA 3PLNA 2FHSA 5A06A 1SAYA 1ZEMA 1GQYA 1KVUA 4IQ8A 4XQGA 3QRWA 1DC6A 4EITA 2O23A 3PHLA 5DCYA 2GZ3A 4I9NA 3VVBA 2FWMX 1NQAO 4AJ1A 2C5AA 2IE0A 3A06A 5EMHA 5THKA 4L0QA 1Y81A 4CLRB 2GN8A 3MTJA 5B12A 2B36A 4KDFA 3KETA 1H6BA 3GG2A 5T8KA 2JCYA 1LU9A 4NJMA 4PLVA 3WMWA 1UDBA 1U8XX 3VH4A 3RCBA 2NACA 1U3UA 1VJ1A 4W7IA 4FW8A 4IDFA 5G0VA 2O3RA 4JJFA 1Q0HA 1QRRA 3C3XA 4BO9A 3OEYA 4FQ8A 1P3DA 5A03A 1FDTA 4XGIA 4BGUA 4BO4A 4NMHA 1XCBA 2PGDA 3IKVA 4EYEA 2W90A 1ZMTA 3EDMA 5THQA 1LEHA 2P4QA 1ZO8A 4R68A 4YAJA 1E1KA 4M49A 4W6ZA 4CMAA 4IGFA 1KBZA 3W8DA 1LX6A 4RDHA 3IL2A 1ZK4A 4CM3A 3AW9A 4HV4A 3EVTA 1MV8A 3FTPA 1IPFA 1DBVO 4MP6A 2V7PA 3RC1A 4CR7A 1EDZA 5JPIA 4UVGA 3TZQA 3KUXA 4ZRMA 2FPGA 3WB9A 2YV2A 5DZSA 4G81A 4DC1A 2PV7A 1D1TA 5LC1A 1RWBA 3BMNB 4MDHA 3VPXA 1LDEA 4LGVA 3CMMA 2P5YA 2JD0A 4H16A 5A9SB 3NEPX 2OOSA 1GFSA 4BKRA 4ALKA 4YB8A 1J6UA 1GZ4A 1N8KA 3GVCA 2CF5A 1H9BA 3OFSA 5DBIA 3B20A 3F5SA 1PJCA 5JMWA 4RVHA 4NNJA 3T7CA 4CR8A 4E5YA 2PGJA 2HMTA 3RU7A 4D43A 3HHPA 4H3VA 3D1LA 3UH1A 3D64A 2O48X 1UDCA 3JQBC 1DRWA 3OIDA 3PYMA 2QQ5A 2I9PA 2ZYGA 4CQMB 1D4FA 2JL1A 2AMFA 4BUCA 1JVSA 1TI7A 4RCVA 4E13A 5LDHA 3ANNA 1VKNA 4H7PA 3SX2A 3O03A 1DAPA 3K9QO 3DBRA 2PD4A 4PIVA 3PLRA 3IOYA 3IMFA 3D5TA 4D0RA 1N5DA 1EVIA 4A10A 4UUNA 2ZB8A 4M8SA 4WLNA 1ULUA 5JCJD 5GZ1A 1O95A 3TPCA 1ZSVA 4CMGA 3ZU3A 1R0SA 1J0XO 2ILTA 2O3QA 2WDZA 3WGIA 2BFAA 3GDOA 4QFCA 4M1QA 3H5RA 4JP3A 3JCZA 4NBTA 4NK4A 2D8AA 4BGEA 3AWDA 2B69A 3Q6IA 4XQCA 3KHUA 4D79A 5KCZA 3PEFA 1E5LA 1I36A 2YY7A 4EBFA 1MFZA 4IQGA 4N54A 1E3SA 3IS3A 3D3EA 3W4IA 5JBIA 4J16A 5TT0A 4HKTA 4ROSA 3NUGA 3B1KA 1WZEA 2J3KA 4P38A 4D44A 5JSFA 4XX0A 1FDSA 4Z9FA 1YQXA 3S2FA 2E82A 1VL6A 1ZNQO 3ZWBA 1KEWA 1G0OA 1YONA 2C2YA 1Z7EA 3UN1A 4E4YA 1F14A 4CV3A 3OQBA 4GVLA 4BO2A 4URFA 1MP0A 2Y0DA 2OP1A 5FI3A 1SEVA 3U5TA 3DAFA 4MKZA 4CM5A 2JKVA 1ENOA 4ND5A 3PZRA 2Q2QA 4K6FA 2RBEA 1RM3A 4I9HA 1GCOA 1F12A 5BT9A 4XJTA 5B4VA 4LRSB 5TF4A 5KKCA 3E5MA 4FFPA 3OIFA 5EPOA 5BNTA 1H0KA 3G1UA 4PGFA 2YQ5A 3C24A 3G0OA 4DGSA 2GUGA 4XDYA 1F0YA 4R9SA 1T26A 4O59O 5LCXA 3WGOA 1QV6A 4CPDA 1QLJA 1P45A 1C3VA 2TMGA 1BWSA 1ZCJA 1HE2A 4OGWA 4Q39A 5DNAA 5F3RA 3UVEA 5HS4A 5IAAA 2NQ8A 4J9VA 1ZK1A 4BB6A 4RGBA 3I4FA 4NR0A 4P4GA 5GMOA 3D4PA 1D7OA 1SMKA 4ESOA 2C20A 4PZCA 2JD2A 2F00A 2NVBA 5JS6A 1PR3A 2CD9A 1U7TA 3B6ZA 4KQXA 4KUEA 4II3A 3JQCA 3ZV5A 1ZBQA 2CVOA 4ND4A 3TZKA 2QRKA 1PGOA 4D0SA 3LQFA 3NT2A 3ZGYA 3ZWAA 3B1JA 1MX3A 5EQFA 4EGFA 4J9UE 5HWSA 4R1NA 5CFZA 4R41A 3ZDFA 3HJAA 2B37A 2HMWA 3X2FA 2Z1NA 4GLOA 3RFVA 4XJSA 2Y0EA 1B8PA 3TJRA 5JC1A 1LLQA 3GVXA 2VWPA 4CM8B 3AOEC 3ZHXA 4RVGA 5IDQA 5JFOA 1K2WA 4AJHA 2I99A 2W2KA 4P22A 4IJUA 1YB1A 3ZW8A 4J3FA 1JU9A 3TF5A 3QJ5A 1PEDA 2DFDA 4Y8VA 3ASVA 1K5HA 3H8VA 3MJVA 1HDOA 2AQKA 3H2ZA 1NASA 3ICPA 4B7XA 1GD1O 2D1YA 4ZHSA 3JYNA 4QX6A 1QYDA 5ITWA 3F6YA 1GQ2A 1A27A 5JXWA 3UKOA 3HADA 2P9GA 1W4ZA 2AQHA 3E03A 3VTZA 2WJPA 1A5ZA 2VT3A 3L6DA 4IIUA 2OFPA 2RH8A 4BS9A 2W2LD 1DSSG 2BFOA 5GZ3A 2EF1A 4BNTA 3RI3A 3D0OA 4INAA 2B35A 2BD0A 3D3WA 3OJ0A 2X58A 5ES3A 2IZ1A 2ZQZA 3AU9A 4BNVA 2GCGA 2JHGA 3L0DA 3AUSA 4NFHA 3DBHA 4ALMA 3ONEA 1LA2A 1I01A 1P1KA 1X7GA 3DHEA 1PQWA 2VYVD 4IZIA 2PWZA 2X1HA 1E6EA 1I30A 2VHVA 3PK0A 4J1NA 2R6JA 1AUPA 4DL9A 1HWYA 4O1MA 3H2SA 1U3WA 2VTEA 3K73O 4XQ9A 3GQVA 1H9AA 1KYQA 2WD7A 3OICA 4FGWA 4IDAA 4O63O 4LRTB 4XIYA 4E5NA 3PJDA 3UF0A 3JD0A 2C54A 3MJCA 2BKAA 5KKAA 3JD4A 5L51A 4E21A 3OF2A 3OH8A 5JCJA 4CQMD 4WUVA 4PZDA 4CMKA 4R51A 1BVUA 1ADGA 2Y0CA 3PQFA 4CMBA 3DWFA 4RDIA 2I5PO 4FIZA 5DT9A 3TL2A 5I9LA 4IDGA 1GZ3A 3OA2A 2X5OA 4JXKA 3R3JA 1LXCA 2PZJA 4BO3A 1OAAA 4W7HA 3DR3A 1MC4A 