4B6SA

Structure of helicobacter pylori type ii dehydroquinase inhibited by (2s)-2-perfluorobenzyl-3-dehydroquinic acid
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
158
structure length
158
Chain Sequence
MKILVIQGPNLNMLGHRDPRLYGMVTLDQIHEIMQTFVKQGNLDVELEFFQTNFEGEIIDKIQESVGSDYEGIIINPGAFSHTSIAIADAIMLAGKPVIEVHLTNIQAREEFRKNSYTGAACGGVIMGFGPLGYNMALMAMVNILAEMKAFQEAQKNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-DEHYDROQUINATE DEHYDRATASE
publication title Mechanistic basis of the inhibition of type II dehydroquinase by (2S)- and (2R)-2-benzyl-3-dehydroquinic acids.
pubmed doi rcsb
source organism Helicobacter pylori 26695
molecule tags Lyase
total genus 55
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2012-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01220 DHquinase_II Dehydroquinase class II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dehydroquinase, class II 4b6sA00
1H0RA 5WRFA 2XB8A 4CKZA 3N59A 1H0SA 2Y76A 2Y77A 3U80A 4CIXA 1GU1A 2DHQA 4CL0A 2XD9A 1GU0A 1J2YA 2CJFA 4RHCA 2BT4A 4L8LA 2C4VA 4ZC1A 3N8NA 1GQOA 4KIJA 4CKWB 4KIUA 4CIWA 4B6PA 4B6OA 3N87A 5B6PA 3KIPA 4B6RA 2UYGA 2Y71A 3N86A 4KIWA 2C4WA 4V0SA 2XB9A 4RC9A 3N8KA 3N7AA 3N76A 4B6QA 4CKYA 4CKWA 2XDAA 1V1JA 3LWZA 1H05A 4KI7A 4CKXA 1UQRA 4CIYA 2C57A 2WKSA 1GTZA 4CIVA 1D0IA 4B6SA
chains in the Genus database with same CATH superfamily
4Q6BA 3GMTA 2C59A 4RD1A 3A3OA 3GZ4A 2OXRA 1A77A 2C2HA 3WNQA 4FJ0A 2FFQA 2W22A 3MWYW 1U2EA 3LKBA 5H59A 4WRRA 4WXMA 2ZR0A 1VLQA 4UOEA 2UUBB 4RQTA 3E18A 4D26A 1UBCA 1LY1A 2AFRA 4RZXA 2HCBA 4FNOA 3NDIA 5ICCA 3ZU2A 4ZGWA 3EJWA 4WUVA 1RQNA 5LN1A 2VVTA 4RABA 3U0VA 1JUDA 2C9DA 2ZWPA 4L78A 1QF6A 3MK31 1D03A 5HRCA 5B37A 1U8CB 1RTKA 3MOSA 4AM8A 1CY6A 2EFCB 3VJKA 2PZMA 5LQNA 3GLGB 1Z35A 4HS9A 1ZINA 1JJIA 1EK0A 1NXXA 2H00A 5MN5A 5ELXA 2I91A 1POWA 3P0RA 3RJTA 1KO4A 3ETGA 3BA6A 2BN4A 3GDGA 3GXOA 2UVPB 4WBNA 2QGFA 4ZV4A 3QK7A 4C78A 2BGUA 1Y5MA 2Z30A 4YI3A 1WD7A 4XLZA 2OAQ1 1P19A 4DB4A 3HR8A 1UZUA 5HIMA 1XWFA 5E2BA 1AQJA 1I7PA 5GZ6A 2QTCA 1I6LA 2FXVA 2FOLA 3CN7A 4FCVA 1C9JA 4Y9TA 5KQPA 4UFNA 1HLPA 2WT9A 5EKSA 4Y2XA 1S5PA 2UZ1A 2DH5A 1U99A 2I4NA 3HN7A 3IB3A 4KSCA 3MOIA 5CVDA 3SJ7A 3HDHA 1JH9A 3U13A 2JJ8A 1BRMA 1KOJA 1UJMA 2AWOA 3ILHA 4NBKA 4P3OA 1MGPA 4R9UC 3FBWA 5TX7A 4A2QA 2WYIA 1E60A 2A5GA 4CKEA 4XYEA 2ZP1A 3KO8A 4W9NC 1JT9A 1FYDA 1LJ8A 1NQTA 1H69A 3SX2A 2PZLA 5JDCA 1HYBA 4DJDC 2ERCA 4IGAA 1O6BA 4TSFA 5F4BA 4D9NA 1EWQA 2A1TS 4RL4A 1PWYE 2VPIA 1CETA 2QX6A 1KSFX 4IIVA 5LR6A 1YR3A 3M8KA 5CYPA 4BB9A 3WL3A 5KU7A 1KJ9A 4C6TA 1OH7A 3R0QA 3IBGA 2CD7A 1E3LA 2WVAA 1U0OC 3GRPA 2HQRA 3STVA 2I29A 4OU4A 4TV8B 4FD2A 4MQFA 3CF4G 2JHPA 2YH2A 2AFIB 2V7BA 3V9AA 1NDQA 1JAIA 4BVFA 4DDMA 4BEWA 1FX0A 4RTRA 3UMVA 4PAWA 3CX3A 3DD1A 4L9SA 2PX5A 3IH5A 4GW3A 2FPPB 4OK3A 4PQFA 5C0OE 2IZ5A 2D4HA 5FBRB 3S8MA 2D3TA 2PT6A 1NVWQ 1G3UA 1ZGZA 3K5IA 4GUDA 4MR8B 3SKVA 4CV0A 2JLZA 1BE8A 1X1EA 4FS8A 1I3OA 4DSNA 3EVFA 4E30A 4M8SA 1VLJA 2DQKA 2JFNA 1MBZA 3EASA 3FSJX 1J0DA 2MTBA 3HKDB 4ZI3A 2ZM6B 3G8CA 3BB4A 3IP1A 2H4FA 4MPDA 1Z8FA 2FWAA 2LBPA 2RI6A 2VDWB 2SCUB 3DT6A 4YI5A 4J3NA 2BHRA 3QIAA 4B6EA 3C7DB 2CB9A 3GNTA 4E14A 3BGIA 2AE1A 1ZITA 3MUOA 4FEGA 1IWOA 3N2NA 3QUSA 5BSKA 3T7AA 1K2VN 3IJPA 4XWTA 3WA6A 4RDCA 2QK4A 1CY1A 3G8BA 5A3SA 3ZU6A 3WXBA 4YXFA 3TOZA 4WOPA 3ZKWA 1USWA 4UUQA 4ACBA 3EHEA 2OO5C 3GUCA 3NKFA 4UMEA 1IM2A 4HP8A 5K0NA 4FT4A 1WE2A 3TRKA 3FWPA 1OU4A 5A6SB 3ZYCA 4LCBA 1FQOA 4FZVA 1BROA 4CT5A 2ZT8A 3DJYA 2EZ8A 5ALDA 2ZPUA 4EHNA 1E5LA 4AS1A 2Q49A 3HZRA 1TLLA 4HYTA 1M1NA 2ZETA 4PANA 3UH0A 1GPYA 1MHTA 3CG0A 2XT6A 1FFHA 2I1QA 3IBTA 4GSKA 3B13B 3FSRA 4P53A 1AMNA 4R71A 3SYTA 2OKCA 2FK7A 2WP8J 3L8CA 1BN7A 3P9RA 1XV5A 3D02A 2ETXA 3GEHA 4E46A 5DK4A 5JXIA 2C5LA 4EBBA 4EG3A 5E4YA 4IR7A 4LJ5A 3NAGA 1EVZA 1ACLA 3BK2A 1U3WA 2VRCD 4H2DA 4JGGA 5TQJA 5M04A 4G0UA 5AM1A 1LLUA 1O03A 4HHEA 3AEXA 2AQHA 2GEDA 4KLZA 2H9YA 5EJFA 4D41A 4ZPJA 2FFJA 3NR2A 1BN6A 1PUJA 4QXMA 4Z8YA 1R37A 2PNJA 2GJAA 3HGTA 3JSAA 3V00A 3PF8A 4CDRA 3FPLA 5AI9A 1A98A 3MPOA 2DPLA 2JIMA 1YCFA 4WZAA 1YUBA 1RCFA 2GNOA 3KAJA 1NUTA 2HIAA 1SURA 2V0NA 3TL2A 4X6UA 2FMFA 4C7BA 4KFCA 3BRQA 5JSFA 4AQYB 1KS2A 5BN5B 2J8ZA 5FT9A 3W2EA 4UE6A 3L0SA 2PR2A 5SZIA 3OIUA 3TNDA 4B0OA 4UNNA 1QH8B 1UPXA 5LIRA 3KQLA 1E5DA 1LDBA 1FFXB 2AUMA 2QPTA 4J0KA 3SE0A 2GAFA 4UM7A 1TU4A 4ENVA 4Y1RA 4XUDA 1EQ2A 1QMGA 3DQZA 2XYRA 4HWTA 4YRDA 4BB0A 4K3VA 1Z4PX 2P6NA 4JC5A 1NLYA 4BLSA 1VB3A 2YIDA 4HNTA 5K6AA 1EFRD 1N2HA 4IEFB 3MJVA 5DTIA 2MDTA 1JIXA 3EGIA 4NBTA 3IDOA 5C8YF 3QE9Y 1XJCA 4E1BA 3IUEA 2YS7A 3LGSA 3OIWA 3IT3A 5HK9A 3I1FA 3VHXA 3MJTA 1ORWA 4H0CA 4HAWA 4O2BA 2AXEA 2XB4A 3ANXA 4JBLA 5H02A 1CUAA 5AW6A 2GBPA 2Z4TA 4GGOA 1QHEA 3ZWCA 5A0TA 3UWPA 1YZTA 2HA0A 4GM0A 1EAMA 4FOTA 4Y1GA 2QF7A 1U4OA 2JATA 2ZZMA 4NH4A 1H85A 5AJHA 2DULA 2PV7A 3USZA 1W93A 1ZD3A 2AOVA 1BDHA 1A5AB 1HE2A 2XEDA 1EK1A 3DT9A 3CVYA 2FGKA 1RR6A 1OFVA 4L7QA 3RQSA 5CCEA 3W2TA 1YI1A 4H1UA 3TL3A 1JGTA 1SC9A 1ZD8A 3DV9A 3OT4A 5D1HA 4FC6A 5JW6A 4GH5A 1GPMA 4N3BA 3L1UA 2FPIB 3CIFA 1NY5A 2Z3ZA 5HX7A 4BZQA 5EIXA 2XZOA 1BJTA 2CL0X 2HPVA 