4B6SA

Structure of helicobacter pylori type ii dehydroquinase inhibited by (2s)-2-perfluorobenzyl-3-dehydroquinic acid
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
158
structure length
158
Chain Sequence
MKILVIQGPNLNMLGHRDPRLYGMVTLDQIHEIMQTFVKQGNLDVELEFFQTNFEGEIIDKIQESVGSDYEGIIINPGAFSHTSIAIADAIMLAGKPVIEVHLTNIQAREEFRKNSYTGAACGGVIMGFGPLGYNMALMAMVNILAEMKAFQEAQKNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 3-DEHYDROQUINATE DEHYDRATASE
publication title Mechanistic basis of the inhibition of type II dehydroquinase by (2S)- and (2R)-2-benzyl-3-dehydroquinic acids.
pubmed doi rcsb
source organism Helicobacter pylori 26695
total genus 55
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2012-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01220 DHquinase_II Dehydroquinase class II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dehydroquinase, class II 4b6sA00
4RHCA 3N87A 4RC9A 1J2YA 1V1JA 2C57A 4B6QA 3N59A 1D0IA 2Y71A 4B6OA 3N86A 3N8KA 4CIYA 2XDAA 4L8LA 2WKSA 5B6PA 3N76A 4KIUA 4CKWB 4KIWA 2CJFA 1UQRA 2XB9A 4CKYA 4V0SA 2C4WA 4CIVA 1GQOA 2UYGA 1H0RA 4B6PA 2XD9A 4CL0A 4CIWA 4CKZA 3N8NA 2DHQA 4KI7A 5WRFA 4CIXA 2XB8A 4B6RA 3N7AA 3U80A 1H0SA 1GU1A 2Y76A 4ZC1A 1GU0A 3KIPA 2BT4A 1GTZA 1H05A 3LWZA 4KIJA 4CKWA 4CKXA 2Y77A 2C4VA 4B6SA
chains in the Genus database with same CATH superfamily
2XUJA 1T8WA 3F5DA 1ODJA 2F62A 4O1MA 5C1BA 2JEYA 3BE5A 4ND3A 5LB4A 2FQQA 4RLFA 1TUEA 2A9FA 3LUKA 1M8JA 3BIWA 5LQCA 1I2ZA 3DDOA 2RBGA 3JU3A 1W4AA 2ZBUA 4XD7D 2ZBEA 3ZDXB 1GZSA 3OO0A 4AMYA 4P0PB 2C9MA 1UQRA 2ZSHA 1KSHA 3HCNA 1Y3AA 2W2MA 2YN2A 4FWIB 4V0OA 3JW8A 3VTZA 2IL1A 3ZDFA 4QVKA 2FA9A 4GLFA 4PNZA 4XWYA 1SXJB 2GA8A 4IFIA 4L3OA 3OJOA 2RBKA 4FKBA 1SHKA 1KQNA 1N2BA 1WBJB 5AVWA 5EJ7A 3T9DA 2PTHA 3QW4B 1FDIA 4B3FX 3O91A 3I5AA 1Q0QA 4MI1A 3U4QB 1PTJC 4BNNA 1O95D 2BFBA 3CCBA 3PNQA 1L5FA 3O4RA 4R8VA 1ZNQO 4I9UA 2XVAA 3S2IA 4F3CA 1O0CA 2EERA 4GMHA 1M6YA 1J8FA 1V6SA 1XZFA 1SXJE 3R23A 4OQ4A 5E3JA 2NO4A 3DQZA 5IJZA 1MGOA 2PQ0A 4K86A 3UWDA 3LA8A 1DKLA 2C7QA 2GK3A 2JI7A 1P2GA 4PG5A 2R65A 3TDMA 4D4MA 1L7EA 4RSHA 3NI2A 4WLEA 2R7KA 1P5RA 3OX3A 4S2EA 2O0LA 3WAJA 3IULA 1C81A 3LDHA 1X7XA 3TM5A 1QBKC 5CLQA 4D45A 1GVNB 4BNTA 3LBIA 1US8A 3WISA 5IAJA 3DWIA 1R18A 3B52X 4G2TA 4BBZA 2AH5A 5E2BA 2AN1A 1ZCAA 4G23A 4QYSA 4CKWA 4LJLA 5DWDA 2IODA 1N6RA 2I76A 4WJLA 1ZEJA 3GDGA 4N5LA 4N7JA 3KZCA 2WUFA 3NFYA 3CF4G 2ERYA 4N6GA 3TYXA 4PYKA 3KEOA 2ZJ4A 1YWGO 2A57A 2VLBA 4LOIA 1TA9A 1LUAA 2JLBA 2RHCA 4IOMA 5C81A 3Q3GE 4ZI7A 2Q2NA 2AFIA 3SN6A 1AQNA 3SDSA 1LVUA 4D02A 3NBAA 1NG1A 2E48A 1AUOA 3KHUA 3Q8KA 3O8CA 5EEHA 1LNZA 1HDXA 4NULA 4KGDA 4QELA 3GIWA 3MUNA 2XQJA 3TOZA 4N76A 3DO8A 1C9MA 1C1XA 1GO2A 3PV0A 1IUNA 2NPOA 5G0SA 2QD5A 2CXHA 5AOCA 4URWR 5KYUB 2OMKA 2XKBA 2CLIB 1EWVA 1GDHA 3EFHA 4M87A 4RLHA 4L0QA 4XTRA 2GZAA 3O4FA 2WE8A 3LA6A 1JDVA 1VLQA 2YC2C 4RQAA 4OKSA 1THMA 5L8VA 1L4LA 5DNYB 3FVVA 1WQ1R 2Q0QA 3O5AA 1ZU5A 2YIVX 3NJ4A 1N57A 4WESA 3R3HA 3DHNA 4RHXA 4IJQA 1L7MA 3N75A 4RVDA 4XZ3A 3BYZA 4PXAA 2GD0A 1H1DA 1DBIA 1E2NA 4EI8A 1XEFA 1JW9B 1AU9A 2AYZA 3N5CA 2PK3A 1RAGA 3FDZA 4YMHA 4KAJA 2V03A 3NBYC 3WYBA 1N7GA 2P2DA 3GB9A 4EFDA 4EYOA 2EBWA 4J9UE 3FZEA 1UJ2A 4GO1A 5AI0A 2YVUA 3CPSA 2DP4E 3C70A 5G1NA 2EYQA 2ZT8A 1H6AA 3K20A 4K0KB 3EA4A 1EX6A 3NJRA 4YV0A 3A36A 3UOGA 1YUNA 3A1WA 3T1OA 3AUXA 5A02A 1TB4A 4C1NA 4C0AC 4LXQA 4ZALA 3UK2A 4CV0A 1LX7A 2H2WA 3HNOA 5JARA 1PFKA 4DA4A 3B1KA 2FG7C 1QVAA 2BD0A 3A06A 4B7XA 2QE7A 2YQ4A 4UVGA 3N2LA 2AHRA 1ZSNA 3PC3A 2VNHA 4HMPA 2VDMB 4XCVA 3KQKA 1EX1A 2VSYA 1PUXA 2OO5A 2DYKA 3BXGA 4YK7A 3SC2B 4KSYA 4V24A 2MR6A 1NV9A 3MT9A 2HJHA 3L7AA 4OGKA 3HO1A 3OIUA 2I9KA 1SUAA 3IHWA 1KVRA 4GLBA 3BB1A 3WLJA 1EVYA 3EIUA 4DR2B 4JQYA 2FCRA 2OZEA 2IZOA 3BWXA 2JJ8A 4RA9B 3JVEA 1MO6A 4P7BA 3ZIUA 2CKMA 4A0RA 5ESRA 1P91A 2G0NA 2AYYA 1NR5A 2HK8A 4TXJA 2FPWA 5E95A 2A4MA 3ZWKA 3BMXA 3LUGA 4JDPA 4ECAA 4JYCA 4OLHA 2VHUA 3B7GA 1EFPA 4JI6B 4Z9XA 3ZX4A 2KBEA 2O8BA 4ZEOA 3PC6A 5LFAA 2X1HA 1EUDB 1X7YA 4UVHA 4EENA 1LDGA 4F2GA 1DIOB 1XP8A 4HNQA 2X22A 2QEQA 3P9QA 4R9SA 3O1IC 2RHHA 4R3UC 3U4AA 2PS1A 2VO1A 1X15A 1GY8A 2A5LA 4B17A 2WDPA 4BYMA 1WVIA 1BW9B 3I1FA 3OPNA 4Y8VA 5G1PA 5SZHB 5C8DA 1Z9BA 2CLDX 3ZUGA 3WHLA 1UF9A 4ALJA 4FKZA 4FVTA 1V9CA 4RU1A 5EXPA 5LDDC 3UWMA 4D9FA 3UB4A 1I3MA 4MIEA 2I0FA 2C4NA 1JYFA 2P6NA 4Y0VA 5JFGA 1FDTA 2VTVA 5F73A 4DUYB 2R60A 4OQQA 3WOVA 2PUBA 2VL7A 1W88A 3WMFA 2IZ6A 4BNKA 2XUDA 3T4XA 4UU1A 5DTQA 4DY6A 1MW8X 5ALRA 2GARA 1KJZA 1BGWA 3ND5A 1WXDA 4RK0A 4UBLA 1FJHA 1XU4A 2PSJA 1ODLA 2WUDA 3CZ9A 4CGZA 2FZEA 1CE8A 3ADPA 3IMKA 4QJ5A 5G1OA 3T5GA 4PSVA 3QVGB 5E4JA 3UOWA 1X7ZA 3MNFA 2J5RA 2PS9A 3G6WA 3GEPA 1WVMA 2AK3A 2WZCA 1GD1O 3PBKA 5FI1B 4RJTA 4MYUA 5DHQA 2NO6A 2PKQO 3WYNA 1XAIA 2WKPA 1P73A 1CUHA 3J81A 3NUZA 4ENWA 4BVHA 1O77A 2Q99A 3LD9A 3Q6NA 2CNWD 4RD2A 3CVJA 4TT3D 4JX9A 1FFDA 5HIKA 3H8VA 2UYQA 1XZLA 3NDJA 1G3MA 3W2TA 4GOKA 1E6WA 4Y9TA 2VOJA 2W2XA 3D6UA 4KQ6A 2OQIA 5LMZA 3BWVA 1R88A 3PRYA 3LCUA 5I45A 1ZSYA 3UHPA 2QZSA 3SZOA 1JKJA 3N8IA 4I4LA 1JR6A 3SKVA 2Y27A 4YAJA 5DCYA 1BCRA 3BSYA 1P5JA 3EMDA 