1BWSA

Crystal structure of gdp-4-keto-6-deoxy-d-mannose epimerase/reductase from escherichia coli a key enzyme in the biosynthesis of gdp-l-fucose
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
314
structure length
314
Chain Sequence
KQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQNAPDVVVWGSGTPMREFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCTIRDLAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVTRLHQLGWYHEISLEAGLASTYQWFLENQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title GDP-4-keto-6-deoxy-D-mannose epimerase/reductase from Escherichia coli, a key enzyme in the biosynthesis of GDP-L-fucose, displays the structural characteristics of the RED protein homology superfamily.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords PROTEIN (GDP-4-KETO-6-DEOXY-D-MANNOSE EPIMERASE/REDUCTASE)
total genus 104
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 1998-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1bwsA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1bwsA02
3QA9A 4AFNA 1P1HA 4PIVA 5A05A 1WW8A 3TZCA 2YDXA 4CMBA 1RJWA 1E92A 1D3AA 2AA3A 1O8CA 2C20A 2JFHA 3PQFA 4IXTA 4KDEA 4FN4A 1KVTA 4MVJI 3GVHA 4D41A 3GFGA 1HSOA 1PU2A 1TT7A 2CVZA 2Z1MA 5KKAA 3ZW8A 6LDHA 2X5JO 5IDWA 3EMKA 3LC2O 2YHUA 3CINA 4HXYA 2WEKA 4J2HA 1B16A 4XRGA 4OQYA 4WLVA 3DZBA 1PS9A 1E77A 3ZWNA 1JVSA 4K26A 4PRKA 1VM6A 4ILKA 3BMQA 1H6CA 4IPTA 3QV1A 3QIVA 1E3IA 3D64A 3ZWAA 1U28A 4EJ6A 4J43A 1VSVA 5TC4A 2IDZA 1ADBA 1FDSA 1T2CA 2JJYA 1YDEA 1MA0A 1RM4A 3F5SA 3I4CA 1QORA 1XU7A 4BO9A 2IEBA 3P19A 4NU6A 3I1JA 4ZRNA 3AK4A 3U62A 3H9JA 5FI5A 3VAZA 1LSJA 2JD1A 4CLEA 2EP5A 4NK4A 2ZYAA 3VTZA 5DP1A 1BSVA 1T2FA 1ZZEA 2ZCUA 3Q6IA 3EVTA 5G2OA 5GMOA 4DWVA 1EDZA 1Q7BA 1YWGO 2JKVA 4E30A 1XQ6A 3MJ4A 4C7KA 4J9UE 3N58A 1NHWA 5ILOA 3FSRA 3CKYA 2J5RA 1HDRA 1M66A 2VYVA 4XJSA 1GQ2A 3GGPA 3OA0A 3STHA 4DMMA 1PJCA 3AY3A 4BV8A 1ZXLA 3I9NA 4DRYA 1WNTA 3CMMA 3CMCO 1FK8A 2OP0A 3PYXA 5EIOA 5TF4A 2E6UX 3WJ7A 4EEZA 2W2KB 3HUDA 3JD4A 1WDKA 3UOGA 2IODA 3WNVA 4BNLA 1LU9A 3JQ9C 3V2UA 4YAKA 1MC4A 3BHJA 3VHRA 3HDYA 2EF1A 4O0LA 3LLVA 3VDQA 5A03A 4R68A 4CV2A 3I52A 4II3A 3WIEA 4UVDA 4HP8A 1BW9A 2BKAA 1PGJA 2JCVA 3MJVA 2VWGA 3ZV5A 4DIFA 1YB5A 3WBBA 4L4SA 5CG1A 1QYDA 4J1NA 3KBOA 3RI3A 4UUOA 2O48X 2CY0A 1E5LA 4YAJA 2C82A 1A9ZA 3JV7A 2AXQA 1PTJA 5F3RA 1O95A 1LDBA 2CF6A 1U5AA 3PI7A 1DBVO 2X0RA 5T67A 1C1XB 4BNJA 1E3SA 1A72A 4BO0A 3GDOA 5KVVA 1F14A 4ALJA 2EJWA 2PH5A 4JK3A 4CR8A 4BNKA 1VL0A 2W8ZA 1T4BA 4I9HA 4ZQFA 5CG2A 4XD2A 1Y8RA 3DB2A 1R16A 3NAQA 4U6SA 3CZRA 2DTXA 2Q4BA 2VTDA 1ORRA 4CPDA 3D5TA 1P0FA 4UVGA 5TIIA 1Z7EA 1GTMA 2CMDA 3T7EA 5A3JA 4B8ZA 2QYTA 1ZIDA 5TGDA 3KETA 4Z9FA 1GZ4A 4B4UA 5JDIA 2OOSA 5BSFA 1A4IA 5K6AC 4DLBA 4ZU3A 4EZBA 4R01A 3EZYA 4IIUA 3C3XA 2AQ8A 4J6FA 2YQ5A 3BTVA 3TPCA 3QW2A 1NQ5A 4PLZA 3A9WA 3WMXA 4AJLA 2TMGA 1HL3A 1IY8A 3CZMA 4DC0A 3SLGA 4A7PA 1DLIA 2GZ2A 4GBJA 1NFFA 1LDEA 1YOVA 1ISIA 2DLDA 3K30A 4YTEA 5L7TA 2G17A 4DREA 1ZJZA 4AJEA 1E3JA 2YDYA 4PG7A 2FWMX 3JD1A 3E8XA 2POQX 4P22A 5EPOA 1LBEA 3VDRA 1WAMA 1GV0A 3GR6A 4AJNA 4INAA 3W6UA 1OOEA 3B1FA 3MZ0A 2DKNA 1AUPA 2DPHA 3AFMA 4PGFA 4BNFA 2W4QA 2PV7A 3KYDA 5JE8A 3W8FA 3F4LA 4TQGA 3OEWA 2HRZA 4BO3A 4YT5A 3OIDA 4RVGA 2FN7A 3LT1A 2D3TA 1BXZA 4WCFA 4A26A 4IIVA 5LDGA 1PS8A 4MJLA 2GASA 4QSMA 1FXSA 3TNLA 3RBZA 4RVFA 1K6JA 3H5AA 4FFOA 3IC5A 3RUDA 1SBYA 1GEEA 2PA3A 4XJTA 3RROA 1DHRA 4XIYA 4NPCA 1EK6A 3ZHYA 1LI4A 1QV7A 4MKZA 4HBGA 3WNQA 4L9RA 4OXYA 4XEHA 5ITVA 1UXKA 2P4QA 4FW8A 1UP7A 4JJIA 3WDSA 2BHLA 3WTBA 1YBMA 4IDDA 2SCUA 4FFNA 2E4AA 2A4KA 4B3HA 2PD3A 1LUAA 2OO5A 1TT5A 2O7SA 4YJFA 1GR0A 1NBOA 4NFSA 2GZ1A 3AJRA 3WS7A 1E7MA 1ENZA 3ZV3A 4RCVA 4N5LA 4UEOA 4OAQA 4ZQGA 1P1RA 3DBHA 1E6UA 1L7DA 3JQ6A 4IDEA 4N5MA 2JL1A 1LLCA 2PZMA 4B7XA 4CLOB 1I2BA 2B83A 4J0EA 2C54A 3PFWO 1BXGA 3ZI0A 5G4KB 4PRLA 2Y0CA 1P45A 4IJKA 3DC2A 1NASA 4LW8A 5ICMA 3FNFA 1GV1A 1UXHA 3GAFA 1D7OA 2IYOA 5KJFA 4GVXA 2EG9A 3S2FA 1KETA 2IZ1A 4BNUA 3ICPA 1BXKA 5IN5A 3ZV6A 3WYBA 2C29D 2NVWA 2QX7A 3OIFA 5I8ZA 1CF2O 4A03A 4OKIA 1TEHA 1ZK2A 2X1HA 3VZRA 4ZVVA 4EEXA 3AW9A 4O59O 5BSEA 1BDMA 3WOHA 1XIVA 3V1TC 2I6TA 4TVBA 1WDMA 5I9LA 3ST7A 3DBLA 2G82A 2Y0EA 2VHVA 3HN2A 4KMSA 1M76A 3DHYA 4J91A 5HS4A 3HADA 4E2WA 5DF1A 3FD8A 1GCOA 1VJ0A 1F0YA 4U6QA 3C1AA 5JCJA 3UW3A 4I1IA 1DJQA 1I36A 1I3KA 4B4VA 4B7CA 4PLYA 2DTEA 1I5RA 1ZO8A 4BNMA 1GL3A 2PTGA 3W4KA 1KEUA 2D5AA 1UXJA 2C5AA 2QHXA 1SEPA 1MXFA 1QSGA 1N7GA 1ISGA 1Y5MA 4M49A 4RDHA 4YVFA 5LCXA 1JA9A 2YV2A 4YRBA 3FHLA 4G5HA 3KV3O 2X0NA 3PWZA 5JDCA 3BYZA 5F1KA 3L07A 3R6DA 4PZDA 3GDGA 4PG5A 5BSGA 4GAEA 3WGYA 5DCWA 1PWZA 5K0ZA 1PJLA 1D1SA 1ONOA 4NU5A 3JQ7B 4Q3EA 4RQTA 5HRUA 3NDIA 4XCVA 3RUCA 3K2BA 5F1PA 3IOYA 2R6JA 2P9EA 1A9YA 4NH4A 3R0IA 2A94A 4IQ8A 4L76A 1W8DA 3H2ZA 4YJHA 2O3TA 4I9UA 3C1OA 4CQMB 4B79A 2X0IA 2O3RA 3UCFA 4KQXA 1AN9A 3IQDB 1N9GA 2GD1O 3GN1A 3LF1A 3S2IA 3M1LA 4L4XA 4JBHA 1ZK3A 4Z9XA 1SZJG 4MVJD 4BKRA 4MVJH 1YB4A 4DIBA 2NU7A 4ZQEA 2WYWA 2OL4A 4Z0HO 5JCXA 5A3VA 4O63O 2NTVA 1B8VA 1I3MA 2RH8A 3AOEC 3UGKA 2WD8A 4JLWA 3UUWA 1KVRA 1XYGA 1QYWA 3O8QB 3NDJA 4KTTE 4L73A 1ISFA 