4G07A 2ONCA 1II8A 2ZWOA 1W9MA 4N40A 4UBNA 1F60A 1X19A 3R1IA 3RSGA 4YTEA 1NVBA 4RNCA 4R84A 2JLUA 1K7YA 2W6NA 2DEUA 4LGCA 1IY1A 1H9AA 2OGUA 1DEOA 2BE9A 1OOEA 1YL5A 1J0AA 4GL2A 4LWOA 4OU5A 4RHFA 5NULA 1M75A 1IBCA 1P7CA 2BM1A 2HJSA 4DRXA 4IGEA 4OHKA 4R51A 4OHVA 3DUFB 2ZYWX 1NVGA 3IX7A 5FLXA 1MJGM 1Y3AA 3M6MD 3QLJA 4I55B 1FFCA 1FRNA 2DU8A 2P9ZA 1CUFA 2NAPA 2Q5HA 4MDFA 3EIOA 4FCTA 4XWAA 5B2EA 3Q11A 1HY3A 2O1EA 4CHGA 4LQLA 1OBOA 1R8QA 2R1ZA 3PPYA 2XNDA 5FTLA 4DMUB 1WD5A 4KL8S 1RHQA 3T99A 1OSNA 5KQLA 1P0FA 1FP6A 4B32A 3QYFA 5AKKA 4KSYA 2I2CA 1Y5NA 2BCEA 4DBLE 3P45A 1QE0A 3SF8B 3WKBA 4ASUA 2Y4NA 3GV0A 3NC0C 4OYRA 5E7IA 3VU1A 1TM7E 5KNLA 1WSBA 2OFPA 2OC4A 2F1OA 2GM3A 4ITVA 3OPQA 2Z2IA 3TOCA 5HSGA 5IS2A 2I7DA 1P9OA 3WQBA 2K2WA 1T36B 5EMLA 1BNCA 4JKOA 4YRCA 4Z7NB 3UB3A 1ISIA 4IW3B 5E3IA 1UF9A 4K87A 4IIEA 5JCXA 1LPAB 5LB2A 1DDIA 5FPKA 2NUPA 5M5BA 5LD2C 1MB3A 4B73A 1NUPA 2V55B 1GZ6A 5KYUB 1E92A 4PG4A 2LXNA 3OAAA 2RKBA 4QXOA 1EB8A 2Z56A 4YJ3A 3L49A 3L4KA 5EIWA 2O2IA 5C8DA 4CM4A 1XDBA 2PGJA 3G0DA 4F4IA 3PSHA 3KU1A 2ZBGA 3G7NA 4GM4A 3U09A 3ETDA 3FN4A 4TTPA 2NPIA 4U4AA 5BQ3A 4FR2A 4H7KA 1SZJG 3KSAC 2RHGB 4HAOA 2DX7A 1QYWA 2R68A 2YVAA 5A0FA 2C82A 8AT1A 1ONSA 4YCDA 2IDJA 3B1JA 4CKCA 2BRUA 2CL6X 3RTBA 3DLBA 3RRZA 1JKMA 2C5HA 3MYYA 4QPZA 4TZTA 5JG7A 3QMPA 3B82A 3C45A 1TTTA 2HUPA 1LJLA 4NICA 3MB5A 2XITA 1NI5A 4MUIA 3NGXA 1FIUA 3LX5A 1GOTA 3A7EA 3MTAA 3UAZA 5EZYB 4BNJA 1PTJA 4FE4A 2YV1A 4K0KB 5ESDA 2QJFA 2AG8A 2BC9A 3CSSA 3ONVA 3P0JA 3T06B 4OYLA 3BMQB 4X6YA 3U4HA 4JV5B 5E9WA 1RCUA 4E1AA 4BJ1A 3HEMA 3VKGA 4UD6A 3L7BA 3FGPA 3PR3A 4KOAA 3C0KA 1WXFA 4GZLA 4BO5A 5AXDA 4EHLA 5MFZA 4ZGBA 1V3TA 3NP9A 4XLTA 2BTQB 3AVTA 1FBNA 2ZUUA 1XA3A 1JEAA 1GGHA 5CBKA 1Z6PA 2PT9A 4GR9A 4OQDA 4O4LF 2I62A 2VPPA 1J0CA 1PG2A 3NUQA 3CQ9A 1XPUA 3GN1A 1TAHA 1UCFA 4C01A 3N58A 1ZYUA 4Q7KA 2GAAA 2FN3A 1K9SA 1N0IA 2O8FB 1QO7A 4K1LA 4N0DA 3SHWA 2I8LA 1U04A 4A2CA 1PV1A 1WXDA 2AFVA 2XWQA 2CMFA 3Q2KA 2P8SA 3DMFA 2UKDA 2RAVA 1A8SA 4J4TA 1HE1C 1DG3A 1GL6A 3A6KA 2ZZKA 3ASUA 4I8IA 1I5RA 2IYYA 2HF8A 7GPBA 5LOVF 1NOJA 2IYXA 2XOXA 4RADA 3LLSA 5CPBA 1ZM2A 3W5CA 1CF4A 2C4MA 5AK4A 1WMAA 5CDGA 3EEIA 1JH8A 3VU3A 2VBCA 2VDOB 5C9ZA 3RYCB 2XMRA 3E9YA 3PDIB 3EA5A 4DA9A 4WNYA 4CR6A 2X5XA 5TF4A 2C1EA 4AO7A 3L9WA 2F43B 2KHZA 5C81A 3TTXA 3JD3A 5KQRA 3EEOA 4MJ7A 3TTTA 3DMRA 1M7GA 1RCTE 3OTGA 2RMKA 3TRDA 3RVLA 4ZOLF 1I2DA 3WLNA 1C8LA 3DQPA 3KKPA 1HNXB 1JDBB 3ZOZA 2Q5LA 3ZVRA 1D0VA 1MO6A 4E5YA 4EPTA 5C8ZA 5BUZA 5BRJA 1OF1A 2PSHA 3C98A 2JGLA 1R0ZA 4OQEA 4AJ9A 4UOQA 1E9DA 2PQMA 2C3PA 2WM9B 3NXSA 4LRUA 3N2GB 5D2CA 3TAUA 1F9EA 1SA0B 1TB4A 4PGMA 2YICA 2YJNA 1R5NA 1G38A 1YTUA 3PQ4A 4LVOA 3UMJA 3ZGXA 3MJSA 3BSYA 3DH0A 5KNBH 3EVBA 3GROA 1KWGA 1P81A 1R15A 4HZUB 4R8RA 3RYHB 2CSUA 2HYDA 3RQIA 1DQNA 1NVUQ 2OK8A 1ML3A 2PO7A 2WF7A 1Z6YA 3HABA 3NAQA 5DHQA 3MBKA 1GV1A 3WGQA 3OE4A 4YUXA 1X77A 3WLQA 3A4VA 3WK9A 1R0CA 4AYWA 2UVPA 4G23A 4KPUA 2YASA 5F5NA 5LBUA 5LMUB 4FDMA 3B7GA 5EP4A 3RWOA 3MEQA 4D9JA 1FFWA 2ATIA 2MINA 1UK7A 5HJEA 4ARIA 1V0JA 1CJKC 4OP1A 1D2MA 2PUAA 2V8BA 3KR0A 1KC1A 1T5BA 4IEEA 1W36C 5FWNA 3GLHA 2O5CA 1TZCA 1MT0A 2CNLA 2X1LA 4GKBA 2XGOA 1UPUA 2EW8A 2R8ZA 2NT4A 3MBIA 1E5TA 1OIVA 5KJEA 4CEHA 4EO4A 1NJ2A 1XNHA 3BN3A 3OA2A 3DDNA 3TQHA 1B73A 1D1TA 5F7XA 4IYRA 1CW2B 5B6IA 3JVIA 2HJRA 1EFRA 4HRXA 4HAVA 1R8JA 4M38A 4MYHA 3VJMA 3U7FB 4W5NA 3KOXA 4DQLA 4LDJA 1ZAKA 5EIBD 6YASA 4MI1A 3WGVA 3W2IA 3GZNA 4GRIA 3BWVA 2AFHB 4OJTA 5CHEA 4BNDA 1CZHA 2BHLA 2LZ0A 1F3LA 1LSOA 1IH8A 2H3HA 1S3GA 2PS0A 5K3FB 1EFCA 2QP9X 4GSLA 3RAFC 2UUCB 2Q1UA 1EDEA 4MX8A 5K09A 2HZ7A 2QPLA 3OQBA 5EJ8A 5K6TA 1EFVB 3NYRA 3OZVA 4MLPA 1WG8A 3FPBA 4JT4A 3SC4A 4KVGA 2Q0SA 3KHTA 4CLDA 4DCTA 2XQGA 2XTNA 4UMDA 3RYFB 5CXSA 3TEFA 3ZZUA 4ZT2A 3ZW7A 1JNXX 1Q0RA 2AFIA 2WIAA 1IWBB 4AS2A 1LPOA 4NLLA 2M6SA 4MDYA 1M5UA 2IBTA 1EVEA 2DM6A 5KWSA 3OIYA 3VDXA 4P34A 4P32A 3KVVA 1S2GA 1SU8A 5C1PA 4XFJA 3I0ZA 2FSUA 2WG1A 4LYFA 4E2WA 4UTXA 1KK3A 2GVNA 1RC1A 3EULA 3R09A 2I66A 3UTDA 1H2EA 2IUTA 2Y0BA 1M6YA 3A2MA 3AVQA 1PF7E 4QO7A 7ABPA 4BNIA 1CY8A 2D2XA 4D74A 3H4VA 8ABPA 3FUUA 4EMUA 2Q45A 3JYQA 5KNDH 2VS1A 3N5CA 3TXYA 1OY1A 1KRWA 1SKMA 2P9CA 2WMNB 2K7ZA 5AIAA 1V39A 4L5JA 4RTOA 4PINA 1GTL1 5HF5A 2VOJA 1ZI9A 3LPDA 4B3TB 5G0SA 1J4AA 5HDBB 2B61A 5ITSA 1TAUA 3K7EA 1QGZA 2D5LA 2Q8QA 1HK7A 5CJ2A 3VR6H 4MSUA 3S7ZA 1OZGA 1PVVA 3IQZA 3LL4A 1G5QA 3VKUA 3S8EA 1QWSA 2ZE7A 1A82A 4PIMA 5YASA 3KZOA 1KY3A 1RP7A 3RPEA 1H9BA 2OWEA 3NS7A 2GA9A 2OWDA 2Q3MA 2QT0A 3QE4A 1RPNA 1G3IA 1XVLA 2EV9A 1Z6AA 3BJIC 4PFQA 1M72A 3U80A 3SSOA 5L3VA 2JLWA 4IUCS 4RY8A 1X9HA 3P9PA 1NMQA 1PVOA 5EMHA 2G0AA 4D8WA 1WNFA 5JRZA 2UDPA 4IMIB 4HEJA 4G4IA 4CLOA 3U1BA 1ZCBA 2JFZA 2P9JA 5J4LA 4G1VA 5EWMB 2HBQA 4L72A 4R83A 3RV4A 1H93A 1UINA 3NHRA 3OEED 5AK3A 3SVLA 3P9SA 2QJTA 5I47A 5JARA 4DJ5X 4Y6QA 4UUMA 4EYEA 1DUVG 3OTOB 5KCZA 5ERXA 1VSTA 3T7SA 1T34A 5EKXA 1N57A 1PJZA 2WKWA 4GRAA 4U7PB 4I1OA 3NBKA 3G89A 4J6EA 3W06A 4ENUA 1W1WA 2FH5B 3CWZA 4O1HA 1D0IA 1X7YB 1GSHA 5J4KA 1EAYA 5M7EA 1RXEA 2GH1A 1UJ6A 3HUDA 4KN9S 5AOCA 3Q6IA 3SYMA 5BN5A 1XHLA 4LV5B 3VNAA 3W8FA 3CGWA 1GTMA 1COWA 