4B6SA

Structure of helicobacter pylori type ii dehydroquinase inhibited by (2s)-2-perfluorobenzyl-3-dehydroquinic acid
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
158
structure length
158
Chain Sequence
MKILVIQGPNLNMLGHRDPRLYGMVTLDQIHEIMQTFVKQGNLDVELEFFQTNFEGEIIDKIQESVGSDYEGIIINPGAFSHTSIAIADAIMLAGKPVIEVHLTNIQAREEFRKNSYTGAACGGVIMGFGPLGYNMALMAMVNILAEMKAFQEAQKNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-DEHYDROQUINATE DEHYDRATASE
publication title Mechanistic basis of the inhibition of type II dehydroquinase by (2S)- and (2R)-2-benzyl-3-dehydroquinic acids.
pubmed doi rcsb
source organism Helicobacter pylori 26695
molecule tags Lyase
total genus 55
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2012-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01220 DHquinase_II Dehydroquinase class II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dehydroquinase, class II 4b6sA00
2Y77A 3LWZA 2CJFA 4CKZA 3N86A 4CIXA 1UQRA 2XD9A 2UYGA 3N59A 3N8KA 2WKSA 1H0RA 3N87A 1GU0A 4CKWB 3U80A 1GU1A 4KIWA 4B6OA 4B6QA 2XB8A 4CKWA 4RHCA 2C57A 3N8NA 2C4WA 4V0SA 5B6PA 4CIVA 4B6PA 2C4VA 1H05A 1D0IA 4KIJA 4CL0A 4CKYA 2Y71A 4ZC1A 4RC9A 3N76A 1J2YA 1GQOA 2XDAA 4CIWA 3N7AA 5WRFA 3KIPA 2DHQA 4KIUA 4KI7A 4B6SA 4B6RA 2BT4A 4CIYA 1GTZA 1V1JA 4L8LA 2XB9A 1H0SA 4CKXA 2Y76A
chains in the Genus database with same CATH superfamily
1NVAA 4TYYA 3L49A 3LNTA 1V8OA 3U60B 5J2UA 2P9FA 1OLSB 1HZJA 3RJZA 4LGMA 4RDCA 2PAAA 2EARA 4QOJA 2G6BA 4I5EA 1GZHB 2V7WA 4KK4A 2GH1A 2R8YA 4IIHA 1U1EA 4RKWA 3D6TB 2NT4A 1T8UA 2HMSA 1VE5A 3IMCA 1IVYA 1SZJG 2X5XA 2KB0A 4IDBA 3T7SA 4TYWA 3RVJA 2EX4A 4BPRA 4JJ8A 2ZJFA 3ENWA 3ORSA 2HRZA 1REQB 2A0XA 2AT1A 2W93A 2WIAA 4JGBA 4REMA 3N3BC 2QN8A 3W2TA 1AMOA 3NM6B 2WAMA 1XMXA 2FSIA 4ZI3A 2EGHA 3HSKA 4CKWA 1R8XA 1EFDN 1JR2A 2CHQA 3PVZA 2FFBA 4ZVLA 2QP9X 1A72A 3OQ1A 2O0HA 1KDRA 2XSZD 4UBNA 2I4IA 4NU0A 4DCNA 5CJ2A 2FUCA 1JDVA 2MSCB 5T6BA 2N3ZA 4LXXA 4OREX 1WPRA 5D7NA 5FEMA 4BO1A 3LLSA 2JRCA 3H3JA 4OCZA 5D7BA 3LZCA 5C4IA 1C1XB 2JGDA 2GGSA 3CWQA 1D1PA 3TJMA 4DABA 3GEEA 5HR5A 2ODAA 3LWDA 1FYFA 5AXBA 1I9CA 5EMMA 1E1MA 2AW5A 2GF0A 3A6ZA 4QBHA 1E1QD 4IV0A 1MQSA 4JA0A 5TEVA 4JP8A 1NUHA 3GQBA 3H1AA 4AT1A 4KI0A 5T8KC 2X1VA 3RBVA 4ZRMA 1RWWA 2C5AA 1PNTA 1EESA 3O73A 4G5YA 3W1EA 3THXA 1PT6A 3C3XA 2JFBA 1A4UA 4PGMA 3SEAA 2QTVB 3WGKA 2D7DA 2FJ0A 3GR6A 4LJLA 3VR6A 3WYAA 4D4LA 4GNRA 3U4MA 2Q29A 1SVMA 1VP3A 5B1DA 4G01B 1B23P 1S4QA 2GPAA 5L3SA 2JCXA 3LX6A 2R6CA 1YWGO 5THXA 4B34A 4Z0NA 1M2EA 1W1UA 1ZNQO 2V3CC 1XMVA 3ZZUA 1DPGA 4DUYB 2TRSB 1ZL2A 1GPLA 1HDEA 2VQ6A 3DE3X 4LYYA 3IOYA 4MQEA 3WDSA 4CZ2A 3MWEB 1W49A 1NQTA 1XRNA 3JY6A 3KKZA 2M9MA 1G6KA 3DXZA 3E9ZA 3CNNA 1I6LA 3Q2OA 3NZEA 3D3QA 2CHUA 2HSDA 2IX9A 2MSLA 4QUHA 1B8PA 1CDOA 1BX1A 2G83A 3DAHA 4Y2TA 4OPMA 4CDMA 4ZCLA 2QX6A 4QQNA 3ZY5A 2BE9A 1I7PA 2HOQA 2HX1A 2ON6A 5JC8A 1P6QA 3H65A 3AHFA 5KDDA 2AN1A 2FP4B 2ZSKA 2I6XA 3A3NA 4XQCA 1EFVB 1GNSA 1NFQA 2JIDA 4RIEA 1JBEA 3VDNB 4I3FA 1E6WA 1HETA 1XWFA 1E2HA 4TM7A 3AYZB 3OE7A 4CUJA 1KP9A 2AQHA 2GOYA 4JX8A 1Z47A 3AEUA 4RTRA 4R01A 1I4TD 4Z51A 1PV1A 4M54A 3EPJA 1OBHA 4KO3S 3GLQA 1E1KA 1A9ZA 1Q7EA 3QJ5A 3FE2A 4UCFA 3TRKA 4CEJA 2C94A 3FUXA 1X38A 3EUWA 4GWKA 1SEVA 4K9RA 3C4QA 5A04A 4IP0A 2A9PA 2B92A 5LYYA 4QVIA 3O1HB 1EX7A 5K20A 2PDAA 1WU7A 1ZGJA 1JJBA 3BRQA 5AI5A 5IAAA 2E87A 2RB4A 3DAFA 1OHHD 1H1TA 3E9EA 3EXG2 3IUJA 3P4UA 5DP2A 1BHQ1 3EIQA 1QXSA 3FCSB 3VV3A 2IODA 4I5DA 3TZBA 4HMQA 2E7ZA 5G0SA 2Q3DA 3SZMA 4YV2A 4YYZA 1QFYA 5CDSA 2IYXA 2XRFA 1SUFA 5AI8A 5EPOA 4BNGA 4E15A 1RPZA 4JC0A 1UJ4A 3COJA 4WTOA 1C2YA 4RABA 2P1DA 4Z1MA 4MOWA 2HY7A 3P2JA 2LP4Y 2XVYA 1TZKA 1PFWA 2YV5A 5P8WA 3ZKAA 4TRRA 