4J7XA 4JX8A 4FJ0A 3AUUA 3L4BC 4CLHA 1HDOA 3BA1A 4PLGA 3DMTA 2HLPA 3JQBC 2P9CA 4A73A 3H8VA 3PK0A 1ZNQO 1HTBA 1HE5A 1TLTA 2R2GA 1B3RA 2PKRA 1LDYA 3PLNA 1ARZA 4LRSB 5IDXA 1O89A 3I6IA 2O3UA 3DOOA 3W4JA 4RZIA 4YT2A 5IF3A 1YQDA 4D7AA 3WYCA 4E5NA 2BRUA 2OXIA 1NYTA 2VOJA 1IUKA 3GUYA 3R3JA 3RFVA 3WR5A 4DLLA 9LDTA 1AHHA 1U3VA 1NAHA 5DDIP 4JJFA 2CD9A 3JQFC 1A7KA 3GG2A 3E1KA 3VH2A 3F46A 4P4GA 2NNLD 2A92A 3I5MA 4HFMA 4ND3A 1F06A 3KHUA 1DFIA 1Z82A 3K8ZA 3TFQA 5T8KC 3GMDA 3LT4A 5ER6A 3GDFA 1GCUA 5A1TA 1PJQA 5I7SA 2X58A 2GF2A 1ZCJA 1X14A 1ZK0A 1EUDA 1R0LA 4QQRA 3GVCA 3GF4A 3DBVO 1R0SA 1XKQA 4Y8VA 2HQ1A 3EW7A 3S8MA 5A04A 5BQFA 1DC6A 2YV1A 3G3EA 1PR9A 1ZEMA 2YUTA 2ZK7A 4JGBA 3ZWYA 4CM5A 1T2AA 4MVJA 3RBVA 2IYPA 4OSOA 1N92A 3H5NA 4IMPA 3WGOA 1MB4A 4BL5A 3IKVA 1YJQA 4IS3A 4RF4A 4WLNA 5L7WA 1OC4A 2GZ3A 2HCTA 1NQTA 1YOVB 3VOSA 2NTNA 4A5OA 5DULA 3EDMA 5L53A 2GNAA 1Y8QA 4DLAA 4E0BA 2DPGA 1BGVA 3KYBA 1S6YA 4J90A 2NQTA 3V1UA 4N5NA 1BDBA 4GQAA 2CNBA 4CUJA 4CR6A 4EJ0A 4D45A 1EBUA 1VRWA 1R4MA 1K0UA 3HZZA 1ISHA 3ETDA 1M6WA 1ZMOA 3OQ6A 1IOLA 3Q9UA 4D43A 4FB5A 1ISMA 1DIBA 2BELA 4CLRB 4HFNA 4NDNE 2QRKA 2WWRA 3GN2A 2VWQA 1VKNA 2VCYA 1E3WB 2GLXA 4P38A 4YCAA 2VHZA 1KOLA 4FFPA 4MVJE 2VWPA 5FF9A 5ICSA 3M6IA 4GX5A 5JYDA 1K89A 2EIHA 3PRJA 2VUSA 3GQVA 1KVUA 3K92A 1XU9A 1YXMA 2BFPA 4LVCA 5TJHA 3DONA 1SO8A 3D1LA 3JQ8B 4UAGA 3BTUA 4J4TA 4EUFA 5B4UA 4YAEA 4I5GA 1FMCA 3I83A 4CM9A 5GZ3A 1HDCA 3ZGYA 1YO6A 1F8GA 4WLOA 4YXFA 4PLWA 4CL8A 3RUEA 2ZKLA 2C7VA 1DC4A 2Y1CA 3PHGA 2R00A 4OGWA 4XYBA 1KC1A 4GL4A 4AJJA 3R1IA 1LXCA 1P0CA 1TXGA 4ZQHA 4GX1A 4HKTA 5G0VA 4IDGA 1GEGA 3ZU2A 1VC2A 4B7UA 4BKOA 4BGVA 2C0CA 2DFDA 3D7LA 3VVCA 3G1TA 3WGIA 4LSMA 2AEJA 4CL3A 2LDXA 1NFRA 4YWJA 5HTOA 5JYEA 3OIGA 5IZCA 1GUZA 1RM3A 5C7LO 4E31A 5K9ZA 1IPEA 3O9ZA 1G1AA 4MKXA 4IINA 1E1LA 1UZNA 3FBGA 3PYLA 2G0TA 3H9UA 3L77A 4LCJA 4XGNA 2AHRA 3C1TA 4YPOA 1JQBA 2O4UX 3WLFA 5EQFA 3UHAA 1CYDA 4FJ1A 3ZU4A 4UVIA 5CHEA 1GZ3A 1XHLA 1MX3A 4EITA 3T7CA 1PIWA 2E49A 4GMGA 1LDMA 1YDWA 4R1NA 1CDOA 3JD0A 4DQXA 1LSSA 1G6KA 5AQ1A 4DIOA 1T25A 4DGSA 4ND2A 4Y6SA 4ZJUA 2GCGA 1YGYA 4HV4A 4WKGA 3DBLB 4PZCA 4LRTB 3D4PA 1J4AA 2Q45A 1A71A 1Q0QA 3DHEA 4ALMA 4D44A 4OM8A 3Q1LA 4HFJA 4DVJA 1DFGA 3WX0A 3RC2A 4NZ9A 2J5QA 5K6AA 2CF5A 2HAEA 3KSDO 2JD0A 4Y98A 1PS0A 4DYVA 3ASUA 4R3NA 4QXMA 4AVYA 2W98A 1EMDA 4CLDA 1U4SA 4YRDA 2WE7A 5L7YA 1Q0HA 1DEHA 3RWBA 4MKRA 2ZQZA 4CMAA 2X9GA 5KJ1A 5U4QA 3KRTA 3KLPX 2WD7A 2C5EA 3K9QO 5L51A 3GZNB 1E3EA 1J5PA 1NX6A 1P1KA 3VKVA 4E5PA 3UICA 4WOKA 3EUWA 3LLSA 2DT5A 1LJ8A 3ENKA 3MJCA 2GGSA 5LC1A 1V8BA 3TZKA 5T5QA 4BQPA 4YRAA 1VL8A 2XOXA 4ID9A 4NR0A 4ZN6A 1H5QA 1ZXBA 1KY5A 2P91A 4E4YA 3E48A 1ULSA 5T6BA 4Q3BA 3I3OA 4R5HA 2H5LA 3TZQA 4OL9A 3QVTA 3P2YA 3DOJA 2OHXA 5KVSA 4H16A 1EE9A 2BGMA 2RHCA 3D4OA 4AJ1A 4MIEA 2QG4A 4PN3A 2FR8A 1MC5A 1V0JA 1ZK1A 2D1YA 1P77A 4AJPA 3RQSA 1YL6A 3GRPA 4I8XA 4UUMA 2GN4A 3VKUA 2CZCA 4Z0PA 4P4NA 3HG7A 3SEFA 4BO7A 4MP8A 1X13A 4PCVA 1VKOA 1VPDA 2YYYA 4Z6KA 3MWEB 4GLOA 2Y99A 3MJSA 3ANLA 3SVTA 3PEFA 4IDCA 4KUHA 1OBFO 3QE3A 2DFVA 1DLJA 4WEOA 3GNTA 1H2BA 3D3WA 5JPIA 3EY4A 3KVOA 3VZQA 4BO5A 1O9BA 2I65A 2WM3A 4OIMA 3NT5A 3VH3A 8ADHA 5I7VA 1AGNA 1BRMA 1UDCA 4YB8A 2PGDA 1T4DA 2Q1TA 3I4FA 2PNFA 2D2IA 1Q0LA 3EVNA 3WMWA 3ON5A 5COQA 1I33A 4O6VA 2HMTA 4DBVO 5HA5A 5ILGA 3IP3A 5B4TA 3F9IA 1UDBA 5L95A 1M67A 4K6FA 1XG5A 3PWSA 4L75A 4A2CA 1LLUA 4CMKA 3DL2A 3EYWA 3HDQA 3H9EO 3GOHA 1GQYA 1N1GA 4W99A 2Q49A 1HDXA 2BH9A 3WQQA 1WLYA 3KLMX 1DAOA 2BD0A 3EC7A 2H6EA 4NBTA 3P7MA 3AUSA 1DRUA 3ONDA 4NBWA 2QRJA 4B3IA 3WICA 2UVDA 4R5MA 3FTNA 4IZHA 3UN1A 4ESOA 2EW2A 5FI3A 5BNTA 3K2EA 1ENOA 4URFA 4AJHA 1T26A 3CTMA 2X22A 3KSUA 3VC7A 3X2EA 3WYEA 4RZHA 2AE1A 1HLPA 5ENVA 3KM0A 2VRBA 1C1XA 1E1MA 4U7WA 2W2LA 4KDFA 4HNGA 4CM8B 3H7AA 1E1KA 1WPQA 1VE9A 1UDAA 1I30A 3RKRA 6ADHA 1K2WA 5GY7A 2E82A 1KS9A 3ZWCA 4EYEA 5A9RA 1ONPA 5BNFA 1GYRA 4IGFA 1R15A 3CH6A 2RCYA 4CV3A 3ZV4A 1GUYA 1LQUA 1MFZA 1ENYA 2P9GA 2X4GA 5EMHA 1HZZA 2PKQP 3GZNA 3AM4A 4NIMA 4DC1A 3U4IA 4MVJM 2PZJA 5TQVA 3JD2A 4YACA 1NVMB 1NWCA 2F1KA 4IJVA 4BV9A 4CM4B 3GHYA 2GDZA 5T64A 3CUKA 3FCOA 5DOVA 3U5TA 4AICA 3PJEA 5LDHA 1NR1A 2DM6A 4OOFA 3OICA 3PDUA 3VTFA 2HSDA 3WGHA 3B6ZA 5EINA 1UZMA 3LSYA 1IL0A 3GUCA 4R9RA 1ENPA 2D0IA 3LC1O 3E5RA 1EFLA 1XSEA 1NAIA 3LVFO 4GX0A 4R54A 1AXGA 5JFOA 3EHEA 5A9SA 5I9NA 1NR7A 3SLKA 2X23A 3DZIA 3ZNNA 3WG9A 1CEQA 3RJ9A 4DQUA 4XRRA 4MOWA 1PQPA 2EKQA 4ND5A 3JCZA 1O6ZA 1SOWA 3OQ1A 1ID1A 2FR1A 2BFOA 2NV6A 5ER9A 3KYDB 2HU2A 2Y0DA 1QG6A 3B20A 4XGIA 3RU7A 2PLAA 2QZ9A 3DZJA 3FRJA 2GO1A 3JQ9A 4M54A 2D8AA 4N7RA 4RLHA 4TROA 3VZSA 2CSUA 4LISA 2EV9A 3KTDA 1YKFA 1Z7BA 3KB6A 5CEFA 1H9AA 3Q0EA 4OMUA 4GWGA 2EKPA 2NADA 4YT8A 3DAFA 3I6QA 3NTQA 4JROA 4PLHA 3PHJA 1H6BA 5AXDA 5DCUA 3NJ4A 1G0OA 1HDZA 1R6DA 1CJCA 3OJFA 1PJSA 2QYSA 4CLOA 2H1SA 4IDAA 4P8RA 4WE3A 1E0DA 4NJMA 3RJ5A 3PHHA 3TL3A 1YRLA 4X54A 4UEKA 4EDFA 2VHXA 1U2GA 3JQFA 1ZEJA 3K96A 5IAAA 3COSA 3WFJA 4JP2A 1DRWA 3QHAA 2GUGA 1ZSVA 2IXBA 5U1PA 3FF4A 5AOVA 1DXYA 5CDUA 3KUXA 3PJDA 5F21A 3S2GA 3TSCA 2IRWA 1FF9A 4W9NA 1L7EA 1J49A 1PZGA 3UKOA 4YAGA 4BQRA 1LTHR 3AUTA 1T1RA 2W90A 4HNHA 