1BWSA

Crystal structure of gdp-4-keto-6-deoxy-d-mannose epimerase/reductase from escherichia coli a key enzyme in the biosynthesis of gdp-l-fucose
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
314
structure length
314
Chain Sequence
KQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQNAPDVVVWGSGTPMREFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCTIRDLAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVTRLHQLGWYHEISLEAGLASTYQWFLENQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PROTEIN (GDP-4-KETO-6-DEOXY-D-MANNOSE EPIMERASE/REDUCTASE)
publication title GDP-4-keto-6-deoxy-D-mannose epimerase/reductase from Escherichia coli, a key enzyme in the biosynthesis of GDP-L-fucose, displays the structural characteristics of the RED protein homology superfamily.
pubmed doi rcsb
source organism Escherichia coli
total genus 104
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 1998-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1bwsA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1bwsA02
4JBIA 3QSGA 1PJ4A 1JKJA 2PD3A 2YDXA 2HSDA 4W7HA 4I5FA 1E1LA 4OKNA 3UF0A 1PTJA 1WDKA 1CWUA 2NVBA 3GA0A 1JVSA 1Y8RA 3H65A 3EC7A 4KUEA 4QTZA 4ZQBA 1EUZA 1YBVA 4J7UA 3DBHA 1ZO8A 2X9GA 4NFHA 3UXYA 2V7PA 5EIOA 3EVTA 3KHUA 1GV0A 4HADA 4RF3A 5G0SA 4U0KA 3G0OA 4DQXA 3HB4X 2RBEA 5KJ1A 4I9UA 4UVIA 4YT5A 3QWHA 3GMDA 4IXTA 3HE3A 3QRWA 1HL3A 3NDIA 3RU7A 3CZRA 4OXNA 1R4MB 3R3JA 2O3JA 4GSKA 3DWFA 1DLIA 3GZNB 2PGLA 4K28A 4MIEA 3ADOA 3I9OA 3C7DB 3K73O 3RWBA 4XYEA 1QKIA 1YQGA 3IUPA 4CLDA 4XKJA 1HXHA 5FEUA 3PLRA 3T7EA 4GVXA 3VKUA 1L7EA 3PZRA 1WLYA 4XRRA 3MTGA 4NJMB 1F8FA 2WWRA 4Y6RA 3C1OA 3T7CA 4AJIA 4NJOA 2PK3A 4IS2A 4CQLB 4HP8A 3C8MA 3ZWBA 1V35A 1PJBA 5DDIP 4B4VA 2O4UX 3RASA 3SJ7A 3WGQA 1LLQA 2Z1MA 2W4QA 3C1AA 3EYWA 2Y1DA 1DXYA 1ZK4A 1HYHA 1DFGA 4CR8A 2YQ4A 3GN1A 3FWNA 1KYQA 5A9SA 1NTOA 1X13A 4B7CA 2HK7A 3V2UA 2JL1A 4WOJA 3WX0A 1CETA 4A2CA 2VHWA 2NWQA 3WWZA 3GEMA 1E3WA 3NGXA 3CXRA 2PFGA 1EK5A 3AY7A 4HKTA 3EZYA 4WLNA 1SEVA 1GZ3A 2I65A 3RC9A 4EW6A 1R4NB 2G0TA 3AY3A 4DQVA 5H81A 3X2EA 3NV9A 3ROPA 5CPBA 2JAPA 3TL2A 1T2FA 4ALKA 1LI4A 2A35A 4QFDA 1VL6A 2VOEA 3DAFA 3GFBA 4LRTB 3FR7A 3LDHA 3PGJA 4IMPA 4J7CA 5IZCA 2O7SA 4YTEA 2CSUA 4OO3A 4IQ8A 2D2IA 4J1QA 4RVFA 4IJVA 4UVHA 2JD1A 4GGPA 3JQDA 1SOVA 1P45A 1UAGA 2ZQZA 3U5TA 4TRNA 3NJ8A 5JS6A 1XWFA 5JC1A 4ND5A 2R00C 4NBVA 1IZ0A 3T4XA 4NDNE 4W9NC 4WNCA 4IZIA 3SEFA 1SBYA 4CLHA 3OECA 1E1MA 4R1UA 1T24A 3KO8A 1BDMA 3AFNA 4FBGA 4GLLA 4B7UA 3IAHA 3AWDA 2VTDA 4I08A 2VWQA 4WASA 4CM4B 3SVTA 5JYDA 1YL7A 2O3SA 3UAGA 3U9LA 5I8ZA 2HMTA 2EJWA 3ZW9A 3DZJA 3C7AA 3F3SA 1GPJA 4KOAA 3JD3A 4CQMA 4YQYA 3HB5X 2I99A 4YJDA 1TLTA 5DCWA 5HWSA 2YJZA 4NK4A 1ZXBA 3I6IA 5KIAA 1E7MA 4DMLA 1BRMA 2AE1A 1FDUA 2AE2A 2PZMA 1CIVA 3PJDA 1DIAA 2IYOA 2DFVA 4FIZA 2OL4A 1CDOA 2D8AA 1LXCA 4RVUA 1OOEA 3RIHA 4KWHA 1A72A 3OJEA 5HS6A 1ZKMA 1AXEA 3FCOA 2NQTA 4RF4A 3OJ0A 4MVJE 3B1KA 5EN4A 3F4BA 1Z74A 2ZYGA 5KJCA 1NVTA 2IXBA 3NT4A 4A0SA 1I33A 1DC3A 1DIGA 4C7JA 3V8BA 3W8FA 1OFGA 3R6DA 4CJXA 3GR6A 5KTKA 4BO0A 3INGA 3ZWVA 4R51A 2AQ8A 2X8LA 5G0VA 2BGMA 4BO2A 4XWYA 3ANNA 3EMKA 4HNGA 3A4VA 4O63O 4ZN6A 3ASUA 5IF3A 3OICA 1PJLA 2EW8A 4GWGA 1T2DA 2FSVA 4J4HA 1WP4A 3U49A 8LDHA 1BVRA 1RYEA 3D0OA 3K5PA 3OHSX 2EKQA 4EUEA 4R1TA 5JCJD 2PGJA 3D1LA 4BO9A 2P4QA 3ZNPA 2J3JA 1Q2XA 1LEHA 3VKVA 1IPEA 4PG8A 1E6EA 3ASVA 4FB5A 3RUEA 1XG5A 4CMIB 2I67A 4IDGA 5IAAA 1JU9A 1U2GA 3D3WA 4OQYA 3JQ8B 1Q0LA 1SB8A 2B4TO 1HE5A 2XAAA 4BNGA 3TJRA 4HV4A 5DULA 4PN3A 2FR1A 5ITWA 3PIIA 5T8KA 5CPFA 4YRBA 2QZ9A 3PTZA 1JA9A 2IZZA 2YW9A 3H8VA 3NT5A 3NTQA 1X7HA 3FNHA 2HK9A 1RM3A 4TROA 2X5KO 3H2ZA 5CDSA 4NNJA 1NNUA 3CMCO 3H5NA 4YEDA 2GLXA 2FPGA 2B5WA 1U3VA 4NI5A 3U4CA 1TT5A 4LN1A 2BI7A 2TMDA 5KKCA 4LISA 3L0DA 3W4IA 1TA4A 4YYZA 1UZLA 3VPGA 3DBRB 3FRJA 1ZCJA 4NIMA 2VHVA 4ZGWA 5I7FA 3S1LA 2DKNA 2QX7A 5IZ4A 3OQ6A 5JSFA 3E48A 3H7AA 4Q3CA 3WS7A 2O48X 4IDEA 1YB1A 2G17A 2RHRA 1E7YA 1ONPA 1VM6A 4IM7A 3KOUA 1LJ8A 2DC1A 4FFPA 1V6AA 3FD8A 2H63A 5L7WA 5FFFA 1YB5A 5KVQA 4EJ6A 2D0IA 4NBUA 2DFDA 1R0SA 4YRDA 3NDRA 3RUCA 1Y8QA 3NJ4A 4PVDA 4CLOB 2Q1SA 1E77A 1C14A 1DJNA 3GUYA 5I7EA 3NT2A 3OFSA 4BO8A 3KEQA 1HZJA 2JKVA 3GRPA 3GF4A 1QSGA 2Z95A 5TJHA 4G81A 4IDCA 1TEHA 3GDGA 3DBHB 1DFHA 1E1NA 4E6PA 2E4AA 5JAQA 2YY7A 1O95A 4NMHA 3D4NA 1VKNA 3ZWWA 3ONEA 5KCZA 3DZKA 3I9KA 3ZU5A 1G0NA 3PQFA 1RM4A 2VTEA 4PG4A 4IZHA 4BNKA 2EG9A 2Q49A 1ISJA 4GX5A 1YDWA 2GERA 1C1DB 3L6OO 3ABIA 3IIEA 4OXYA 4M86A 1BDBA 3NKLA 3VOSA 3I4FA 1U2DA 4KZPA 1B14A 4J9VA 3U4HA 1N7GA 1NQ5A 1PEDA 4RVHA 2DTXA 3ZWCA 1LLDA 1P1RA 3WLEA 3E6AA 1XLTA 4NR0A 3VAZA 5B4TA 4MVJM 3DL2A 4WLOA 4CMEA 4ZVVA 4YJHA 3HQ4O 3JQGA 4Q3BA 4YWJA 4ZA2A 2I6TA 1B8PA 4ZU3A 4QEDA 4MINA 2EERA 4EDFA 4AJLA 5F5LA 2Y66A 4ND1A 4FJ2A 3PJFA 4RPGA 3JQ7B 4RDHA 5A9SB 4I9HA 1WW8A 1PZHA 3H2SA 5C5IA 1G0OA 3GRKA 2DBRA 3INRA 5L7YA 4JP2A 5JPIA 1BGVA 4DBZA 3U4IA 3ZU3A 1WXDA 3VPHA 1T2AA 3ZWAA 4GVLA 2X0RA 1A5ZA 2QG4A 3DTTA 1EMDA 5FI5A 3BAZA 3QW2A 1LUAA 3O03A 1YBAA 2X0JA 4NFSA 9LDBA 1IOLA 1X7GA 3PHJA 4D0SA 3RJ9A 5LDGA 1A9YA 2AQKA 2VNAA 2YDYA 4IXWA 4BO6A 3LLVA 2CF6A 