5A4KA

Crystal structure of the r139w variant of human nad(p)h:quinone oxidoreductase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
271
structure length
271
Chain Sequence
GRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFWSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic competence, structure and stability of the cancer-associated R139W variant of the human NAD(P)H:quinone oxidoreductase 1 (NQO1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords NAD(P)H DEHYDROGENASE [QUINONE] 1
total genus 87
structure length 271
sequence length 271
chains with identical sequence B, C, D
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2015-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5a4kA00
2HPVA 3OWXA 2R97A 4QOEA 2HNBA 2QR2A 3OX3A 5F4BA 3UXEA 1AKWA 5LLDA 1OFVA 3QFRA 1SQSA 4S24A 2BMVA 1D04A 4LAFA 3S2YA 1AG9A 4CETA 2OYSA 1TLLA 4QOHA 3GAMA 3G5MA 1XYYA 3L9XA 4C76A 2MTBA 1FVXA 5LBUA 4YAOA 1V4BA 5LMCA 3HR4A 5BUCA 2B3DA 2FDXA 1OBOA 2FZVA 2WC1A 1FLAA 3OX1A 3R6WA 3JSXA 2Q62A 1T0IA 2FLVA 4BMPB 3L9WA 4ZVKA 2V9CA 3B6IA 4PU0A 4GR9A 4QOFA 2ARKA 3N3BC 2FAXA 2FX2A 1I1OA 3KEGA 3NHJA 4ICIA 4Y9RA 2D5IA 1ZX1A 1VMEA 4Y7CA 1H66A 2N1MA 4FGJA 1XI2A 3OX2A 3LT5A 3ESZA 4XDGA 6NULA 4YAFA 4HS4A 1DXQA 5EAIA 1RLJA 2V5VA 1YRHA 4YQEA 3GFRA 4U7FA 1AKUA 3ZHOA 4U7GA 5A4KA 1QR2A 3W77A 1D4AA 3F90A 5F12A 2BZSA 1YDGA 3GFSA 1CZLA 2QWXA 2QX8A 3NHLA 5FA6A 4C0WA 3F6SA 1AHNA 2FOXA 3B6JA 1CZKA 1QBGA 2BF4A 2BPOA 4PTYA 5TGZA 1CZRA 4LA4A 1X77A 3TEMA 5B3KA 1CZNA 1OBVA 3NHRA 1BVYF 3P0RA 1DXOA 2W5UA 3UXHA 2X2PA 4QOGA 3RPEA 3TZBA 2AMJA 4OXXA 5B3LA 2M6RA 3OVMA 4ESEA 2QX6A 2Z9DA 4YALA 3FW1A 3EDOA 4BMOB 1C7EA 2Z9BA 1BU5A 1H69A 3N3AC 2MWMA 4FX2A 4DY4A 1QHEA 2QMZA 1YCHA 3B6KA 3O73A 4HEQA 2OHJA 4N82A 4U7HA 5EA2A 5NLLA 1ZWLA 1F4PA 1YOBA 1J8QA 2FVXA 4H6PA 4XDHA 4ZVNA 4D02A 5FX2A 1RLIA 1C7FA 3NHWA 5F51A 5NULA 3EYWA 1WSBA 3KAPA 3KAQA 3LCMA 1AKRA 3OWHA 3ESXA 2OHHA 1KBOA 4NLLA 1RTTA 3GFQA 3K20A 3QE2A 3NHUA 4YAUA 1YCFA 1FUEA 2M6SA 3F6RA 1FLVA 5EMNA 3W79A 4ZVLA 3F2VA 3FX2A 5LJLA 1J9EA 2Q9UA 4N65A 2F1OA 2RG1A 3FNIA 3NHFA 4QOIA 4QOJA 1D03A 1TIKA 1XYVA 3NHKA 1FTGA 2Z98A 4LTMA 3QFCA 1J9GA 3NFRA 2A5LA 5ULLA 1B1CA 3NLLA 4H2DA 2XODA 3TE7A 1GG5A 1FLNA 1FX1A 1SG0A 4Y9UA 4ZVMA 4CF6A 4LTDA 3D7NA 3U7IA 4C14A 4GQIA 4F8YA 2GSWA 3OJXA 4FGLA 1JA1A 4M0CA 4N9QA 3N39C 4C0XA 1AKQA 3B6MA 3O2NA 1ZWKA 2OHIA 2MT9A 2V5UA 3HA2A 2R96A 1QRDA 3ES9A 3K1YA 2QMYA 1T5BA 4YAWA 1CZHA 3ESYA 2KLBA 5LBTA 4DIKA 2X2OA 4GI5A 1CZOA 5LJIA 3NHSA 1CZUA 1JA0A 1J9ZA 4QODA 1WSWA 2HNAA 4R81A 1AKVA 1XT6A 2ZKIA 5JROA 3U7RA 4FGKA 3KLBA 3NHPA 2FZ5A 3OJWA 3SVLA 5LVAA 1AKTA 3FJOA 1AMOA 3W7AA 2KQUA 2QX9A 2BN4A 1KBQA 1NNI1 2XOEA 2QX4A 3FVWA 3HLYA 3W78A 1RCFA 1E5DA 1DX9A 4PTZA 1YKGA 2MOKA 1YCGA 5FUQA 3NHYA 4LTNA 4DILA 1FLDA 1AZLA 4NULA 2FCRA 4J8PA 2Z9CA
chains in the Genus database with same CATH superfamily
3UJNA 1QBKC 1VKZA 3MWDB 4M0DA 621PA 3SKXA 2F43B 1SQSA 4HB2A 1YVRA 3RVQA 3WICA 3WRYA 1VP9A 1IJKA 1K3UB 3PF9A 4QPZA 1BH2A 1OFGA 2MU1A 4U2FA 2Y99A 2V8BA 2O5VA 3URKA 3MTJA 4C6RA 3IEIA 1ZJJA 1E69A 2YNMD 4M1ZA 1Y9ZA 1JFSA 1J42A 2QB5A 1HYEA 3OX1A 3PXBA 2BBOA 3B8HA 2IU6A 4K40A 4WJZA 1EG7A 3ZXXA 3AOGA 2QX7A 3V2GA 3B48A 3M34A 2QEQA 1P2GA 1E5VA 3JZAA 5I4KA 1LFAA 4CIYA 4M89A 2B1QA 4RKQA 1Z4MA 1TQ6A 2AIRA 1DQZA 3IJRA 3QBTA 4WZZA 5KCZA 2EYUA 2HJ9A 2DQSA 4BMNA 3FSJX 3L7KA 1C0EA 1COWA 1TRHA 3NH9A 2C8KA 3FSRA 3QQPA 5A4KA 4Q1CA 4QBTA 2GK6A 4LJ8A 2W9XA 1ESNA 3AUXA 3IMFA 1H8EA 2HA4A 4RZIA 4F72A 2WG1A 3IQWA 1LI4A 1M6EX 1QIGA 4M1TA 2FMKA 2EJUA 4V39A 5AJWA 4DSUA 4I19A 3KZVA 5CEFA 1O58A 2NZWA 3C4VA 3KD2A 3IE1A 5KB3A 2X9QA 3ETLA 2CMHA 4OXXA 3RTCA 3G2LA 5FTLA 4J0FA 2GN8A 4MINA 1L1FA 3RUHA 3MA0A 4DN6A 2WT4A 5C1OA 4RBNA 5HJ7A 1Y5LA 1FS6A 1A2OA 1FXWF 1WUKS 3IBSA 3K2IA 4MA4A 4WOCA 3WGQA 4HAWA 3H3JA 5J2TA 2QMQA 4UMEA 2BV3A 3OTIA 1NBEA 3BC1A 3LFHA 5DM60 1WMSA 3LG2A 1JHMA 3EX7C 1XKLA 2IWRA 3LCMA 2JJ2D 1JG1A 4Q5IA 4TL8A 1E1YA 1HDOA 4LMPA 2VF2A 5GMOA 2D1QA 3A14A 1CQZA 3N6RA 4RFSA 4BNDA 2ORYA 4HG2A 3R74A 2PRIA 2B3TA 4QOJA 5AJZA 4YLEA 3RQSA 4BRWA 3BMQB 1M1XB 2D5AA 4C87A 4Q01A 3C43A 5GZ6A 3KS9A 3NCHA 1FXWA 4GBMA 1IVYA 2EXXA 4H2DA 2MSNA 4GBED 3A04A 3A2NA 2JPDA 4XB6B 1TTPB 1OXVA 1UQRA 2O3UA 5IJZA 1SCBA 1T26A 1MOZA 5HJ2A 3GLGB 2FWIA 1LBQA 4I9HA 4M7PA 2LDBA 4JUDX 2X0DA 4GL4A 4YT5A 3SQOA 2HLDD 4G89A 4GP6A 2BDEA 4RH0A 4EB3A 4BFZA 1B0PA 2C9YA 2R96A 3F73A 3WDKA 2CJWB 1JBQA 2VBIA 1UM9B 4EUKA 2ACKA 2EEPA 1P73A 3C6MA 4XX1A 2ZROA 1C0IA 3R0ZA 5FYDA 4AIIA 4N7JA 3RREA 3UFXA 2JLXA 4G2TA 2DKOA 4E2YA 2WP0A 4NABA 3ZY2A 4MJ3A 4OHCA 4TXLA 1H42A 2QM3A 3DA8A 1MC4A 1RZUA 1Z25A 5GJVC 3STXA 1CIVA 3LWDA 1OJ7A 4XM2A 1XPOA 4RIEA 4OKNA 4LTNA 1OLOA 1APBA 3MF4A 2J9FB 3NONA 1CJKC 3DMTC 1F5NA 1J4AA 4DAOA 3GY0A 4IIDA 2XD9A 1ZJ5A 3CHYA 4U5XA 4F1JA 3BZUA 3U1VA 1CUBA 2GJ4A 1Z7BA 1LEHA 2K4MA 3K4HA 1KQNA 3RVLA 5BW8A 5FLKA 3R3WA 3MC1A 3RODA 5JXGA 1JI0A 5HMMA 1FUUA 1NOJA 2NTJA 3WAKA 4BVLA 2QR3A 3FETA 4H08A 5AI8A 5C7IO 4PGFA 3ZEAA 2PRKA 3N2GB 4NYMR 3CNNA 3W5DA 2CL5A 3BL6A 1RM5A 2AD5A 3A4IA 3G8AA 2OFFA 2DKNA 5HRUA 4A03A 