3ZHXA 1Q2XA 1V3UA 4D3FA 1NQAO 5DT9A 1ZJYA 5JC1A 2UYYA 2BI8A 2P5UA 2PKQO 1LRKA 3QVSA 5DOZA 3WIDA 5IXYA 2PWZA 1MGOA 5CDTA 3DWFA 2Q2VA 5TT1A 3T4EA 3NDRA 5I7EA 3OSUA 4L8VA 4MVJG 4CMEC 3AI2A 1KIFA 3PJGA 1HXHA 3D5QA 1JKFA 4CQMD 1SB9A 1F8FA 1IPFA 4QT0A 4M1QA 1PGQA 1RKXA 4QFDA 3SJ7A 3MTJA 3D4NA 1CETA 4I9NA 4RPHA 4XQGA 1UXGA 2Q1WA 3K31A 4NBRA 2ZATA 3GA0A 3MJTA 3W4IA 2NU9A 2BF7A 1QXSA 4I5DA 2EW8A 2Y93A 4D42A 3RC9A 1X15A 4E12A 4JXKA 4BO1A 1P44A 1U3TA 2C7GA 4RVDA 3HB4X 4WASA 2B69A 2FSSA 3H5RA 4B4OA 4HX5A 4E5MA 3G49A 2JHFA 3KEQA 3CE6A 1DHTA 1GADO 1DB3A 2P4HX 4Q39A 3HSKA 3IUSA 1W73A 3ASVA 3L4SO 3QLJA 4GLLA 4RVUA 4R16A 1K6IA 4DA9A 5JSFA 1B8PA 4H15A 4FOOA 3K6JA 2P2SA 1HRDA 4WCFB 2AQIA 3A1NA 3PTZA 1U5CA 1LQTA 3DTTA 1ZK4A 1AE1A 5B12A 4Z0TA 1E3WA 1LNQA 2ET6A 3P2OA 3PPIA 1R37A 3INGA 3U4DA 2NUAA 3GY0A 1Y81A 1DAPA 4HUJA 2PGLA 3OECA 4E21A 2ZQYA 4BVAA 1ZW1A 1C0KA 1IZ9A 3H2SA 1ZSNA 4G2NA 1DOHA 3C7CB 3K73O 1YL5A 3MJEA 1QKIA 4J4BA 1N7HA 3RBXA 2DTDA 3ROMA 3AM5A 4WCDA 3GH3A 1RWBA 5JCJD 4W4TA 2WDZA 4IUYA 2W2KA 4FFMA 1LRJA 1IYZA 3E5MA 2NSDA 1EQUA 4W7IA 5G4LA 1UJMA 4QO7A 2Y68A 3TRIA 4PLPA 4WUVA 2B5VA 1EZ4A 4IDBA 1JWAB 4RV9A 3OF2A 2Z5LA 5G4KA 2DBQA 2HK7A 4M87A 4J7CA 3GC6A 3AM3A 5ENDA 3JQEA 1R4NB 2EJVA 2PFGA 2QRLA 2Y1OA 5G0SA 5JNLA 1E7SA 2I3GA 4PG4A 1H93A 4YQYA 3IDSA 1SC6A 3L6DA 3C24A 3GZ4A 2CDBA 1D1TA 2HK9A 4WPGA 2J3JA 2Y1EA 2YY7A 2Q99A 4E3ZA 2UDPA 3FTPA 4RF2A 5KVQA 4AJ4A 2B4TO 4OYRA 3H3FA 5F5NA 3ZDFA 4NQZA 1K6XA 4PVCA 3VVBA 4R4JA 1H0KA 1QYXA 1X0VA 3FN4A 3JQBA 3IKTA 5JMWA 3NGXA 2V65A 4FC6A 1E7RA 4TRRA 4I5FA 1ZMTA 4K9DA 3V2GA 1H6AA 5FFFA 5AXCA 4BKPA 4DPMA 4AL4A 1Y8RB 2DAPA 2B37A 2OGUA 1PL8A 1C0PA 1PR3A 4IGEA 4U0KA 3ZU5A 4CV0A 3GEGA 5CDSA 2EXXA 5H81A 2FP4A 4L74A 1OMOA 5TX7A 1E5QA 5I9MA 3AOGA 5L3ZA 9LDBA 4L4RA 5A06A 4YDRA 1H2HA 2O2YA 2PD4A 3QVXA 3AU9A 2AEFA 1FDTA 1HWYA 4GKVA 1YE3A 5B1YA 3JYQA 4XDYA 4CUZA 5IXSA 1WMAA 4YT4A 4ZGWA 1R0KA 2VHYA 3G0OA 1LDGA 1MLDA 2AG8A 1MP0A 5A5FA 1P1JA 2Q4EA 1HSZA 3FWZA 1XQ1A 2Q46A 4JQCA 2Q3EA 3BMOA 3TJRA 1C1DB 2Q50A 3GVPA 3IUPA 4W6ZA 4F6CA 3KOUA 4PLVA 1NQOA 2FHSA 1C0LA 1QR6A 4D0SA 1HDGO 1Y8QB 1DIAA 4CM4A 1FDWA 1C14A 2DBVO 2NACA 4RL6A 3JYPA 3PFFA 2PH3A 5JO9A 4Q3CA 3ENNA 2PK3A 2B4QA 3TWOA 3VPGA 3GMSA 3PIIA 5IG2A 4QX6A 1P1FA 4XYEA 2ZB7A 1JTVA 2QIOA 1I01A 5TLSA 1B2LA 1ZVMA 4RPLA 1EBFA 4BO4A 4CQLB 3AWDA 3RCBA 1HYGA 1T2DA 2ILTA 2NVBA 3HN7A 4LMRA 4U8GA 1B15A 3Q11A 2XXJA 4R1UA 5GZ1A 4LCEA 3K5PA 1CRWG 2I9PA 5L4SA 4MP6A 3F1LA 3X2FA 4QTZA 1EDOA 4WK6A 2TMDA 4B4WA 4CV1A 1NVGA 1LLDA 3S55A 3ONFA 3H65A 7MDHA 1U3WA 4JJGA 1BHSA 5A4DA 1Y9AA 1ADGA 3WGQA 1B14A 4Y67A 5DNAA 3U49A 1PGOA 3B1JA 3AOEA 1PJTA 2IZZA 5A02A 3I9KA 1PQUA 1ADFA 3G1UA 3GHHA 3QWFA 1TT5B 4WCFC 1ZH8A 3DZGA 1PL7A 4ND4A 4S1VA 2NU6A 4XQ9A 3G17A 4FS3A 5IDYA 4YYZA 1Y9EA 3A06A 4ALKA 2VYVD 1U4OA 4CM6A 1RYEA 4HADA 1JDJA 1S7CA 4DL9A 2ZIZA 5L45A 4OJNA 2VRCD 2Y1FA 5BT9A 1NXQA 3WSWA 3ZWOA 4D0RA 4AG3A 3FWNA 2I99A 1U7HA 1SOVA 1DRVA 3F3SA 3O03A 4ZD6A 3SC6A 1N2SA 3HWRA 4BMNA 3LQFA 2AMFA 4CMHA 4YJGA 3JTMA 1KEPA 1JVBA 1HZJA 2VOEA 1YJ8A 1IULA 4KZPA 3EK2A 3NJ8A 2FPPA 4BUCA 4RVHA 5KJCA 1ISJA 3KSZO 4RO0A 5DBFA 1P1IA 2EWMA 4E2XA 3L0DA 3O26A 3CXRA 1XDWA 1WVGA 3GT0A 3RIHA 3L9XA 1LA2A 4CMIA 3OFSA 4FIZA 1DIGA 4CMIB 1HE2A 4XDZA 3OP4A 4WNCA 3DBRA 5IZ4A 4BNIA 1YS4A 3HFGA 3DZKA 4ALIA 5ITWA 1SEVA 4BMSA 1JKIA 3BMNB 1HE3A 4J1TA 4R1SA 3TQHA 3BMNA 1GQQA 3PGJA 3F5QA 5COBA 1Z45A 5JLAA 1T2EA 3I9LA 3JQGB 3OBBA 1PGPA 4WLEA 5DN9A 1DO8A 1PL6A 5EQDA 5C7IO 2Y67A 3OETA 5CDGA 1JWBB 4FJ2A 1GZ6A 2DUWA 2VT2A 2V6GA 3V1YA 5CEJA 1PEDA 3DMYA 4M55A 4CM8A 3GRKA 1LLQA 5AXAA 3C7AA 2G1UA 2OBNA 1UAYA 4Z9YA 2WYVA 3RUAA 4CLXA 2AG5A 4LGVA 4RF5A 2OUIA 4ROSA 2BFAA 1E1NA 4KUEA 5CEEA 2A9FA 1PSDA 1VLLA 4RVSA 3N74A 1JAYA 3OHSX 4E2YA 1E6EA 1NPYA 1NWHA 3NEPX 3ZNPA 1XLTA 1ZBQA 1KBZA 3ZU3A 2ZTLA 2B0JA 5F1OA 4IS2A 3N7UA 3TZ6A 2YHIA 3MOIA 3T4XA 1SPXA 2RHRA 4RGBA 5CDYA 2YHIB 2VT3A 3NUGA 4LSWA 4OH1A 3SC4A 3GVIA 1JAXA 5DZSA 4DBZA 4J2OA 4CM7A 1UR5A 2JAPA 4BKUA 2ZJ1A 2VN8A 1GYQA 5JO0A 3JQ7A 3WLEA 4K1LA 3ZZNA 5JY1A 1B3BA 2DBRA 2HDHA 1HYEA 1O0SA 5CFZA 3VH4A 1GAEO 2BFMA 3RC1A 4J16A 2RAFA 1E7QA 1X0XA 4A27A 2IEDA 4IQ0A 3UAGA 4TRNA 3KZVA 4RPGA 4XQEA 4YJHB 1XWFA 1LC3A 4BGUA 5A5EA 1EUZA 3PJFA 3LZ6A 5EL0A 2Q2WA 3V2HA 5A9TA 4EBFA 3A14A 4CMJA 1N9GB 4MINA 3BTSA 2A35A 3GEDA 1PZHA 3FBTA 3GVXA 3KYCA 3I23A 2D59A 4JBGA 3V5NA 1UP4A 3M2PA 4BNXA 4FBGA 4JCOA 1H94A 2GSDA 4DTIA 1MG5A 3QWHA 1MV8A 2X0JA 3PHIA 4PG8A 3NGLA 1PGNA 4U5QA 3OH8A 2RBEA 3S1LA 4IJWA 3JD3A 1SAYA 3OQBA 1GDHA 1SB8A 2YV3A 4XR4A 1B7GO 3M1AA 3L9WA 4BS9A 1Z75A 4DMLA 3HDHA 3V8BA 3IL2A 2NU8A 4AJOA 1JLLA 3OEYA 3I9MA 4WNIA 2AE2A 2I76A 4TMFA 4R9SA 5HWSA 1DC5A 3ORFA 1X1TA 1OZAA 3GG9A 4W7HA 2NTJA 4J4HA 1M75A 4YJFB 3W1VA 4M8SA 4BNHA 4CODB 1NFQA 2EP7A 1FDVA 4XYGA 4F46A 3IJRA 3NRCA 4GVLA 2JD2A 3ICCA 3VH1A 1VSUA 1ML3A 3D3WB 3L4BA 2BI7A 3C85A 4II2A 1KY4A 4FQ8A 1RPNA 2OZPA 3AI3A 1JKJA 4G81A 3H3JA 2O7QA 1V35A 5ES3A 3L6EA 5L4LA 2Z1NA 2CUKA 4PZEA 4XYMA 1BXGB 2BGKA 3QJ5A 4UEJA 1I2CA 4Q3DA 2HJSA 1M2WA 2PR2A 5JS6A 3AFNA 2NM0A 2P5YA 1EK5A 3SX2A 4NG5A 4NJOA 3JQDA 1FDUA 3TZHA 3PGXA 1KEVA 3NKLA 3QWBA 4FOSA 