2YV3A 4FOSA 2VWGA 2BF7A 2HJSA 1XU7A 3A28A 5FF9A 1QXSA 3K2EA 2DUUA 4ID9A 2QRJA 3WGYA 1HYEA 2AXQA 3O8QB 5TGDA 3T4EA 1PZEA 4FJ1A 2P9EA 1JKIA 3S2GA 1VL0A 4M87A 2P5YA 2RIRA 4AJ1A 2GCGA 3G3EA 2EEZA 2GSDA 1LQTA 1PGPA 1HDYA 1GUYA 1GPDG 4HY3A 1H93A 2BFAA 2VQ3A 1F14A 1KETA 3GEGA 4QX6A 3F1LA 3KYBA 3EGOA 2G5CA 2HMSA 3AI1A 2RH8A 1MP0A 3V2GA 3AY6A 1SOWA 5JDCC 3K8ZA 2AMFA 2DPGA 3LC2O 1JKFA 3QVOA 2EKLA 2H9IA 1YJ8A 4J9UE 1IHXA 4CQMB 3FPLA 4A73A 4W6ZA 2FSSA 1WZIA 2IRWA 4PIVA 2DBVO 5IXSA 1ZW1A 3BTVA 4YRAA 4O59O 1EQUA 1YGYA 3OH8A 3Q0EA 3FI9A 4NZ9A 3HN7A 2HRBA 5C7OO 5I7VA 3IQDB 1W8DA 3KUXA 1H0KA 3PHLA 1QV6A 4TZTA 4ZQGA 5DP2A 3RBZA 4BHTA 3LK7A 4UUPA 2NSDA 3Q6IA 3HWRA 2OBNA 1S6YA 4EEXA 4JP3A 2Q4BA 1T4DA 1PJSA 1XDWA 4J4TA 1T1RA 4BQPA 4CLRA 1Z7BA 4WK6A 5ER6A 2IE0A 3WGIA 3U09A 1VPDA 2GZ2A 4EYEA 1IUKA 1P9LA 3KM0A 3WJAA 1W73A 5A3JA 5THKA 3ZN2A 1T2CA 1KBZA 4J2OA 1M76A 3ICCA 4OSPA 4BNHA 4YAIA 2I76A 2JJYA 2C2YA 3EY4A 2GN8A 3KYCA 2ZJ1A 2I3GA 5JLAA 3OIDA 4ALNA 4UUOA 3STHA 1HDZA 2GRAA 4FJ0A 3KYDB 4XX0A 1R0LA 3KSDO 3A1NA 3S8MA 1HYGA 1YDEA 4DREA 1SB9A 4GH5A 3VZPA 3GVHA 1AHIA 3E18A 1E3JA 1E6WA 1KY5A 1NFQA 3ZWPA 3HFSA 4CL8A 2EWMA 1ONNA 2C0CA 3WNQA 3ZCXA 1Z45A 3PJGA 2NQ8A 1PL7A 1DJQA 4J4BA 3EDMA 2NTVA 3QHAA 5B4UA 4LRSB 1A27A 1T4BA 2Q45A 1LU9A 3RC7A 2OXIA 3TNLA 1SEPA 4GKBA 4XDYA 2W8ZA 2XXJA 4JNKA 1T2EA 1LSOA 2HK8A 3VPSA 4E2YA 3ZHXA 3JSAA 4TRRA 3QWBA 3PZBA 1PS8A 2AW5A 3IP1A 4YBZA 1UZNA 5LDHA 2VYVA 1ZEJA 5AYVA 1B7GO 2P2SA 1E7SA 4TZKA 4LMRA 3K2BA 2WD7B 1TT5B 1XA0A 2ZK7A 1V3VA 4MKXA 4BNLA 3HG7A 1HE4A 3WYEA 1PQPA 3I9NA 4L4RA 1KIFA 4MOWA 5GY7A 1YJQA 2RCYA 4ITUA 1IHYA 1NYTA 1PZFA 2ZQYA 4XQGA 3W6UA 4WJZA 4ND3A 1GADO 4YT2A 3QY9A 1N2SA 1BHSA 1H6BA 1WZEA 3OQ1A 2CDBA 2E48A 5CP8A 1LTHR 3BA1A 2OFPA 1Q7CA 5I8WA 1ZBQA 1Q0QA 2ZCUA 1VJTA 1E92A 5GZ3A 3VC7A 3E8XA 1QORA 1PJ2A 1VSUA 4D41A 4J91A 1HDXA 1EE9A 1KVSA 1Y8QB 2CY0A 4GAEA 3L4BA 3NX4A 4N5MA 3WOHA 3DBLA 1R0KA 3GQVA 4BNTA 1R66A 8ADHA 2Y68A 1HWYA 2GZ3A 2OZPA 2WJPA 2ZCVA 3BMOA 4BNIA 1EVYA 4WGGA 4ALIA 4DC0A 5JMWA 4IJUA 2X1HA 3C1TA 1VL8A 4FOOA 2PWZA 2HQ1A 3ZH2A 3RFVA 4HNHA 3DFUA 4H15A 1NASA 3WMWA 1VJ0A 3F6YA 2VUUA 1EE2A 2WM3A 3TFOA 1EK6A 4R9RA 2RHCA 3BMCB 4OAQA 1H6AA 3DXFA 2WDZA 3EUWA 1VSVA 5K0ZA 4AJKA 3HFGA 5T8KC 5T6BA 4WLVA 3PVZA 1RPNA 1E3LA 3TZQA 4KQXA 3LC1O 1EBFA 1K89A 4CUJA 2VRBA 4YJFA 3FNEA 4J7XA 4BGVA 5A02A 3RQSA 3TQHA 4B4OA 1R37A 1UR5A 4I8XA 2FN7A 5CG2A 1LRKA 1BW9A 3NUGA 1HEUA 3EVNA 3GNQA 3PYMA 4ROSA 4U5QA 3TWOA 4CV0A 1HRDA 4D3DA 2VRCA 1OC4A 1ENZA 1GV1A 2O4CA 4RLHA 3C3XA 1V8BA 2AA3A 3FN4A 2AG5A 4FFLA 3JQGB 1M67A 4D46A 5IDQA 2YFHA 3PGXA 1SO8A 2J5KA 4RGBA 4U7WA 4DQUA 4MVJG 1ULSA 1CRWG 3BYZA 4TWRA 3DMYA 2DUWA 4FDAA 5BSEA 4NH4A 1KEUA 4P4GA 4PRLA 1FDTA 4E12A 2OOSA 1ENOA 4R41A 1ISIA 1LBEA 3WIDA 3NTOA 3BMQA 5COQA 2VYNA 4QO7A 4MP6A 2QHXA 4BVAA 3UUWA 3QWIA 3BTUA 2QRKA 5COAA 3RBXA 4IS3A 3N58A 1CQJA 4UEJA 4YCAA 3GOHA 4E13A 3ONFA 3GFGA 3NEPX 1PJQA 1GYRA 1ZVMA 4R01A 5HM8A 1B3BA 2HDHA 2O3UA 4RL6A 3DZGA 5F5NA 3LT4A 5A04A 3H5RA 4D45A 3UCXA 4B79A 2C5EA 1KOLA 3GH3A 5A3VA 4QQRA 3ZV5A 2W2LA 2CFCA 2D5AA 2GASA 1D4FA 1DHRA 3VH4A 1QMGA 4ALMA 2P9CA 3JQ9A 4GSLA 3WGZA 4DPMA 3P5SA 2PH5A 1WMAA 4GMFA 1QG6A 2ET6A 4PLGA 3O4RA 1H5QA 2B4RO 5ILGA 4CQMD 1XGKA 3B1JA 2DBQA 5AXAA 3DHYA 3F9IA 1YVEI 4JJGA 2H1SA 1ISGA 3HDYA 3QVXA 3O9ZA 1B15A 4FFMA 4P4LA 2ZB7A 1TXGA 1PR3A 2IDZA 3V1YA 1ADCA 4FFNA 5L95A 1AUPA 1GQYA 3ZNQA 4U6SA 1YOVB 2AHRA 2O3TA 5AOVA 3UGKA 2PKRA 4II2A 1ARZA 4GI2A 4O1MA 2VN8A 5JE8A 3HDJA 4A27A 4IUYA 1QYCA 2Y99A 4RPJA 2B37A 2HMUA 2EGGA 2ZB8A 4UVEA 2VT3A 3ZHYA 2GDZA 5G0WA 4E21A 4IINA 1OBFO 4BNMA 1O89A 5JDIA 1P0FA 2GPTA 2J5QA 5L51A 3PP8A 3ZU4A 3DTYA 3CKYA 1R16A 3CE6A 4ALJA 1LDYA 5G4KA 1L7DA 3PIDA 5B37A 2D59A 2PKQO 3CSDA 1MX3A 1A7AA 3FNFA 5CAEA 2P91A 3LT2A 3MOIA 2AEMA 4MJLA 1P1IA 3ROQA 3ZGYA 1UUFA 3EAGA 5TT1A 1GQ2A 5A03A 2X0IA 1EVJA 4N5NA 1MXHA 2O7QA 2BRUA 5JY1A 1CF2O 2Q99A 1E7QA 3JD0A 2C54A 3FBTA 3GLQA 3NDJA 2EXXA 3SXPA 2HMWA 4Z9YA 1IB6A 1P0CA 4KUHA 3RUHA 5IFLA 2Q4EA 3WLFA 2ZTVA 1JN0A 4LSWA 3BMNB 4ESOA 1ZJYA 1NXQA 5JAIA 1N8KA 1FDSA 1UXHA 2CVZA 1LC0A 3JQFC 4HUJA 5AVOA 3GUCA 2QRLA 3E5RA 4C7KA 2OGUA 2J5RA 5IN4A 2E6UX 4H3VA 5TX7A 4QUKA 4K26A 1LDMA 3NTRA 3ONDA 2X9NA 5MDHA 2GGSA 4FC7A 3PYXA 2X9VA 1F12A 4CMHA 1WWKA 1E0DA 4IGEA 4XYMA 3OMLA 3DOCA 1I3LA 3LYLA 2C82A 1J5PA 1JWAB 5L4LA 2JCVA 3P7MA 3MJVA 5G2OA 2F1KA 1GZ4A 1T1SA 3PWKA 3AUTA 1SMKA 1W6UA 4YVFA 3ROKA 5L9AA 5EERA 1A7KA 3A14A 2ZYAA 4ND2A 4BIIA 4RF2A 3IL2A 4PLTA 1YXMA 1NQTA 3V1UA 3U3XA 2POQX 1I0ZA 3ITDA 3JYOA 4II3A 4J2HA 3WWYA 2AQHA 4FGWA 5DBGA 3JD2A 4D42A 2C20A 3OP4A 4B4WA 4J49A 4BO1A 5CDGA 2C07A 4PLCA 1HSOA 5AXDA 3WTCA 4IDDA 4BKPA 4R16A 5TQVA 4U8GA 2YHIB 3PDUA 2Y0EA 4Z0HO 1D1TA 4IY1A 4Q3EA 4CMAA 5L53A 3HDQA 3PFFA 3WGGA 1X14A 4GWKA 3HUDA 2HAEA 2QYTA 3CZMA 1HSZA 1I3NA 5CG1A 2X5JO 2OUIA 2AQIA 1V3TA 1GZ6A 4LW8A 4LMPA 1DRUA 1RJWA 4FC6A 4A26A 3AUAA 3PHIA 4PLYA 1TB4A 2ZKLA 1Y1PA 3EHEA 5LC1A 3D5QA 4CM1A 4YAKA 5J23A 3LZ6A 3P19A 4CM9A 3PXXA 4MPDA 1HDGO 4IDAA 1NQAO 4XGNA 5H82A 1BXGA 1I2ZA 2LDBA 3SX2A 2BFPA 1CERA 4XB1A 4DL9A 4OM8A 2IEDA 1LQUA 1U3UA 4PFJA 1UDBA 3R0IA 4JN6B 3PPIA 3C7CB 