1QH8A 1Z5GA 3GUUA 5CA0F 1QRSA 4Q16A 2PSJA 3MMZA 1QQTA 3SHOA 1QYDA 1P5FA 2ZR7A 2XUHA 3MCUA 4UUAA 1SK8A 2BGMA 2R66A 3CXRA 1QIJA 4E70A 2JA1A 2VTKA 5LSAA 4BMOB 1T9ZA 4JC8A 4N0EA 3SQMA 2PQ6A 1P2VA 2IIQA 3SEFA 4BRSA 2ZCVA 5CB4B 4MI6A 5KSYA 4PPNA 5B1SA 2RHOA 4JMLA 5KTMA 1KIAA 3SIRA 2AX3A 1CQXA 1UDRA 1J5EB 3X0DA 3I9MA 4EATA 5K2OA 1WJGA 2PH5A 4OKIA 2AK3A 2ASVA 5DF1A 4E32A 1P1JA 2ORYA 4C2UA 3CLRC 4HLUC 1QRUA 3G6WA 2WV7A 1OTHA 1QFYA 2X0FA 2O57A 3EN0A 3O93A 1XA0A 2F55A 3T3OA 1WSDA 3EY9A 3FTDA 4PYOA 5EHQA 4F3YA 1GEEA 4MRPA 4Q1BA 4BTVA 2RK3A 1TGVA 2WMYA 3ND8A 1HDIA 3FTFA 3FVRA 4J7XA 2KMLA 4J0HA 4JR0A 4KYTA 5E1OA 4C2AA 2JH8A 2CFRA 2FV8A 1E2UA 4HNUA 3HM2A 5KOJA 2C0PA 3L1JA 4L4ZA 1CRWG 5BV2P 2OYSA 1SU7A 4PN7A 5K0ZA 3ZCXA 4UTNA 3D7SA 4GWGA 4BO6A 2XYPA 2IHVA 3QVLA 1AMUA 3M4ZA 4KJXA 1KJJA 4C06A 1B3BA 3EVCA 4ZODA 3Q98A 3WB2A 3GEIA 3JQFC 3LCUA 3OZBA 4NRDA 5G4LA 3Q9UA 2HEGA 1E8DA 3FY4A 1N92A 3TUIC 1N2ZA 4ZVVA 3GOQA 5IT4A 4DCMA 5TMPA 1SCUB 2WVHA 2A0UA 2BZ0A 3PUXA 5IZCC 1QHGA 3FMFA 4R1OA 5JECA 1LKZA 2BMJA 2BJHA 3DUFA 2WD9A 1MPXA 4QOIA 3AHIA 4URZR 5IZ4A 4QEZA 4A0QA 1JRLA 4DV1B 3VNVA 3C74A 4H60A 2A5DA 3ED1A 1T9BA 4J1TA 4XIIA 1RRPA 3MHTA 5D5PA 4ONEA 2JH3A 5KX5B 1KKLA 2H1CA 4ALKA 2WSMA 2BI4A 1RYFA 3PPXA 4GVLA 2F2TA 3HB1A 4HQRA 4NS4A 2AXPA 3T9BA 3NIGB 3QWIA 1X1TA 1USUA 1CKEA 4FQ7A 3AB7A 2EW1A 2DBVO 3NWPA 3PUWA 4JLJA 4R9VA 4Y2JA 3U3OA 3QPDA 4YRJA 5KNCD 4A16A 4ZTUB 1U1GA 2G9ZA 2AVNA 1YRWA 4AUMA 2VDQB 3WIDA 4FU0A 3RGGA 1GPNA 4F7DA 4HTFB 2C3UA 1L2TA 3TS1A 5KTTA 1ESCA 4LV8B 2RGNA 3I1YA 4Q3KA 4ZZIA 3AG5A 3T15A 3SYLA 1YKGA 3GRCA 4WBNF 2C29D 3C7KA 2G72A 3OBIA 4GOND 1PZMA 4JR1A 1LGYA 2GZ2A 1VMIA 1ZNQO 1A8UA 1RQ2A 1WLYA 5BMVA 2D1TA 3DEIA 1YA4A 4BXOB 3SQLA 1FU4A 4DIBA 1K4YA 3W2FA 2PZGA 4M21A 1NVVR 1GZVA 4GBMA 1VLHA 1K97A 3K2BA 5FAKA 3HP1A 2VIIA 1P2BA 1V5WA 4G1CA 2ZJ7A 3DBHB 4NV0A 4Q34A 1IN6A 1PV2A 4BRZA 3WL4A 3GLIB 4YP6A 4QPNA 4HGZA 2ZRCA 2JFFA 3LRPA 1QYCA 3AV3A 1LBTA 3RC3A 3IQWA 3R0IA 1CUCA 2R8RA 3IC5A 3IOMA 3W34A 4OI0A 4KWIA 4MP6A 3F8SA 4AVYA 2QY6A 4R40A 1EFDN 1N3IA 1UDBA 2PGDA 1RXIA 4TXHA 2V4ZA 3TZQA 3ACDA 2ZRBA 3K1AA 2B4AA 4HEA6 4UTOA 5DFAA 4MMYB 1WDWB 4LTMA 5AHRA 2IP4A 5BPFA 5DNVA 5EJIA 3ZH2A 5BN3B 1SB9A 4OL9A 2DJ5A 1TYCA 2LRHA 1EJ6A 4RSMA 2DY1A 5AW2A 4NCAA 3IS3A 1UIRA 3UBMA 1QYXA 1T4CB 5AI6A 2YY7A 4JJKA 3K8YA 5ALLA 3TZHA 3UG6A 4EFDA 2MMCA 3LKVA 4IIHA 2JGAA 3B53X 4IDQA 4F96A 1G5IA 4L8LA 2IHYA 1BU5A 1DIHA 3HSKA 4COOA 4ENPA 4YX9A 5M2QA 1W76A 1G6OA 3H4IA 4FSDA 3E15A 3AL3A 1OLUB 2QN3A 1P18A 1UAAA 3TX2A 1G64A 1YDWA 3OOHA 4CCSA 5BSVA 1KTVA 2VL7A 4JL5A 2O8FA 2NADA 2Z3WA 3C5VA 3Q0EA 4GYJA 4L7VA 1HWYA 1E7YA 1T8UA 3C8UA 4ON9A 1ATIA 4LHVA 1XT6A 3RV3A 3ZIUA 1KEPA 4MHSA 3OOEA 1AZWA 4DUYB 4GSYA 4D1YA 5IYZA 3EMKA 3HJHA 2YZ2A 1Q19A 2OV8A 2Z3VA 4MVJG 1CQIB 2H29A 4FGSA 1N1GA 3AM1A 4F45A 3TI7A 2FX5A 2D3WA 4JLDA 2W8BA 1CNMA 5GONB 5TQ0A 4ZCPA 3SEAA 2EATA 3F49S 2VCYA 3HCPA 4MUBA 1MJHA 3MTGA 2BMWA 4YC7A 4KV9A 1ODTC 4MA0A 2AUTA 2V45A 4O2RA 2Q5CA 4W1SA 4F4HA 2YN2A 3LA8A 3O0TA 2IS4A 2F43A 3U4QA 4OXXA 1HEYA 2JIPA 2XVZA 1QGUA 1VZ2A 2OLEA 1E64A 4A8JB 3DDOA 3W4IA 4EB3A 1JAXA 4ZFNA 4DA6A 1L4BA 3VKHA 4G0MA 1XYVA 1XUOA 1N7GA 1Q0HA 2G36A 2VA9A 3CF2A 3DDCA 4LSMA 1DTWB 3AF5A 5BRNA 3UOWA 3WQSB 2WG0A 3HFJA 3KNZA 4JLWA 4KC0A 3OIFA 4ENTA 1N33B 4CXMA 5I7EA 3KTAA 2UVQA 1YKSA 2JBHA 1R0LA 1P1HA 2YMPA 1W5BA 3QXCA 1W19A 4V0NA 2IY7A 3JYPA 2W2OA 4TXLA 2R0QC 3GP8A 2CLEB 2Y2UA 3N2GA 4Y9SA 1SA0A 5ALJA 5F3RA 2VJPA 3U40A 1MFPA 2EX1A 1H2BA 1T35A 2ECPA 2ACEA 2ZB2A 5JFTA 4KXUA 3RG2A 3T3HA 1I4EB 1A7JA 3RYHA 5KDLA 4LJ8A 3PQ5A 2VJBA 3CLHA 3KV3O 4X44A 4ND8A 2PLNA 4CQMD 3JS5A 3LX8A 4IXMA 1IVYA 3JWJA 1V16B 4KI7A 3C3MA 5LWHA 1NQXA 1ZVQA 1BHSA 3KB1A 3ELUA 5I9NA 3O8NA 4KOEC 2Q3BA 2DUMA 1ZMOA 1RJFA 1BKSB 3HZOA 3HXMA 3TZ6A 5HM8A 2DUWA 2HLDD 2R1UA 2GBFA 4ER3A 4OAQA 2AIRA 1AGXA 3REQB 1RZUA 3ENVA 2CC2A 1FF9A 2XNKA 3ET5A 3KEQA 4RD3A 1EK5A 4RHCA 3PC6A 4M9QA 4L5BA 4BZWA 1DWQA 3B1YA 3UJ8A 3OOJA 3BCHA 1WEKA 4QTTB 3T5CA 2V7EA 4W7HA 1JIUA 4YJ2B 3SFTA 4E33A 1W52X 1FUEA 3ICEA 3DS8A 3JQ8B 1R6AA 1E7QA 3MLAA 4HXEB 4NOKA 1GITA 2HMWA 4DR3B 1TD1A 4RFSB 2BGNA 3JQAB 3H2ZA 5L7YA 2FSGA 2Z9CA 3ZIDA 2AKYA 2HRCA 1RQ7A 4ZI7B 2JGDB 4IJKA 3UT6A 1Z88A 1QB8A 1QTIA 3ZE7A 2AFHA 3GT7A 1UWLA 3H8VA 1KYYA 1SHLA 2F8MA 1H0SA 1MXHA 3QA9A 4YONB 5B3KA 1LUAA 2FZWA 1LTHR 4TTQA 5TMEA 4CEJB 3F97A 4O2BF 5B1IA 3RIEA 1RWVA 2ZBUA 2ZW9A 3I04A 4BWYA 2C9ZA 5K4GA 3OWXA 1C80A 2E7ZA 2ZSAA 1TYBE 4QGBA 1EFVA 3R5FA 1T2CA 3RKRA 3HVUA 1ABEA 2C5AA 3JVVA 3UHOA 1GUFA 3JSXA 1YCGA 2IHZA 4KR3A 3RYFA 1XAJA 3ABRB 1XJQA 3B3GA 5G1NA 4AZSA 1MGOA 3OO0A 3AV0B 1JIQA 4RZ2A 2ZSHA 1BKYA 5T4HA 3OBBA 2YFQA 1SPBS 1KYZA 2O48X 1YQGA 3AT1A 5JEDA 2DPHA 1YJCA 4QX6A 4CTMA 4L9AA 4ARAA 1Z7GA 1EXDA 3IUQA 4R8SA 4C4SA 3MJEA 5GOTA 5EEGA 3KQHA 2VO1A 4FR0A 5AKJA 1ZHFA 1E58A 4PRYA 1EH5A 1T5IA 2JGMA 3OPMA 4JWTA 5EIAA 4A5OA 2YTZA 4S1NA 3AETB 1XD9A 1L5SA 2QUZA 5ABPA 3QNMA 4JZKA 2X41A 3JVDA 2RAPA 4BO1A 4MI3A 2LNDA 1EQUA 1IHOA 8ATCA 1GCGA 5FD8A 4OB7A 1IUPA 2GLTA 3V55A 5CDFE 1DRWA 3BH6A 2BFBB 3PITA 1RS0A 4J9VA 4N5DA 4Q02A 1C9NA 2RGDA 4ZYXA 3I62A 1FNDA 4RSHA 4QDKA 2PRKA 3JVEA 