1YL7A 4QFCA 3W6ZA 1WMBA 2FMUA 3W8EA 4WLFA 1W6UA 2WSBA 5C7OO 1DPGA 3ABIA 2WD7B 4E6PA 3WWYA 1ZFNA 3E03A 3RU9A 1K3TA 2DC1A 3A4VA 3I9OA 1HF3A 3INTA 4IXWA 4OOEA 4BOYA 1DDOA 1C1DA 1J0XO 1U9JA 3AU8A 2B35A 2Q1UA 3IMFA 4KUGA 1DIHA 1I2ZA 1IZ0A 4LVUA 1LSUA 2HK8A 1U3UA 3E6AA 4D3DA 5CPFA 1QLHA 1FJHA 3UFXA 1PZEA 3PLRA 5HBRA 3ETEA 4UULA 3D0OA 5JDCC 5KTKA 4MVJP 3INRA 3UCEA 1X1EA 3DFUA 3ULKA 1NHGA 3MOGA 3DZHA 5THKA 2OFPA 3Q2IA 4YAIA 2RH4A 1YBVA 1I0ZA 4OSPA 3IS3A 4QEDA 5HS6A 3RFXA 1BMDA 4BO2A 5JAIA 3U9LA 5AYVA 4BB5A 3NV9A 3H6KA 4XX0A 1V3VA 1Y1PA 4PLFA 5F5LA 2FSVA 1OFGA 3BHIA 4GMFA 4DUPA 5I8WA 1KC3A 1QV6A 2VTEA 3EZLA 4UREA 3FNGA 2UV8A 5DBGA 5TS3A 2FPIA 3OMLA 1UZLA 3UXYA 5T57A 3DFZA 3HFSA 4J9VA 3CPSA 4TRMA 4LN1A 4YBZA 1C3VA 1NNUA 1PJ3A 2HMUA 5FWNA 4IDFA 3GGOA 1IB6A 5TNXA 3WSVA 4QO8A 2FPGA 3EAGA 3LC7O 2PGJA 2O4CA 4KWHA 2FOIA 3UF0A 4NMHA 2XF8A 3GK3A 2Q1SA 2OP1A 3GEMA 1OI7A 3RUFA 1XELA 4F6LA 4Z3DA 3Q9NA 1JU9A 1PJBA 2D4AA 2EGGA 3E9NA 4O5OA 3U0BA 1V9LA 3IJPA 1I32A 1HEUA 2YQ4A 1H6DA 1Y6JA 4DXHA 1DIRA 3ANNA 1PX0A 1YH3A 4TWRA 1LSOA 3ZW9A 3ZHBA 3DMTC 5KOIA 3ITDA 2B4RO 3LDHA 3AUAA 1BW9B 1UUFA 4U0JA 5HM8A 4FGWA 4W82A 1PQWA 2HUNA 4NFHA 4QECA 2Z95A 3FR7A 4BNYA 5JAMA 4IBOA 3DOCA 3PZRA 2YFQA 4MP3A 3GFBA 2V6FA 4NJMB 1QRRA 1EFKA 3WXBA 1A27A 1W0CA 1JW9B 1X7GA 4BKQA 3O8QA 3KXDA 4RDIA 2G76A 2ZB4A 3ZCXA 1WZIA 3VPXA 3Q3CA 2ZTUA 4JBIA 3QY9A 1D8AA 4GSLA 5ADHA 2I5PO 3ZWBA 5IFLA 2IXAA 2H63A 4BGEA 3U4CA 1I3LA 1V3TA 5B37A 2ZTMA 1VJ1A 4ND1A 4RF3A 2PY6A 2CFCA 5JY6A 1OC2A 3QRWA 2PD6A 4M89A 3ANMA 3ADPA 3WJAA 3RD5A 3B70A 3W8DA 1A7AA 3F1KA 5TT0A 4B3JA 3ZNOA 5H82A 4BIIA 4CJXA 5DCYA 4E5KA 1IE3A 4XYLA 5JDIC 2C07A 3HB5X 1IHXA 4UVEA 4TSKA 4N18A 2X9NA 3OJOA 4KOAA 3PP8A 2FY8A 3ZH2A 3D3EA 1F17A 3JYOA 2G5CA 2IE0A 2OORA 4IMRA 4ALLA 3LT0A 4YQZA 1QYCA 3LT2A 3TOXA 1ZSYA 4DYDA 4R1TA 1GU7A 1Q7CA 2ZB3A 3FPLA 3JQAA 3OA2A 1EQ2A 3BZUA 4PG6A 4QUKA 1T1SA 5MGBA 1HKUA 3CEAA 4CM9D 3O4RA 4TKMA 2I3AA 3R3SA 3RC7A 4EUHA 2X7HA 3PDJA 1I8TA 3JQCA 3OJLA 3F4BA 3WTCA 5G0TA 1KYQA 5C37A 1ZKMA 2CVQA 2J3IA 2FZWA 1Q7GA 2GPTA 4BNTA 4IY1A 4E2ZA 3G79A 3ZWPA 3TF5A 5A9SB 2H9IA 5EN4A 4CM1A 1GY8A 4IM7A 4R69A 3U09A 5CAEA 4BMVA 2Y1DA 5BNIA 2UUPA 1R66A 3L6OO 4K28A 4YA6A 3ETGA 4C7JA 3DQPA 1CQIA 1GFSA 3DZFA 4GPD1 2O23A 2GR9A 3WGZA 2WJPA 3TFOA 4NK5A 3PZBA 4Q3AA 1B0AA 4WEQA 3DXFA 3M2TA 2QW8A 4BO6A 1JN0A 3SXPA 4UUNA 5AVOA 2O50A 4E5YA 4HWKA 3E82A 4KP7A 4E13A 5IN4A 4GSKA 3GNQA 5TSDA 2ZCVA 1M6HA 4GKBA 4IJUA 3LYLA 1SMKA 4ITUA 3QVWA 4EI2A 7ADHA 3ZNQA 5TRTA 3EGOA 3RASA 3F47A 4NBUA 1EVJA 4TRJA 3VPHA 4JIGA 1XCBA 4RLSA 2WE8A 3UH1A 4FSHA 4JNKA 1X7HA 1I10A 4CR7A 1O94A 2OBYA 4RPKA 3NTOA 4CUKA 1HLDA 4WGGA 3HDJA 2UUOA 2WYUA 3OM9A 1B8UA 2P68A 4CMCA 4K6CA 1YQGA 1E6WA 3PYMA 3JSAA 1R12A 3PVZA 2WMDA 3BTOA 1WWKA 5GZ6A 1WP4A 4KWIA 1KVQA 2ZYDA 3SBOA 1Y7TA 3HHPA 4FC7A 1U2DA 2BLLA 1N1EA 1N5DA 2XPCA 3DBHB 2JFGA 3DO5A 1VJTA 3FPCA 2UAGA 4FPXA 4XGKA 3NYWA 3BAZA 1CQJA 2CVOA 4OKNA 2AEMA 3NTRA 4GGPA 4JN6B 1U8XX 1LEHA 3DEYX 3BXXA 4B8WA 4EGFA 2XXBA 3OJ0A 1R4NA 3A28A 4I5EA 4J1QA 3U3XA 2RIRA 3DAGA 4RJTA 1U1IA 4NBVA 1MG0A 2YZ7A 4L0QA 3ROKA 2GERA 2EHDA 4OO3A 1QLJA 4UVHA 1E7YA 1NPDA 2GRAA 4MPDA 4FR5A 4GH5A 5KVCA 1CIVA 1HE4A 2LDBA 5IDQA 2J3HA 4DPLA 1XEAA 2HKIA 1H9BA 2FRDA 2VYND 1LRLA 5CP8A 4G65A 1PWXA 4MIYA 5C5IA 5KNLA 2E48A 3BHMA 4XR9A 4R51A 3LU1A 4OQZA 4OXNA 4XKJA 2JCXA 4Q9NA 2VRCA 2W2LD 5L9AA 1OAAA 1GUFA 4GGOA 4LK3A 4LMPA 3WQSB 4KQWA 1KVSA 4ONEA 5T8KA 4F45A 5L40A 5EERA 4WLUA 4YEDA 1ONNA 4BNZA 2I67A 1TA4A 2O2SA 1P33A 3HE3A 4D79A 3WB9A 1IHYA 2FR0A 5AXBA 1Z73A 3QSGA 3UVEA 4XB2A 3ITKA 2HMSA 5B4VA 2PZLA 1NVTA 1BVUA 4OHUA 1I3NA 1UH5A 4GX2A 3TDKA 4ZRMA 3VPSA 1WXDA 4N54A 3AY6A 3GPIA 3ZWMA 3RKUA 4EW6A 1AHIA 2V7PA 4D3SA 4NHEA 3VZPA 4PLTA 3QWAA 3BMCB 3HNPA 1D4FA 2V6MA 5JMPA 1ULUA 4S3MA 5EJ2A 1Q1NA 2AW5A 2ZJ0A 2EKLA 3MTGA 1SNYA 2Y1GA 2VZ9A 4FFLA 2ZTVA 4NFYA 4CQMA 3Q2KA 3BMQB 1T24A 3AY7A 3BIOA 3P5SA 2GN9A 3B1KA 3HJAA 3ROPA 1ZUD1 3QWIA 3H9GA 2GN6A 2X8LA 2HRBA 3PXXA 1X7DA 4ALNA 3KYCB 2JHGA 1HYHA 4FFRA 1VI2A 4IQGA 2VYNA 3GGGA 3U4HA 3GAZA 1GD1O 1RYDA 3KO8A 1BG6A 2C2YA 2CDAA 3JQAD 8LDHA 4Y9DA 1P74A 3WFIA 4ZQBA 3O38A 2VNAA 4DQVA 1UXIA 4Z3KA 2CDCA 3PHLA 2GN8A 3ZHZA 1TI7A 4BNGA 5CPBA 1EUCA 5KJ6A 5U9CA 1MUUA 4YJDA 4D46A 3QP9A 5I7FA 1KEWA 3WGGA 1P9LA 2AQKA 3RFTA 5THQA 3SJUA 5L4NA 1GPDG 1DC3A 2O3SA 4XIJA 2VNSA 4GI2A 2DU8A 1P3DA 1YQXA 2BGLA 5TJ9A 4CMGA 1U8FO 2X9VA 3PQDA 4A0SA 4TZTA 3WQRA 4BNVA 1Z6ZA 3GLQA 1QYVA 1C0IA 2HO5A 5H83A 2NVUB 3JYNA 1YBAA 1XR3A 1HETA 1YVEI 2C2XA 2VQ3A 4FGSA 3UCXA 3I9JA 4AJIA 5FEUA 5KJEA 3QQPA 1EE2A 2HJRA 2AQHA 4KTVE 4BHTA 3OJEA 4YJGB 5MDHA 3NT2A 3DAPA 4UUPA 4XZ3A 2JCYA 1CWUA 2ZYGA 3DDNA 3RUIA 2DQ4A 4BB6A 4BO8A 3ONEA 5IJZA 1RM0A 1NP3A 4WJZA 1EVIA 1PJ4A 5COAA 3DTYA 1P31A 2VZ0A 3PWKA 1Z74A 1YB1A 5G0WA 4BNWA 3JQGA 1DJNA 5KKCA 3GNSA 4JP3A 3BMOB 4I08A 4W9NC 3E9QA 2O3QA 2YW9A 3JYLA 1CERA 4C4OA 3DBRB 3IP1A 3JQAB 2C59A 2IZ0A 2EEZA 3CIFA 1PJ2A 2OMEA 5JAQA 3WGTA 5JXWA 2Y66A 1N8KA 1EVZA 2VZ8A 3PIDA 3QVOA 1R4MB 1EEHA 1UP6A 3ZWXA 3MWDB 1TB4A 3ZWWA 3GPDG 3ROQA 5EESA 3RVDA 2DUUA 2O3JA 3PQEA 3MEQA 2VHWA 1HDYA 2XAAA 4CQLA 1QP8A 2B5WA 1DSSG 