1RXYA 2PUJA 2NP7A 3H2JA 5JCXA 4P08A 2B4AA 3F7TA 4IQ0A 1GR0A 3VOTA 1NF8A 4MQ6A 3IPLA 4HAXA 1XCPA 5FTNA 4E5PA 1EKXA 5HFAA 1UBLS 4Q9JA 4DQXA 5JDIA 5BQXA 3RABA 4TZ6A 3GLTA 4RIIA 2BV3A 2XUFA 1YDMA 4TGLA 3U5ZB 2V7GA 4ER7A 2RC5A 1Z63A 4NNPA 1QDLB 3WNZA 2R84A 3EUWA 3IA2A 1T9DA 4KR0A 3RVLA 2XCRB 2B5VA 3HXMA 1WB5A 1XT6A 3JQ8A 4KO8A 2VS1A 2GEBA 4CWAA 2PUDA 1NXVA 2FZWA 1A27A 2A9KA 1U1GA 1OAOC 1SBYA 1ZH6A 1OWMA 2J09A 2QXUA 3KSMA 4IIUA 4M1YA 4UEJA 4R3NA 5JSKA 5IXSA 1ECPA 1H2RS 1NC3A 1Z7YA 2C5LA 3C43A 3V4ZA 3M33A 1LSJA 3JVDA 1GGVA 2WJHA 1QX3A 3TRIA 5AW9A 1YJ5A 4FU0A 4P32A 3KJIA 4GPBA 5T41A 4MCHA 4KITB 5LOVA 3KOXA 4IHJF 1O0BA 4NBKA 1HF3A 5C5IA 1FJXA 1J1ZA 2RC6A 3SS9X 4QOHA 3LT0A 1H05A 2QPOA 4H0NA 1SC9A 4ZT2A 4BX8A 1RQPA 4IXNA 1OJLA 2IX3A 2AKEA 3IVCA 3HB1A 4A4DA 2AZMA 2D1TA 4O4JF 5IN4A 5ESDA 2FCAA 3KKQA 5ERYA 3FYTA 4D3SA 2JJ1D 2WAMA 2OXIA 4LFCB 5JQGA 1LW6E 4CZ2A 4UE3S 2IXBA 1RBMA 4BKMA 5KQMA 1VRVA 4MVWA 1RHUA 2BR5A 2R1VA 3PF8A 2IZ7A 2CFIA 3GLUA 2IEGA 1E1QD 2XB9A 2X0FA 4OBWA 4BMPB 4NMMA 4J0IA 5AOAA 2XEDA 4JEHA 5DN9A 3QKSA 2QDXA 1EU1A 1GN8A 3W6ZA 1VHTA 5AM1A 4OJNA 3T7IA 5AKGA 4QFMA 1J56A 2G4VA 3ZR4B 1KAEA 5FPYA 5HTKA 3UOAB 4NBUA 1L8AA 1NE7A 3C8ZA 3MAGA 5FBLB 2GAOA 1J0AA 4EI9A 2IWHA 4EZEA 1ULAA 2DU8A 4LNUA 5DHTA 5BR4A 5J1TB 3H2GA 5CB8A 2IIQA 1J25A 5AICA 5BMVF 3W9SA 1GG2A 4A26A 3UIEA 1ISMA 2OGTA 1R2QA 1UKVY 3VO1A 4UPEA 4HQ6A 4G0PA 2UKDA 2HFKA 4CCWA 2TSYB 3OU7A 1KZYC 1ISHA 1E3SA 4WZBB 2GB4A 1GT6A 1TEXA 3K16A 1S2GA 2BKVA 5E1MA 3HP4A 5BVGA 1B74A 3NKLA 1LBEA 3FFTA 3G1TA 5FI5A 1DKOA 5FOXA 2QMYA 3S5JA 4B2YA 1FLNA 1L7BA 1PU2A 3QBDA 3V4SA 3WJ2A 4UVDA 2ORVA 2X4LA 2ASEA 4NMLA 3BHNA 2JNWA 4U2FA 4B3HA 1KRXA 2MINA 1V95A 1RD4A 2XCIA 4CM1A 2WP8J 3GQVA 4X91A 3DJFA 4WZBE 5E6SB 4MUAA 1JR3D 3O21A 4D25A 1DX6A 3LX5A 4ODIA 1EGMB 3WKEA 5IBQA 1X7WA 1L5LA 4E11A 2WWGA 1OVGA 4V38A 3VDRA 1ZINA 3TIGA 3T7AA 2X4DA 3QPCA 2W6JA 4AJIA 1QQTA 2OT3B 4YC7A 1TTQB 3N28A 1X70A 2REXB 2CC2A 2ZIWB 3IURA 4BFLA 4D3XA 4ZVPA 3V7UA 3E9ZA 4PR3A 5HKLA 1J1UA 2PH7A 4RJJA 4DR3B 3EFOB 2O2IA 3B13B 1P74A 5B64A 3T9BA 2EJBA 1Q7EA 3IYLW 3DXXA 4EBBA 4WNYA 1RR6A 1NKVA 2O8CA 3TMKA 2IYNA 2BEUB 2GD1O 5CB4F 2CNLA 4AO7A 4ABTA 3OFSA 4NBTA 3QYJA 1E18A 2SCUA 2XE4A 3FGOA 4Y2PA 3UW3A 5JNTA 1D2GA 1S3IA 2O1WA 2VRBA 4UATA 1KVUA 2H4YA 1AS0A 3FDJA 4C43A 3GOHA 1UPBA 2HJGA 5G41A 2PNFA 1DDOA 2JLZA 5BNFA 2YH2A 3KQVA 2B5WA 4HAUA 4DPMA 4YCBA 1GPMA 4EW3A 1U98A 2XQFA 3RQIA 2NSDA 2YJZA 2HV8A 3E3LA 2C5EA 3DJYA 3NNSA 4LZNA 1KOLA 4N41A 2QMUA 4K0RA 3LL7A 3GMTA 2Y0BA 3E61A 4HEA1 4JEMA 3GRCA 5HIMA 4B32A 4FWTA 2H06A 2K2QB 1OV6A 2I4LA 1WPXA 3C7KA 4FSHA 4DA0A 1XTTA 2QX9A 3JS5A 4M9CA 5H4HA 5KC8A 1N32B 1V6CA 1K3TA 2VP5A 4PHCA 3FNHA 4MGIR 3V9AA 3MIIA 1XOIA 2FSVA 3JQ7B 4H18A 4NDAA 5B55A 1CZHA 4OA8A 1HDRA 1OIVA 1SOMA 4Q37A 2V0CA 4RZIA 5LVAA 3LOPA 3R7NA 2VRNA 4I8IA 1E3JA 2YJTD 3MSXA 4ZIRB 5ALIA 1DCKA 2BFEA 2D62A 3H11B 2QWXA 4OIFA 1EVKA 4U5XA 4XQEA 2E4XA 4LTDA 4NK4A 3T1VA 5CCEA 5JHHB 3JQAA 1WMSA 4C88A 3ADOA 2CVHA 2V1XA 2ODQA 3I2IA 3ROQA 1QFJA 2XGSA 4E12A 1ARZA 4B0OA 3CJTA 3OEEA 4HDKB 4IPTA 1R6VA 2G07A 2G70A 1UZMA 3PX2A 4Z9YA 1KFEB 2CMKA 4UOQA 4X6XA 2B8EA 5L7YA 1KMCA 2EKLA 3RVJA 2A1UA 2JF0A 2HI0A 3BMCB 4WLFA 3BHJA 2OUIA 1RQXA 3VHXB 4LOKA 4PG4A 5PGMA 1DXHA 3BXPA 3DMTC 1KOGA 4HQFA 1KMNA 1F0NA 1JDZA 2A0KA 5EYPB 4I2VA 4CCYA 4JEUA 2O1SA 3U61B 2UUBB 1N92A 3LM8A 3RE1A 1T4GA 2F1IA 3SQLA 3RK0A 5I9IA 2F1OA 1FB5A 2RFLA 4L50A 3LGXA 2JEZA 2Z6VA 1WV0A 5FT9A 5AW8A 4KQ1A 2LGJA 4B0PA 5TMDA 2COEA 4BNYA 4PYQA 3EEOA 3IQZA 2VJBA 1E58A 1E9SA 2AF4C 1N5LA 2VHCA 3CZAA 5B5SA 1A7JA 3VR4H 5KKNB 2J5XA 4JYAB 2AF3C 2E49A 2DFKB 3R44A 4JVLA 4WKBA 5BN5A 1RPJA 2CB9A 2I6GA 3ZY3A 3D3WA 2PZBA 5TGTA 3IP5A 4O1HA 4D57A 5BVHA 4D8UA 1P2DA 2YN0A 2IUUA 3AG6A 4RD6A 1MC1A 1TJYA 2P2SA 4MZDA 1Z0DA 5ENDA 4ZC8A 3WWZA 4BQEA 2ZUFA 1J20A 4MS3B 4WACA 4XJSA 4FHEA 1AO3A 1FFSA 1IOWA 1VCIA 1P72A 1QIHA 3P2KA 3RS5A 4C7KA 4KE6A 4P3PA 4IXMA 2D4HA 3G5UA 4JBYA 3SE0A 2QU8A 3V46A 3VKFA 1ZIOA 2D59A 1XZNA 4C21A 5K99A 3UJBA 2V1UA 3KD3A 2BM9A 1TW2A 3VPAA 2FN9A 3ZEAA 1XJ0A 2DJIA 3ENQA 2NN3C 3SY8A 3W0LB 3H8WA 4CT5A 1GGKA 5FA6A 1BYIA 3Q3IA 1JHPA 3EZ2A 3U7JA 4CI9A 2J0UA 2PL9A 4NF2A 3OT4A 3ZE9A 1XKQA 4O4HA 5HGXA 4CNBA 3MWFA 5DHAA 1FLVA 2QB5A 3H18A 2NUTA 2ENUA 1GPKA 3L9WA 3DDWA 3D6JA 4M9ZA 4B3GA 1DVRA 4KXUA 1U2QA 4E22A 2WFZA 1T4CA 4TKUA 2B3DA 4W9RA 1CK4A 1MABB 3DFZA 3B89A 3DULA 1XP5A 2W6PA 2X0RA 4TN5A 1YJBA 1W2HA 1ZI9A 2BKUA 2FN3A 1DCMA 5C1PA 1U11A 1FXWF 1X77A 3RSZA 5BWOA 2Z3VA 3FKQA 1Z18A 4HWPA 4IIDA 3FBTA 2GZ3A 1J22A 1OI2A 3OKPA 3TGWA 3LBYA 4PCAA 2GD2A 3ETNA 3GJSA 4N9QA 3FH0A 5K1ZA 1KVQA 3QF7A 4EFLA 2FSVC 2P9FA 4I9GA 2HJRA 3CS3A 3LKDA 5KYWB 3KETA 3BBLA 3VKVA 5EZYA 1N2HA 5EJGA 3VSEA 5KSPA 3L77A 5AK6A 1F20A 2JGNA 2CVZA 2GBLC 3D8RA 3O84A 3H83A 3D3NA 5EJFA 1U0GA 4B6GA 3GBVA 4EEXA 2GT1A 3QVMA 2X2OA 4R84A 4LDZA 1QH9A 5EUMA 4WKGA 5LKRA 4ZT5A 3Q0IA 1VE3A 5IDWA 5AJZA 2I66A 5C35A 4IV5A 1DRKA 2EGGA 4H17A 3WKDA 1Y6JA 2B30A 5DHRA 1QQ6A 4CM9D 3INTA 4QO8A 1QRAA 4UBMA 2EATA 3D8NA 1MX3A 4WASA 5IKPA 3RHZA 2VATA 4HH4A 2EOAA 3HO8A 4XWAA 1KZHA 4G5YA 1EFRA 3QTBA 4J2OA 4HFJA 2RHRA 4QQFA 