1GA6A 4FONA 4RORA 3SS9X 3NKFA 5H70A 4V1CB 5KMGB 2FG6C 2GKOA 1YKFA 1PT8A 3DOUA 4FDLA 4FNMA 2WPDA 3BS4A 3DFZA 3R09A 3K4HA 1RTKA 1UBLS 4OQEA 4QUKA 3W04A 5K99A 3PS9A 4IPTA 4JB3A 1QUFA 4JJ6A 3G68A 3I30X 4HOYA 2PE5A 2O07A 4XGKA 4B33A 1RFGE 4W6QA 5E6RA 1X7ZA 4TTTS 3B3JA 4ZU1X 3MRSA 4N65A 1EDOA 3MW8A 4U2FA 4MA4A 2IV7A 3U3XA 4AN4A 3EBPA 1KY2A 1YMUA 3LRXA 5HQJA 1GG2A 1HT2E 2DGDA 5HKAA 4A3SA 5EIWA 1C8LA 5EWMB 3A06A 4IDDA 1XD9A 2XBUA 1A9RA 4E09A 1IPHA 3VPGA 3LT0A 4INPA 4KGDA 2QD1A 1T9ZA 1GDDA 3DVAB 3NKLA 1GL9B 1RQ2A 3LLCA 4NE7A 2OZPA 2XVAA 5EZQA 1FB5A 5I45A 3CEHA 3QPCA 4RTQA 5EP4A 1F2VA 1U0LA 3QXCA 2WICA 1JEDA 1QDLB 5C7OO 2QAGC 2CYAA 1RBZA 4B5KA 4MQBA 4Y2RA 1TCCA 2J45A 4LKOA 1EI9A 3OX1A 1Q15A 4R69A 4XGIA 3EQ8A 5CBPB 1XTKA 4MB6A 1II8B 1TGYA 1AQIA 2XMQA 3K30A 1GP2A 2O1EA 4ABYA 1KMQA 2AX3A 1Q1AA 3M6LA 2IH5A 5HIJA 4C21A 4PRYA 4QT4A 2ZVQX 1SURA 1X14A 1CY2A 3RBZA 4EY4A 1Y4SA 3AL3A 2CL6X 3H1PA 4WW0A 3VOAA 1K3FA 2PZAA 4WXMA 5KWJA 4G2NA 2PRZA 5K3OA 1AO3A 5F1PA 3C45A 3TXXA 1EHYA 2WAYA 4F3TA 2ONYA 4IO0A 1AO0A 3BYZA 2MYTA 4CFZA 4JI2B 4IJKA 2X15A 3P7MA 4BTEA 1FF9A 3JVVA 2DX7A 3I01A 1O57A 2CHEA 4N47A 3NBQA 2XJ4A 3A9CA 5KYUA 3CF2A 4BQIA 3WJ2A 1E0KA 1O96A 2E9SA 3PC8C 2I22A 2JIBA 4F45A 4GECA 4R8KA 2A86A 3IAXA 3EZFA 1HTTA 4I55A 3EIUA 1DIGA 2A5LA 1SXJC 2G7ZA 3KFXA 3GRAA 4AMGA 1MJ5A 2EIHA 4MKGA 1JXOA 2ST1A 4QRHA 1PV4A 3NDIA 2I3GA 1AXEA 3QVLA 4LXHA 4PXSA 4WEQA 4XCXA 4DLNA 2CLDX 1RBQA 4G84A 4X3OA 3IELA 1MT3A 1W581 2DTDA 3PPXA 3BFJA 4CUZA 3OPVA 1OX4A 3E70C 1H66A 4R2KA 4X61A 3V2HA 1ATZA 4BDSA 4EDHA 3ZXSA 2D5IA 2FFJA 4JI7B 4XQ0A 4G65A 5JCJA 2ZI3A 5C52B 3GV0A 4FINA 3SC4A 3VUEA 3R3YA 1UDBA 3IEPA 2K5UA 4NV0A 1KTVA 4KVZA 4PBRA 1MZVA 3MFQA 3SY8A 2G1PA 3NGXA 3VYSB 2VH5R 4IDGA 1JHQA 2RBKA 3CLHA 2IYTA 1IRIA 1VA4A 2C2MA 5BYBA 1EEHA 3MJRA 2C8JA 1CQWA 5GZ3A 3HKDB 2JBHA 2Q21A 4UDNA 5C1IA 2GN8A 2VJNA 4AQDA 5MDHA 2C98A 4LRWA 5DTQA 4F5WA 3H7IA 4DNXA 5G1OA 4DLLA 3A1UA 3IAHA 3PWTA 2AOUB 3JQ9A 2CLLB 4PVDA 1GPBA 1YCHA 2IEBA 4D6YA 2WT8A 1OFGA 1Q3HA 2ZSBA 4JWKA 5I8WA 4KX3A 2VJDA 4H18A 2ZIXA 1VZ2A 3GLRA 5ALJA 2CEKA 3D3WA 3H9UA 1T5DX 1V37A 2ZYUX 4TWIA 2NSDA 2Z04A 1TADA 3KAQA 5KYKA 1PSDA 2CSXA 1TMGE 2PM8A 1YQGA 1ZJ5A 5E6SA 2P41A 1PR2A 3EH1A 1VTKA 4CWAA 1X9GA 4RJTA 4FDUA 3ZHZA 4NZ9A 4BVEA 3EMDA 1ADYA 1YNOA 3RTBA 1WBBA 1MGOA 1H1DA 4ZOQI 1NDQA 2YY7A 3HKEA 3HCPA 4C06A 3QFHA 3ZZ1A 4FGWA 2QQ5A 2EFDB 3HP7A 5E9WA 3SXPA 1NDHA 1JXMA 1L3IA 1Z4MA 1ZM4A 4X54A 3R7NA 5KEIA 2BFFA 3SCZA 4H7IA 4D79A 4Q4CA 2JC3A 1NV9A 2B9EA 4QQFA 3VNAA 5HX7A 4HAYA 3OZ7A 2P90A 1K27A 3NP9A 1XWIA 3LHIA 3VVBA 5I47A 3KVNA 4PSDA 5CTAA 1J0AA 3F73A 1MIHA 1IJEA 1NW8A 3STXA 2GA9A 4TTVA 5K3FB 4YCNA 3TH5A 2M6RA 4PINA 1M1XB 2FA9A 4TMZA 3SICE 4QOSA 2PUWA 4BKOA 1XXHE 2CC2A 2W6PA 5CB6A 1K8RA 3UMVA 5BQXA 4C5AA 1DKUA 1ZXXA 5CPFA 4M0MA 3TLZA 5BSMA 1VIDA 4HUQA 1IAVA 5AI4A 2OGUA 4GXNA 2Y66A 4ZDJA 2PWBA 1UC8A 3HA7A 1SCJA 1WCIB 2GJ8A 1NVUQ 1Q6ZA 4CQMA 2CJWB 4DM3A 1JT2A 1DAHA 1O58A 1D7AA 3Q3CA 1S8NA 2B1IA 4MMYB 1A1VA 2XGJA 2NVUA 1V9SA 1PUXA 1Q0ZA 4HK4A 4B6QA 4C7JA 1GAEO 4G1BA 2C8LA 4QQKA 5TGTA 3TRJA 4F91B 4W9MC 2Y27A 1P0IA 2IXEA 1EXDA 5KX5B 2REXB 1FP4B 1BOOA 2JZOA 2TMYA 2XX3A 4V0MA 1I3MA 4YRDA 2XLBA 1V4VA 1E2PA 3I9JA 3JQGA 2VK4A 1N0UA 3MBKA 3LZ6A 3KJQA 4OGFA 5HRUA 1AUVA 2YV4A 1Q3KA 3G8YA 3ZG6A 2LXNA 4A91A 1U2RA 3KQSA 4JC8A 1XQYA 1K97A 4B76A 4PY2A 2IYFA 1CR4A 1JB1A 4WFQA 1O9HA 3KHSA 4ODIA 3WBBA 2YMQA 3MRTA 2VDQB 3WSWA 1SUPA 3BTOA 3HXQA 4ZV4A 1L4UA 5CFMA 1ZVKA 3PYXA 1ID1A 3WMGA 1ES9A 5CDUA 4Y2QA 1ACJA 1AUPA 2QOEA 4Z3DA 3RD5A 3WYGA 1ILWA 2BBOA 1J0CA 4RIFA 2I55A 3A3KA 3LPLA 3QFSA 5FPYA 4Y1GA 3WAKA 4CL8A 3B6IA 2FMHA 3MINA 3QBDA 4YB8A 1FQWA 1W4LA 4YX9A 1E6CA 1KI3A 5CYFA 3GVHA 