4H3VA 3ZWVA 1LDNA 4DPKA 1DFHA 4F3YA 1G0NA 2ZB8A 1E7WA 3ADOA 2B36A 3H9QA 2J5KA 3RAJA 4ZICA 1PZFA 2BMAA 2D5CA 4HY3A 3FI9A 2DBZA 1K5HA 4TVOA 3DR3A 4EUEA 4MO2A 4ZHSA 4NNJA 1A5ZA 3RUHA 3IIEA 1V6AA 1U7TA 4RPJA 1MXHA 2HMWA 3ZN2A 2I66A 3BMCA 4MIOA 3FR8A 3MCVA 4YR9A 4J1SA 3TN7A 4CLRA 4O1MA 3LK7A 2QQ5A 3WBFA 2F00A 1XGKA 4ZA2A 2J8ZA 4PVDA 5FYDA 2R00C 4J7UA 1HT0A 2VUUA 2FZEA 1GPJA 2NWQA 2EERA 4IZIA 5DBIA 3S2EA 5KWEA 2JAHA 1E3LA 3JQ8A 1QMGA 3E18A 4RORA 4XWYA 1AXEA 1ADCA 4J49A 4FD3A 1VL6A 2NLOA 1BWSA 4Y6PA 1L1FA 3F6YA 2DVMA 2NQ8A 5KIAA 3FNHA 5JW6A 4H7PA 4BGIA 5DP2A 5JBIA 3C7DB 4Q3NA 4EJMA 3HQ4O 4R3WA 4PFJA 4HFRA 2YFHA 4P4LA 5C3MA 3H4VA 4FDAA 5IZCC 1NM5A 2QZZA 1O5IA 4WECA 2X5KO 3RSHA 1SCUA 2V6BA 2YJZA 1WZEA 4NI5A 4E33A 3TOZA 3KEOA 3C8MA 1BVRA 5J23A 2X6TA 1F12A 2PZKA 4FCCA 4R41A 3WWZA 2Y05A 5G0UA 3NT4A 3TL2A 4GWKA 3IAHA 2J6IA 1NTOA 3LF2A 4A10A 1RM5A 4M86A 3DHNA 1NPTO 4XQCA 5BR7A 1W4ZA 4MDHA 4MVJF 2NVUA 3AI1A 1TVEA 2VWHA 5KCZA 3FNEA 4AJ2A 2GYYA 2J3KA 1BTOA 2WTBA 1UAGA 4E32A 1GYPA 4PLCA 1J6UA 4XB1A 5JAZA 4Y6RA 1B26A 2E37A 4RQUA 3VPFA 1A4UA 4BNNA 2X86A 1EVYA 1Y5RA 2JFFA 2Q2QA 4CMEA 4CM3A 1I24A 1KERA 1LX6A 2HMVA 2VUTA 1LC0A 3NX4A 4J3FA 4OXKA 5JC8A 2EGHA 1MFPA 4TZKA 4AJKA 4J0FA 1XA0A 3CSDA 2X5OA 5BSHA 1YONA 4TKLA 4WOJA 4XA8A 1WDLA 3E9MA
chains in the Genus database with same CATH superfamily
5E6UB 4GEGA 3F90A 4A36A 1VFPA 1P1HA 1NTRA 5A4MS 2O06A 1M6NA 5FPHA 2VHEA 2ZAGA 3W5IA 3ZHQA 4OX9B 2V3VA 3S2ZA 3L7NA 2R65A 3NHKA 2D8MA 1D3AA 4RK5A 4P3OA 4DJ5X 5JD4A 1Y6FA 1J99A 1O8CA 2JFHA 3BDVA 2QTLA 4DWOA 5BYBA 1AOXA 8AT1A 4IXTA 2Z3WA 3SEAA 4ZZ2A 1K9VF 1W9MA 4K2HA 4URVR 2ABWA 3BJMA 3GVHA 2GAAA 1HSOA 3CKLA 3GFGA 4D41A 1SG0A 4KXNA 3STXA 3WADA 2VQ6A 3SMQA 1E2KA 1K3FA 2ZIXA 3GL9A 3KAKA 2BFEB 1UMCA 1W2HA 2OQRA 3EIFA 3MCWA 4LQCA 1P6XA 1S8NA 4MGEA 1BAPA 3CINA 3WA7A 4HXYA 1PAUA 1XZPA 3TRFA 4HMQA 4OQYA 2GNPA 1X3SA 2ZREA 1SCQA 3IOCA 1UJ6A 1YHNA 2GZDA 3KEGA 2VLIA 1MOPA 3IQIX 3Q7RA 2XDWA 3K9NA 1SCNE 2GPAA 4PRKA 5WRFA 1H6CA 4DJAA 2PWYA 2YN0A 1DG3A 1HY3A 1RKBA 2XUIA 1E3IA 2BBTA 4KSCA 5EIAA 4D8VA 1Q91A 1AF7A 1V11A 2QD2A 1JXQA 1XD9A 3DEZA 4BQSA 2IDZA 5C8ZA 3IA7A 1T3GA 4RA9B 4CUZA 3OQIA 2RBKA 1MABA 1BS1A 1RM4A 4UBLA 5TS2A 3LIIA 5ICGA 2XRZA 1Q44A 1P62B 4G0UA 4ENPA 1ZXXA 1QORA 3IPYA 3NANA 3QTLA 1UQUA 5FWXB 2ZUFA 4UBNA 1U6IA 4OB8A 1V48A 3LHKA 2XY4A 3RK1A 3GLGB 1PSWA 3I1JA 2CXUA 4D81A 1T3ZA 4XX0B 1JQLB 1IG0A 2ZLBA 1LSJA 3VAZA 4AUNA 3R3HA 2ZYAA 5DP1A 1U04A 4QIHA 1UK8A 3OLYA 2YBDA 2B25A 1CUXA 5HNKA 3K3PA 5JLJA 1O7JA 1Q7BA 1FUUA 2ZZKA 4QQFA 2VP2A 2HCBA 4PC7A 4C7KA 1RBZA 3MJRA 4JQYA 3N58A 3H7IA 1H66A 4L7QA 5CT4A 3CKYA 2J5RA 3DF7A 5KWIA 4XJSA 3STHA 3OA0A 2XBMA 2PBRA 5K3EA 1T2UA 1PJCA 3K9FC 4BV8A 3UJ3X 2QMQA 4GZMA 3ROZA 3CRZA 4DRYA 1WNTA 3CMMA 5EG5A 5ED4A 1TGVA 3CMCO 3EEBA 4I36A 3RVJA 4GOKA 2XMPA 3OZEA 4HAVA 2E6UX 3PUYA 4MUFA 3WJ7A 3TO5A 3BBLA 2C04A 3HUDA 3N5CA 4MV1A 1JMYA 1BXRB 4Y2TA 3UOGA 4KAJA 3WNVA 5CFQA 2XIJA 4EHDA 1SVNA 3PQ5A 1SOUA 4AROA 4HNAA 2CUTA 2IP2A 4MRMB 4YAKA 1MC4A 3BHJA 2EF1A 3KSRA 3LLVA 3U80A 5A03A 2QVGA 4NS4A 4HGRA 4S12A 4URUR 4WDQA 3TLXA 5BN4B 5SICE 4II3A 2ZI3A 3KQYA 2AXEA 3SU8A 1XZGA 4YH1A 3IVGA 4UVDA 3IAM1 4LJAA 3ZZUA 1BW9A 3SQDA 1PGJA 3MK31 3U3RA 1E9FA 3TZLA 2XI4A 1PFQA 3TVDA 1DAKA 3WBBA 1JKMA 4M0EA 2C3MA 1QYDA 1OLOA 1CPYA 4F3NA 1PDVA 2M6RA 3RIYA 1RRGA 1NV8A 4YAJA 1E5LA 2X8WA 3PR2B 5D7NA 4CNBA 1G59A 4PRZA 3IKMB 2OXCA 3B9PA 2I2BA 4YUZA 2HXGA 2VO1A 3WJ1A 1CHNA 4N6OA 4PM4A 4OHZA 1RYHA 5FB3A 3PI7A 2VSNA 3Q6NA 2G0AA 1O97D 2V7UA 3SPXA 2HR1A 1Q0ZA 2HSWA 1QGAA 1YDFA 2UVPB 2WP0A 1P5ZB 1A72A 3LPMA 4HO1X 2YN4A 4IHJB 3NWBA 3Q98A 4ZCIA 1EXNA 3EF3A 3LZDA 5EUCA 1G8SA 3AGQA 1WMDA 1XD2A 3A32A 3M6AA 2W2XA 3ZGZA 4RJLA 3WHLA 5CD9A 1D2AA 4I9HA 5DW3A 3S2UA 4MWOA 4NV3A 3SF8B 2DY1A 4FZ5A 4KWEA 2PUJA 4C7OB 1G3IA 1UJBA 2GAFA 2GJ4A 4Q7LA 1Y8RA 2R8OA 4QPDA 1SXPA 1TW3A 2V9PA 3CZRA 4KH1A 3K70C 2ZUEA 2VTDA 3FGZA 1KXZA 4FGUA 4QC2A 4CPDA 4XSGA 3IDAA 1HLGA 1VBFA 1NMYA 5D2CA 2CMDA 4RABA 3T7EA 3OOWA 1TKCA 2WHXA 2QYTA 1ZIDA 2RMKA 5TGDA 4B8ZA 1KJZA 1ICEA 1P9OA 1X1QA 1INLA 1H2XA 4MPPA 4IIBA 3R75A 1GP2A 4B4UA 5JDIA 2NO6A 2OOSA 2ZTHA 3BIJA 1A4IA 1A5TA 4P81A 2V8BA 3H6GA 2JA2A 3HXMA 5AMXA 1BX1A 3LW7A 5A71A 1J8QA 3OU6A 2P4UA 3QW2A 4M88A 3WK5A 1O6GA 3ZE7A 5CD1A 2K87A 2OCKA 5HGXA 3IT3A 5P21A 3DWEX 1GUAA 2VDMB 1F4LA 5DXJA 2Q0QA 3ZJYA 1QU2A 2D3WA 4EL5A 2D2EA 1IY8A 2G70A 3H2IA 3IVRA 4FN5A 3TZBA 4DC0A 4EQZA 4MLDA 3CW8X 1DLIA 1XNQB 3DFIA 4G5YA 3FWKA 5ES4B 4FHDA 1LDEA 1ISIA 2DR3A 3GCDA 4XQ0A 2EZUA 1YBFA 3RSQA 1K8QA 4AJEA 5HILA 1Y4UA 4WESA 3RLFA 5AVSA 3WLMA 1NBMD 3E8XA 1TDJA 4P22A 1I80A 5EPOA 3HCBA 1GV0A 2RHMA 4ZOEA 2AFRA 3QUTA 2BFDA 1WEHA 1JFLA 2QE7A 4DY6A 1KU6A 2IIBA 3C3MA 3FMVA 3KYDA 3W8FA 1W5FA 4CKWB 2I2DA 4E7PA 3F97A 3F4LA 4LYHA 3OEWA 3SX4A 2C9ZA 4BO3A 3OIDA 4RVGA 4E94A 3W2EA 5MFPA 2D3TA 2A1UA 1BXZA 1NT4A 1R9NA 5EMJA 1PS8A 1CQPA 1EZ1A 1WD5A 1G8HA 3TRJA 2OCAA 1CLUA 4YLEA 5EJ9A 1BVYF 1ZC3A 2HQSA 3H5AA 3IHTA 4P83A 3IC5A 3V46A 3ZGNA 2VJAA 1T5HX 5K5EA 1P0MA 1DHRA 4XIYA 3VI4B 2I4LA 3ZHYA 3EOZA 2OHHA 1JIQA 3A6LA 3F7NA 3OZSA 3P2IA 4HBGA 4L9SA 3DZCA 4L6AA 3MMSA 1UXKA 4W5QA 5GQSA 