5A4KA

Crystal structure of the r139w variant of human nad(p)h:quinone oxidoreductase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
271
structure length
271
Chain Sequence
GRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFWSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NAD(P)H DEHYDROGENASE [QUINONE] 1
publication title Catalytic competence, structure and stability of the cancer-associated R139W variant of the human NAD(P)H:quinone oxidoreductase 1 (NQO1).
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 271
sequence length 271
chains with identical sequence B, C, D
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2015-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5a4kA00
3B6JA 3FVWA 2X2OA 2R97A 3NHWA 1CZUA 2QX9A 1XYVA 3OJWA 1WSBA 3QFRA 4D02A 4GQIA 1QBGA 1XI2A 1TIKA 3GFSA 3OVMA 3O2NA 3U7IA 3L9WA 2ZKIA 2BMVA 3SVLA 1AKTA 1AHNA 3EDOA 4QOIA 4ZVLA 1RLIA 1YDGA 3TZBA 3TE7A 4ZVMA 4QOGA 3F2VA 4QOFA 4NULA 3W7AA 1AKVA 3KLBA 2Z9CA 3L9XA 4N82A 3ESXA 1DXOA 1H69A 2Q62A 3NHUA 3FNIA 1KBOA 1OBVA 4M0CA 1D4AA 2BF4A 3KAPA 2Z9DA 3NFRA 4LTDA 3K20A 1CZOA 3KAQA 2WC1A 3N3BC 4J8PA 2F1OA 3OX3A 1FLVA 4DILA 4ZVKA 3TEMA 3O73A 1JA0A 3R6WA 2FZVA 4CF6A 2B3DA 4FGKA 1AKUA 4F8YA 3G5MA 1AMOA 1CZNA 5F12A 1KBQA 3HA2A 2OHHA 5A4KA 2QMYA 3UXHA 3EYWA 3ES9A 4BMPB 5LBTA 3N3AC 3OJXA 3ESZA 3NHPA 2V9CA 5FX2A 3B6KA 2ARKA 4QOHA 2V5VA 1RTTA 4ICIA 1AG9A 1NNI1 2KLBA 5F4BA 1FVXA 2BN4A 1ZWKA 5LJIA 2Z98A 4OXXA 2QX4A 1AKQA 1VMEA 1QR2A 4C0WA 2V5UA 4FX2A 5FUQA 4YALA 1F4PA 1SQSA 2BZSA 2N1MA 4Y7CA 4DIKA 2OYSA 3ZHOA 3D7NA 1D04A 4ZVNA 2QMZA 4LTNA 3F90A 1D03A 4ESEA 5LMCA 2FX2A 4QOEA 4Y9UA 3HLYA 1YCHA 3B6IA 1J9GA 2MOKA 3NHRA 4HEQA 4C76A 4YAFA 2OHJA 1ZWLA 3B6MA 5EA2A 3QE2A 5B3KA 1OBOA 1XT6A 4YAUA 1ZX1A 2FDXA 3W78A 5NLLA 2D5IA 2XOEA 5NULA 5EAIA 1T5BA 5ULLA 1BU5A 1RLJA 3JSXA 4GR9A 1T0IA 2BPOA 1CZKA 3GFRA 1JA1A 4PU0A 5BUCA 4QOJA 4DY4A 1CZHA 1RCFA 3RPEA 3P0RA 1CZRA 2M6RA 1QRDA 1AZLA 2QX6A 1V4BA 2MWMA 4R81A 1FUEA 2FZ5A 1C7FA 1FX1A 2QWXA 1YKGA 1FLAA 4BMOB 3FW1A 2HNBA 5EMNA 5F51A 4PTZA 1YOBA 2HNAA 3W77A 1XYYA 4XDHA 2W5UA 3NHJA 2QX8A 1WSWA 1FLNA 3NHKA 2GSWA 2FVXA 3W79A 3FX2A 1FLDA 4H2DA 3GFQA 1J8QA 2Q9UA 3GAMA 3OWHA 4N9QA 2AMJA 1DX9A 1X77A 2A5LA 2FAXA 5TGZA 1YCFA 2MT9A 2QR2A 1I1OA 1H66A 2RG1A 1TLLA 1AKWA 5FA6A 4LAFA 1GG5A 1FTGA 6NULA 2Z9BA 1J9EA 3ESYA 5JROA 4U7GA 1E5DA 2M6SA 3OX2A 4H6PA 2HPVA 1CZLA 4NLLA 2KQUA 5LJLA 2FCRA 4PTYA 4FGJA 3LT5A 3KEGA 1YCGA 4YAWA 3UXEA 4N65A 4GI5A 4LTMA 5LLDA 2OHIA 4U7HA 5LVAA 3NHYA 3HR4A 1SG0A 4HS4A 3U7RA 3N39C 5LBUA 1AKRA 4YQEA 1DXQA 2FLVA 4U7FA 2MTBA 1C7EA 3F6RA 4QODA 5B3LA 1YRHA 4FGLA 4C14A 3F6SA 3NHSA 3QFCA 1B1CA 4C0XA 2R96A 4YAOA 4XDGA 4Y9RA 3NHFA 2XODA 3OWXA 4LA4A 3FJOA 3NHLA 4CETA 4S24A 1OFVA 3NLLA 3OX1A 1BVYF 2X2PA 1QHEA 3K1YA 2FOXA 3S2YA 3LCMA 1J9ZA
chains in the Genus database with same CATH superfamily
4ZQIA 1NZFA 1UKYA 1SURA 3AHFA 2YOGA 3H1PA 2OVBA 4Z9FA 4H7IA 3D6AA 1MB9A 3AVOA 4WT7A 4EHFA 1MAAA 4S05A 1SKYE 4C7OB 4BNHA 2ZETA 2ZI9A 3MT9A 2D4AA 4ROSA 4B6GA 3FTFA 1LQTA 2ZJ8A 3BMCB 3HB5X 3L0IB 4LNHA 1CE8A 4UNIA 2WK1A 2OLKA 5EP1A 1VPWA 3H9GA 5LUBA 4Q9NA 3SS7X 1V3QE 4ZVSA 3PD1A 3EY9A 1BH2A 2Q1SA 2RG7A 1Y1TA 2AIRA 3W5UA 5J43A 2UXBB 3Q9SA 5FUVA 4D02A 4D0NA 4A8PA 5JNSA 4JI2B 4LG1A 4Q15A 4D5EA 5I9IA 1LV7A 3KUKA 1A76A 4K2AA 2M32A 3OIVA 3MGGA 4PCAA 3UENA 1PNOA 3OCCA 4NX2A 5KTPA 3F6EX 1C1XA 5BNZA 1UBLS 3H4MA 1PHRA 4IR7A 3EIEA 4PNPA 3H0CA 4EKDA 2ZR8A 2UYYA 2AJLI 2Q5EA 1QG2A 4KJZA 4P81A 3RYIA 3SSOA 2V6BA 4KSYA 1IN1A 3AVQA 4E46A 5IVKA 1JHVA 1FZQA 1DO8A 2KBFA 3ANYB 3HBJA 4O2BB 4QOIA 5BW4A 3PL1A 2SKDA 3B85A 4L0CA 2QBYB 2O2CA 3AL2A 3CXUA 2ZAMA 5IJ0A 1SCJA 3HO1A 1IBSA 1SBZA 3AY3A 3COWA 1A50B 3RR2A 5JJCA 1XHFA 4OXQA 2GCOA 3NNSA 4DDKA 1Q57A 4HB4A 5DCWA 2FQYA 4CNQA 3ZE6A 2XMCA 1YIOA 2I4TA 3EXHC 4QOGA 4R9UC 2FG5A 4KXQA 1MX3A 5AW9A 2FPXA 2NZJA 1RXWA 1DHTA 2OECA 1OXSC 2YXPX 4BQQA 4AS1A 5T5QA 3UYLA 1E99A 2WSLA 1AKVA 1XRMA 3A14A 5HK9A 5BV7A 1AUQA 1IFXA 1Q1EA 2OM6A 4FOLA 3OFJA 1NF2A 1FDIA 3O31A 3PJFA 3SKXA 3IC5A 4FDAA 4NZPA 5EIXA 1PL0A 3K9LA 4EL0A 3S2UA 1AOXA 3BRQA 4MWDA 3CH4B 3GFFA 4NBRA 5IAAA 2QROA 2GK4A 3QOFA 1NJ8A 1KXZA 2PNJA 2XUHA 2Z8YM 2EKPA 2YOHA 4HN2A 1FMCA 3RHZA 3QLVC 1NZJA 2AFHB 2G63A 4GVPA 4IUBS 5AIAA 1FCJA 3I04M 5HE9A 2Z6VA 5CAEB 3IUSA 1X8KA 2JGAA 2Y2UA 5HUHA 4FKBA 3HUDA 4M9ZA 3K20A 5D7NA 2ZJFA 1WW2A 2C7GA 2JAQA 3G8DA 3ILXA 4PC7A 3GGJA 4AJHA 3E22A 3KALA 1J5PA 3OPYB 4ZQHA 1N1EA 4LC1A 2WJJA 1DCKA 3OO0A 4A6XA 3GQBB 1T36A 3OX3A 1TM5E 2NU7A 1RI1A 3P9IA 1JPVA 4B7UA 2XE4A 2O8DB 4EKEA 4ZVKA 1HZZA 5AKGA 3LVFO 4FFDA 2WWHA 3GGDA 5ETJA 3TGPA 1ZXBA 3LUJA 1IVNA 3QYJA 5DNYB 2NO9A 2X8WA 4EY6A 1GV0A 3SJCA 2JIPA 3AG5A 1Q1GA 1KDVA 1E6LA 1F4VA 2H5JA 1E4VA 1VCHA 3DEAA 1I1NA 1OT3A 2IPOA 3OKAA 3P7MA 3RIEA 3U1TA 2KPOA 2I2AA 2V0GA 1FL9A 2PLFA 2PPLA 1O03A 2O0KA 2XVXA 4EELA 3BSSA 4H16A 3ZK7A 1H8HD 1GGVA 5KO2A 3FCEA 3N0VA 4L4RA 4BNUA 3GLFB 1U63A 1DKMA 4N5MA 1JHPA 3SAJA 1B41A 2AOUB 2VHTA 5TRTA 2QAIA 4NV1A 3K6RA 4PNZA 2IYEA 1A7KA 2OPBA 2WI8A 4EAAA 3FOZA 2VRCD 1EDEA 1FYXA 1VA5A 2MYUA 3U44A 