1U7OA 2P68A 1K6XA 2B2CA 1H3FA 2H4XA 4LJ8A 5EHIA 5TT1A 2RGBA 2GVZC 4RH0A 3HVRA 3H2HA 3GZJA 1W0KD 3N86A 3TVTA 1P0MA 1TO2E 4N5LA 5FI0B 3GFPA 3L04A 2PKQO 5C4MA 4CF7A 1WVMA 4BFTA 1FTSA 3GPIA 2ECQA 1CY8A 1YQ9A 3BIFA 4O4LF 1WXEA 5A03A 4L8FA 3C6QA 1A04A 1TJPB 3LUGA 3MTDA 3JQRA 3P9CA 3DV0A 3GLGE 2C1ZA 1YRHA 4RZUA 3RS9A 2D74A 4ROSA 4JBXA 2W2MA 1BSVA 1Q95A 1VCMA 1SVSA 1XJ0A 4FZ3A 2CXQA 5ABPA 1LW7A 1GRNA 4ZC1A 3T7DA 4PFKA 2KM1A 4RS4A 5HUJA 3UH0A 3D5TA 1EWKA 2J3IA 5HE8A 2QX9A 4IO1A 3RSGA 1VG9B 4INAA 4Q3AA 4GGOA 4RZXA 3TRDA 4B85A 5DLYA 4RTSA 3M3HA 2W6MA 1CR2A 2OORC 1FSFA 1GZDA 3EW9A 4YAFA 3IQXA 3FKQA 1X1SA 1VG8A 2E1PA 1N0HA 1Z4QA 5JXIA 4KJZA 1NF2A 3A9VA 2WHQA 2H85A 3TW8B 2WHXA 3ZI4A 4C4SA 5K3DA 1KJQA 2XZTA 4QLOA 3H2YA 4MQFA 1T3LA 4R9RA 4DZZA 3N3AC 3IKVA 4Y2SA 4N6NA 1OQAA 5ERGB 1J7KA 2J9FB 1H93A 3IP6A 1YE3A 4EG8A 3CU5A 5TVKA 2GN4A 1DIAA 1J8MF 2DC1A 4IQFA 4JSYA 2AFIB 5KYYB 4C0BA 4BTLA 3TBFA 3OTQA 4A0RA 3LY7A 2IUYA 3EOZA 3TDNA 2ZUUA 1CYDA 3AH8A 1I4EB 3CZCA 4PYIA 1SBHA 4CM4A 2QJTA 1KH2A 1VKRA 3K16A 4KDCA 3LRPA 5K3SA 1FXWA 1LY1A 1XAIA 4R2JA 3VH4A 4YUWA 4GBED 3K1AA 3KTAA 4LV8B 4OKIA 4I1YA 2FRVA 5AM2A 2IBSA 2NX2A 4S35A 4TT8A 1QH0A 5I9TA 1HDCA 4MCIA 3H4IA 2XD9A 2OBLA 4ZYXA 3VR2D 2R5WA 3NPAA 1WLYA 5AKXA 3AERB 3FBGA 1ECJA 4HS9A 1FDRA 3R7FA 2ZRBA 1MEOA 2SCUA 2F3UA 2UUOA 2W6NA 3CWCA 4NOJA 5DIFA 5JHGB 3SD7A 1NF8A 3QIAA 5TDHA 4K6GA 1UOQA 4OU4A 4F4IA 1ZWKA 2QAIA 4Y98A 3PKJA 1QYIA 3HL0A 4LECA 4M0UA 4RZ2A 2FRDC 4TMYA 4O8CA 1PGPA 3HK2A 2PXAA 3DEZA 3I5AA 4YRPA 4W5TA 2XXBA 3R3SA 1J21A 2JFOA 3HCAA 4RPHA 1G2IA 1LTKA 2GCOB 5IBRA 3M1AA 2FN7A 1R15A 5J59A 2BMAA 4MRVA 2AZMA 4NH4A 5GJBA 3ZGNA 2C78A 1RHUA 1YB6A 3LUBA 3HNOA 4F84A 1RKUA 2CFIA 3G3EA 4GR4A 2AE2A 2VF5X 1ABEA 5AIBA 1U8EA 1C4WA 1XCJA 3ACBA 3A70A 1TEZA 2V74B 1DAOA 3P0IA 4PCAA 4OBEA 4TQGA 2NU9B 3MJ4A 3ZD9A 1X8JA 1EVYA 2Q6VA 2ZRMA 4MR9B 3TIVA 4O2BB 2FUKA 3EEFA 4NMMA 3DCYA 5D6OA 1DP4A 3PNOA 1ND5A 1JFFA 2PX2A 3VR1A 4BU0A 2BPOA 3J7AC 3T41A 421PA 1BROA 1JEAA 4L15A 2VPZA 4R3UC 3ZWNA 4AF7A 4ZAZA 2XOEA 1G6Q1 4QGGA 2VXBA 1UPTA 4Y2GA 3G0BA 3V7YA 4F5EA 1JWLA 2WF7A 2W2PA 2WTNA 4LMBA 1R6DA 4LFCB 1YOBA 1S2NA 1Y9JA 4E46A 3EHEA 4V0QA 3TNYA 1UEIA 1WHSB 2P0AA 5E3JA 5M2QA 1JDPA 3GL9A 3QKSA 4HN2A 4P32A 3VDRA 5BV1A 3T1HB 1EIWA 2GQ0A 3H6HA 1FYEA 3DVQX 4QOIA 3MUEA 4GKJB 1QQ5A 4HDQB 3RLFA 1PTJA 3L4JA 3I83A 1C0LA 4IV8A 2ORVA 2KS6A 4PHTA 1TUGA 1XX6A 4AS3A 2DKNA 3MTJA 1BWPA 1UPBA 3OM9A 1JDUA 5FNVA 4DEXA 1Y4AE 2BF4A 3SX0A 1MMFB 1KNQA 2Z58A 3PXBA 3U4IA 4LK2A 1EA7A 5CT4A 5BN4B 3UGQA 4ESHA 1DO0A 1NIJA 2QM8A 2PRIA 2Z6VA 1H9CA 2P9TA 1MG5A 4GT1A 2FLKA 3W8DA 4JUFA 3TLYA 3PE3A 1FZQA 5CB8A 1T9KA 2WNSA 4YI5A 1GNQA 3DMHA 3E1SA 4IXNA 2HKIA 3I0ZA 4TGLA 2IUEA 4R2LA 4C3UA 4C6TB 1N2ZA 4EO7A 2IIQA 1ZOIA 4MUNA 1DARA 4EPWA 2WAAA 5JXHA 1B15A 3Q5EA 4FKBA 3JVEA 5DRTA 2HI0A 1X87A 1DOZA 5EUMA 5EQFA 1M74A 1NVTA 1X7GA 2C96A 5E2IA 3VOBA 1EDDA 1XYYA 3ZKWA 5IBQA 3O31A 3E23A 4CL0A 3BUSA 1NLZA 4AL4A 3VA7A 2E49A 1FC0A 2Z1DA 4BE4A 3G0IA 4WNAA 5EYPB 3WYNA 2UXDB 4MVJE 2Z4RA 3UQZA 1WKBA 1RYYA 4OLJA 1C3VA 3C39A 1I7NA 3V8BA 5LQUA 3ZGLA 2B61A 1L4LA 1TZMA 3D4NA 1SK8A 3WIUA 2R47A 2IJGX 1MLDA 2YWHA 3DZGA 5AK6A 5CG2A 3NNDA 3OD5A 2G08A 1FUEA 4B6GA 3M4NA 5ANRB 4FZVA 4L8VA 4R4JA 4X7BA 1LFAA 5EQJB 2EKQA 1BJKA 3U62A 3PGVA 1PDWA 3F90A 4KXXA 3TLMA 3UTDA 3QKRA 4D44A 4TQUS 3SEZA 3JQ7A 1G20E 4QHSA 5A4DA 1Y5LA 2IE8A 4FFSA 4M21A 2XZDA 4YP0A 2HA5A 2FUG1 4BIMA 3KV3O 2FPSA 3PX3A 1E6LA 1FVFA 1TIKA 3OOWA 3J81k 1MB2A 1J42A 4FQ5A 4JIMA 5I7VA 1W36C 3X2SA 1M0TA 2FZLA 4KPEC 4IIDA 1YQWA 2DR3A 4TZTA 4BE7B 4G8CA 3WHPA 2UYYA 2QRUA 1CY1A 4NMXB 5LB4A 4ER5A 1RI3A 4R8SA 4LJ7A 5HPYB 5JZVA 5KJ1A 5KOHA 2P6PA 1S1CA 2QLNA 4K28A 2ZSUA 4XOIA 3W5DA 