2ZR0A 1RLOA 1AKQA 4PPGA 4ZV7A 2JIBA 5IAEA 3OT1A 1S7GA 5TMPA 2BHLA 2CXRA 3DT8A 3TM5A 4DLNA 3DVAB 4EPVA 2A4KA 1UC8A 3R7NA 1LUAA 2OO5A 4H1VA 2R60A 4BLVA 2HWUA 4ZCSA 1TT5A 2O7SA 4YJFA 3ROEA 3WFZA 3LL7A 3IT1A 5CT6A 4R7TA 1ITZA 2YXBA 4E09A 3WS7A 3NXKA 1ENZA 4BBAA 2FETA 2WJ3A 4QQ8A 2NGRA 4G0XA 1L7DA 1NT2A 3JQ6A 4BGDA 2LRHA 4MS4A 5T4EA 2NZXA 2JL1A 5BN3B 1BQEA 5IFKA 4M8KA 2PZMA 2OGWA 4B7XA 1RKVA 1U81A 1RLMA 3PFWO 4QGHA 3ZI0A 1AKRA 4YGXB 5ICMA 3DC2A 4AF7A 4X6UA 2ZRNA 3O1JC 1G5QA 3FDFA 3LVQE 1EA5A 1V1MB 1TMGE 1ZN8A 2JBHA 1FBTA 3QOFA 3GAFA 2VJMB 2IYOA 1W88B 5D3ZA 4B6RA 4G0ZA 4I3FA 3E3AA 1M3SA 5BW6B 4ID3A 2IZ1A 1H85A 3CCBA 3G23A 1YF3A 2QA5A 1YQEA 2W6ID 2Z5FA 3LCUA 4NCKA 4RLQA 4IQFA 3FOBA 3IULA 4QQNA 4AKTA 4HSGA 4KB5A 5IN5A 3TCNA 3ZV6A 1FS5A 1C50A 1YQUA 2C29D 2QX7A 1D5WA 2C2OA 3BSYA 4TTQA 4CVNA 3PCRB 1TEHA 1HKHA 2G8LA 3D43A 4U2GA 1OHHA 2A3NA 2YZ2A 1HPLA 3NBZC 5TMEA 3AW9A 4PZ0A 5C5DA 4GMHA 3UENA 5JNTA 1KFCB 2JGNA 1LK5A 3V1TC 2QUKA 5IXSA 2I6TA 3O8BA 3LE8A 4GM0A 2F62A 3ST7A 1EXWA 1MO4A 1WKCA 2WT9A 4KMSA 4I4TF 2GM9A 1I7PA 3UJDA 3DHYA 4K87A 5FDFA 1XZLA 2AN5A 3I58A 3CZ5A 5AW6A 4MR7A 2O59A 5DF1A 1NDHA 3BWEA 3FD8A 1GCOA 1Y8CA 1Z08A 5CNKA 3K9GA 5ALHA 5D5QA 1YUNA 3C1AA 4IJQA 2AXNA 5SY9A 1RWNA 1RJ9B 4LXIA 1M5TA 4KACA 1JDNA 1VPWA 1V7ZA 1CB0A 2OV4A 3I76A 1Q5PA 2PEYA 4QYSA 3C2QA 4FIDA 5JFGA 4ETIA 1ZO8A 4HTFA 2IK8A 2CVFA 2M6SA 4YJKA 2XA1A 3N2GA 3PC7A 4PIMA 4HH0A 3URKA 2OXEA 1NVEA 3IDZA 3WKDA 1GLVA 2P62A 2VEOA 4UPEA 4YMTA 4QFBA 3E4CA 1HE1C 3GUZA 1T10A 2PS9A 3LI2A 4L50A 2IOYA 3H9BA 4ZXPA 5JVDB 4WBNF 4OLAA 2AOXA 4MTLA 5EIHA 5DHUA 5MHTA 2X7JA 1BGWA 4QULA 4RDHA 2YV2A 4M9XA 3NTVA 1HG1A 1YZYA 3FHLA 3PFKA 4ZZ3A 1JR4A 4AX4A 1G291 5CCBA 2YUIA 1Q22A 4XGQA 4QUGA 4WESB 5BSGA 5LQMA 5EJEA 4O8ZA 5HG0A 1PJLA 4M98A 1Y7IA 4Q9IA 4TS1A 1UC9A 4UAJA 4GEKA 2C0PA 3K2IA 2OYRA 2GBLC 4IHAA 2ZBUA 5JCZA 2X19A 2PH7A 1JR3A 4Q3EA 4TWAA 5TEWA 5TPZD 4C6RA 1A2BA 2WVGA 3UJHA 1GOTA 4WD3A 2RGYA 4BQIA 2M1ZA 1XRSB 2A1UB 2F64A 2IEYA 3HB0A 4ZVSA 4AI6A 2WTEA 4ZOBA 4REQA 3AF0A 3H83A 4YJHA 5JH7B 2C3YA 3MN1A 1E20A 3C1OA 4I9UA 1LNSA 4CQMB 1ZZGA 4LOKA 4B79A 2P35A 3LTNC 3KTFA 3DBIA 5F2NA 5IDXA 16PKA 3S2IA 3FNQA 2X8JB 3IIIA 3M1LA 4H7JA 1MR3F 4ZCLA 1C0EA 1TCUA 2AMJA 3HDGA 3QELA 4LVOA 3EZFA 1ZK3A 4N3CA 5LZ4A 1SZJG 4DLKA 1C9MA 2HF7A 1YB4A 4MVJH 4W1RA 4BKRA 4DIBA 4HDMA 1OWLA 1CS0A 2NXNA 2OL4A 4O4IA 3SS7X 3K35A 3KJEA 3PPWA 1KDOA 1BKSB 4GBMA 3ACCA 4HQ0A 4ZZIA 4JLWA 4CL0A 1KVRA 3TQRA 1RMTA 2I8LA 3KJHA 2IPNA 5LOVF 4ZO7A 3GJ5A 4JX8A 2NSLA 1DKUA 3ZI4A 3AVTA 4MVWA 1V41E 2PS3A 3JQBC 2D00A 4Y2QA 3RYIB 1L5OA 1RAHA 2P9CA 3CF4A 4KJZA 3W6NA 1HE5A 1TLTA 2WIGA 4FDUA 3RM3A 5KQSA 3CWZA 3OCWA 3PT9A 4LRSB 1KK3A 3SNKA 4D9NA 2O3UA 4DVGA 2FP3A 4K05A 3D2AA 4C3ZA 2X13A 4A5SA 3ER6A 3AEYA 1RWWA 1Z6PA 1T5DX 4E5NA 2BRUA 1FZQA 4YAFA 1NYTA 5EVCA 5LBIA 2ZE7A 1LZKA 2CBZA 2ZAOA 3OF3A 3FSJX 4MCHA 3WR5A 4EVIA 4DLLA 3MT0A 9LDTA 1JH8A 4IJ6A 1DC8A 1II8A 1H23A 3F8TA 1RRMA 3TQTA 4IUBS 2EBHX 4QPNA 2YRWA 1XZJA 3WKEA 3SFTA 2BFBA 2DFTA 3VH2A 6PFKA 1EM6A 4R84A 1M1NB 2XCOA 3SQLA 2A92A 4NULA 5FWDA 1VTKA 3FNRA 2HGSA 5KYYB 3KHUA 1DFIA 1Y33E 3WAJA 1W5AA 3P20A 1Z82A 4HWGA 5K0GA 3UAXA 1OH5A 3O3NB 3GDFA 1GCUA 5KTTA 4X6YA 3RSCA 3ZCTA 1W52X 4I1YA 2OXTA 5DXAA 1RXVA 4LHYA 3CRQA 4K46A 4RMNA 1ZK0A 1QH0A 3RBAA 3GF4A 1E0AA 2EOAA 1JFVA 4H4EA 4MW7A 4D26A 2AI1A 4F60A 1XKQA 4Y8VA 4QRHA 5EZYF 2WPDA 2HQ1A 3EISA 2BCEA 2JHCA 4I9FA 4B1FA 4YX9A 1DC6A 5A04A 1Q57A 4JGBA 2ZK7A 4JENA 2P30A 4UASA 4M9QA 4ZTUB 1T2AA 4AJ9A 2OEPA 5F9MA 5F77A 3WY9A 1NJ2A 4OSOA 5LQJA 1VBKA 3DD1A 3KR9A 2ZBFA 4IMPA 4G5FA 4QBFA 2NUTA 1WXFA 2QN9A 1DELA 5SZIA 3PWTA 1Z4NA 3QTTA 3HZHA 2DFPA 3L40A 1FFHA 1YR6A 2HCTA 3D4IA 1X38A 3K9WA 1NQTA 5M2QA 1FRVA 2NTNA 4A5OA 2CMGA 5DULA 1Y8QA 4E0BA 4O3FA 4XVQA 5CVEA 3SLRA 3KYBA 5AWFC 2OM6A 3GOQA 2ERYA 4HUTA 1BDBA 3OPXA 4CUJA 5AM1A 3DLHA 4Z2YA 4CR6A 1RRCA 1ZHOA 1R4MA 2YH2A 3RRMA 4YMVA 2AFHE 1K0UA 1Q7TA 3THYB 1Z5UA 1ISHA 5K0FA 1F8UA 3ETDA 4CRWB 1MA3A 3I0NA 3OQ6A 4D43A 1IOLA 2JIZD 1ISMA 3JVVA 2JATA 4CLRB 1ORDA 4HFNA 2JIQA 3R9WA 5C8YA 1IK6A 3TW8A 5K6RA 2O05A 4ON9A 4BVEA 2YJGA 1VKNA 2VCYA 2GLXA 1E3WB 1XLWA 2BKEA 4HR7A 1RTTA 1V9CA 4LTMA 2N0SA 2QN7A 4MVJE 3UFBA 4CG1A 3M6IA 1PR2A 2VHJA 3A4MA 3MB5A 4JU8A 1K89A 5EQJB 2VUSA 4ECAA 4LPKA 4ENQA 3K92A 3VMMA 1N6PA 4KMMA 2XCRB 3W1EA 3M5DA 3DONA 1SO8A 3JQ8B 2YOHA 4HRYA 1RXEA 4AM8A 3GMTA 3BTUA 2BWJA 4LFCB 4FB4A 4QHYA 1FMCA 3I83A 4REQB 5TXGA 1F8GA 4WFIA 4AD8A 5BR4A 3H16A 3OZCA 1YC5A 4JBWA 5JEDA 3ZVNA 2QZ4A 1E1RA 3VX4A 4RXMA 3D9QX 3HCNA 3VR5H 3RUEA 4CL8A 1XTZA 2CFIA 1DC4A 1TJ5A 3PHGA 1U7ZA 2HF9A 1BE8A 1NJ8A 2Y9MB 3K70D 2IH2A 4GL4A 1VMIA 4FYWA 2PT9A 2V7GA 1W47A 4FWTA 3BEOA 2JFUA 4FKMA 1GN8A 4C87A 4E15A 5EUMA 3IB6A 2NYVA 3GRCA 2C4HA 1A9PA 1KI6B 2IT1A 2R66A 3NZEA 2WFAA 4Y1RA 1HT1E 4AZWA 1ZH6A 3P9YA 4UOQA 4B7UA 2R5NA 1IEWA 3PDWA 4AJNA 4YRMA 1NVKA 4BGVA 4BQEA 4WGFA 1PL0A 1IEXA 2DFDA 2WVAA 3D7LA 3VVCA 3G1TA 5JCPA 1ZI8A 4N49A 5HF5A 2ZAMA 5JG7A 5LPNA 3T1TA 1NFRA 2OV2A 2QGFA 1RM3A 2NZYA 3RVNA 3W8RA 4E31A 5DE3A 5JWRA 2QN1A 2XVMA 1IQPA 3UATA 2ZW9A 2Q8QA 3K71B 2WSIA 4G1EB 3L77A 4XGNA 5GGYA 4G5SA 3OTGA 2O4UX 3PC2A 4B7AA 