2XTAA 4X94A 4CLDA 5JZBA 1V3QE 3VH4A 3BWBA 1XVUA 1GKUB 4QJIA 4ZOBA 4CIWA 5BSKA 3S6JA 5C8ZA 2VQEB 3Q9NA 3QBJA 1DC4A 1Q50A 4YDSA 4L57A 4C0AC 5JH7F 4YMWA 1H6AA 4BRSA 2PQMA 1VIMA 1MDBA 1VJ1A 2ZI3A 4FNAA 4JUAA 3AX6A 1O4VA 2EQAA 2BM8A 2JEOA 2R47A 5HDBB 4EK9A 3E5MA 4K5QA 4TLEA 4B6JA 3VR5A 4CEJB 2VPQA 2R86A 5H68A 3DJFA 3NHLA 3NGLA 1FPQA 2UVPB 1JR3A 1EFCA 2PH1A 3HJGA 3NDPA 1HQDA 2YH2A 3H75A 3VU1A 1D8TA 3GJ5A 4X7PA 1EDDA 3DOOA 4EF6A 4UCWA 1JLKA 1W94A 4GLOA 4OH7A 2RHMA 4H1TA 5TPWA 3ZNNA 3ZVRA 3K9NA 3PNBA 5CA1A 5CFLA 1E4EA 4MV3A 5ECGC 2GI4A 4M1EA 1DPGA 4TSFA 4PSAA 1IULA 2VT7A 1DINA 3GFBA 5FD8A 3EGVA 1F12A 1U94A 3I8XA 4M1SA 4XUDA 1RWBA 4YRSA 4PGMA 1RLIA 4UM9B 1P2BA 1UMCA 3LRTA 2GXSA 4N3NA 4UU7A 1NRXA 3K0AA 2Z09A 2HU8A 2B2CA 1RQLA 2YOFA 3VOSA 1YS9A 1U7WA 1K7YA 1G7TA 1SO8A 3KWJA 4KKXB 4TN1A 1J39A 4R9UC 4ENWA 3UAGA 1PFWA 2IRWA 5E9JA 1M6NA 3L7LA 4CF7A 3QLVC 2FY8A 2PFGA 3AR7A 3NORA 4WA7A 2JJ1D 2IK8A 4V0QA 4CI9A 1DSSG 1UOQA 5IN4A 4DA7A 4FDUA 1QAOA 1HL3A 1UFOA 1UKYA 2GT1A 1GZVA 4N5IX 1L0BA 1UT6A 1XU9A 4EH1A 1Z6QA 3GEHA 4WINA 1HPLA 1USGA 3LQ4A 4LSZA 3VFDA 2GPNA 4HMOA 3FFTA 3T3IA 1GJRA 1UP6A 3QLEA 1P0PA 2QD3A 2QY6A 3THYB 2XRYA 3P19A 2CXSA 1LVUA 2HPAA 2I3ZA 2VF4X 4G8JA 3MUFA 3TKLA 4ZGWA 4IXMA 3OEHD 4B3TB 1JIQA 2DQZA 1ULHA 4NYIQ 5GY7A 4LFCB 2PD4A 4BQIA 2Y1LA 1PYDA 2HNAA 5LWQA 3OQJA 5LA6A 4NRDA 5KQGA 2QP4A 1CIJA 2RDMA 6LDHA 2NSLA 4FUQA 1NLFA 4XZ3A 3DEAA 2GPAA 5JS7A 1THMA 4BQQA 1WM1A 3CRRA 2FF5A 3WZ2A 5JH7B 4L51A 3AJ9A 4LC1A 2LPMA 1MUUA 2WJJA 4W5HA 5HRCA 2VRBA 2B1JA 3W1EA 4R1SA 4P81A 4G5YA 4ZCRA 4UOZA 1JHVA 2R7NA 2NZXA 2QLTA 4J16A 4NULA 3ZV5A 4YRKA 2HT1A 4ONEA 5IX8A 3HGMA 1Y48E 1NUTA 1PBNA 2ZPAA 3CLSC 3MBIA 3N76A 1EVKA 5FBVB 1Q1EA 2V03A 2GNPA 1QHIA 2LRHA 2AOTB 4HEA6 1RLMA 3AJEA 4IP0A 1XRNA 2XYGA 4PLPA 1WD7A 5EUMA 4GC9A 1RPNA 1E9RA 3C3MA 1Q12A 1G66A 4H7DA 4M55A 1G3QA 4QXQA 2P2DA 5FO1A 3R7SA 4KQXA 4KQIA 3R6GA 1X8LA 3CUTA 4X64B 1OQAA 2IYZA 4MRMA 1F0YA 4G0WA 1PTJA 2DLCX 3BOSA 4EL5A 4RTLA 3PS9A 4IDNA 4MW4A 1HORA 4Q3KA 4CDGA 5K8TA 4LK2A 1RRVA 2IXTA 1NUSA 5FPPA 2P2LA 2PXXA 1BEUB 5P21A 2C7GA 4HB0A 5DLQC 1XHEA 5CEEA 1QO7A 5H59A 4DDWA 4U0JA 3T1QA 3OFJA 4BNIA 3SIRA 3QY0A 3F5SA 5F12A 1JKXA 3RVNA 1J21A 2Z5GA 2G06A 3B38A 7ADHA 2HBQA 4YCDA 5B4UA 2O2HA 5H4GA 1XWIA 2JAOA 1OU4A 1KYTA 3GW8A 2AF4C 4XWYA 3JALA 3DDCA 4G25A 3HVUA 1KAQA 1I6LA 1KR5A 3I2HA 3G5LA 3EDRA 2GA8A 4GPTA 3EOBI 2HI0A 3UJDA 4FHGA 1AA9A 3WWPA 5BMVB 4FX2A 1ZK4A 3PNVA 1QIMA 2WIKA 3EZNA 4J9VA 4P3NA 2BTQB 2CNWA 1DO2A 5G0WA 5C9ZA 1DDGA 1CUIA 2Q7XA 4EF4A 1FDOA 5BWCA 1M3SA 1IHDA 3AZPA 4YONB 1MAWA 1C9JA 3LT4A 5TRTA 4CHGA 1N7JA 2RB4A 1WUYA 2P9HA 1QNFA 3HCDA 1L5HB 3KZNA 5DXJA 1P9LA 4BGVA 2F6RA 2FZKA 1RRCA 5COQA 4FSDA 4N7MA 5E0OA 3V8PA 2GHIA 2CN1A 2UZ0A 2XUPA 3HCRA 1XUOA 5AXCA 3STTA 1U1GA 3TEJA 3OQOA 5EWJB 3LQ1A 2BFDA 4JENA 4O6VA 1DP4A 1FTGA 3QKSA 4LTMA 4DW8A 2HHHB 5ULLA 5EPEA 3SEFA 4B31A 4NV1A 1HLGA 1Q15A 3IKMB 1RCTE 3BEDA 3OQ6A 1GCAA 3D5QA 3S27A 5GINE 2D5LA 2V6JA 2QN6A 5BPFA 1MPXA 3WO0A 4WNIA 3DCYA 3EASA 3OG9A 1J49A 1H2EA 4MVCA 1GQFA 4XD7D 1E62A 4I50B 3AM3A 4LQDA 4EZIA 4EB8A 2L42A 3BAZA 4RPLA 5K0FA 4KR3A 1THGA 2X4GA 2CDCA 2WYIA 3DB1A 5T3UA 3INYA 1VTKA 2PKEA 3K16A 3JWIA 5BOSB 2GAAA 1U3GA 2LIVA 3BXHA 5JPIA 1O94A 5J4HA 4TKUB 2XOEA 2OCYC 3A31A 3LF2A 2EW8A 4P4LA 4R8RA 5SZJA 1E1LA 3CC8A 4N41A 2EZ8A 3TL2A 1VL0A 1TO2E 3ZWMA 3KB1A 3DTVA 3MT0A 3PX3A 4I50A 3PEWA 2OBFA 1Z82A 1EXVA 2J6IA 3S68A 3FPEA 3MTDA 4AUKA 1JAYA 3G8CA 4PAQA 2B5WA 1P0IA 1SULA 1OVMA 3L93A 1QP8A 3OOYA 4MRRA 3SZRA 3OTOB 2XGOA 4QOHA 4AYWA 2JGLA 4WXMA 1JX6A 4EYGA 1RJGA 1T5LA 1CF9A 1N2ZA 1JIKA 2VWPA 5LM3A 3OEWA 5HBRA 3FPBA 2AUTA 3QLVA 1DWUA 3R7NA 2G9RA 4JLOA 3SJ7A 3UK7A 1JSZA 2W2TA 5HX7A 4F3CA 4ZIRA 1Z0DA 3ENWA 2V9PA 4BLTA 1P4AA 5B36A 5AQ1A 2O23A 5MGBA 4JC5A 1I1NA 1ONSA 4DJ5X 4BZWA 1OMOA 1S9HA 2ZIWB 2D5IA 3A6ZA 2ZE6A 4DQKA 1Z2PX 3DZIA 5BO5A 5DK6A 2ZIAA 3PC6A 4PXYA 4TROA 2DR2A 4YRFA 3TZLA 2XNSA 1S7GA 1HXHA 1DELA 4GWGA 4YRLA 1Z26A 1ZQ9A 3H4VA 1KRHA 1R5OA 3DW3X 2BHTA 1P2UA 3FBGA 3HYRA 3JQCA 4NPAA 4OPMA 4R68A 5FL7D 2B37A 3M70A 3ONNA 4LYEA 4DEYA 2UZ4A 2HHAA 3JAKB 3PRKE 1PFQA 4MWCA 1N5KA 4BJ5A 2IEZA 4U0KA 1Z5VA 4NFHA 5DK4A 1CR4A 2GQ0A 4O29A 2C2MA 4Q3OA 4V0MA 5FPQA 5H16A 3TYXA 4FMBB 2QRQA 1W0KD 4HAIA 1TCBA 3URMA 4BU1A 2PL9A 3ZLVA 2QTCA 3WQSB 4E4TA 3AF1A 5K0BA 2I4NA 4X6YA 1USVA 4JYZA 5HTOA 3VHXA 1ZWLA 4UAJA 5F33A 3ZDXB 2YJ6A 3U60B 3UFBA 5ERXA 3RIYA 4RF4A 4V0SA 4LHXA 3LCRA 2J3HA 1AURA 4QVIA 2D13A 3UCEA 1Z4LA 4RYDA 3IB6A 1TA9A 4RIFA 3DMPA 3ZNQA 3FE2A 2PBFA 2B69A 1PD0A 4HS9A 4HPWA 2XNJA 2XXJA 3BQNB 3CYFA 4GX5A 1IUNA 1RPZA 5KBYA 2HO4A 2PBLA 1XPUA 2XB2A 3JQ9C 1SUFA 3N2LA 4JB0A 1EP9A 3KALA 1N7HA 1MX5A 4ZO6A 3ZUGA 2J7KA 4PSCA 1E6MA 3UA4A 3EDCA 4GWLA 5KX5B 5KYWB 3AEUA 3V00A 2VJKA 4HNSA 4QYMA 3FYCA 2QT0A 3ITNA 4A73A 4MUEA 3QITA 5CFZA 3KQYA 5CG2A 2FN7A 2H92A 2Q5JA 2F59A 1I3CA 1KVQA 5KJCA 2VP4A 1NQ5A 4L78A 1KVUA 2JGEA 4QJ4A 1PR2A 5IANA 1KC1A 1J1IA 4PRLA 3ZHVA 4WT7A 1UC8A 3IR6A 4BNUA 2C2WA 4F85A 3P0EA 2PUCA 3NPMA 4MB6A 3HL0A 3KHUA 4RD1A 3UMCA 4B45A 4M0EA 3FCEA 2VLIA 2DXIA 2H1OA 2HRQA 5I9SA 1J5XA 2QM7A 4UMDA 