3LU1A 3E9NA 4Y6PA 2JCXA 1F8FA 1HL3A 2DPGA 3TNLA 3PP8A 4QO8A 4UVEA 1P33A 4QFDA 1HYEA 4RF3A 1BHSA 4BNWA 2ZCUA 3GRPA 3WMXA 1R12A 5TJHA 1I2BA 1KETA 3Q2KA 3MOIA 4AICA 3RUAA 3ADOA 2EJVA 4O6VA 2YJZA 3DOCA 4PLCA 4KQWA 3RD5A 3S2IA 3V8BA 1IZ0A 5GY7A 3K92A 4Z3KA 3KEQA 1DO8A 1WWKA 1RM0A 1GEGA 4MPDA 5L53A 5CDUA 3NDRA 3ENKA 5TS3A 5HM8A 4OKIA 4GBJA 3D7LA 2AE1A 4J1TA 3FI9A 4J90A 1VM6A 3QLJA 4D7AA 5C7IO 1ZW1A 4S1VA 1E7QA 1HE4A 4D42A 3GH3A 4DREA 3MOGA 5DCUA 3FNFA 1P1JA 4CLOB 3L4BC 4MVJD 1E0DA 3CXRA 3TQHA 1GCUA 1HSZA 3EMKA 3E1KA 5IF3A 2WD8A 3KYDA 3BTVA 3CZRA 4KUHA 4JJGA 3WG9A 4PG6A 5FYDA 3ETDA 4FFRA 3WGYA 1U2GA 3GPDG 1P0FA 1PS0A 3MJSA 5ICSA 3PFFA 4UVIA 1TLTA 3HG7A 1XEAA 2HK7A 3ROQA 3B70A 4FC7A 4FB5A 4BO1A 4L9RA 5U9CA 4GPD1 3G17A 5TX7A 2DT5A 3LVFO 3GEGA 3UFXA 5KVVA 3G1TA 1GZ6A 2W2KB 4GH5A 1PJLA 2QW8A 1T2DA 4BNFA 2VZ0A 3GGPA 3M2PA 3A4VA 3LLSA 2CDBA 2FPPA 1N92A 4GKBA 2HJRA 1P0CA 4E3ZA 4F45A 3I9JA 3ONFA 2NSDA 4PG4A 3LT0A 4RF2A 4GMFA 1DC4A 3V5NA 3ABIA 5FEUA 2XPCA 4A73A 1ZIDA 2RAFA 3QIVA 2HLPA 3U4DA 1PS8A 2SCUA 2DAPA 2IZ0A 3JYOA 5KVQA 4B4VA 1PQPA 3WFJA 4AL4A 2CF6A 1IOLA 2ZK7A 3BHJA 3JQ6A 3FCOA 4CLRA 3ITDA 2WYWA 4GAEA 1RYDA 4DPLA 5JC8A 5ER6A 1XKQA 2DBQA 5AOVA 1YB5A 1AGNA 1O6ZA 2X23A 4KMSA 3D3WB 4M89A 4NH4A 1JLLA 4GLLA 2O3TA 1O89A 2GNAA 1TT5A 4XGNA 1J4AA 3FHLA 3R1IA 4RLHA 3RBXA 3WIDA 3U09A 4HFRA 4I8XA 4AJNA 1NBOA 3KLPX 1QXSA 5EIOA 1E3WB 1IB6A 3UCFA 4JLWA 4PVCA 3OETA 9LDBA 2EW2A 4BNUA 2W2LA 1SBYA 2GN4A 2VWGA 4EUHA 1XELA 3K5PA 4J2HA 5T8KC 4XR4A 4WASA 2JCVA 5K6AC 1IPEA 4YT2A 4FFMA 4W99A 4CV2A 3NDIA 1E1LA 3MJEA 1V0JA 2VYVA 4EW6A 1Z7BA 4YQZA 3F1LA 3C7CB 5COQA 1SEPA 2NADA 3SJUA 4YACA 1VPDA 2CDAA 2Y93A 2Q1UA 4Y67A 3WGQA 3F46A 1X0VA 2Q3EA 1W73A 4NBUA 4YJGA 3INRA 3ZHYA 3ZU4A 4CV0A 4YYZA 5T57A 5A9SA 1Q7BA 1E6WA 3MCVA 4ALJA 3AM4A 4YJHB 2A4KA 2PD3A 4J4HA 5L7WA 1PS9A 1NHGA 4PLZA 2Q99A 4PLHA 4Q3AA 4HP8A 2HO5A 1DRUA 2AEMA 1NVGA 4OL9A 4NIMA 5H82A 4L75A 5A04A 4XB1A 3QA9A 2VWQA 1EK5A 4BNHA 4YT4A 4CQMA 3IDSA 1RKXA 2YQ4A 3LF1A 1WZIA 4DYDA 2J8ZA 3ZWXA 2GN9A 3JSAA 4FFNA 3I52A 4RQTA 5G4KA 1ZK2A 4HFNA 4IBOA 2I67A 3IUSA 1ISIA 5KJCA 2JJYA 2YHIA 3EHEA 5BR7A 4R9RA 2O7QA 3DQPA 2J5RA 1NVTA 2UUPA 1BXZA 4C4OA 3LLVA 5AQ1A 3QWBA 3QVWA 1OC4A 1VC2A 4TROA 4AFNA 4ONEA 1I3KA 4RVFA 4GI2A 4H15A 4KWHA 4JX8A 2BMAA 4RPLA 3RIHA 1B3RA 1HZJA 1W6UA 2GERA 2EXXA 3VZQA 3GK3A 4Y6SA 3D4OA 1E7SA 2PD6A 2GO1A 2ZTLA 4Y98A 1QP8A 3U4HA 1PGJA 1U5AA 2D59A 1ZK3A 4NBWA 1GEEA 3U4IA 4UVHA 1XDWA 2V6GA 1BGVA 2VNSA 3H5NA 2A35A 1ZXBA 2Y1OA 1E7YA 2VOJA 1PWZA 3RKUA 1BDMA 1DB3A 1NYTA 5C7LO 2GPTA 1GYQA 3GA0A 5HTOA 3KYDB 4Q9NA 4FOSA 1MB4A 4J0EA 1MG0A 3RUDA 3NTOA 3ZHZA 2Q4BA 4HNHA 4EZBA 3GNQA 3ONDA 4Q3DA 3L9WA 1EK6A 4IJVA 3NJ4A 5DP2A 3PWKA 3A1NA 3LK7A 1E3EA 1EMDA 1QYVA 1I10A 3AFMA 3DZKA 4XYGA 2CY0A 1X1TA 3MEQA 4QQRA 4KZPA 4BQRA 3O4RA 3UAGA 1KVTA 1U1IA 3WJ7A 4MP8A 1NR1A 1U4SA 2QYSA 2H9IA 4U6QA 2AEJA 4JNKA 1KC1A 4YQYA 2LDBA 4I08A 3GOHA 2BELA 1ZUD1 3W1VA 4R54A 1HYHA 1V3VA 2VNAA 2X0RA 3DHYA 1ORRA 3GNTA 2JFGA 4PN3A 3LYLA 5ENDA 4MKXA 2WEKA 3VH2A 4PG8A 2ZYAA 1KC3A 2B4QA 3OECA 4GX5A 5IN4A 2P2SA 1LSUA 4NU6A 3PVZA 1Z82A 4TRRA 1PZFA 4KUGA 6ADHA 4PG5A 3D5QA 1SPXA 1U3TA 5L40A 1ONPA 1TXGA 1EUDA 1YBAA 2NVUA 4A0SA 1P1RA 1M2WA 3ETEA 3GMSA 3JQ8A 1YQDA 2QYTA 2GD1O 3PIIA 1XGKA 1HDXA 1PU2A 3CE6A 3UCEA 3VC7A 4J1SA 2PK3A 4XYBA 5K6AA 2JD1A 5C7OO 4QT0A 4ZVVA 5EINA 1WDKA 2FSSA 5U1PA 3ETGA 3EY4A 1I24A 4BGVA 3ON5A 1K0UA 1Q0QA 1TT5B 4KDEA 2GLXA 2EJWA 3VKUA 1Y7TA 1ULSA 4MVJM 5I8WA 3AM5A 3KYBA 4DBVO 3GN1A 2O2SA 4EUFA 1K6JA 2VTDA 3DFUA 1LQUA 3QW2A 3I6IA 5JE8A 1OBFO 3GHHA 1NFQA 1DIBA 1T4DA 2G17A 3ASUA 