2VUSA 4HFNA 1HDRA 2B83A 2JCXA 2NNLD 3DB2A 4IQ0A 2NVUB 1UAYA 4D0RA 4DPLA 1Y9AA 2UVDA 4Y6SA 3GZ4A 3U4DA 3UKOA 2DVMA 1N92A 4XR9A 3TRIA 1MB4A 4PLWA 4QFCA 2HRZA 1FMCA 5H83A 1Y6JA 4PGFA 1GCUA 1ISHA 4PCVA 1R15A 2GO1A 1UDAA 3L77A 5JO9A 2ZTLA 3ZWNA 1RKXA 2X0NA 3WMXA 2BFMA 1HDOA 4EZBA 1I2BA 2E49A 4Z6KA 5C3MA 4CMKA 2Y0DA 3UCEA 1EFKA 1M2WA 2Z5LA 3WBBA 2QQ5A 2DT5A 4EUFA 2YV2A 2X86A 1C0KA 1KVRA 3S2EA 3RUFA 2X22A 1NFRA 4BKOA 2I5PO 1IPFA 3ZHZA 4J3FA 1MA0A 1K6IA 1H9AA 4X54A 4Z9FA 2A92A 3IDSA 3MTJA 4DBVO 3WFIA 1ZEMA 5JNLA 1M6HA 1OZAA 3AW9A 4O0LA 1DIBA 3KTDA 4WLFA 4DA9A 2Q50A 5I9MA 3PHHA 1ADGA 3RI3A 2D5CA 1P33A 4BNNA 4ALLA 4L76A 4BNXA 1PGOA 2VUTA 4H7PA 2BH9A 2Y0CA 5JMPA 3I1JA 3G49A 2BKAA 3ENKA 3IKTA 4CM6A 4AVYA 4KP7A 4I5DA 4GLOA 3ZWMA 4MKZA 1Y8RB 3JD1A 3O38A 1YL5A 4J1TA 3PYLA 4Q3NA 4OH1A 5K6AA 4ZD6A 4ZHSA 4RDIA 4TRMA 5DOVA 3JQBC 4XB2A 1YQXA 3HNPA 3JYQA 4ONEA 4RV9A 5BNIA 2YYYA 4F6CA 4ZJUA 1CEQA 1GUZA 1QYXA 2V6GA 4ZQEA 2DAPA 4BMSA 1WVGA 3WJ7A 1ZMTA 4OOEA 4L73A 1NR7A 5F1OA 3H9JA 4JBHA 1XYGA 4W4TA 5HS4A 3QVSA 5HRUA 5JAZA 1GFSA 2DM6A 3I52A 4F45A 2PZLA 3LQFA 3DBVO 1DLJA 1O8CA 3ULKA 4YJGA 3HHPA 3ETDA 4Y8VA 4WKGA 4BNFA 4IJWA 3RUIA 1U9JA 3AK4A 1QLHA 1W4ZA 4M89A 5JCJA 4PLPA 2NTJA 2P9GA 2C7VA 3W1VA 1KEPA 3VZSA 3MWEB 3WQRA 1O6ZA 1UXJA 3DR3A 4EI2A 1EDOA 4L74A 2UAGA 4Z3DA 4CM7A 4L75A 5DF1A 4DIBA 2Y67A 2A94A 3RUDA 3ZV4A 3WXBA 1P77A 1U5CA 3AJRA 1CQIA 4INAA 1H2HA 4DXHA 2NV6A 2D1YA 4PRKA 2GYYA 2C5AA 4WE3A 2VWPA 2FZWA 2PD4A 4GBJA 4FGSA 5ADHA 4LK3A 3JQ6A 4CM5A 2VT2A 1YS4A 1JAXA 1RM0A 1ONOA 5BR7A 5GZ1A 1E3WB 1N5DA 3PQDA 4AJJA 2WE8A 4J43A 5ILOA 4LVCA 1BXZA 2VWHA 2HKIA 4WNIA 5DP1A 3IMFA 1E6UA 4KTVE 4CUZA 1N1GA 2XF8A 3ETEA 5THQA 4UUNA 2B0JA 3FBGA 1ZIDA 4KQWA 2HO5A 2J3HA 1NP3A 1I3KA 2VHXA 2BFOA 3EW7A 4U6QA 3I9MA 4DMMA 5T57A 3Q11A 1GQQA 1N9GA 2IYPA 1XIVA 2JCYA 4TMFA 5B1YA 4J0EA 5F21A 3JD4A 1N1EA 1E3IA 4W7IA 1I01A 2NLOA 3KVOA 4MVJI 2Q3EA 1DAOA 1LC3A 2OHXA 4TVOA 1E3SA 1DPGA 1LDEA 3DDNA 2PZJA 3K6JA 4HBGA 2NM0A 1SPXA 1H9BA 4EEZA 4JJIA 4FSHA 4GMGA 2V6MA 4RCVA 3Q9UA 1KVQA 2BGLA 4NBRA 4S3MA 4OHUA 3JYNA 3I23A 4CODB 2FOIA 3PFWO 1ZUD1 4W9NA 5TS3A 4ZRMA 2HUNA 3L6DA 4WCDA 1U8XX 1JDJA 4Z0TA 4E31A 4F46A 1EDZA 2V6BA 2IZ0A 1UXGA 3PDJA 3GZNA 4XIJA 2W98A 3F46A 3F5QA 3AOGA 3RU9A 2IEBA 3W4JA 2ILTA 3RROA 1LX6A 1XEAA 1J6UA 4Q3AA 4EGFA 3Q3CA 1P1HA 3Q1LA 1VI2A 3VDQA 4TKMA 5JO0A 4NJMA 3HSKA 1MGOA 2O2SA 2R2GA 5JDIC 3RBVA 5A9RA 1U3TA 2Y1CA 4CQLA 5KVCA 3ON5A 1EEHA 4GX2A 4IGFA 5DNAA 4AJOA 1EQ2A 4CM8A 3GPIA 3H4VA 1QYWA 3KBOA 1Y5MA 3UW3A 1B8VA 2HCTA 1P1FA 5HTOA 4JK3A 4GL4A 5JW6A 3DO5A 5JAMA 1XSEA 1UXKA 3OF2A 4E30A 4R54A 1KS9A 4E2XA 4KUGA 4BGEA 1N7HA 4B8WA 5IDWA 2OORA 4GGOA 4MVJP 4PG5A 1M75A 3EK2A 4PLZA 4I5GA 2D3TA 1DC5A 4JXKA 4D79A 5IZCC 2PA3A 2C59A 1Y9EA 1V3UA 2PH3A 2H5LA 5CEFA 4UEOA 1YE3A 1HT0A 2DTDA 5L7TA 1J4AA 3GVPA 4XGKA 2Y05A 1R4NA 3TZCA 4MVJD 3ANMA 1UP4A 2A9FA 4CM3A 2JFHA 2PV7A 3LT0A 4BKQA 1PL6A 2X6TA 1ADFA 3D3WB 1B2LA 4UAGA 4PZCA 4B7XA 3PRJA 2HJRA 5ITVA 2E37A 3X2FA 1HF3A 3TZHA 3ZU2A 3I9JA 1LSUA 4ND4A 4KTTE 4DRYA 2YHUA 3U0BA 3JQAA 4BNWA 4Q9NA 4HFRA 2BMAA 5TRTA 1U7TA 3DQPA 1EZ4A 2F00A 4XGIA 2VRCD 4ZQFA 1E1KA 3LF1A 4A7PA 2CNBA 4BO4A 2NU9A 3DZHA 4L0QA 3AI3A 1DHTA 1FJHA 4CM4A 1PGJA 1UP7A 3PWSA 3VH2A 4BGUA 3EZLA 1PU2A 3OJOA 2ZATA 3RC1A 2J3IA 3SBOA 2NADA 1PJCA 1A71A 2Y1GA 1TT7A 3OSUA 3V2HA 4HFJA 4DLLA 3P2YA 4AJHA 3GVXA 1NQOA 3E1KA 4CMGA 3WYCA 2FY8A 2O2YA 3TZKA 2ZB3A 3F5SA 1U7HA 2VYND 3R1IA 1XU9A 1X1TA 4GKVA 4F6LA 3W4KA 5B12A 1OI7A 1ZK2A 4R3NA 1SC6A 3RCBA 5KWEA 3AM3A 1DO8A 1D7OA 2IZ1A 3PI7A 1RWBA 3L07A 3DZIA 4N54A 3N7UA 7ADHA 4WLUA 2DTEA 1JWBB 3GT0A 1NWHA 5JBIA 4WECA 3LSYA 5DOZA 2GNAA 2BELA 2O23A 1Z6ZA 1GR0A 5U9CA 2W2KA 1P1JA 3O26A 4XD2A 2HLPA 4CPDA 1ENPA 2PLAA 3MJSA 4BMNA 3N74A 3CMMA 1LLCA 5L4SA 5JCXA 5BSHA 2OBYA 4YR9A 3KSUA 4BNZA 1GEGA 1U28A 2C29D 3HJAA 4IMRA 1GDHA 4TKLA 5A9TA 3GVCA 4GPD1 3AUUA 4DUPA 5IDXA 3ZHBA 5A4DA 4DLBA 1MFPA 3UCFA 1F06A 5C7IO 2JFFA 5TC4A 4NQZA 2NU6A 4RO0A 5BQFA 1NPTO 3INTA 2VZ8A 2WEKA 1Q1NA 3K30A 5A06A 3GPDG 4MKRA 1GU7A 1B16A 2CF5A 2VZ0A 1E5QA 5LCXA 1P44A 3IJPA 3GDFA 1F8GA 4WCFA 5DZSA 4RVGA 4BV8A 3ZI0A 3RC2A 1NVMB 2DQ4A 5HA5A 2CVQA 3CH6A 1L1FA 1X1EA 4CMIA 3OA2A 5BNTA 4YT8A 2DPHA 1UZMA 3GEDA 3JQ8A 3F47A 3RUAA 1EVIA 3BHMA 4XDZA 3M1LA 3CEAA 3DAGA 5CDYA 1ADBA 4OSOA 3DFZA 2WYUA 1JLLA 4YAGA 1C0IA 1GYPA 4XJSA 4YJHB 3DC2A 4PLHA 2HU2A 2WTBA 1ZZEA 3FTPA 1PJ3A 4URFA 4FS3A 1VE9A 1IE3A 1Q0HA 3WBFA 4E5KA 1K2WA 2GR9A 5DCYA 5JXWA 4RPLA 3VVBA 1MLDA 5COBA 1UH5A 1DEHA 1ZH8A 3NRCA 2VHZA 1BMDA 4R1NA 2GN9A 4Y9DA 4Q39A 3Q9NA 1ENYA 1NWCA 1X15A 3DBRA 3I83A 3LLSA 4QECA 4TQGA 3VH1A 4BNVA 2GZ1A 1V9LA 4FFRA 1UXIA 4E5PA 2SCUA 5U1PA 3TN7A 5JY6A 2B4QA 4JJFA 3OIFA 3SC6A 3RFTA 1WAMA 1KERA 1ISMA 2YFQA 1K5HA 2G76A 5AXCA 3WICA 4A10A 5DCUA 3RAJA 1KEVA 5CDTA 3GNTA 4BNUA 2EJVA 3OEWA 1D1SA 1MG0A 2I9PA 5TJ9A 4N18A 3VZRA 1U1IA 5A05A 5MGBA 4CUKA 3LU1A 5EESA 4KDEA 1ZMOA 3RJ5A 4BMVA 4OQZA 5AXBA 4AJ4A 4W82A 2O3RA 5FWNA 4EUHA 1P1KA 4CLOA 1DRWA 1PL8A 3KETA 3JYPA 4I1IA 1F17A 4IIVA 4OYRA 2BHLA 4BOYA 4P22A 3ZZNA 2UUPA 4O5OA 2B69A 4CMCA 2I3AA 3JV7A 3DHNA 3OM9A 3GC6A 1DSSG 1YH3A 2I66A 