3LECA 1HNXB 3S2UA 3ZCRA 1PRYA 4HAVA 3VPCA 3MWJA 3IOCA 2ET6A 4HX2A 4PXAA 1VJCA 2BGJA 3I2KA 5H0IA 3L0BA 4BAUA 2FJUA 3FFAA 4DILA 1NBME 3DB2A 1FLDA 2YRXA 1I7LA 2ZQZA 1UT5A 2I1QA 3IV9A 4GH5A 2ZJOA 3OIUA 2HT6A 4JMLA 4XWGA 1DFGA 3FTEA 1EDOA 3GCXA 3EUEA 4A82A 3GCZA 1E7MA 3A1FA 4HLUC 2NU8A 1T6XA 3I6IA 1AG9A 3I2FA 1UXJA 4I9FA 2BMFA 2I0FA 4A23A 3KKQA 5B30A 1AUQA 1R50A 2VSXA 3GRKA 4TLBA 3CTPA 4TKMA 1S1CA 4ERNA 3IUYA 3A3NA 2NV2B 5LKAA 4GQBA 5HCUA 2DHDA 5A4AA 4JYBA 4D4HA 1JLLA 2CHVA 1ZICA 2V58A 3AJ8A 3SP1A 4P7FA 1MBZA 1YBFA 3G02A 4X1KA 1QV9A 3U3RA 1L8OA 1A50B 1P45A 5F1KA 4BMPB 5KPJA 2O7RA 1XRMA 3A9RA 5JFGA 1LDEA 1HMYA 3H19A 1Z38A 3O8NA 1L5OA 1MHPA 2C9MA 2G3YA 1C7QA 2FSPA 4YMTA 1O6ZA 1Q3TA 1G5HA 1H05A 2BGNA 2HADA 2E4WA 2HZ7A 3DAFA 2FJPA 3EMVA 3HUTA 3NIBA 3PCXA 4B2LA 4KFSA 1BRMA 3L7MA 2FRXA 1XRJA 3GFSA 3X44A 2VDPB 2P2ZA 4KQEA 4W8OA 5LOVF 3HI4A 5DEOA 3B6JA 1Z2OX 3TLZA 1Y42X 2J0UA 3MEQA 3UWPA 1BU8A 1UT8A 1JZQA 1OXKB 1XTZA 3RG2A 1HGXA 2PXAA 4RGVA 4RK4A 4XD2A 3USES 2GHQA 3L7IA 1D2GA 2M6RA 1CQXA 4XM0A 4KWTA 3G9TA 3BD9A 3LUDA 5BT8A 3C6ZA 4B79A 1D4ZA 4UNIA 4L3WA 2G04A 4LNUA 2VA8A 3CKKA 3AR4A 5E38A 1CRLA 2AYXA 1WMBA 4H7HA 1JXQA 2GUWA 5CB4B 3TECE 5I47A 4FDVA 2FWNA 4DIMA 1FFHA 4FHCA 4GDFA 1BFUA 1Q92A 4WBXC 5IP5A 4FE4A 4BB0A 4DCNA 2TMDA 4WFKA 2ZRPA 2HSJA 4A8PA 2NACA 1XCPA 1KJ8A 5I4BA 3VNUA 3GPCA 3ADCA 3LKBA 2NUPB 1F8GA 4YBRA 3I5AA 3BCRA 1B0UA 3IAM1 2Z98A 4MKRA 5TQ2A 2RD2A 2ZAMA 1NU6A 2ZDHA 2ZIXB 4KWCA 4B76A 4CF6A 5ENDA 3UK0A 1WCIB 1ZXBA 1ZJ6A 2YHUA 4PVCA 5IDWA 2B5VA 3A1EA 3FF1A 1EFTA 3HCOA 5BUSA 2K2QB 4DCUA 5FA5A 2NSYA 1H3FA 3RLFA 3ZYCA 4YHHB 2HR1A 2A67A 4JI1B 3T61A 4U2GA 4LI3X 1Z12A 3RVBA 4GI2A 1F9AA 4Y7DA 1RJFA 2V7EA 1CZUA 2H7XA 1R18A 2X5OA 4GX1A 1W2GA 5F7ZA 1PQYA 1ZD3A 2VXYA 3FNQA 1DDOA 5E9QA 5B1YA 1NNLA 3LGAA 2KX7A 4C3VA 1X1DA 3AQ4A 5BV1A 3RYCB 1K86A 3IEVA 3C87A 1E9DA 1K7SN 1G4HA 1XKXA 2Y92A 5FPHA 3TOSA 7YASA 2YDXA 4Y2YA 5BMOA 4B8YA 1QU3A 5L3VA 3AVXA 3L40A 1FNCA 5H81A 3OU6A 5G40A 4F4HA 5BYKA 2DMRA 3PWSA 9ATCA 1SBIA 1EX6A 2Q3FA 3ZX4A 1SC3A 3ZGZA 4IUDS 2HCBA 3CNOA 4O2AB 1E2GA 4PHGA 5KYGA 2OXFA 1C3JA 3VYSB 1W1UA 2JF0A 5JSZB 3QPDA 4IJMA 2QVCA 3ZZ1A 1V6CA 1U7PA 4DLLA 2WJVA 4JR2A 5C4GB 1ILEA 2GPYA 1LX7A 4KH0A 1NN0A 2QJWA 3JVUA 3DLTA 4I5EA 2ZIUB 1S2MA 4MYRA 2FR1A 1LXCA 4FONA 4V1CB 3WL7A 3WLAA 2Y1XA 1GZDA 4UD2A 4LF8B 5J3JA 5DTMA 4TV8A 1AK1A 3GHHA 2DULA 4YB8A 4A3SA 3L8FA 4NV3A 4PTLA 4GSKA 4KI0A 3LUPA 4HAUA 5EMHA 1E1NA 3QXGA 3SEAA 5B7PA 2REQA 1U0RA 3GZNB 4S12A 5E1BA 3UHJA 5TJ9A 4MJ7A 4DDHA 2PKWA 2XNCA 1KZHA 3RSQA 2IGBA 2IGTA 2O2IA 1XQVA 4DJEC 2IQ5A 2LXNA 4BFVA 4C0WA 4OLAA 3OT5A 4XTCS 1E3MA 4H4EA 4MCAA 5AO9A 2ZYVX 3BGIA 3EEQA 4RJKA 1CEEA 1KDRA 3O9MA 4K1XA 1VECA 4WI1A 4Z3DA 3TZBA 3ZCQA 2O8DB 4EO7A 2CL6X 3KYCB 2HEIA 2ACWA 1EEHA 1TYEB 2H2AA 3BD6A 3GIWA 4PZAA 4FWTA 1TK2A 4UUMA 1KVTA 1RRMA 2HGZA 2AFIB 3JU3A 4YI3A 3OZGA 3RVMA 5F51A 2C61A 1Q20A 1BHQ1 4DMLA 2PWPA 5KEIA 2VSYA 2ZRAA 4C06A 3E22B 4CQMA 5ALKA 3D31A 1BXZA 5KTPA 1X7WA 3OOJA 7MDHA 3A28A 1MJGA 3DYVA 4IIXA 2D1SA 4CTJA 4DLKA 2GD0A 3TTUA 1JS1X 3F2VA 5DBGA 2F9FA 2J46A 1FX0B 1SUSA 1V25A 2ACEA 3ANNA 3E9RA 4HD8A 4N65A 2J0UB 2OBLA 1TZMA 3USZA 4R8MA 2FX5A 3GAFA 4MUNA 3TSAA 3L8CA 3HYSA 1XCJA 3T0FA 3WLPA 5DTRA 1PFUA 1YR1A 2B92A 1U9ZA 3ESDA 2VYND 2NTVA 3GEGA 3QEKA 2OPBA 5E9WA 3U7IA 3W0LB 4C14A 3IIIA 4ZYYA 5I8WA 4E09A 1MU0A 3B3JA 4RVOA 3AUYA 4C0XA 5C3MA 2FOLA 3HWRA 5CFMA 4QYXA 1AN9A 3ADOA 4JXXA 3D64A 4MEJA 5E6UA 3QX9A 5T41A 1XZBA 4DIDA 1VHWA 1ZCFA 4KO4S 5IG2A 1VJTA 3D2AA 1X94A 1X9GA 3GT7A 1G21A 1NW8A 4WX2B 2HDWA 3AOEA 4JT8A 5KVVA 1KH2A 1Z9BA 2AG0A 4L9AA 3ZV7A 3TRDA 1MKYA 3LPLA 3E70C 1Z5OA 1Q0PA 3DKIA 1UKEA 3LHSA 2CCGA 5COAA 3SNHA 3I6YA 2FUG6 4ZHQA 1ZNZA 3ADBA 1Q11A 5FPTA 4J94A 3L4EA 1EYZA 2ZJ1A 5I7RA 5IT0A 3D5EA 2XUQA 3EMBA 3IE0A 5A3RA 2FXIA 3NYQA 5I45A 1Q1GA 1S89A 2I6UA 1PEAA 2XE4A 3GCDA 1HYHA 3LHDA 4KK3A 4MVJP 4Y18A 3RWMB 1EZ1A 5ALRA 2R4TA 2RGAA 2ZYIA 1BS2A 1V7CA 3GZJA 4MB2A 2P9JA 1AKNA 4D2IA 4G0PA 3KCQA 3RRFA 2HU2A 1KJZA 1P3DA 2WU4A 4R0MA 5LLDA 1UP7A 4JX8A 4OTZA 1DAMA 1I24A 1CR6A 4QL3A 2J07A 4DCOA 5DHAA 1MV8A 1YJCA 5LLTA 3OIFA 4FLEA 4AJ9A 5D00A 4YAJA 5EZ5A 3K0KA 4TL9A 4AICA 4XRRA 1SRRA 3BMCB 4WKBA 1Z63A 3REQA 3FZQA 2FJ0A 3O21A 1TZJA 2J4FA 1TO1E 4HNTA 13PKA 5JCOA 4YPOA 4RGQA 5K8IA 1PI3A 3FIJA 2WUGA 4C20A 2RHLA 4WGGA 1Q7EA 2KJQA 1YV9A 4P93A 4CF5A 3FNGA 4NBUA 3FHTA 4AZ3A 3GGDA 4CT0A 2VTKA 4BVHA 1T6NA 4HVAA 2ARKA 3Q5DA 4YUXA 4IJ6A 3VVMA 1AZTA 3BFKA 3WLOA 3L6UA 4KRGA 3TIXB 4YRMA 4TTPA 3STUA 5IM4A 1MIOA 3ZWPA 2PZKA 1MIOB 3RYFB 1OLUB 4ND7A 1U2RA 4ZZ3A 2R44A 3A70A 4DV3B 3N70A 1KO8A 3O75A 3IQIX 1UPFA 1XDBA 1KI4A 3M4JA 4PHFA 1V11A 2F1KA 2WF7A 3U40A 2P1ZA 3VO9A 1P31A 4FIDA 3PUWA 1OBVA 1ZGAA 2C7VA 2W6QA 3LPDA 2OXRA 3WMFA 1R6DA 5EZYB 4ZI2A 1U4SA 2G67A 5BRAA 5LDDC 1OYOA 1KFJB 1SK9A 4LOLA 4J9UE 1T2UA 1UMCB 1TF2A 1UK9A 4I6EA 3X2FA 5KSOA 5CW2A 3I1YA 3ZIAA 3U4MA 1ZA2A 1QCDA 4IICA 5FBWB 1M1ZA 1FDIA 1BE1A 2VJNA 4W5QA 3LUGA 3LX5A 4D4MA 3AEQA 3FPHA 3CRZA 4FOSA 1N9GA 3KAQA 3Q3EA 1RLUA 2R6HA 3N53A 1XAHA 3VOBA 2XE6A 3G0IA 3FUCA 4RIIA 5J5VA 2IXFA 3P94A 2NSDA 3CPEA 