1SUFA 3FTCA 4QBHA 3TH5A 9LDTA 3EZ7A 3T5AA 2W0MA 5DVZA 3TBKA 2QMHA 3HVHA 1XD8A 2Q4BA 2SECE 4OGWA 4MP8A 5TGTA 4R8MA 1JSXA 5B12A 3C85A 5TJHA 4D0NA 3IT1A 2F9MA 3BFXA 1W46A 1JHUA 3DG9A 4QKQA 3ANSA 3KYDB 4ZAVA 3ZQ6A 4RZ3A 4KQ1A 5KNCA 2DMRA 1G21B 3S1AB 4FN5A 1C8KA 1SKAA 4V0MA 1XALA 2GN8A 1V9SA 1VIMA 2W11A 4MWSA 4U6SA 5ARDA 5FWDA 3OZGA 1W5EA 3LCMA 3MG9A 3C8DA 3ZHUA 2OPBA 4M7PA 1E5QA 3N0XA 4I8XA 4PXAA 1LK5A 3KD2A 4QODA 4E4TA 3N2LA 5EXTA 2HAEA 4CMGA 1V43A 1D8TA 3QUQA 3FDXA 3PXAA 3LM8A 4B3IA 4C4ZA 5EWMA 3TFOA 2R47A 4BVAA 1F20A 1T8WA 3C41J 3KJFA 4P93A 1CNEA 1NW5A 3DZJA 4PX9A 4YJ3F 1L7MA 1ULTA 4CW7A 4DVGA 5HS6A 4MKGA 2VT6A 3UHFA 1J9ZA 3PJGA 5KZMB 1WETA 2CXQA 1DFIA 1PEDA 5G0WA 4EABA 1UC9A 1GSOA 5F64A 4B1FA 1OBVA 1KS9A 1QIGA 2VJMB 3R0XA 4KCGA 4YJFB 1XVAA 3A6FA 2XUQA 4JB3A 5EAIA 1EVLA 2V74B 3RHTA 1ITZA 4ADSG 1RC8A 1ZH4A 3ZHOA 2WSBA 1EP3B 2CN1A 2EOAA 3FDJA 3N8HA 4LZOA 3CBGA 3QLUA 4M49A 4UHBA 5TR9A 4RVGA 2C3OA 1A7KA 1VRVA 3IEXA 5BP7A 1IM8A 2E87A 4FDAA 1MCZA 3E1SA 1KNXA 1MDFA 3FA2A 2XQJA 3ACCA 1N8NA 1OGYA 3QX7A 1Y89A 2JH9A 1A76A 3TF5A 1PFQA 4PTZA 4DAOA 3EVTA 1R66A 2XE4A 4INZA 1XRQA 2GBLC 3WRXA 1XU4A 3ZGOA 4QXRA 4HDQB 1VL8A 2Z8XA 4X90A 5KYXA 2W37A 2Q4OA 4CLHA 4RO0A 1G7SA 5LBIA 2Q7OE 4C0QC 4OAPA 2NXNA 4DABA 2QAGA 3GBSA 3VZSA 2YY5A 2XQIA 1RTTA 2IEZA 3OY7A 1R12A 4FYXA 4CMKA 2P1RA 3NOVA 2O8DA 1LLQA 5DISB 2DECA 1HMYA 1WMBA 3QXHA 1V11A 2F3QA 4QQ8A 5CUQA 4I1YA 3DMGA 4EJ6A 3QBEA 3WV4A 4JI7B 1Z8NA 4YCNA 5HFNA 2Q0QA 2NSYA 5DX1A 3AUJB 2AG1A 1Y3HA 4CFYA 4A36A 2YXNA 3EUFA 4WLUA 5AUOB 4WCDA 3DHYA 5T57A 2VP9A 1Q0UA 2O7RA 4O4IB 3OT1B 4P6VF 2OQVA 4C7JA 4DRZA 5KWIA 2QLFA 4TPKA 2TMKA 2PCJA 4GXRA 1XF9A 3OU6A 3NPAA 5B1HA 4EEKA 3UXEA 2ZRNA 2YOHA 3SHFA 4F92B 2HRZA 4BNTA 3NM6B 3BTUA 1YB4A 2H4XA 1MH9A 3NJRA 3W8DA 3O1LA 2NW6A 4TM7A 1NLZA 2H0AA 4HZIA 2PMFA 1SCUA 4H1HA 4AW9A 4A0SA 2F1RA 4ERXA 1BE0A 3L40A 2ODWA 4B2YA 1F8GA 2BKUA 4PGFA 5AW7A 2FLVA 5J2TB 1KL7A 4K2HA 4NBWA 2AZDA 5ES3A 3BQMB 3OQ1A 2XDWA 1IPEA 2VSQA 5HIAA 3HB4X 1LPMA 2O52A 3ZD9A 1T0BA 3V4ZA 4YRFA 4C0HA 3F67A 2J6HA 1IOZA 3RVRA 5KX5A 3IUJA 3AMVA 3F5FA 3VPHA 2P2CA 4R31A 1B2LA 2BOVA 1XJ5A 3RREA 3JARA 4HNVA 2PTGA 4AKHA 1EFUA 1T8SA 2VH2A 5K0JA 2ZOSA 2OO3A 1HSZA 4P8RA 1L5QA 3K9CA 5B7PA 1KYTA 4L9RA 1GPLA 1NZDA 5FI5A 1DXOA 3ZZ1A 4EGSA 3G9XA 1RU3A 5HG0A 1SR8A 4HDMB 4N4AA 1FVXA 4ILKA 1E1NA 5DOZA 2QR3A 5D85A 4HTFA 3F9CA 1IEQA 4R01A 3I39X 3IT2A 3EB9A 3NX4A 3TCKA 3BWEA 1G5HA 5CJPA 1FW6A 1ZVMA 3NWOA 3H1BA 2O8NA 3GJZA 3K6RA 3NHLA 3PC8C 1W36B 3VOTA 1NUAA 4MQEB 5ICGA 4OLBA 1N4DA 2HF2A 1ODKA 1Q3TA 2HLDA 3AJDA 2OD7A 1MQAA 1JAHA 3D6UA 4UTZA 5IAGA 1ZRMA 3ABIA 1JAYA 3HEBA 3QUBA 5J4HA 3HBNA 4R69A 4EB8A 4XSGA 3KQVA 3O03A 3ZJTA 1AUVA 3HC7A 1G20B 5EE0A 5I9MA 2DBZA 1IEWA 5IVDA 5L4NA 2I99A 4FYMA 2X42A 3GLIA 4W9NA 2EYQA 1OB2A 2K5UA 1TLTA 2ZUDA 4I3GA 3OM8A 2AYXA 2GXSA 4FP9A 1IOVA 4LFBB 3H0CA 1WEHA 1Z8HA 2P5SA 1WCV1 2XUOA 3PUYA 4PRZA 1N1DA 3TDKA 1NIJA 3ZH9B 621PA 4M1SA 1R0YA 4IDDA 2GAIA 3PXUA 4UOZA 5EE3A 2CHFA 5FIUA 4P33A 1Q2XA 3FOBA 1JLLB 3Q15C 4O6VA 4Y6PA 5BN3A 3PZBA 3EF3A 5LKAA 1G9SA 1HYHA 2J9FA 1T4CA 3GLTA 1Q77A 1UBLS 1UBNA 4EFLA 1T6BY 4Y2UA 4NECA 4G63A 5EWJA 1OI2A 4UHJA 2Q2WA 1W4AA 1L5RA 3E9ZA 1NXOA 4AF8A 4X7BA 5BYAA 1GUZA 3C2QA 3ZHQA 3L7AA 1OLUA 3I3SR 3TJMA 4G5GA 2XCTB 2Y1OA 2G8LA 2XWJI 5HJ7A 1Q2UA 2NZ8A 3ZLVA 3VH3A 3BSSA 3N74A 4Y6SA 2F90A 2HK8A 1DAOA 3JRWA 4JI0B 3ORSA 2G9NA 2GF9A 4JELA 1GRVA 1VG9B 1I0ZA 4HQ0A 1Y6QA 5GJCA 1PK9A 2H5JA 1K5GA 2B6NA 3U7JA 1TEZA 1EEHA 2FCRA 2DQ4A 5IEJA 3VR4H 4R5HA 3HR7A 4RKEA 5I9TA 4CMEC 3NEAA 4H16A 3T7IA 1NYQA 5JAOA 1REQA 1VJDA 2JK0A 2PDAA 3A1DA 1G8KA 4D9IA 2WTUA 3OZXA 2X2FA 5G4KB 4KBGA 3V8QA 1WIWA 3H18A 3K0HA 3SU8A 3O95A 4Y2HA 3RIHA 4XX0A 3K92A 3OOYA 1JE1A 2X3YA 4H08A 2UU9B 1YS4A 1J2TA 4UXJA 1W96A 4YREA 2VDJA 4A8JA 2ZVPX 3FNGA 4GYKA 3BHMA 3EVGA 5A9RA 2AHOA 1H1DA 1KI6A 1L4UA 4I4NA 2NAFA 2ZIAA 1RZRA 1NU6A 2FU5C 2HNKA 4WZBB 2WABA 3I5UA 1I24A 2C88A 4OSEA 3COWA 4Q1DA 4X8HA 4YVFA 5BSFA 5K99A 5L45A 4LOHA 2WUVA 2OQ2A 2QYSA 3CE6A 3AK4A 5I8ZA 4DHWA 2DFNA 4MZXA 4BX0A 1SNYA 4PBSA 4ENRA 3AU8A 1A9RA 1II9A 4KRGA 1EFHA 1OA1A 2P2DA 3B3JA 4ZV9A 3WLSA 2Z9DA 2PU7A 4HH1A 1JXAA 3P52A 3D2BA 3RRFA 4EY3A 1OB5A 4B71A 1KU6A 1XNGA 3L05A 1TQ4A 4QJ3A 2HC9A 3K73O 4BLQA 2FPRA 1NJGA 5GV7A 4R0NA 1B43A 4LRWA 4MHTA 3DBIA 1Y3IA 1NMXA 2IZZA 4RPGA 1KQOA 3BB3A 2BH9A 2HSGA 1UM8A 3QENA 3D5EA 3R8CA 1RWXA 1N8TA 3G0OA 4IIYA 4RK4A 3O8DA 1KNQA 3NWEA 1V8PA 1KZHA 3CB2A 1DDOA 1TX4B 3BMNB 2QA5A 4DS3A 4G4SP 1B6RA 4ZCQA 4PPQA 2WI8A 1E0SA 2WG2A 2XXJA 2YXPX 3AILA 2JG3A 3Q3GE 3COYA 3P9IA 3S2YA 4YJ2A 4PNHA 2IU0A 2DUJA 4D7AA 3WOVA 1KBZA 2WAMA 3JQ8A 2J87A 3NORA 3LPAA 4FT2A 2AN5A 2W48A 1BX3A 2OP1A 4YYZA 4RFSA 4MS4B 4YV0A 2GZDA 4BLWA 2YWHA 5A1TA 4TRRA 4MK4A 1EP2B 2PH3A 2VI5A 4QGAA 5ESWA 5JH7B 4G65A 4ED9A 4QFDA 1NMSA 4ZVMA 3RKSA 4F5DA 5FLEX 4DCCA 1HFEL 3HJFA 3N7TA 4KXYA 5SV2A 2LD4A 3HLYA 3OZWA 4GAEA 4RM3A 4FC7A 1U90A 5IP5A 4ZZ0A 1VKZA 1N32B 3ZE1B 1MEOA 4PF1A 2C7RA 1Y33E 1L4MA 3LP6A 3EUWA 3DV0B 2EF1A 3GD5A 3EGDB 4KDCA 4QOGA 3TK1A 3BGOS 3NGMA 4BWVA 1TW2A 1DC6A 1PWZA 3R0VA 4UBIA 1NI4A 2G28A 3GPBA 5DYWA 4C6HA 4EG7A 