3IIEA 2VEOA 2BY4A 2FPIB 4B33A 3CF0A 4CQJA 4B74A 4AT1A 5L4LA 3LL7A 3O92A 5IABA 3A6ZA 4D0LB 1EE2A 3B53X 1XMPA 4X24A 3B6KA 2VZEA 4CW7A 4XIFA 1UDRA 2C2ZA 2GJSA 3TGLA 4KHPB 4GX2A 4B45A 4TSRA 4ZMSA 4RD4A 4ME6A 3QV2A 2DX7A 3GT7A 1L7QA 2DLDA 3GDGA 4IX9A 5ALOA 2X6QA 3GLKA 4NH4A 2I2XB 3SLKA 3BFKA 5F4BA 2GZRA 5ISMA 1PZXA 3STHA 2I80A 3B1YA 1KJQA 1KJYA 2MSDB 3K09A 2I4MA 4PZZA 3HKEA 3GFOA 3O1LA 1XNRB 4M1OA 1FPMA 4ETWA 4FE7A 3DMYA 1O0BA 4KPFC 4MGZR 5CVVA 1YA8A 2FWIA 1J0BA 2RGUA 3CRZA 1DIGA 2MYTA 1OXUA 1JS1X 5FBHA 1GL7A 1PK9A 3EGXB 3QYAA 2O23A 3ZY3A 1HFJA 2NLOA 1PK7A 3C3YA 3Q0TA 2WDZA 1ABFA 1GSHA 3A9WA 3FBWA 4KV7A 4PZLA 1L6IA 4OGLA 4RHUA 1TL7C 4FE3A 2C07A 1U5CA 4QHYA 4BFXA 4CUKA 4OA5A 4M8IA 2FXVA 3TNJA 5FOVA 4D9IA 5C3MA 4MP8A 2I0FA 3P1JA 2PBRA 4LRQA 4MMZB 4JB8A 8GPBA 4G1MB 4DJJA 5J2TA 4X5OA 4XGRA 4HL6A 1W0KA 3PRYA 3KQQA 1MRNA 3DE0X 3RROA 2Z6AA 2MSCB 3EGDA 1V37A 1A9PA 3AQ4A 2ZTMA 4L95C 5BQOA 3O8QB 3ICVA 1Z0SA 4IHAA 2P67A 5K7SA 2GVZC 4AIRA 5KU1A 5FXMA 3GVIA 4RHXA 1Y8RA 1A7AA 1F8XA 4BP3A 4CT0A 1XU4A 1TKRA 2BFOA 3A4YA 2O4UX 4MV1A 1FMJA 2YJ3A 3GRYA 2BKAA 4PAMA 3W5AA 1G20B 1JKJA 4EGSA 2FWJA 4OB6A 1KJIA 3V48A 3THWA 5IM4F 4QKQA 3AO0B 1V6AA 1M7GA 1YIAA 2GA9A 5C81A 5ILOA 5EC8A 2QUIA 3EIQA 3R8CA 5K5EA 3GEGA 2J8ZA 4BQFA 4Z7QB 1ZZEA 1V4VA 2OHJA 3GELA 3B6MA 4K6CA 2Z0MA 3BJZA 3N53A 4H7PA 1P77A 4GZ6A 4WKPA 3RUHA 5B3KA 1P31A 1TAQA 3L7KA 3NIDB 2R6JA 5KCZA 3KQSA 4LXTA 2PT6A 4PX3A 1RRFA 3ESDA 4IIJB 5AKHA 3LUBA 1TGVA 1TNDA 1LVUA 3DNFA 3E7PA 1W5BA 1WNFA 1DZ3A 3A1UA 3ITKA 3OHMA 2ZI6A 4Z8XA 2E55A 4ND1A 4PYRA 3FWKA 2CLSA 1T5BA 1K75A 1GN9A 4MGYR 2GNAA 5GOTA 3ZD9A 5JQGF 3CW8X 4Y6RA 4BKMA 5JTTA 3Q3VA 1HMPA 4U6SA 1G6HA 4PYJA 3R8FA 2IKQA 2EFDB 5HCNA 4DIUA 3G5TA 2GKOA 5TNXA 1T0IA 2KI5A 1XD9A 1H93A 5C35A 1QKKA 3GUHA 1NXTA 1XLWA 4X54A 5CDSA 4CLRA 4RIGA 2ZIGA 3N74A 2WT8A 3HI4A 3E8SA 5TQ0A 1JQAA 2P4SA 1F14A 2ODTX 1E2DA 2ENUA 1KEPA 4O4HA 4CIBA 5INTA 1L4NA 1V1RB 1JHAA 1GZSA 4N18A 1ZEMA 1GUZA 4ZHQF 3KPWA 4NJMA 2QMHA 3UKJA 3KXKA 3ZD7A 5K1ZA 3KJGA 3G59A 3HXQA 2F67A 2PT5A 1BSVA 4KE7A 3FYDA 3H8JA 4DGQA 4K40A 5IKXA 1RCFA 1ORWA 1XCBA 1CF9A 2Z5FA 4MVJD 3U1VA 1T4DA 2JFPA 3MWLA 4BQOA 2PPVA 4J4HA 3U4QB 2BM9A 1QOZA 2PFKA 2RAPA 1AUXA 1OXBB 1FFWA 1FPQA 2HIGA 4KX3A 4O0LA 5A9TA 1CZRA 2DHCA 2YQZA 1UBNA 4UVIA 5KYXA 1ZM7A 2J6HA 2V74B 1YRBA 1RBQA 1NXXA 1ZEJA 2UVPA 1E3TA 2FZ5A 2W8ZA 3H2YA 4TM7A 4ZT2A 5J59A 2ZOSA 1N4AA 3CX3A 3B9PA 2ZZKA 2QWXA 5E9JA 2C2KA 3GRCA 4NBSA 4NMHA 2ZBVA 3VNAA 2ETVA 2DU8A 3OQJA 3EMKA 2BJWA 2Q5LA 1VG0B 1XIVA 2QVZX 3WL8A 3CNHA 4B83A 1DWPA 1WQ1R 4FEGA 3VDXA 2WUFA 4YMHA 2WVGA 4GI3A 4Z54A 4PCVA 2P2DA 4AMYA 2ZE5A 2VH5R 3DAOA 4KI0A 3F2IA 2VI5A 4QU8A 4RA6A 5TPWA 4ASUD 3EK2A 2OORC 4PRKA 2IE0A 5E6RB 2C0QA 5CYOA 3KLMX 3NHKA 2GZMA 5H0IA 3TCKA 4F7DA 4YMVA 3DZCA 4PSCA 1NBEA 2OE2A 3EG9B 4OU4A 1X1AA 1J90A 1V16B 3ZU5A 2CCKA 2II6A 2PO5A 4N47A 3LAWA 4B2IA 1RLOA 1RT9A 3ZK8A 3NATA 1CQIA 3AWIA 4DNXA 1XA4A 3AMVA 4B2PA 2XCUA 1INLA 1RJ9B 1VSQA 2G0AA 4MO9A 4Y2QA 5AI6A 1JG4A 3E9MA 4LFCB 4QEZA 1EGMB 1TJPB 4KMRA 2XRZA 4QTZA 1Q0LA 2FW7A 2WU0A 3NGXA 1NRWA 1KI7A 4XUEA 5ICEA 5KTKA 1EFTA 1G8JA 3JS5A 1SR8A 2Q6IA 3DO5A 3L8CA 4OQPA 1DWQA 1DPGA 1QMGA 1L9KA 3JRNA 1LLCA 4MR9A 4ZZIA 2ZYSA 1P91A 4O8ZA 1J56A 4O33A 1U8UA 2CKMA 3EF0A 1BAPA 1JHQA 4GVLA 4UM8B 1E79D 4DMCA 1CDEA 1HDYA 3LC0A 4BLWA 4FDLA 1MO5A 4UOEA 5HOQA 1TM4E 1WPQA 3A6FA 5JAZA 3S6JA 3E9DA 4G24A 1RJDA 1MQSA 1TCAA 1NI4A 2EX1A 2B78A 2GN0A 3E0XA 4PLVA 4ALJA 4RDXA 3UQYS 3U6KA 3GBVA 4MJXA 5EJIA 2CB0A 1XDDA 3NBUA 2F1JA 1JIQA 1HSOA 1OJ7A 2W2NA 1Q7BA 2ZSFA 4Y2VA 3K0AA 3D3EA 3NYQA 5EJFA 5FD8A 2NVOA 3K32A 2J4DA 1KSFX 2YTZA 1FTNA 4XWYA 1XVAA 2EZUA 3L0OA 2FRXA 2QN1A 3QXGA 4KR3A 4KR7A 2C88A 1J1ZA 1PN3A 3C14C 4RGYA 4KUGA 1LBEA 5CT8A 4FQ5A 5A3RA 3T7CA 2VJAA 2CW5A 2Q9CA 3GYGA 1HNNA 1IE3A 5U4QA 1CZLA 2B4AA 2J59A 4PO9A 4YRDA 3RSLA 5LJLA 4X9XA 1OB2A 2A33A 3FUXA 4Z9AA 4RSMA 4MMYB 2C31A 1SCUB 1X3LA 5A5DA 1QHIA 4J2TA 3WJ7A 3H3XA 3E18A 2Q2QA 1CQPA 4FGJA 1O9GA 3O1JC 3O75A 2KW5A 3PQ8A 3PIIA 4LC9A 1QPGA 4CV2A 1CYEA 1MAUA 4P82A 4DNOA 3T1QA 2C2MA 4YJ2B 3L0CA 4OREX 2F64A 2R7KA 5CVDA 2P3QA 4KR6A 4LYHA 1H3NA 1XHLA 2TS1A 1YCDA 4OSOA 1J1IA 3GNTA 3PXUA 4XLZA 4C4XA 1WUHS 1TPYA 1RKQA 4V0OA 5JSYA 2DE0X 5TY0A 2W2LA 2HWYA 5I3ZA 4JI8B 2F3QA 2QPLA 6GPBA 1VSUA 2QZ9A 4U02A 1EFPA 4DNQA 1TVKB 3AV0B 4YREA 3KV1A 1XZNA 2ZJZA 4BNJA 3T1TA 1UZMA 2Q1UA 4RFVA 4NFYA 2JEOA 2ZYAA 1RCTE 3BD8A 3UHFA 5KYWB 5ALZA 5B1DA 4C89A 3LP8A 4LBZA 4M3NA 5JRZA 4LBWA 3D43A 4Z51A 3CZCA 4EHDA 4DL9A 3SMQA 2IOFA 3LY5A 4G5SA 4L3VA 1MIHA 5D5PA 1GU7A 1AKEA 5BRNA 4F9EA 4LWZA 3L6EA 4Z0HO 3LNCA 4CQMB 4D9BA 3PFGA 1GR0A 2HTEA 4AG3A 3T7EA 1JVNA 3IVMA 1X7ZB 2OHGA 1NJSA 3TZKA 3X1KA 2B8NA 2F1IA 2I2BA 2JCBA 3QUBA 4FK8A 1NVMB 1U8ZA 3CF6R 2PANA 4JUAA 3TQCA 3V7NA 4DCUA 5KNDA 1I24A 1KA9H 4E08A 3WNCA 1E2PA 3L7LA 1E9VA 2V7QD 4EKGA 3GLIE 5C7YA 5JH7F 3Q8LA 4W5NA 2CNBA 3PNLA 4DXDA 1ZXXA 2D06A 2VAXA 2W2XA 2NYAA 5FWYA 2PHZA 3GMTA 1KERA 3THOA 1BKSB 5GZ1A 2QW8A 4S24A 1U2EA 5IVPA 3P2IA 2BFCB 3VDRA 2G28A 3N8IA 1DCTA 1IBRA 4GPD1 1P9OA 4KXMA 4DV2B 1YS2X 2NN3C 2AN3A 3O8BA 3S2YA 3HUEA 1GILA 