1XZLA 2PZBA 1W34A 4XTRA 2AWNA 3QEMA 3QE2A 1JNXX 2V6BA 1VSBA 2M6SA 4BDSA 5EEHA 1E3IA 1KP3A 4NJMB 4PYQA 1NXPA 4NYJR 4JBLA 2WHXA 3LUAA 3QI2A 2UYOA 2BGIA 4MR7A 1FL9A 1A95A 3KQOA 4EB6A 5BN3B 2GHRA 2LGJA 4XXHA 5HJ5A 1H6BA 1ISRA 1XJCA 1A9XB 2FFAA 2WPDA 3H8JA 4O02B 5KU1A 2VSNA 1O96A 4KRXA 2HRZA 3E7FA 5DN6A 1NMEA 2JIDA 1U3UA 2OILA 4M86A 3HV2A 5EE5B 1QVAA 3WLRA 4CM4B 4YCAA 4DCCA 3TG2A 3OCVA 4UM7A 4ER0A 1E1CB 1X7DA 2J5RA 3L6DA 4KRFA 2O8FA 1HE5A 3OP1A 3EARA 1DRVA 1DTSA 1OB2A 1IFXA 3AO0B 1GNVA 1RYDA 2B8EA 4FBLA 2VWGA 1NLMA 1GPJA 2Q3HA 4N8SA 3S8MA 1TJYA 1SVUA 2O3TA 4EA8A 4LFAB 4C7OB 4DDVA 4CMEC 3FRHA 4BX3A 3GGJA 3A3YA 1ESMA 5JRDS 1ABFA 1QLWA 1XA3A 1XVTA 4JC8A 2PYDA 1ZW1A 4JFRA 4N4AA 1NBMA 1Y33E 5A3SA 3U3XA 1YZ3A 4UUNA 2NNLD 4AJOA 3LVFO 4K6FA 3IUNA 2VL7A 1JQAA 3BILA 6PFKA 3U2QA 1XOIA 5EE9A 2PZFA 1WBBA 2PYIA 1K27A 3HXLA 4W1PA 5C1IA 4RJIA 2AOTA 4L02A 3AESB 3PSAA 3C1OA 1NVVQ 2V65A 2X0NA 5JQGA 1K88A 5AK5A 1RYFA 5EJGA 1ZSNA 3LGSA 3C8UA 1Y89A 4DQDA 1E6WA 1DBWA 1T1SA 2MYPA 1JHAA 1F60A 3FOAA 4GNKA 4I1UA 4ESHA 1H5NA 2V5AA 4KLCA 5DHTA 5A62A 2FV8A 5IJXA 3B2NA 3V4FA 4ZI5A 2IA5A 4YXWD 2G82A 1DBQA 2YWHA 4CKZA 1WIWA 3IMCA 3LT2A 1QFJA 2C2GA 4B4WA 4LZPA 3KJZA 2G0AA 4I4IA 3PDIB 2DPYA 3LXRA 4G86A 4TT3D 3FBTA 4DM4A 2C94A 2JFXA 4NE7A 2DC1A 1DI0A 1M34B 2IPXA 1R6BX 3NI2A 4H3KB 2EFEB 1SA0A 4FCWA 5T6BA 5DLYA 3U4HA 3OF3A 4DV1B 4B3CA 5L7WA 3QVTA 4ZV4A 2JBHA 4KXXA 1U4NA 1F17A 3C24A 2GZ3A 4I6JA 4YI5A 5ALOA 2A5DA 1QR2A 4NATA 4EYEA 3AXSA 3IS3A 4NBRA 4CU2A 2VKTA 2QT1A 2DEUA 2DB3A 4K6OA 1PT5A 2PX5A 5DGIA 5ALVA 3U1BA 1J1UA 5EWJA 3IELA 4PG6A 4O25A 2FZGA 2ZFUA 1CZNA 1CDOA 3DCIA 3MB5A 1E1RD 1HT0A 1XTVA 1YHYA 3BH0A 4AM8A 4KR2A 3VGPA 2IEAA 4F9FA 4NONA 1H8HD 2AEJA 4P32A 4R2KA 2P65A 4LCEA 3FDIA 1P5JA 1GCGA 4TWBA 3FOBA 2CXQA 3OZEA 1U9IA 2I7CA 1E89A 4BO4A 2FI1A 2JJ1A 4HNRA 1HF3A 3NOXA 1OC4A 3SIPA 1A0OA 3E3MA 4KQJA 3V7UA 3OQVA 2ZYGA 3DEYX 1P1IA 5B1DA 3PHHA 1HQCA 1R64A 4LJ4A 5M2QA 1VPTA 3HYCA 4COOA 2W11A 3ASYA 1CS0B 4PC3A 3DBRA 3OKCA 3ZV6A 2RK6A 2WZBA 2QYOA 2ZUUA 4O4JA 5JEEA 1E0DA 4Z0NA 3T1YB 1EX7A 3AT1A 2YXDA 1YQQA 1Q83A 1ZUIA 4A16A 3QSYA 4HFMA 3NT5A 1AN0A 5ITVA 2O2JA 2R8XA 2HK9A 1A4UA 1GXSB 2QM0A 1NN5A 1C9KA 2EGGA 4FDLA 4JLBA 3O6VA 1UADA 4RLFA 3RKUA 3MWYW 1W46A 2UVPA 1QGZA 3L6BA 2J7PA 3JVDA 4MWGA 2FFBA 3TI9A 2KSQA 4MUMA 3H6GA 5K0TA 1SXJE 4JCCA 1WETA 3NAQA 4Z6KA 1OJLA 4G5SA 3RTGA 2C5AA 3G0HA 1ADGA 1AGXA 3QYFA 2W6ZA 2X8AA 4LX0A 4ZHSA 1CXZA 1Z2EA 3F47A 4I14A 3GBPA 5G0VA 3WJAA 1IJBA 3NP9A 1XTBA 3M0EA 4HYTA 3BF8A 3AR5A 3VV2A 1Z36A 2QRKA 3PDWA 4BLPA 5BW5A 4MHTA 3DZ8A 4F4IA 5EE3A 3GBSA 3QIAA 5EY5B 3Q7SA 4RVHA 4JQOA 2SECE 3UN1A 4WK6A 1V2GA 5K01A 2QVBA 4CF4A 2H29A 4XGRA 4KKVA 2PL5A 5K3FA 5ISMA 1FFBA 3PL1A 4UU0A 1QHHA 3G6KA 4B74A 4HX9A 3WGNA 1C9EA 1QPBA 1GILA 2JARA 2HIMA 3T9FA 1W5BA 1URPA 2C8VA 4O4LA 3RFFA 2R97A 4LRQA 4DDKA 1VG1A 2DLNA 2QRLA 1HTBA 3OZFA 4Y2TA 4ZAFA 4JJZA 4J4BA 3RC2A 2GAOA 2QV0A 1ZD8A 1BX3A 5TLSA 2CJFA 4XX0B 2JHCA 1TEXA 1XYYA 1VL5A 3EIHA 3AWIA 5CTJA 3ZKWB 3BXPA 1ZMTA 3IAFA 3OECA 2PTGA 3QUTA 1JKIA 1N3BA 2P5SA 1KY4A 4X97A 1KAGA 2GS9A 3O4GA 2I91A 2A14A 4ZA2A 4W99A 1P1CA 4PYJA 3P5SA 1LBHA 1UPTA 1VLHA 1Y6JA 3A9TA 4IJWA 4GKBA 3K2QA 2C7RA 1V5WA 4O08A 1GRNA 1ORTA 5CA0F 1DKLA 2LWIA 1JT2A 1NUPA 4IEIA 3E3OA 5H8WA 4LFBB 1FCJA 5IABA 1REQA 3TW4A 2Z1DA 4LHVA 1JH9A 1CY0A 4QUBA 3O93A 2J59A 4N7RA 3T1HB 4NBWA 2A9JA 3CUSA 2W93A 3FDXA 4QUHA 4J76A 2X9NA 2VKQA 2B20A 4KQMA 2P0AA 1ZUD1 2JD0A 3D8UA 3IVXA 4ENRA 4BGDA 4B6QA 4PYRA 3GCWA 5F9HA 3BKWA 3DMNA 1YH3A 4LQ4A 2ZRIA 2JFNA 1I10A 3B6EA 3H1PA 3LYUA 1R9GA 1EFVB 3NHMA 2R8PA 4EVQA 3A6PC 2FK8A 3IAS1 5F7XA 3JWJA 1Z4JA 3LDUA 4Q93A 4WXPA 4Y1RB 2VWHA 2P40A 3N3AC 2O48X 5CURA 1NVWQ 4DHEA 2V0CA 3AEXA 3I1IA 3CLVA 4RE6A 1DRUA 3A9UA 5A4DA 2AOXA 1QC5B 4Y2PA 1WB9A 2O06A 2OGZA 4XQ0A 4O4IA 3U0VA 2GKOA 1QRAA 2JBAA 1BA2A 2WB2A 1SWWA 3BDIA 4UW9A 1V3TA 3N8IA 3SLRA 4ZJPA 1JWLA 3I52A 3FUWA 2ID8A 4G56A 4J2TA 5B2EA 3GLFA 1VHJA 4YJDA 1O97C 2PD6A 1KSJA 3C1TA 3L07A 5CGQB 5CXUA 4YRIA 4EDHA 3WRVA 4H27A 5CLQA 5C18A 4OJKA 3EY9A 2Z8XA 5EKSA 4RCZA 5JAIA 4QKQA 4KMOA 1WX1A 3MBKA 2H1SA 3JQQA 3S29A 2VNIA 2WIJA 3KLMX 2XCLA 3FR7A 1RTKA 2GJAA 2WLTA 4ISCA 1KYYA 2C98A 2ZWVA 3HN7A 2IPLA 5EG5A 1G21E 4ZP1A 4JL6A 3RF7A 3OPVA 3AZOA 3LT0A 5FEMA 4ZAWA 4F9TA 5HQ3A 1RQGA 2HRRA 4F5EA 3U16A 4F3TA 1C1XA 2IOQA 3JX9A 2FUEA 2UXBB 1QMPA 2VNJA 3FI0A 4O8ZA 4HUJA 2ADFA 2JFBA 4JKIA 4A2CA 1AH2A 1YC2A 4H1HA 3PFGA 5IXJA 2D74A 3GT0A 4QC2A 3W1VA 1C3XA 3SVZA 4U2KA 4IH9A 3TQCA 4D0GA 1CTQA 3AR8A 1KK3A 1VJ5A 1JLHA 1A8PA 1YHZA 4YVFA 1R15A 1X1BA 2YX1A 4H6WA 5EUBA 1IUKA 1XEWY 2AW3A 2OEPA 2VIIA 3LBAA 3NV7A 4E32A 5FI1B 3WLJA 3ZZTA 3OFVA 3ONWA 1E94E 1WNFA 4ZU1X 3SC4A 3GI1A 1WOMA 3GV0A 4Y0AA 4FS8A 4JJ8A 3RFXA 4S1PA 4BO5A 1GQRA 4LK3A 4XFKA 3TR6A 4HWGA 4YLYA 2PVPA 4BV9A 1JTVA 1A2KC 1I30A 2FPGA 4O5OA 4RAOA 4CTMA 4BFLA 3SQWA 4ADSG 4L5BA 1D4FA 1ISGA 3MERA 4L8LA 1BHSA 1JE1A 1C7ZA 3CJRA 1DJNA 2REQB 3GZNA 3HJUA 1US8B 5DHPA 3T7DA 4BEWA 4EKNB 3ZHXA 1SBNE 4OQPA 1NHWA 1XCOA 1ZGHA 3N2KA 1IK6A 4H18A 4GYJA 5ARDA 4XVUA 1G5RA 1XQXA 3TXAA 5LMCA 3CE9A 3GMTA 4A0SA 1N36B 2VP5A 