1WBBA 2QSYA 3OIGA 5LLSA 5SICE 1JALA 4X24A 1YDGA 4MVCA 3ZE6A 1RYHA 2I1LA 1H8HD 1V1RA 2HX1A 3NJ8A 4RTNA 1OLXB 4AKGA 4DLYA 4RETA 1Z4LA 5AOBA 3ZVKA 1YONA 2V8OA 3EW9A 3S1SA 3C4VA 3P4YA 1PV4A 3OI7A 1QZZA 1ONBA 4PCUA 1ABBA 4JI4B 4EHHA 4QSHA 4JJZA 1ZCFA 3AETA 3PF9A 1EWKA 3LX6A 1DE0A 3SIPA 1LW6E 1EVYA 3CBQA 4M86A 2FP3A 4P38A 2OPHA 5C7LO 5KTKA 2WAOA 3LBHA 2J5RA 2BR5A 1YVEI 2FA9A 1WXXA 3BL5A 2BFBA 1KBOA 2IYWA 3GO4A 1JJ7A 1SXGA 3AF4A 1ICEA 4EJFA 1IY8A 5AVUA 3E3AA 1O5TA 1DC3A 3UTCA 1O58A 3THOA 1ULBA 4R2XA 4BO3A 1T0HB 2GPAA 2KE5A 2UZIR 3BQNB 2B2XA 1SVLA 5FFNA 2VLBA 5LZ4A 1GR1A 5B1EA 4Q3CA 2PLFA 4DLAA 1NNEA 4ZOCA 3TUJC 1YS6A 1G21A 1PDVA 1R50A 1X9IA 1EI9A 3I9FA 4RPJA 1Z33A 2ZCUA 3I6MA 2WJYA 1QCZA 4M46A 1GTRA 1PEYA 4QFBA 3OPYB 3B7WA 1LNQA 4IDNA 1R3UA 1JPNA 3RODA 3VC1A 3B38A 4YYEA 2RGXA 4DBZA 3FPAA 1I7SB 4FYVA 2W43A 4ECEA 5CK4A 3MT7A 1ECLA 3L04A 1LX7A 1GGEA 1IDN1 1MA0A 3H5RA 4G0OA 1N5JA 5BNTA 1AKTA 2QGNA 3IMEA 3ZW9A 2I03A 1EBBA 1E9AA 2BFDB 4YRLA 3QU7A 1L7OA 1I32A 5DNYB 3GLFE 3PNLA 4OQPA 5BMVF 4IFTA 5D3MB 4K26A 3KYCA 3GUVA 1TQ2A 1ZI8A 1DC5A 2ZBFA 3K1YA 3W3ZB 2OXCA 4OFBA 5M29A 2N0SA 1NRWA 3KKEA 1RMTA 2X5KO 4FZRA 4L0DA 5J59A 3P8ZA 2R4QA 3KXPA 2XCUA 3UKDA 3A6HA 1GKUB 5LQJA 1H5QA 1L9XA 4E5MA 2FKNA 2I76A 4G84A 4B45A 1SM4A 2QW0X 2BFWA 1JEEA 2GPTA 2QQEA 3CRZA 2ORED 3E9EA 4LKOA 4MPTA 1WSAA 3RJZA 3WMEA 1B3RA 1O6CA 1CZRA 2OHGA 3BE4A 3AEQB 3ETEA 4NH0A 3JALB 8LDHA 2P90A 4B17A 4UCQA 1FOEB 4PLCA 5K3CA 3DZIA 2G82A 2HU5A 4F97A 1H3FA 3GGPA 5H82A 2E9SA 4RACA 1N1MA 2HK7A 4MEBA 1C7IA 1SULA 2AVDA 2W93A 2RKOA 5GAJA 5IKPA 2WZCA 3EOZA 2EZTA 5B7NA 1VYVA 1XVVA 5KCMA 1IHUA 4RVFA 2FQ1A 3HRKA 1QRDA 1NN1A 1V9LA 3CLRD 3LUCA 4A91A 5AD1A 1SBNE 4LZNA 2D0OB 3WTCA 4DIFA 2YWGA 2OENG 3HUFA 3IIEA 3IQGX 2B7LA 4WKNA 4O29A 2GCEA 2Q27A 3NT4A 4OYHA 2Y1CA 5DM60 4C0BA 4CV2A 2VNKA 1VBFA 5FWYB 3I61A 2Z1NA 4W5WA 2VDPB 3SZ3A 4RD0A 3HL4A 1TE2A 4KVFA 4OPMA 4OVKA 4XR4A 2IHNA 1RE0A 2Z08A 1E0AA 4GP7A 3A2KA 2WV9A 1L7NA 2KX7A 4KUEA 1GPWB 1QGYA 1Z6ZA 1VYHA 3UV7A 2CHVA 4Y98A 5JS6A 1CJCA 1UM9B 3E7XA 3O1HB 2XY4A 4ZA2A 1YOVB 3V42A 3MSXA 4GBJA 3DPSA 2FCAA 3L79A 1ESEA 4O4IA 5LDDC 2Z5FA 2BV3A 1IU9A 2NWQA 1QCDA 5IYZF 2PUHA 1ZGAA 2HV9A 1UBUS 3LGXA 4LNAA 4V0LA 4NESA 3WJ2A 1TPZA 5H70A 5BNIA 1E2HA 2J3HA 1QG4A 4MV3A 3LCVB 4YWJA 1P2DA 2XD4A 4Z86A 2ZM5A 1A9OA 2D2FA 1ODSA 3VV2A 1IXSB 2YC4C 1BJKA 4MR7B 1E6CA 5HE8A 4OBWA 2AEMA 1J7KA 5HCNA 1KMIY 1TRHA 2ZYAA 3E9NA 2P8JA 2O1WA 3FOCA 4LRQA 1NYLA 4UHEA 3WAJA 1A1VA 2AYZA 3MUFA 3X3HA 2G63A 4UPEA 1OZHA 2D62A 5J2TA 3NBFA 3IHLA 4HWRA 5KB3A 4ZEWA 5KREA 4I4TB 5AKIA 3ZGNA 3H3XA 3B60A 4DR6B 2M98A 4ZAXA 1AHNA 3WNZA 3JATA 5K4HA 1XZNA 2YXEA 1VL5A 4W82A 3THWB 2C9BA 3KVRA 3W79A 4HADA 1JMVA 1R88A 1XRSB 1Y6JA 1ZC3A 1Q14A 3M3HA 4U8HA 4PFKA 3AHCA 5CLHA 1DLIA 4YIKA 3L7OA 1I01A 1FYFA 2DBYA 3ZY3A 1QDLB 1XKQA 3MT0A 4KK4A 1V5FA 2N75A 5TQVA 2E85A 4ARVA 1CB7A 2MYNA 1CZOA 2JFBA 3EZGA 4AN0A 4O8ZA 4B81A 2JD0A 1OWMA 2QMZA 3C1AA 3JAKB 2R6FA 1KVTA 3E2MA 4JJ7A 5AYVA 2RSLA 3EC1A 2CSXA 1X3LA 1CUVA 2I1WA 4RCZA 4HAYA 4QJ5A 2GHQA 1H3EA 2QVBA 4D25A 3WR5A 2VAPA 2P77A 3B1KA 1T5LA 3RVMA 1YQEA 1UFQA 4PHCA 5K8UA 1F6DA 2QW1A 1U2DC 3JR7A 3QYPA 3OCZA 3S2FA 3ZC3A 1P80A 4HLQB 1JU3A 2RGEA 4BGDA 3TDNA 4RU1A 1DKLA 1PFYA 2O0KA 4LPSA 4X54A 1Z2DA 5FI1B 5CEFA 3O4HA 1Y8AA 1JHOA 4NC9A 4UHFA 1A9TA 3I04M 4HATA 2FYTA 4NFSA 2G09A 3C16C 1QJ4A 4TMWA 4X8MA 2EKQA 2G06A 2QV7A 2UZ3A 5G3YA 2SHKA 4AQDA 1DARA 2R62A 3IAM1 3Q7TA 1GPDG 1UXOA 3L4BC 2NIPA 3D4IA 2FQWA 5GJWC 2DCMA 1VI2A 2VJOA 2W98A 2XRFA 3EDOA 3I6YA 1F8XA 4MAMA 3OJWA 4TRNA 421PA 4AJJA 4BP9A 1GG9A 5TF0A 2HZBA 2POQX 1SQFA 1TRKA 4S05A 3NALA 2Y9MB 5F1OA 1E3EA 1MEJA 2BEUA 4O0LA 4EFKA 3FRJA 4F4FA 2NO1A 3NBXX 5IANA 1TTQB 4J6FA 4ZYUA 5AT1A 1BA3A 3UA4A 5HF6A 1KARA 5JZOA 4MR9A 4TSRA 3PX2A 2A57A 2DFPA 5KTRA 4GKAA 3C8ZA 1OROA 4F1KA 1SJ9A 1FVFA 1GQQA 2YJ6A 2DQZA 3FLMA 3MYRA 2APJA 1T9KA 2D0PB 2PD6A 1RKVA 1YQWA 2CLOB 4LZLA 4R2KA 2XYVA 1QHNA 2ASEA 4IPTA 1E6LA 1Z3CA 4ZOEA 1Z22A 1RWMA 5EWLA 2A5LA 4BGEA 3BERA 1USIA 2W6ZA 2FUKA 2A5JA 1R9MA 5FH9A 3PNMA 4ZDIA 4A6DA 2IE8A 4WCVA 4B6JA 3WKDA 1O9BA 2R44A 4G97A 4IM7A 5JZMA 4C4YA 2WTXA 1GSIA 5C1DA 1UEJA 2GN4A 2DXIA 1VXRA 4I5GA 1R6UA 2HN9A 1OPRA 1WWKA 3JRXA 5LFAA 1OPXA 2FK8A 2RONA 2X0DA 4RKQA 5KVCA 3M9WA 2QW8A 2XUPA 3O4FA 1SUIA 1H2AS 2CFOA 1DWUA 4XIYA 4YN3A 1FJ2A 3N2KB 4CFSA 3DVAB 3NI2A 5EUBA 3Q9SA 1ZP6A 1G5RA 1L8AA 2GETA 3BMXA 5G4KA 3SQDA 2EX0A 1UOEA 1VKRA 2XGMA 1SWWA 2G1PA 1TZBA 2D5BA 1XTBA 3NJ4A 1T9DA 5CDHA 3DXZA 2X6QA 4FFMA 3RU3A 4MICA 1DS6A 2HMTA 1PE0A 2QD5A 3PGA1 4NFLA 4QHSA 3VO1A 3WIUA 1XQ9A 4F3NA 5EINA 1OC2A 5EOVA 2G83A 3B6IA 5BN4B 1Z07A 5T3YA 3KDSE 2BKAA 4M55A 3WWOA 4AZ0A 4UTRA 1LCIA 1XMPA 3NPMA 5FJIA 3SE7A 2R751 3NHJA 4F06A 3OU7A 7YASA 1E8NA 3W3AA 4H7HA 4YO8A 3ZNQA 5G02A 5HGXA 1VKJA 2QYOA 3I52A 1DRUA 3N2EA 3TRIA 3WI7A 1E99A 4JWKA 3T1QA 3V48A 1Q16A 2FEXA 2PJZA 2BF7A 2C20A 3O4RA 4UBLA 3I5AA 4EY7A 3S8YA 1I2MA 4FGKA 1PT8A 1M67A 4WXYB 4Y2PA 4BEJA 1O3YA 2HGSA 3ZY2A 1OU0A 4KO2S 3FKSD 1YZGA 4OHOA 4UEJA 1GU0A 1UFKA 4DAEA 5C8XA 1O96B 1NTRA 4L4YA 3FRIA 2CFSA 3RVOA 2SNIE 2JPDA 1Z2NX 2LR0A 2WUFA 3KKQA 3QOWA 4XQEA 