2QPTA 1DQZA 1NHGA 2UZAA 3JASA 2PUHA 3GP5A 3CO0S 1DTSA 1LDBA 1HK7A 3KHKA 3PSAA 2BHRA 3O2QB 5IYZF 3WBKA 3B6JA 1G60A 1P1JA 3E5RA 2R6FA 4B4DA 5LOVB 1QH8A 1JSXA 1VE7A 2H1FA 3R77A 4KN9S 3DWFA 4MS4B 3TDMA 1PSDA 2ANCA 2BTEA 4KXUA 3L18A 4YYEA 1AO0A 1EVJA 4MWBA 4JLSA 1CNMA 3OI7A 3IAM6 1U28C 1I9GA 3B60A 2VKQA 1YRYE 4M60A 1IM8A 1PTJA 4GOJA 3WFJA 2X6RA 1TJ4A 4WLOA 1DQYA 5LQNA 4HQFA 1TQ4A 3ROXA 2OD7A 2I3DA 3ZWPA 1W7AA 1FSFA 1F2UA 3G89A 5EOVA 4L5IA 3RFCA 4GPTA 3AW8A 1CPYA 1MX1A 1V39A 3SBDA 5CG1A 4TKMA 2IYLD 2VZ0A 3K8OE 2CVHA 4I2NA 1T2NA 1K97A 4PXAA 3IBGA 5TX7A 1UJ4A 1O96B 3KVRA 3OVMA 4BN4A 3R9WA 3S1AB 4U8GA 4F60A 3FYUA 5EINA 1TI7A 1AB5A 4ZIRA 4ZDIA 4EUSA 1MU0A 2WHEA 3CSSA 4RMGA 4NONA 4KXXA 1HEUA 2VCHA 4UCWA 4EB6A 1FW6A 2A6PA 1EUZA 2BFDA 1A8HA 1IQ0A 3L9WA 4MOWA 5CM2Z 4YRAA 4ZJPA 3SVLA 1CSEE 1FRZA 2OBMA 2R00A 5IBPA 4AG6A 1AHNA 4BNTA 1CQJB 1LS1A 1KVQA 3GGPA 1TQ2A 3G8CA 3TPCA 2JFQA 2RGGA 4AMGA 3QITA 4KRFA 4HLQB 1F20A 3LHSA 4GH5A 1RLIA 1CY4A 2JPDA 4F3CA 4D8YA 3CX6A 4G2NA 1BQ4A 4WQMA 4XH9B 1P75A 1IM2A 1J21A 5IP5A 4UFPA 1B4DA 1HOTA 1MABA 3KQNA 3QU4A 4U9UA 3UKOA 2Q3MA 2V4UA 2WZQA 1KVTA 5KREA 3TLXA 1CLEA 1U81A 4REOA 4L74A 2AW5A 4YV0A 4NESA 1SQGA 2HA6A 2YZKA 1MZVA 3B5JA 3ND5A 3Q41A 3PJGA 4IS3A 3WMGA 4CMCA 4NNPA 3PQ7A 2HJGA 2WABA 1BHQ1 3ZY4A 5HR5A 1RQLA 3FCUB 1OR8A 2CBGA 1F17A 4FONA 1BCSA 3HGMA 4V0KA 4DCGA 3B1XA 4OHUA 4C01A 4PG8A 1UDCA 3KQWA 3ZLVA 4ND5A 1HQYE 4IMIB 5SY4A 3EUAA 1PEAA 1QQ6A 2OXCA 2XUPA 5KYUB 2A1IA 3BQMB 1Q15A 4CIXA 3ZE2B 3L7IA 3R6TA 4YJGA 4URUR 3GUVA 4IIEA 4YP5A 3D0KA 1B8PA 4PAWA 1RI3A 4P4SB 5EWMA 1XKTA 1T6ZA 4TKZA 1UT8A 3ZU4A 1WPRA 1KYWA 2G08A 2OLEA 2FW1A 3JQFC 2VDWA 4C4ZA 5JRDS 3A3KA 3F6YA 3L43A 3CF4G 4BLOA 4W5QA 3HL4A 1PBTA 1K6XA 4NYJQ 3FLBA 2OHOA 4P83A 4ENSA 3P9QA 3IP6A 2EBWA 1FDUA 4YJFB 5TQVA 4E5VA 5FNZA 3HYTA 4V0LA 4OMCA 1J2UA 5LYJB 2WF8A 4HS9A 2QTNA 5G3YA 2DR2A 3W5IA 2O2XA 2TRSB 3OY2A 4GNRA 4YNBA 3A6HA 1FDOA 4LS3A 1R5BA 3H5LA 3JYOA 3KQVA 3LQYA 2PRJA 3AYXB 4HGRA 2JATA 4JASB 3SF8A 4D8WA 4OBBA 3W5BA 4BGIA 1EFAA 5ENDA 3IPCA 1IJBA 2ZPTX 4DHEA 2F3SA 3TRHA 2YIDA 5IH3A 2QAGB 1QBKC 1L4LA 1GM5A 1U0RA 3TW0A 5FHQA 2H52A 2NADA 4UBMA 4JR2A 1E98A 4BZXA 1U7DA 5AKKA 2NZ2A 2WY2D 1T5SA 3T5PA 1I4DD 1ORDA 1I3MA 2QT9A 2P77A 3G7NA 1VZ3A 1DUVG 3ZE7A 4WK4B 1T6XA 3A0RB 1B6GA 2M1XA 4R4JA 3ZJVA 1PR0A 2G09A 1CY6A 1II9A 3UTCA 3F67A 3ZKWB 4QGGA 5LQSA 2F3UA 1WHSB 4BMCA 2NT4A 3Q11A 4DIDA 1A9XA 2WU4A 3F1KA 1A2OA 1JKFA 2VT6A 2BMAA 2W6JD 2X5XA 2IXAA 5EHIA 5B5SA 5CNIA 3WWCA 3TW6A 4B8YA 2FZCA 1H6BA 4MV9A 2V5AA 4ZCPA 2HQ1A 2FZKA 5K6TA 4IIDA 3I0MA 1ZI6A 2YWFA 4KQXA 1KGDA 2IV2X 5IJXA 1N6RA 1BQEA 1DIRA 4U39A 1SU6A 2ZUCA 3KEQA 2GQ0A 4BV2A 3JTMA 2PRSA 3AEKB 3LPCA 4JHXA 1COWD 3J81A 2PSSA 1P6QA 3WL3A 2O5EA 1ZR2A 2C0PA 4FEAA 3CT4A 2O20A 3QPWA 4D6PA 2HHLA 3GROA 3R5TA 3Q12A 1C3JA 1JDSA 3I2GA 3IBSA 4IEEA 4OJTA 4YALA 3LTEA 2HA7A 4KDCA 4DN6A 5CYFA 1Z6GA 2TSYB 5JDCC 2H17A 5TMPA 4LXXA 3LFUA 1I4WA 3UMYA 3DMRA 1PWEA 4I0WB 1C30A 3LU1A 4NC9A 4PGMA 1C7IA 1U04A 3EUFA 3R20A 2FJUA 3WG9A 3TG8A 3LHFA 4C0AC 1POXA 4UTXA 4ZVQA 5G1PA 4CMGA 3C3KA 3LW7A 1E9BA 1PG0A 5EQTA 1LJLA 1L7AA 1XQVA 2OC4A 3FZYA 4L3OA 3B1JA 3OZRA 4WBNB 4EHIA 3KOYA 2IPXA 2X7HA 4B8WA 4F9TA 5THXA 2H59A 1N0UA 1WTAA 1SCNE 1NSYA 3VR6D 4HNGA 2WYHA 3D7RA 3IKVA 3LX5A 4TXLA 3LPNA 4H7FA 1J1UA 2ORIA 3IQEA 2JZOA 2WSYB 1SN7A 5KSPA 4DQXA 2NU6B 4UZSA 2PUAA 3NO4A 4Q37A 4YFYA 5LMCA 4EFDA 3W2EA 1YCHA 3RTAA 4E5SA 1UBOS 1NUAA 1E4EB 4PX9A 4D43A 5AW3A 2GJKA 2O2YA 3WJAA 3LX4A 1GZ3A 1YRAA 3F9RA 4OYHA 4YIHA 2XNSA 4YDHB 3EDMA 2JCGA 3IQWA 3KJXA 1B8OA 1V7CA 5AOVA 1N2BA 5TVKA 4DV7B 5EA2A 1Q0PA 2KE5A 2V4ZA 1NUQA 1EX6A 1Z4PX 5E7QA 1GDDA 2VH2A 3S7TA 5C80A 3K4HA 3DLIA 1IXZA 3KKOA 4HSGA 1XT6A 1DDIA 4ONEA 2JD0A 4CKCA 5JSHA 2GCNA 2ODNA 1HQKA 2C8KA 5JBNA 4XPIA 2BUCA 1UFRA 1GU1A 3UPTA 2D5IA 1OREA 2X77A 4KW7A 1ADCA 2XEDA 4LDRA 1KE1A 1BEUB 1Y9DA 4OK6A 4CLOA 2BSQA 1XQXA 2X23A 2ROQA 4OKSA 2P3LA 3RK4A 5CR9A 5BXQC 4I55F 1D5CA 4MICA 3PVSA 2FSSA 3GVHA 3KSDO 3IP7A 3RSCA 3G7UA 4I4TB 1OD6A 4LHVA 5KBYA 3BXGA 4UOQA 2FR1A 1PQPA 2Y99A 2F1HA 4X1IA 5EXEA 4KSCA 2D7JA 2C7VA 4M0PA 3CUWA 3G6WA 2WIKA 1W0CA 1IAVA 2FN8A 5T6MA 3X1JA 4PBRA 3SX2A 4H60A 4BE9A 3O5AA 5D7BA 2X1HA 3KT3A 4PXSA 1B0PA 4OKNA 1I7DA 1Z4LA 4TYPA 1WUKS 4C3ZA 1KO7A 2DY1A 4CLDA 2R1TA 2AVNA 2WSIA 3EVBA 4B43A 1A5AB 3UAVA 5C8YF 2DEUA 2GTHA 2W4IA 3I3SR 3NR2A 1CZHA 3N2KA 2VQDA 2XCIA 4DUYB 3PUWA 4MKFA 4O4IB 2V97A 3T5BA 1XEWX 3WK7A 2J3QA 4B7AA 5GQSA 4EPWA 2QRMA 3WLFA 3T1YB 5JFOA 1P2UA 2PX8A 5A2GA 2NUBA 4EEXA 3HR7A 4IQ0A 1P60A 3HKBA 4EA9A 3DLCA 3VZRA 1WTCA 4BYGA 1A8PA 2PJZA 3KZMA 3FYSA 1BEZA 1PJRA 1TM3E 4QQFA 3TR6A 2FRDA 4MUKA 5K3SA 2VT3A 3K30A 3RVQA 3TZLA 5JJ5A 2J85A 5TJ9A 4IXNA 4R2XA 3OZUA 2G8LA 5PNTA 4WZAB 5B58C 1OH8A 4R1MA 1QF6A 4HX9A 1SUBA 4LYGA 4HP8A 4MVYA 1UC8A 4D9NA 1UBHS 3HYLA 3PNMA 5HRCA 4Z8YA 4H1TA 2P65A 2W2VA 4LE1A 2Z5LA 4OOEA 3OCUA 1XA0A 4YMTA 1XTUA 1ZUNA 2YFYA 3GRAA 4FYVA 2H48A 3S99A 2IWHA 1FLNA 2I3GA 3JWPA 4RXMA 4YAGA 2HMWA 1XU7A 3T5GA 3AM1A 2HXSA 2PWYA 3LS2A 3C5WP 3MT0A 4QX6A 5EXPA 3VR1A 4CV0A 5AW7A 4H35A 1GNVA 1MPTA 2ODPA 3W79A 4ZI7A 