1AGRA 2OYSA 2ZRQA 1BS2A 1EM8B 2F8SA 3OOYA 4IHJF 2Y67A 2OLKA 3ASZA 3E82A 4QTYA 3NC1C 2I29A 4ZXPA 2HJGA 1OA0A 2NUTA 2L18A 4RV9A 5H5JA 2EP5A 2PKWA 3MGAA 1G98A 3M5CA 4BNUA 3OQMA 3DHEA 2HXSA 4UAJA 1GNPA 1ZN9A 1FYDA 1G0NA 3DL0A 4UNNA 3PXAA 1Z13A 1QHYA 1U8CB 3JWHA 3LA8A 5EG5A 4KRGA 2VDWA 4P3OA 3DC7A 1K6MA 2GD1O 1IY8A 3IAS6 3FPJA 5ED0A 3V7UA 2W43A 4E5UA 3CG4A 3MCVA 1CEYA 3O03A 4P33A 5JQGB 2Z6AA 5T5QA 3MWDA 2Y1XA 2WZDA 2HA4A 3AEQB 3TTTA 1CUYA 2YXEA 3AVVA 3FKJA 3S8EA 3WQSB 2DECA 2PGJA 4JI3B 3U80A 3UGJA 1Y6QA 2OZLA 3FI0A 2PGAA 5HILA 4QPZA 3TIGA 3IB3A 3GXOA 5HJEA 1C2TA 1C4OA 3IMEA 4F46A 1HNXB 1Z37A 1AQ6A 1DVRA 1W29A 4UREA 3V1KA 2FE1A 2ASVA 4R6WA 4YRMA 2ZANA 2BJVA 1HE3A 5DHPA 1Q5PA 1I33A 2B1QA 2PL5A 1D7OA 4IOMA 1DHRA 1KI4A 2DERA 4DC9A 1RYBA 3ZLUA 4CF3A 1OX6A 2D0PB 4A0QA 4C4ZA 1AOXA 3HB5X 2PZLA 3DPSA 3T7EA 2PU7A 4WFJA 5FBWB 2ZBEA 3CY6A 1F8GA 1H3EA 2JGEA 4PPGA 2AOWA 3GA0A 1Z5OA 3H11A 2PLFA 2J6BA 3TGLA 4LDQA 3TQSA 4C7OB 4GXTA 1Y8AA 4BAZA 2YZ2A 1DRKA 2CNKA 2I71A 3TIIA 3GG9A 1YL6A 3GLSA 2C8KA 1R5NA 1WKCA 5KOJA 2EJWA 2P5TB 2E4XA 2XCIA 3LC7O 1O94C 4UFPA 1F2UB 1FCJA 3CSDA 2QL7A 3FETA 4ZTUB 2FEMA 2IHKA 1E3EA 3HTXA 2F64A 1GITA 2W2LD 5IAOA 2P6RA 2X3FA 4GL4A 1VRCA 3UAOA 2YZ7A 3BQMB 5B58C 2PG3A 4TKUB 5TJHA 1GUZA 3O8OA 3MCZA 1XYVA 4JEUA 5DRYA 1LTHR 4EGSA 5CFOA 2D6FA 1QTQA 1TMOA 3FPHA 3T52A 4DTCA 3UWDA 4M8SA 2CZQA 2GBFA 1PJSA 4RF4A 4WA8A 2XMBA 4BZWA 1AN0A 1FNCA 5EVCA 3RRNA 1B14A 3ZCPA 1GARA 3HWX1 1A96A 5ALIA 5ENVA 2ZYGA 2BCJQ 4AY2A 1IU9A 1YR1A 2IZ0A 3ZV6A 3I2HA 4L51A 1XB2A 2YIDA 2SKCA 4YPVA 3N74A 1NW6A 1OYWA 2Q2VA 3H2IA 4HC4A 3TUIC 1GZSA 3I05A 4JLNA 5JNWA 3VR4A 3CBQA 521PA 1FP2A 1PJTA 1S8OA 1VE1A 3GVXA 4QXPA 4DR2B 3TFQA 5HF5A 1CZKA 1TJ5A 2WWYA 3MAAC 2CB9A 1DBQA 2XF2A 1MX3A 3HYTA 3RABA 5CB4A 4WZZA 5I01A 4TL6A 2NG1A 3AB8A 4QO8A 1JI3A 4BNNA 8GPBA 1A9OA 2OSBA 3QVSA 2D06A 3AHEA 1IG3A 2A1IA 4MGYR 3VU1A 1DUSA 3QLUA 4BIIA 2G9RA 4OQXA 5LYJF 1W4RA 1E7MA 4JJFA 4QD3A 1E0AA 4DMLA 1UCFA 1T3HA 1C29B 1E9DA 1GPH1 3L7MA 4F9TA 5K0GA 3DDHA 1VJ5A 4EY5A 3I12A 2X9QA 1AMNA 3K73O 2DKOA 1RXCA 1AUXA 1ZK2A 1DG1G 4ML3A 2CVFA 1R0XA 2ES4A 1T36A 4P4SA 2VJQA 1B42A 1NQAO 2BFBB 3HMKA 3I0NA 1MAAA 3DO5A 4G8DA 3SP1A 1DIRA 1JHAA 3AP1A 4O4HF 1OYOA 4NENA 4DSOA 3BMNA 4LC0A 4CM6A 1Y3HA 5ADWA 4IKOA 2GBLC 4Q66C 1US8B 4RIIA 4N0EA 4KWCA 1L5VA 1XDWA 4JQCA 3QYPA 3LL4A 1EA5A 3JTMA 3UG6A 2PXCA 2A1UA 2GXSA 5KYVA 5C8YB 1NMEA 2IHNA 2GZRA 3RIXA 4RHFA 5L95A 5CURA 3F1KA 4QJBA 4EYGA 4RJLA 4RQUA 3OKPA 2QTAA 3PNMA 2VXOA 3W3ZB 1KEKA 3BWDD 1IFXA 5G3YA 5AQEA 2CNNA 4LEIA 2WFLB 4JBIA 5K3BA 1I1NA 4EUNA 4HD8A 1GPDG 2DQSA 2HR1A 5TGDA 4L0DA 4ME6A 3G2KA 3TQRA 5IH7A 1PN3A 2CV1A 1SQGA 4ARIA 2JAOA 3R9XA 1H2BA 3FVQA 4JROA 5AJHA 1TU4A 1NOJA 1RRMA 3AK4A 1TMKA 3QOWA 2FWAA 3VR0A 1L7XA 3E4DA 3SHQA 3QBTA 5E1DA 1JSZA 1NXVA 4B3HA 1E2BA 2R8OA 3LGXA 2IVFA 1XMOB 1N6IA 2P9EA 2O8CB 4JVLA 2JJ2D 1RC1A 2YZMA 1PR6A 4MAAA 4P7FA 1SMKA 1FSGA 3ESAA 3KZMA 5DWVA 2P7IA 4DR7B 1L0BA 2NTJA 3HI4A 4FDAA 3D4IA 4YS6A 5F12A 3ZWMA 4KPYA 2NAPA 2H2IA 1VPLA 4Q3LA 2HJSA 4WLUA 4HGQA 4Z86A 3ZX5A 3PRYA 3D4LA 5LM3A 3K09A 3RSQA 4MUMA 5IEBA 3H16A 2IP1A 5DK6A 3T7CA 4UXIA 1XWWA 4E2YA 1L7BA 2VATA 1RJDA 4HG2A 1VI6A 1X13A 1WUYA 4M0EA 3RWBA 3HRHA 1S89A 3LVRE 3SNHA 3QXHA 1UQUA 3CUTA 3EWSA 4FHGA 1CRZA 1ZITA 1Z4IA 3VTFA 4ZEVA 2ZU0C 3DHYA 3Q1LA 1YRWA 4GSYA 4DY6A 1Y7IA 5BMOA 2GYWA 3PXUA 3KEOA 2V7UA 3SYMA 1KAGA 4WBXC 5U1PA 5E9JA 2X5NA 4PIPA 2Q4EA 1Z0SA 3TPZA 3VGJA 4YCLA 2FDXA 2JI4A 1KHHA 3KYIB 4N3NA 1AGYA 4NL4H 1UZNA 2YHIB 4K9PA 4H77A 4UTRA 2A1TR 4H0CA 4CMIA 1XEFA 3BH7A 5AKKA 4PZEA 3DQZA 1LI5A 3ZZMA 3STWA 4F3YA 4PYMA 3FNQA 5FA5A 5TPWA 2JAXA 3NUQA 1N33B 4UOQA 2XSZA 5ILGA 1L8QA 4JUIA 2EQ5A 2CVOA 2V4UA 1H1LB 