4UU8A 1UR5A 3LKVA 1WDWB 4GD3Q 1T5LA 4HN2A 3LIIA 3U39A 1I7LA 3ZH2A 2CCKA 3K09A 5EVCA 1OW3B 5B2EA 2IOQA 4L0CA 3BTSA 1D9ZA 5AUNB 3QRWA 3REFA 5IABA 1Y1RA 5K20A 3OH8A 1NBEA 4EHKA 4QGBA 1JG2A 4G1EB 3LT5A 1GTJ1 3PHBE 3CEPB 4RS4A 4AKTA 4C2BA 1YTUA 1EH5A 2RGXA 4LMPA 1CUFA 4NU5A 3WYCA 1GPYA 1XYVA 3ABQB 5ALNA 3QXGA 3HU5A 4PRYA 4DLKA 2GLTA 2X3UA 4ALIA 1H2ZA 3SHOA 1IVSA 3DNPA 4BNVA 4V39A 1CDOA 1L1QA 3BDVA 5EMNA 2Y1CA 1TW3A 1DINA 2IELA 1N6NA 2C0CA 1PAUA 5IYZB 5KYGA 2ZQ5A 1RMTA 1T8UA 1XLVA 2XD9A 2BGLA 4TWJA 5IVKA 1QNLA 1WB4A 3O7WA 4GSLA 2DKNA 2YXLA 3OTIA 5ADHA 2Q7XA 1NP7A 1U9JA 4G0ZA 3W3AH 5CFPA 4D3FA 2CUTA 1NVVR 1KNXA 2A1IA 4F5YA 121PA 1HYEA 5JNVA 2F2TA 5KVAA 4Y9UA 3CKMA 3K4QA 3OU2A 5AKYA 3DV0B 1IJKA 1CR0A 3GRFA 3PRKE 4JELA 4YJ3A 4ZAWA 1X7HA 3DE2X 4BKQA 4E88A 1DBRA 3KXIA 5DHSA 1I7NA 1S2NA 1F6WA 5T8KA 4JV5B 3KJGA 4RZHA 3TQRA 4W5WA 1ODCA 1R5BA 4JSRA 1IUPA 1G66A 2QT0A 3WBFA 2HY7A 1CUWA 1PQYA 3S2EA 3AFGA 1NNUA 3P2OA 2OBMA 3AR4A 4R0VA 4FNAA 2Q5EA 3AFOA 4LK3A 3V4VB 1SEVA 1TUGA 3ONNA 5KWEA 1GNPA 2OHXA 3RU9A 2V45A 1HL7A 1YR3A 2AMJA 3E2IA 3G2IA 4EF5A 2Y2VA 4R9VA 3W8DA 3SLRA 3UK1A 3FCXA 4XVQA 3SDZA 1OWLA 1EFKA 1YZKA 1K5DA 4Q1DA 4I3HA 2DRIA 3USCS 4DFDA 4EEKA 4IWXA 4ZQIA 3UJNA 4XOIA 5JJLA 2CFOA 2YS6A 3MCUA 2WPDD 3HRIA 4IIGA 3PJGA 4PFJA 4TM7A 4PONA 1DLJA 3EISA 1VMKA 3GAMA 3IP9A 3EPJA 2ATVA 2AT1A 3DZDA 5BNZA 5GOZA 1D7OA 4G0XA 5IKOA 2AMFA 2ZWVA 2D13A 4N3GA 2PXAA 4LIPD 3PX7A 3Q0TA 3L0SA 3NVKI 3G49A 4CKZA 3A9UA 1FJ2A 1E9AA 1VSTA 1YE3A 2NZWA 2X4IA 3M4JA 3PSAA 4N9WA 4UCQA 3S2ZA 4BS9A 2JLUA 3DE0X 3DL2A 2IX9A 3HE3A 4R1MA 4MUIA 2HPVA 1A9ZA 1E0JA 3A4IA 3AV3A 4JVMA 4ZC1A 3ER8A 2I03A 3VYWA 5C1IA 1XAHA 4PBRA 4FN5A 1TQ2A 3IAFA 4IRXA 1ZM2A 5KJ1A 1EVQA 2GAFA 4QG7A 1AXRA 3U3RA 3CB2A 4F8EA 1C4KA 1ZH4A 3K9LA 3GT7A 2GYUA 1RIIA 4OI4A 3QOWA 3CY6A 4RAQA 4UAUA 3UZUA 3K9QO 5CH5A 4TS9A 1MG0A 1U04A 2IPXA 1UFKA 2J33A 2JLCA 2O7NA 2P78A 3RRXA 2RGDA 3RYIA 5A4IS 2Q6VA 1G7CA 4D2IA 2R6CA 2QMOA 3FX2A 3K09C 2H3HA 1OA0A 2O8NA 3O6VA 1QWOA 3B6KA 4P6VF 1U0NA 1P7PA 1PX0A 2EKPA 2I7TA 1SPXA 4OHMA 1GPDG 1UDBA 4LC1A 4PLFA 4L73A 3RHFA 1RKQA 1I6MA 1JFVA 5A4KA 4A7PA 3OJCA 3GUZA 1UM9A 1WXGA 4KKVA 1YDEA 2ANBA 3DUWA 3K7EA 4LMRA 3WZMA 1IIRA 4NE7A 3VJRA 1CUYA 3EZLA 4O3MA 4RUKA 2BFFB 2FRXA 3Q40A 4IBOA 1UQTA 3WBJA 4CMHA 4WH0A 4CV1A 4EA9A 5BNWA 1A69A 2X4GA 3PGLA 4K28A 1L7XA 1XRQA 1BNCA 2PPVA 3PXAA 4F5WA 3ZVMA 3QE2A 4DR4B 3HJCA 1N4DA 1XMXA 4LA4A 1P9WA 4UJ3A 1V7CA 5E2AA 5F51A 3CYFA 3PVSA 5KQLA 2PGJA 2R751 4EB8A 4ZT7A 4P2GA 2FUNB 2P62A 4YAKA 3P5SA 1F2UA 3V7WA 2PT5A 2WU4A 1Z0SA 4IICA 4F4DA 3PHGA 3T7EA 1ZVQA 2FJUA 3QJGA 4TSFA 3RYHB 2XRZA 1MA0A 1NW6A 3G6KA 4G36A 4FI3C 4WX2B 3ECCA 3OD1A 1T0HB 4TXHA 3OESA 3R76A 3NDIA 3DOUA 5TXGA 3CF6R 3ANYB 2XCLA 3H87A 2C03A 4ZYUA 5T8KC 1T3LA 3O2QB 1G5FA 1OILA 4EYKA 4FIDA 5J23A 2LKDA 4FZRA 4MK4A 4B3XA 5DCUA 1VXOA 3DP7A 3V00A 4ZVQA 1QGAA 3NHUA 3SSAA 1H5QA 2P0AA 2KW5A 2EEPA 3PT9A 3BAFA 2HLHA 1QNFA 4QAJA 1Z2AA 4Q01A 3OKFA 3UXMA 4RJIA 1W25A 4GNKA 3UKOA 4H6WA 4Q1AA 5KNDD 4EJSB 4Y2YA 2AI1A 2QYSA 4JLJA 5ALFA 1HSZA 2JHFA 5FLKA 1GFZA 1G3QA 3PGVA 4IDFA 5JSYA 1YAJA 1AF4A 2VHJA 4GNRA 4QBHA 1YFLA 3I4FA 2GCOA 1OYVA 1PJ4A 1JZQA 4MGEA 2HDWA 1YFKA 2RHWA 3WGJA 5DXAA 2NX2A 1JPNA 4RVSA 1Z2DA 3MRVA 4QTTB 2GEDA 2QUKA 1OXKB 2EJUA 2YBDA 1II8A 4MUNA 4DV4B 3I4CA 4L6CA 4U0KA 1CXZA 3WQQA 4GZ6A 1IPEA 4HAZA 2YN4A 1UEIA 2FW1A 1XLTC 3H5IA 1UANA 1RJEA 1FLAA 2O9JA 3OE7D 3PPWA 1MORA 1YZGA 1X80B 3JAKB 2FF7A 4RCVA 2HCJB 4I1RA 2XX3A 4BVKA 3ZV5A 1P8JA 5HFJA 1YKGA 4L4YA 3L40A 4MWTA 1Z4KA 3IP3A 4LV8B 2JLSA 4O4IA 1I2BA 1E3TA 4LVCA 3V8EA 1J2UA 2V7WA 2Q9AA 5EJIA 5BSWA 3A27A 1UMDB 4QUJA 1E2HA 5CDYA 3ZLJA 5AJYA 4OHYA 1FP2A 2BM1A 1QF9A 4U7JA 2Y77A 4TQUS 1E1RD 4MW9A 1Q2XA 3RM3A 1VJTA 3PPYA 1IHUA 4GMFA 2GD6A 1KO8A 4BFYA 4DR5B 1AKVA 1Y42X 3PFBA 4GL2A 4REOA 3L8MA 4BX0A 1G1AA 1RABA 3U6BA 1THTA 2UXDB 3IPXA 4LYEA 4Q19A 4RKQA 1Z35A 3MINB 1A9QA 1QOQB 3OX4A 3RVOA 2JGJA 1UUFA 1HFJA 1GQ2A 3A6LA 2EJTA 3EQZA 4I6GA 3ISJA 5AI5A 8MHTA 1DRWA 3GRKA 1V3UA 3UAZA 1BVHA 2A86A 1JXOA 5CD9A 2RGGA 4KNVA 4PPYA 1I10A 3AUUA 3KKNA 4CR8A 4YMTA 1NWHA 3U3OA 3SLGA 4X97A 3ZU6A 1WSBA 2KBFA 4FJ0A 2EWVA 3RT7A 5JJKA 1M54A 1E1CB 4D9GA 2NU6B 1EXDA 1VM6A 2PZEA 2Z30A 1Z26A 3K96A 3H9QA 2XXAA 2ORED 3ENWA 1BHSA 2E7ZA 1IE3A 1NN5A 2W2TA 3VDQA 1TGVA 5KEIA 2FR8C 1YIOA 1W93A 2IOFA 2A0FA 4YROA 3DCIA 4E46A 1M2HA 4KYVA 2CD7A 3EW7A 1FFYA 3PD0A 3I5XA 2AQIA 3AJAA 4D92A 1SA0B 3QPBA 3AY7A 1KARA 2Y6UA 4E6PA 5P8WA 3DE6X 2I6UA 2PSEA 1R0CA 1JAHA 1R74A 1NVKA 3OU6A 3NHSA 3OLQA 5AVTA 1NZFA 1V71A 4AY2A 3QUCA 3SKYA 5ADVA 5J4KA 1SXJD 5F7JA 1NJFA 1NBAA 1M2VB 3LQKA 3JTMA 3ZE8A 3ZJUA 1NX6A 1E92A 1RYNA 4P9NA 4FB4A 1UAAA 2ZWAA 1WWKA 1CJVC 2POCA 5AJHA 3H5LA 3SYRA 3ESQA 5F77A 4E2WA 3AUKA 3HDGA 3GD7A 1RIFA 4GVXA 3C3DA 4C4AA 2XWJI 5HHTA 1A2BA 2JI8A 2QJWA 2VHVA 2HDOA 5FPSA 3TF5A 1MP0A 4MYSA 2VRCD 1WVGA 2E6KA 2HQSA 2O5CA 1IPHA 2CNDA 1DPGA 2HCFA 3A6ZA 2CDCA 2HAEA 3E3NA 3A8TA 3OZBA 4QULA 1YFJA 2J46A 1B8VA 4HADA 1ZWKA 2VIIA 1NY6A 3LGAA 3MFYA 1G5PA 1QO7A 5AOBA 1CS4C 4FILA 4MMZB 4RZ3A 4B3JA 1DV1A 2GEVA 3HB9A 4M1KA 2A84A 5DO9A 2AMVA 4HNAA 5I7RA 4MR9A 2HA3A 1K06A 