1YBMA 4I9NA 3TFQA 1I24A 2LDXA 4WEOA 4A5OA 7MDHA 2H6EA 3H5AA 1DC4A 2FR0A 3CINA 3TL3A 5BSGA 2UV8A 1NM5A 2J3KA 1XR3A 1R6DA 4YQZA 2NACA 4NK5A 3TOXA 4OKIA 5CEEA 3ANLA 5B4VA 5TSDA 4HFMA 3D5TA 1C1DA 1LRJA 4CMEC 5JDCA 1I32A 2ZIZA 2OMEA 3I6QA 4NFYA 3UH1A 5I7SA 6LDHA 1Y7TA 1UDCA 4UEKA 1D3AA 2Q2VA 3WGOA 5F1KA 4DIFA 5F1PA 2PY6A 2QYSA 1GEEA 2JHFA 3GMSA 2VOJA 1QR6A 3AM4A 4M1QA 4CLRB 2FHSA 3QIVA 3L9WA 4K9DA 1MV8A 3IUSA 3MJ4A 4G65A 4P38A 4AFNA 3KLMX 4UREA 3KZVA 4Z3KA 2J6IA 4ZRNA 5BSFA 4JLWA 2QIOA 2TMGA 2WMDA 4CM8B 3AOEA 3C24A 1C1XA 1DAPA 1SAYA 3JQ7A 2X58A 3CUKA 1YQDA 2EP5A 3OEYA 1M6WA 4JBGA 5U4QA 4CM9D 2Y1FA 3AFMA 4UULA 3KYCB 1T25A 1IZ9A 1Z82A 3LC7O 4J16A 4RF5A 1HE2A 2JFGA 2PKQP 4RVSA 1FK8A 5EL0A 3G17A 5TF4A 3VDRA 1B26A 1DFIA 3TZ6A 5JFOA 4IIUA 2B5VA 3S2FA 3ZNNA 5IJZA 2XPCA 3PEFA 1PQWA 1ZSVA 2ZJ0A 1PIWA 1LA2A 2FP4A 4B3IA 4RQUA 1PX0A 3QP9A 1UP6A 1U4SA 1ID1A 1X0XA 3VPFA 5ES3A 3G79A 4DPKA 2AEFA 3DAPA 3I4CA 4CV1A 1NVGA 1JAYA 3DOJA 3BHIA 4OGWA 3GGPA 3O8QA 4DIOA 4XQ9A 4FCCA 5L45A 2YUTA 1U3WA 1U4OA 3JQAB 3M2TA 1YL6A 2NVWA 1G1AA 1XKQA 3DOOA 3ZDFA 1K3TA 3ZWXA 4XRGA 2CZCA 1PR9A 2XOXA 3V1TC 3DZBA 3CIFA 3D7LA 3R3SA 4TRJA 1DC6A 5A1TA 1Y81A 1KY4A 4NHEA 2DU8A 1SNYA 2WSBA 3E03A 4E5YA 2ZTUA 5DN9A 1Q7GA 4OOFA 5IXYA 4R68A 3DMTA 2RAFA 3AU8A 3HDHA 3H3FA 1H2BA 3VHRA 4N7RA 1A9ZA 1W0CA 2JD0A 1IYZA 1Z75A 1HETA 2X23A 3GY0A 4J1SA 3L9XA 1U8FO 4YACA 3RSHA 3BTOA 5GMOA 1K6JA 4CL3A 1JQBA 4MP8A 1E7WA 2UUOA 1ZFNA 3ZV3A 4B3HA 1WDLA 4CMJA 4AJEA 2A4KA 2GN6A 3D4PA 5KJEA 4IDBA 1MFZA 3IJRA 2E82A 2NUAA 1YKFA 3ETGA 1NPYA 4QT0A 1TI7A 3FR8A 3DBLB 5IDYA 2WD8A 4BO7A 1X7DA 5CFZA 1NX6A 1SCUA 2W2KB 1HZZA 3MJTA 2BD0A 2QW8A 3VH3A 1GD1O 4FN4A 3BMOB 4Y6PA 1S7CA 1BXKA 3GGGA 2AG8A 3QQPA 4BQRA 1A4IA 2JHGA 3WNVA 2Q2WA 1MG5A 3NAQA 5DBFA 1P74A 3K31A 5T67A 3WGTA 3K96A 1NPDA 1VC2A 5CEJA 1LLUA 3GK3A 3I3OA 3SLGA 4YAEA 4AICA 3GG9A 4RZHA 3KYDA 3SC4A 1XQ1A 2X5OA 3UHAA 1A4UA 4FFOA 4CV2A 1TVEA 3WYBA 1EVZA 4MVJH 4NG5A 4DC1A 4WCFB 5KJ6A 1YONA 4YJFB 4LCEA 1DB3A 4OJNA 1EUCA 2CDAA 4F3YA 1MXFA 1M66A 2PD6A 3M2PA 1BW9B 1QP8A 3UICA 4XA8A 3ICPA 4H16A 5EINA 3LT1A 1PZGA 1LDNA 4XJTA 3ROMA 4L4XA 1DBVO 1QYDA 3H3JA 2EP7A 2B36A 4HWKA 1EBUA 2DLDA 2P4HX 3ORFA 4QXMA 4RLSA 4MIOA 5T5QA 3V5NA 5L4NA 5C7LO 3LF2A 3PJEA 1I5RA 4B3JA 3WG9A 4HX5A 3FPCA 1WDMA 1B8UA 4E3ZA 3HN2A 3DONA 3QJ5A 4FR5A 1DOHA 1E3EA 2EHDA 4ILKA 4R4JA 1ZXLA 5I9LA 1K0UA 2WD7A 3VVCA 4YT4A 1H94A 1YWGO 3M1AA 1B3RA 1DIRA 3IOYA 3ZNOA 1GYQA 1O9BA 2Q1UA 3BMQB 4FD3A 1NBOA 4DVJA 3MCVA 4WPGA 4XR4A 1AE1A 4K6FA 3WSWA 1EFLA 1PWZA 2V6FA 1KC3A 3ITKA 3L4BC 1C0PA 3KRTA 2WE7A 5CHEA 4ZQHA 4E5MA 3K9QO 4JROA 5EPOA 4LVUA 3VPXA 4E0BA 2PR2A 4RQTA 4OXKA 1PS0A 4MVJF 3MOGA 4CMBA 1KC1A 5AQ1A 3I5MA 3ZV6A 3E9QA 4FW8A 1NFFA 1ZK1A 1FXSA 4L4SA 3WQQA 4MDHA 3PK0A 1MC4A 2WYVA 2C7GA 4L9RA 1ZSYA 2R6JA 4PZDA 4NU6A 4PVCA 3H9QA 5TT0A 1ISFA 4DGSA 4E5NA 1XHLA 1P3DA 4RPHA 4PG6A 3G1TA 4PZEA 5EQDA 4MO2A 3RKUA 1DIHA 1J0XO 4WCFC 4BB6A 2X7HA 2O3QA 3P2OA 1KVTA 4BKRA 1ZSNA 1LSSA 1OMOA 5G0UA 3W8EA 2V65A 4FQ8A 1EUDA 2EF1A 1GY8A 2GD1O 3IC5A 2G1UA 9LDTA 3BTSA 3I9LA 1PWXA 3BMCA 3FHLA 3QWAA 2PZKA 3JCZA 3ZWOA 3KLPX 3U62A 5IG2A 4GX1A 1PSDA 4BS9A 5FYDA 2HMVA 4WOKA 4O6VA 3OA0A 4IBOA 2Y93A 2CVOA 1C3VA 4J6FA 1J49A 1P31A 5JYEA 3S2IA 2WYWA 2FWMX 3HADA 5TNXA 4YXFA 3OJFA 2P5UA 2O50A 4E2WA 4XYLA 2EV9A 1QRRA 2FMUA 1IULA 3Q2KA 4LCJA 3GN2A 2VCYA 3TOZA 2G82A 1ZJZA 4NU5A 3QVTA 2FR8A 1MUUA 4J1NA 3TPCA 1GL3A 1T26A 4D3SA 5ER9A 3MWDB 4EJMA 1GAEO 3VTZA 4BNJA 3RVDA 5G4KB 3W8DA 1C1XB 1I8TA 4WUVA 1XCBA 3VZQA 1KEWA 1O94A 3C85A 4YB8A 4NBWA 4PLVA 3QA9A 3UOGA 2CDCA 4GX0A 4OIMA 1RYDA 4E33A 5G0TA 5KVVA 2YQ5A 2IXAA 2GUGA 2FPPA 3A06A 3E5MA 3GG2A 3RFXA 5EJ2A 4DLAA 3FSRA 1H6CA 4RPKA 1I2CA 3D64A 5EMHA 5L3ZA 4JX8A 3JQ9C 4KMSA 4U0JA 4IDFA 5FI3A 1X0VA 4IQGA 2GN4A 3GVIA 4BV9A 4CV3A 4WLEA 3OBBA 4Q3DA 2Q46A 3JQAD 4QO8A 1I36A 3QWFA 1IL0A 2XXBA 1ZK0A 2Y1OA 2VYVD 1GTMA 1ULUA 4TSKA 5HBRA 2R00A 4G5HA 4LSMA 1PJTA 1UJMA 5KVSA 1ML3A 3MJCA 2CUKA 4DTIA 3OJLA 1ORRA 2Q1WA 4BL5A 1Z7EA 1HTBA 4D3FA 4P4NA 3ZWYA 4M49A 4AG3A 1R4MA 4OMUA 2UYYA 4D7AA 3JQFA 4TVBA 4UVDA 5DT9A 3H9GA 4KDFA 4A03A 4YAJA 1O5IA 3BXXA 2PNFA 2NU7A 3F1KA 4DYDA 5CDUA 3QV1A 3VTFA 3FF4A 5KOIA 1OAAA 4E32A 4CR6A 1I3MA 4D43A 3OIGA 2BI8A 1YOVA 1CYDA 3L4SO 2EKPA 1HKUA 3MJEA 4JQCA 3IKVA 1OC2A 2IODA 2RH4A 1IY8A 1VLLA 3CTMA 2EW2A 3H6KA 5BT9A 2QZZA 1HDCA 3OQBA 3AOEC 4BKUA 1PS9A 1JTVA 1KVUA 4M54A 2P68A 5BNFA 4E2ZA 2ZTMA 4CLXA 4Y98A 4R1SA 2Q1TA 5ICSA 3QE3A 2X4GA 4GQAA 3BIOA 4R69A 2EGHA 5T64A 5L40A 4XQCA 3UN1A 1AGNA 4QSMA 1BXGB 3JQEA 1WMBA 3JQCA 4NPCA 4EBFA 4FPXA 1C0LA 3IP3A 1LRLA 3RKRA 4EITA 1Q7BA 5TLSA 2CD9A 1MC5A 3JYLA 3L6EA 5ENVA 4AJ2A 3AUSA 3E9MA 4XQEA 5F3RA 3AI2A 4RJTA 2PTGA 4WEQA 2NU8A 4JIGA 4W99A 3DEYX 1AHHA 2OP0A 3ZW8A 2C2XA 1XELA 3WB9A 3K92A 2BGKA 4YDRA 4R3WA 4CR7A 1NHGA 1QV7A 2PGDA 4KWIA 3BMNA 3KSZO 4N5LA 4S1VA 4M8SA 3B70A 2YZ7A 3QVWA 1E7RA 3AM5A 3E82A 5A5FA 1VJ1A 3NGLA 4OL9A 1LSJA 4EJ0A 3ENNA 2FPIA 2NTNA 2Q2QA 5K9ZA 4PG7A 1AXGA 5IN5A 3KB6A 3WR5A 1FF9A 5KNLA 1E5LA 1U5AA 2ZB4A 3DMTC 1XQ6A 3B20A 3BZUA 1PGQA 4RORA 4BB5A 3FTNA 4R5MA 2OP1A 4XZ3A 3BHJA 4XCVA 1YO6A 4HXYA 1JVBA 3H9EO 