3VZSA 2ZB3A 1PIWA 1XA0A 3DZBA 3K2BA 5COBA 3JD3A 3DDNA 3H6KA 1P1FA 3I1JA 4NI5A 5F1OA 1M6HA 2J5KA 1DLJA 2XOXA 3KRTA 1QYCA 2GGSA 4CM8A 1WMBA 2YFHA 3PRJA 1ZK0A 1R4MB 3G49A 3RFXA 2B4RO 1E92A 2HU2A 4NHEA 3DZFA 4RJTA 1F06A 1U2DA 5DCWA 1GY8A 3LC2O 4EJ6A 2ZJ0A 3BZUA 4YJGB 1JWBB 1BVRA 2IYPA 1JW9B 3GUYA 3KM0A 4B3JA 2GRAA 2O4CA 4GMGA 5IG2A 3AM3A 3RUFA 4YWJA 2WSBA 3ROPA 3QVXA 1NNUA 2PH5A 1FJHA 3HDYA 3RQSA 1R37A 1V3TA 5TRTA 3UXYA 4CMCA 3WXBA 2W4QA 2X6TA 4NBVA 1NAHA 4WGGA 1MLDA 3H4VA 4MP3A 1ENYA 3Q11A 4EJMA 4NFSA 1ZVMA 4CQLA 1UP4A 1YJ8A 3A28A 3RROA 3WTBA 1YL6A 1ONOA 4ND2A 4AJPA 4D3SA 5G4KB 1ZZEA 4I1IA 4IDDA 2OXIA 2NTJA 2YHIB 2X9VA 5EL0A 1HEUA 1DIGA 1IHXA 3PPIA 2C5EA 2H1SA 2CNBA 4K26A 3P2OA 4GX0A 1LC3A 1A7AA 5IDWA 1E3IA 3O26A 3HDQA 1RYEA 3RC2A 4BMNA 4B3IA 4DA9A 3C1TA 3ZCXA 1DOHA 3U62A 3VZRA 3H5AA 4RVUA 1B16A 3WGZA 4II2A 3I6QA 4JCOA 2P91A 2B5WA 1MXHA 1JKFA 1LSOA 2Y99A 3ORFA 5K0ZA 2FZWA 3I9LA 4FSHA 4Q3NA 4TVBA 4XCVA 4BNJA 5KJFA 5L95A 4PLWA 4B4WA 2BFMA 5FI5A 1PTJA 1KIFA 4YAEA 2Q4EA 2ET6A 3DC2A 3EAGA 2PNFA 4DLLA 3RC7A 4DIFA 1HRDA 4W4TA 4D3FA 2BGMA 4WCDA 1WAMA 1WMAA 4ZN6A 1EE9A 1E3LA 3E82A 3R0IA 4QUKA 4U0KA 4R5HA 1MFPA 4PRLA 4CUJA 4E5MA 3F3SA 5F1PA 2QIOA 3KSUA 2GZ2A 1NHWA 2WMDA 1EBFA 1XHLA 1T2AA 3GR6A 2R00A 1QYWA 5ER9A 5ILGA 3CH6A 4UEJA 4OOFA 4N5LA 3I9MA 1MUUA 5B4TA 1VE9A 4QTZA 1KVQA 3GFBA 3FRJA 2HCTA 5TSDA 5JYDA 1NXQA 2VHZA 3EK2A 5GZ6A 2NM0A 1E77A 1GYRA 4E12A 4RZIA 3LSYA 3E48A 4JGBA 3B1FA 3QHAA 1PX0A 1E6UA 2NV6A 4FBGA 4WJZA 5H81A 4DTIA 3F47A 2VUTA 3JTMA 4BIIA 1X15A 2X0NA 4BHTA 1A9YA 2EKQA 1XLTA 3NKLA 1LLUA 3IKTA 4I5FA 3TFOA 2NTNA 3K2EA 2NVWA 2RHRA 3IJPA 5JYEA 1WVGA 3ZWCA 3JQEA 5T64A 3W8EA 4CM7A 2EP5A 4YEDA 1CEQA 3CKYA 1GUFA 1YE3A 1LLCA 3GPIA 1GUZA 4DMLA 1I0ZA 3L07A 2NVUB 1U5CA 3JQ8B 2C0CA 5A4DA 4L4SA 3K31A 1MG5A 1W0CA 4G65A 4B7UA 3PZBA 4CV1A 4IDCA 4JP2A 3F4LA 4MKRA 4LMRA 3PFWO 1VJTA 1IL0A 4LCEA 3ZNOA 1EFLA 1H93A 4O5OA 1Y5MA 2V65A 3TFQA 4EEZA 4D45A 4CLOA 2TMDA 4WOJA 3GAFA 3WR5A 3GGOA 5FF9A 4AG3A 1OI7A 4AJ4A 3PWSA 1B2LA 2O2YA 2FRDA 1Y8RB 4FS3A 3OEWA 5A3VA 5TQVA 2CDCA 1KVRA 5G0TA 1D1SA 5I7VA 3ZWVA 1P9LA 3DO5A 5MGBA 4HNGA 4XYMA 3H3FA 3V2GA 4PLFA 5A5EA 2HMVA 4QSMA 4J91A 3RUIA 1TEHA 3WYCA 4E2XA 1UXHA 4OH1A 4ALNA 1PJTA 2V6BA 4DQUA 3BMOA 3H9UA 4PFJA 4AJKA 2OMEA 5KOIA 1LDGA 1FXSA 2DKNA 1Z6ZA 5HA5A 1BDBA 2AW5A 3QVTA 3QV1A 1N9GA 1V35A 3NGXA 4IGEA 4KTVE 4DYVA 5AXCA 3DONA 4I5EA 1YGYA 4WECA 5ADHA 1NR7A
chains in the Genus database with same CATH superfamily
2NUBA 3DE5X 4DADA 4M86A 1NQWA 4UBLA 1ZUWA 2FYTA 1SCIA 2BKEA 2OB1A 3PNYA 4L8GA 1L5KA 2VF8A 1UANA 1JLKA 1V96A 3L0YA 3U3KA 2BEWA 3OZAA 5FUXA 5EQDA 1WU7A 2HCBA 4G1MB 2OVBA 4WCVA 3ZI7A 1XXHE 2ZI5A 2OORA 3B36A 3EVAA 2HWWA 4IINA 1Z62A 1R74A 2YMPA 3NATA 4YMTA 4DUYB 4A03A 4EHAA 5K8UA 1MEOA 1J0DA 1R8JA 3FZEA 1A4IA 1UOOA 1RPAA 4MGIR 4Q7MB 5MN4A 1ETUA 1R0CA 1GFZA 1V1RB 3WFIA 1II0A 2AIRA 2BHNA 4IIHA 2IW3A 1KIAA 2X2PA 2R1VA 3IULA 3EPJA 1HDZA 5K9ZA 2C3YA 3G02A 3OZBA 3H17A 4OHVA 4C03A 3U7JA 2SHKA 3HEAA 1FU4A 3K1JA 2JLUA 3A11A 3L7OA 1G66A 2EU8A 1EPUA 3FDIA 1Y9ZA 1E8NA 4EVIA 3L7LA 3RS2A 2HSEA 5IC6A 3C16C 4WVLA 3NVAA 5LZ5A 3FF4A 4A5OA 3UUGA 2ZYHA 1E7WA 5ALWA 3STTA 2J9XB 1L7EA 4IMRA 4CM4B 4KR7A 3V6MA 4MROA 2PX5A 3RUCA 3CHYA 4GX1A 1GDDA 5E6UB 4RPHA 2YJNA 3W5AA 1S6YA 1OBVA 1WKCA 1Y6QA 3TGPA 1I3MA 1ZD5A 2XWBF 1YK0A 4DEVA 2Z2IA 2DPYA 3MN1A 1CJSA 4W1SA 1W76A 3S1LA 2D4AA 3JQGA 3K0CC 4G4SO 3V2IA 5JU6A 1L1EA 2YXDA 1LY1A 4L08A 5B58T 1OILA 3TN7A 1AXRA 4G5XA 3IH5A 2DOKA 3BQMB 1XEXA 4Q12A 2HJ9A 5KQRA 4ESVA 3EPRA 3DKKA 1O0SA 3CLRC 3TUJC 3BTUA 1Z6TA 1YDWA 2HA6A 4G24A 5FWYB 3VO1A 