1O2DA 1CQXA 3JD3A 2B1RA 5CNKA 4TYPA 4K03A 5JSUA 3EC7A 1G291 3G6KA 3GNQA 3SXUA 2CUNA 1WB4A 3FCOA 1B8UA 1LBHA 3LUFA 5CHEA 4Z0HO 3KJHA 4LJSA 3U19A 5DOZA 2LCIA 5FTLA 3M82A 2NPFA 2JHPA 1PFGA 3IOBA 1XT6A 3LECA 2B1JA 2J9RA 3MELA 4QATA 4RH3A 4Y2JA 1E1QA 3HDTA 4X62B 4LDPA 5F4ZA 1VKHA 3UCEA 1FSSA 2VNHA 4DA0A 4DHWA 3KCNA 4N76A 1OR8A 4O08A 5CUQA 1BX0A 1C80A 1DEHA 4BO9A 4JC5A 1E9CA 1CIPA 2O8VA 5JZBA 2C9DA 1XCGB 2D7CA 2IDKA 3GN1A 3PUHA 3PUJA 4Y9SA 5K4GA 5KKNB 1FMFA 4UNRA 1TD1A 3CN7A 2P3SA 2ZBRA 2RAVA 3EXFA 7MDHA 4U02A 3B48A 4A8TA 1SY7A 3HJHA 5FYDA 2VRNA 3QU9A 3VDXA 5IZ4A 3CUKA 4BLOA 3NTXA 3CLSC 3WMXA 1QS0B 1ZMRA 2OK8A 4WZBA 3HEAA 2A58A 1NULA 3LIPA 3MYYA 1CUWA 2BI8A 4JAVC 5AHRA 3W3AD 3HFGA 1DCKA 3PQ5A 4JJGA 4RIGA 4DT1A 5CMLA 5JXGA 1CJSA 1J06A 1U1FA 3EQ9A 4U5QA 1VL0A 3BRSA 4EG0A 4XJVA 3PFGA 3VZCA 4KITB 4Y18A 5ICMA 1NTRA 3AF2A 1SXQA 1M0EA 1AKEA 5TXGA 4PVCA 2P1ZA 3F3KA 3GUYA 1E9BA 2GRUA 4LVNA 3IVAA 1QC5A 1P19A 2G9UA 4K81B 4R5HA 1Z5VA 4RPIA 1BXGB 4JMLA 4ENPA 2OZVA 1Q2XA 3STYA 5HBRA 2V7BA 1UXHA 4XSVA 3UVEA 4UHBA 4PLCA 5A02A 5BMVF 5A62A 3V80A 4UATA 2B78A 1VGRA 1W52X 1PZNA 3MYRA 5CEFA 2A3NA 2QRHA 3QV1A 4AP6A 3OCCA 3TEMA 4FFMA 4M9RA 5KKCA 5TR9A 3A2LA 4NEHB 2I4OA 4PC1A 3IP5A 1XELA 2NTYC 3HN6A 1SOMA 5CR9A 1KY4A 1XZJA 4Y6SA 1E3WA 5AM5A 4GPAA 1G8PA 4OOEA 4QYXA 1BH2A 4MUJA 3N2EA 1X1QA 2XZPA 4IEFB 4LZAA 3I37X 2OOSA 4N5NA 4WKPA 4MO2A 2CXUA 2VWPA 5EHGA 3VH2A 5LMZA 1N5IA 4XTRA 5EJ4A 5EL0A 4HXFB 1OHHA 2F1HA 1XI2A 2VSOA 5HHTA 4FB4A 5M29A 1GEEA 1P73A 2YW9A 4KXLA 3WLOA 1NNEA 1A7JA 2HPAA 2VZEA 2ZVPX 2ZYWX 1PL8A 4Q48A 2FSVC 1KKUA 1L5HB 2PQMA 4O4LB 3SX4A 3T5DA 5CLJA 1ULAA 1NWCA 2RBGA 1H05A 3EXHB 4U2KA 2GUWA 4KPFC 1JHDA 2IV2X 2HW8A 3L4KA 2PBFA 2CLIB 4EKDA 5JPDA 4F85A 4G1MB 4GICA 1ZK4A 2QUIA 4F86A 1UAGA 1T3ZA 4ZT3A 3LXXA 1D4AA 5B6IA 4CDGA 1ZJZA 3KRTA 4WZAE 5CCBA 2EW1A 4WK0B 3HVHA 4NJOA 5EKUA 1RIFA 3PZBA 4NZYA 1UBFA 2XI4A 4MZDA 4Y30A 1NVKA 2EEZA 3WKEA 3R4VA 1ZJ6A 1N2IA 2VZ9A 3LGSA 5K51A 4E30A 3HRIA 5KNCD 1NLMA 4FYKA 2Q7XA 3MTGA 2M6KA 1NNSA 1E89A 1WPXA 1YQTA 2GS9A 3R77A 4QYTA 4RA9B 4EJSC 1Q0RA 2GN0A 1RHQA 3H84A 1T3GA 3PV0A 4CIBA 3AU9A 1L3CA 3MRXA 3GT7A 2CWWA 2I99A 3KU4A 3ZPXA 1JQBA 4ZYZA 2VR1A 3SE7A 1C7QA 2HB6A 2V6BA 5KOYA 2G71A 1Q1BA 4DR4B 1V39A 3P9KA 4PLHA 4PO3X 4NEQA 1KDVA 4ZI7F 5LZ7A 4MMXB 4MV0A 3WAJA 2HIAA 3IE1A 3WL4A 2G1AA 1VXRA 1D8TA 1RXIA 1UMCB 2AJLI 3KZVA 2Y0DA 1UODA 2WUEA 1TZCA 4NCJA 4QBGB 3VMMA 4CHTA 1RIIA 4ATNA 2J3DA 1NA5A 4QGSA 1OUMA 5ALZA 5BPHA 3AM3A 3O9ZA 4EVIA 1H8ED 3A14A 4RKQA 4MVJG 5JVDF 2VVTA 3VJKA 4AAYA 2I3ZA 1HG0A 4O1HA 3QGMA 4H3SA 5AK5A 4C6RA 1IULA 3IJ5A 5GADl 3OA2A 4B71A 4CM3A 1WEHA 3VBEA 3Q7PA 2D1SA 1ZH8A 1QBKC 3NWBA 2J46A 2FPPB 2I54A 1J8VA 5HF8A 4DS3A 3ACDA 4RW0A 1QHHB 8LDHA 1KXZA 1ZJWA 1Q16A 2BT4A 2JK1A 1KO5A 1AQUA 4RANA 2IUTA 3HUEA 4YY3B 1YF3A 4KQ2A 5G40A 4X3CA 3QVTA 4FTWA 2BR5A 1RLIA 2DM6A 4ENVA 3UK7A 3V8EA 2XA9A 3Q7TA 5ILQA 1PJ3A 2QZPA 1RQRA 2XIQA 2O3UA 1VPWA 2WJWA 2Y6VA 1JR4A 4URHA 5CXXA 4KR9A 4TV9A 3ED1A 3A4IA 4FOSA 4B3XA 2C95A 3PHJA 3TSOA 1CXZA 3CSSA 4BXOB 2G5CA 1NM5A 1HKUA 1MVLA 1U8XX 1UP7A 2AXEA 2MHCA 1T5BA 3ET5A 5KVQA 1IB6A 1GG8A 4IINA 1RHRA 4X90A 1I1QB 4BCBA 5JRDS 5AVJA 2NP6A 1MGPA 4LS3A 4CKYA 3Q98A 4CRWB 2H7YA 3OMLA 1SR8A 4R7ZA 1KYYA 3GD7A 1OIVA 2QLLA 2O59A 1C3LA 3QPDA 4DUGD 1A7UA 1HFJA 1L7PA 4BX9A 1XKXA 3ETDA 4QPCA 1U6JA 2W7TA 4EHAA 4RV4A 3LOQA 4S2UA 2ZROA 1ESCA 3BGVA 4FYIA 3W5CA 3VSAA 5M5BA 3B5EA 2QS9A 1A8IA 5LR6A 2DBVO 2HLPA 1ZNYA 2W98A 1X7WB 4WEOA 1KFBB 1HT0A 3H0CA 1BVUA 1PIWA 1R9JA 3HO6A 1RSZA 2NUBA 3O3NB 4EAQA 4Q82A 3N1UA 3GEDA 2OD2A 1L4HA 2V0NA 1FPQA 1XZIA 4Q0MA 2PJDA 2B35A 4P31A 5JRZA 2YRFA 1WZNA 3V7FA 1BVRA 1SCUA 5GGYA 2Y1GA 3A7DA 3M3DA 3L6UA 3DD5A 2QRJA 