4Z0PA 3RD5A 4BO5A 5GZ6A 2DBZA 5A5EA 4XEHA 3MEQA 1BG6A 1H6DA 5EQFA 2AEJA 3B6ZA 5KKAA 3WIEA 1ZK3A 3GHHA 4JCOA 4Y67A 3G1UA 3IS3A 3PHGA 2VNSA 3PWZA 3QLJA 4BGIA 4BUCA 1HLDA 4IPTA 5KJFA 4CLEA 2ZYDA 3ADPA 4R5HA 2GF2A 5TIIA 4RZIA 2W2LD 1K6XA 1YRLA 2YHIA 4I5EA 3W6ZA 2JAHA 1WPQA 4K1LA 3S55A 4YA6A 2YV1A 3COSA 1GCOA 4YPOA 1JW9B 1CJCA 4C4OA 4MP3A 1LDGA 3UVEA 2CMDA 5G4LA 1B0AA 1I10A 1SZJG 1VKOA 3NYWA 4RVDA 5DBIA 4PLFA 3F4LA 3AU9A 4JGBA 3Q2IA 2EIHA 3GDOA 4XYBA 3SLKA 6ADHA 1QYVA 4B4UA 4XYGA 3WQSB 3M6IA 4E4YA 2OO5A 2UDPA 5ICMA 3WGHA 2B35A 4R9SA 4P8RA 4XIYA 3UFXA 3CPSA 5I9NA 1FDVA 3JQBA 1LDBA 1ZNQO 4YJGB 3HZZA 3GNSA 3H9UA 3PLNA 1LNQA 3PQEA 3FNGA 3WSVA 4G2NA 1GUFA 3TF5A 4AJNA 3LVFO 4LGVA 2NVUA 4MVJA 5C37A 1D8AA 1DRVA 1G6KA 1NAHA 2D4AA 2Z1NA 3WTBA 4BO3A 4B8ZA 4UUMA 5JC8A 4UVGA 3DHEA 3GGOA 3OETA 3ST7A 3KV3O 3WFJA 2BLLA 4MIYA 1PQUA 4M55A 4K6CA 1YB4A 1R12A 4AJPA 1BWSA 2W90A 1FDWA 3D4OA 3JTMA 1NHWA 2VZ9A 2FRDA 1Z73A 1DDOA 1HE3A 2Y1EA 3GAFA 1WNTA 3KEOA 4IJKA 3TSCA 4DYVA 1PGNA 1I30A 3MZ0A 3E9NA 4BNYA 2FZEA 4L8VA 4AL4A 4NBTA 3WDSA 3GAZA 3GHYA 4Z9XA 4D44A 3B1FA 1RM5A 5ENDA 1VRWA 3DZFA 1NAIA 1AN9A 4ZICA 1F0YA 3A9WA 3FWZA 1QLJA 1V0JA 2JD2A 1NR1A 1BSVA 3D3EA 3TDKA 2J8ZA 1BVUA 1O0SA 4J0FA 5K6AC 3KXDA 1N9GB 4DWVA 4J90A 1HLPA 3SJUA 1Y5RA 1BTOA 2VHYA
chains in the Genus database with same CATH superfamily
2J9GA 3DV0A 1AG9A 1VMAA 2OD7A 5K8TA 1PJ4A 5TEWA 4V1CA 2EBUA 5E7MA 1VDZA 3Q3HA 4EZIA 2QP9X 2XB2A 1IDN1 3W8NA 3N75A 5FOVA 1M5RA 4KGXA 4O33A 2NGRA 3EZFA 4OKNA 2YOHA 4EMBA 4GPTA 1ZVKA 2WIJA 3FDIA 2NVBA 2GF0A 3GA0A 5LLDA 4UCFA 2R6CA 4ZQBA 2Q62A 1BIFA 1TKBA 2WA2A 3PC4A 4ESVA 3QXJA 4Y6LA 1TKAA 4JBLA 1GGVA 3EVTA 3YASA 3GJ5A 1YNOA 1YQEA 3KKPA 4MYHA 4RD4A 1H1DA 1JAHA 3FDZB 5G0SA 3VGJA 4BMDA 2R8ZA 2RBEA 4DQXA 1CTQA 4EDHA 5KJ1A 1KMMA 2HTEA 2GJKA 3F5FA 4UVIA 3CSUA 1PBNA 4YT5A 5EQTA 3G5AA 3F5MA 3QWHA 2VDPB 3A6KA 1XZDA 1DU4A 3A3KA 3GEBA 3GMDA 3UJ9A 3R0QA 2G70A 4PBRA 1CKEA 4OX9B 1E4YA 2Q9BA 3NBMA 4M9UA 4BLRA 3L0SA 5JZ9A 2OHIA 4GSKA 3IPLA 4MIEA 3AYZB 2ICAA 3OPYB 1G7TA 3ECAA 2QJFA 3DDWA 4FWTA 1JP7A 3G13A 2ZSKA 2JLZA 1IZZA 1PT5A 1VG0B 4XYEA 1QKIA 1E58A 3CN7A 3IUPA 4LIPD 4CLDA 1T36B 4G5GA 1B42A 2IF0A 4EHKA 5CVJA 3CUYA 3VKUA 4Q3OA 2HHJA 1L7EA 3PZRA 4RL4A 3HK2A 4XRRA 1A8UA 1T2UA 2L2QA 4NJMB 4C7VA 4AJIA 4I81A 3RO7A 2Z83A 1KBOA 2PK3A 2Y27A 2ZYTX 3MGAA 1X9HA 4IS2A 4B2PA 5HXAA 3C8MA 4F4CA 3L0CA 3BWCA 3HLTA 5TQ0B 2P9BA 6REQB 3RKSA 4XPZA 2C04A 3C1AA 1FL9A 1SWWA 1DXYA 4FDTA 4KXUA 3GLHB 3UANA 2YQ4A 4CR8A 4RE5A 3NIWA 3VFDA 2PV0A 2YINC 1JKMA 3E3NA 1D0SA 4R40A 1AZSC 4OQXA 5EWLB 2Q3DA 5A9SA 1WHSB 3CLSC 4G23A 3PGKA 4IDHA 3CLUC 3UT6A 1UJ2A 3VI3B 3WX0A 4A2CA 4M21A 3HPRA 4HEQA 5CXSA 3GCXA 1XZEA 2IGTA 1FMFA 5CCEA 4X94A 3WLTA 1N2JA 2WKPA 2PFGA 4D8VA 1CW2B 1G16A 1QGUB 3AY7A 3EZYA 3QBDA 4HKTA 1QIHA 4WLNA 1LWNA 3AY3A 2Q6TA 5H81A 4EY8A 1K5PA 3W7AA 1WU8A 3KALA 5CPBA 5F52A 3UQYS 4ZIRA 4DKXA 3KLNA 1T2FA 3AQ4A 3RT9A 5B6JA 2VOEA 2IHBA 1M2OB 4PS0A 2FYTA 4A2WA 5IZCA 4AY3A 3AVVA 2O7SA 1W4LA 2FFBA 5MN5A 2JGLA 4LOJA 4YRJA 1NXWA 3V1MA 4GRDA 4B3CA 1OILA 2C2KA 4RVFA 4DEVA 2JD1A 3KIPA 5DJ5A 4Q18A 1UAGA 2LNDA 3VDNB 3NYQA 3WQBA 2Z3VA 3U5TA 1CUHA 3L79A 1MW9X 5JS6A 1JH9A 4HQNA 4BHHB 2R00C 4NBVA 2ONZA 3BDVA 1IZ0A 2WB4A 5AHRA 3AT1A 1MOZA 3AL3A 1EK0A 1KS2A 3N8IA 1SBYA 4MW4A 1RWMA 1U1GA 1Y5NA 4GLJA 3OE7A 4B6JA 1E1MA 1GU0A 1T24A 2FW0A 5DM0A 4F8JA 2CJPA 2IE8A 3DUFB 1H2YA 4KDCA 2RG1A 3IAHA 5CM8B 3AWDA 4FDMA 2P62A 1U7UA 4WASA 4CM4B 5JYDA 3OPVA 1X7YA 5I8ZA 2QZJA 1PSZA 3RIGA 4XUEA 5J4KA 5JPDA 4IIJA 4NYMQ 1JJ7A 1G5IA 1G6Q1 3NM6B 4XOIA 4YQYA 1C7FA 5DCWA 1TLTA 5DHUA 4LOKA 1C9YA 4NK4A 3I6IA 5KIAA 2FW6A 1Z83A 2EX4A 2HGSA 4KSCA 1FRNA 3HU1A 1E7MA 5AM5A 4DMLA 4EY6A 2X3UA 4XXHA 2AE2A 3PJDA 3ZXUB 3L01A 1KEEB 2YMMA 2XNKA 2OL4A 4DA6A 3FVRA 2C9MA 1DAIA 3V34A 1NVUQ 1PRYA 3GARA 4ZZ2A 5JD5A 3LT5A 5HS6A 1A72A 1ZA1A 4R8SA 4WFQA 3P1JA 2BFFB 1DADA 3OJ0A 1ODJA 4MVJE 3NFRA 2JJ2A 3F4BA 3MMZA 2QGNA 5B36A 5H7XA 1JDZA 4LZWA 5E7IA 1GPNA 1FTYA 4QRIA 1NVTA 1UBUS 2IXBA 3EIFA 4AYXA 4Z53A 2I22A 1V1RA 2OB1A 4ISCA 1SY7A 1DIGA 2WIGA 3SIPA 3W2IA 3V8BA 3A05A 3WWPA 2A1TR 3R6DA 5KTKA 1GGNA 4BO0A 3ZWVA 4R51A 2X8LA 1EA5A 1T34A 2BGMA 2QJTA 1VL1A 5G0VA 3N39C 3FB1A 2F43A 5BSTA 1M8PA 4XWYA 5LOVF 1WL8A 4MROA 3FXAA 4LC0A 5ADVA 5IF3A 5DNCA 3I92A 2PU7A 5ILQA 2KHZA 1DV1A 5EJ4A 1AQIA 5KYXA 1PFQA 3BJMA 2OV4A 2KS6A 4NCBA 2YIDA 2QD3A 3A4LA 4E1VA 1E9AA 1K8RA 1RKVA 1RWXA 3L02A 3K5PA 4B76A 3JY6A 4XJXA 1YMUA 3OHSX 4EUEA 3AEUA 3AHCA 2PUAA 4A16A 2AXEA 4KIGA 2IYXA 1D8TA 2A1IA 1KO8A 2N3ZA 3E7XA 4L6CA 1ZRMA 5I6DA 3PD0A 2VXYA 4G4GA 1P17A 2X4IA 2PNJA 4KE9A 4XUDA 4P0PB 3QJYA 4GC9A 4EW3A 4AAYA 5F23A 2HCRA 4Z4FA 1ANKA 4CMIB 1BKSB 2I67A 3EUEA 3OZUA 2JGAA 4MGIR 1U2GA 3D3WA 4GOOD 4ENTA 1KRWA 3V9PA 5IXJA 3LP6A 2IL1A 3R2JA 1FLAA 3DG9A 3HGTA 3TJRA 3K0AA 4PSCA 1OFVA 1N7JA 4Y9RA 1UDXA 5K3CA 3UYKA 1JEAA 5ITWA 2CXQA 4ZO4A 3NAGA 5I3ZA 3QLVA 3CNNA 3H8VA 1TJ4A 3NT5A 1M10A 1T6ZA 1UJNA 3IPCA 4O4JB 3ZCSA 5I5EA 5HF5A 1PLJA 4X62B 5GTDA 1YRQA 1IXRC 3EXHB 1T5IA 1Z6QA 2B6NA 2EKDA 3H5NA 2GLXA 1CB0A 1E2PA 1QZZA 4U4AA 4D56A 4AZ3A 4PFQA 4DBLE 3AB7A 4F5EA 3EA0A 3U4CA 1TT5A 2A5FA 