1U2DA 3HWX1 4QBKA 4F1KA 4OP2A 2FK7A 3ND6A 4IDGA 2PUAA 1C1DB 3AK4A 2LDXA 2G36A 1T0IA 3CZPA 3NVMB 4RL4A 1W44A 4EUNA 4F04A 3PA6A 1NIJA 3QMWA 3PXXA 1VBNA 1ES9A 2E1RA 1GGJA 4QT0A 4Y9RA 2YNMC 4HFRA 5WRFA 3W8NA 1FE8A 1SXJD 1P19A 3OEEA 5JSYA 5KTRA 2PSHA 2BGWA 3BPSA 3VTFA 1T9BA 4RX1A 2IXBA 1XX6A 2QN3A 3Q3HA 4JDUA 3IXQA 4IYRA 4LSGA 3RRZA 1B2LA 4BX2A 4YJ3B 1PFVA 4JYAB 1U11A 4X8HA 5KNDA 4BASA 1YDGA 2XA1A 2WA2A 4RHTA 1PVVA 2Y76A 3JD2A 3K8YA 4TRMA 2WZCA 2OSBA 4F21A 1Y8RB 5K3CA 3RUAA 3UVEA 1L7OA 1M67A 1GUBA 4K0RA 4Q9KA 1ZOIA 5GQSA 3DEFA 5FUMA 2QP9X 2HU7A 3A1TA 4JBXA 5K05A 2BH2A 5SZKB 4QXRA 2P9TA 4BKUA 4CM1A 4TSRA 2IIPA 1QHEA 5ILOA 2PN1A 4AT1A 4EG4A 1X8XA 2WD7A 4XEHA 1WCWA 2AFIA 3ZGYA 1RLTA 3ZDRA 3ZWXA 1NPYA 2H5IA 3P0IA 4B44A 1J33A 4C4AA 1JJBA 3C1AA 1Z5GA 3ZCXA 3ORRA 4YMHA 1E64A 3U4QB 3ZDAA 1XEFA 1H0HA 4RM2A 1UKBA 2OZPA 5D3QA 2VDKB 4OXIA 5MGNA 1IHYA 4LS3A 1MMFB 3O2JA 4RAQA 3LC7O 3NHFA 4OUDB 3TLBA 4L27A 5JNRA 1L8AA 3HA7A 4B83A 4D6XA 2AQIA 521PA 5AR1A 2Q6LA 1DAGA 1U7XA 5K3EA 1R0YA 1Q16A 1IAQA 3DS8A 5A3VA 3LUHA 5UKDA 1Z37A 4EYQA 4D45A 1OZHA 4ROTA 4M0CA 5AW6A 4TZ0A 1MENA 1JJ7A 3ZZMA 1QHXA 1TVMA 4BNZA 1JYSA 1BW9A 4R3NA 4DIFA 2AD1A 3K1ZA 3OLZA 5DGXA 5M04A 2VF7A 2UYCA 3KXLA 4FCTA 4TL6A 3AUAA 3WGMA 5E1DA 3T9EA 5ED4A 2PBRA 1K3TA 3KPYA 4KMSA 1P7CA 5HZKA 2QLNA 4YRJA 1AQYA 2Q0HA 3IDZA 5BR1A 1EJ6A 4QJ5A 2P4HX 2HK8A 3ZHQA 2FNAA 3QXSA 3G2PA 1U8ZA 1XLTA 1Z16A 3QWHA 2A9PA 5JPDA 2NYVA 1NP6A 4HRXA 2OCAA 3FOEC 2C77A 2PIDA 4K6GA 2NVUB 4UHBA 2I1WA 2X1LA 1OLXB 4HLCA 5CB6A 4MJLA 1LFDB 4C5BA 1ZK1A 2BL4A 3IIEA 4I4NA 1YU6A 2IZ7A 3UMBA 4X6XA 1GAJA 1Q1NA 3WXMA 1D2EA 1DIHA 3NBAA 3O4JA 3SF0A 2V7QD 1IZZA 5ENVA 5TV2A 1YDHA 1PW7A 2ZP1A 3ZV3A 4X91A 1F2TA 2E6UX 1GM5A 3KM0A 4OV6B 2ZYUX 3QHPA 2CD9A 8MHTA 4FBGA 4QM6A 1YR8A 3TDNA 1MC5A 1Z18A 3NANA 2R5NA 3M4XA 4TOIA 3TIVA 2OWDA 1EVJA 3LP5A 4X8MA 4ANFA 2FZVA 2VC2B 4LISA 5E3JA 1US8A 3VVCA 4PO3X 5HNKA 2XMPA 2OQ2A 1L7RA 2WSLA 5AI6A 5ABPA 4KNYA 1LWNA 3FBWA 3DJYA 2B1GA 3MCZA 4UVEA 3VMFA 2A7QA 2HRCA 2MSWA 1ZN7A 3GGPA 1CDZA 1E8NA 1F48A 3PB3A 4L4YA 4TV9A 2FR0A 2I3AA 2YJZA 2ZT6A 4PZLA 3RSLA 1ODLA 5CCEA 2BZSA 5E7MA 5GM1A 4IDOA 3KOXA 2ZI6A 3MOIA 3GX1A 4DE5A 1GLGA 2HMYB 3OWOA 3SBOA 3O03A 1TW3A 1EJBA 3LQFA 4UVIA 2HF8A 1EM8B 2OO5A 3EG5A 4DADA 2A5FA 1BMDA 2WD7B 3KKOA 4HH3C 1ZLYA 3RUPA 1C4KA 3A1SA 1G5FA 5EWLA 3UEOA 1J25A 3B51X 4BO3A 5ICGA 2BEJA 4U63A 3QM1A 4K81B 1KOFA 1XRLA 3KBOA 5KWVA 1EVQA 4D02A 2FHSA 2GSDA 2BRUA 2IV2X 1TF5A 3HUDA 4DFDA 3IQFA 2FMUA 1XG5A 2BMWA 4ZANA 1VBMA 1MAHA 2GBLA 1M0TA 2GN6A 3R5XA 2OBBA 3EVNA 1AGNA 3IP1A 4L4UA 1OFTA 1PIWA 4LF5B 1QU2A 1NW7A 4NCHA 2GHTA 5A71A 3EFOA 3CVYA 5EGNA 4CM8A 4G8CA 1A9TA 3C7DB 2HMVA 3UJPA 3TNYA 3V1UA 5B7QA 2V4ZA 2VUTA 4QBHA 3VUEA 2ANBA 1FA9A 1JZSA 5FO0A 5IC6A 2P9EA 4E5KA 2QE7A 3NHZA 4L0CA 4OF4A 2K87A 3STVA 3UKOA 3TD9A 5JZMA 3QXJA 4CQNA 2V4UA 2VAPA 4MS3B 3K9CA 3I9V6 2RJNA 4NEHB 3GDHA 2C4WA 1MA0A 3EA5A 3W8RA 4F2WA 4PAOA 4QTXA 3HA2A 1NXVA 4IHQA 4TMTA 1HK7A 2A9RA 2D0OB 4QICA 1C4WA 3JZDA 3VQTA 5BMVF 1O5OA 4JP2A 4TLMB 4X93A 2FR8C 3CX3A 4BWFB 3SJBA 1NBMD 4H60A 4F45A 2ZYSA 3LUCA 5DGDA 3F7MA 1XZQA 2VDLB 1CRQA 5GOTA 4LJ5A 4IMPA 2FQXA 5C37A 2APJA 1JR3D 3TZQA 4YLGA 1HA3A 1V3UA 5D3KA 2A1UA 4HQLA 4Z0PA 2CXTA 4LMAA 5DLPA 4RA9B 2VJYA 2J4DA 2OCLA 3CR3C 3DHNA 3IAAA 1D2MA 5E2BA 1T10A 1U80A 3JAKA 1VPWA 2R1TB 1GPNA 2RONA 2OWEA 2FPMA 2POQX 3DG9A 1ETUA 2REBA 1R74A 5DTIA 5JVDB 5A5GA 1U1FA 1KQOA 2BSXA 2COKA 3ORQA 5GM2A 4KPGA 3UJ7A 2KBFA 4OQDA 5DASA 3ZK9A 2HF9A 3C6YA 5CYPA 3HGTA 1P1FA 2Z56A 3BCUA 3KTFA 4MW9A 2I6SA 5HQJA 5ILGA 2E4ZA 4AQDA 1HC7A 1RWNA 4BJ1A 1IOVA 4R83A 4XPIA 5IT9A 4UCQA 3EF3A 1S6YA 3JWGA 4DM7A 4I50F 3CWZA 3CLSD 4HNGA 4YCSA 4FE7A 4DR1B 4IM7A 3PJRA 2BEVA 2JLYA 4J2HA 1VKNA 3CEPB 3VPBA 1XVLA 1YT5A 3IULA 2P3OA 3A10A 2V0GA 3H9UA 3NHJA 3MAJA 5CCBA 1GTZA 2C1EA 4YCBA 3SJZA 4BNLA 1YU9A 4Q4CA 4DWWA 4ND6A 2J87A 3AH8A 1P4RA 1RMYA 3HCNA 4Z2YA 1M74A 3OO0A 1U9JA 4OOEA 2YV2A 1B6GA 1NJ1A 4M76B 1YRQA 4CUZA 4PSUA 5FOVA 4YYZA 2GB4A 1JFLA 3PDJA 3GL9A 1W4RA 3M83A 4FZVA 4HJRA 1KSGA 1TJ3A 3VPDA 3GB9A 2QTBA 4J2OA 3CNLA 3RV3A 4LEIA 3WISA 3JD4A 4M9QA 3UWDA 1T8UA 3T99A 1T3LA 1DXYA 4Z9YA 4QOGA 3A1VA 4J7XA 4F12A 3RK1A 2C2HA 4IVNA 3T3EA 4F4DA 2W0MA 1HDCA 1C2TA 4TS4A 5DKFA 1R0BA 1GSIA 1YMUA 4ID3A 2MWMA 5HILA 2FN4A 4L4XA 3B53X 2XZOA 5J9FA 1FNDA 3UANA 4DNPA 2HSGA 1ZKDA 2HX1A 1K4KA 1YA8A 2HTFA 1P9RA 3C5WP 3F3YA 4MPJA 3GLFE 2VJAA 4NCBA 4QUDA 1JVNA 3PI6A 4BWGA 1AK2A 3ASZA 1C7JA 3GUUA 4MAFA 2AZXA 3TO5A 1QX3A 4H0NA 4CCYA 5ALSA 4UFNA 3WX0A 1T36B 2ZRGA 3T1OA 1VFPA 3OZUA 1B0AA 1YJXA 2IDZA 4HQ6A 3E1KA 3W9SA 1D1QA 3AHGA 1Z5NA 3NJ4A 4KL8S 2QTLA 3H1BA 4JY7A 3KVYA 1TUIA 2G40A 2O1EA 1L7DA 2YRFA 2BI4A 3K9GA 5E7JA 5HCNA 3FGOA 5AOAA 4DCMA 1XNHA 4GMHA 4KCGA 1VRCA 1W73A 2VPWA 1QV7A 1LPNA 3KV3O 1H65A 3LK7A 4LJ7A 4UXIA 3W2GA 4D9NA 1Z6PA 2GUGA 1GG5A 3EZXA 4FXPA 2GBLC 7REQB 1UIRA 5JU6A 3TI7A 2WIDA 3HBMA 1H6CA 1NVDA 2G71A 3AM5A 3LVQE 2C83A 4HGYA 4DABA 1TIBA 1SU4A 2P4EA 4I46A 3AF3A 1AKQA 1A2QA 1GVHA 1GR1A 1F2VA 5CM8B 4G3XA 4URFA 1ESDA 3H5WA 4DLWA 7MHTA 3JD0A 2VRWA 1T5BA 3MELA 3ASVA 3P32A 2HCFA 