2GXAA 5KVVA 2QTAA 1HYEA 1FLDA 3GRFA 2PIDA 3PXGA 7ADHA 2Z6QA 1N9KA 3STUA 4CDNA 3KKLA 1TO2E 1KH3A 3HKCA 2PV0A 3QKIA 2WWGA 3ZXUB 5BVHB 3CVYA 1NR1A 3RBXA 2QL5A 1P45A 2C4NA 4A5OA 2A7XA 2RKBA 4GLBA 4R1NA 4C0SA 1FFAA 3DKPA 4DLWA 1ESZA 2LRHA 2QSZA 1Y33E 2XYPA 3H16A 3IMCA 4G07A 4UAJA 3KQOA 1QVRA 2WNHA 1NXPA 2DQSA 4H17A 1OZGA 3I6ZA 2QVYX 1XFDA 1CX9B 4C07A 1WXEA 3R3SA 1VRCA 2CF6A 3H18A 1OGYA 1W75A 1UAYA 3LSTA 1HLFA 5KQSA 4OHPA 1X77A 3ZDCA 1TVEA 3HJRA 3I2HA 4KLCA 4DCSA 4GSKA 2D3WA 2RONA 2NO4A 2WHPB 1VSTA 3LBHA 4RYDA 1I1OA 4G81A 3Q0IA 2H1SA 4RY9A 5KDOA 4EO7A 4UASA 5HJEA 2OZLB 2LUOA 2GARA 3AIMA 2BBSA 1GYQA 5EXTA 4BXOB 4E5DA 2NT3A 1JYEA 1K68A 2VPWA 4YUZA 1P2TA 3PUKA 1VXRA 4BY9E 3H87A 2MINB 2ZG6A 3FHCB 2O2JA 2PSHA 3KHUA 1AZWA 1JB9A 1LNQA 4C4TA 4EATA 5EE0A 5JROA 3H9CA 1E0AA 2DFTA 4OH1A 3DZDA 5A3SA 1CJSA 1FNCA 2PK3A 1L1RA 4MEBA 4BZQA 1MIOA 4H6PA 4TV8A 3RARA 4PC3A 5REQA 1H9BA 3R4CA 3WLOA 4YJHA 3DCJA 2PBFA 2YWDA 2CV2A 2R86A 4G0OA 4GKVA 4NJEA 2B7CA 3BXPA 3SIWA 3ABRB 3JZDA 4K6KA 3KEGA 1I3NA 2ZRKA 3R9IA 1B6TA 1JDTA 1U1CA 5CA1A 3SZRA 2YXLA 1YZGA 3GJ0A 2PL9A 1O95A 2BP7B 1ZD9A 2IIQA 1EVZA 3MTDA 3VI3B 3DT6A 3KUXA 4E4TA 1VL6A 3NHYA 1P2VA 4FNGA 2D0IA 3M3DA 2MJLA 1T4BA 4CL8A 3PKIA 5F7ZA 2YYYA 1XQYA 4URXR 3HR4A 5CNMA 3JATB 4M8KA 5FNVA 1JLSA 1HLPA 2WZBA 1W9MA 5HX7A 5LBUA 3CE9A 5C8YB 2RARA 3CPHA 1ZP6A 2IYFA 2HDNB 1PJSA 3DWEX 1Y7PA 1FF9A 2ODBA 4IDDA 2L18A 5BUSA 2G80A 1TO1E 3A6DA 3MUEA 4IJUA 3RS7A 2MTBA 4MUAA 3VO2A 4NAHA 1WD5A 2PUDA 4QODA 2WKPA 2D2IA 2HBQA 3LTNC 4EL5A 3I9JA 4Z6KA 3OCYA 4Q4HB 5LQDA 1PWYE 3EIOA 2ZSJA 2Y0CA 4KQ9A 4QELA 3T9BA 1J49A 5IULC 4FGLA 4OSPA 2OENG 4E7OA 2FQXA 5EP3A 4B44A 4RYLA 3RFTA 4TKUA 5SY6A 3OJ0A 1CUGA 1LLUA 3KPJA 3VR5H 5EKXA 4YP1A 4Z4GA 1NXQA 4FYXA 2EIHA 1DRUA 2R96A 1SC4A 4LYFA 2WFZA 3FWNA 3QLJA 3ISJA 4RK0A 4Y9RA 3AOEA 1GSAA 2YASA 4K81B 4D99A 4ZQBA 1BGWA 1WMBA 1DDOA 4MROA 1ZD8A 5U1PA 2LKDA 2JCSA 3RRMA 2P4QA 2C2HA 2LCFA 3D4PA 8ADHA 1YZHA 2QY6A 2JL1A 5AW8A 3DA8A 3K5HA 2FK8A 1LBSA 3OHPA 1LDEA 4NPAA 2AZDA 4Q1EA 1OV6A 4B3JA 1O0SA 4UAUA 3AEUA 3K71B 3QBTA 2DFLA 4PSKA 4RIEA 3LG2A 2XB4A 1J99A 2XUJA 2WA1A 2ZAOA 3AL3A 4FR5A 3EZ7A 3AOGA 4PC1A 2VUHB 3ACBA 4R71A 4KKXB 3UICA 3IP8A 1R6DA 4HI0E 3EZ2A 1WOYA 1VBNA 1KI8A 1Q21A 1I10A 1C8BA 2BZ0A 3GFGA 1OAOA 3GN2A 4ZA2A 5HZGA 2O07A 1HDCA 1XZCA 3RT9A 2NOAA 4GPBA 3FZGA 3QLTA 1WP9A 2C9CA 2WIGA 3JAWB 2CLIB 3Q1LA 3ZD8A 1HG0A 3NHWA 4GKJB 1I7NA 1I2DA 2CXXA 3KWJA 4M1QA 4MJ7A 2QRLA 4ARCA 4OOFA 2YWXA 3PFWO 2XMBA 4U2KA 5BN3B 4FBMA 1U9JA 2VPZA 3WYEA 4P5EA 1ST3A 1LBQA 4KBYA 1TUEA 2LCIA 1P7YA 1R12A 2O3SA 3CRNA 3M4YA 4TVOA 2OFOA 2ERYA 1AK9A 1R0CA 2OCGA 2IH2A 4X92A 1NNEA 1F7VA 2IY9A 1ZGJA 4EG8A 1SXJB 2UYOA 4PE5B 1NVVQ 2VP5A 2FPRA 4WFKA 5AVRA 1U2SA 2J30A 3A58B 3JZMA 1TM7E 3TIVA 2BMDA 1LTKA 1SRRA 2JH9A 4CMIB 3OEWA 4IAOA 5J2TF 1NF8A 4TOIA 3WX0A 4GICA 2GT1A 1EINA 3O4RA 1CUFA 3HYSA 2IYVA 3NJ4A 1GKUB 1GITA 3S70A 3HYRA 4LEIA 4M0UA 3WBBA 2RHGB 2ZCUA 2PRYA 5CITA 1A9TA 4EM6A 4MB6A 2IHJA 4RPCA 2BHTA 4A0HA 1HBJA 2CNDA 2OAGA 3OZ7A 1QLJA 2CNNA 3U5ZB 4OLAA 2BRUC 2QG9A 4KXVA 5M5BA 1OWOA 2RGNA 1QV7A 1PEDA 2F3PA 3V9AA 1JU9A 2PKQO 4G5HA 2JARA 5BNFA 3TZBA 5FPPA 2PJDA 1EFKA 4RHEA 2WIDA 1AKYA 4DEXA 1M72A 3PDIA 4LDAA 3D8SA 4ZOLA 3TSOA 1JZTA 1S8FA 2WG2A 3Q40A 2DPLA 5CLIA 2BFFA 1TEZA 4B73A 4LF6B 3W7AA 2F3RA 2QV7A 5KYNA 3SQDA 1M34B 1GP2A 1L7NA 3CUYA 3CVOA 4WW0A 5F1PA 5KWIA 1I4LD 1PKEA 4MLCA 2C7BA 1G38A 3R0JA 3H1BA 1O8BA 3DDWA 3HCPA 3BTOA 1B8VA 3ULKA 4BUCA 4DJAA 2ENWA 4M1ZA 2Q46A 5IAOA 3DDSA 4CQLA 4C6HA 3WJ1A 5C51B 1YB1A 3DMDA 2H18A 3OJLA 5JWHA 1TM1E 2IPMA 4DHWA 1P4JA 2Q3EA 2OR3A 3ABQB 4YRTA 3LGSA 3S2SA 1YTLA 4DE5A 2OOSA 1XZEA 2WYUA 1VCNA 4TL6A 5T3YA 4DSNA 3T5AA 1PT8A 2HYDA 3BJRA 5EKUA 3P0JA 1WKVA 2DTDA 3JVDA 2QGFA 3TSWA 4F38A 4CEJB 1F5SA 2BTQA 3QEKA 2I6XA 5JPDA 3O7WA 5LD2C 3IHWA 3L84A 2F00A 4IHJB 2QRPA 3ESQA 1YS1X 3O73A 4MYHA 4O4HF 3TEMA 2PDAA 4EO4A 5ICMA 1EGAA 4LJ5A 4Y2HA 3CO5A 4AZ0B 1XYGA 5FUBA 1T6YA 3DAPA 1P74A 2LNDA 4N54A 3QLUA 3ZH9B 1MD9A 2HDHA 2CVOA 2ZYVX 3ZNPA 2ZSAA 3T9CA 1E1DA 5ITZA 3LF1A 4LRXA 5TPZD 4DIFA 4DLVA 1WL8A 5FOTA 3GZNA 3PXBA 3C24A 1IEQA 2AH5A 3DLHA 1AKUA 5E9QA 1XZLA 2Q1TA 3I9FA 2OILA 5DYYA 1E2JA 4CTKA 3DL7A 4WLNA 1P4HA 1R4ZA 2MIIA 1WZUA 3OIYA 1QYDA 4N76A 1W0JD 3IHLA 5F35A 4S1TA 1H3FA 3FBGA 3DUFA 3FCCA 3MINB 4J1TA 1UMDA 3D7KA 4QSHA 5THKA 3DKKA 2LR0A 4L8WB 5JMTA 4GW3A 3GOQA 1XALA 1VPVA 4ZXFA 3ZY5A 2QMYA 5K0EA 3EYWA 3Q7SA 4OHOA 2QLLA 2EGUA 4HMPA 4WKBA 1QFSA 2G70A 4QNMA 2ILVA 3TQOA 5C32A 1E1RA 2XYVA 1EVLA 4CG2A 1I3CA 3FSGD 3ONVA 3VPDA 5T4HA 2C2GA 3GT4A 5CT6A 4FZVA 3VU3A 5E1DA 1M1NA 3WNQA 1AUVA 2UVDA 1CUHA 3EVGA 3K5WA 2VLIA 1USKA 4CG3A 4XPZA 2PS0A 2PV7A 4HH1A 3K2QA 1ZJYA 5KUTA 4EJ2A 4ISCA 4QOHA 4MGKR 4D42A 3PDUA 1YFLA 2Z8XA 4L5JA 3SD7A 4YPOA 1Q77A 2PUCA 5HVNA 2DWOA 2EP5A 2B8JA 3MBIA 4MW1A 4R8SA 2H0QA 3M1YA 1NNI1 3IOBA 4DJDC 1XX6A 3O7MA 5KTYA 1BFKA 2ZITA 4ENPA 1TECE 2VYNA 5KHAA 1VRWA 3WP0A 1XZIA 2D1QA 4ITRC 3ZWBA 4D4IA 1H65A 4Z2AA 1KEUA 1GOTA 1OXMA 3SOZA 3WWYA 2QLFA 1KETA 4JFAA 2ATIA 3T3GA 4RWEA 3BL6A 3ET4A 4ZRDA 3M1LA 2C29D 3LQQA 1AGYA 2Z5GA 3ZI4A 4DQKA 