4BUZA 4E3WA 3CSSA 3FNQA 4L28A 1DWQA 1PLJA 1JQBA 1TD9A 1FNBA 1T43A 2EX4A 1RJFA 4DY4A 4BVGA 2XT6A 3IAM6 1JIJA 4K1LA 2NT3A 3ADKA 2C8KA 1OR8A 3AI7A 3X1MA 2XCIA 5IK2D 3RLFA 2CL6X 4C7JA 1SHLA 3A04A 2QL6A 1DUIA 2PYIA 4GPZA 4NK5A 4QXQA 4R7GA 5H16A 1JFTA 2AVDA 4UXHA 2AFIA 1N0VC 2CYAA 1JHXA 4W5HA 2I2WA 1Y9EA 1WSWA 2G1UA 2POCA 3OPYB 1EZ4A 3K2IA 5BNIA 1CUJA 1MMFB 3PQDA 4V24A 2YXEA 4G5GA 1SBQA 1IHOA 2ZUVA 3H13A 1I7LA 1HYQA 4UHKA 1RHKA 3I6YA 1U7WA 4PWZA 1ACLA 2G9QA 4G2TA 4KWEA 3PDWA 3W78A 4DPKA 1XRPA 1R6AA 2C07A 1V95A 4BNZA 3EXEB 2PUBA 4K9DA 2HYIC 1SD1A 4FR5A 4UEKA 1XVAA 5FHQA 3GGGA 5FTWA 5IBQA 4MYSA 5JZBA 2OCGA 4J0CA 4RORA 3J80A 4QOHA 3FUUA 2AX4A 3CIFA 3D3KA 1SXPA 4V1CA 3V1UA 3THYA 3CG0A 2X13A 2YNMA 4QQFA 3RFFA 4XEHA 4M8LA 2VSFA 3NBFA 2CUKA 2LTAA 2WHXA 3K0AB 3OF5A 3ZNQA 3RARA 3VR0A 2OE2A 1QR2A 3E35A 3MNFA 2QUBA 4G1EB 1G21A 5DM60 4EP1A 3IHWA 1JQ5A 4CT4B 3B6KA 3ZZ0A 5LNK1 2FEOA 5EP2A 1NZDA 2PSHA 1YF3A 2E89A 4MYTA 4Q6WA 3F5QA 4GR5A 3L8YA 5H59A 1JYEA 1L5LA 5LKAA 2Z8ZA 4H1WA 3P2YA 1EEHA 2NOAA 4ZYTA 4U0JA 1QZ3A 3T61A 4QYSA 1O6CA 4JIGA 2AZDA 2I4MA 2PKRA 4CM9A 1KERA 3C7AA 4X7RA 4UTZA 1YZGA 3E9ZA 3KOUA 3TZ6A 4IDUA 1D7AA 2Q6KA 3AV0B 1OFUX 4U1RA 3U0BA 5LQAA 2CK3D 2IOQA 2NXNA 2GVDC 4EJFA 2XOKA 3JATA 4JN6B 4L78A 5JO0A 2UZ1B 2REBA 1TECE 2FPIA 2AMLA 3NHBA 2G80A 4MRRA 1PJ3A 1EGAA 2X19A 3P9XA 3NP9A 4BAGA 1Y8QA 2FFQA 3AWIA 3FCAA 2FHPA 2IYOA 4UVDA 1X7ZA 2RGAA 1II9A 2V7UA 4UTRA 1WXFA 1LRLA 5EZYA 1I4TD 4MQEA 1C9MA 3D7RA 4EKDA 5E7QA 2Z43A 2QVYX 5BMOA 3EZ9A 4NCNA 4GR9A 1TC2A 4LTDA 1QOPB 3VQTA 1A5TA 1D4AA 1KMHA 3KELA 4GLBA 4BVBA 1N9GB 3PEUA 3DMTC 1CUFA 2Q7OE 3PF9A 5CFMA 2X8WA 4R2JA 1AA9A 1IMOA 2GYYA 4I55A 3FWZA 1K7SN 1PX2A 2C03A 4NESA 3K53A 4WK4B 4P2BA 3WGMA 5TXGA 1FBTA 1GTMA 2GAFA 2XA9A 4TVKA 1ESEA 3HDHA 4XFDA 3W9YA 1OA0A 2AC7A 3KZNA 1CXZA 1PZEA 1UK8A 3PR2B 1VGQA 2OWEA 4PYJA 3D0KA 5FJJA 3VJLA 3EDOA 1F6BA 5L7YA 3SJ7A 2N47A 2WJGA 5KSYA 3EWIA 3QPVA 4P3YA 4LF4B 4IIJF 1YKFA 4F3YA 4ME6A 1TU3A 3DOJA 5KHLB 3LFHA 2C78A 2ZT6A 4JZYA 5EESA 2RARA 1G17A 2OQ2A 3QFHA 1QG0A 1NUAA 5AK4A 4L76A 3S2UA 1NJ6A 2WWIA 1XF1A 4JB8A 4BO8A 1TRHA 4MVJI 1MGPA 3BYZA 3E9YA 1PVVA 3Q3IA 3MT9A 4S1OA 2OXCA 4MOWA 1IG3A 1NUUA 2W2TA 3P27A 3I3OA 4BMXA 4RZ2A 5K8LA 2AKEA 1I4LD 3SIWA 1ONBA 2QL7A 1YB6A 4WESA 3H9JA 4UKDA 5TC4A 4YCDA 5FRDA 5IRCD 3B3JA 2PY6A 1SXGA 2I6FA 4RMHA 1BS9A 4RK0A 4TKZA 5EHZA 1A9PA 2R2AA 2MYTA 3WRYA 5G0SA 2GUWA 3BGSA 4QELA 3TXXA 2E4VA 7AT1A 3G1WA 1WUKS 3AP2A 2A0FA 4K9RA 3AI2A 3TMAA 4HQLA 4CKWB 3HDJA 1QP0A 5KS2A 1UKAA 1FP1D 2H7YA 3RREA 2YFQA 4UMFA 1HT0A 4KFSA 5AM3A 2JFHA 3CZCA 1NP3A 1X77A 3BXOA 3KT6A 4IX1A 5DNWA 3KJIA 5BWMA 1PYGA 4YRQA 4V0SA 4TYQA 4EK9A 2B2CA 5IHPA 2P4HX 1SCUB 2X8JB 5I9BA 3K5IA 1FVFA 2I8LA 5L3ZA 1JDTA 5IM4A 2AE2A 1S8FA 2P6OA 1OXMA 3O9MA 5HR5A 2NN3C 2JLWA 3ZV7A 2IS4A 2C4WA 2DCMA 1B3BA 2VK2A 3GYBA 5JWRA 4WFKA 3DTNA 3DHVA 1NXPA 2OVFA 4Q16A 2C9OA 3OX4A 3KOOA 1GPJA 2VSYA 2X3FA 3IYLW 4WLEA 3WP1B 4W1PA 4TXMA 3DMPA 4DDMA 2HRZA 3IPYA 3A6KA 4MO9A 1H05A 4ATNA 3V7NA 2EJTA 4LECA 4HFMA 4LUCA 2KBFA 2VHWA 3EVFA 3E7WA 1OFGA 3ROTA 4MIOA 2UVPA 4LJ4A 3Q7EA 1JFRA 1XA3A 3BSYA 4IIVA 2HHJA 4M9CA 4QUHA 5IT5A 3MS7A 4JEHA 1U2DC 3O0DA 4CFSA 4B85A 3RVRA 4QQNA 2ZCJA 1KEKA 1DTWB 2I6XA 3KBBA 4IQ0A 4B2IA 1H0SA 1GFIA 2F8SA 4R83A 2E4UA 1SD5A 3LX5A 1IN7A 2J5XA 4HDKB 2IV2X 2QYHA 1PK7A 2R48A 3JQ7B 1Q7CA 4N65A 1RYYA 5CBPA 3CM0A 5ALYA 3RIMA 4QGHA 4KYUA 2C0QA 3COSA 1YJCA 1NOIA 4WINA 2RC6A 3MWEA 1JAXA 2IHTA 3PHJA 1LI7A 2JBHA 2ZIAA 1NW4A 2XIQA 5JQGA 2I9KA 1N6PA 3GAAA 3TINA 2PBLA 2Q46A 3ZWOA 3KHTA 1XZFA 4B46A 5KHOC 1DOAA 2TYSB 3TRIA 4DHWA 5JISA 2DUWA 1M0SA 