4N5DA 3PF9A 4PLWA 1N2HA 1PJ2A 1RHJA 4GPIB 3KDSE 4M86A 3IURA 4MVJI 4RPGA 5DHAA 3W5IA 2BHTA 3OEYA 3RSFA 4ZHQB 1H22A 3FF1A 2PSSA 2XA1A 3E9RA 4NE9A 5I7EA 2PKEA 1L4BA 1FUYB 2UZ1B 2O2DA 2RHMA 4RK7A 2OGWA 3EXG1 3HSSA 2NU6A 5MF6A 4YR7A 3GUCA 3UMGA 1O0CA 2V7GA 2YFYA 3N59A 1RYHA 3S40A 4D0GA 4HATA 4U7FA 4EMUA 2P6OA 3QKIA 1RZVA 1IN8A 2Q5JA 4UMFA 4A36A 3BBLA 4KLZA 3W4IA 5JZSA 3SE0A 4BP9A 1BO6A 3WADA 4F8JA 2IV3A 1JGTA 4DA4A 5AHXA 4Y6PA 1ZG3A 5JMWA 2IS6A 4DXHA 1U7WA 4OHXA 1CLEA 4G6ZA 3PFFA 3GFBA 1JQDA 1UJ2A 4WKBA 5BV8A 1K8ZB 4BL5A 5JAUA 3UV3A 2K87A 1PEKE 1X7XB 4URVR 4HCJA 3H5LA 3TQCA 5LA6F 4QREA 2QI9F 1TYZA 3ITEA 5EQTA 5HJ5A 2JH8A 1UKAA 3ZEIA 1ITZA 1N8TA 1AS3A 2F62A 2GF9A 1VL6A 3JYLA 3TX2A 2VDMB 3VKHA 1J25A 1E7YA 1NZFA 2OV6A 3OG9A 3FPEA 4NE2A 3SC3A 4YXWD 2O8DB 3N5CA 2G07A 1P2SA 3FDIA 3SHWA 3DMYA 2J31A 1SG9A 3BL5A 3E7FA 4ZRDA 4B6EA 3X1KA 1RQNA 2CUZA 4ZKDA 3UFXA 4P3KA 1TF2A 4BNMA 3AEKA 3WIBA 2VJMA 1UBTS 2CDBA 3AETB 3VR3D 4ZZ1A 2H9YA 4G8JA 1XEXA 4A6PA 2ZUWA 1RAHA 3KVOA 2VP6A 3GF4A 4YPOA 2PYZA 2BZ1A 2CBXA 2XODA 4MJXA 4BX3A 10MHA 1Y5NA 4LY3A 4MYHA 3RJTA 4A03A 2CXRA 1O3YA 4F2WA 4DBZA 4RVCA 1KI6A 2XB9A 4MPTA 5L4LA 4YONB 3P2OA 1S7GA 2DQZA 3CV3A 1A82A 5CD1A 2V45A 3QOXA 1QFZA 4G4SP 2J48A 2X7JA 1ZHFA 5HE9A 3NEYA 2O7VA 2H4ZA 1FFCA 2ZIEA 4N12A 4EAAA 3AV3A 4N18A 4Z54A 1BTOA 1BN6A 3OFJA 1I1OA 4I1VA 2WJPA 2R8BA 4MROA 3F5FA 2A7QA 1EP2B 1I51A 3HCRA 3NXKA 3OBBA 4IHJB 4NEGA 3EZ9A 2O0JA 3S7ZA 1ONBA 2P2CA 4RMHA 4B79A 1AKUA 1N5DA 2PX0A 3CW8X 3L93A 4U4AA 1YGYA 4P2BA 4B84A 2SKEA 3U7QB 1ODSA 4EG1A 5IU6A 3CNLA 1XALA 3QU2A 1SQ0A 5B2EA 5FPPA 3KTDA 1N6OA 3KHKA 1DMRA 1SKYE 1K6JA 1SZCA 3GBVA 4S3MA 5CA0B 3Q40A 3E9MA 1GA1A 4GC9A 4L9RA 1O97C 2EZTA 5D00A 2XGOA 3BE8A 3TQOA 3OLVA 4AMVA 2H4FA 1JVSA 1DAEA 1N9KA 5KWIA 1GG9A 2YQ4A 3HLKA 4WOBA 5KVAA 1DNPA 3LL7A 3VPFA 4KU4A 4KXQA 5AW1A 2XQIA 4BLPA 5CXSA 3A0UA 1ZOOA 2OHGA 5GPBA 2HDHA 3E22A 3QY9A 4G1FA 1QYWA 2BJHA 1EFCA 2QI9C 2GK4A 4Q3EA 4B80A 1NRJB 3HWRA 3MERA 4M1YA 5ALFA 2ZYSA 4E2XA 2HTEA 1CD5A 1XQVA 1U0FA 4I9UA 5DT9A 4G5RA 1FMCA 3JZDA 5LFAA 3KT6A 2QNBA 3UT6A 4GZLA 4LY0A 4BEWA 2QB5A 5HYVA 3FOZA 4CLXA 3H5VA 3MWLA 1MG0A 4E6EA 5FQNA 3TI9A 1LRLA 1CJKC 1ORIA 2IOQA 4DCUA 4JKYA 1W0KA 1IE3A 2V1UA 1SAYA 4ZREA 1XNJA 1V7PC 3S55A 1FS6A 1V71A 2Y2VA 3EGCA 1HLPA 2XYVA 4J0FA 4MQ4A 5F77A 3QYAA 1G4UR 4KK3A 4QX6A 1JSRA 1WY5A 4XCVA 3RS0A 4DMKA 1WMAA 1GFZA 3WLSA 1MW8X 3RUFA 3RQSA 4MUKA 2X1LA 3UJAA 1NN5A 3F4LA 2UXBB 5WRFA 2Z1MA 2IEZA 1IUOA 4JUDX 2V03A 3BG5A 2ZJOA 3OZVA 4FR2A 2MMCA 4TOIA 3IMKA 2QDXA 9ABPA 1UMDB 4XDYA 3OT5A 4HAXA 4RVOA 2GARA 2UVDA 3IIKA 5FOUA 3KEGA 3RS2A 1SB9A 4JJKA 5JCOA 1YA6A 4NNOA 3CHYA 4NI5A 3H9CA 2HSGA 3VMFA 2G9VA 3BOSA 3DBRB 5H3HA 4KZKA 1VHDA 2GJSA 4P84A 4LE2A 1GFIA 3H97A 2WM3A 2EATA 2QUJA 1Z88A 1QZ3A 3B5JA 4IIYA 4BZQA 1M1NB 3PNBA 3DFUA 5FRDA 3ZDZB 1Q22A 3K1TA 1W48A 3M5WA 3OCXA 4B2PA 1SQFA 2WTUA 1PQUA 1KZ1A 2BSQA 3LYHA 1IXYA 3O8DA 1ZD3A 3QPBA 3P9PA 3TVYA 4B3BA 3HB4X 2WUGA 3DMTC 4RAQA 2HT6A 3FN4A 4JY7A 4QVGA 1G66A 5HS6A 3SOZA 2IWRA 4FYPA 3CIOA 3T35A 5IJ9B 2FSSA 1G0OA 1X39A 1QR2A 1R0KA 3OCUA 4H4CA 1P44A 1TM5E 1S1MA 2UVQA 1WW8A 3CZAA 3NV9A 1W2GA 1CY7A 1NOIA 5HTKA 1DS6A 4MW1A 3ZS8A 4QKQA 4N5IX 3R7DA 1FX0B 3FNGA 3E05A 1AKTA 5DBEX 2FV8A 4UU8A 2Z4SA 4O6VA 7GPBA 3AF3A 3HYRA 2C7OA 2X77A 3QU5A 2JDID 2WJJA 3NXSA 1YUBA 5L3QA 1UKEA 5JO0A 3VR2A 1V96A 4HEA6 1IH8A 2YDYA 4XLZA 5JLAA 5LYJB 4ZPXA 3B6MA 5KAMA 2B8NA 3G89A 1J99A 2QM3A 4G24A 4HO1X 4A16A 5IT9A 2F17A 2JFWA 5DI3B 1N8KA 5GZ1A 1SXJE 4PYQA 1NGSA 2FEWB 2QMUA 3WICA 1D4ZA 1NHWA 4DV6B 1C1DB 2W8BB 1NP3A 3OY7A 4GVLA 1FMJA 4RD2A 2GHQA 4JXKA 1XCLA 4D45A 3MWKA 3X1WA 1MX1A 4O4HB 2OHHA 1O03A 3DFKA 3LKVA 3CEMA 4QGAA 1GQQA 4JQZA 3TNDA 