4I3HA 4DRZA 1I3CA 4INPA 2PO7A 4XE5A 2ADFA 4YYZA 3N2ZB 4V0SA 1C7JA 1M0SA 4DNXA 2O2JA 1O94D 5E4TA 4KQKA 3DSRA 1Z33A 2XDYA 4DMHA 1ZCJA 4HB2A 4ESEA 4NIMA 2VHVA 3NEAA 4ZGWA 1N1MA 4P3PA 1RMYA 5BW4A 4LY3A 1C9EA 2QX7A 3RS2A 5IZ4A 4DM4A 1HEYA 1H3EA 2O1EA 5JSFA 1E5XA 3HU3A 2MSDB 3H7AA 5DWQA 4G8CA 3KR9A 1YB1A 3HWSA 3TLXA 5JI2E 2XMCA 3AVQA 4PQYA 2P5SA 1DKOA 3E15A 4LGYA 1LK0A 1LJ8A 2E4WA 4QDUA 5KEIA 2VQDA 1EFDN 2IVZA 4EH1A 3NM4A 4EELA 2LCQA 2Z8XA 3AJDA 3LA8A 1CUVA 1JEDA 2VKQA 3AC0A 4NBUA 3RHTA 2R65A 1GWNA 4JYZA 2ECQA 3G6KA 3NDRA 4B3FX 2E55A 4HYYA 1U5BA 4BP3A 1DTSA 4PVDA 2XMZA 2XODA 4BV2A 2HC9A 2Q1SA 1C4OA 2CL5A 1W4BA 3CRQA 5FTLA 1W36B 3IYLW 5I7EA 3F6RA 4BO8A 3DDHA 2DXIA 2BCGY 3I53A 2PU5A 2REQB 3M7IA 3P9RA 4M1WA 1M9NA 4N6NA 2A14A 5DM2A 1GRQA 1WCXA 2J9XB 5ARCA 1HE8B 1DFHA 1WQ1R 2J0VA 4RMIA 2IIBA 1MO6A 2VSYA 4KQ6A 4Y0AA 1XYVA 2YY7A 1LBSA 3FIUA 5JSZB 1CBUA 1O95A 1ZRNA 1VKNA 5D2CA 1NXPA 4OV6B 3I9KA 1NUHA 2BBOA 1KWKA 2J45A 4JVSB 4TT3D 1GPH1 2H5JA 3TIXB 1OX5A 1QX4A 4QUDA 4XM1A 3BXFA 3AP3A 1JXAA 1ISJA 1PK9A 4MXDA 4TYYA 4DNQA 2IYRA 3H86A 4TQUS 4YMLA 1LJUA 3JASB 1UJ6A 2Z8YA 3D6JA 2I34A 2WIAA 1WXGA 3CR3C 4Z8YA 3ZWKA 1Z4KA 3I4FA 1E6KA 5MN4A 1T0HB 3KE9A 4OQQA 1C9KA 2JBAB 3FSEA 4HHEA 2HSGA 2JK0A 3WLPA 1P4GA 2QLFA 3A9CA 3W2FA 4B9EA 2ODNA 3TGWA 2BLNA 3KLOA 5EIHA 3E6AA 1I13A 2WF7A 5KSOA 3ER9A 5K2MA 4MVJM 1KK2A 1RHUA 4EY5A 3PWTA 3FWPA 4CMEA 3HQ4O 4Q3BA 1F38A 2ZDHA 2I6TA 2O8CB 2G4CA 4JEMA 4MINA 4QU0A 2CMHA 4WBNA 3S81A 4MS4A 5F5LA 3PJFA 2CLEB 2Z4RA 1GT91 4RDHA 1SKMA 5D5HA 3H2SA 3N6VA 3VQTA 3L0IB 5J2UF 1GXSA 4UCQA 3TTTA 2C5HA 3EGCA 2AMJA 1UKEA 1SK8A 3QX3A 1HBJA 5M04A 5E8JA 4EB8A 4OEHA 4AF7A 3Q0TA 4MDFA 3GBVA 3WZLA 2DFNA 3AKYA 4GVLA 1W0KD 2QG4A 3K2QA 1EMDA 1MQSA 1YAJA 2MYTA 3QW2A 3DMNA 2WF5A 1YBAA 2H4HA 3K09A 1CUBA 2IP1A 4B33A 1I4LD 1PV2A 1J8YF 2XYVA 4TS1A 1Z0JA 4URYR 1AK1A 2X2PA 1PR2A 3Q8WA 5LDGA 2AFHA 2B82A 3ZVLA 2AQKA 5HKLA 3WY9A 5E3HA 1UBLS 1P4JA 2JANA 5J2TA 2VWGA 1U3CA 3A28A 4WFIA 4FMCF 1L5HA 3U5ZB 2AB0A 4B83A 3R5KA 5BWLA 2MSNA 5K99A 4OU4A 2ZWMA 4FJ1A 3RLIA 3J7AC 1WDTA 1OYYA 4M87A 2FFRA 3O83A 1V9CA 4RIHA 2ZBPA 4D6XA 3HJUA 4UHJA 1K8YB 4MQ6A 1HDYA 4ZJYA 4KPUA 1VYTA 3AEXA 1JJIA 3RU3A 1JHQA 5FBZA 4JI7B 3GEGA 3F1LA 4R71A 1SUFA 1KE2A 1XQVA 2G5CA 3AI1A 4L2IB 3C6XA 5GIOE 2RGAA 3SVZA 3UUFA 5HKKD 2XSZA 3HXTA 2AMFA 2JKYA 2H4YA 1QU2A 2Z5FA 3LP8A 2DPGA 3RABA 1W44A 4PWYA 4RM3A 1IJBA 4A73A 5KC8A 2RARA 4W6ZA 2F90A 2FSSA 1PDVA 1SUWA 3DD5A 2DKOA 4P33A 4F3NA 3MAGA 1FFEA 2DBVO 3CV3A 3EAFA 1ZW1A 4AWXA 1II0A 1ESDA 1SVNA 3L7OA 2FB9A 4DRXA 1NF9A 2A30A 3ML1A 3WNBA 1YGYA 1BFUA 3KYJB 3R09A 2HRBA 4L5YA 5D3KA 4C4PA 3IQDB 1IVYA 2ZRCA 2CNOA 2QJWA 3HR7A 4PYMA 5I7VA 1E79D 1QDLB 1QDEA 1H0KA 1PI3A 3KUXA 4QELA 5CX1A 4AG6A 5B1DA 3K4QA 4WOPA 4CDMA 3UJ7A 1M7BA 3PUKA 2QA5A 3Q6IA 4HAIA 2OBNA 3IP5A 4H6PA 5E6SA 1VA4A 2KLBA 4JP3A 4ZZ1A 1YCHA 2Q4BA 2Q7XA 2Y0BA 4NBKA 2IYLD 1WBBA 1OWLA 2WVJA 4RSMA 2BGRA 1XDWA 5GJVC 1CFZA 4BQPA 1P2DA 3U6KA 1OTYA 1MQAA 5J40A 4WK6A 4YRTA 5ER6A 5C4GB 2W2PA 3WGIA 3T5GA 4CF5A 5CU7A 1RQPA 1CY4A 1P9LA 1P2BA 2RGDA 3NPMA 1W73A 5DWVA 3NEJA 5THKA 1T2CA 3B60A 3BF7A 4Z4GA 1M76A 1HT3A 1Q16A 1JB9A 4OSPA 5CT4A 5T4HA 3O4VA 5EJAA 4YAIA 2JJYA 4P32A 3JAKB 4QJ5A 2AVDA 1FYFA 1G4HA 2FWAA 4Q7LA 4RKWA 3T7AA 1ZI9A 3QU2A 3W5HA 4U9HS 1U1CA 4CCYB 2HU8A 2I3GA 3CCFA 3ISTA 4FEAA 3OIDA 4TTAA 5BO5A 1K1EA 1VIVA 2GRAA 3CS3A 1ZOLA 3CRRA 3KYDB 5JD6A 3KSDO 1YDEA 3HSYA 1SB9A 1Y7IA 2YNMC 4PXSA 5B3KA 1E89A 1R9JA 2HREA 1AHIA 1TYEB 2J87A 1E6WA 1KY5A 5P21A 3UQZA 3GLIA 3NMUF 1OA0A 2IV7A 1JIJA 4YJ2A 3SF8B 2HT1A 4CL8A 3QPVA 1ONNA 3OEHD 1XF9A 4IIHA 2PBRA 5E1MA 2ZRMA 1DJQA 1TEVA 5AMXA 4AUMA 3QHAA 2ERXA 2J9YB 3VVLA 4F9EA 4LSZA 4I50F 3SWWA 1ODKA 3FUUA 3L40A 4F2PA 1GGJA 4LYEA 5M5BA 4MMXB 2JZOA 1EG7A 2QT1A 3UWDA 3W5CA 1KHHA 1LNZA 3P71T 1ZAYA 1N6OA 3P0JA 5KJFA 2IXEA 1LBHA 2O7RA 1TMGE 1LSOA 1QH0A 2W8ZA 1SU4A 3OTIA 4BEWA 1FA9A 2CNNA 1EFHA 4D5GA 4E2YA 1KJIA 3ZHXA 2O2ZA 4TRRA 3KWFA 2ADOA 3ZCUA 1Z2NX 4MV7A 1T3LA 1L9XA 2ZU6A 3CB2A 4PW0A 4XGQA 1ECPA 4YBZA 3ID6C 3ITNA 4L9AA 5AYVA 4Q5IA 3FYHA 2ATXA 2A2ZA 2GO7A 2P2SA 4X61A 5EJ9A 1JYSA 4TZKA 4LMRA 2IIPA 2XAUA 3VPAA 2WD7B 1LI5A 1WO8A 3TRDA 4B48A 1KI4A 2BFWA 1HE4A 2KPOA 2MSCB 3OLWA 3DT9A 4O0MA 3HYSA 4GPIB 1G18A 3TTVA 4IHJB 3O7MA 5J5VA 1TQ8A 1KIFA 4C43A 4W5TA 1BGXT 3HYTA 2WC1A 1IWBB 1TO2E 1Y34E 4ITUA 3O2NA 3ZDCA 1NYTA 1JEOA 2WTEA 3GLKA 1PZFA 2WILA 4NJEB 4EF5A 4OP2A 5JCOA 2ZBVA 1GADO 2PJZA 3QY9A 1J7KA 1OGYA 3W05A 1H6BA 1Q3KA 2R86A 4JI4B 2E48A 4TUYB 1V43A 4XUCA 1G8MA 5I8WA 2I03A 2OFPA 1V8DA 1RYMA 1BMFD 1Q0QA 1UBMS 2AD5A 2NP6A 4YMHA 3LCVB 5LDDC 3OC6A 3PC6A 4DA4A 3HH8A 2VJOA 4J91A 1HDXA 4G2TA 4GAEA 2XMBA 1Q0PA 5BWOA 1MABB 4Q4CA 2DETA 4JVNA 1USWA 4WZZA 2EFHB 2QVZX 1TM1E 2OZPA 3ZVNA 3C16C 2QUAA 4RZ2A 5EYPB 3E5NA 3E9CA 3RG8A 4BNIA 4ALIA 5JWRA 4DC0A 1MT3A 1NVBA 1WZCA 5J4YA 4GOKA 1TZMA 3OLZA 4MRSA 1PFGA 2FXIA 3UHJA 3KZNA 3FYTA 2WHPB 4RK0A 1P4HA 2HQ1A 1X77A 4MS3A 1VGRA 1SHJA 1DAMA 1VJ0A 1ADJA 1YI8A 2VUUA 3EZNA 3HRIA 4NOJA 1EE2A 2XQFA 1U2GC 3F7OA 2P67A 1N2IA 1ZI6A 3QUTA 5DGDA 1KJQA 1VSVA 2NTEA 2Q4DA 3IOCA 5CA0F 1J07A 4DSUA 1IJFA 4JVOA 4ERNA 4FONA 1G7SA 3NC0C 