2JJ1A 2X0JA 3D8SA 1C3OA 3TLGB 3FHTA 4KB5A 1P29A 1M9NA 1PF7E 3W5DA 1YVRA 2JIZD 3E3NA 3RWMB 2IBMA 2TSYB 4Q18A 4DF3A 2VDVE 2AN3A 1JIXA 3WWYA 2OY0A 1IN6A 1R6XA 1KFKB 3LC1O 4IWXA 1AE1A 5I3ZA 3U44A 4MAFA 2Z08A 5ERYA 1H4QA 3HWX1 3A2LA 2QGFA 4BVLA 3BHMA 4NSNA 3R6GA 4Q9IA 4IJWA 2RB5A 3F4BA 2JVJA 3B6JA 1GA4A 3M4YA 4AP6A 6LDHA 1JR2A 2OSBA 1YJBA 4DV6B 4WH0A 1LSSA 3FMOB 3SKVA 4HATA 1UXGA 4A8TA 2CBZA 2R9VA 5ALNA 1FF9A 5IAGA 3QXGA 1HTTA 3EGXB 4NV0A 1PQYA 1QIIA 2HBQA 3QUSA 4X6YA 3L8GA 4X8LA 5TIIA 2EZ9A 1IATA 4KMOA 5C8ZA 5ICFA 3ABOB 4B4UA 4XSHA 4L0MA 3W04A 3NYIA 4XUDA 3HJUA 4IWNA 4CMEA 5B55A 4ETMA 2PEYA 2PRKA 2DWOA 5TQ0B 1CHNA 4QEDA 4KLCA 3D1JA 4O2AB 1ZJ4A 3N8GA 1QFMA 3JR3A 1K9SA 1M76A 3Q9NA 4OOEA 4BEJA 1QFYA 1FW8A 1PJ4A 5LQRA 1TKBA 3R9KA 5IFLA 2PZ8A 2VUIB 4C06A 1KI4A 1XTUA 4YIHA 5M2QA 2PS3A 2YV3A 3NT4A 2MTBA 2GK7A 1F7UA 4NTZA 5EUMA 1JFFB 5FOUA 1I9GA 3S3TA 3BSFA 2Y1CA 2CLLB 1U0SY 5T7BA 1KHTA 5DI9A 1TGYA 2VKQA 1DL5A 1T3GA 4I1UA 5TR9A 5ITSA 1YR6A 4EM6A 1W85A 3GA5A 2ZRCA 2VZ8A 2CHGA 3GJYA 4AYXA 1QAOA 2OO5A 3BGIA 5B7GA 1LC0A 1NXXA 1Z2NX 3WGHA 2XMCA 1DKQA 3C70A 1DIHA 4XFKA 2XKKA 2ZS8A 4HCJA 3SJAA 2QT0A 4C0BA 5KTPA 4UHBA 1NPTO 4K05A 2XMDA 3LA8A 2Y1DA 1UPCA 2FLKA 4OGFA 5DTQA 1Z2PX 3OZSA 1YZHA 5J4HA 4OBBA 2QX9A 2BH9A 1T8TA 3CLSD 1XLTC 3JVDA 3RSLA 3X2SA 3WZLA 4O8CA 5FNVF 1MNQA 5HBRA 4P6VF 3GLHE 4BZZA 1SCNE 4BO6A 4BPBA 4YJFB 4MQFA 4DLYA 3RBVA 4CTNA 1T2NA 1E9AA 3GJSA 1U1DA 3N2GA 2R96A 3P2KA 2JI9A 4DDVA 3DLTA 3ZDQA 4AN0A 1DUVG 2WILA 1XU9A 3Q15C 5DXJA 1UDWA 5SV2A 4A23A 1LJ8A 4K2AA 2OZLA 1Y8RA 4MSUA 1FSZA 2O2GA 5TB5A 1XV5A 3UKDA 4HGQA 4ACBA 1WD5A 3PJFA 4Y0NA 2Q5IA 1T9BA 2YYYA 1KE1A 4KNVA 1Z0FA 2EL7A 2Z95A 4H1TA 2A9FA 3TZBA 2WQ6A 4AJEA 2YX1A 3CBGA 4MWTA 1I1OA 4WXPA 4P84A 2AYXA 3LUHA 2NIPA 3P9NA 1CFZA 1G1AA 2PR7A 2Q29A 4IKEA 1OPXA 1YI1A 2GAJA 3I6BA 4JBNA 3DYIA 3GGCA 2XW6A 4FXPA 1GLNA 1OT5A 2R8EA 4YV0A 1TYEB 2UZ4A 2BMWA 1XMSA 1I0IA 5E7IA 4P58A 2H1OA 1RP7A 3CH5A 1Z47A 2QRLA 3DKVA 4U63A 5J4YA 4U02A 2P67A 2CMKA 3GFTA 4DNPA 2J6IA 3UMJA 1KOGA 5EAIA 2EHDA 3KTDA 3KP1A 4S0XA 1PFWA 5KPJA 3C85A 1GADO 4DLUA 2FMFA 4D6YA 4LISA 4DUZB 4JJZA 4TUYF 13PKA 3K0KA 1VRWA 5FFFA 3TRHA 4QUJA 3RK4A 4G5HA 2DQSA 1YMUA 1PGPA 2VDJA 4OB6A 4J0QA 5AFSA 2V7VA 3UV3A 1JWAB 3W7BA 1V7PC 2JIOA 4RD3A 1PFYA 3H65A 1RRFA 4E4TA 2ATIA 5IVPA 3LL7A 2D5AA 1SQFA 3IT2A 1OYOA 1GNRA 4K6CA 2WTXA 2VH2A 3Q12A 3GZNB 4US1R 1W35A 4E33A 4ECEA 4XVCA 1PZHA 4U9IS 1RC0A 3U7GA 3M1IA 2K2WA 3QOXA 2GN0A 5B57C 1UP7A 1Q57A 2HJSA 1K89A 4KAXA 2HADA 1KSHA 5IJZA 4BX3A 2WAAA 4GL4A 2W93A 1IE3A 2QJWA 5CA0A 1NXOA 3KQLA 2XMPA 3A9WA 4LHSA 4N82A 4LY6A 2WHRA 3ZV6A 3MTIA 3W6NA 3UB4A 2X4GA 3DBLA 2DETA 2C9BA 2PBRA 5EJIA 1VE3A 4DCGA 3EDCA 4FR0A 3DZIA 5BSHA 2Q2VA 3NGLA 4Q9LA 4I50B 4GQBA 5KREA 4E51A 1X7HA 5CEFA 1EBUA 2J6HA 1X13A 1UODA 3I4CA 3BB4A 3RHZA 5HDQA 5I5GA 2BRUC 2RGNC 4DNOA 4DQXA 4Z7JA 5TLSA 2J46A 1DDOA 1N25A 2AB0A 2QK4A 3HB5X 1AGXA 5EEHA 5K0FA 3TE7A 4PPGA 1Z08A 2QZ9A 3TTWA 2ZWAA 4TV8B 4F2GA 1QQAA 3BUSA 2BAGA 2PZEA 3JPYA 2C2KA 3NETA 3UC9A 4YI5A 5K8JB 3LBFA 3DHNA 1LDYA 1IZZA 4X3CA 3KNZA 5K7SA 2HF8A 2C1EA 3LJKA 4XX1A 1JG2A 4AD8A 1UOQA 4PM4A 3LGXA 5G2OA 1W52X 2PA0A 2I7XA 2FGJA 3NFYA 4X20B 4WCFC 5B1SA 4RCZA 4I6JA 4UCWA 2XHEA 3FWNA 4X8HA 4RIEA 1EM6A 1U7OA 4PBRA 4B4DA 2E5WA 4R1TA 5B4UA 1HYGA 2XMGA 4KQEA 1BZYA 1BQEA 1TYBE 1PVDA 1SQ0A 5I9MA 3TVDA 5HCUA 4I5GA 1T4BA 1HI9A 3KALA 3VU9B 3CF2A 3EA0A 3ICWA 4FXOA 2IHUA 4URWR 3ZE8A 4MWGA 2O5VA 2DSNA 2DFVA 4KQ1A 4N5MA 5JDIC 5CIWA 2RCYA 3Q1LA 5CYOA 4ZOAA 5KNDA 2DLCX 1I7PA 1KI3A 4YN3A 1B8OA 3ZE2B 4A16A 4FYXA 2EGGA 1FMCA 4W7IA 1BC5A 2UZAA 2YNMD 