4JIGA 3WO0A 4C0HA 3AVXA 2ECOA 3MWYW 4O4IA 2GK3A 3KQHA 1E8DA 4LHXA 3UJ8A 1PF7E 4Z49A 3RE1A 3OCWA 1E4YA 1Z0DA 4KPUA 1HFEL 2UZ0A 3RU2A 3GAAA 2D5CA 1U3GA 2QJOA 1RWPA 2QYTA 2FFQA 4ECEA 1VPEA 4OGKA 2FCRA 4MDHA 3RPEA 5JAPA 2BMFA 1YU9A 5F7JA 1VG0B 2K2WA 3MB8A 4PZ9A 3UV6A 2Q3HA 3D8UA 3PD7A 1WXQA 1EBFA 1EWTA 4PE5B 3QP9A 1GYPA 1JSCA 3H8SA 4RHEA 3USES 1SRQA 3GC6A 1VGQA 1W4AA 4NC9A 1VLLA 3N0WA 2D1RA 4OFBA 3C6BA 1IBMB 4X7PA 2V4MA 3PEUA 2NU7B 2JJQA 1S2IA 2QN7A 1Y63A 4O5AA 1MRSA 4JBNA 1Q21A 4PGGA 2VHWA 1DQZA 1L4NA 4XDZA 3BE6A 3SLKA 2I87A 2FDCA 2P91A 4G9BA 2C7QA 1XZDA 3VZSA 2HBYA 1DV1A 1FMLA 1HT3A 3T1QA 2H92A 3FYUA 1P0QA 3ZXYA 1VHQA 1G1MA 2P2SA 4OBBA 2WJGA 1UJMA 2ZCVA 3A9UA 3DBLA 1VBMA 2EX1A 4EELA 4LYAA 4QNMA 1SUCA 3AF6A 2E4UA 3ESYA 1E2MA 3JD0A 3NWJA 4I4LA 1JXQA 3TTVA 4DA9A 3CZRA 5F2OA 3IR5A 2YZKA 2D1YA 2C7PA 5LPNA 3BHMA 1NJSA 3TTXA 5ESDA 3L0PA 4KTVE 2ZIAA 1G55A 1EWVA 1E1RD 1F2TA 2GBPA 3QWBA 3W34A 2C9YA 3P2EA 4L72A 4DG9A 2JIOA 5K8TA 5LDHA 1C7FA 4YXFA 2GAOA 4PNEA 1ZXBA 2ANBA 5A7HA 4K9QA 1R88A 3GLHA 3B1JA 3Q9SA 3OUTA 4PYRA 1Z12A 4GMXA 4QU0A 2PX3A 4LTDA 1KEEA 2H48A 5DYGA 1SOVA 3RF6A 3U7RA 1JEQB 1CJCA 3K5HA 3H2ZA 3OTWA 1X7YA 2VHJA 4LX0A 5E7IA 1C3JA 1P2BA 3A6LA 3EEBA 2AIRA 3FYHA 1XCOA 1M5UA 4HNVA 1N5MA 3DPIA 4LNAA 2BMEA 1J09A 3W8RA 5FFMA 4JX9A 4XH9B 4ZO6A 3IIEA 3I2GA 1CF2O 4D46A 3SDBA 2Z83A 3QOYA 4XEUA 5CHYA 3X0DA 3LPAA 4OK6A 2AOVA 5FPQA 2VPIA 4DTIA 3OZWA 3VTAA 2V58A 2YMLA 4H7EA 5A2QA 3IEVA 5DHFA 3B8EA 4MEAA 2DE0X 5KTPA 2Z08A 2OILA 4YREA 3GJRA 4OX9B 4F6CA 3QY0A 4H3KB 4LDNA 4Z4EA 3K8ZA 3A9WA 3FMVA 3HB1A 1GU7A 4CQMD 3U09A 3ZVKA 5AW2A 4URZR 3ZDDA 2Q1XA 1H2EA 3LF2A 4H59A 1QJCA 3DSRA 4QBIA 3W5JA 4CR8A 4D96A 5EQDA 3X1XA 1Z2OX 2OD9A 3E7XA 4OYLA 5FDFA 2YJNA 3EISA 2B7LA 2J3EA 4WN3A 1Q2UA 1XHLA 3VR6H 1HDZA 4RFLA 5JWHA 3PTAA 5TY0A 3L92A 3M9LA 4Q4JA 1BXKA 4X1IA 3HR7A 4AG6A 3WWDA 2A5FA 5C7IO 5J43A 3G0HA 5KJCA 2P4SA 2AMFA 5K8JB 4IVQA 4JVOA 3DEKA 1J8FA 1JG2A 1L8LA 2XQFA 3ETLA 4XYLA 4X6LA 5CM8B 2DTXA 4EG3A 4K8OA 3S8YA 3WL8A 3GP8A 2V54A 4E5PA 4HDSB 5BV7A 1W34A 3FCUB 3NG1A 3CINA 3H99A 4EGFA 1V16B 4POAA 2E55A 4DDHA 4LCJA 4YJ2A 3ZD7A 4G56A 1TYCA 1D07A 2IP4A 2GHRA 3IMGA 1LPMA 2CL5A 4RWZA 1MEEA 2JFUA 2I8LA 3FUUA 3PFNA 5EXXA 3VU3A 3C6ZA 2A88A 4P93A 2R7KA 3PENA 4XXHA 3MBIA 4PRZA 4IZIA 5EWJB 3E9QA 3ZLBA 3EEOA 3OQOA 5E8JA 1JA1A 1LPOA 4D4GA 2CVPA 4GMGA 2IZ7A 3FUCA 5DCWA 2AFHE 4ZVUA 4HNAB 2PKQP 3GJ5A 4JXZA 5PNTA 1DXOA 1D09A 2FPMA 2VS1A 3N6VA 4HFJA 5AHKA 1NLFA 3BF8A 4C6HA 4D9KA 4QG3A 3H5NA 2W2KB 3TOVA 4HV4A 3UHJA 4FSXA 3QFFA 2FF7A 5THKA 4BFVA 4W5QA 4OJKA 2O3QA 1H4VB 1RYFA 1C9YA 2V0CA 2ZT7A 4PZ0A 3EDOA 3UFBA 2NMVA 2OD7A 1E2LA 5DW3A 3SMVA 2Y0EA 3QHQA 3WYBA 4B3CA 4JXJA 1NX9A 1Z0ZA 5AKLA 5JMTA 2DETA 2PL9A 4L78A 2DF8A 3CS3A 4RK1A 1YACA 2F43A 2NV2B 1N2XA 2MIIA 2OXCA 2FPGA 4ESEA 3ELDA 1X2BA 4A0FA 5DISB 1B41A 2BLNA 5CLQA 3MGCA 4DR3B 4BB6A 2HDNB 5HRAA 1UWCA 4F92B 2KQUA 3LUPA 5AKJA 1DXQA 1GUDA 1JPJA 3ERCA 2PA3A 3SIPA 3SQWA 2Q5FA 4DQ0A 5DHSA 3U7HB 3Q9NA 3CKMA 3ISJA 3GLFE 2XUJA 1U98A 4XB2A 1FQKA 3GPCA 4LI0A 4NBWA 1RXUA 1SC6A 3O94A 1R0LA 3IDFA 3R6DA 5E6UB 1BCRA 1KU0A 2OP0A 5CLIA 1ZICA 4OLHA 4DIDA 1GILA 5FWXB 3G5AA 3HVJA 4WAUA 5EJ2A 4L4SA 2O48X 5JG7A 5C1DA 3R76A 3BKWA 1B0ZA 1V2GA 1R6VA 4JHLA 4RLQA 4NABA 3TR0A 4ACBA 2PFKA 4BVJA 1H5QA 1THZA 2ZB2A 3C6XA 3L1UA 3LVBA 2Q3EA 2HHCA 4GR5A 1QP8A 4JP5A 5JSZB 1GRQA 3WQQA 3FXAA 5C5CA 5AW0A 4ZV9A 5CITA 3S1AB 3TLCA 4X71A 4YFVA 1LRKA 4Q3BA 1OBVA 5LD2B 5C81A 2QROA 1CG6A 3R0XA 5TMDA 3GLKA 2XCTB 1R6BX 3KK0A 1C4XA 4OA8A 5AJUA 5ALEA 2HLDA 2WTBA 4IFBA 4P3XA 3VKFA 4ZI7B 2ZFUA 1VPVA 2WEKA 5HZHA 3K3PA 1YMVA 1CULC 1I7DA 2RGNA 4PIMA 5A71A 3KT8A 3U56A 1XL0A 1ZCFA 3L7KA 2E18A 3IMFA 2PEYA 3D59A 3I6BA 