1G21E 5AJZA 1K0UA 1NW5A 5FUQA 4OA8A 3SKVA 4G41A 1GNRA 2V45A 5L3QA 1TZBA 1RWWA 1KVRA 2H9IA 1F4PA 3GVPA 5FKJA 5JS2A 3WYGA 5ANRB 4PLYA 4DDWA 1A4RA 1H42A 3SYRA 3IIIA 2XB9A 1ZJZA 1IHXA 3O90A 1JG2A 5DTMA 2OTCA 1G0OA 2EQ5A 2JCYA 3AINA 4J3NA 3RRFA 3F5DA 2WIJA 2FR0A 3H05A 4KIFA 4TL7A 1RHMA 3RIYA 3VSAA 1U3FA 1SAYA 4Z1MA 2O3JA 1IL0A 5AM1A 1GHTA 1XXHB 4HWRA 1KDZA 3SYMA 2OCPA 2JVJA 1QX3A 4QNNA 1QQ5A 1RNLA 3PICA 3QHAA 4E2FA 4AQYB 1CDOA 5JAMA 2J4FA 3PTLA 4TXMA 5T8KA 1PJ8A 1DEOA 3G1WA 3L07A 4L5YA 1BD4A 5AJUA 4UTPA 3F3YA 3INRA 3CUEF 3KQYA 2ATCA 2C5SA 4B6JA 2YRWA 5BW8A 1C9EA 2C99A 2BMFA 3M6FA 3BWBA 1XTQA 4TWZA 2PLNA 3O8DA 4WTOA 2Q1WA 4H7HA 4JLVA 4O4JA 1XTRA 4TQAA 2QVLA 2VF5X 3GJTA 2A0FA 3IP9A 3IQZA 1KC3A 4IIFA 1RQNA 1X7WB 1FXWF 3TKAA 1JLMA 2HD4A 4LQLA 4BDSA 2PUEA 4EF6A 1GWNA 5D6OA 3UJDA 2JLRA 2XKBA 1RAHA 3UT0A 4CUZA 3O94A 4OHFA 3I09A 1LLQA 1I4TD 1RKUA 5GV8A 4B3DA 1JMVA 2VSNA 2CL5A 2COKA 2H2GA 2JLQA 3EXFB 1SZCA 4HYQA 4WXHA 1EGQA 2Q4EA 2JDID 4B4KA 1OI3A 1TYZA 2NYRA 4X91A 2AE2A 4QICA 4JENA 2B99A 4RVUA 5DVZA 3KPUA 4G8BA 4F3KA 1PJTA 1Z5ZA 1OHHA 1ZX1A 1Y48E 4Q1AA 1I7LA 2FDXA 3BRWD 3HYNA 1XD2B 4RV4A 3R7WB 1YBHA 3HNRA 4CCYA 2IBTA 3FDZA 1HDZA 1URPA 2NPIA 3ZVNA 2NZWA 2Q2OA 1V8OA 1MEEA 4MQ6A 2E1RA 1KFKB 4DJEC 4JYMA 2Y1EA 1EFVB 2XQKA 3AHCA 2A92A 2J9XB 1E9SA 4JBYA 5JUWA 1FDTA 4G1BA 3CW9A 4M8LA 3B3GA 1DB3A 1SUEA 1XCGB 3GFBA 2AOXA 4IMPA 3GI1A 2VXOA 2YMQA 3CSUA 3DYVA 3F46A 3ZDZB 5CIWA 2NWQA 2R62A 2D54A 3ZE1B 3ZOKA 3P71T 2LIPA 1FTYA 2Q5HA 3T7SA 3RQSA 3UWMA 4B46A 4DQ0A 1DS6A 4URHA 1RFLA 2OOKA 4NWIA 4UUNA 3QXHA 4NCIA 2BC9A 4E88A 2VJMB 4JLKA 5DNDA 4OATA 1ZK0A 4N3NA 3PZRA 5JLAA 4JXJA 3RSGA 2UZIR 5TGDA 1AHPA 1TW3A 4NI5A 4EGAA 1SXIA 2JJ8A 3RBZA 2IQIA 3R6DA 4N0PA 4DT1A 2LCQA 4AJLA 2ZDGA 4OB7A 2O8EB 2QJOA 4KODA 3NNDA 4YRSA 4TZ6A 3UKDA 3WLEA 1SIOA 5JISA 1G5RA 3BL8A 2M6RA 4AS3A 4U7WA 3KL4A 3CEAA 4M9CA 4YGYA 5AVTA 1DAHA 3H6HA 3VJLA 2BFMA 2NYVA 3SY8A 1XMIA 4PCUA 4TQ9A 4E13A 3NEAA 1THGA 4POAA 1WMSA 3OFVA 2I7TA 4G1CA 4OLJA 1T8TA 1QH0A 2OGTA 5HFNA 1QJCA 4IOJA 1DAMA 4E11A 4D6XA 1ZNYA 3R75A 4MRAA 4E5UA 2AD5A 5HNKA 1YKSA 1I7QB 1A4UA 1YI1A 1Y82A 2W5UA 4JCCA 4QU9A 1UXGA 1SCDA 4ZCMA 1ZH6A 4M4SA 4KQMA 3NHJA 4IIYA 1R4MB 3KE9A 1SQFA 4GX1A 1N5JA 1IDOA 2GOYA 1T4MA 2I76A 4FBLA 1X1SA 5U4XA 1U7XA 2VH1A 1W6UA 2JAWA 4Q93A 5A9SB 3KOOA 2FZGA 1OV4A 4X66B 3EEOA 3DAFA 2RBKA 3T9FA 4LOHA 2HPZA 5FT9A 2BFBA 4B81A 2SNIE 3VKVA 4LC0A 2AFIB 3ELBA 5KI6A 1K7SN 4D3YA 3BMCA 3KKKA 4YGXB 4DQUA 1A3CA 4YA6A 2I1WA 5HXAA 3WK4A 2R7AA 4YCDA 4DDMA 2WMYA 2ZTUA 1E3EA 2VFAA 3M5PA 2O3TA 4JI5B 5LMUB 1L5LA 4AM8A 3MWKA 4S35A 2IZZA 2OCKA 3OM8A 1HEIA 1U9CA 3OESA 2IIPA 3AB8A 4WCFA 3W90A 2X6TA 3JV7A 4MV4A 4FNOA 5E4TA 2Z2XA 4HVAA 1OLXA 2OGSA 1S9DA 4YDSA 3N7UA 1T3ZA 2IDJA 3LZ6A 4RLQA 1JEQB 4L16A 4MKIA 5JSUA 2P41A 4R7ZA 4DF3A 3BZUA 1Q11A 3E2PA 2WPDD 2GHQA 5IDXA 2XD9A 1RD4A 1X74A 3VYWA 3I32A 3AR2A 4B17A 5D3ZA 4A91A 3G85A 1HI9A 4O2BA 1HLDA 3LDGA 1ZJJA 3Q98A 5GZ3A 4BRUA 4NZNA 7REQA 1V8PA 3ETLA 3P0IA 1RAAA 1SKQA 3D8TA 1Z6ZA 1PBNA 4N3GA 2FR8C 1ORHA 1XMVA 3FF4A 4CVNA 3C6KA 4PY2A 1XMQB 1OKKD 2XQVA 1NP3A 3AEQB 3KQTA 3GJ5A 3WK6A 1PYGA 3EPLA 1SJ9A 3LBAA 3W6PA 3VU8A 1WXDA 2CCGA 2HRQA 3TJRA 2PZKA 2E4UA 5FUMA 2CV0A 1GGJA 2QU7A 3GJSA 1WZIA 3N9IA 1GFIA 1KMQA 2XNJA 2PLWA 4WN9A 4YQZA 1ZCFA 1N5DA 2POCA 1FSGA 2X4LA 4JEMA 2AZXA 2K7ZA 3N8GA 3P9CA 1VG1A 3RRNA 3IE1A 1I4EB 3OE1A 5D51S 4EVRA 2OBBA 3QG5A 4HNTA 2EP7A 3AI1A 1OLSB 1CUZA 2J5RA 4LTMA 1TFRA 4E7PA 1FDVA 4M0MA 1C0KA 3B3AA 1ZW1A 1KAQA 2GEKA 4KVZA 4DCNA 4U7HA 3TMAA 5CAEA 1W4AA 5AM3A 1JPNA 5C8ZA 5LVAA 1O9HA 4KH1A 3TIXB 2G5GX 1S02A 1YR6A 5JQGB 2J3HA 3E03A 2HZ7A 3NTRA 2ZEJA 4JB3A 2QTTA 3ELYA 3T54A 5A1TA 1G3QA 3E3NA 5H02A 4G5RA 3F3KA 3HU5A 4FI3F 4O1MA 4GIBA 3GCWA 1YGYA 1CUDA 5B1YA 4TSFD 2JBWA 3TB4A 2GETA 4D7AA 3GQBA 1WCIB 5IS2A 2NQ2C 3H6KA 4N0EA 4ALLA 3EZ6A 1OLUA 1ZHFA 3LECA 1K7FB 5DHUA 3ZDEA 4BNKA 4CGZA 1RYYA 4RKQA 3G0IA 5ALXA 2O8DA 1ZMRA 3W9YA 1WZCA 4GDFA 3D02A 1NONA 4CNBA 4LF7B 4GPZA 5BSEA 5HJ7A 3JQRA 1AGPA 5EIAA 1P39A 2HCTA 3DAYA 3BEOA 5DZSA 5JZBA 2C7RA 3CN7A 4ZHQB 3L40A 4WE3A 2I3BA 1B8NA 3PQ3A 4KQ6A 3RS9A 2HUNA 4RKRA 1TUGA 4YS6A 1S2LA 3PJDA 2X0DA 3RFUA 5CBKA 3PPYA 3IR6A 5KWEA 1LV8A 3EC2A 1XTSA 4MCAA 5CNKA 5F77A 3IAS6 2YBEA 3TDNA 4N48A 2X58A 3GLFA 1HORA 3DOHA 3ZC3A 2ZE6A 3VM6A 3KL2A 2LP4Y 3N70A 1NJ1A 4U3JB 2GESA 2J0EA 3WWOA 5FOWA 4IGKA 1S1MA 1COZA 5L45A 3L06A 1ZOSA 4KWCA 1I2CA 2VNAA 3NHFA 3ON5A 2BR4A 1P81A 1O57A 1V35A 2Z57A 1KDTA 1ZBQA 2A3RA 2XWBF 4R5MA 1XMSA 4EIWA 4DA0A 5BRJA 2OCAA 3DGEC 4HQ6A 2Q29A 1W34A 2IA5A 3QNWA 2WTAA 4RVNA 1A9QA 3PR1A 2ATXA 4MVJE 4Q1FA 2YQ5A 4MRRA 1Z0FA 3K9GA 3H2BA 1HT2E 2J33A 1Z4OA 3ZPXA 5DM4A 1YB5A 1NN3A 3DDHA 4Y2SA 4X3OA 1S4MA 1E1LA 1OFHA 2JIMA 5JCOC 3T15A 5KTNA 2WU1A 1J8FA 4F9FA 3GPBA 4AO8A 3PQEA 3BCHA 1SVNA 3DE4X 4BHTA 4ENVA 2QKYA 1CFZA 2DSNA 4V1CI 1WNTA 2IV7A 5FL7A 4JOBA 4AKTA 3L0PA 4US1R 3MTJA 4Q01A 4QHTA 2B30A 2B82A 1CUYA 1E3QA 1TF5A 3DKVA 3EVNA 4CF3A 2PU5A 5KC9A 3VKHA 3P0FA 1ISPA 1NF3A 1AN9A 1CZUA 2XLBA 5AJYA 3QW4B 5IVIA 2HSDA 2F55A 2HMSA 2ZCVA 4GLJA 1A1VA 5JJKA 3SZOA 3QVGB 4JT9A 2V65A 