4DVGA 2QJTA 4DS3A 1SCDA 3IB3A 4JNKA 4X9XA 1T1GA 3RODA 5JYEA 2I2AA 1RAHA 1IZ7A 3DLTA 2BY4A 4N3NA 2ZBGA 4RMHA 1XN1A 4PAGA 5FEMA 2QYOA 3ZCPA 5DM0A 4LJRA 1BXRB 4C20A 4JLNA 3EVTA 5FP0A 1ECJA 2A30A 4QGHA 3NBKA 1QF7A 1SHUX 2QRUA 1GKIA 1QVWA 3UV3A 2WA1A 4I6JA 2MOKA 4BMVA 2AG0A 3TSOA 2Q3JA 1CVRA 1URPA 6ABPA 4L9SA 5JNSA 2WWIA 1AS3A 1GCGA 4KWEA 5AW4A 3P20A 2YASA 4OK6A 2WTUA 3BWMA 4RQTA 2BUBA 5HOEA 1CU1A 4RIHA 2WJIA 4DV5B 5EWJA 1NJ2A 3F7NA 2CCJA 1NQXA 2PIDA 2OO7A 5GONB 1IVNA 4YAFA 3KPYA 5HTOA 1X1DA 2QTBA 4QUDA 3T7CA 3SJUA 4YPOA 3N2KA 1D1TA 4J91A 1IZ8A 3WQHA 3JYOA 1Z74A 1JLLA 5TQ0B 4BGEA 4EGCB 5E6RA 1QIFA 4MQMA 4B6PA 1FP4B 2BISA 4GI2A 1D8AA 4TMFA 5K0ZA 2HHHB 1SEPA 1NFFA 4MLPA 1C1YA 5FR1A 3P7MA 2RB4A 5F1OA 3ZCSA 5JROA 2ID4A 4UHEA 3MMXA 4UTOA 3UXHA 4JJFA 3B1WA 4IYJA 1O58A 3DZCA 4MRAA 3QWBA 4EH1A 1KWKA 5FTKA 2RKBA 3EWIA 1W96A 1GADO 1DAFA 4FB5A 4EG4A 3I72A 2GVDC 3N3BC 1RE0A 2YDYA 5AXDA 1MB0A 3NVMB 4MQUA 3WX0A 5F52A 3PXGA 1GOTA 3ESRA 4XIFA 5FWNA 3GNLA 3CVYA 4KUHA 2AJCA 1TT7A 5E4FA 4AKSA 1X14A 2FVYA 3IQXA 5JS2A 2OHIA 3OY7A 5CLLA 3RRFA 3JQEA 4Z8YA 3DA8A 2PUFA 2YVQA 5IZCA 5KTPA 4F2PA 3K9HA 1M66A 2HW8A 4EKGA 2C77A 2L82A 1Z5VA 4U6SA 1QZXA 3TW0A 2QYTA 3WDSA 2I1QA 3H7AA 3LCCA 2E5LB 2WSSA 2E87A 1IHXA 3VV2A 5EA2A 4XWTA 2ZJOA 1G21A 3DWFA 5BN1A 2F9LA 4MQLA 1LPMA 1PJSA 3UJ7A 3KIPA 1OX5A 1E1MA 5DPMA 3AR9A 5JXJA 4G9EA 1MO2A 4B74A 1RYFA 1BS2A 5K5EA 4K9DA 1Q17A 5D1HA 5IG2A 4X1YA 1NYLA 3P2IA 1JSXA 3QPAA 4B7AA 5FORA 5K0JA 5CLHA 2QGNA 2YZMA 4E13A 5JS7A 3PXXA 4CYMA 4NS1A 4MQBA 1A04A 2YJGA 4TTPA 2Q46A 4I8DA 4NPAA 3OJWA 1JX6A 3JQQA 3B3GA 4BWVA 3ONDA 3HWX1 3DE3X 3CVUA 4IJ5A 3DC2A 5K3FB 4MV3A 1ZVMA 4D4LA 4FYVA 3K70B 2Y2UA 4WW0A 2EBUA 3B9RA 1LEHA 2JA1A 3CPJB 1Z08A 3DG9A 4J4TA 4I81A 1A0OA 2DPHA 1ATZA 1GGNA 1NNSA 4AJJA 5EPEA 1DMSA 4GMDA 1D7AA 2QSYA 4ISBA 4JQOA 4BPRA 2DPMA 1V8BA 4U9UA 2BJWA 3ASZA 4GOJA 5TLSA 3DOEA 5D3QA 4ROSA 1MDFA 2CVPA 3EXHB 3KPVA 4TSRA 4Z3DA 4ZMSA 5CG2A 2MDTA 4AUMA 3GUYA 2PKQP 4CIYA 1Q77A 3KDSE 2HWWA 3KKMA 3A3OA 1Y7IA 2XUKA 3PVZA 3Q9NA 2J7PA 4JUBA 4MKFA 1W44A 4DLXA 2C7RA 1PGOA 2NUBA 4ASUA 4ZD6A 1HKUA 4H1VA 1X87A 2R1TB 3I2HA 4BE7B 1ZOSA 4D4HA 2PXCA 3I2KA 4YWJA 4EO4A 2J6HA 4GZ3A 1ADGA 5BRNA 2BR4A 4S0XA 3E82A 1AGXA 3O95A 1LI7A 4ZMBA 5K8TA 3QUQA 4AS3A 2W93A 5JXGA 3QELA 5CA0A 5KU7A 5T7BA 1JS1X 2QS9A 1QS0B 3K3PA 1GZ3A 2QV0A 2I2WA 1QAQA 3E4CA 3JPWA 5ALUA 1WUHS 3OP1A 1AURA 1HE1C 2HPHA 1P1BA 1YCGA 1N5OX 3FE2A 3MTDA 4JKYA 4Y1GA 5L53A 5C8VA 1ZL0A 2R8ZA 5G4KA 3RKUA 3UAXA 5F98A 2C8KA 3CA8A 4ABYA 4D6XA 1UC5B 2QD4A 3GUUA 5FWDA 3UEOA 1R00A 5AUPB 1GFWA 4JJEA 5EP2A 1Y48E 4P3YA 1RMYA 4R1NA 1OX4A 4HLQB 4WK4B 2IP1A 5DBFA 2O2DA 3WMXA 2BMJA 3INGA 3LFTA 2DWQA 4HNRA 4B4OA 4II3A 3IJ5A 2QN8A 3K8QA 5HF5A 2BP7A 4BLQA 3L0IB 1P5HA 3CLTC 1JE0A 3FYCA 2VDPB 2ICAA 1EWQA 1U6IA 1COWA 2ZQZA 3PWKA 4NV3A 2PMDA 1JP7A 2QNRA 4IF4A 3C6ZA 3A2MA 4MDEA 1M1YB 4S1TA 3E23A 2H48A 5CP8A 4M9XA 3EPRA 1O8BA 1VA5A 2OAEA 1RQRA 3EBPA 5C1OA 2MYNA 2HWYA 3ROTA 5IZCC 3M6WA 4JBHA 1REQA 3KG2A 2ZETA 2WJ4A 4BATA 4D26A 2V4MA 1EE2A 1ZCJA 3N1UA 5AT1A 1GTRA 1U90A 3CZQA 2Z6QA 3LDAA 3AF5A 3QZUA 1M1YE 2V58A 3X2EA 1T1RA 4MA5A 4N3AA 2XB8A 1SUPA 3AM4A 1C9JA 5D7NA 3W8EA 4C7BA 2IXEA 4LOAA 4DSTA 3K1TA 4QOSA 4CHTA 4UMDA 1A5SB 3FTFA 2NXEA 1SUCA 2I4OA 1EB8A 2A14A 2PX6A 3LXXA 4PIVA 3VFDA 1Z68A 2Q1XA 5IT9A 1GLNA 4BV9A 3CJRA 5CFNA 1S1CA 2JZCA 4EABA 1DEOA 2IBMA 2OCDA 1W5FA 3I53A 2Q4TA 4A0GA 3L1HA 5EP1A 1GA4A 3H2IA 1BCSA 1QH1B 1XB2A 4YAUA 1AJEA 4LW8A 3GHYA 1YRHA 1GKLA 3K0AA 3CLUC 3RWOA 2JZOA 3K6JA 1ZCFA 1MDBA 3E8XA 1KYVA 4OHUA 2XTZA 4DIBA 1VBKA 2UUCB 3QVVA 4AG3A 3QXCA 3AUTA 4ARIA 1Z17A 2ODEA 1CQIB 2JLYA 4JYPA 3RYTC 5KC9A 4ZVLA 3FLBA 4TKZA 2QI9F 3KQSA 4XLTA 5BYAA 1CHNA 1ULHA 2E5FA 3AKEA 4M37A 4B87A 4UMVA 4M0EA 1KY2A 3AHGA 1UMBA 3E9QA 5ICMA 3X2FA 2M9MA 1DTSA 3K92A 4LEIA 1E1KA 2Z8YA 3C8MA 5K0SA 3BGIA 1E9VA 1A88A 3CH4B 3LRTA 1NBMA 4L4RA 1WMBA 3Q2IA 4UJ5A 3QTTA 3TM4A 4BLOA 1CJKC 4QATA 3I5YA 1FS4A 3GEIA 3SEAA 4PF1A 1V16A 2R6GA 4R3WA 1VZ3A 3G9TA 4OB6A 1G18A 1PVOA 1QONA 1QJCA 2PZMA 4BHTA 4RK1A 4YAWA 1WTCA 4EHAA 4Z4FA 2PGDA 2G7ZA 2IEIA 2L18A 4OSPA 5EIFA 3BMOB 4FWBA 4EJFA 1FSZA 2NYRA 3CGGA 3UUGA 3Q2KA 3OCVA 5A04A 5EESA 4QGFA 1E4EB 1D6JA 3GROA 4DYDA 2D00A 4WY2A 3DHEA 5GQSA 3L93A 5TF4A 1FJGB 4PAWA 1JEQB 2RI0A 2G83A 3BPSA 3CWQA 3QOXA 2X6QA 3MMPA 2P4SA 3UO8B 1MVLA 2QLLA 3NATA 4N47A 1GYPA 2VP6A 5HKKA 4FT4A 3ZS9A 1I0IA 4DQUA 4RLSA 2JD1A 3ZDAA 1YS2X 3ZQ4A 2P9BA 1KO1A 2FFHA 2FOLA 3AO0B 4YJ2A 5DGCA 1WUYA 1XCBA 2CVOA 2NACA 4MICA 3WGMA 2D1SA 3TECE 1ZXBA 3HXOA 1C0LA 2D1QA 4BY9E 1F1JA 3DBHA 5AKZA 1XD2B 3HADA 1SQ5A 2FWMX 1NW9B 2PSDA 3K9BA 1XQWA 2O4CA 4RL6A 3SNKA 4DJDC 4LMBA 1NL3A 3BX1A 5A9SB 5LLDA 1E2BA 1BXZA 4AJOA 2H08A 4FEAA 1W19A 1XRLA 4PZ0A 3QX3A 3ERCA 2O7QA 5ETJA 3H9EO 4YJGA 1OZFA 3IILA 2X42A 4QASA 3HLYA 4EI2A 3QVTA 1TYAE 4M36A 4LXXA 2D2EA 4Q3BA 1K0UA 4JLWA 4L5BA 3VJLA 4QFBA 4IIVA 5HKBA 3M0EA 4DB4A 3LRPA 3LL4A 5IT4A 3B20A 3BD9A 3VC1A 3W2FA 3IUSA 5LMNB 2WJYA 2VJPA 2Z95A 3PDIA 5JPIA 4PS1A 4MEBA 1NNEA 1DQZA 5IYZF 1BWRA 1JHAA 1I80A 3GAZA 4KXFB 4AYWA 4ZDJA 5HS6A 3HBFA 1WJGA 2A7QA 2ORIA 4NV1A 2W11A 2H2HA 