5CG2A 2DQ4A 4TS4A 3PFHA 4W99A 1URPA 1M1NB 3KD3A 1ID1A 4LK3A 4XPZA 4BV2A 2NZVG 2WWVD 4LGMA 2V7GA 2ZG6A 4RFSB 4XFJA 3CINA 2NP6A 2GBIA 2VJOA 2QD1A 4JKIA 4RV9A 3CR3C 2QW1A 2QRMA 3TD6A 4OMFG 5CH8A 4RHCA 4ENSA 3HCRA 5GWXA 4XRGA 4BJHB 7REQA 3U4MA 1A9TA 2XITA 4F1KA 1GT91 2JA1A 4OBXA 4RPGA 3UXMA 4BO5A 3LUJA 2QTLA 1Y5RA 4ISCA 5A7HA 2BLLA 1Z4LA 2EERA 4QXMA 3KDAA 1N2CA 3FWPA 3BK1A 1QH1B 2B21A 3DFZA 3MINB 3UJNA 2OUIA 4CM9D 3N39C 4HWRA 5I7HA 3L1UA 2B5OA 3U4AA 1TEZA 4D82A 1I2DA 4LAFA 2JAWA 1BOFA 1K75A 3NYWA 1DJQA 4Q7EA 3REOA 1KY3A 5E8JA 3V6LA 4IJKA 3ZOZA 2VYND 4BQSA 3VR3A 1W19A 2ZYSA 1XD9A 2W2QA 3E6AA 3FAKA 4QDXA 5LMNB 2GPBA 2IXAA 3L6EA 2GPJA 2XRYA 1QVVA 4ILKA 2V1UA 4OATA 5JWHA 2DY1A 1Y3IA 1G16A 3RS3A 1L9XA 1MAVA 2HLHA 4Z7OB 3QLVA 1FLDA 2WF9A 4M1YA 3VAAA 4NJMB 1EA5A 4ZQGA 3S40A 3UW3A 4PPQA 4DBLE 3JAWB 3Q3GE 1HDGO 4PFKA 5ERXA 3EVDA 1P61B 1A9SA 3P5BA 3RHSA 4QTZA 3RBAA 4NMXB 4WKPA 4HXYA 3MW8A 1U0HC 4JD5A 2CUTA 3A3PA 4X3OA 2EP7A 3C6KA 5IABA 4TT8A 1U7PA 5AVYA 1U9JA 2GJ4A 4JGGA 5FOVA 5DX8A 4Z53A 1IY8A 3HN6A 1M1ZA 2PA3A 4LX8A 2WTMA 2PLFA 2YWCA 4YAOA 2B6NA 3S28A 1RI2A 1GPUA 1NMZA 3H2BA 1SCKA 3BWMA 4DIEA 4CIXA 7ABPA 1C0KA 4K28A 1XA4A 5DNYB 3HABA 3OBIA 4KPGA 1M73E 4OP1A 1SJ9A 4P1ZA 4C7KA 1PL8A 2NW6A 3ZQJA 1RXCA 3T5AA 4TMFA 1XSEA 3DM9B 5TGDA 3TEMA 2I22A 3KLMX 4M6WA 5KTKA 5LNK6 1NURA 2Q4TA 4P4SA 3OEEA 1D4OA 2PBFA 2NU9A 1WJGA 4JJAA 4I1VA 4KP7A 4ON9A 5EJMA 2AN9A 4AZTA 4DQDA 1NQVA 4ZI5A 1N2SA 3PJGA 4AY2A 1ESNA 2IZZA 2H54A 1TKAA 3CEJA 4C0AC 4P5EA 2FA9A 3RS5A 3U60B 1POWA 3WJAA 1B8UA 4QHTA 3T4XA 4C7OB 1K6XA 2ZR0A 4JI2B 1GGEA 1HDRA 1Z13A 3G2OA 2OMKA 4K3UA 1BYUA 4C4SA 3KK0A 2E4XA 3INGA 5H02A 4ZI7F 1RW4A 1CUIA 2IBTA 3U6BA 4G5FA 3BGWA 2VQ6A 5B1HA 3A70A 3ANYB 1SHTX 5BW6B 2BMDA 3AHJA 3U1BA 4PXSA 1CY6A 1QB7A 1VPTA 2OHFA 2M6KA 5JS7A 4DR6B 2ZCVA 3CYFA 4JBXA 4Z99A 1LK7A 3TJMA 4EH1A 3MFQA 5AUQA 3ANLA 2QAGA 1D0VA 3DOOA 1VG0B 4WPGA 4ZXPA 3COZA 4M7PA 2ID8A 3ZW9A 3TXAA 4L8VA 6REQB 3LZ6A 5INTA 5TE9A 1EX9A 3A6JA 5A6VA 2HBRA 4F6LA 5JZOA 3C4JA 4B74A 1ZSYA 3FPLA 3PENA 4YRRA 4FGSA 3B51X 1U0GA 5CXXA 1LNQA 2WTBA 3GVPA 2D1SA 4KVFA 5FBKA 3SGLA 4C4AA 5FWXB 2OBNA 4A26A 2XNSA 3TZEA 1E5TA 4FSDA 4OAQA 2C82A 3AFIA 2O8VA 3L79A 5T3YA 1IAQA 2XF2A 5E4TA 4V2UA 4D8XA 4DLSA 1GAWA 3KR2A 1P7CA 2HJGA 3T1YB 5HP4A 3QPWA 3GJ0A 1NJ5A 2V6FA 3E3LA 3R20A 4BCDA 1E9BA 5EVJA 3E9MA 3O2QB 4MLCA 4HAYA 1UJCA 5NLLA 3VZPA 5A0FA 3DSRA 4EKNB 4D8TA 3P2MA 3LHSA 3T5MA 1YI0A 5IUNC 4ARCA 2Q7DA 2R5WA 3UMYA 5JAZA 1DV1A 2RI1A 1JR4A 1VJ0A 3FTNA 2A6PA 3KZXA 4LFBB 1T2CA 2FZ5A 4CFZA 1ZUNB 2O2XA 3NJRA 3ZHVA 4EB6B 3AZOA 5A7FA 5LXTB 1H5NA 5ENVA 4CR6A 5F78A 3QSYA 2D06A 4HQRA 4XDGA 2WNIA 4QU8A 2NTYC 1RWNA 3BXEA 3UB2A 2F3UA 3DB2A 2VRCD 4WLVA 1VA5A 3T9AA 3WS7A 4B80A 4ZDIA 4JMLA 2IC5A 3MAGA 3DDUA 4KDCA 4MQUA 5FNVA 1GVHA 4U7DA 2JJ1D 4PC3A 4X8MA 1SR8A 4BNYA 3EUAA 1IFXA 4W5TA 2P3OA 6CHYA 4K0RA 3KPWA 3H86A 4JVLA 4UBIA 3S99A 1XCLA 2HMSA 4LG1A 1FFHA 1JEOA 4WKGA 3D6TB 2QHXA 4KFTA 4FJ2A 1KBOA 2RJOA 3BH0A 4MINA 2ZUFA 2FSHA 4QYWA 3L8CA 3PQ6A 1L5GB 1N7GA 2GM3A 4XJXA 3RYIB 1M2VA 3U49A 5C8DA 3G0CA 2ONJA 4L85A 2WWXA 2B3TA 3M1LA 4UASA 2E49A 2Z5LA 3R8XA 3LT4A 3NM4A 3EX7C 4F9TA 4CIAA 4DR5B 2ONKA 4MW5A 1W36B 2HSGA 3HLTA 5EP4A 2ZTHA 4HD8A 2ZEJA 2HL6A 3ROMA 2EQ5A 4BKPA 1TM2A 5ALFA 5EIAA 1T4MA 1CERA 1NYLA 1Y1SA 3JD1A 3QWAA 4EX6A 1MAAA 4QTUB 1EFHA 3LUBA 4HOYA 4P86A 2VAMA 4LCBA 4PC1A 5AI0A 2PSJA 1X80A 2R751 1RE1A 3DAPA 3H2IA 3VJRA 1JSRA 2P78A 2YW9A 2YYAA 3BCSA 3OTHA 4DMMA 1C1XA 5JUWA 2I3BA 1BTOA 1AKYA 1WM1A 4AQYB 1JEAA 3EY9A 1FRQA 1MOZA 4JASB 2JHPA 3B7WA 4Q1DA 1MJ5A 5HE8A 1VHWA 2WU0A 4EDFA 3TG2A 1LW6E 