3UHAA 1CYDA 4I4CA 4M6WA 4I6GA 4R2JA 3L93A 4YO7A 4G8JA 2BEJA 1W76A 1XHLA 2PR7A 2Z8XA 4N82A 1KHTA 1W5TA 3HCEA 2ZIEA 3G6WA 1FMTA 4JNCA 1X74A 1ZD4A 2MSLA 3G13A 3DDHA 5AQ1A 1P19A 4IWYA 4ND2A 4O2AA 4Y6SA 2GCGA 1E2IA 1GA6A 2P7IA 3E9DA 1VHTA 2QAIA 1UM9A 3DBLB 5EWMB 4AQ7A 4Q6WA 3SEQA 2ZUSA 2XAUA 3QVKA 5FLKA 1J4AA 2A33A 4WDRA 4ALMA 4RJ2A 4WZBE 5AJXA 4LY0A 4WN9B 4KI0A 4D44A 1AC5A 4DVJA 2Z6VA 5C7YA 5K4GA 1FVXA 2XADA 5TR9A 1RT9A 2NW6A 5AW7A 4JBXA 4X0EA 3U7RA 2NT4A 5J4YA 5EVJA 4DYVA 2C7BA 1KMIY 4P7BA 3LDAA 2RGNC 1PQ4A 4QXMA 3A7EA 4M1YA 4X1OA 1YU6A 2G88A 4AECA 5TGTA 3NBAA 4YRDA 1WUHS 3QQ5A 2ZE8A 5HRCA 5K03A 1M72A 1YZ3A 2I8CA 1IY0A 2HPAA 3M83A 4S2UA 3UMBA 2WD7A 3UKJA 5MN5A 2JFZA 1JIKA 2IY7A 3G88A 2OV6A 1FU7A 1FOEB 1DCTA 4I1VA 5REQB 7GPBA 9GPBA 4EJSC 5IU6A 4XIFA 3MTDA 4TTVA 3GZJA 1WY7A 1NX6A 2CLFB 2HREA 4CDMA 2OTCA 2VNIA 4ZO6A 4C0HA 3M9WA 3N8IA 1AZSC 1ZN2A 1GKUB 4FHGA 1VECA 2DT5A 3MUFA 3ENKA 3HTXA 1V8BA 1YIAA 4P54A 3JX9A 4LOJA 1GWNA 1NOKA 5T5QA 2XZTA 4DUGA 2XDQB 2XOXA 4AY3A 1MKYA 3RG8A 3BXEA 5JASA 3X1ZA 1KY5A 2P91A 1KJIA 4M9UA 2P8SA 2BYTA 3LJKA 4BATA 4F2HA 1Z4PX 2E5FA 3X1MA 3K6KA 4PR0A 5BW4A 3I3OA 4R5HA 3TZQA 4JDUA 1UBOS 5F35A 1CZUA 1OV4A 1H1DA 2XCSB 4LHZA 2JANA 5KVSA 2GPSA 4H16A 5DSTA 2HTFA 4DADA 3VDMA 3BF8A 2ZZNA 3IFSA 2QG4A 3RB8A 2WSSD 3W1WA 2GS9A 1JEEA 2JAUA 4MI1A 4P9NA 2H08A 3KOZA 2OHGA 4YY3B 1N3YA 1P77A 5J2UF 3BWYA 4AJPA 4MWCA 2CXSA 4I8XA 4UUMA 5AVVA 3C0KA 5C52B 3FJOA 3UG7A 1B1AA 5CB4B 5DN6D 4IUDS 1JHUA 1NLZA 4DCJA 2HHCA 2UZ1A 1W44A 1X13A 2ASVA 3PUXA 1H4VB 1T15A 4TYNA 3BK2A 4C89A 1WKBA 1PF7E 4LJSA 1A4RA 1E9BA 3S0JA 4HQKA 3MJSA 3DWIA 3MT9A 1QVZA 2GBGA 4IDCA 3SVTA 2H4HA 4LZPA 1KZ7B 4O4JB 3ZXXA 1TJ4A 2O7RA 4FT4A 4IH4A 3D3WA 5JPIA 5A7GA 2XH8A 1E1YA 3OX3A 3U3ZA 3VZQA 1V8PA 1TM4E 2AX3A 3BQNB 3CNOA 1O9BA 3NOVA 3Q7TA 3Q7QA 3VSAA 1NN5A 1CUAA 3NT5A 1M2VB 1P5HA 3RC3A 2ZE6A 2G4VA 8ADHA 2MMCA 2C1EA 1A1SA 5DI3A 4A16A 4DR4B 3QX8A 3S5JA 5HF8A 1QKKA 1AGNA 3EAFA 3N70A 4FM9A 4JWKA 4YB8A 4AXBA 4DY4A 2Q1TA 2WWIA 1SVKA 1FYFA 1OY1A 3OLCX 2Z43A 4JQZA 3I4FA 1PJRA 4Z7OB 1OLXB 3MT7A 3VHLB 1Q0LA 4B6PA 1USKA 1YMQA 3ON5A 3QFTA 2PJZA 1KO8A 1VLVA 1I33A 3C3CA 3VHQA 4DBVO 5TDHA 1S5PA 5L3SA 3N2NA 3F9IA 5AVJA 4MDEA 3TTSA 4K6FA 4L75A 2QORA 2OA0A 4A2CA 1JPVA 3IILA 2GETA 1M34A 2AB0A 3Q41A 4FKZA 4I1RA 4IX9A 4NATA 1E69A 3T8YA 1F5NA 2ZI5A 3E7XA 3HDQA 1T43A 3BN3A 4EG7A 3GOHA 4LQDA 1QZZA 5JBNA 1GQYA 1N6OA 4ZMSA 5DTQA 5EZYA 2JCSA 1BIFA 4L0CA 5E1DA 1C7IA 1IHDA 1QB8A 3ONDA 1DRUA 4P6VF 4NBWA 1R6TA 1HL7A 2EJTA 3WICA 4YRNA 2O8CA 1KO1A 4C7OA 1YFJA 2UXBB 5CU7A 4R5MA 3FTNA 3UN1A 2A9JA 4ZIRB 2O2GA 4TL9A 1FX0A 5FI3A 4BLSA 5MN4A 4M9ZA 3K2EA 1KIAA 2G72A 5JYCA 4DA4A 1DX4A 3EEYA 3JATB 3UANA 1T26A 4Q4CA 5KQRA 3WYEA 1H2EA 3AYZB 4IH9A 4RZHA 2B7CA 1RXCA 5ENVA 5F4ZA 3RJTA 4BV3A 4HQOA 3CO0S 4ZAVA 4AZVA 4RTQA 4D8XA 3RQIA 4U7WA 2W2LA 3UK6A 5KOJA 4KDFA 4HNGA 1JQEA 2HYDA 3G0BA 1QFSA 1ZOOA 1BROA 1WPQA 2ZIUB 3EZGA 1UDAA 3QOWA 1OU4A 4IVQA 5BOSB 3T3OA 6ADHA 2W6PA 3DVQX 5GY7A 1ABBA 3IMEA 5GAJA 4NU8X 3GPCA 1UOQA 4IYRA 5A9RA 1AO0A 4BNDB 2SBTA 3GLGE 5FL7A 1KYTA 3SHVA 1QH8B 1GGNA 4MUGA 1NXPA 1AA9A 1LQUA 2VIIA 3LBIA 3WRVA 4ACBA 2OZLA 4C30A 1UJCA 1G8KA 2F1OA 4DWJA 5HHTA 1JF8A 3EXEA 3U4IA 3EN0A 2PZJA 5TQVA 1Z5OA 3HS3A 3CUYA 3I8OA 3JD2A 2PUEA 5IKOA 4CM4B 1VP3A 2JFWA 2R5WA 5ALXA 5KC8A 1V8FA 1UMDA 2NSHA 5KYXB 3OTQA 1B2RA 1ZKDA 3PL1A 2N9UA 3U3KA 2YBEA 1I1QB 4XD7D 3GLVA 2DM6A 5LSAA 1CYEA 3W3AH 2COEA 2B1GA 2GEUA 1NE7A 3VTFA 2HSDA 2NZ2A 1CJKC 2V03A 3QVLA 1A9XA 2GM5A 2CJWA 2GD2A 1Z68A 4OGFA 2D0IA 3FCYA 4M3NA 1SHKA 2TSYB 1TMOA 3BFXA 3LC1O 4IOMA 1H0SA 3LXMA 1EXDA 1WXGA 1AXGA 5JFOA 2WBLC 4UU8A 1NR7A 1QQ5A 3QVMA 3AF1A 3SLKA 4HUQB 3Q72A 4BP1A 1L2TA 1I4WA 5AM4A 2ZAIA 4Q24A 2J0QA 1LK0A 1K75A 2INGX 2JBAB 1DQNA 1U80A 1ZWLA 2SICE 1V39A 3PU6A 5F7OA 4HZGA 1TJYA 1XUOA 1O4VA 3V8RA 1WHTB 3KFVA 2A7QA 3OQ1A 1ID1A 5K4HA 4TLLB 4JEUA 4XASA 4KYUA 1JHOA 1K2VN 5EWLB 2Q8NA 3VUFA 1QG6A 3VI3B 4YALA 3ACDA 2BTOA 3EG9B 3DTVB 4YCDA 4EPRA 3GJZA 4Y0NA 3OIVA 3FRJA 4JASB 4M54A 4TROA 3WLPA 1E58A 3AXSA 3U3DA 1U3FA 1MW8X 2EV9A 4NENA 1Z7BA 1V26A 3U40A 4KODA 5JS2A 2Q07A 2Q3MA 4HDRB 5HCUA 4Y2RA 3TSYA 4ZV9A 3QI7A 1DUVG 3O7MA 4KCGA 4HQLA 2YMPA 4MPJA 3UB4A 1GXSA 1OKKD 1H6BA 5IX8A 3QFFA 1G0OA 2ZI4A 5E3JA 1CJCA 1OGYA 1O87A 1TPYA 2IEGA 1NG1A 2X0FA 3RF7A 3UO8B 5TV2A 4DDVA 5DI3B 3OTOB 1TAUA 1EINA 2BZ0A 1E0DA 1S1MA 4WBNA 1CQXA 4Q1CA 3PHHA 3TL3A 4B4DA 3Q8WA 4YN3A 3LO5A 4X54A 1D1QA 4UEKA 1KQGA 2K5UA 4FLFA 5AKYA 1U2GA 2W2TA 1CS4C 1GKLA 3LBAA 5C80A 2GILA 5BUQA 1EFCA 3QHAA 2JGRA 3CX6A 3UWPA 4BZQA 4A15A 5JSZB 1Y4DE 1CDDA 1ZSVA 5FD8A 1CFJA 2LP4Y 3NEYA 2AD1A 1ZVQA 3E1SA 2WIAA 2NAPA 3IPXA 4HHEA 4Q4LA 5AOVA 5U1PA 3TD9A 3PJDA 3TSCA 1A2KC 4L5AA 3DPIA 3HEMA 5E2BA 1P7WA 1W9HA 4M9RA 1CU1A 3HXQA 3UKOA 1Y48E 1SZCA 4D4GA 4UKDA 4MR8B 4BQRA 1FRZA 3AUTA 4RBNA 1T1RA 3UWMA 3FOAA 4PYLA 4LFBB 3RSGA 4D3FA 3WLQA 1NQAO 2XMBA 4ZI2A 2OQIA 2UYYA 3HUEA 2BI8A 5CVJA 1UEIA 2XGMA 1P7CA 4DCTA 2C4WA 2QXYA 1T5SA 1UODA 4GZ6A 3FYHA 4B2LA 5C8VA 3DWFA 3EVGA 3NBKA 3W5UA 2V0NA 4MV6A 3AGPA 3Q3GE 4XWGA 4L8VA 4M21A 4QOGA 3IURA 1I7LA 4E5DA 3RRBA 1UBNA 2HSGA 4FI3C 1BN6A 1FNCA 