5AXCA 4E5NA 2I3GA 5YASA 5IM4A 2FSSA 5BT8A 1F9AA 1UMKA 4R41A 3TZLA 2CJPA 3D3QA 1P2VA 1NQVA 2OD9A 4L16A 4KFRA 3FNRA 2XLBA 1QO0A 2QTCA 1MJNA 3VU9A 4D9MA 2FEKA 3DTYA 1OVMA 2WSLA 2WF6A 1FVOA 3A9SA 4WDQA 2BL4A 5KTTA 3TQOA 1N6IA 1UDWA 4U2KA 3UJPA 3BIFA 1UZAA 5KTRA 3H97A 5DE3A 3PXEA 1LSOA 4PICA 5DM70 2WJVA 4QYTA 3UC5A 2BFBB 2PZAA 3IUBA 1KS2A 3FCAA 2GWRA 3N7UA 4JP3A 5JY1A 3PS9A 4HWGA 5EJ8A 3PPXA 2I33A 2J9FA 3UHFA 4EQ6A 3HBAA 2YKGA 2HYIC 4UM9B 3KUCA 4NK5A 5E8JA 1PS9A 4IUYA 3VR5A 2HSZA 4RNCA 3UC9A 3SU8A 4YUAA 4R05A 3CLHA 4LVUA 4MP3A 4IIBA 2WIBA 3D8BA 2O8EA 3TXXA 2PS0A 4F1JA 4LCJA 2YIDA 3ND7A 4ZV9A 1X7XB 2NQTA 3B1XA 4G8JA 4MJ3A 3S7ZA 3FR8A 4HG2A 1PJLA 4Z54A 2IE8A 2WUEA 1US8B 3HL0A 4D4JA 1LBSA 2O2YA 3VQTA 1FA9A 3BWEA 5J47A 5GADl 1ULSA 2FDCA 2KX7A 1HO3A 1QJ4A 1LSUA 4FDMA 5IKEA 3LCMA 3ABRB 3QQPA 4TMKA 2VDQB 1CDEA 3IV7A 4PX5A 1R4MB 1MENA 4QDXA 3TXYA 1H2WA 3IP7A 3HO6A 3IKMB 4L8YA 3T0IA 2C5FA 1LPAB 3AEUA 4QPZA 2PV0A 5A05A 2WV9A 1PNRA 4CE6A 6CHYA 2BW0A 1TMGE 4LGCA 4ZI7B 3QMVA 2AFIB 4QWWA 2PTGA 3Q9SA 1N1EA 4YRTA 4NMWA 3CNQS 3QBTA 1ESNA 4BO2A 1H65A 1JECA 1KQPA 3REOA 1AK9A 2ZGVA 3H5NA 2VJMA 3ZXIA 2WQ6A 1XNJA 3BL5A 1J9GA 3BMQA 4G2NA 3TRDA 3AF2A 4H3KB 3CWCA 3PHCA 1Z8HA 1FXUA 4HAYA 4G81A 1ZISA 2JCVA 2WVJA 2AFIE 3GL9A 3NU1A 2GM9A 3ED5A 3OICA 1PT8A 1Z4QA 4JITA 5AKIA 3JD4A 4F2DA 1ZK3A 3GVIA 4A1OA 1A9XA 4QYIB 2AOUB 3I0ZA 4TLCA 4B83A 2AJDA 3F7MA 1WLYA 2PSHA 4EY3A 4WESB 5K0NA 4PN7A 5AQEA 3ADDA 2X1MA 1RJ9A 1PDOA 3KSZO 1ENOA 2PUHA 2FSIA 2Q3BA 4F4IA 4Q00A 4HEA6 3HJNA 4RD0A 3P4UA 4Y0AA 3LVBA 3RK4A 3ZDQA 3TD2A 3D6HA 3I6MA 3IBSA 1TKCA 2YMQA 3IX7A 5EE3A 3ZCRA 1ADBA 2ZSIA 4MKIA 3NDRA 5A1TA 5LBUA 2ZTMA 4W8HA 2ZSUA 3VBEA 3VSCA 4HSGA 5FAXA 3GLRA 3L7CA 2CXTA 5TRTA 4B6EA 4EA6A 3AF6A 3C7CB 2VTBA 1EI9A 2VSFA 4HEHA 1OYYA 3ZD9A 2XKKA 1UXGA 3KUDA 3MILA 1E6KA 4FQ7A 4QC2A 1UXIA 3M5DA 1PYOA 4AZWA 1MA3A 4ZO8A 1R6DA 3EB9A 1LZKA 5KNCA 3GP5A 3WNQA 4HMQA 3CKYA 4D9KA 3V4LA 3U6KA 2O07A 2M6RA 1NUSA 5T4FA 1VLMA 4D7AA 2HXYA 3MJTA 9LDBA 5F2NA 2H7VA 2O1XA 1AXEA 1ZXXA 1ZP6A 3GGCA 1HUQA 1XE3A 1ZUHA 3DEYX 1Y8CA 4FFNA 1CP3A 2NQ2C 4PCUA 3M1LA 4XIIA 4C7MA 2DC1A 5CW1A 2O59A 3EE6A 1WW3A 4EMTA 2BFMA 1KK3A 1J2TA 1R0SA 2JI6A 2Q5CA 2RCYA 3G0IA 4LGVA 1Y4UA 1N6HA 4R1TA 3AUJB 3FNIA 1TU4A 2WHEA 4FX5A 4FZVA 4U1RA 4Q05A 1T5OA 4RVNA 3ZZTA 1J97A 1XHFA 3OHPA 3D3JA 2OFOA 2ISSD 3TZQA 2WJ6A 1MQAA 2A3RA 2H4JA 5LZ4A 1X9GA 1GXSA 1TQ6A 4NBSA 2TMDA 2FPXA 3AMVA 1XKXA 1JBEA 2H59A 3P2YA 4JUCA 4ZDWA 4PLPA 5SZKB 1WQ3A 3AP2A 2BJHA 1P4SA 3IMFA 4GRIA 3NGLA 5FI3A 3C85A 2O3UA 3IKTA 4GPTA 3HJBA 4AWXA 1E89A 1ZICA 1P8AA 3K1JA 2JS7A 4MULA 3ZWOA 4MVCA 3HUDA 4R6XA 4CV2A 5DJ5A 3LUHA 3ML1A 1EFPB 1QYVA 1V8PA 4RCZA 5CK5A 1EAMA 2X0KA 2M6KA 3ZHTA 4JI2B 4L95C 4RMNA 2QRMA 3KYJB 3PF9A 1XZCA 3NHYA 5HJEA 4JP8A 1CUSA 4LV6A 3L8FA 3IB6A 1F12A 1A2QA 4WVFA 4HB3A 4LY6A 2HKIA 3IJRA 4J0KA 4DBLC 1T43A 2Z5GA 3I76A 2X1LA 3WXMA 2GTHA 1ZJJA 5ALGA 2FEMA 1WSAA 5HCNA 1KJIA 4BMYA 2QRQA 2ZRLA 3B5EA 3THYA 4NWIA 1GUAA 3LUDA 1XAGA 4PGAA 3RUIA 4TKLA 5EQTA 5ITZA 2C4HA 4ZZ0A 1P1CA 2BR3A 3OLCX 3QYAA 5JZ9A 1HTWA 2PRSA 2VNIA 3SZRA 4UCWA 1JHYA 1RLOA 2ZI5A 5CH8A 4LF4B 1N33B 1E7SA 3BCSA 4L3WA 4QPCA 1NVBA 1GPWB 1CE8B 1Z2NX 4BEBA 5ERXA 1X7ZB 3K8YA 4UARA 2HMVA 4HPJB 4AURA 1G3RA 5IBPA 2BLLA 5CT9A 2R3SA 3ITEA 3JVIA 3EZNA 4ZYTA 2I91A 2DFDA 3N2YA 3LGSA 4YJHA 3LPMA 4I19A 4INOA 1EBFA 1FP6A 1W581 1XQVA 2ZIEA 3NG1A 4BNDA 1O0SA 2C95A 4U02A 2JA2A 3E4DA 2GNAA 2WUVA 4G25A 3QLJA 1MEEA 3T3MB 5K3EA 1D6NA 5HIJA 2FZCA 4PHFA 4YH1A 5KPDA 3PUVA 1SKMA 1WD5A 2GPNA 2JJ1A 3ETLA 1LPBB 4I9NA 5DGTA 5EJ5A 4BJ5A 3DEZA 2Q2WA 2XQIA 4Q4DA 3LZDA 1J24A 3O8LA 2FFBA 2ZUBA 1A50B 3D5QA 1E1QA 4FYYA 1ACLA 3OUUA 4EKNB 2JIPA 1WKBA 3MQ2A 4KGVA 2P35A 3ZXUB 3L8ZA 1EDDA 1H85A 1FW6A 1AH2A 4E3ZA 2QZPA 2O7VA 3B1JA 4TWRA 1TO1E 3IUQA 3Q8WA 3GFFA 2QD1A 1ZMRA 1FYVA 2AOTB 4NAVA 3TLGA 3N70A 1NSYA 2CNKA 1MB9A 2ZJ3A 3AIKA 4KWCA 1W36C 1XHLA 4JJ4A 4MROA 5C8YA 1HC7A 3LUCA 2WNHA 1E6LA 1LY1A 1Z6AA 2I62A 5H68A 3NBZC 3CSUA 2QLTA 3V6MA 1QM5A 3ORRA 4PLTA 1E7YA 3ZYCA 4F97A 1E2JA 1ZUNA 4RTSA 1G9TA 1QCDA 2PSFA 4OKIA 1GRVA 4PZZA 4WUTA 1M76A 5F3WB 4XM1A 4URFA 3ZNOA 4HDMA 2YWCA 4FSXA 4PZEA 2J7KA 4WVLA 3RSFA 4O29A 3AC0A 5KYYB 3FLAA 3PHLA 1ICIA 4Q9LA 2YWRA 2VPTA 2QVXX 1P60A 4MIKA 2ZTSA 2WF9A 3GGDA 3BTVA 1RLUA 2VNSA 2FOIA 3PB3A 2PV7A 2WIAA 3AGPA 3GXBA 1RLIA 3PIRA 5DI3B 3OQ1A 1DC7A 4L5YA 3JV7A 4HX5A 2D7CA 3STVA 3B3JA 3QY9A 2Q3LA 4JDUA 1N2XA 1C1HA 3L7KA 5EN4A 5TR9A 4ARUA 4E6EA 5BOVA 2VSOA 1VSBA 3RBZA 3ZZMA 1JR3A 3TLXA 3DDCA 1T9ZA 4L85A 5F78A 4L5AA 4CIAA 3RIMA 2Q07A 4PPFA 2YJNA 1NVVQ 1B41A 3H2BA 5ITSA 2GN9A 5JQGB 5H3CA 2NT4A 3ELUA 1KI8A 2BKLA 4WCVA 3OM9A 2NXNA 4Q02A 1E7MA 1QG6A 5BR8B 3EGXB 1CY0A 1TJ4A 3QKSB 1VCHA 3IV6A 4ZGWA 4RE5A 3NLLA 4Y18A 2FEXA 3H9UA 4YJFB 3H04A 3WL7A 1USKA 4ZXPA 4F96A 1EB9A 3OHSX 1NXSA 3LQ4A 1Q1NA 2LUOA 3N2NA 3R0IA 3WJ7A 2WE7A 1RRCA 4L76A 4R2HA 3ZHRA 4G5RA 3OWXA 1BHJA 1XLUA 3Q10A 4KIFA 2BSQA 1G38A 1J90A 2JFQA 4UFOA 2XJ9A 4EUHA 5C37A 2QVLA 2RGEA 5JUWA 4NHOA 5K4HA 1PUJA 4ZV7A 1AQ6A 5A7HA 2G6BA 2BZSA 2WSBA 3LPCA 4DA8A 4ZI3A 3ANSA 2OKGA 4S3MA 3PWSA 5G2OA 3N2EA 4IILA 1PYDA 4IKEA 