4TUYA 5IJ9A 3K0BA 3AVXA 4KXYA 5F98A 3DOEA 4O1HA 5D87A 2CXOA 1LCIA 1JH9A 1OPRA 4GSKA 2ZIWB 5K2OA 5U4XA 3BTOA 1GAJA 1R2QA 2E4WA 2CJFA 2P9CA 1N32B 1QSGA 2FNAA 3G2MA 5G1NA 1DAGA 1PJ2A 3BMQB 3BS4A 3LF2A 5CK5A 5E0KB 2HSDA 5FAXA 1FDVA 2JFXA 4DDKA 4NZYA 4BV9A 1G9TA 3K9BA 3ZDCA 4GXNA 2NU6B 3HV0A 2OGSA 3EZLA 2XHZA 4BX9A 2PRSA 2Q8PA 4BQNA 1T2EA 4Q37A 3WGTA 4CW7A 5CGQB 1RAHA 3TL6A 2J4FA 1DMRA 3VR2A 1NLZA 3K0FA 3CRMA 4AY4A 4CTKA 2OM2A 3GLIB 4NBLA 3K8QA 3OT5A 1QLWA 1KRXA 2W6QA 2JAHA 1S7GA 4EPXA 3WGVA 1WSBA 1OIVA 3V4RA 1V9SA 2O2HA 2C5BA 4J94A 1L1FA 5HJEA 4G84A 4JY7A 1QYXA 1SU6A 1ODJA 2N1MA 1KJ9A 3DYBA 4K9KA 5EN4A 3OZGA 2XYGA 2VBFA 3IAUA 5IUKC 5ALOA 3WHPA 2C98A 4WVFA 1IHDA 2FZVA 3M6LA 5BR8B 4PW0A 3ACCA 2V6JA 2OV6A 5AESA 2J9RA 5ADWA 1RI4A 1OW3B 3AIIA 3EVCA 3NG1A 3PGVA 4QXRA 5CVDA 4GM1A 1J09A 3E7DA 2H2IA 5CDYA 2JGEA 4KFRA 3ZKWA 1OZ0A 4KVZA 1FMLA 5L4SA 3JQAB 4X94A 3S44A 2BKVA 1KXJA 2ZIZA 1JALA 1I3NA 1U2RA 4LGYA 2OC9A 1Z74A 3KQUA 1HTBA 1QHHB 2ZUWA 4RF4A 1G41A 3RANA 1LZKA 2XE4A 4DWVA 5BMVF 1V47A 2CT8A 2W2NA 2FW1A 3PDIA 2W7TA 2Z8XA 3GN2A 1FYFA 4GGPA 2QTVA 3U19A 2GYVA 4X8OA 2IZ7A 3QI2A 1KOFA 3HA3A 3TSCA 2DT8A 5B7NA 2YW2A 3NX4A 4FJ1A 2L18A 1I7NA 1U7XA 1UXKA 4H3HB 4FONA 4HNAA 5T4FA 1PJQA 2ECOA 3WQQA 1A2OA 1U31A 4L73A 1DCTA 1G0NA 2PT7A 2WFMA 1GQSA 3PHGA 1ECCA 4HQ6A 1CUZA 4NU5A 4UW9A 5CVUA 3GGSA 2HMUA 3GEDA 1DHTA 3TI9A 1E5VA 2IGBA 5F21A 1B00A 1BG6A 3WWZA 1L1QA 2R3SA 3MYRA 2ZR8A 3WIEA 1GV1A 3R0XA 4MARA 5ALLA 3ESCA 3QXJA 3ZNPA 1Z35A 2YIDA 3W6PA 1UFRA 2XZPA 2WIJA 1L5YA 2Z1DA 5EWLA 1G6OA 1PJSA 16PKA 5JD3A 3R9IA 2GCOA 3A7EA 3QXHA 3F9CA 4M46A 4FDAA 2QVCA 3D0RA 3HEMA 1SU7A 2CSXA 3IOCA 5DGCA 2BSXA 4EA9A 4KDRA 1Z2AA 1IEVA 3SXPA 4NAVA 4L8YA 1ST2A 4R69A 4UCFA 4JNGA 2ODEA 3EGOA 3SYLA 4E30A 2FR1A 4MWBA 4EG4A 1DBQA 2G1KA 3BWEA 5CNIA 5I9NA 1M34A 4JR0A 3IMKA 4J2OA 3PNKA 3PHBE 2ZATA 4CKEB 1M6EX 1CF2O 1T1IA 3CKLA 5JNWA 1J7KA 5E2IA 3KB6A 3P9CA 4J4BA 3RR2A 3HB7A 3ESBA 2G9NA 4L3OA 3G2LA 4OUDB 2ERXA 4P0TA 1ISGA 3PHHA 3KTOA 3BH6A 3WYNA 3FPGA 5WRFA 1GLVA 3GELA 3TTXA 1NVUQ 4MUIA 5DPMA 4YP0A 3T0GA 2EWMA 3HFRA 4JOQA 4BJ6A 1GPLA 2O05A 4OKNA 2OHXA 4DS3A 2VLIA 3MSXA 4LZWA 1SOUA 3O8QB 4TMWA 1NXSA 4BOYA 3IBYA 2HUPA 1ZXLA 3VDXA 1U28C 3S6JA 1UBNA 3KL2A 4PX2A 5KOHA 4WXMA 5TPZA 3ZX5A 4Z0NA 4PNPA 3V9AA 1U8CB 1KO8A 1IDN1 1XUOA 1J1IA 2G76A 3FTQA 2EYQA 5DM4A 4E0BA 1L3IA 3A0UA 3SZMA 1OVMA 3WADA 3X2EA 1X1BA 3ZWYA 2A5LA 5EWMB 4E2FA 4XYLA 2C9YA 2UVDA 4FDUA 3F6BX 5IW8A 4JI4B 2CJWA 2JGKA 3UJCA 3AQ4A 3SICE 4BRWA 4DXDA 4Y9DA 3GLGB 3EUWA 4MQMA 2TS1A 1ORTA 2EKPA 3QEMA 2IP2A 2FWRA 3LXRA 4G3XA 1NNSA 4G5SA 2RFLA 5A1JA 1RJWA 1SXHA 2I80A 2Y8EA 5IEJA 3M33A 3A6ZA 4XUEA 3WXMA 1P2BA 4XLTA 1Y3HA 2IITA 3R23A 5ALQA 4DLWA 2NV0A 1LDMA 1T3LA 2OQRA 1TX4B 2I66A 2YUIA 4DANA 3AUXA 2I3GA 4ZEXA 5JAQA 3UJPA 1D6JA 1XZAA 2FW8A 2OHIA 3F9IA 3LDHA 4OIMA 2Q4RA 4OJMX 4WZBA 4TLDA 5M7EA 4GEKA 1NFFA 3EZNA 1DG3A 4E70A 3FYDA 1EX6A 2VQDA 3G3EA 5K4AA 2XDWA 2BMEA 4YP5A 1GPWB 4YAWA 1KY4A 1Y37A 4QNNA 1A2BA 1O5OA 2VDOB 4YJDA 4PRKA 5JH7B 4ZYWA 2HNAA 4HNRA 5ED0A 2GFQA 1NF3A 4MW7A 2O8NA 4B3BA 3OE7A 5SYNA 1X19A 5HKOA 2FZGA 2J6BA 3NIFB 4ZI7A 3IVXA 3QXXA 4EA8A 2PZBA 2EFGA 3GRVA 3LPNA 2YHSA 3FM9A 3QVGA 2L19A 2QSUA 2IYRA 2QENA 1L7OA 2V9CA 1RWMA 2P1ZA 3K96A 1V4VA 3KHKA 4BGPA 4EJSC 3S0JA 2R1ZA 4LOHA 2UZ0A 3OUUA 4UUQA 4YUVA 3Q0IA 3TDMA 5JAMA 4WBSA 3STYA 2I54A 4PC2A 4BNKA 2J3DA 2G82A 2GPWA 3B3QA 3NV9A 1K9VF 1IQRA 1HE5A 2CVQA 3OCCA 4RIFA 5GOZA 5SZIA 2IUSA 4LJSA 1D9XA 3O3NB 1P75A 4BDTA 4BVHA 4XWKA 2XDQA 3PLNA 3GAZA 1KI1A 5A06A 1P62B 2GBLC 4KMMA 5IBCA 1K66A 4OLJA 4IQ8A 4B5LA 2Q1XA 3VNBA 2ARKA 