4QYMA 2N1BA 5F7OA 4FHDA 2AFHE 2Q2WA 3L7DA 4EUNA 2A9VA 3OMWA 1KFCB 3T3DA 4AYXA 4Y6PA 2WWIA 5K8CA 2OXIA 3EQZA 1RZVA 1SXQA 3C97A 3HCWA 5IAGA 3UJBA 1VQ1A 4GBED 1NJ2A 4TTTS 1A1SA 2AQ8A 1QK3A 2JJ2A 2VIIA 3JD1A 3R6GA 5HF5A 4Z7OB 2WQ6A 3COYA 1X1TA 3DZ8A 4UU1A 4PZYA 4X63A 1WY7A 4BVFA 2NPOA 6Q21A 1Y98A 4JQSA 3WIVA 2Y1CA 5CCEA 3DJYA 3FPLA 4JT2A 5HMLA 3GA7A 4L50A 1D07A 2EOAA 4D25A 3QK7A 4JH0A 4IPTA 4CDGA 1TT7A 3IBCA 3NKVA 5HRUA 3AB3A 3M9XA 1AKTA 3PXAA 3AUJB 3EDOA 1XDZA 1Y4AE 2FX5A 3FNQA 1SBNE 2ACEA 4I6JA 4RS3A 1MGOA 1QG6A 3M82A 3QA9A 1UOOA 2Q6VA 4V2IA 2G17A 5FLKA 1ULBA 2EQAA 3SYLA 3LWBA 2JRCA 4LV6A 3QMMA 3K1JA 2ZYUX 1U0OC 4P2GA 4HAYA 1UK8A 2LE0A 3CNQS 3CT6A 2IHTA 3DBLB 4FR0A 1I33A 2XEXA 2OFWA 4MV5A 4ZARA 4OHRA 2YMPA 1DEKA 4ZVMA 1DKUA 1PT6A 1T0BA 2VYCA 3AM3A 4OFWA 2VJBA 3JALB 3K2EA 2HEGA 1DTEA 2JI8A 1C9YA 2J3JA 2WM9B 2J9YB 1XTTA 2IWRA 1W4RA 2OBYA 1LJUA 1XVLA 3VH2A 1DBRA 1ZLYA 2CEAA 4IIJA 2Z9CA 2JANA 1ZIXA 5LPNA 2JLWA 1XMOB 1U0LA 1TQDA 4R05A 2AOTA 2B2CA 1DV2A 4AUKA 4R0NA 5MN4A 3CA8A 3DDNA 3ZVRA 4I46A 4ZPXA 1PV4A 3WGYA 1T5LA 1TJ3A 4F3NA 1MDFA 2J6CA 1Y7IA 3K9BA 5CLGA 5EVCA 3H7AA 2PMBA 3MN1A 4M0CA 1E3IA 1F8UA 3EOAI 4GI7A 4ZTUB 1J2EA 1NQUA 4ZOAA 2O0JA 1XLTA 3DMHA 1GCOA 2REQB 1VE3A 2AQKA 4FYMA 4ND8A 4TS4A 4CODB 4X1OA 2Q4DA 3NETA 3VI4B 1OILA 1YONA 4JKIA 4QO8A 5HHTA 5K09A 3C4QA 2V9ZA 3KV3O 3HY3A 3UG7A 5FBZA 5FAKA 1YASA 4F96A 1PJBA 5M2QA 1JWBB 1XCOA 3AKDA 3PXXA 4XJVA 5JJIA 4R2WA 2IXBA 2IGBA 4M9UA 4E5PA 1UH5A 3OT5A 1JDNA 4OM8A 1U0BB 3CLTD 1KDPA 3GBPA 1J7KA 5KNBA 4X60A 3ORHA 3U60B 4OKIA 2GAFA 3FR8A 3BICA 3AESA 4FCWA 5K4HA 2X2EA 4Y0NA 1XG5A 2W83A 5B7PA 3B9RA 4LJ8A 2V3VA 3CX8A 2I71A 4EKYA 1TXGA 1CZNA 1XTVA 3SN6A 3CKLA 4WASA 4BS9A 5CEJA 2BD0A 2HF8A 3BRCA 2FEOA 1TA9A 3LMKA 2C95A 3TD2A 4OSEA 3WL4A 2MMGA 2AR0A 3PC4A 2NVBA 2AVDA 2HK7A 4DMFA 1JALA 4IWYA 4AY6A 5DO9A 4A2QA 1JIXA 1RYHA 2BWJA 3NGMA 4U2EA 2H3HA 2YJGA 3JD2A 1E6UA 5H80A 4E0BA 1IU9A 1E2QA 5B1EA 1G20E 2GXUA 5JH7B 2CFTA 3QOXA 5DXFA 1JIVA 3BMOB 5IAJA 1HURA 3L0DA 3PHBE 3K0FB 1M2EA 2O0LA 3AK4A 2UZ1A 5DJ5A 2BGLA 2XGGA 1IZ7A 2BHLA 5IWAB 4S1PA 1OBFO 4FBGA 5T3UA 4MVXA 1AXGA 1DAEA 1T10A 5E2IA 4C2AA 3P9NA 3D1JA 3BC1A 4OBXA 2PUWA 1RZ3A 3M83A 3TK1A 2ORED 4O8CA 4EZEA 2HMAA 3EG9A 3HVHA 2ZWPA 3TMKA 2QTFA 1V16A 4OQMA 2OGUA 2WIAA 3L0SA 4XJSA 4G37A 2QQFA 1A9OA 3OM0A 4JJGA 1KZ4A 4UUQA 4OAQA 5IYZB 3FI0A 4RD0A 3IP1A 1RQXA 2GUGA 1PCXA 2C96A 1E20A 1TC1A 2Q0HA 3GCZA 2HHCA 2ZRFA 1QZ3A 4NCKA 4AKGA 3I9KA 1Q0QA 4ZU3A 1IBLB 2ZRPA 3WKAA 4KZKA 2I8AA 4Q24A 3RJZA 2BZSA 1IC6A 3OQVA 1T2FA 4WLUA 2PTGA 2C9ZA 4Y2RA 4Y7CA 3EMBA 6YASA 2PAFA 5J1TB 3VX4A 2BEVB 2BEWB 2C58A 5ALMA 3MMXA 4IOKA 4LSWA 1J39A 4PFJA 4XZ3A 3AB7A 1NR7A 3D7NA 1B43A 1K8YB 2AEFA 1VCIA 1VL2A 1RWPA 1IXKA 3H0EA 5E2BA 1QAQA 2P35A 3B3JA 1O5IA 1SBIA 3HCDA 3IAEA 5AVWA 4EGJA 5CA1B 3E27A 1Y3BE 3L7AA 4QUKA 4P5PA 3C8DA 3SEQA 3S5JA 1ORVA 1H0RA 3MXOA 2J5BA 3HE3A 3WLMA 2EKBA 4RE5A 3AUKA 1BMFA 1YZLA 4GL2A 3A2LA 3UTDA 3BGOS 1ZC4A 4JJEA 1NG1A 4GWKA 4OGGA 4WBXC 3E3OA 4C88A 4JL8A 1KU6A 3I2YX 4N7BA 2CDNA 1OGIA 3EW7A 4YRBA 3ZBUA 1DELA 3OC6A 3V32A 1FNNA 4ITUA 4TV8F 3ZHCA 3B2NA 1OFTA 3P26A 1RVDA 3BXZA 2GPSA 5IAEA 4GP7A 5DOVA 4ARBA 3EQ9A 4NBTA 4F45A 5IT5A 2IH5A 1KEWA 1FJ2A 2YWGA 3D6JA 3NOQA 1V7QA 1S89A 4O3MA 1UP7A 1R8SA 3R5KA 2XOEA 4EJFA 3RSHA 3C6YA 4JYCA 1NW6A 5CA1F 5HQ3A 2C92A 5HOEA 4FHCA 1RLJA 3ZX5A 4C4AA 4RTMA 3HB4X 3HVIA 3DG9A 4AD8A 4KLZA 3CNLA 1BW9B 4RY0A 3I9LA 5GJBA 1WF3A 3KUDA 4RAOA 2B6NA 3KWMA 4E2WA 3DYBA 4G4SP 4K6OA 1BHO1 3HB1A 4MVJH 4M37A 5K4AA 1Z17A 1NW8A 3U3KA 2WILA 4I14A 3ORSA 1GTG1 3PNOA 1E8MA 1MPXA 4LZJA 2ATVA 3ROGA 1YBAA 2DPHA 2HGZA 5KNCD 3O9MA 1R3DA 3QPBA 4UAVA 5FNVF 4DCJA 1XNQB 2OK7A 3DVRX 4ERXA 1U1GA 3KOXA 3GLGE 2YL2A 1FY2A 1YB2A 1F3OA 1W1IA 2P79A 3LCUA 4EW1A 2PGOA 1IY8A 5ESDA 1QQBA 3V2HA 3KTAB 3VC2A 5B37A 5GWXA 1NVDA 1R64A 4EG0A 5TVGA 1N2JA 1OY1A 1RW4A 4NATA 4BLQA 2P5TB 4QOJA 1HKHA 1YNSA 1J2RA 3IMKA 4UAGA 3CR3C 5GGXA 3AFGA 3VHRA 2VZLA 1KY5A 2CVZA 5AQ1A 5IZ4A 1Y3IA 3LT0A 2WAAA 1SIWA 2H4WA 1T3LA 2R8BA 4FOTA 4K9OA 2HFKA 2NU9B 4CDRA 3LUDA 1X7ZA 1GAEO 3C3JA 4H0FA 2FQWA 1OH7A 3BERA 4GX5A 3OP4A 3SU8A 3JRWA 5EQJB 1JBKA 3LRPA 1RQ2A 4E6EA 2D0DA 3I6QA 5HRAA 3S7ZA 4RBNA 2H4XA 1NMXA 5E38A 2OKGA 13PKA 1CD5A 1ML3A 1NJGA 4JD5A 5EIOA 2ZDQA 1VYTA 5G0WA 1Y63A 3AKZA 2VPXA 4BU0A 1VIVA 9MHTA 4LCJA 2GDJA 1FLAA 2JHGA 1PZMA 1ZCZA 2X9NA 3MJFA 1EUCB 2XCSB 5A5GA 3OQMA 4RWZA 1XJ5A 1RQRA 2VHVA 1ISMA 3BORA 421PA 5EHNA 1Z36A 2X9GA 5IVDA 2FN4A 2G4VA 4UFNA 2EF0A 1J06A 1DRVA 4I3FA 5DLEA 1ECJA 2QN3A 2VG8A 5BW6B 4R01A 3TOVA 3LGAA 4S3MA 4NDAA 4HNQA 4JQYA 4G8DA 1FUUA 1C9JA 2NO1A 3BD6A 5KTSA 4B87A 2ZUVA 1FMFA 4ARZB 4X8OA 4UPVA 3ITEA 4PO8A 2VHCA 2OAEA 2WVHA 4Y8VA 1T6BY 2YDXA 1HSZA 1P0PA 3EC7A 1AA9A 4EVQA 3L79A 3TWOA 1QTNA 3VSDA 4NZMA 2H2WA 2QDXA 5BOVA 1N0WA 4ML3A 2Y9MB 1AC5A 1DBQA 1WAMA 2D8MA 2O8FB 4KQ2A 4IIVA 3A05A 5DXJA 3D81A 2NIPA 3M89A 4JVNA 1SMKA 2OV2A 3MOSA 4W5WA 2J48A 3KPYA 5JTUA 5KTMA 1SKMA 2PZJA 3AKEA 4NCXA 4GI2A 4L73A 2W6IA 2JLZA 1E7RA 3O82A 5G3ZA 2IHVA 2ZB4A 4MVJG 2X5KO 4FLMA 5A6SA 5T4EA 1ZU5A 1O96A 2RKWA 3CURA 2OWEA 4MA0A 