4RELA 3WIVA 3TTUA 5LKRA 3RG8A 4MV9A 2PWZA 3ITEA 3R9IA 4W5TA 1D1QA 2X0NA 4YJDA 2QRMA 4BLPA 4CIVA 1XWIA 4F4JA 1D5CA 1VHTA 4ZCSA 2QM0A 2ACKA 5KKCA 3K9FC 1QR6A 1WO8A 2HEIA 4FHFA 3LK7A 3QE3A 3H2HA 2PX3A 1X42A 4IOKA 2SBTA 2IYAA 1LNSA 3EVNA 3GEEA 3PUHA 4UASA 2O8VA 2P41A 4XR9A 2IZ7A 1ZHOA 4IJUA 4HDNA 1KIFA 4BMDA 4Z2AA 3K3PA 3UHAA 5F3WB 4HLUA 3ZXYA 1Q50A 4B4VA 4AZ3B 1JL3A 3EUEA 2J5BA 1LS1A 3OCUA 4HRAA 3QXXA 1UBTS 3HBJA 3R7WA 4XDGA 2IOYA 3MMNA 4NBRA 4H1WA 1DAIA 1YJQA 1U7HA 2WUDA 2Y1LA 3INNA 3AOEC 4AQ7A 1VPDA 2ZRGA 3WYNA 3I9V1 2YJ4A 4FFSA 4U5QA 4F04A 2JJ1D 1E66A 3OTIA 3FJ1A 4RFLA 4E09A 1FFSA 1IOWA 4DW8A 2Y1EA 2NU9A 5EERA 3GAAA 1SC6A 2HIGA 3EGDA 2Q4RA 5LYJB 8MHTA 1D1PA 3LSYA 3VHRA 1PL0A 1W1UA 4HDKB 4NPCA 4RZUA 4QICA 3DEHA 3JQFA 4M0LA 5ARCA 5J23A 3KKNA 4O4JB 4DUGD 3T52A 3WHIA 2WZDA 2B7BA 2RGYA 1IQUA 2V6JA 1YS9A 1UKVY 3CNBA 4M98A 2FDXA 1HKHA 2ZB8A 4LWQA 3F2IA 1XTVA 3ETJA 4UU0A 4DM4A 4F86A 1ZWLA 4UBMA 3C7CB 4FXOA 5F2OA 3CZ5A 4YT5A 4IXTA 3CR7A 3GFRA 1G8HA 2G7ZA 4L6CA 1E2BA 2EKBA 1U1CA 3QEJA 4JLNA 4JX9A 2N1MA 1YF3A 2ZG6A 2O2DA 2GLXA 1WKCA 3C1UA 3EFOB 3LH5A 3PUJA 2J32A 4Q7EA 4BN4A 5HZHA 4RMIA 5JHHB 1MOQA 5SY6A 4WK0B 3N39C 3AR9A 3EGXB 3N8IA 5J4YA 3FYSA 2X7XA 3THYB 5A62A 1TEVA 4PYQA 4W5JA 4XLLA 1LPSA 1OI4A 3AIKA 4FNAA 2PWAA 1O9HA 2V5AA 3Q8WA 4R6XA 2G25A 1JIKA 1L1RA 13PKA 3EUAA 4MUMA 4BV8A 3CLUC 1NC3A 5KOIA 5IN4A 5LXTB 5IFLA 4R7ZA 1V6CA 1SUWA 3D6VA 2X0EA 1C8VB 1CR4A 1RJWA 1TM5E 1QNFA 3E82A 3DKRA 2E82A 3AXTA 1D2RA 2IOQA 1BS1A 3OLQA 5DBFA 4EZBA 4D4IA 3J7AC 2HO5A 5AW4A 4AKIA 3OPYA 1GGKA 3GJ0A 4WXEA 1G2QA 2X5OA 3LCCA 3IDSA 3I3OA 3M1IA 4K9LA 1QPZA 3MCAA 2REBA 4YS6A 1JR6A 3QLEA 1UT5A 4JBXA 2ONYA 4JKIA 4EW6A 1PU2A 3Q7QA 2XCQA 4H3SA 3CEPB 1H4TA 4Z2YA 4ZYVA 4PLFA 1LWOA 1QG0A 1Z18A 2BFDA 1HE8B 3C3JA 3O3NB 3D7RA 4NJMB 4WLEA 3KKZA 4EPVA 4AY6A 1T6YA 1ILWA 2QQFA 4YMIA 2Q50A 2X8BA 2WWVD 1XKLA 4YJKA 3QV1A 1EXVA 4ZDJA 3RSZA 3IPLA 2O2SA 4PXSA 1L8LA 3IEIA 1KH2A 3HJUA 5IBRA 1X8KA 4ZU3A 5BW4A 2G0TA 1T3GA 4IJMA 1G19A 3T5GA 2PKWA 1ZUNB 3P9YA 5DI3B 3EOBI 1PEKE 4PG7A 4YAUA 3D1LA 2IEBA 4G26A 5B3JC 5E3HA 5CDFA 3GGDA 3TO5A 3PHJA 3KOYA 4EEXA 2GPSA 1G41A 1BMTA 1PJ2A 2WICA 3PYLA 2HMAA 2HXSA 1IZ9A 4EZIA 1DDGA 3VAZA 1R0XA 2QD4A 2DHEA 2E1PA 4L76A 3AI3A 1MT3A 1Z15A 3Q8MA 1TVMA 3JZDA 3U7QB 3GDOA 3RFVA 2WHEA 2B5OA 2PUBA 1RYMA 1JNYA 3OY2A 2ZTUA 3VYUB 1JJAA 3W0LB 5FEMA 5IVPA 4L22A 4CIDA 5FWYA 1XL1A 4MUEA 5AJXA 4YDQA 3Q8XB 4X92A 1U0FA 1FMFA 4LVNA 2EERA 1KKUA 4XDYA 1Q21A 4YR7A 2UYCA 2IUUA 4MS3B 5C2JB 4N01A 4D3YA 4HRVA 4FKZA 2GN6A 1G0OA 3DVQX 5EPEA 2OB1A 3GJ8A 5G53C 1T6XA 2G80A 2RBEA 1TCVA 1ZL0A 1CY0A 1MENA 4KZKA 2DTXA 4AUEA 4F8JA 1X74A 2WHPB 4ND6A 4TRMA 4C89A 2D8AA 3IFSA 2J3DA 3ADBA 1N6LA 2NO7A 2PS3A 1LDNA 2ZAMA 5CT6A 4CM9A 1E9RA 2RGCA 3V8NA 4LYYA 2O6LA 5EYPB 3H9QA 2BPOA 1QB7A 2P2LA 1SU6A 2VXYA 1PR4A 3SJAA 3SK0A 2H92A 1PS8A 4GT1A 2CV0A 3WHPA 4RFVA 1PD0A 4LF6B 1T25A 2O5VA 5D84A 2QD1A 3NYIA 1V3QE 3B2NA 4NCKA 5TMBA 1R5OA 5JNVA 3FSGD 2FN8A 1LZKA 2CZQA 4D96A 5JYDA 4CG0A 1SK9A 3F0TA 3TOVA 1GQRA 4I4TA 1O95A 3GLQA 3TPCA 4EP1A 1OUMA 1X7WB 5DN9A 3DHVA 3MPUA 3V7YA 4R2MA 4XI9A 1M54A 1JWAB 4YASA 3THWA 1EBFA 4M1OA 1JHMA 1JZSA 3GARA 4FHCA 1Q83A 2OEPA 4O3FA 3RE1A 2V7QD 3VZDA 4ZICA 1AGYA 4QVIA 3ESAA 3KR1A 5PGMA 4R16A 4V39A 2B2NA 1QHIA 1ZRHA 3CF0A 4MB2A 4XWKA 4ZT3A 3X2EA 1X80B 1GQ2A 2YIMA 4FOSA 4GI7A 5ITWA 4B3MB 1L6RA 2EVWX 2Q4TA 3EEBA 4RJ2A 4X41A 3PEWA 3A27A 4B2LA 1C4KA 5FWXA 1HNNA 5C7YA 3JAKA 1Y1RA 2E5LB 1OWLA 4ZCIA 1QYVA 1HM5A 3N28A 2W6MA 5ALKA 1S89A 4M8KA 3RTDA 3ZHYA 2ACWA 5HJ2A 1IG0A 1YQDA 2WJJA 4R9RA 1FDWA 1L1EA 2VQSA 3IV9A 1B0ZA 1HNZB 2JJYA 4BHTA 1YBHA 5K1ZA 5FUQA 1N0HA 1XZQA 4BX8A 1UWVA 4FCCA 3DEAA 5FA5A 4DJFC 4LXTA 1Q15A 4B7AA 4OK6A 1W87A 5K3SA 3CISA 1JQ5A 3S2EA 4J0FA 4RMGA 4BWFB 4LMAA 1A7AA 3HMQA 5A4JA 4J75A 4Z9AA 2J30A 2O2EA 4O02B 2PS1A 3C6BA 2D7CA 1UXHA 2V6MA 3MTDA 4G5FA 3TZEA 1NF3A 2R9VA 1OTYA 2IIPA 1O4VA 2EC5A 4KJZA 4KP7A 4R1NA 4WAUA 4JI6B 1OX6A 3VM6A 3EG9A 3PHLA 3WL7A 2NSDA 1YZQA 2W83A 3ZNOA 3VR3D 4CKYA 4DLNA 1QJCA 4JJIA 4EX7A 1IC6A 3EYAA 4KN8A 2COUA 2EJTA 2EZ9A 3WC4A 4ZTBA 1JG3A 4I1UA 821PA 1MJNA 1F8YA 3BS4A 2CUNA 3LW7A 1GXSB 3RU9A 2E4XA 4BAZA 4KIGA 5I4BA 2MSLA 2WD7A 2VYQA 5EE9A 4KDFA 4NYMR 1WQ1R 3MTBA 3PA8A 5JSZA 2FZ4A 1TDJA 2A14A 2NTEA 4ZMSA 2OXIA 3NFRA 3VHLB 4BDTA 4Z9BA 3OJEA 3OE7D 5J1SB 2VRBA 3E48A 3ESCA 3M82A 4DG5A 3W8NA 4HXYA 1J07A 2EWMA 3FNRA 1C9EA 1X7HA 4ZAWA 2HU2A 3C5WP 4RV5A 3BJEA 1U2SA 4P3XA 5GM1A 3KCNA 1V7QA 4DUGA 3RBXA 3KTDA 4ATNA 4CMIB 1W2HA 3U19A 1RYNA 4M7WA 2JS7A 4IIGA 5AKEA 1AKMA 3ESRA 4N7MA 4WA8A 3ZCQA 4PSKA 5JSQA 3WADA 3FPHA 3TNFA 1YBMA 5AW5A 4CPDA 1GYRA 2A9FA 4FMDF 3BJMA 4ND1A 3H5VA 3KWMA 3M9XA 3WL8A 1L0BA 2A8YA 2FKAA 3PP8A 3FBGA 4UAGA 1FDOA 1F2UB 2N42A 5FBLB 5AVTA 5I51A 3N2KA 3P2IA 3ENWA 1R0KA 3DVAA 4HNQA 3PIDA 4AROA 4CF4A 5BOSB 4EK9A 1WU7A 2DP4E 5AVJA 1RZVA 3QKUA 4F5YA 4ZIRA 3AQ4A 1BWRA 2W4IA 7REQB 1JMYA 2HU8A 3G23A 4GPEA 3EIWA 3F3KA 1JDTA 1L1QA 1AK2A 4U3JB 2DB3A 3JTMA 4MI9A 1VHJA 3ONEA 3IDZA 3A6EA 3ZJUA 1SOMA 3KEMA 2R3SA 2VATA 2ERXA 3SQWA 3KOOA 2ID9A 5JPIA 4BU1A 3KE9A 5EUCA 1L7PA 5EHXA 3AX6A 2FF5A 2BTOA 1KJWA 