4ZU1X 5KTTA 3AV3A 5HUHA 3DNFA 5DCYA 1E9EA 1T5DX 3EIUA 2G0NA 1PNRA 3LO8A 1YV9A 1OZHA 4FFWA 5FA5A 4D9HA 1U8UA 3HYCA 2RGDA 3RVMA 1Y81A 3RHTA 2GN8A 2B36A 3AEYA 5BWNA 1FFYA 1H6BA 2XVMA 5J2UB 4RD6A 3I5XA 5K3OA 1Z5PA 3W9UA 2P5TB 4EY8A 1OD6A 1DI0A 3OJCA 5AI4A 5LB2A 5BOSA 3QNWA 3WMWA 3PI6A 4EB0A 3RCBA 1M1YB 2ZREA 4FE4A 4HWSA 4HZIA 3U3RA 1VJ1A 4W1RA 3AJAA 1GZHB 3LNTA 4JI1B 2HJVA 5CX1A 2BBWA 3A6LA 1G6HA 2NZXA 4WSOA 3OEYA 4AZ3A 5JCPA 1VL1A 1WB6A 2CYCA 2UZ3A 3A26A 1ECBA 3BIWA 3JZAA 3M9LA 2BHRA 4BO4A 4NMHA 3OEED 1FE8A 1XCBA 2OXRA 3MHTA 1T5TA 1RRVA 2PGDA 3DBOB 4KHZA 2W48A 2W90A 3GEEA 4V0KA 4QOGA 1ZMTA 4EAQA 1Z2CA 1NN0A 3S1AA 2IY7A 1H69A 4DV1B 1X7YB 2FAXA 3KAKA 1D6MA 3IB6A 4CMAA 5AVTA 1WF6A 4TLLB 4Y2YA 3W8DA 4K3VA 1PT7A 1P5HA 1RSZA 2AOWA 5AKXA 4NYMQ 4HV4A 4YMUA 2ZJ8A 3A6HA 4REMA 3CNOA 1HG1A 3HVKA 4FBLA 4XPIA 4F3TA 3DHWC 2V7PA 4CR7A 3K35A 3RK1A 5JPIA 4YR7A 3TZQA 3ICEA 3KQPA 3KUXA 4GRAA 1FS5A 3T3DA 3EGEA 3WB9A 2YV2A 2H0RA 4G81A 2ZYWX 1C41A 1D1TA 1RWBA 2WJZB 1I1NA 4R98A 3BMNB 3AB3A 4Q9AA 2A88A 3H2JA 3A4YA 1LDEA 2V58A 3BGVA 1PNTA 1IZ8A 1QTIA 1WD7A 2RG7A 3HY6A 4H16A 4TYNA 2NO5A 2YIVX 2FW9A 1R6VA 4BKRA 3GBSA 4CFYA 5FBVB 5LMCA 3W6OA 4X7PA 3QBEA 1B73A 2CF5A 4PIMA 2O8DA 3U3OA 3GQBA 3T34A 1O2DA 3OFSA 1L7XA 1LVUA 2XMRA 1VJDA 3F5SA 2ZS9A 1PJCA 5DBIA 4RVHA 2HWKA 4LXHA 2XMBA 4AMGA 4BASA 3ZHOA 1PJZA 4DCNA 3B1YA 3WK5A 3TW8A 5I7RA 4LYYA 2AXPA 1G20A 1ATZA 2NPIA 3UH1A 4WX2B 2B4KA 3D64A 3VHXA 3OIDA 3O9VA 1FFGA 1YBHA 4V38A 2REQA 4AMUA 5EJ4A 1JMVA 3H0EA 2H29A 2FN3A 4X60A 2BFEA 4HMQA 4RCVA 4C5CA 2WJHA 3ANNA 2FP3A 2JGLA 2RHDA 3EXHB 3I3SR 2GD0A 1A1SA 2G9RA 3PGKA 4I2NA 4JQZA 1XC7A 3T7RA 3K9QO 3T3MB 4K88A 2C97A 5HKKA 3CV3A 1CUUA 2XX3A 2NU7B 3DBRA 1M1XB 5KDDA 1R6UA 3GT4A 4PY2A 3AQIA 3JAKA 3IMFA 4C1NA 3FLAA 3TKLA 4D0RA 5KAPA 4FZ3A 5DGHA 4A10A 3BG5A 2UUCB 4RD2A 1H4VB 3ZHCA 4M9RA 3U9SA 1G2PA 5C5CA 2AZMA 1YOBA 1RRMA 1XZKA 3PQ4A 5GZ1A 1H3FA 1YJXA 3EISA 1M3SA 2H3HA 4JC0A 1ZUHA 2O3QA 1JQJC 2FUEA 2WDZA 2A0XA 5EUQB 2BFAA 1T1EA 1TOAA 4L5YA 3H5RA 1NRJB 3AT1A 3JCZA 4JP3A 3TRDA 3W3ZB 3THOA 4BGEA 4LF7B 3NH6A 3I2IA 1D4ZA 2M2IA 5EUCA 2EGUA 1I13A 2B69A 4RHUA 4X9XA 1PZXA 3D59A 3B2EA 5FTLA 1UT6A 3D7SA 2R8YA 4CRWB 3OLXA 4WXRA 3RRYA 2IXEA 1E59A 3MGBA 4D79A 5KCZA 2EQBA 5ALPA 3ZGOA 1Z6QA 1FDOA 3F5FA 3SF8A 2RHOA 4Q1VA 3FFWA 1CJMA 1Z29A 2WAXA 4ROSA 3NUGA 3B1KA 4HI0E 4RHEA 4ZEMA 2VS1A 5JSFA 1CF4A 1OXXK 1AQJA 3DLAA 3B3GA 3GO4A 2E82A 1VL6A 1NKTA 4PHTA 1ZNQO 2Y92A 1PYDA 3KVVA 3NUZA 1TO6A 2EP8A 1Z9BA 3KDSE 2LZ0A 4PANA 1F14A 3DD5A 1YR7A 1AV7A 4O2BF 4LZZA 1MP0A 2H8GA 2QTGA 1GJRA 3AYXB 3GRUA 3QX8A 4PBSA 3WGLA 4D5GA 621PA 1SEVA 2OHGA 5BMVA 1EGVB 3DAFA 4R1OA 3CEPB 1AIPA 3BD7A 2JKVA 3DXZA 4CCWA 1XBTA 1M6NA 1D2GA 1ANKA 4GP6A 2GZRA 1F12A 5K8VA 1I7DA 3CF4A 4JP1A 1WEHA 1NVVQ 1ZCZA 2FP4B 3N8IA 1E62A 3OESA 1W48A 1CBUA 1GXSA 2BLNA 4RH3A 2Q3BA 5EPOA 4YCCA 3DFKA 2OA0A 5IVIA 3N3AC 5IJXA 3G0OA 4Y1RA 2QQGA 1W25A 3KTAA 3RVNA 1B42A 1FFAA 3RIGA 2XUQA 1T26A 2IOFA 1UQRA 4G6ZA 4A0FA 4MH0R 4RIGA 4LBYA 2DPLA 2O52A 3L1IA 4GHWA 3ZJVA 3M89A 3WFZA 3PUJA 2ACWA 2F90A 4CI0B 4CPDA 1P4SA 1Y63A 1QQ7A 1P45A 2TMGA 2YN2A 2BEVA 1BWSA 3MJDA 3UVEA 4EHDA 2NQ8A 2IIPA 2QNRA 4H6VA 1D2NA 2R6ZA 1PJAA 1VIYA 4RAQA 5T4HA 3RE1A 4RGBA 3VR2D 1Y8AA 1YNOA 3X1XA 4NR0A 3DV0B 2X2OA 3OLVA 1KU6A 1QG4A 1MNAA 2C20A 1AB6A 4CHGA 3CEMA 5IJ0A 1RPJA 1PR3A 1ZQ1A 1U7TA 3ZWQA 5ALEA 4II3A 1K7FB 3AR6A 1SBCA 1T3HA 1RJ9B 2PXHA 4YCMA 3BXFA 3A6GA 2CVOA 3MQ4A 3SC3A 3GIDA 2QRKA 2GEDA 5IM5A 5LP6F 1U0BB 4ZYYA 3G0IA 4D0SA 4Q7KA 3NT2A 4QVGA 1UBUS 3ORRA 3B1JA 5K0CA 5F4ZA 3C5EA 4WT7A 5KTRA 4R1NA 1VTKA 4X00A 4M8IA 1OXKB 2XUHA