4F3KA 3PLAE 1Z4PX 2ZTSA 3KR9A 3WGLA 2H7CA 4R81A 1E66A 2DOKA 1I4TD 5KQRA 4N03A 1G55A 2XWSA 5DP1A 5K0GA 3C8HA 2BP7A 5E4FA 3Q7IA 3T3NA 4K0KB 1DJMA 1M8KA 2A35A 1A96A 2D2VA 3ADKA 3BGWA 3P9QA 3R09A 4PZYA 1YI1A 2OYCA 1L5LA 1INLA 1CR2A 1U6IA 1CQIA 2JAWA 4LXQA 2IBSA 3HHPA 1CQIB 2O4UX 2FSVA 3B1KA 4OGLA 5E0KB 1E3WA 1X1AA 4BC0A 3SE0A 2CLEB 3T35A 1IY8A 5BUQA 4YP1A 1VLQA 1S3GA 2WG2A 2A9KA 4M36A 2Z8YA 3NASA 1XMVA 5BR4A 4PS1A 3K6SA 3DDWA 4XGQA 4X60A 2MIIA 3FWNA 4JYCA 3BE4A 1P7VA 1KFKB 2BKUA 2PGXA 3EZ2A 2G1AA 4PC2A 3E9QA 1NMXA 1FTYA 2HK7A 1JT9A 3FFBA 4HGZA 2RARA 4PC1A 2FPWA 5JJIA 5IJAA 4R1LA 1VL1A 2OV4A 2EHDA 2PLAA 1HT3A 3WOHA 4G09A 4TWJA 1EM6A 2Y9MB 3AKCA 3GRZA 1Q0HA 3LAWA 3E7WA 1F3LA 2P2NA 3EBLA 2HA0A 4BLQA 1DKQA 3L0SA 3U39A 4OU4A 2CLOB 4P80A 2HF2A 3D1LA 2DFLA 5AQEA 3ZWDA 5GOZA 2HL6A 3SBDA 5EC8A 1C8LA 5KTNA 3OPNA 3K0SA 2O2XA 4FX5A 2DBYA 3H16A 1Y37A 4C0LA 3A1DA 1IYZA 2F48A 4Q7KA 3W77A 2ADOA 2E4YA 3HJBA 1UBGA 1DKOA 4IKEA 2OXCA 1KY5A 1FYFA 1OI2A 2JL1A 3D8HA 3F74A 3BAFA 1V5GA 2YJ5A 1R5NA 1WE2A 5C8YF 1Q57A 2ZRNA 4YGXB 4YRGA 1Y1RA 4XB1A 3UXHA 4GYYA 4CLOB 1D0IA 2QZ4A 3RSSA 5FR2A 3SBEA 1KE1A 1N3IA 2V3WA 1L7MA 3A2LA 1HBJA 1SVIA 3G1WA 3MZ0A 4KODA 2X19A 5U1PA 2A0XA 2D1RA 4CMAA 5GZ1A 3QSGA 3WQQA 4YV0A 1HYQA 3ZWNA 3BSWA 1YVEI 3T52A 1B1AA 1G42A 1HNZB 4A0GA 1DWPA 2P6OA 2BVNA 3G5TA 3LI2A 5A4JA 2ODEA 3HZRA 1JW9B 2YYSA 3GFFA 3EG9B 4JROA 4ZODA 3H04A 4PO8A 1Q21A 5D8DA 2W00A 4IXWA 4P4SB 2KE5A 3O4RA 1C2YA 1NYTA 1XO1A 2DJIA 2JAPA 2Q9AA 4V0ME 5ALQA 1J09A 4JWTA 1Q17A 2XDYA 5DNVA 3B8EA 2BDUA 3I1FA 5F76A 1PNTA 4G67A 1TL7C 1GP2A 4QNNA 3VBEA 3DLIA 3TLMA 1POWA 3HEAA 3UXYA 2G5TA 4LCJA 3M1YA 4WZ6A 5JI3E 3QTLA 1J5PA 4N5HX 5JSQA 3CY6A 3SOZA 3WAJA 2AJBA 3MVEA 4EQ6B 4DR3B 3VSDA 1SOMA 4YAWA 3Q6MA 1LVGA 4YP5A 1IM8A 4E22A 5MFPA 1FXUA 4FP9A 1FQKA 1VL2A 2GVNA 1OTYA 1V71A 2IBTA 1M8JA 4GP7A 1W5SA 1R9NA 4QA9A 3W7BA 1Y3HA 2OV8A 4EI8A 4HDRA 1SG6A 1VLZA 2WB4A 1QGYA 1Y3CE 1ULUA 3CRW1 1CULC 1LA2A 1DJQA 1YASA 2H1LA 3KJFA 1XJQA 3U0BA 3U80A 5EJ7A 1Z8FA 3DSRA 3P52A 3PR3A 1A97A 4PTZA 4RF3A 5AHXA 3HJCA 3QPUA 2C9CA 2ZS7A 5HFJA 1AVTA 1BDBA 3T94A 3UK2A 3EFOB 2PFSA 1YAHA 1ZU5A 2R1UA 2QPTA 3O47A 2PIAA 5KVSA 4NYIR 1RMTA 2PQ2A 1D6MA 3I5XA 5JYEA 2GK3A 2NZUG 3CEAA 1RIIA 4MI6A 3WBFA 1GKIA 2F8LA 1E99A 1RHMA 1XHLA 2IYRA 3CEHA 3G7SA 4JODA 4XLLA 3DLAA 4E51A 6REQB 3I8OA 2JI8A 3E6AA 4F1WA 2ILTA 4MRMB 1FVXA 4MKXA 5TQJA 4LECA 2VSOA 5EHIA 3HJAA 2O8FB 4V0LA 3VC3A 3IPYA 4N39A 2IYNA 2OC4A 4JNCA 3QUCA 1M2GA 2JFYA 3QVOA 5FB3A 2V4MA 2JVJA 4YRZA 1DTWB 1E3QA 1WQ4A 3I6ZA 2YJNA 3MAGA 1GNRA 4J6EA 4UTXA 3U4DA 3VR3A 3RE1A 4EM6A 1E79D 2PUBA 4UUBA 2W71A 4PC6A 5KKCA 5DYNA 1OYYA 2Q0QA 1X7ZB 4I1PA 2WJWA 1SKMA 4CEJA 3K53A 5IVKA 2B7LA 5ARCA 2B4AA 3O4IA 3WGHA 4RQBA 3Q9UA 2PUDA 3GVXA 4G6ZA 5CDGA 3JYOA 4G0QA 1GTL1 5K45A 3SCZA 1FYEA 5KIAA 3QVVA 4WA8A 1ZI8A 5ES3A 1NQXA 1BEZA 3U9SA 3T5AA 4W5JA 1XNJA 4F84A 4AI6A 2DWQA 4UE2A 2OAGA 1VYHA 3HPQA 3F7TA 4PFSA 1RRKA 1S96A 1DUVG 2P35A 2GXQA 3KYJB 3LY9A 4I1SA 4G63A 3CSSA 1QTRA 1J8YF 2XDQB 1SQ0A 3SF8B 2ONKA 3A58B 4H7FA 3DL2A 1FYVA 2C4KA 3CUWA 4OK3A 5HK8A 5ITZA 1NVKA 2IDJA 3IURA 1UBMS 2OO3A 2J3IA 1HLDA 4IHKA 3VU8A 3F4LA 1QB8A 2HQOA 4TTRA 4YAUA 4UPEA 2BGTA 4WXEA 3GEMA 3LZDA 2GFHA 3M9XA 1ADBA 4Q48A 4EPXA 1Q1ZA 1J9EA 5DSZA 5JDIC 4QOIA 2HJHA 2JZNA 5CH5A 3D4PA 4OMDA 5BRJA 3B89A 3N2YA 3GPBA 4LVOA 3L7NA 1DKNA 2A3RA 3MOSA 5DBEX 3AGPA 4H31A 4EMBA 1FX1A 4NE9A 4YRAA 2VA9A 1Y1KE 1RXIA 2G08A 2X0IA 4NMXB 4NZYA 1D4OA 3ZOZA 3EGXA 1SXJC 2QAJA 3OCWA 3K0AB 2JKVA 4IGIA 4YGYA 1QH0A 1G8KA 1VE6A 3DFZA 5IU6A 4K9DA 4CKWB 1RM4A 2BJVA 4R9RA 4Y30A 1FFCA 1TMKA 4PYNA 2D4AA 3TMAA 4C03A 4DZTA 2C0QA 4TZ6A 5KQPA 1QK5A 3NHPA 3M2PA 4P1ZA 3A6DA 4GYKA 1ISSA 3CNQS 4EY8A 1XN4A 2KYRA 4I99A 3DFUA 1UJCA 2P62A 3SJCA 1GTJ1 1B73A 4CMHA 1QIKA 2ES4A 4AU1A 1XLTC 1R6UA 1M2HA 1K0FA 3TOVA 1DL5A 2QVZX 2A9QA 1V1RA 1U8YA 1U3TA 1XA4A 2QLJA 2ZXEA 2Q1UA 3C8ZA 4KV7A 3CSUA 5G4KA 5LD2B 1G8SA 1VGQA 4PG4A 1RHUA 1Y8QA 1LC3A 4Q1BA 1P80A 1CE8B 2EJWA 1M2JA 3A7EA 2IW3A 3ML1A 2WV9A 1J0DA 3O38A 1UZLA 5TMDA 3THOA 1XN1A 1UDCA 1Z88A 2WJZB 1RR6A 1Z6TA 4PRYA 2C42A 4W1RA 3ET4A 5BURA 5KOIA 4I1RA 5CCXA 3EVCA 4G0YA 5ALXA 3HSYA 1I13A 3RC3A 4CDNA 4EY5A 1EXNA 5LQJA 3CCFA 1EU1A 2I6XA 3TPFA 1XEWX 3PYMA 4QQNA 2ODWA 2ORED 3QVLA 5HIKA 3DZHA 3PFKA 1DQPA 4LMBA 2AG8A 3KJXA 5ERGB 3TW8B 1I5EA 1XKQA 1CDDA 4J0HA 3JZMA 3V97A 3FLEA 2ZRMA 4Q47A 3AM1A 3GA0A 1QE5A 2RHRA 1EXWA 1I2CA 1MEOA 4KIGA 2Z6QA 1FZQA 1KI3A 3OPYI 4B2YA 4BS9A 2EYQA 3JTMA 4GGPA 4ZDWA 4F91B 1IEXA 5MN4A 1W4LA 5EXTA 4X66B 3IRVA 3SX2A 4TQAA 3U4QA 4R8KA 5TQ2B 1K2VN 4TTSA 2XH8A 3V1NA 1ZNWA 4XKJA 3VMMA 4DA4A 3KVNA 4FC7A 2DSNA 2J30A 3IKTA 2AXNA 2CBGA 2QDKA 1BDJA 1MAVA 2A0UA 4B3IA 1O9BA 1KK2A 1RJWA 3DMHA 2CZCA 2Q5CA 3K70D 4QJ3A 1YZTA 1OWLA 2G70A 4KYUA 1JFFA 1MIHA 3CW9A 1WZ2A 1K5DA 1JR3E 4QATA 2VNKA 5AK0A 5ECYA 5SICE 5A7FA 4KXLA 3CIOA 1H0RA 3IBCA 4RPCA 1WTAA 3G3EA 3TMYA 1L8XA 2Z0MA 5EWLB 3TX6A 1KZ9A 1NASA 1L5SA 1Q1QA 4CTOA 3L1UA 3N5CA 3OTHA 1EGAA 1IB6A 4BQNA 4HV4A 3ZJUA 3MB8A 4Q21A 4JBHA 2I03A 3OLCX 3QY9A 4EJSC 2Q3LA 5HW0A 2IWHA 4YY3B 2PZEA 3RC7A 1XV5A 5C51B 5BPHA 