5BN3A 5LIPA 1JTEA 3IL2A 2Q4DA 4MUMA 1JT9A 1NVWQ 1TVEA 3U4DA 2WTXA 1O6BA 5E2IA 4CCAA 4G5XA 4XB1A 1C0EA 4W5HA 1XEAA 3HSSA 3ZTWA 4B8ZA 3JSAA 5AVJA 1Q3KA 4WLOA 3FZGA 1ODFA 1IU9A 1HT2E 3QMWA 3LI2A 4HRXA 1XTUA 4M1TA 4Q47A 1U2DA 2WZDA 3L4BA 2WM3A 5JG7A 2MINB 3LWNA 2VKTA 4R1SA 1UIMA 4MDHA 2ZZKA 2YTZA 1KZGB 1A5ZA 1E94E 3QFHA 1IDN1 4MQEA 1S2MA 5C1DA 1SQSA 4UPDA 4X5OA 1G17A 3TNYA 1WUKS 4A73A 2BGJA 1YJCA 2DQ4A 2OLJA 1HY3A 2PO5A 2PSSA 3QFCA 4KRXA 5KJEA 2BONA 3KZXA 3S2YA 5JISA 1KJNA 1I4TD 2ONKA 3VU8A 1ISFA 3SQDA 5JOQA 1BOOA 2JL1A 3GGSA 4MUFA 4KNYA 2WUWE 4GKBA 2ZPUA 1UAGA 1W0CA 5JRJA 1VKZA 2DTXA 1BN6A 3PGXA 2B0CA 5KWVA 4HX2A 3MGGA 3PHJA 4DXHA 4QXRA 1G6HA 3DLHA 4TZKA 1WV1A 4UVEA 1KMQA 1E77A 2Q3CA 3RBAA 5DXFA 4UHDA 2H31A 1NIPA 3I6BA 3KSBC 4Y1FA 2IUSA 3BORA 3FPSA 1ZH0A 2AN9A 2O3QA 2X9GA 1C7QA 4L8WB 3BGDA 1MC5A 3U7EB 2Q28A 2O8CB 1SOAA 2ZUCA 5T67A 3QM1A 1RRFA 4UHCA 1ISJA 1FOEB 2DFTA 2OP1A 4XQ9A 4CKEB 1E99A 1WTAA 4ENPA 3WK7A 1AKEA 1CVIA 4XTCS 4JL5A 4QQ8A 2CHUA 5FQNA 5ED0A 4BN4A 1Q1ZA 3IAUA 4TQAA 5JI3E 3MCZA 3OBBA 1FFGA 2EF1A 3TL2A 2IZ1A 3ASUA 4OKNA 4FFOA 2YYSA 1YCDA 3PI6A 4IHKA 4LE0A 5EZ5A 2I1VB 2FKNA 5TV2A 4JY7A 4M1SA 4W99A 2XMCA 5EWLA 5AJXA 3RFTA 1E6CA 3UT0A 3EA5A 2VF8A 1F60A 2RKWA 3K94A 1A5AB 2JFGA 2QUJA 3PQFA 1JVSA 4KO1S 4B7UA 1Q95A 3CNBA 4P0QB 1I3OA 2HIAA 4BLRA 2AOWA 1VG8A 3SHFA 2GJAA 3E0XA 2V9ZA 4NEQA 2QVZX 1RKBA 4JVOA 3TZCA 1XX6A 4MW0A 4ETIA 4U2EA 3VNUA 1SG9A 3KEMA 2PS3A 2RHMA 4H4DA 3JQDA 2QP3A 4JKOA 2GHTA 1ISGA 5BWCA 2PLWA 1EFVA 4Y9RA 3Q7IA 3PFGA 4MNTA 1VJ1A 3TL3A 3GPCA 3B5JA 2NGRA 1FYDA 3QHAA 1MQ9A 1I13A 3MJDA 4UE2A 2RGAA 3SXJA 3I61A 2WKRA 2FX5A 2BFEB 5BPHA 3SBEA 1P4HA 2QHXA 1AKRA 2A9VA 2WIKA 2HJWA 1OFUX 2AYXA 3JQAB 3RT9A 3AEYA 1A4RA 4ZQGA 5A1JA 1GAXA 5E4TA 1E98A 1NMZA 1UPCA 2R1UA 4X71A 4W5NA 1NN3A 2P68A 3OSUA 5HILA 1NU8A 1QGZA 2PX3A 2Y1EA 4JBLA 2OAQ1 3R6LA 4AJPA 3G9UA 3D2AA 2A1UB 4CLRB 3F78A 3QU9A 1ADJA 1ZI8A 3THXA 1YB5A 3GZTB 5ABPA 1DE0A 5TPZD 1QGYA 2JAWA 1DXQA 1RS0A 1VJ0A 4QXOA 5CFOA 2H9AA 5IKXA 1SCBA 4LXYA 3MFQA 4CCYB 1V5FA 2VH5R 3L4BC 2F1HA 2A5FA 1NQOA 1Z34A 2BCEA 2PDAA 4PPGA 1IEVA 1YXMA 2W4QA 2WF7A 3GRZA 1D1SA 2WD9A 3MN1A 2RGYA 4UTPA 5CBPA 3TGPA 2JJMA 4FMPA 4O4JA 4KI0A 3VYTB 2RH8A 3IE0A 4X7BA 1JAIA 5FL7A 1JIXA 1Z5OA 1XMPA 4K6KA 2AI2A 3B9QA 1Q0PA 2IDMA 4YUYA 3DM9B 4XM2A 4CRWB 2FSHA 1RI5A 3D3WB 2LD4A 3HSKA 2VQ6A 4PYNA 5BVHB 4JYMA 2TYSB 4LRWA 4JU8A 4OQDA 3FVQA 5CIQA 5C7OO 5JS6A 4XYGA 1FFCA 3WWCA 4MAMA 3VI4B 5HM6A 1C3EA 4YRAA 1WG8A 1L3CA 4EPRA 2V55B 5IANA 4IO1A 5FB3A 4FSDA 3VOAA 4CG0A 4QLBA 1SVKA 2UYCA 2FPIA 1ONNA 2C31A 4MPTA 4XUDA 5DLEA 3DXFA 1JDBC 2XV1A 4CM9A 1SXIA 2REOA 4PTZA 3UAOA 2QBYB 1DWQA 2O3SA 1XR3A 3FYUA 4X8MA 1WEKA 5FLEX 2JJYA 1NY5A 1Y6ZA 1YBAA 4WN9B 5BO5A 5T3YA 1IB0A 5EZQA 3RBXA 5IDQA 5HJ5A 4IQFA 5T4HA 2H9IA 1PG2A 4URUR 1GU1A 4AX8A 1DT3A 2J0UB 3IC5A 2NLOA 4O4HB 1RADA 1N5RA 2OG1A 5GY7A 4EG5A 1N1DA 1MQSA 1XJCA 3BC1A 4LC0A 3SR4A 1S89A 2NUTB 3KT0A 6AT1A 5HZMA 3CW9A 4BYGA 3MT7A 3OUZA 4JNCA 5C8ZA 4TYYA 1W8DA 4NC9A 2ODPA 2XMGA 4QJIA 1T4CB 5KSYA 5LWQA 5F9MA 3FUVA 2QTHA 4LY0A 5KNLA 2HMUA 4LJ7A 3V8VA 3OZFA 1DI0A 2FWBA 4UNRA 1DTWB 3Q5DA 1U81A 1Y9JA 4FYWA 4H2DA 2EFYA 3EPKA 3GFVA 4EYQA 5JDCA 1KPGA 1P0FA 2GFHA 1G8GA 1XROA 2QLJA 4ZVNA 3TSCA 2HRDA 3M2PA 3CR3C 3Q5EA 4WJKB 2ZYHA 2ACVA 2KS6A 5BMOA 2A1TR 4BQNA 2SBTA 3PE4A 4E08A 3W90A 1ZD9A 4K05A 1EDZA 2ZS7A 5CCDA 3D7NA 3M6XA 4J7CA 4MO2A 5EZYB 3T15A 4TOIA 4LF6B 2WAAA 1PGQA 2JCYA 1UC9A 1DS6A 1SKYB 4ND6A 4Y9DA 1XU7A 3NXKA 1FDOA 3TVYA 2LNDA 2OD7A 5DRTA 1PJAA 4JP2A 5C8XA 1PGPA 4LWPA 1ENZA 2XNJA 3JALA 3CH6A 4YIHA 2AKYA 4XVCA 1XZMA 2B6NA 5JZMA 3QKIA 1PR0A 2Y68A 2ZJ8A 2YFQA 1MV5A 3DNFA 4RGQA 5H59A 3ENZA 6NULA 4MI9A 5L95A 5EGNA 5BSTA 1YIDA 4JCOA 2MTBA 2QQEA 3RUCA 3WMGA 5E7JA 1IBKB 3HPQA 1SKYE 2W2NA 2QD2A 3U7GA 3OJXA 3NYIA 1F2VA 1JAZA 1Y7PA 3FWYA 4ZRNA 4J43A 3JY6A 5DNUA 3DAGA 3IEXA 4EVRA 2R6HA 2DUJA 3D3KA 4JMLA 5DTJA 1OCEA 1SC6A 1MVNA 1V25A 2HA5A 4JFRA 5HK8A 4DMHA 4P34A 1ZAYA 4HNHA 3FN4A 2XR1A 3JYQA 4LSGA 1DC5A 2IXAA 4AIIA 3CEMA 1OXXK 3V1NA 5IT5A 1F4VA 4FYHA 2G06A 2WI8A 4DCSA 1RWQA 4P4SB 1PSDA 2WPDA 3E5HA 5TY0A 1TE2A 4WA8A 1RNLA 4BNZA 3MHTA 3DTNA 4CIDA 1N1GA 3HU2A 3IPYA 3QKTA 4NENA 1L5YA 4Q48A 3NTQA 4QQNA 4RY9A 4RPHA 1TYEB 1LKZA 1A3CA 5ECGC 3DP9A 4HGPA 4TZTA 3VMFA 1ZYUA 1G7SA 4A2CA 3CUTA 3VNAA 4TPKA 2ASVA 8ABPA 1T2FA 4GBJA 4JXJA 4JWKA 4C7OB 3T6KA 5FA5A 1QIIA 4YMWA 3ZI7A 4IDPA 3FNBA 2OHHA 4LYYA 2AVNA 5EZ6B 4LNHA 1IY2A 4UPVA 4F93B 2I8CA 3HVHA 5JYBA 4BX9A 2HQOA 3MG9A 3RVPA 4RTKA 1IATA 5B53A 4ATNA 1T0JB 3FYUC 1XFDA 4JXXA 2EWMA 4V0QA 3ZZNA 5LYJB 4J9VA 1BQ4A 3HXLA 4RKYA 1KAQA 4MTLA 8ADHA 3L7IA 4E2FA 3E05A 4S04A 1IQUA 1DKMA 3F6EX 2ZRHA 3OTWA 4I08A 3NMUF 1AB6A 1L8OA 3KR9A 4QDZA 1ZUIA 1PGNA 1NDUA 2QPTA 1L4UA 3ROXA 1MEJA 4ZCRA 2I2DA 3GV0A 4O0MA 1SPBS 1D6MA 5DNVA 2Q6LA 4U3JB 3IESA 4JODA 1H3EA 4EHFA 1BMDA 2ZU6A 2PZ8A 3C97A 4QUBA 3KJXA 3SZUA 3K70D 1DZIA 1XI2A 4IH9A 1KJ8A 3G2OA 2MYUA 4AZ3A 4DCGA 3O75A 2Q5IA 3IQGX 4KTVE 1SCUA 4N54A 3HP1A 1WETA 5J4VA 1ORTA 2J48A 1UEXC 1ZGHA 3W4JA 3ACCA 2YV5A 3DD1A 4KFUA 1MRZA 3H3XA 3FBGA 2B83A 1CZOA 1GGHA 3IKLA 4AVYA 3FUUA 3MS7A 