4O33A 1F8FA 4RXTA 4M1ZA 4GI7A 4EFMA 3M0EA 1PGQA 1RKXA 2I7XA 3QJGA 1V5EA 1ZN7A 2IFTA 1RWQA 2WU8A 2XQFA 3SJ7A 1CRZA 3GIDA 5TVKA 2Q1WA 3K31A 1SHLA 4NBRA 1Q15A 4LF6B 3GA0A 2BBSA 3IP8A 2C92A 2BF7A 3QMVA 1QXSA 1U0SY 4I5DA 2HU8A 2XYHA 3P8ZA 1AF4A 2Z2JA 4H18A 4E12A 2IS6A 4BO1A 5BSRA 1P44A 2DH5A 1EHYA 5IH7A 2AKAB 2FSSA 2HK6A 2IPOA 4LGMA 4HX5A 4YUAA 3F98A 4GOLD 1DHTA 2ZBVA 3QEOA 2HA5A 3B1WA 4P82A 2I6SA 3IUSA 1G6HA 4FZ3A 3VNQA 4NU0A 1Z0IA 1IM2A 2EKBA 5IVIA 1RZVA 3DG9A 4DMKA 3HMQA 4LZLA 1Z0JA 4R16A 1OCEA 3A27A 1J9ZA 3FRIA 1Y3HA 4DILA 1B8PA 4FOOA 4F4UA 2YYZA 5IS2A 4RZ3A 3EMVA 2FNAA 3A1NA 3PTZA 1HM5A 3BIXA 3FHOA 1AE1A 1TJPB 2FAXA 3LNTA 3IRVA 3U7QA 2ET6A 3AR8A 3P2OA 4PYIA 3A9SA 1DKPA 4V1CI 1GG8A 1Z56C 1CZOA 2DHCA 4Q03A 1DO2A 1XMQB 1ONBA 3TTYA 1DAPA 4HUJA 1Y37A 3IMGA 3PGA1 3S40A 2ZU0C 3V8PA 4B3SB 4OLFA 3JQQA 1MOSA 3EBPA 1C0KA 1IZ9A 1GNRA 1DIOB 1NNEA 1DOHA 4FZJA 1M1ZA 3K73O 1YL5A 1R8XA 1QQTA 1S3SA 3LFUA 1LBQA 1RRFA 2HFKA 3L1IA 1DV2A 4KGXA 3L6CA 4CU2A 4BVGA 3KXIA 1RWVA 3E5NA 1OPRA 2ID4A 4JLVA 4C7BA 3IHWA 4O1IA 3JY6A 4GMXA 5LA6F 1FDRA 2V7TA 1Z8FA 2ODTX 5DYGA 3KUDA 1SCKA 4G56A 1J1ZA 1B76A 1G2IA 4EYQA 3BK1A 7REQA 1RYYA 5DTRA 3CLSC 2WZBA 1UJMA 5BORA 3NHWA 4X6XA 3PTLA 4KPYA 4IDBA 1XZCA 2V45A 4RV9A 2EFHB 2R7KA 1XZNA 3OF2A 3URMA 4DR2B 4BQNA 4ZGGA 3MHPA 2F43A 3A6PC 3Q88A 5G4KA 4LSGA 2Y1XA 3TS1A 1IAQA 4MUYA 3GC6A 3KELA 4MV9A 5BN4A 2O8EB 3AKDA 1TX4B 2EJVA 1P2BA 2BM8A 1U11A 1E7SA 2I3GA 4ZOCA 4Y30A 3JXEA 1RFGE 2NZUG 1P18A 4RJKA 4BUZA 1PBTA 5A7HA 2C7QA 2FN4A 1FVHA 4JGIA 2HK9A 4YONB 1CJVC 5M29A 4L8FA 3DP9A 2Q99A 1XB2A 3ZCQA 5KVQA 4HYTA 2B4TO 4DLRA 1WOYA 4KHZA 1JQ5A 1C3OA 3F5DA 3GYGA 2I2FA 5J9FA 2AF3C 5LP6C 1M1YB 2EU8A 4Q1AA 4YAUA 4QM7A 1H0KA 2PKXA 1FTSA 3JQBA 3IKTA 5E95A 1XRQA 1YAHA 1TU3A 2EJCA 5G3YA 1H0RA 1QHGA 5LJIA 1A96A 3L41A 4YXWD 3D6JA 5HK9A 2IXEA 4K9DA 3FCUB 1OBOA 4K8RB 5FJIA 1WNFA 3THRA 3VR4H 5DM2A 2Y92A 5JWHA 1ZVJA 1Y8RB 2DAPA 2B37A 3RRJA 4AB1A 3C6XA 2BN4A 3RT7A 4PYJA 2FXVA 4B2YA 4NOKA 1XEFA 3LCVB 4YYEA 4RHYA 5H81A 4L74A 2RGNA 4BX0A 1D5CA 3VZBA 1ZRSA 4DB2A 4PRYA 2JI8A 4YDRA 1H2HA 3PITA 2O2YA 3I32A 2ZSHA 3QVXA 1XKLA 3SSMA 1TQDA 2AEFA 3DEJA 1FDTA 1HWYA 1JQKA 4KXYA 1SQSA 4GKVA 5GV7A 4WXYB 5A2GA 5LM3A 2VAWA 4XDYA 5LUAA 3Q7IA 3JALA 2B8TA 3AHJA 4UBKA 5KWJA 1A69A 1UDWA 2Q9BA 1MP0A 1FRFS 1P1JA 3LFHA 2Q46A 1EUQA 2VA8A 4TX1A 1C1DB 4MYHA 3GVPA 1DOZA 3HRHA 2ZRAA 3WWOA 1FY2A 4W6ZA 2LCQA 4XIGS 4ZC8A 2XA2A 4ZCPA 1KH2A 4F6CA 5J4LA 4LRWA 3UUFA 4M9SA 4Z4IA 1NQOA 2FHSA 3CLRD 3T41A 2GPNA 2PMWB 5CFOA 5DNCA 4D0SA 3ZVKA 4QD3A 1V5FA 5CVVA 5F2KA 3BFJA 3ZHVA 1CD5A 4UOZA 4N12A 1FDWA 4W8HA 5LB4A 2XE8A 2I6UA 5SV2A 2FPWA 4TSRA 3FUUA 1FDIA 1MBZA 3ENNA 3MVEA 3LOQA 1NUTA 3IPLA 2Z9DA 2EX0A 4HZUB 1W30A 3MXTA 4QL3A 3OIYA 2X9QA 3PIIA 3ABOB 4LV6A 4OAOA 4OU5A 2IC5A 2OV3A 4S2EA 4XYEA 2J3EA 2GCOB 2ZB7A 4A3SA 2V96A 3H18A 4TZ6A 4WW0A 4BO4A 4CQLB 3A4YA 3W5SA 1Y89A 2ILTA 4IIYA 1X6VA 1K68A 1T4CA 4PQEA 2DHRA 1ZQ1A 5GZ1A 1XXHA 1I3OA 4AYWA 4LCEA 3K5PA 4U7HA 1J0CA 3HUUA 4MP6A 5FL3A 1QRSA 1G6Q1 1V1RB 1LI5A 3F1LA 2G67A 2GM3A 3HRIA 2ID8A 4WUTA 5EGSA 2ZRHA 1YVRA 4WK6A 2H4YA 2YC4C 4QYTA 3RAGA 2RHBA 5FPPA 3O47A 3PB3A 4B4WA 4CV1A 1NVGA 5DM1A 3S55A 4V0KA 3RKSA 3ZBPA 4I7EA 5ERXA 4JYAB 3D0QA 121PA 1U3WA 1GT91 4JJGA 2A9RA 5JECA 2PQ6A 4OP2A 4WJLA 3F4KA 1XP5A 3G5UA 4WXHA 3C4QA 1ADGA 3HGTA 4Y67A 1Z6XA 5EJIA 3B1JA 3AOEA 1PJTA 1CVRA 1YAJA 2IZZA 2WWWA 3G2KA 3I9KA 1PQUA 4XXHA 3WQHA 3NVAA 3ZLVA 3FVWA 1ADFA 2QTGA 1JSCA 1QYIA 1TT5B 2H2HA 1PL7A 1M2OA 3DZGA 4WCFC 4AF8A 1LBIA 1RBMA 3BE5A 1XOIA 3A1WA 3EMBA 5IDYA 1XMIA 3D3JA 2IU6A 2VYVD 4LJLA 4RGQA 3FUWA 3OE5A 1JDJA 3RS7A 5L45A 3GCWA 1VCIA 4OJNA 1E8NA 3NIDB 2B6NA 3UHFA 1ZI6A 3T1HB 1USWA 1UBGA 1RLTA 4XPIB 3SZ3A 1BE6A 3G2PA 1R6UA 3VA7A 4ZD6A 5B57C 1P0PA 3SM9A 4NMLA 3H86A 3NYRA 3REQB 2C4TA 2JFYA 2W4IA 3ZVLA 4YJGA 4CMHA 1KEPA 1W85A 2VJLA 4UJ5A 4NESA 1IY9A 2OO5C 2F9LA 2V97A 2VOEA 3G9XA 1WMSA 2REQB 4TLEA 4KZPA 5ALLA 3H84A 3ANXA 4Q18A 2ZOSA 3CH4B 1QFJA 1SU8A 4RO0A 1N2ZA 3ORRA 4O2AF 4TOIA 1P1IA 1IVYA 3QE4A 4OU4A 1XU4A 4KQ2A 4W7SA 3R7WA 1QRUA 3CXRA 3GT0A 1P7PA 1WVGA 4EY3A 4QUEA 1ODIA 3T0FA 3O8RA 1IWOA 3FXAA 2HL6A 4FIZA 4CMIB 2XXAB 1C8LA 1HE2A 4XDZA 4PPYA 1G5RA 4LDQA 5DYYA 3HCAA 2O2ZA 3OP4A 3Q40A 4U2EA 4AMUA 2GK3A 1UK9A 4UHBA 2PO7A 3QZUA 3KKNA 1M8GA 3NCTA 1OE0A 1VYTA 4HAZA 3NCHA 3QK7A 4CMKA 4EDHA 1GZSA 1FLDA 3N2KB 1HE3A 4J1TA 2QW0X 4R1SA 4OG2A 2J41A 3A1SA 4JI8B 2ZRDA 3PGJA 1RABA 5COBA 3MOSA 2B7BA 4RJJA 3CNNA 4TYPA 1KS2A 1RBQA 2A1TS 4WLEA 1R5NA 5C7IO 4BMPB 5CDGA 5JRZA 1VHQA 1L4FA 4FJ2A 2HBRA 4INZA 2DUWA 4M83A 2VT2A 4D4MA 1R88A 3KDSE 4Z2AA 2P1RA 4BC1A 1PEDA 1W581 3BL5A 3DMYA 3P71T 4D8YA 5MGBA 4DZTA 3D8SA 5DPMA 1E2MA 3C7AA 2OBNA 3R9XA 2C8KA 3SJBA 2LPMA 5BPFA 2G4CA 4RS4A 2OLKA 2AG5A 4KQHA 4RF5A 5D8DA 4YIKA 1X39A 4ROSA 1VJDA 2BFAA 3C70A 5KMGA 5I8PA 5CEEA 5GM2A 3EGXB 3E35A 3UTCA 5BVGB 1PSDA 1VLLA 4RVSA 3N74A 1OW3B 4UFPA 5FXMA 1WXWA 2RKOA 1NPYA 1NWHA 3ZNPA 1XLTA 4HVAA 1ZBQA 1KBZA 2GK7A 3ZU3A 2ZTLA 2X42A 2RAUA 3HJTA 1UFRA 3HKEB 2QY6A 1EWVA 2BE9A 2O5VA 3HMKA 3MOIA 3N7UA 1HOTA 2VPPA 2YHIB 1DKMA 1YB6A 4LSWA 2JJ1A 3DYVA 5AFSA 1G20B 5KNBD 1GKYA 3IB3A 4DBZA