1ULTA 5CDTA 2ZWIA 3GAZA 1MDBA 3E5MA 2Z3VA 3ZTYA 4ZCLA 4EY3A 3D8UA 8AT1A 3H1GA 3G23A 5LZ7A 3IXQA 1TX4B 2E37A 1QF9A 2FUEA 1IULA 5JT1A 3VSBA 3UGQA 2I4NA 3HA2A 2I4RA 3ZGVA 4U00A 3FAKA 1W2GA 1TLLA 4TQGA 2GAIA 4O25A 2AI3A 3HJHA 2J3IA 2G9VA 4LJLA 3FSEA 1YZFA 3P96A 2H2IA 5L3ZA 2V59A 3BS4A 4B3IA 4P34A 3LC7O 5EIHA 5BOSA 4ZKDA 1RQ7A 3C3CA 3N6XA 2FPPA 3IRUA 1V5IA 2RHTA 4NZ9A 4RK5A 2FQ1A 3I05A 1CUCA 5L53A 1ATZA 2HRRA 3AY6A 3EISA 1SWWA 4Q9IA 4ZAXA 3TFQA 2W0MA 2JIDA 4Y3UA 4UREA 3VOAA 2HJHA 1NE7A 3F7MA 1RCUA 4LBVA 4ZOLF 4JP2A 3M4JA 4J75A 4U7TB 1EH5A 2ZZNA 1N5OX 2G83A 5CG2A 1JKXA 3VJMA 1LTHR 2POQX 4YDRA 3MWGA 1N1MA 3QVKA 2B92A 5F23A 4Q7MB 4K6FA 1JQ3A 1M3SA 3JQ8B 2Y92A 5E2AA 5KYUA 3DW1X 3ENQA 4B9AA 1U2GC 2L69A 1N2XA 5FQOA 4EMBA 2AJCA 3WP1B 5FPKA 4JLMA 5E95A 4BV9A 4LXQA 2NP7A 4L9AA 4AMZA 1ADJA 4PGFA 3NALA 4Z2YA 1LI7A 4AO6A 3C87A 1Y8QA 2QOEA 4GOLD 1B16A 4KC0A 5FTNA 2XWPA 2G88A 2HSJA 4B79A 4E70A 4ZOEA 4I55B 5DM0A 2I2FA 3PVZA 1XTIA 3PDJA 4FFPA 3RBAA 4R1TA 5CXSA 3AFNA 2JFOA 4DLRA 2O2SA 1ADGA 1ZD3A 2HA5A 4QPNA 3QFTA 2C2OA 3ZNOA 1LQUA 2Q3LA 3E53A 4QQ8A 2XPCA 4YQEA 2XUAA 1BVHA 3EDRA 1E5VA 4QQRA 1UPFA 3PLRA 4HAOA 1ECGA 1JHDA 3B8EA 3V4SA 7MDHA 1U0JA 3BDIA 4DMRA 1WE2A 3IT3A 1GUYA 1PYOA 1ZK2A 5G4KB 1XAJA 1ECPA 1C7RA 1HG1A 1TOAA 1UK7A 3EBOA 3GXBA 3HNOA 1VJCA 2UKDA 3BMQB 5IBCA 4GYWA 4HB0A 1YRHA 1E32A 2WRZA 3GCXA 1NBOA 3H5WA 4FVTA 4IY1A 1GQQA 5L7YA 3CVXA 1QIKA 1KI1A 2QUZA 2RAUA 3QFCA 3UGJA 2EJUA 2P0YA 3N0RA 1G8MA 1FFXB 5BNTA 3FG9A 3FDFA 3H3FA 1LDGA 1M5UA 3CNOA 4XDGA 1P7WA 4MB2A 4E09A 1V2GA 3FCSB 3GPDG 3OF5A 2DHEA 4Y0VA 4LDZA 3K0EA 5IZCA 4C4OA 5K8JB 3ASYA 3F8SA 3OWXA 3UMCA 1V26A 3FUTA 3P4YA 2PL3A 4EB3A 3OD5A 1L3BA 1PX0A 2I6GA 1CY0A 1PJZA 2F90A 2X4DA 3CUTA 4GAEA 4IFIA 1WHSA 3ZKWA 4PIVA 1TDJA 2E1PA 2WM2A 4HTAA 3VKWA 3ZBPA 2A0UA 4YBRA 4UU0A 1WMDA 2I03A 2X2PA 1QK4A 4ZT7A 3VV2A 1DRKA 1VGVA 4MO2A 3VZBA 2RJ3A 1KO8A 1VC2A 5AK0A 5FTLA 1CR2A 3K1YA 4YMSA 4JYZA 1SHUX 1DRWA 2BGNA 2VDPB 3LCMA 3AU9A 4N0MA 4UQLA 1G5TA 1ZA2A 1JR3D 3K2BA 1W88A 3VZSA 1A0OA 2BBWA 1IJEA 3B1KA 1WBJB 4IVRA 4Q18A 4W5RA 3KOWA 3GWZA 2B1RA 4R7TA 3T6KA 5GIOE 1RPTA 3GCGA 3M33A 4P7JA 4DUGD 1P3DA 3DCIA 3D5TA 4QVKA 4F4FA 3U7GA 1B26A 4LPSA 3TL3A 1GZUA 1NVXQ 1KF0A 2IZ0A 5ICCA 3B2EA 3SLRA 1I7PA 3JQ7A 1DFGA 3O91A 4IGEA 3FOEC 4UMVA 3GAAA 4L7QA 4YP9A 1X1RA 1UOQA 5I7AA 4ZQFA 4CF5A 3TTUA 4XYLA 1P4GA 3OZVA 3PC8A 2GCEA 2ZSEA 3P19A 2C5LA 2D5LA 1E1CB 2H2AA 3ICWA 4JFRA 5D1HA 4LJYA 3RC3A 1CE8B 2BH2A 1ZRHA 1BHSA 2JNWA 4MLZA 4ZYXA 4PS1A 1JMYA 5ALNA 2A9PA 4FP9A 3OETA 4LJ9A 4KO3S 3FJYA 1M1XB 3LIIA 4MW7A 1YJ5A 3U7IA 1C29B 5IMSA 1WUJS 4U2FA 5L4NA 1AGXA 2IYNA 3RVMA 1RHQA 3PRKE 1YFJA 3SSNA 2C20A 4Q1BA 3TTSA 4R1UA 2NU6A 1UBJS 1RC1A 1QONA 4D0SA 1H23A 2EW1A 3GUUA 1G9SA 1XLUA 3H8WA 1ZNZA 3KZOA 5PGMA 3ZDRA 1TMGE 3KAKA 2WTUA 5AESA 3NT5A 4TGLA 5FIUA 4G84A 1HDRA 1USWA 4DLNA 3NVKI 2BSXA 3F5QA 1IATA 3LBNA 2CNKA 3TH5A 4EBFA 3IT0A 3Q3HA 1GIAA 1QFYA 1EFUA 3KCNA 3MW8A 1Y3FE 2B8WA 1JR2A 1SZDA 3PEVA 2GCOB 2GLUA 3IILA 3PYMA 4J2HA 4PYLA 1Z7YA 4EX6A 4AX4A 2HREA 3LYHA 3OBBA 4J3JA 3BHIA 2DQKA 4OHMA 5A7FA 5CD1A 1RS0A 1UQRA 1GPJA 2CLOB 1UJMA 2IHBA 2QN8A 2WWWA 3FSRA 3N8DA 1QVVA 4KACA 2YIVX 3LP5A 1LK5A 2ZM6B 2Z4TA 4J2OA 2H7YA 3DXFA 1UL1X 3FWHA 3R2JA 4FE4A 4A2WA 4D4LA 2FLKA 4DLPA 5KJ6A 2O7QA 2XTAA 2X76A 1QCCA 4MAAA 3UAWA 4EQZA 5FJJA 1KBOA 2C98A 4R83A 3AFHA 1K3TA 4KEAA 2F8TA 4WZBA 1OU0A 1X42A 5JXJA 1BXKA 1JT2A 2O2DA 5ITWA 3V4FA 3BSFA 4INPA 1U99A 3PHHA 3EHEA 4I4TA 4IV5A 5LZ5A 3UATA 2XA9A 4JOCA 4PSDA 2QB5A 3E2IA 5KYGA 1D8AA 1IWPB 1QIEA 3STTA 2VDVE 1XVUA 4DLSA 1AS3A 2GGSA 4JSTA 3LUGA 2RHWA 1K7CA 1CJUC 2Q6KA 3QKSA 5DLYA 3SC3A 2FEXA 4S1WA 1WU7A 3MRSA 3DTVA 4MTCA 3D64A 1D2NA 1JAYA 1G16A 3TTVA 4PYMA 3HN2A 2X1MA 3E22B 1YUNA 2VUUA 3E9ZA 4RADA 3RWOA 1PV2A 3K0BA 4HWTA 1RI4A 1T36B 1WDKA 2PA0A 2YV4A 3I9V1 3K05A 1Z12A 3QPAA 3T5CA 4XX0A 4RY8A 1V1MA 3O3NB 3OSZA 1OCEA 4K3UA 4B6RA 1YJBA 3AERA 1Q16A 3TFOA 1TT5B 1Z2PX 4JLOA 5CMLA 3THYA 3LOQA 2JGKA 2G76A 5EJMA 1X94A 1P6UA 1GAWA 1XELA 4QJ5A 1PTKA 3LUHA 3V8BA 3ZBTA 3MGKA 2C83A 4NPCA 3T5DA 2QR5A 3LFTA 1CUEA 3QI7A 2BLLA 1YRQA 2ZBFA 2Q6OA 4A0GA 2GK6A 3BIFA 5LDHA 1W1WA 2R7MA 2AUTA 3ES9A 4CMEA 1OC2A 4ECEA 4J0CA 1G5QA 2FOLA 2X40A 5LBTA 3R74A 5EJEA 1FXSA 3GRVA 3WLKX 4F5DA 1ZH8A 1R8YA 1H2FA 4J0KA 1EVIA 2OAP1 3PDWA 3SS8A 4U6QA 2ALJA 1VJTA 1BG6A 1U80A 1V3UA 1WU8A 2CSUA 2HMVA 2JIOA 3L8ZA 3U44B 2BKUA 5CEFA 5F52A 1DU4A 1LC3A 4HB3A 3EQ7A 2IP4A 2IEGA 1Z08A 3MK31 1KZ9A 5IDQA 2GUWA 4WA8A 5ALYA 1UXJA 3QVJA 1W36B 1F6BA 1NBMD 1QE3A 2OP0A 3KE8A 1MAVA 3GVXA 3N07A 2AMLA 2DJIA 5HCUA 1XQWA 2ADOA 5L40A 1E3LA 2I62A 3DR5A 4GOMD 3ZV5A 2WQ7A 1D5WA 3NDPA 1YE5A 3V33A 1MQ8B 1Y5LA 4ROTA 3UAZA 2JGFA 3EFEA 1GSIA 3ZH2A 2R66A 3MT8A 3K9WA 3U31A 1E3JA 1YZUA 1T9HA 1VMEA 1YDWA 2JLBA 3LCCA 3KG2A 4X84A 3V6LA 5BVHA 5EJGA 2BMEA 3WKEA 2V5UA 4GWGA 4NCHA 1UXHA 4KDFA 2R44A 1XR3A 5BMVB 1DJMA 3D4LA 1XEXA 4R54A 4M6WA 2GM9A 4D6YA 1OI4A 4FB4A 4JJFA 2UZ0A 2I4OA 2CXQA 1A5TA 2ET6A 4HDQB 4AIIA 1BOFA 1SCBA 4QT0A 3L46A 4JJIA 5C8VA 2Y27A 1E2IA 2FETA 3K8ZA 3S40A 1BA2A 1FYWA 2SKEA 4K87A 3K1ZA 4PQEA 1FEZA 3ZGOA 5K0JA 