1N8TA 2VF4X 3D43A 1P18A 4G56A 1BDJA 4IX1A 4JS0A 1KPIA 1WBBA 5C5EA 7MHTA 2AEJA 4R8LA 4Q6BA 4LRUA 4RDCA 2VNAA 3HGMA 4Q1VA 4FXPA 5CYFA 2JC3A 3R24A 3PLRA 4KK4A 4Q82A 4RWEA 1UBRS 2C4UA 2XEXA 3NRJA 4W7SA 3T1YB 5T4BA 1QG0A 3KE9A 2IEZA 4GSKA 1ZOPA 3DBLA 3HUFA 4ZI7F 1CUVA 2QZ9A 3GZJA 3B2EA 4HAOA 1E66A 3U26A 2CVFA 5L3QB 2Y67A 3E7FA 2ZE5A 4M2LA 5H4GA 5KVCA 1JT2A 4LDJA 3I0NA 2IDZA 4AF8A 1QU2A 2FUG6 1WU8A 4MXDA 2I4NA 2I3ZA 4Q4AA 3MGAA 1JXMA 1M67A 1RM4A 3IDZA 1H2AS 1Y1LA 3KUXA 4NYJR 3R8CA 1I7PA 1PL8A 2HRQA 4TMXA 2PJDA 1FP7A 4Y30A 3C74A 4CNQA 5JZSA 2J9RA 5EIXA 2CV0A 2YOGA 3PKIA 4XX0A 5M3BA 4MRRA 2QN3A 2HMAA 2JAQA 3NM6B 4NBNA 1T8SA 2C3YA 4PCLA 4YB8A 3RYIB 4AYTA 3B8EA 5IAOA 3ZDDA 1B14A 1JILA 1XTZA 3A11A 2Q5FA 1B1CA 3ZDCA 3C7AA 3CTMA 2BFAA 3JASB 2G76A 3V1UA 3W6PA 4W6QA 2AEEA 2J3JA 4KN9S 1DP4A 1QZZA 1W0KD 3H2ZA 3OX2A 5B7NA 2CT8A 3RYFB 2J4FA 4Q24A 4G86A 1F8FA 1BJKA 1UM9B 1ZR2A 1GZDA 1U8FO 3NP9A 1L8LA 1Y7HA 4ND1A 1P6UA 2PX2A 3NT2A 1E3EA 2Y4NA 2PD4A 5IJ9A 3JYHA 4OHWA 1LWNA 4AP9A 4QBIA 2PA0A 1ONSA 4F5EA 4DNFA 1FTWA 1BFUA 2GM3A 3OE7A 4L08A 2N9UA 4G67A 1I1HA 2WY2D 1JG6A 1Z0AA 3V7FA 1ULTA 2C97A 4MV0A 4KSBA 4DCUA 1XQXA 1IY0A 2BHRA 3PUHA 4PFSA 2V6IA 2HSWA 2J3EA 1L5HA 2Y1KA 4PLCA 2HT6A 1UIRA 3A2KA 1MOSA 1S9HA 2OUKA 3AX6A 3K5PA 3L6CA 4KACA 1DQPA 3UA3A 2DUMA 2DMRA 3AYXB 3HKCA 5J5AA 3WLMA 1OPRA 5CX4A 4C6TA 1E1RA 3F3YA 1E9BA 5LD2C 2P0YA 4HUJA 4PSAA 2V3WA 3NRCA 3WB0A 5GWXA 1NQUA 1MD9A 4LXHA 2CYAA 1ZFNA 3A1EA 3O1LA 4YMIA 4J1NA 2UZAA 1D0VA 3DR3A 4YALA 3S40A 3LK6A 4AQDA 4GKJB 5K09A 3GUVA 2ARKA 1TQ4A 3E9NA 5B57C 2BDEA 1LQUA 3RVSA 3F97A 5FWXA 4DMUB 3T94A 4DMLA 3DBIA 3PT5A 1UWKA 3FFWA 3S1LA 2V7VA 1X8JA 4C2TA 1TEVA 3IGFA 5I4KA 1EE1A 3R5SA 1Q91A 2ZYIA 1Z75A 2X0NA 3HYSA 1JXQA 2PGIA 3C2QA 1VOTA 2BFPA 2I29A 1DKUA 1WP9A 1EQAA 2GCOB 1UK6A 4DF3A 4S1OA 3KM0A 3MMNA 3ETHA 3MJ4A 5JNRA 4KPYA 2JFNA 1I6LA 1WDKA 3Q15C 4G09A 4JBGA 2YFYA 4OL0A 4OMUA 4CXMA 2MSKA 5DYGA 1KTVA 4P53A 1II8B 3FR7A 4MRPA 3BB3A 4P22A 4PIPA 1HI9A 4QODA 3W9YA 3C15C 4BCBA 3K6SB 1U0LA 1T1SA 2NZ2A 1BDBA 3BILA 5EKTA 2HJSA 1TDJA 5AVXA 3IUNA 1P1RA 4C03A 5COBA 2IZ5A 3ZGNA 1KK1A 3KS9A 4P98A 1TLLA 3M6LA 2P6UA 1KBOA 4IIFA 4UNSA 2J5BA 4B2LA 4H7DA 5JD3A 3AVWA 1R0KA 1XMSA 4BLTA 4BRUA 1NVTA 2IHYA 4G24A 5HJ7A 2R7LA 1SXJA 1V11A 2AD1A 3QKRA 2D2IA 3QUBA 1EWYA 1W4RA 2WTBA 3EDMA 4O63O 3OAAA 2Q2VA 1Z25A 3U4QA 4X1OA 3PFKA 4NMXB 4F7WA 2ZVPX 2MR5A 3ZVNA 5F5XA 3AJ8A 5DBHX 4BIIA 1MH1A 4Y7CA 2VRCA 3NWJA 4ZHQB 1W8IA 4OHFA 2AE1A 1TXGA 1HKHA 4GG1A 4CM6A 1JUDA 3GUHA 4ZCPA 3UTCA 1XSEA 4KZKA 4JL8A 3K8OE 1G0OA 2VK1A 2ZJ5A 1EVZA 2CJXA 4MYHA 2OM6A 3K0CA 3QVUA 4Q3NA 5JVDB 2H5EA 1HL3A 4UQPA 4OOFA 3QWHA 4RD3A 1FNCA 4HDSB 4MUKA 4R8KA 3W4IA 3KQHA 4RM3A 4OP1A 3B1ZA 2W7TA 1Q6YA 3Q85A 2YJ3A 2OLEA 5FXMA 3VTKA 3F5MA 3D4PA 4CMKA 5JNWA 1PF7E 2VH1A 3LO8A 4MUEA 3OLXA 5TT1A 2OGZA 2YMPA 4KE8A 4QPNA 1DJNA 2FK7A 4C4ZA 2XXAB 4KE9A 4H0FA 4XIGS 3DZ8A 3IKVA 2GKSA 5KWIA 4K88A 1LBIA 3X1JA 3I9OA 5EHQA 5G02A 5LNK6 2A78A 1HE3A 2CBZA 2AFRA 2QKYA 2WJGA 1KBQA 5EKDA 2G9RA 4Q7EA 2IVZA 4YFYA 1JLMA 1IUKA 4OXKA 3GCZA 2WG2A 3LZ6A 4W1PA 1YONA 5EIOA 1TADA 2HO4A 5G3ZA 4Y2QA 1C50A 1KSGA 4CT4B 4FOLA 3WKBA 3O4VA 3I6QA 3JR7A 3HXPA 1XKLA 2V65A 3LBFA 5B1IA 1Q3HA 1PR4A 3EN0A 4XVRA 5FBWB 4AZSA 1BMQA 5CLIA 3CMCO 4F3RA 4DKJA 2R44A 4V03A 3QJYA 4FGJA 4ZP1A 4V2IA 2YL2A 2ZDHA 2P65A 4XQCA 5DTEA 2FN4A 4RY0A 1G55A 1A72A 4AF7A 2H54A 4C4OA 1X2BA 4CN9A 4D96A 4K6GA 1I5EA 1YS6A 5JD6A 2QL6A 3ADCA 1O6ZA 2HFJA 3LPLA 5DVZA 1J33A 2WD7B 4O1IA 3WRYA 5AD1A 3IVXA 5BSVA 5HUHA 1YA4A 3MF4A 1TZMA 3FJ1A 4WKCA 1T1JA 3ZTYA 2WT8A 5E6UA 1DXOA 3BQ9A 2FFQA 1MC8A 2FR1A 3SZGA 4UM9D 1NVMB 2QRKA 4I66A 4Q1CA 3FJOA 5FHRA 4X0EA 1JHUA 3WRVA 1GTG1 1KY5A 1CRWG 2EZ8A 3ODPA 1DSSG 1K8QA 1OBCA 3V2UA 4HNSA 4DXDA 3QXHA 1JVBA 1Q1BA 3VZDA 3PTAA 4NQZA 4HP8A 1Z13A 4MIYA 2PANA 2ZSKA 3W05A 4QQRA 4HNAB 4ZARA 1GIAA 4QEZA 4WAUA 4PC7A 4PZCA 4X1KA 3R8FA 3P2MA 5CT5A 4B4UA 4F72A 3CEAA 1E5XA 3AF4A 4LBZA 4OJTA 5JQGF 1Z36A 3ORHA 3Q41A 3ZIAD 2F43B 4C0JA 4Q66C 3TXAA 1RQLA 1SIUA 2N75A 5HA5A 3EPHA 3C4JA 4FE3A 3EBLA 4GDMA 3GEHA 5I7VA 2GH1A 2AV6A 2VT6A 1NXTA 1YQGA 3HYCA 4RM2A 3U13A 2FZVA 3F74A 1R0LA 4RV5A 2IHZA 4HJRA 1EYZA 4ZOLB 3ZU3A 1SVUA 5ELXA 3VVCA 4P35A 3DTVD 2WJ3A 3LCJA 4KXWA 3C16C 4H1HA 4OLFA 4ZU6X 3VAZA 1B6TA 1JWBB 4TRJA 1Y8RA 3EPLA 3WGUA 1T5TA 2IYSA 3L84A 2HN9A 5EWJB 3VX4A 1QPBA 4M8KA 4PGFA 4CODB 1CFJA 2V4UA 2LKCA 4R9NA 2VLIA 3NWOA 3U09A 1BMTA 2CL5A 3A4YA 3D9QX 3R0VA 2J3MA 3K35A 3THRA 4FDLA 1Z39A 3UCXA 3ZS8A 4Z4GA 4PHGA 1F14A 2QQFA 3FXAA 3DONA 4KEAA 2HBRA 3K0CC 3LNTA 4YPFA 3WGOA 4AMZA 2JFZA 5C5DA 4IJWA 1D1PA 3OJ0A 4LHYA 5E6RB 3SC4A 4RPIA 5LJLA 3BSFA 3HVJA 4JEIA 4B79A 4DSZA 2OCKA 1T4MA 1XTVA 2PBFA 4X3OA 5DSXA 4K9NA 4RA9A 3NHBA 1S0UA 3B3FA 2PHZA 1U4NA 3R8XA 4NEGA 4FKMA 3LP6A 2NNWB 2POQX 3FZQA 3B6MA 3I34X 5LDGA 2I2XB 4K7JA 4PY2A 4Q3AA 4ZODA 1O08A 1J09A 2WKWA 2Z8ZA 1XQ6A 3K0KA 5WRFA 1TECE 1LTKA 3H17A 3K0FA 1T8YA 4QOGA 5F7ZA 2Q1SA 2NTVA 4KX5A 3OM1A 3PICA 1SK9A 2W90A 3A9VA 3KQWA 5IEBA 4ZYYA 1HNWB 1U65A 4HD8A 4AJEA 2QUZA 3Q88A 5F35A 2BE9A 4BV2A 2EW1A 5ALZA 5DTIA 4C3UA 4W7IA 1M75A 1BW9A 1G42A 1X0VA 2B78A 