5LQJA 4WN9B 5T6BA 4XWKA 3LCMA 1RPNA 3R7SA 4KQXA 3CNHA 3VKFA 4O2LA 4F12A 4CUJA 1IN8A 5CLQA 1Q12A 1UBRS 3HJBA 4OHOA 3NHLA 1V4NA 2F3SA 3VR6A 4A82A 4B4OA 4DV4B 1Z4LA 1T8RA 1RMQA 2F67A 4I8XA 5KO2A 1BW9A 4C5AA 5ALNA 3GX1A 3FJYA 1V6SA 1R2QA 2QEQA 3GNQA 4U5QA 1T1GA 5E9JA 1ECLA 1LB1B 3TQRA 3L6BA 2JJQA 1DKMA 1QFSA 4QA9A 1FE8A 2X15A 2EVWX 1Y1RA 3P2EA 4FFLA 4TMYA 5CYPA 4ZAXA 5B64A 4LVNA 4O2BA 2JFVA 4V24A 3NIGB 3SZMA 3PEVA 3I01M 4RGBA 4D8YA 2H4XA 3AVPA 4PX2A 2XLBA 2W6PA 4PANA 5KVAA 4EGQA 4Z7QB 5LQAA 3H2HA 3O0DA 4AZVA 4JENA 3UGQA 3SM3A 3AUFA 4LZJA 4S04A 1TZKA 3QX9A 2I3ZA 4IHAA 3PFKA 2GZAA 4E12A 1ENOA 4R41A 2HIMA 1PWEA 2PGAA 3DMHA 3HCEA 3A6JA 3WIDA 1IXYA 3JWEA 2JVIA 2PYIA 2BGIA 3BMQA 5COQA 3TD2A 1JEYA 1Q1ZA 4QO7A 2AJTA 4TLDA 4MP6A 4XD7D 1UKVY 3AEQA 4IZOA 1TDJA 1QVRA 5CW1A 1SVWA 2WU8A 3QWIA 1EKXA 5IJ9B 1W36D 3BBLA 3W5UA 4K1XA 2CDNA 2VF2A 4HH4A 4HX2A 2ZRJA 1JEEA 1ND6A 2Q8QA 4E13A 5IFKA 3FHTA 4G8DA 3EX7C 2WMYA 3NIFB 3FDXA 1VIAA 3IBSA 2XHEA 3KOXA 4R01A 4Y2GA 5GM1A 4ABYA 5BWMA 1L1RA 2C2MA 2CXPA 4WXRA 1G66A 1PX2A 2I4OA 4WK2B 4ASUD 1DTWB 1KH3A 5IKXA 4P08A 2ZOSA 1QGOA 3UCXA 2N0SA 4B79A 2ODTX 4P4UA 4PSAA 3ZV5A 3FPHA 1G2QA 4OLBA 1VOTA 1P7PA 2RMKA 2GASA 1IY0A 1O95C 1DHRA 3VH4A 5KDOA 1QMGA 2BTEA 1BYUA 4OPMA 2JH3A 2FPLA 3JQ9A 4Z8XA 3O31A 3UK1A 3PE3A 1NGSA 1L6IA 4PRZA 2ODEA 1E9BA 1ZPDA 4D9FA 3RYHA 1J2JA 2O0MA 5DVZA 4PLGA 2B4RO 3GYBA 3OQIB 4CQMD 2IU4A 4I6GA 1XGKA 3B1JA 2VHJA 4OJKA 1TEXA 1YJCA 2DBQA 2OCDA 4F7WA 3NWPA 4N6GA 3U7GA 4EPXA 1NW4A 2BEUA 3MXTA 3C5VA 4FNAA 4WQMA 1RJ9B 4ENRA 2A84A 3QVXA 4J0HA 5AJYA 2WQ7A 1EVLA 2OUKA 4P4LA 4G5XA 1UKAA 1P2TA 2AZXA 1UKCA 3CNLA 3DFFA 4FFNA 3U7IA 2O52A 4KE8A 3NDPA 3ZNQA 1BMTA 1MMFB 3MELA 1BWRA 2JVJA 1Q74A 2O3TA 1U1EA 2RGNA 2ZFUA 3B2NA 2FR8C 3EVZA 4JMPA 4MNTA 3UGKA 3QKTA 3HVRA 1ARZA 2BZSA 2VPXA 4GI2A 4I99A 4HXGA 4MJ3A 4D97A 1TQ4A 1WKCA 3E2MA 1AUQA 1QC5B 1R5BA 1W30A 4RPJA 3BGDA 1FRZA 2HMUA 4OVKA 2ZB8A 4KQEA 3JW8A 2VT3A 3SMQA 4AB1A 4ZU6X 4L8GA 4G5YA 1O94C 3VC2A 1AUVA 4XIGS 3CCBA 1ZXXA 3TAXA 3TTXA 1R6TA 4E21A 2YVLA 3VJLA 2AS0A 4BNMA 2QD2A 5KQSA 5K3AA 1O89A 3M9LA 1P0FA 4FX5A 4RANA 4RTLA 4IR7A 1JPVA 4B74A 4E88A 2J5QA 1NY5A 3GJ0A 4FOTA 3TIVA 3NNDA 1DMSA 4I8IA 4TTVA 1KZYC 3MWDA 3ACCA 3T0IA 4MV0A 2DF8A 4QM7A 3EEIA 1L0BA 1DUVG 3PIDA 3MF4A 4RZUA 5B2EA 1OB2A 3DEZA 2GPSA 3T5DA 5LMZA 3Q7RA 3E7FA 2YVQA 1HFWA 1EJ0A 1P1IA 5BT8A 1ZJ4A 1UUFA 4LI0A 3ZGYA 1JFTA 2HPZA 3SQDA 4LJSA 1T5SA 4N5NA 4LQ4A 1SKAA 2IUEA 3KEFA 3NEYA 4HTFA 4II7A 3NM5A 3FSGA 4KR0A 2IYEA 1UOPA 4OBEA 1CF2O 3BCHA 3MCAA 4PNHA 2XVYA 5JY1A 1FVHA 3ZJ5A 3QLUA 3JD0A 2FPKA 3ELBA 1RRCA 1JYFA 4NESA 3FBTA 1F3LA 1E6LA 1RLJA 3SK0A 4X3CA 3BXHA 3WWCA 1KMCA 4AF6A 1P8AA 3K9CA 1VMIA 4KUHA 3EGWA 3RUHA 2Q4EA 1N78A 1M5TA 2ZTVA 4RM2A 1GGEA 4LSWA 4ESOA 4LECA 1KWGA 2VDOB 1XFAA 2O5EA 1A9SA 4V3BA 2ZVPX 3BICA 5HOQA 3JQFC 4PHCA 4HUJA 1YAHA 3MUFA 5K1ZA 5TV2A 4E08A 3E5RA 2XQVA 2V7GA 4B5LA 5IN4A 2OA0A 1JBQA 1R6XA 4H3VA 5CD1A 4KN9S 4PYJA 1VMDA 4PZ9A 4V0NA 4IILA 1CUCA 3V6LA 4FC7A 2H2GA 1F12A 2CCKA 4L5IA 4J07A 2QQFA 3UMMA 1WWKA 4IGEA 5DM60 1DL5A 4I55B 1MORA 4HLQB 3LYLA 2Y9PB 3HB1A 1CNFA 3OKAA 5IJXA 4JB2A 3FLBA 3HXQA 5L4LA 4KI7A 5LUBA 1Z35A 1TZ2A 2V9CA 3MJVA 3ORYA 4PGAA 4M8KA 4YVFA 4DOMA 4IL5A 4EENA 3FFWA 5L9AA 4ND2A 2ZYAA 3LBFA 4EPYA 2I87A 4RF2A 4PLTA 4E11A 1NQTA 3RGWS 3V1UA 2Q7OE 1HG1A 1SG0A 2DFLA 2ZJOA 3AETB 3AJ9A 3K2IA 5HG0A 2AQHA 2O1XA 4D42A 3JD2A 3AJEA 4JS0A 3KPUA 3IPYA 2C07A 3TLGA 3VMMA 4F3CA 1T43A 4ZYTA 5AXDA 4PRYA 1XP8A 4RYDA 3WMFA 3Q5DA 1NVDA 4ZEMA 3VAYA 4U8GA 4KR2A 3X44A 3PDUA 2GPYA 4RY0A 1DELA 3F67A 1YSCA 1KOJA 3RJZA 3S40A 2AYXA 2H2AA 3IPAA 1J2YA 3DTVA 1KAMA 4GWKA 4TMKA 5CNMA 4YQEA 4E3WA 3A1UA 3OX3A 3TSAA 3U60B 1AQLA 3G9TA 2UYGA 3LUPA 1I3NA 1GTG1 5CG1A 2OUIA 1GM5A 2AQIA 3HA3A 3WZ2A 2QW1A 1RP7A 1JDUA 3PC8A 1YDMA 1NW7A 3JAMA 1S2MA 3LMKA 2XCTB 1QG0A 2IH5A 1VL2A 3IA2A 3PHIA 1Z2PX 4NKRA 4PLYA 3TW8A 1JDBB 2YOGA 5JEEA 3RUPA 1Y1PA 4YP6A 3D5QA 3H5IA 4TSFA 4YAKA 5IJ0B 2BFEA 1U7XA 5J23A 1X1AA 4GGMX 4IVNA 3U3OA 4ARCA 3AP2A 1DBRA 2JLBA 3PXXA 1BJRE 1RYFA 4GEKA 4A1FA 1R18A 4MPDA 5H82A 2DBYA 4D9JA 1BXGA 3WSTA 3ZXYA 2N42A 3SX2A 2VHQA 3N2LA 4IIBA 2IVFA 1ULBA 4XB1A 2ZDQA 3BWDD 4OM8A 4L4ZA 1PNVA 2IEDA 3OCXA 2QAGA 2WNIA 3LAWA 4G6ZA 1KJJA 4JN6B 4O2RA 3PPIA 2H5EA 2VUSA 1FTGA 2RJ3A 4G4SP 1PDOA 4HFNA 5ELLA 2JCXA 3WXMA 4D0RA 5MHTA 2Z08A 4Y6SA 4DHWA 1F8XA 3WYGA 1QRSA 3ZBQA 3U4DA 1J0CA 1VECA 1SCIA 4Q1DA 3T5AA 4DKJA 4MCJA 2DVMA 4XR9A 1SXJE 3O8LA 3FCCA 4PLWA 3I01A 1MC1A 3K1JA 2HRZA 4TN1A 1V96A 3AUXA 4B09A 1Y6JA 3SIXA 3WE7A 3RSOA 3PIRA 1R15A 2CE7A 4A0FA 1R10A 2PGXA 4MYRA 4TKZA 4C22A 3K0CA 5KBYA 1RXWA 3WMXA 2BFMA 1TUGA 1BEEA 2C8VA 5LXTF 4Q4LA 2P6NA 1SBCA 2IU6A 3G88A 4MGYR 1QVWA 5E95A 4Z6KA 4HXFB 2XXAA 2O8DB 3U81A 4TYQA 2NPFA 4KK3A 1Y1TA 4QGSA 1E0SA 1M2WA 1Y48E 3WBBA 1GSIA 2YV2A 1AGYA 1EINA 2NUBA 2X86A 3SS8A 3NNSA 2CJWA 3A27A 1LX7A 5DGCA 2MYNA 2PRZA 2AUMA 2XUAA 5G1PA 1W1WA 5K8IA 1QYRA 4FB4A 3TW8B 2ZBRA 4YRPA 2QTCA 2G63A 4RABA 3IILA 5BWCA 3QXGA 3EH2A 2C4KA 4YV2A 1JG6A 3IDAA 3N0XA 5BN5B 4RHXA 5H3CA 2G6TA 2R5WA 4KFUA 4P7JA 1FX0B 4AROA 4C0SA 3T7RA 5JCOC 4NECA 4R2IA 3C41J 2Z3WA 3CZQA 4BLUA 