1DUSA 3RC9A 4HUQA 4N0MA 4BYMA 4YUZA 5DM2A 3ND5A 4V3CA 4DDVA 4QVGA 3F4BA 4XD7D 4Q1FA 3OZDA 5FJJA 4QNNA 3U0BA 5A03A 5AW1A 3A3NA 1V47A 4JLPA 3ASZA 1DRJA 2ZSFA 3LQYA 2DKFA 1B26A 5F1PA 3VO8A 3S27A 4B3SB 2NTYC 4N8DA 4R1TA 1PLJA 3SYRA 3UT5B 1KETA 3T35A 1O96A 3V4FA 3A36A 2NO5A 3F73A 4RK6A 5EMMA 4E5VA 5HYVA 3D4PA 5IBPA 5C35A 1BS2A 1U2GC 2DZDA 3KL2A 3F98A 3GMIA 1HOXA 3RIYA 5FR1A 1Z4KA 5I7UA 3OZUA 3H9UA 1TKBA 4LJ6A 2XUKA 3VTAA 2P6RA 4E5PA 2CMDA 4YBRA 3AFIA 1RYBA 2Q1SA 3PQ3A 4W63A 5CVVA 2YV5A 5T4FA 2ENUA 4NQRA 5TSDA 5FCDA 1XK6A 1GRNA 2E55A 2NUTB 2QPOA 3DBLB 1LSSA 1A50B 4JUAA 4O2AA 5AFSA 3VH4A 3WGNA 4L57A 3TIIA 1AZSC 2H85A 1Y3CE 1JFFB 2F1JA 3RU2A 3HA7A 4XGIA 4RZQA 3E9RA 3L6OO 1V71A 3GLUA 4LX0A 3WZLA 1VBNA 1SXPA 1T3TA 3I83A 1N77A 5DH9A 1UK8A 1N8SA 2YJGA 3D1VA 2HXGA 3VMMA 4B3JA 1O6FA 2PL3A 2XBMA 1L7AA 2FUG1 4GQAA 4ENWA 3KJEA 4DF3A 2B3TA 2B99A 3IAEA 2WJWA 2C2WA 3D8HA 5ETJA 1D2HA 3AR4A 1JSLA 4G37A 4KYVA 4OJNA 3BH7A 2IXTA 2BCGY 3RS4A 2Y0EA 1B1CA 1UH5A 3AFNA 3E84A 3I01M 4XUCA 4JLOA 5JS8A 1CZKA 1YR7A 2DLNA 2EG5A 3KVYA 5DT2A 2V1XA 3E9CA 4J1NA 3ZZMA 2O8BB 4R5MA 3TTVA 3QUCA 3WWZA 1SCJA 5C1IA 2Q6LA 3KK0A 4YRBA 2FGJA 3MC1A 2EBFX 3LTEA 5K0CA 1P33A 1KZ6A 4RC9A 3H1PA 1BXRB 5LYJA 3B12A 4ZU1X 1P0PA 4DY4A 1ECFA 4AD8A 1D1SA 1E1RD 3C6XA 2F3TA 4HDKA 4QLOA 3ABZA 3MMSA 3SJUA 4CKXA 3DDUA 4F71A 1OMOA 4A0HA 5JRJA 4IQ4A 4O4IF 4O4JA 3FAKA 3OZAA 3ENNA 3FYCA 4KKXB 2P3LA 1HDRA 4OQZA 3B9BA 4AKEA 3L4EA 3NTXA 2HA3A 5HILA 4BVGA 4BS9A 4E4RA 1X87A 5SYMA 4ARBA 3Q8KA 2QM3A 5A04A 4KQ2A 3U7HB 1PR3A 3AM3A 2ZT7A 3QE0A 3K31A 1RLJA 4QFCA 4UM9D 2W2MA 3SZMA 1Z4JA 4EYKA 2HFJA 4TTIA 5HBGA 2FW6A 1IXKA 3FSGA 5TE9A 3S29A 4EVSA 3LYUA 2QTWB 2GTIA 5J2TF 4X0EA 2QAIA 2QZSA 4KREA 2CDBA 4HVCA 1UKEA 2I78A 1S4MA 4EI9A 2IP2A 3MF4A 5AUQA 4AIIA 1UDAA 1YZUA 1MIOB 3THYA 1YVUA 4IYJA 5H0IA 2V7GA 1U3TA 2IUFA 3A31A 3ADOA 3P96A 2BDEA 2XA1A 3R6WA 2NZJA 5CU7A 1J2YA 2XNHA 1Q5PA 4UQPA 5LXTA 3OQMA 4FPXA 4XJXA 2X9GA 1DXQA 1FFGA 1ELOA 3TZKA 2YHBA 4B85A 1M0WA 1MX5A 2D74A 2FW7A 1T26A 1U5BA 4AY3A 5FX2A 1FYEA 3PC8A 1KAGA 1PR6A 3SDSA 4POOA 2A35A 4GD3Q 1U0EA 2WJZB 3KOZA 1K8XB 2CW5A 4GOKA 5IJWA 1N2CE 2QL7A 1T2UA 4AYTA 1XWWA 3FMPB 1QIMA 2YWJA 4NIMA 2MIIA 3ZU3A 2Z0MA 1KDPA 3FE2A 4Q15A 4BMVA 3QQ5A 1ZH0A 4JP2A 1XU9A 4LV6A 1QSGA 1WZ2A 1UP7A 4LYGA 1ZJZA 4HZGA 1DAFA 2BDUA 3B1VA 4DA8A 1WW2A 1P5HA 4TLEA 3FI0A 4EJ0A 1NRXA 2Y1FA 2YHIB 3K8ZA 2FZCA 2M6KA 1AQUA 3BWXA 3HP4A 3T7TA 2H4JA 5COQA 1J9EA 4NG5A 2HM7A 1Z56C 2JIBA 2AMJA 2VPWA 5GOZA 3MS7A 1V8BA 2VBGA 5H68A 3R75A 1R0SA 4G24A 1FPMA 4ZZ2A 1G1MA 1RLOA 2XNCA 3DOCA 4ZGGA 2VJCA 2BY4A 1Q3KA 4HQ6A 2X2PA 5DI3A 2FPGB 4GX5A 4N7RA 2J3MA 1I2AA 3O1JC 1P1FA 3ECSA 1I33A 4NS1A 4Q7JB 3D43A 3W9YA 4AMGA 3VKVA 3L4JA 2KSQA 3TSAA 4JU8A 2QUBA 2FX3A 2I4MA 2B4KA 2Q3HA 2VWGA 4J2OA 1O08A 4C7KA 1KSHA 2CFIA 1PFUA 1QG2A 2J3LA 2XWSA 2I7TA 2RG7A 3BHNA 3CA8A 4DKJA 3P0HA 1X0XA 5FADA 5EJMA 2C2KA 3RAGA 1XI2A 4X1KA 5D8DA 5EJ5A 3O5AA 4YH1A 3R76A 1MN6A 4BEVA 2NXJA 3UJPA 4EI8A 1M2FA 4FFWA 4NR0A 4A8PA 3QP9A 4YCJA 2GPBA 5JZ9A 2VFAA 1Z5OA 1Z6GA 2WTAA 3FFXA 3MD9A 3N75A 5L53A 2IZ0A 3R5KA 2JD1A 2NUAB 3P2OA 1GRQA 3EBPA 2F62A 3WBKA 5KYYB 3N2YA 5ADUS 4MUXA 1O9GA 4IQ8A 4B75A 3DW1X 4CMEA 1UXJA 3LVRE 2P9QA 2XKAA 2ZREA 3TXAA 2I5PO 2FWJA 4JNCA 5CIWA 1TU3A 1JHVA 2A9KA 5A5GA 4IX1A 3FZEA 3A10A 2CBGA 3OM1A 4ND3A 1BFKA 2FWBA 4UVGA 4WL0A 4K86A 4BV9A 1NKSA 3FYUB 4AX8A 1DOAA 3IBYA 4N12A 5KTPA 4EYSA 1ZBQA 4GE0A 1A69A 1YKFA 2DY0A 3LPLA 4KN6A 2AEFA 1Q0SA 4QREA 5IJXA 4BGUA 5EVJA 3H11A 4JJ4A 2GASA 2AR9A 1DUIA 3PCTA 4RORA 2QTVB 1FSSA 1QVVA 3OF2A 2Q0HA 4IZOA 4X3PA 2GEKA 2A7XA 1E1KA 3PUZA 4MB6A 2WWYA 1ZR4A 2JAUA 4H6VA 3FUCA 3F1KA 4Z4IA 5EE5B 3EVAA 3LLVA 1WPRA 2ZDQA 1OXXK 3IEKA 4WACA 4AWAA 1IVSA 1O0BA 4PM4A 5DNEA 3OUTA 1KAOA 2POCA 5DPMA 1EJ0A 1MC5A 3ZQJA 4TWIA 5DHFA 4NDZA 4XD7A 3WYFA 3IXQA 3I5YA 1V7ZA 3OZCA 4FX5A 3K9BA 3RFTA 1NXTA 4HDOB 2YZNA 4F9EA 2TMYA 2LCQA 3HUEA 5JC8A 3OPNA 4MCIA 4RW0A 1T24A 3ZHTA 1MO4A 3PRYA 1TMGE 2AQ8A 1NQWA 1A4XA 3ETNA 5MHTA 2L2QA 4JK3A 2H2HA 5FP0A 3DCNA 3MBOA 3D7KA 4M87A 1BQ3A 1WP4A 3FIJA 2ZXFA 3UB2A 2PGAA 4ZJZA 1B8UA 1A8IA 5DTQA 3EVEA 3I64A 2IQ5A 3IIMA 3ILYA 1FDRA 2VZ9A 1RMQA 3CO0S 3VR2A 3R5XA 2COKA 5KNDD 3ZX5A 4JFRA 1QVZA 1Y4ZA 4S1VA 2PTHA 5G1OA 4L5CA 4P08A 4GNKA 4JGIA 1YWGO 2QIPA 3HXKA 3MVEA 1X70A 5FKJA 2X9NA 2ZI4A 3ZWKA 4AT1A 1VLMA 4L16A 4LNUA 3PQ6A 4U7GA 3O90A 3SZUA 1FXUA 4B9EA 2VQ3A 2PL1A 4CCWA 1CVRA 4E5DA 4NEHB 1AQNA 1QNLA 4AXBA 4P9NA 3O4GA 4CF3A 3BIJA 3U62A 3VR6D 3RSQA 1SU4A 3A1UA 3C8HA 3K4HA 3EW7A 1TPYA 2JAOA 4WECA 4XTRA 3UKOA 2TECE 4OHXA 2VSYA 5A9SB 1TC1A 4CM6A 2Z5GA 3M6XA 1TTPB 3CCFA 1JR2A 5FWAA 1DEXA 1PQUA 2BFEB 2WF8A 5LZ2A 2WZQA 1SVMA 3GPCA 1KJYA 3N6RA 4HVAA 5JWHA 1DBWA 1WDLA 5DGDA 4WFQA 1Z2AA 1X7ZA 3KJHA 1GIAA 4CT4B 4GEKA 4CV3A 1GXSA 5DB4A 3IPXA 4PFSA 2P78A 5FBWB 4B6PA 3BGSA 1VE1A 4RULA 1RABA 4NKRA 5EC8A 4Q3NA 5FDFA 1R1DA 1SXHA 4HGPA 2WU8A 3NMUF 1T1IA 2ZWMA 3O8QB 2IF0A 2TSYB 2DKOA 3SF0A 4B9AA 1FP7A 4FOOA 8ADHA 1A1SA 5JATA 4R2IA 3MWFA 5BQOA 1WVMA 1S3FA 4ID3A 4HB3A 3QSGA 4NAVA 3TLMA 1YZLA 5JBQA 2VNIA 5KNCH 1JU4A 2CFTA 2Y68A 5CA1A 4C1NA 3G7UA 4Z4FA 2HWYA 3FZYA 