4IZ6A 3H87A 1SZJG 3KZCA 4KHPB 4B7CA 3JYHA 1OXBB 5DV9A 3T41A 5HIMA 1OBFO 2GVDC 1P91A 4Q1VA 3Q98A 3GFQA 2F43A 5FNVB 3GN1A 3TRFA 2HO5A 10MHA 4TLLB 2BBTA 1C8VB 3BH6A 3DGFC 5JG7A 4BVFA 3CWQA 3LOPA 3PPVA 2XGSA 5JTTA 3SX0A 4C6TA 3QJ5A 4MGZR 3DKRA 3P9YA 4KPUA 4M7OA 5ICMA 1IZ8A 3H2BA 3NQ41 3RHTA 3TFWA 4Y9UA 1KJIA 2E4UA 5AM4A 3VR4H 1NR7A 2B83A 5KYXB 2NV6A 4X85A 3JQAA 5HUJA 2OD7A 4EW2A 3HXKA 1K0UA 3TQIA 4CG3A 1N6LA 3ZIDA 1NVGA 1QRDA 1XF1A 3P8ZA 2GRAA 5EZQA 1C1XB 2VUUA 3DULA 5DM0A 1UKZA 2C82A 4M9SA 2YOHA 4Z4HA 3SFTA 4DHWA 4J7UA 2XITA 1KTVA 3GDFA 2RGYA 3IQXA 4M2LA 4BIIA 3NH6A 1TADA 1ETHA 1OZ0A 3HB7A 1O94D 1NQVA 4A4DA 1QIEA 2PRJA 3H42B 2XCSB 1N2XA 3AWDA 4XDYA 3NUZA 1I8TA 1SIUA 1PEDA 1XB2A 4WPGA 1JDBC 1DX9A 4LHEA 1IL0A 1C14A 1C7RA 2V96A 4F5DA 1TOAA 1DQNA 2FPRA 1N2JA 4JT9A 5M3BA 3R7LA 3QVXA 1O6GA 1V7QA 1YRWA 3DZKA 4GKVA 3FYUC 4R9NA 4DMUB 4FSHA 4QU9A 2W6NA 5ESWA 4CKBA 4WAUA 3T5DA 1K06A 1P4HA 1QGDA 3JQAD 5FQNA 1OI4A 4E5MA 5I7EA 1Z47A 2A5YB 3OLYA 1E1DA 5IYZF 3RWOA 3FGPA 1QH8B 3VKFA 3V8BA 1ZXLA 1U2DC 4WGFA 4RGBA 4RVNA 3H5IA 4RSMA 1YUNA 3SR0A 2XE8A 3HHEA 8ABPA 2P77A 5KTMA 5G4KB 1OB5A 2HC9A 3CF2A 1OH7A 2B25A 2WHRA 3ND7A 1L3BA 1JDUA 1ZMOA 3BL5A 1DIAA 1OV4A 4U3JB 3Q7RA 1PQ4A 4DM3A 5IDYA 3PK0A 3WKDA 3N2IA 1T2NA 5AVRA 1FJGB 3TSWA 2KB0A 4YJGA 4DV7B 3DL4A 3P2KA 4FQ7A 2Q2WA 1QANA 2YY5A 2WHPB 3ANLA 2DAPA 4F5ZA 5JJKA 3ESZA 2Z6AA 1CQJB 5FBKA 4DG5A 1MORA 4IDDA 1Z8NA 3G82C 1Z2DA 1M2EA 2YJGA 3CH4B 4IHJA 4XR4A 3D4NA 2ZRFA 2E48A 1C1DA 3D6UA 4PNZA 1RLOA 2NT3A 4B7XA 5K5EA 1D9ZA 1OGYA 2ATEA 3DYIA 1CZRA 2M2IA 3HM2A 3GQBB 4UC0A 3CNEA 4QUIA 1U3WA 4TYNA 3WOVA 5BSVA 3D3NA 2FTKE 1XJ5A 4LNUB 2XB6A 3KELA 4HDQB 4QVGA 4MEAA 1H1LB 3UM9A 1QQBA 4DWOA 1O03A 4FNMA 2Z9DA 1OBHA 3JQ9A 4X1KB 2W6CX 2IVZA 2HDHA 1G5TA 3BICA 2XGGA 3F46A 3LLCA 5CIWA 5H02A 5KYVA 5C1BA 1C3OA 1Y8QB 4RPGA 4CLHA 1T13A 2ATVA 5E1OA 1DFIA 1Z3IX 4D9CA 2ZJ2A 1KH1A 4Q9NA 3M3PA 5DYTA 4AWAA 5FTMA 5M34A 1VGRA 1NURA 3JAWA 2UUAB 4UFOA 2GO1A 2R4QA 2OG2A 2EIXA 2OV2A 3PZBA 4XJXA 5ALMA 1XRQA 4JB8A 1M2WA 2RGNC 4L08A 3FLAA 4WY5A 3FM9A 3VKUA 4OFWA 2JCBA 4DLVA 5AVVA 3L01A 1W85B 3C41J 5EJ6A 4P5DA 4DC0A 2C2BA 3DO6A 1U28A 2IP1A 5CB8A 2AI1A 1VIYA 3ANMA 4QYSA 2WY2D 1SVOA 2WZQA 1Q6YA 5HM8A 1B8PA 4KREA 1P5ZB 1MJFA 1W5FA 3OJXA 5IKOA 5DYWA 3DEZA 4L4ZA 2MT9A 2WHEA 4LYAA 5LR6A 2Q3CA 4R98A 1GG9A 2Q21A 3ICPA 3TRIA 1XQ9A 3WGJA 1QRSA 2P4UA 4YJHA 1NUHA 5EIOA 3O4HA 1XDWA 3RFVA 5FLYA 1L4BA 2XVZA 3F4BA 2PUWA 2W8BA 2WU1A 4A6PA 4AAYA 2QAGB 4ZOLB 3W7AA 4D3FA 1Q14A 3S1SA 3AFMA 3WDSA 3DAGA 1PN3A 4CV3A 3T7EA 1VP3A 5KYWA 1KQFA 1UBUS 2RGRA 4W9RA 5KHAA 4YYEA 2OCDA 4Z4QA 1M2OA 5AM5A 5LZ8A 3TOXA 1K4MA 5FUQA 3S40A 3OM1A 2Q6OA 3BJIC 1UBHS 3EXG1 4O4HA 3ZS8A 2AKYA 1M1YE 5M7EA 2D7DA 4WJKB 3UO8B 4JNKA 5IZCC 3AB7A 2BTOA 3PPXA 4WK4B 2YHIB 4WY2A 4O3FA 3T5CA 2I6FA 3R3HA 3RSGA 4D5GA 3HACA 3KAKA 1GADO 2G6TA 4Q7JB 1E9VA 2H8GA 3C16C 5GPBA 2G5CA 3ODGA 3KJGA 2G1KA 1JLLB 4NQRA 1PZXA 4O2BA 5DSXA 1LZKA 1AS3A 3E7XA 4UJ3A 3BD8A 2QPAA 4ZCLA 1EWRA 1PGJA 1TZKA 4G97A 3B6IA 2V7VA 3RUDA 4FFVA 2H1IA 2EQ5A 4RH1A 4DA9A 1VYVA 1JTFA 1BWPA 2NU8B 4FYHA 4R1UA 1U5BA 3T4EA 3RFTA 3NAMA 3A6HA 3B1JA 3LOUA 4K2HA 2P3SA 5HS4A 2XTNA 2DGDA 3DZGA 3S2EA 1NGSA 5JCPA 3FPLA 4B73A 1WOYA 1VXOA 5AI5A 4RVCA 1PJZA 1ODSA 5J47A 5DW3A 3OCUA 1DAEA 4F6RB 3TEMA 1GL7A 1K7XB 2DLDA 2ZBPA 4OFZA 4UQLA 4G8BA 3A4MA 3C98A 2RC6A 3FUVA 1L5HA 3WLSA 4JXKA 4WESB 4R1MA 1HL7A 1YKFA 3VR5D 2JRLA 1PK9A 3BXXA 4DSTA 3VU9A 1ARZA 3HKDB 4GOXA 3HCWA 4LY3A 4HDMA 1GRCA 3RIHA 2H57A 2XGJA 4DUGA 3PV0A 4XW2A 2QN1A 3GJYA 1CUSA 1HE1C 4KYVA 4B32A 3AIOA 5EKDA 2AFHB 1O7JA 1TZ2A 4F46A 4PCUA 3PQ7A 1IN7A 2X76A 4EA7A 1NTRA 3AFHA 3DE0X 2XF2A 1KE2A 1COWD 4DIBA 5JJ5A 3IPAA 1EG2A 3TF5A 5B6IA 4OX9B 4RULA 1T9GS 1FUEA 3GCGA 3R0VA 5T7BA 2ONCA 3VHRA 1UH5A 2ISQA 1VJGA 3HKDA 1EB9A 2QJRA 4YHBA 1N92A 3RYIB 3WADA 3P4YA 2QP3A 1N5LA 4QT4A 2C2YA 2H00A 2NSJA 3OZRA 1DBVO 2XOKA 4K3VA 4YAIA 2BFBB 4UAGA 2YZ7A 1SVLA 4K9OA 2PNJA 3UV7A 2QSYA 1GPBA 1TTQB 1Y7PA 5KOJB 2EKZA 2OECA 2WKRA 1R4MB 2COEA 4S0XA 4DUYB 3U44B 1IBLB 2QSJA 4QHYA 4E5NA 3BBLA 1F0KA 2EKQA 3AINA 2NO0A 2WZDA 2AR7A 4MO9A 2XR1A 3ESYA 5HUHA 4JEIA 2VDJA 1Z08A 2GDJA 5KYNA 4JI0B 1U5CA 2XUKA 4L50A 2CCJA 4UHEA 4C0SA 2NVBA 3QX7A 2B7CA 2JB9A 3AESA 3R76A 1Z6AA 1S2NA 3MXTA 3E5HA 4E4RA 2IYPA 2B34A 1M2NA 2PX3A 3DWFA 4IJKA 2PKQO 4A2PA 5E8RA 2I2WA 3UMSA 4CQLA 4RNCA 4WZAA 4QG3A 4NMWA 2GJKA 3KJHA 5FA8A 4Q00A 1NF9A 2RGUA 3VPFA 3PBKA 3LQKA 1VSVA 2JAUA 1ONNA 1OXSC 2JLBA 3U4IA 3S55A 2H8KA 1JDSA 3TZEA 4DLPA 1AT1A 1EKXA 2GYVA 1QQ7A 1VOTA 4WE3A 2EZUA 1OF1A 2DH5A 2P9GA 3GDGA 3SZGA 3G2NA 2EFYA 1X1TA 5EFOA 4H4DA 1GYRA 4FDMA 4L73A 4M1YA 3DE2X 4YQYA 1KYIA 3HKCA 4ZQFA 2V3VA 1Z62A 1N2BA 3COPA 3VUFA 1N4DA 2VQSA 4QHSA 2AJCA 5C5DA 5L3QA 1C80A 1NFRA 1YDEA 2Q2NA 3G2HA 3TB6A 3EH1A 5BN4B 2PMBA 2Q4BA 4XQEA 2R3SA 4R2JA 3SJUA 3NWJA 4QRHA 1LWOA 1Q3HA 5H1YA 3PXCX 4RPIA 2M6LA 3NVKI 3QF4B 3KUUA 5K3AA 2PH3A 2QUJA 1WMDA 2O54A 4ZVKA 3KO8A 2JAXA 4RUKA 4YH1A 1N34B 3HS3A 3CZQA 3MS7A 1XRPA 5AKZA 2NVWA 1E20A 3EHDA 2HD4A 3D3QA 4ICIA 3ROFA 2JGDB 3LQQA 5FT9A 4FHDA 5DW0A 1IY0A 1SA0B 1JAIA 1Z83A 