1QYIA 2W6MA 5LQRA 4QNRA 4U5QA 1QO9A 1ODKA 1BRTA 3AIIA 4HLDA 4ZREA 1G21B 5EPUA 2IV2X 4FLFA 4FBLA 1JU4A 3FMIA 4Q1EA 2A59A 1O89A 2HQRA 3EVGA 1K3FA 3OLYA 4WADA 3SP1A 4BQRA 4BTLA 4QXPA 3AVQA 5JECA 2CFTA 3IEUA 1K8RA 4RIFA 3FMPB 3X1ZA 2Y1XA 4DCJA 5DBOA 1R6TA 5HZHA 3H2YA 1A8IA 4X1YB 2IH5A 1KERA 3C6KA 1LPOA 3WRYC 1HQKA 4KXXA 4Z4CA 5CCXA 2QE7D 1WM1A 1LU9A 3PA6A 5ARDA 1INLA 3QVGA 4F71A 1G20A 1VLHA 1U0EA 2W2LA 1G21E 3I9V6 5HBRA 4JQSA 4DLAA 3IP1A 2YHUA 1UK7A 3RU2A 1W5BA 2NO7A 4GI5A 3OOHA 1QDUA 3KTOA 4BKUA 2QNBA 1R8JA 3A31A 2IPMA 2J41A 1IBMB 2P9CA 2ES4A 3GWZA 1NMXA 3C8UA 3FWPA 3KL4A 3IODA 5D00A 4KWIA 5FBKA 1P6QA 2NO0A 3DFFA 5FFMA 3ZHYA 4HBGA 4G6ZA 4E31A 2GOYA 2IV7A 4EF6A 4E0BA 1SULA 4HGZA 4YDRA 3Q8XB 4HVTA 4WKPA 2H2DA 5EKSA 1W29A 3TLYA 2XY4A 1O03A 4KB5A 1N3IA 5JMWA 3AXTA 3ENKA 4BP1A 1HRKA 2Y1LA 1HE2A 4FFDA 4DMRA 1DBSA 1J06A 2KI5A 2GEUA 2QNIA 2XT6A 3KZOA 4LVNA 5G4LA 4A6DA 5AVRA 1F7UA 3O8DA 1Y4SA 1YR1A 4YYZA 3C3YA 3GEBA 2CYCA 1Y33E 3I2GA 3MCTA 3NAMA 4WFKA 5H7XA 3L49A 2VPQA 4IXDA 5FV4A 1H93A 2FETA 5B4TA 1EAYA 1DFIA 4K6OA 1LPNA 1OKKA 4IZIA 1SJ9A 3HCEA 3HHPA 4NE9A 3AL0C 1VMAA 1J70A 2B99A 2VPZA 2RGCA 3QELB 4U7GA 7ADHA 3ZOKA 2YJ5A 1DUVG 1P4RA 4RDHA 5F1YA 2IY8A 1CY6A 3V7YA 4HZGA 2V97A 3OPXA 4D98A 2PGOA 3QWFA 1RQGA 2O50A 1LFDB 1XYYA 3CO5A 5G4KB 3DZJA 4N01A 3N7AA 5EP4A 1M1NA 3BK7A 4WMLA 4CLOB 2IZZA 3ETGA 4LYFA 5CYGA 4PGHA 3X0DA 3KLBA 1B6SA 4KMMA 1M0EA 1T15A 1W75A 4YI5A 3HVRA 4IEIA 1UK9A 4ND5A 3ANTA 1HWYA 2BP7B 2RK6A 1PUIA 5C3UA 4DA6A 4XQGA 3LP8A 3I9FA 3KB6A 1VE1A 3AF1A 4KZPA 2P4QA 1U9CA 2XH8A 1TCAA 3LJKA 3GRAA 1DC6A 3CUKA 4DV6B 4PLVA 4GR4A 2FRVA 2OBYA 4UHBA 2F8LA 4UNNA 1REQB 3MQFA 3ZYZA 2Q4EA 5A0VA 3FJYA 1VE6A 1CT9A 5IMBA 2QSZA 4QQKA 4JBIA 1S5PA 1II0A 2WHXA 1UZNA 3OF3A 3HCWA 2VQSA 5K3AA 5EHIA 1TYDE 3C48A 1GL9B 3G9XA 4K9QA 5REQA 4A6EA 1U1DA 1KI2A 4HCJA 3IAS1 1E2IA 2V5UA 3OEHD 4MMXB 1M83A 1RBYA 3LPAA 4RV9A 1PBNA 3LQYA 1SD2A 4WTOA 1TCBA 1QQBA 1VI5A 4B3CA 5B6PA 2OV6A 1ONBA 3CX6A 2ZP1A 1P5ZB 3R0JA 3OIGA 3RLFA 1H4QA 2LZ0A 1W34A 3AINA 4FFBA 4G41A 3VU1A 1PEAA 2H2FA 4CL0A 1GZVA 3I5UA 1JQ5A 4YGXB 4IS3A 5U1PA 5KSWB 2IEDA 3DVQX 2G1JA 1OXUA 1NXWA 1UPAA 4HWKA 4IQGA 5JCPA 3Q3EA 1XCMA 3RROA 3D0OA 3BE4A 3UVEA 4QYWA 4O4HF 1Q7GA 2EAUA 3MGBA 3W5JA 4WZBA 3VR3A 3O1HB 1C30B 2JGAA 3L6OO 1OASA 4BFSA 1P39A 4HUTA 5E3IA 2D2VA 3NH6A 4EYGA 1G8JA 3SYNA 1UMBB 5GAJA 3CKLA 1KAOA 1DIAA 3HWWA 3TOXA 2GN4A 4CMBA 3ZHOA 2CFSA 4D9CA 2B20A 1FDRA 5B58T 5LLSA 3VNQA 4CLDA 4NIMA 2CXOA 1F3LA 1VBMA 1YC2A 2XDWA 4K6FA 1JIKA 3UMYA 1N0IA 2RDMA 5E6SA 3URMA 1KY4A 1Y3CE 4FGKA 3WRXC 5DNCA 2OV3A 1EWKA 6ADHA 2JGRA 1NAHA 4JQZA 4WY5A 2EYUA 3EIWA 3PQ3A 3UN1A 2H11A 1JEYA 3KJQA 2A4KA 2C00A 3PD1A 5BYBA 3P97A 1NBME 1YI8A 4HHEA 3L4JA 4WPGA 2NG1A 1J9ZA 5JLAA 5DOVA 1G7RA 1O5TA 4MV7A 4J0CA 4QIHA 5DIFA 3NYQA 2I65A 1POWA 4MHSA 4U6NA 4FUQA 2EFCB 2WLTA 3BREA 4BN0A 4JASB 2I4TA 3ED1A 1U2GC 2DBVO 4G1UC 4RH0A 5JH7F 2XB2A 1EFTA 2AUTA 2RAUA 3KLMX 1NDQA 2MSCB 3P9CA 3VGJA 4LGMA 4JVNA 5LUBA 1QB7A 1R6BX 2Z9DA 3GRUA 5GV7A 2IOYA 2V7PA 1H2EA 1YZUA 4O08A 3T1HB 2EZ9A 5H02A 2WR8A 4LKRA 4RYDA 1T3GA 3GNQA 4TVKA 1ZJ6A 1XTBA 3EF3A 1E5TA 4C7VA 2BOVA 3RH0A 1LXCA 1TI7A 2QTAA 4I9HA 3LTNC 2ACEA 3AM5A 3EZ6A 1ORHA 1K2WA 1Y5NA 1QHEA 5DSZA 4DB2A 2Y0CA 3WTBA 1G6KA 1UKBA 4G65A 3IEPA 3R6DA 4GUAA 4YJGB 1LJLA 3K15A 1KF0A 3ZH9B 1SFRA 4BFUA 4ZVTA 5AW0A 1M2OA 3U56A 1JFSA 1PSWA 2EKDA 3KQPA 4JQCA 4YGYA 4YAGA 2FMKA 1OIXA 3B6JA 3QW2A 4DNXA 3R5KA 4GDFA 3F73A 3HABA 3QXSA 3Q3JB 2HT1A 2ATEA 3WLPA 2ABWA 1GCAA 1TAGA 2O3RA 4HTAA 4QYMA 2JK1A 2BH2A 3FSRA 3O93A 3PDIB 3VR1A 1QR2A 4ZRMA 1G2PA 4JLVA 4B6JA 1E3DA 4HZUB 1WY5A 1YTLA 3DFKA 1R7RA 4UUNA 3WGZA 2O2GA 3WL8A 1QTNA 2PO7A 3ZKAA 1UK8A 4HB4A 4I1SA 4XWWA 4F11A 2QVGA 4GLOA 4D4GA 2BEKA 1WUTA 2W6JD 2CLMB 3MMSA 4JMPA 4WOKA 3S68A 2ZT6A 1Z2OX 3H11A 3JVUA 4LQCA 5D3MA 4F5ZA 2PUCA 4IDHA 1JI3A 1A8QA 1I9CA 2OD2A 3PG5A 2GF2A 2RK3A 3OZDA 3SSMA 5LYJF 4D44A 4JI0B 3GWGA 4D9IA 5IRCD 3FSGA 5BPFA 4PG6A 4V2UA 3GBSA 5GVRA 5K0LA 3NFRA 1FCJA 1YK0A 4LJ4A 3VPGA 3LY5A 2OE2A 4DMKA 5B6IA 1DPFA 1AMOA 2BMAA 3NBXX 1Q20A 1R64A 4R68A 1H2HA 1T3HA 1VECA 3TK1A 1E4VA 3STTA 2LIPA 3T9AA 4D9JA 3IH5A 4JLSA 3RFUA 4BKPA 3QXXA 3DT9A 2YWDA 1CUGA 2VZEA 2JZNA 3BMCA 1OGIA 2Y93A 3CT4A 4IDDA 4IO0A 3SC6A 2J3LA 3VHXA 4UTRA 5JAIA 5D1NA 3VNSA 2E21A 1H2BA 4EQ6B 5E7MA 3EG5A 5EYPA 1ISIA 5C5CA 1E96A 5AK0A 2VC2B 2V0GA 4CL2A 2ZOSA 4QA9A 4NABA 4PQGA 4GR5A 1ISPA 3SI7A 1W6UA 2XMZA 2FPRA 4L02A 4CCSA 5PNTA 2O8EB 1FUUA 1MJFA 1C8KA 1MTZA 4QM6A 3B7WA 4FOPA 4MV1A 4J2HA 3LMKA 4WFJA 1GSHA 4M1EA 4DUZB 3NXSA 2QMZA 3AV0B 3ETJA 4GVPA 4RETA 3PFWO 4AW9A 2OHFA 3WP1B 5JEEA 2B4YA 2OB2A 4UEQA 4PYIA 1E6MA 2XZOA 1B6GA 4CFYA 5BQFA 1YE5A 3FRHA 2V7UA 3TX2A 3OZUA 4I2NA 3V7NA 1WCWA 2VPIA 1TYZA 2A0XA 4RAOA 3N58A 3NIFB 2RH4A 5EUBA 4DILA 1FSPA 2D54A 1EMDA 3WNVA 3WNDA 1XN4A 2B1IA 1QK5A 3ABIA 4MS3A 1AKUA 1FVXA 3G8CA 3N8HA 3O73A 4MX8A 5TQ2A 2XMBA 4BL5A 1ES9A 1CJMA 3DZFA 1C7IA 1NW7A 3U40A 2AJTA 2M1XA 4JUFA 5A3QA 4XWKA 3OQMA 2DQZA 2VHZA 4KO4S 1J0BA 2NZUG 1KS9A 1PK9A 3AEKA 4PAOA 4XX1A 1C8BA 2WSYB 1I4DD 1TF7A 3ITDA 3JQAD 2VJMB 2VEOA 3ANXA 4HQ0A 3BMQB 4AMVA 1UJNA