2R6ZA 1KDOA 3AGQA 2WHPA 1L5ZA 2C4VA 4JMPA 4LMPA 5EERA 2E5FA 3BH0A 3O1HB 1UBEA 5CDGA 3U7EB 3KDSE 1V25A 2GS9A 1NOKA 5J2TB 1OMOA 3GUYA 1YZYA 4RKWA 4WK2B 4C4YA 1IZZA 1HF3A 4N9WA 4BXOA 4M1MA 3DF9A 3EGDB 1H2AS 1AUOA 1U3DA 2A9KA 1M0TA 3C15C 3Q15C 4B47A 1E1QA 3EMVA 3PX7A 3E9EA 4LIPD 4EG1A 1Q7CA 2JGNA 4QULA 4WADA 4F4UA 4ZZ0A 1L5SA 5H5JA 5H59A 4X6UA 5EMJA 4HRAA 3AEYA 3HCOA 4GE3A 4J9VA 1JKJB 2DBRA 2W6QA 4IHKA 3HB9A 2P2LA 4KLAA 2O5VA 3VYTB 2V7VA 4JXZA 4FQ7A 5T64A 3R1IA 3THWB 4WZ6A 4F4DA 3WQSB 4KQHA 3SYTA 9ATCA 2AK3A 4C7XA 3AJDA 5JAHA 4QDUA 2C9YA 4XVQA 1W93A 5TARA 2QUAA 4YAUA 2ZSHA 2XUGA 4ZHSA 1NYTA 4MP6A 1CRZA 1R7RA 3GX1A 4D0GA 1OC4A 4MJ3A 5EWLA 1U2ZA 4CMAA 3DL2A 3IDSA 1DXYA 1KR5A 2FU5C 3F8TA 3ZZMA 5BWNA 3RUPA 3MQ4A 1FTSA 1N2CA 2JHAA 1S9HA 2D1FA 3NHAA 4MKGA 1N6PA 5SZIA 3ZIAD 2BPOA 1E59A 3L1IA 3JQGA 4QXQA 4N01A 3GFRA 1U8CB 2FWPA 3UJ7A 1M5TA 1WABA 4GO1A 4ZJZA 3PWZA 2JFNA 4M1WA 1WB6A 5COAA 1PWXA 4OP3A 3FPAA 1PDWA 1K3UB 2QRZA 1PWZA 2R6GA 4PU0A 3LXXA 5ARDA 3W05A 5FV7A 2PRIA 4DOMA 1VBMA 4L9RA 3KLPX 1TU4A 5L3VA 3OQBA 4CLRB 3QPVA 2ZRJA 2PKXA 4H7DA 2ZT6A 4GT1A 2Y05A 1QGUA 5JSKA 1BHJA 3E81A 3NAZA 3O8LA 4KMOA 5TQ0B 3FOBA 2I7VA 3NKLA 2BFNA 4JLDA 4M9QA 2IZ6A 3GNLA 4O4HB 1J22A 4PG4A 4REQB 4Q4HA 1U7UA 5B53A 3RJ5A 3W9BA 3I0ZA 1X9GA 4KNWA 1YHZA 3IUMA 4NJMB 3VR0A 3RREA 4L6CA 1A8SA 1CUXA 4J0IA 1E63A 5J4LA 4DV0B 4KL8S 1KI2A 4I5IA 3RPEA 3J80A 5KWJA 1YI8A 2PGJA 5MGNA 4BMZA 1SIUA 3QKWA 2AI1A 4GMKA 4HDOB 5E7MA 3JU3A 1Y8ZA 4BNIA 1T8PA 5DLDA 5EYPB 3AH8A 4RX1A 1LSUA 3OEYA 4XRRA 3UY4A 2FWAA 2ZPUA 4QLOA 1UC4B 4DVGA 1V2HE 3P9XA 2BV3A 3F0TA 4WA7A 4Y2YA 3W6UA 4QUAA 3DEFA 4W8OA 3FI9A 3CHYA 2TMGA 1T3GA 4L27A 3IDAA 4FHZA 2UVPB 2ZFUA 1PW7A 4PTZA 3FOAA 1PNVA 2B61A 5C4IA 3C3DA 3ZHQA 2VQFB 2V6JA 3OIGA 4XM2A 1RYEA 2AJTA 1IXSB 2G36A 3OIFA 3NDRA 1NVGA 1D6JA 1O7JA 4LXYA 1A9RA 1ZW6A 4FIDA 3OE7A 4YCBA 3GJRA 1J6UA 4ZT4A 3WZ2A 3RH0A 4FFVA 3OX4A 3DVAB 4RA6B 4Y6SA 2QLMA 3O0TA 2NXEA 1ETHA 2BBOA 3TGWA 3LWDA 4OV6B 4WOCA 5IUNC 1AY0A 1WETA 2OGWA 2A59A 1E92A 5E3IA 5LZ4A 4O29A 1Z7WA 2YZGA 3NYRA 4RA9B 1BXGA 1G1MA 3CH7A 4KE8A 2HRCA 4UDYX 2VXBA 5IX8A 1YS7A 4A82A 1PSWA 3AKYA 2ISQA 1LS6A 5JS1A 5IKPA 2AJ8A 1OZ0A 1KYXA 1I7SB 3MAGA 3ZNNA 3GD5A 5JXGA 3H5NA 5HIMA 1DIHA 1SXJA 2ODEA 5DYNA 4K03A 1IM5A 1IY9A 3HKDB 4TM8A 1KU0A 3HR8A 2AG0A 4L4SA 1EDDA 4F7WA 2P2GA 4F84A 2VTBA 2GX6A 4QYIA 1T9KA 2A5LA 3VH3A 1JHUA 4EHKA 3ZE0B 4F2DA 2XOKA 3IHTA 2CF5A 4PHCA 3KX2A 4PFQA 3BIOA 5EYPA 4LHSA 3ZLTA 5CDYA 4A92A 4N5HX 5SYMA 3HCBA 1Y6RA 2CZQA 2RG1A 1JUDA 2W93A 2WJYA 3CGWA 3HJCA 4FYJA 4TLAA 1KP9A 5CTAA 3G2MA 3GJ8A 3LUPA 3RRJA 3T7TA 3HDGA 2R7NA 4Q9JA 5I01A 1QUEA 3JQEA 5CIYA 1AKNA 4MGHA 4QWWA 3UJ9A 1D6NA 4H4CA 5AK5A 2J6IA 4W5OA 3EOZA 1LLDA 4IFTA 3I1FA 4B4WA 5LFAA 2C8VA 4O5AA 4OHCA 521PA 2I22A 1C3EA 3K0AB 1QTRA 1SXPA 2JFWA 2H2FA 3IA7A 1WQ4A 1UFVA 1ZM3A 3VJKA 3EVAA 4GBGA 4RMHA 4LKOA 4XUCA 4EHNA 3WLHA 1KE2A 2KQUA 1WXXA 4IQGA 4WOJA 3A6PC 3G13A 3LZCA 1H6CA 2XADA 1QB8A 3VTKA 3KZXA 2CYCA 3V4LA 3GT3A 4I99A 2EBFX 2Q49A 4KH0A 4O2LA 3I9OA 3T7JA 4YAWA 1EGHA 2ZYTX 1D09A 2I55A 2PO7A 2X4GA 3JVVA 4MI6A 4GI5A 4C22A 4QNRA 1SKAA 2VF4X 2D0PB 2PQ0A 5GM2A 2OO3A 3TS1A 4UEOA 4QBIA 4CG0A 1NLFA 4PAOA 2MHCA 3D4NA 2WWFA 3OOJA 3U40A 4Y2JA 1B0AA 1N7IA 3CLRC 1RJGA 4XD2A 4RLHA 4TTVA 4KQCA 3SXPA 5HKOA 4AJ2A 2GBLA 1D2MA 2VO1A 5TMBA 4ZO4A 4QDZA 2KYRA 3BF8A 3Q8MA 3BFXA 2NO7A 2GN8A 3IUYA 3CG0A 1LX7A 1XPJA 3R7NA 4NXNB 5FLEX 4IHJA 3NWEA 3A10A 3NI2A 5H16A 3UOWA 3BB1A 4BKUA 4F92B 4DUZB 3DLBA 2PRZA 4DJ5X 1BO6A 3LDHA 3G68A 4ES6A 2WINI 3GDFA 2HHAA 4IUDS 3FNGA 2P75A 1W0KD 3I0NA 5ALWA 5JAOA 1GGHA 3QBEA 1TVCA 1W8DA 2HJVA 2J4CA 2O52A 2H5LA 3A3YA 3IUNA 3PNKA 3R44A 2W6NA 1XEAA 1Q44A 4FKMA 4G5YA 3VBEA 1UBSB 1H9AA 2QD5A 1JYFA 4G65A 1Z29A 4GXTA 4AJJA 1D1TA 4RESA 1KY4A 1IN8A 3GT0A 1QIFA 2YINC 3PT9A 4H77A 3WFZA 1U0GA 3R0QA 5JEDA 4C0XA 1LCIA 2VL7A 3OM1A 5BYAA 4OH7A 1S8AA 1GPH1 2ZCJA 2RD2A 2A9OA 4KN5A 4JLAA 2BKLA 5GJVC 5THQA 1VB5A 1IN6A 4QTXA 4US0R 3O9ZA 3CTPA 5DT2A 1MP0A 3IUQA 5E9WA 1K89A 3JQ9A 2GNPA 3UCEA 5CH5A 1KH2A 1V9SA 3DUWA 4Y2TA 2QE7D 5E6UA 4NJOA 1SEPA 3HBMA 5EJ2A 4LF8B 4N3BA 3K2IA 1Y5RA 2CWWA 3ND8A 3SQLA 4IOMA 1ZIYA 5TC4A 3A4MA 4QLAA 5AXAA 1L5MA 2ZBQA 3ZGLA 3KQUA 5IC6A 1S8OA 4JJAA 3GH1A 2BL4A 2CFOA 4YQYA 3ROTA 1O87A 1XTJA 5CVTA 1EM8A 1GL9B 4TQUS 1QSGA 1Z82A 5HGJA 4AZSA 2D1SA 1VPEA 4IO1A 2UVQA 2CHEA 2H29A 1M34E 4HDSA 2ODQA 5KINB 3M5WA 5D00A 2AOWA 4QYWA 4EY8A 3QY9A 2YHIB 3JASB 2R97A 1NJFA 3LCJA 4JL6A 4KQJA 4R1OA 4QPZA 1D6SA 5FB3A 1DMSA 2C1ZA 3MS2A 1KKLA 4R1PA 4G1EB 2P9FA 3BM5A 1TF2A 5DB4A 1ZN9A 4RHFA 4OJYA 3KOUA 1QH8B 3KLNA 4P35A 4IJ6A 1H6DA 4M89A 2VTBB 2R3SA 4QATA 1P9LA 4GBJA 1QQAA 2E82A 4JI6B 3UWOA 4KQFA 4BJ3A 2Q0QA 2GA8A 3FGZA 3RVOA 3UHJA 3ZW9A 4DA7A 3H4VA 2FUG1 5MFZA 3NPMA 3ELWA 5AK3A 1K7YA 1G4HA 3DEKA 1TIKA 3EHDA 1F2UB 3NXSA 4ZRMA 2O5RA 4ZVTA 3FM9A 1H2BA 3IO5A 3CG4A 5JCJA 5C5CA 3TI7A 1XXHA 3D4BA 2PE5A 5J5VA 2R48A 2FW0A 4F6RA 3AR3A 3EZ9A 4U8HA 3AVUA 2O3QA 1DAFA 2PGNA 3AXSA 3LX6A 2PD3A 2QJFA 3RYHA 3JAMA 5JE8A 3QFHA 3FVRA 3WHKA 4JOSA 1IONA 2Q5QA 3FYUB 3N8KA 4NOMA 4D9EA 4LZAA 4DCTA 3G9ZA 5C8XA