5EAIA 1G2OA 5THKA 2V5VA 2I65A 3K09A 5IDVA 3TTTA 4JMPA 1HOTA 5K6AC 4BZXA 1W4CA 1L5RA 4DQUA 2EBFX 1Z73A 2FVYA 4WWHA 4JLMA 2WK1A 2Q9CA 3BFVA 4L7VA 2ONZA 1PS8A 4GPEA 1CJVC 1KI8A 1OXMA 1CUDA 1RXCA 4AKGA 4FVTA 1H85A 3LYAA 1NJ2A 3ND5A 3PCRB 5DULA 4NQZA 4FEEA 4D43A 3IUBA 5TT0A 4BWYA 5DN9A 1VPEA 1A9OA 3CVUA 1CLEA 4P36A 2XRZA 3HCEA 1W36B 1SHUX 4GE0A 1V11B 4GXQA 4PANA 4WLFA 2QXYA 3T7IA 3WYNA 1C7FA 1KPGA 3H1AA 2ZI9A 3ZBPA 4E6PA 1P4JA 3DBVO 3ITDA 2Q5LA 2MYNA 4WLNA 4WL0A 4IVPA 1UKCA 1FFWA 4CNQA 1A9XA 1ZLXA 3R8FA 1N0IA 4X41A 3ZDEA 1VLLA 4KDFA 3AKYA 4RQUA 2NXJA 2R00C 2WP8J 3GEEA 3NBQA 4FFMA 3H1FA 4XEUA 2H5LA 2G9QA 2ZJ8A 3CG4A 3A6KA 3W9UA 5C8DA 5FOQA 4A0HA 2BFWA 3H4TA 3VSCA 2Y0PA 1DU4A 3E1GA 4PBSA 4OXQA 4NOLA 3V4PB 4CN9A 3OHSX 1EWVA 2OFPA 1JKJA 1IWOA 1O8CA 2I2DA 1B8VA 4OAPA 4NH0A 4I66A 3MLAA 3GFPA 5ESDA 2F3RA 2V0NA 5CXSA 1JHPA 2B36A 5JNTA 5LDHA 4BY9E 5LU9A 2AMVA 4QD3A 1BN6A 4O4HF 3JVIA 3BA6A 5FI0B 1A8QA 4IMRA 4E5SA 3JZFA 1PLKA 1MB9A 2GCIA 1SFRA 1IK4A 1JIIA 1P72A 3WL8A 4B85A 1XKTA 1SQFA 4Q6WA 5C8YB 4B8WA 1P61B 2IYSA 4Z4GA 1NNI1 1GA4A 1SMKA 1T0JB 3UOAB 4B3DA 3JAWB 3V2HA 2OL4A 5FYQA 3RT7A 2Q5FA 1IBCA 2O1WA 2B4KA 3CX8A 4XJTA 3UJ8A 4BCBA 1E2FA 1T2FA 1EAYA 3ZDBA 2W48A 3TZ6A 4RD4A 1YDWA 3Q41A 1KBZA 1PZNA 2ERYA 3TLYA 2BFCA 1L1EA 4FT4A 4FBMA 5CX1A 1Z56C 1E6KA 2J9RA 4E1VA 3L0ZA 3I73A 5JOQA 1GNSA 1NKSA 2YRWA 4CL8A 2XMGA 1C0PA 5T4FA 5MN5A 1YQGA 4IWXA 3ZVKA 2VH1A 4X7RA 3TE6A 3SNKA 1M0WA 3EF0A 1F8FA 2F1JA 1NE2A 4AB1A 4HVLA 4OJQA 4EHIA 4W9NC 1YVPA 1T9HA 1P6XA 4O4HB 5L3RA 2Z95A 4EKDA 1LB1B 3A26A 1DCMA 3OI7A 4BL5A 1ZZEA 3E58A 3M6FA 4EPVA 1TJNA 2BSAA 1N32B 1UBKS 5BN5A 2AN1A 2ZT5A 1D2NA 1PTKA 5A04A 1Q19A 4DBVO 3BL8A 4TQGA 3RS5A 3W5UA 1BSVA 5L3ZA 4TMVA 2PE5A 1KJNA 2I7XA 5HKKA 4U7GA 2H1CA 2QZPA 2BBSA 2CHUA 4KSBA 3QGMA 3DONA 4UJ5A 3F3KA 2CZGA 5FA6A 1NN1A 3O83A 3VJMA 5D6OA 3A11A 1X70A 4C7KA 1Q44A 4UTRA 1ORHA 2HH9A 1N6KA 2PX2A 1G9TA 1T8SA 3JR7A 2WE8A 4GE3A 2VUHB 4HMPA 4PHHA 3LMKA 3I62A 1RZRD 2AX4A 3F9CA 4MICA 4WH0A 3HJNA 4LNAA 2ATCA 3BHMA 3SN6A 3DHEA 4CKBB 1Z5PA 1W5TA 2Y2UA 4HEQA 4S05A 4IDCA 4LRSB 4FLFA 4PCVA 2ADMA 2D7JA 2PUJA 2Q2OA 3Q2IA 1HR0B 1ZRNA 3O3OB 1WB5A 2BOVA 1JJIA 1UXIA 1CBUA 1PT6A 5I9MA 2HSEA 5CHYA 3VH3A 2EKDA 1SIOA 1DUSA 1EINA 2MSEB 8OHMA 1JEQA 3IDAA 1ZAYA 4Y2QA 1KIAA 3CR7A 3VYWA 1PNRA 1MZPA 2O2EA 2P5YA 2PRZA 3PKZA 3AUFA 2CXPA 2H6EA 5GGXA 1JEYA 1ML4A 221PA 2ZPTX 3I42A 4GP9A 5EKTA 4FD2A 2CUKA 4QTYA 4IXNA 3KWMA 4RTKA 1BW9B 3OY2A 2CVQA 4JGIA 3QKWA 1BCSB 3KOWA 3ICVA 1NG9A 1X15A 4NMHA 2GSWA 5CA0B 2I71A 4RXUA 4OLJA 3FKQA 3JQAB 3FSEA 4QUEA 2GZAA 4AKTA 4DMFA 2RB5A 3OURA 1I5RA 3IDSA 3FB1A 3OM8A 2C9OA 1EVZA 4HAYA 3JD1A 4QDJA 2IPAB 1ZK3A 1TAQA 2VPXA 2Z4TA 4FB5A 4MMXB 1H8HA 1JVSA 1DCKA 1JZTA 1NE7A 3UC5A 3IX7A 4BQSA 1KI9A 5IKPA 4XR9A 1BQEA 4TXJA 1U8FO 1JQDA 2C96A 1UBLS 1QO0D 1Z0SA 5LBIA 4F2PA 3JTEA 4EA6A 2NUAA 4YUWA 5TQVA 3GUYA 3L8DA 5DNDA 3T5MA 3TXXA 1I3LA 2BF7A 1RIFA 2MOKA 2OCIA 2Y6VA 4UATA 3TXYA 3V42A 3D4LA 4RHEA 3OFSA 2ECKA 2WT9A 3AXTA 3L5KA 2NT4A 1XWFA 2BKEA 3GFTA 4C5CA 4OI0A 1VCMA 2C84A 4RZUA 1I7NA 3UUFA 2Q3EA 2YN0A 4GOJA 5J2TF 4G4SO 1LDYA 2VPYA 3PVSA 4KO2S 4K9MA 1B74A 4L2IA 4L8FA 4RJ2A 4OA8A 4DL9A 1JB9A 5D5HA 2OA0A 2BZ1A 4AO6A 4CGZA 1LRKA 4NAUA 2Q4DA 3FNBA 2A9OA 4RENA 5BNWA 2AC4A 1PR1A 1GGEA 1NN3A 1KGSA 4LRTB 4RY0A 5C7OO 2HJSA 2Q0XA 2DUUA 3BZWA 4TYPA 3UKJA 3MRVA 1IC6A 2H65A 4FPXA 3UJBA 3WDLA 2FW9A 3C5VA 3IB3A 4EI7A 3P9PA 5HKLA 5KI6A 3KR2A 1YI0A 1YRHA 3TCKA 4D6PA 4ECEA 2ZWMA 2BFEB 2H4XA 3MTGA 3NB0A 2H9IA 1N3LA 3P2EA 3CMCO 2OLEA 3E9ZA 4ML3A 3R8XA 2L69A 1GN8A 2FSIA 1AA6A 4NCAA 1FDSA 1O94C 1Q0RA 2JIOA 3R0IA 4PZCA 3IOBA 1NSYA 3CJTA 3R3XA 4AMGA 1OCEA 2DHRA 3BFJA 1KDVA 1MX3A 3RVKA 3FTPA 5JJCA 1D0SA 1K63A 3OT1B 3W6UA 2OM2A 5FIUA 5FNZA 3THWA 4L76A 3DAYA 5LXTF 3KKMA 5BSGA 1BU5A 1LKZA 3BMOA 3HCAA 3IVGA 3MBOA 4ARBA 1XVAA 4RVDA 3BMXA 3DUFB 4JOSA 1KYZA 3UYLA 3VNBA 3HXTA 3LF1A 1QE0A 3GEDA 4JYMA 4ZHQB 3CRVA 4REQB 4EPYA 5A02A 1QK4A 1WPQA 3EIQA 5THXA 5BWBA 3HL4A 5J40A 1FS4A 2QKYA 1WTCA 4Q9DA 3FIUA 4PQFA 4RZ3A 3ZWKA 1EHCA 1Z4NA 3QBEA 3EGOA 3WBKA 1UPUA 5EHZA 3H9QA 1SZDA 2FSGA 1U0JA 4ILEA 3TW0A 4RE5A 4PAWA 4RS3A 4KGXA 3IEMA 2QBYA 2IEGA 1TJ5A 1EVEA 4M4SA 3BULA 3DOIA 1PSWA 1YL6A 2ZTLA 2ZYDA 4MW6A 4TZKA 2FF7A 1I3NA 4FILA 4CCSA 2EZ9A 4XLZA 3UG6A 2JFPA 2ANCA 4HLDA 2D1FA 4HQRA 3DWIA 4WK0B 5LBTA 4TRJA 1X7GA 2XDWA 1G8AA 5IEJA 4M87A 1WCIA 1KK0A 1J0BA 1KFEB 1W6RA 4OH1A 5TNXA 5KQMA 3INNA 4K05A 2NW6A 5B1SA 1GWNA 3FUTA 1D9XA 1ORRA 1AKTA 2HA2A 1YFLA 2Z2JA 4CMIB 3LW7A 2YMMA 4PQYA 4CHTA 3GLHA 4KQ2A 3VO1A 3A3PA 3OCZA 4KGVA 4AG6A 3GJ7A 1I7DA 3K5IA 4J90A 2XUFA 3E1SA 5EHGA 3O2SB 2O50A 1H2RS 5CLLA 2IV7A 3T9AA 3E48A 2EZTA 3EAFA 1BXRA 2NZJA 1W8DA 3H6KA 3PRJA 4GG1A 4YAEA 1R0RE 1S3FA 4CI0B 2JLSA 821PA 4FW9A 5FHRA 4ERXA 3W9BA 1G2QA 4RETA 2AJTA 5CNJA 1RAGA 2XEDA 4OXKA 4ZPJA 1L1QA 5KNBD 2J3LA 3C48A 2XIQA 3BWMA 2W98A 4JT4A 4U7TB 3UHPA 3GRFA 5IJ0B 3OU2A 5KO2A 4F9GA 5IBCA 2FPGB 2H2HA 2Q5QA 4MI9A 4YCMA 1C8BA 5FTJA 1CUHA 2GN2A 4TM8A 4LOKA 1PL8A 1UJ6A 2QHXA 4DS3A 1V1RB 1QAMA 1WMAA 2ZUBA 3L7CA 1UXKA 2WNHA 1BOOA 5BWOA 1J0XO 4KQFA 2WTMA 4ZZIA<