4OBWA 4JNCA 4WLFA 1HR0B 4HLUA 2F1JA 4MQ4A 5KNBD 4X64B 2X7JA 3V97A 1C9DB 2ZXUA 5TR9A 4BNNA 2PSEA 1SHLA 2ZUCA 4M9SA 3A6HA 3TCNA 4D6YA 1XRLA 1F0KA 1VE6A 5IVDA 2Q8PA 2QOEA 4EA6A 3Q87B 4L27A 2FEMA 3G49A 3TQCA 1RHRA 5FR1A 5LP6B 2X0FA 4QPZA 4AVYA 3UXHA 4ISBA 2ZIXB 2OZEA 3JD1A 1CU1A 1XXHA 3M3HA 1P9NA 4J1TA 5EWMA 1YZ3A 2JFYA 4QOHA 3N8NA 2TYSB 1UEJA 1ZWLA 2B8EA 4RDIA 4TRMA 5DOVA 1RLTA 1NBHA 3ROEA 4XB2A 1XVIA 3EA5A 1L2TA 3KU4A 4NS4A 2V45A 2YYYA 4EPTA 2GK6A 4ZJUA 3ISVA 2GFQA 3MTAA 4TPKA 1GUZA 4RJLA 3BX1A 2JLAA 4Y6QA 2IY9A 2V6GA 4Q9LA 2DAPA 1Y98A 1WVGA 1VPWA 2R87A 1N2XA 4GS5A 2BL4A 2Q5LA 3W6OA 2ZIVB 3V8NA 3NGMA 5DYWA 5JTTA 1WZ2A 1NR7A 5F1OA 2PVSA 1T9KA 2RGBA 1NZDA 5JATA 1GFSA 4ATNA 4E15A 5LUAA 4A8PA 4YRIA 4N3AA 2JGKA 2R7MA 3W3AD 1XJ0A 1DLJA 1ZRHA 3T5MA 2K6GA 2NXJA 2CLHB 4HAYA 1I7NA 1NRWA 2C42A 3RS8A 1PUXA 4WKGA 2FZVA 4Y8VA 4UTRA 1XOIA 2FX3A 1EHIA 3EOBI 3KJNA 4BFUA 4CEHB 2VAXA 1GPYA 1B1CA 1TUBB 3E9ZA 1MVLA 1NDUA 2R8EA 2CK3D 2P9GA 3RVNA 1T9GR 3W1VA 1TQ6A 1CIPA 1SC1A 3RAFC 4X65B 2B7LA 4DUYB 2H18A 1CF9A 1EDOA 2R8BA 4L74A 3UENA 4DLRA 1E3QA 3EUAA 4JT2A 3A6PC 1MVOA 2GBIA 4HB4A 4DIBA 3SE0A 2G80A 1J20A 2AN4A 2UZ0A 2HDOA 2CYAA 4JA2A 3HV2A 3WXBA 1VMKA 1P60A 1U5CA 3AJRA 1S8OA 1ZM9A 4JLNA 1OLUA 5LA6B 3X1MA 4C3OB 1HM5A 4DXHA 2IQIA 4KC0A 5J4LA 5L3VA 1SFRA 3I2IA 4JLKA 2R6HA 4WE3A 2VWPA 2FZWA 2EQBA 4JMLA 2V98A 4GBJA 2NZJA 4QARA 3EQ9A 1KMNA 1YK0A 1YR1A 2CBZA 2P40A 1SVUA 4M9XA 4WW0A 2BHTA 4CM5A 3SSOA 1U6IA 4DA8A 3UWPA 4YP0A 4QC2A 1JAXA 5ICCA 2GM4A 3EHDA 3C0KA 4J43A 4LVCA 1BXZA 2VPQA 2VWHA 4WNIA 4X91A 5DP1A 1Z0DA 1E6UA 1ZKDA 3IMFA 4KTVE 1MU0A 1IIRA 1XPJA 5KWSA 2ATCA 2X42A 4P1ZA 4QDJA 4WV3A 9MHTA 4WVFA 3BAFA 3FNRA 1V4BA 1IUOA 5KTTA 1MO3A 5EHQA 3A6LA 3E5HA 1I3KA 3NBUA 5JQWA 3R8FA 1NJSA 4LQDA 1KKUA 2VHXA 2XYPA 3IA7A 2RKBA 4CI0B 3FPAA 4U6QA 4D9EA 3AFHA 3RJTA 5DEIA 4ZHQF 3MWKA 1ZGZA 5A3QA 3EVCA 1Q50A 5B1SA 3ZX4A 1YRWA 4DBLC 2IYPA 2WAAA 5B1YA 4J0EA 1H2WA 5F21A 5BNZA 2AF3C 1UBEA 1VB5A 3RS4A 3KR0A 5K03A 3FG9A 1GPWB 4NP6A 1E3IA 2W8BA 3FVTA 4OHFA 4X6YA 4IJMA 1XEWY 3R74A 3AKEA 5FP0A 1I80A 2QROA 3EFBA 3KP1A 1J7JA 2C4VA 2AOTB 4N0EA 4MVJI 5F4ZA 4ZI7F 1LC3A 4ZXPA 2J1LA 1E3SA 1DPGA 2OCGA 3DDNA 3KK0A 2CUTA 2J32A 2V4MA 3D0KA 3H1PA 3OCVA 3B5EA 4H4CA 4F85A 3HXPA 4EEZA 3ZD6A 4FSHA 4UM9B 5CIYA 5IANA 1D9ZA 3OQNA 1N6KA 2PANA 3W9BA 5B1IA 2H0AA 3OZVA 2IIQA 5LMCA 3U4GA 4D9NA 1V7PC 2QXYA 3HCBA 1TMOA 2QTAA 3JYNA 1DX6A 4AZTA 4YGYA 1ZUD1 2NNWB 4G5RA 5B3JC 1XPUA 1RCFA 2OQ2A 3CRVA 2JFQA 1R8JA 1VPEA 3GCDA 4HCJA 1EM8B 2QIPA 1KA9H 2PIAA 4OLJA 4WCDA 5DX0A 4Z0TA 4F46A 2ID7A 2Y1XA 1RQNA 5IM5A 1TUEA 5HPYB 3GZNA 4DA0A 4EHLA 1SR8A 1TYBE 4B3DA 3F46A 3AVYA 4FQ5A 2DCMA 1F3OA 2ATIA 3AOGA 2FE4A 4N5IX 3V00A 1IXZA 3DAHA 4XWGA 4M46A 2ZUUA 2LD4A 1EDEA 1XEAA 1R4AA 4LX0A 1TTQB 3Q3CA 3TR6A 1P1HA 4HDSB 4CT4B 4XWAA 1YZVA 2B4AA 3Q1LA 1GNQA 4G07A 1VI2A 2F64A 2FK7A 4TKMA 4TV9A 3HSKA 4WXHA 1ATZA 1PT6A 3AUYA 1BWQA 1FSFA 4CT5A 3FDJA 1SVOA 2JI6A 5DIZA 4TZ6A 4HTAA 2QLBA 2OV2A 1FQOA 2I6XA 4IGFA 3EARA 5D7NA 4C29A 1GUBA 2E89A 3IUQA 4Z2YA 5DTRA 4CM8A 1E2LA 1XQXA 3H4VA 3ILSA 4BRZA 3UW3A 1PLLA 2HCTA 2D7CA 4KH0A 3SYRA 3UK7A 2EFCB 2HK6A 5JAMA 1XSEA 3HM9A 2QLTA 3M4XA 3OF2A 4E2XA 4YPVA 1YR7A 1KI9A 4B8WA 4D3XA 3JYHA 4MVJP 1CUYA 5CVEA 3PEWA 4XASA 4W63A 2QRHA 2PAFA 3E3OA 4YMWA 3WVNA 3EK2A 5DGIA 1UK8A 1S2NA 1WCV1 3WMEA 4FYMA 4ZMRA 1YASA 4KNVA 2VP2A 4ACAA 1L7VC 1Y9EA 4DM3A 1F2UB 2H5LA 2ECPA 4GXQA 2IXGA 1HT0A 1JZQA 1W49A 2HMYB 2RHBA 3I1YA 3C14C 3G9UA 3GVPA 1I4DD 2Q3HA 3I58A 1P0QA 3A9TA 1RMTA 1ZNXA 4K6KA 5K7SA 3ANMA 4CM3A 1MA3A 2XUDA 3IQEA 4RHEA 2B9EA 4BKQA 4BMYA 1PL6A 2X6TA 2QTGA 1NYQA 1POWA 3U1TA 3QLEA 2VBFA 1ZM7A 3IDQA 4BZWA 2JJ8A 3D0RA 5LSAA 2QBYA 4B75A 4RFSB 1UMDB 3GCWA 3RSGA 3VR3A 4A9AA 3GLGE 1HF3A 2NZUG 1OLSB 3TZHA 3ZDDA 3VU3A 3ZU2A 3FWYA 2XECA 3P27A 3QXXA 3A8TA 4DG8A 2I7CA 1YU9A 1SCDA 1NJ2A 2B6HA 3PRKE 3TSOA 1G4UR 4G0OA 1ABBA 3G2NA 1DS6A 1GAJA 4XGIA 1OLOA 2VJKA 2ZR7A 3RRXA 4ZGBA 2GSWA 3F3KA 2CNBA 1ZL0A 1EJ6A 4MRVA 3X1YA 3I09A 4BO4A 5FPKA 3AI3A 4IEEA 1FJHA 4EHHA 4KJXA 5HVNA 1CDEA 3VH2A 1E4VA 1PR5A 4IDOA 4BGUA 4MARA 2CHQA 2SECE 1ZOPA 3ZJ4A 3RC1A 2J3IA 2Q0HA 1RAIA 1GR1A 2HNAA 2NADA 3L7YA 1EP1B 2FN4A 2Y1GA 3LUBA 1P2UA 4PIMA 3OSUA 4QRHA 4H18A 2WPDD 5CMLA 5IK2A 5TB5A 3VU8A 4C87A 2MSKA 5K6RA 3SFZA 5SYAA 1NQOA 3LNCA 3I5AA 5DN6D 5CT5A 4W5QA 3HEMA 4A15A 2AKAB 2RI1A 3VSAA 3RVPA 1BAPA 4ITRC 13PKA 4F6LA 3HA5A 3K15A 3Q7TA 4XAQA 2QLMA 1SC6A 2W4MA 3RCBA 3NKFA 5KWEA 1R0BA 5FL3A 3AM3A 1DO8A 1D7OA 1H2RS 2IZ1A 3QMMA 2UXBB 4N54A 5MGNA 1OX6A 2Y3IA 1OWOA 1COZA 1JWBB 3N2KB 5JBIA 1ESNA 3K4PA 3BE6A 3TCXB 4LNUA 1WB5A 2FSVC 3NHAA 1ZL2A 2XCRB 1E4OA 4O4IF 5FD8A 3R5JA 1P1JA 3K8QA 4EG5A 5GVSA 2J3LA 3RRMA 2LIVA 3MJDA 4DV6B 1X86B 3E61A 2P4UA 3CMMA 2WRZA 1PW7A 2C3PA 3ET5A 5AO9A 1S3FA 3ZGVA 3SN6A 1GEGA 1NC1A 3HJAA 4IMRA 4YJ3F 4DLNA 5A9TA 3GVCA 4K81B 1XD8A 3AUUA 4Y6OA 4Y2RA 2CKDA 5A4DA 1MPTA 1WCIA 1AKRA 3L3BA 2XE7A 5CDFE 1WXEA 1QIEA 2YRFA 1F06A 2IYUA 4DJJA 4L8WB 4JI1B 2Z5VA 3A9RA 3HUUA 5J47A 1H85A 4RO0A 1PUIA 5BQFA 1NPTO 3RFUA 1VJCA 1JG4A 2VQEB 1Q1NA 5A06A 2W6MA 2IY7A 1U0NA 5EG5A 5GONA 1K5DA 2QZSA 2CF5A 4H77A 4UHFA 2ESRA 3O8BA