4CF6A 4HVLA 5A4FS 1LBQA 2CXSA 1DT3A 2IIBA 3HHEA 5DXAA 4DA0A 1P39A 4ME6A 1VG0B 2JIRA 1HDEA 2VNJA 3PDWA 5EP2A 2Q46A 3C6KA 3LIPA 1YJXA 3FROA 3VVCA 4EUKA 5TQ2A 4YRIA 4GPBA 4OA5A 1ZM4A 3PX3A 3CEHA 1SEPA 1YBAA 2AI2A 2J31A 2VK1A 1TMKA 4L08A 4R8LA 2Z2XA 2XMCA 4KFTA 5DHSA 4KX3A 4C22A 4DSAA 4FFDA 4P84A 4V24A 5CYGA 3UCFA 3SLGA 4ESVA 2C4KA 4E2XA 1J99A 2VUSA 4JROA 3D4OA 3INRA 7REQA 2QUAA 2QJRA 4H7IA 4M1TA 3DTTA 4A82A 2JAHA 4IKPA 2G4VA 2I34A 3JQBC 4NDAA 2C3MA 3D3NA 4K9RA 1SVUA 2G77B 4U3JA 5DOVA 3T4XA 2L69A 1JBKA 1XX6A 1KAMA 2Y66A 3F6RA 3NHKA 3UMFA 1HYGA 4JFAA 2QR5A 2R8BA 5FTWA 3Q7PA 4Z51A 3EY4A 1TYDE 2K87A 3LYLA 1WMSA 3IKJA 5IASA 4JSRA 3FHCB 1O97C 2OO7A 3S5UA 4XQGA 3NYQA 1H9CA 3SX0A 2XCLA 1U0GA 3GUZA 2RGRA 2H11A 4MKZA 3FX2A 5L3SB 2D5AA 3G68A 4H4EA 3PXCX 1ZUD1 1ULHA 3A6JA 3R3HA 5D6OA 1HDZA 4X93A 3TZBA 4EHBA 5I8WA 5DX0A 3TSOA 3UEOA 1B1AA 3IOYA 4PPFA 4URXR 4AP6A 3GEPA 1L5FA 4UZSA 2CE7A 2JHAA 4YAKA 1PDWA 1CY7A 1R18A 1GPKA 5ES4B 1LBHA 3NDRA 3E58A 2XBUA 5F9MA 3TOXA 1MJFA 4YGYA 3UT5A 4IEIA 4XWYA 3SBEA 4YMLA 3OLVA 5C3UA 4MH0R 4F4DA 2YFYA 5CLGA 4ZXPA 4TROA 4RMJA 3G5UA 2G76A 3KT0A 4I3FA 4M6WB 2F8LA 3O9ZA 5IWCA 2C8KA 1N4AA 5EXEA 2V4UA 3QUTA 5ECDA 3EEYA 2YWCA 5ENDA 3Q5EA 2CF5A 2JAWA 1XLUA 3CKMA 3G2HA 4K9QA 2G9VA 4XZ3A 1NFFA 1JDUA 3FNBA 1DFGA 1I80A 4KR9A 2NUTA 4NZMA 1L5LA 4AX4A 4U1RA 1G5FA 3L1IA 2NZXA 2BGJA 1ISHA 1SKYB 3AY6A 3JX9A 2NO0A 3KQYA 1VIDA 1DINA 2BE7A 1RE1A 1HLGA 4UDNA 3WK4A 4BQIA 2QM8A 1J0BA 4PLTA 2PNFA 4X84A 4RPHA 4ZC8A 2NPOA 2H51A 3BUSA 4E88A 2GK4A 5CEEA 1QO9A 5FA8A 3A1EA 3HI4A 1R4AA 3WDMA 4A1OA 5JAZA 5AM2A 3G9UA 2AZXA 1PR1A 1G8PA 1VL1A 2AJBA 4RVNA 3H3JA 4HLCA 4RESA 4IXDA 1MQ8B 3REFA 3ZIAA 4J76A 3LF1A 1V4VA 2R2GA 3D0RA 3A32A 3KG2A 5BW8A 4U0KA 4K05A 4D8YA 3HJNA 2O8BA 5J2UF 1MTOA 2YINC 1DXYA 3WYGA 4TKZA 3BCRA 5JDIA 1XCJA 5LP6B 3ER8A 1U7TA 3GFVA 2HADA 4MP3A 3A14A 3DHWC 2PKCA 1RWQA 3NAZA 3LDGA 5ALVA 1IN5A 1ISRA 2WU1A 4FONA 3WYBA 4DBVO 1LBSA 5IT0A 4TKMA 2VPYA 3F9RA 1NGSA 1K27A 3M1AA 3TW8B 4TUYB 4E2YA 1YQTA 3PL1A 1FNBA 3O94A 2QLNA 1VI6A 4ZQFA 1BJRE 4C5CA 2WOJA 5DO9A 1GKYA 4OA8A 1DOZA 2FMHA 5BXQC 5DRYA 3U56A 1RZ3A 3DFIA 1E4OA 2DQYA 4U9IS 1RRMA 1HFKA 1D7AA 3CS3A 4UM5A 2C8VA 4URWR 5DSXA 5CX4A 1QFXA 5JSHA 2C03A 4B6QA 1MD9A 3H8SA 4RF3A 4BNYA 4EYQA 4M83A 4YROA 5F33A 3V6LA 5FQOA 2XCOA 3DOOA 3PFKA 2FSVA 1U5AA 3DC2A 5FL3A 4B33A 3OKFA 1DX4A 1W5FA 4H0FA 1XCGB 1JFLA 1VSVA 4RH1A 3R2JA 2PLRA 5F2KA 3DKVA 3M4YA 3GAFA 4S35A 1K92A 3LJKA 1MLDA 3N6VA 4JITA 3PNKA 1GILA 4OXYA 4ZAYA 2J6CA 4MQ4A 3CLUD 1TQDA 1ZVJA 2EW2A 4BNUA 5AM0A 4OM8A 1KGDA 1OR8A 4K8RB 4R6WA 4WD3A 5EPUA 3QWFA 3SKYA 4EG5A 4DV0B 1OKKA 2HWXA 4LKRA 3D6NB 5F2EA 3RFXA 3OHSX 1SD1A 4IDPA 3U7GA 3HZZA 3SP1A 4CTJA 2CXTA 3P19A 2GEVA 1GD1O 3QHPA 3RUPA 2QZJA 3ON5A 3N76A 4MV1A 1FTYA 3DLAA 1L4YA 2CBZA 3AUFA 4U2GA 2PKEA 3N1UA 5U9CA 2GCPA 1FUYB 1SPXA 1ZG3A 2R8OA 4K5QA 1P44A 4AO6A 2GNPA 2NTVA 1U2DA 2F8SA 1E4VA 3SN6A 5FHRA 3ES9A 1E2EA 4J0IA 2A9RA 3UAVA 4V2IA 3VGPA 1NATA 5L3RA 4D4KA 4RTSA 3IKTA 3HJRA 1JTFA 4I2NA 3TMKA 4OM7A 1MJ5A 2GERA 4L3VA 4XASA 1JKIA 3GFSA 3C3XA 3MJHA 4M9UA 1F3OA 2QN2A 3H19A 1I0LA 3ZR4B 3GW8A 5TS3A 3L4BA 4AS3A 1PT6A 4WSOA 4HT3B 2QPAA 3HFGA 1V45E 3G8YA 3PNBA 2YHIA 4UUOA 2CWWA 1T1JA 4MQ5A 1JQAA 5AJUA 5EHZA 3K20A 4KE6A 1ILEA 1HQCA 1FLDA 5M3BA 1P0CA 2ZT5A 5ERGB 1PJAA 3H2IA 4BNGA 2RGWA 3G6KA 3WHKA 5B30A 2ZYGA 2ONKA 1Y98A 3K9WA 4BJHB 2CNOA 2HQBA 3KKMA 3L1HA 4BFZA 1FEZA 4BE7B 5KU1A 1P4HA 2WJVA 3IL2A 4IOJA 1U98A 1C4XA 2E4AA 3BFKA 2GA8A 4WADA 2VF5X 3OQIA 1C3LA 1XDSA 2P9YA 4QRHA 2G5GX 5G0UA 3BE8A 2C95A 3WLEA 4B34A 4QYXA 1K7EB 1Z63A 1Q7CA 3H84A 3KIPA 4Q1AA 4N49A 1CR6A 2GZHA 2Z98A 1Q1QA 2AMYA 3FTPA 3ROMA 3GFFA 1F12A 2P1DA 1F4LA 3L7DA 3QWBA 4N65A 5EGNA 4D9HA 2BUCA 3JYHA 4QIHA 3T7EA 2IYRA 3T1NA 2QXUA 5E4TA 1KQNA 2HF9A 1ADBA 4EBFA 2Y1XA 1G4UR 2QI9C 1T5TA 3Q3JB 5DWDA 4NU8X 4Q01A 3ZG6A 5K8JB 4R05A 4TV9A 3JAWA 1F0NA 1MO3A 3ZDQA 4EKGA 1XN1A 3HZHA 1R0RE 3W5JA 3LP5A 1ID8A 3W4KA 2ETVA 1XYYA 3D7NA 1PJ8A 3RVJA 1U63A 1KK0A 3FLAA 2EFJA 3C3BA 4MWZA 2ZIWB 2ZSIA 2IV3A 1HNWB 2XRMA 5F7JA 4WHMA 3UJ9A 2NO4A 2ZSUA 2L42A 4G5RA 5BSMA 1O57A 3AUSA 3N8DA 4MTLA 1D3AA 3J81k 4HNSA 2YX1A 5E0KB 1GAQA 3GH1A 3IO3A 1ZI6A 4UMVA 5BOVA 5F9FA 2X77A 4DMCA 1TVCA 5FBHA 4ZN6A 5HM6A 1YB1A 3FYUA 4N3NA 1PZHA 3FIUA 1T3ZA 4GP9A 1J0EA 2BP7A 5ADWA 4C5BA 4FM9A 3PWZA 1E2DA 5LQDA 4JS0A 3W6UA 1L5KA 4B3CA 5GZ1A 4UXHA 2Q1XA 4MPJA 2C0CA 4YRNA 3W9UA 1SQSA 4CEIA 2ZRLA 3D5TA 1Z0UA 5FBQB 1FTSA 3OPVA 4TVOA 4FKMA 4CM8B 2X4GA 3Q5GA 4QG3A 1EDBA 2EJCA 2XQVA 4KMMA 5KI6A 2QYTA 2B1RA 3H6GA 3L7JA 1ZXLA 3NB0A 1FA9A 1WXIA 4IUBS 3QVXA 3SC2B 4AYXA 2E48A 3EPRA 1H1TA 4ZKEA 3QKIA 4YRSA 2E4ZA 4KWCA 3F7MA 3R77A 4WXHA 4X1IB 4DXHA 1QHYA 4Y18A 3R6DA 4EO9A 1MO5A 4BP3A 5BSEA 2BIFA 2GHTA 2C4NA 4MINA 5I45A 2BEVB 3KPYA 5D3QA 1Q17A 4WBSA 4QBIA 4JHLA 1U9JA 3TNJA 3N70A 5EI5A 2OLJA 4S3MA 1PW5A 1UZLA 1CUHA 3I2YX 4HN4B 4MRMB 4UUBA 1I51A 3RHZA 4PG8A 1WUHS 1A27A 1TT7A 5EMJA 1E0KA 1E7WA 2FPSA 4LA4A 1U7PA 3BXOA 3MGGA 4RHTA 1TA0A 1A04A 1SC4A 5LMZA 1TT5B 2QZ9A 3WGKA 3E2IA 4KV7A 3BULA 5F76A 3UJBA 2W2LA 3MWEB 3TB6A 7ADHA 1C1YA 7AT1A 3E7DA 4OV6B 3PIIA 1CJMA 4JU9A