2J6CA 4E08A 3HKCA 3DVLA 5GZ6A 5AM0A 2W71A 2VHXA 5G0VA 8ABPA 2HCRA 4QTZA 3FNRA 3H2GA 4RA6A 5JVDB 4QXQA 4CM8A 3JQAB 2H00A 5KCMA 3F49S 2IW1A 3OFSA 4BX8A 1WDLA 2FR8A 2BFPA 5DTMA 4QRIA 3U13A 2IU4A 2G76A 3WRWA 1Z9BA 2XAAA 2ZGVA 4K9MA 4FT4A 1A69A 3REQA 4KV7A 5A9SB 4GDMA 3G9XA 1O4WA 4JL5A 1OLSA 2Z09A 4S24A 3S3TA 3EDRA 1MP0A 5C8ZA 1IEQA 1EG7A 3EZLA 3DL4A 4E88A 1KQ3A 1AQNA 1LRJA 5EJAA 3GAZA 2CLEB 3RVLA 3SNKA 1BHSA 2NO4A 3A1CA 2R6R1 2C5SA 4DM7A 3B20A 3GUZA 1QGYA 4W5OA 2DPLA 4Q6BA 2GHTA 1REQA 4FSDA 5F1OA 1FY2A 4F4UA 3BGOS 1VL5A 2TMKA 4ON9A 3ASYA 1KJ8A 1R64A 5TMPA 1R0ZA 1Z6PA 3DMDA 4XFDA 4EKGA 1N9GB 1YCGA 4BQFA 1NT2A 1A50B 1G3RA 1PS8A 3S2SA 1HI9A 1W85B 2ZTMA 3CRMA 4YUXA 4DR6B 1Y4UA 4MXDA 2DR2A 2ZIZA 1PL0A 3WB1A 2QXYA 1QMGA 1O0SA 2UYCA 2IPMA 4HSEA 1X3LA 4Z2YA 1C1XA 2ZJ4A 1SBIA 1XJCA 4HEJA 2EJUA 1AZTA 2LUOA 5FO1A 4KLCA 4CDRA 5ES3A 1OAKA 3C3KA 4RD1A 3GH3A 2WJZB 1LC0A 2HEGA 4J94A 4B2IA 3THSA 2YFKA 4N48A 1DAFA 1ZK1A 4ISCA 5AO9A 5ECGC 4X66B 3A3PA 5GIPE 1PVVA 3MJDA 3WTBA 4HN4B 6CHYA 2ORWA 5C5DA 2B6HA 4LYGA 3H17A 3TL2A 5BWBA 1Q17A 5H3CA 4P34A 3VKVA 1WUHS 4G1VA 2CJPA 4ZMRA 2QTVA 2JJ2A 3JQPA 3OEED 4DR5B 1OXKB 4D25A 3I2KA 1JG6A 1V35A 3GGOA 1AGPA 3I9LA 1TVMA 1VB3A 3K32A 3OPYB 1Z56C 4QE3A 5AM4A 3V1LA 2JH9A 5K8UA 1V5IA 1RAEA 4EYSA 1G5PA 3ADOA 4TMKA 3WFIA 1TTTA 3C41J 3NJ8A 5ERYA 5FF9A 2F3PA 3OCYA 1HSZA 4NWIA 3FZNA 2XUAA 3V1TC 1UXOA 4GMHA 5FPKA 2A7XA 4KXNA 4BDTA 1LDNA 5EXTA 4BWYA 2F9FA 3I5YA 5CFLA 3D2AA 3MWEA 3FPAA 1Q1EA 3CG0A 5AJVB 1KL7A 1CRQA 1PDVA 2XNHA 5KTSA 2WV9A 4KQ9A 1YV9A 4PZAA 4B6RA 4COOA 1CBUA 3FG9A 1VJCA 3K0SA 1Y6ZA 4TXNA 4OMFG 3DOFA 1TC1A 3ROQA 5J2UB 3SYKA 2FHSA 2ZRCA 2VDUE 1SKUA 1FSZA 2FP4A 1L5KA 2HADA 1K88A 1L7DA 1EFVA 1CUGA 3LW7A 3OLXA 2AL7A 2GWRA 2O2HA 5LQNA 3CZQA 2C04A 1V5FA 1X0XA 4N3BA 3JWEA 2AR9A 4RIHA 1WZ2A 4HFMA 3LP8A 4HNRA 4EGQA 3PI6A 4G0PA 1CQPA 4XVCA 1ZMBA 4NK5A 1RWVA 2Q6OA 3AB3A 2LGJA 4XIJA 3K70C 3BXZA 1QIGA 4B4KA 2VHUA 5L51A 1NG9A 2XB2A 3RIMA 4AKGA 4NHEA 5HW0A 2YNMD 4F3NA 3FTPA 1EAYA 3IOEA 4P0TA 5CK4A 4G97A 1TK9A 2ZOSA 4HJXA 1RKQA 4B75A 4HBGA 4LE0A 3IERA 5DTJA 3F0TA 1AXRA 2QMOA 2REQB 5LC1A 2JFXA 3RTGA 1XYGA 4V0KA 3GRVA 1PNVA 3R8CA 4YASA 2X23A 3QA3E 1EK1A 1EFHA 1C1HA 3INTA 3J81A 3V1YA 1XQWA 5FYQA 4JJ7A 4NY1A 3BIWA 3PLAE 4QUDA 1RAIA 5A1JA 4BV2A 2C9ZA 4R1QA 3AM4A 5LKRA 2YL2A 2VBFA 4JOBA 4V1CA 4XASA 5KMGA 5ILOA 3EHDA 1JFLA 4V3CA 1FW8A 4HQ0A 4GG1A 1T6ZA 3OJLA 2FE4A 3W3AA 4JS0A 4EVSA 2B4QA 2QQFA 4QASA 1GQSA 3CF6R 3GRUA 5DBIA 3AM1A 1SULA 1KI8A 1OB2A 3UAVA 3D54D 1HMYA 1EVZA 3PXEA 1MIOB 5K0LA 1AA9A 3THOA 4E70A 1ZP6A 3KLPX 3JALB 4WI1A 5JNVA 4B7UA 4B6JA 3BIXA 3QEOA 5SY9A 2AHOA 1EXWA 1B1AA 1N8NA 5EWMA 2G06A 4I50B 5AXAA 1Q12A 4O59O 4KSCA 5EVJA 1TTPB 3DVAA 3QPAA 1F2DA 1KP2A 2I4TA 1ZAYA 1VSTA 3W9BA 2COKA 3QYFA 1OXTA 4BBZA 4TWBA 3FSJX 3OZSA 1P60A 1NW7A 3NR2A 4NKRA 3Q7RA 4HYEA 4R54A 3A6GA 3DFIA 4P7GA 2NLOA 3A1TA 2QNRA 2CHFA 5CBPA 4U9IS 3N58A 2XNJA 1II8A 2ATEA 1OWNA 4IW3B 5I5EA 1E3SA 1O5TA 3VYRB 1W25A 2EFJA 2QYSA 2VF4X 3KXKA 4XVHA 3ZY2A 1KQOA 4N82A 5CA1B 2BUAA 2PV7A 3JQFA 1W73A 4HQNA 4YLEA 4AM8A 3MXTA 2OKGA 3AR2A 4Q01A 4XEHA 1USWA 4ADSG 2MSWA 3O74A 9LDBA 2JATA 4KRXA 5EC8A 3JQCA 5JS7A 1WEKA 4QXOA 5EMKA 1R6AA 3H8VA 1BDBA 4CLHA 2PT5A 3MILA 1NYQA 3QG5A 2YR0A 2IKQA 3A4TA 4JDUA 3BTSA 5TPZD 3AQ4A 2ZQZA 1IYZA 1YVDA 2Q6KA 1JBQA 1CJMA 1N6NA 4LHSA 5SICE 4LGVA 1MO6A 3F4KA 3P9ZA 4TL9A 2OP1A 5P21A 3SM3A 1U28C 4FDMA 3G79A 3VC1A 3WRXA 1T15A 4AMZA 5IC4A 2VYCA 1YZNA 4Q4AB 4F9EA 3HJGA 2D62A 4FLMA 2P40A 3WBJA 1DJOA 1E4OA 1UK9A 3K6JA 4FQ8A 4O1IA 1H0KA 1QNLA 4WE3A 2AEEA 3RAPR 5FX2A 3KKQA 4LISA 2RMKA 3DEFA 4NESA 5KNCA 1QGED 1DJMA 4YT2A 2BM0A 2QD5A 4K6FA 2FZKA 1GQOA 1QHXA 5HBGA 4GGMX 2C5HA 3DMFA 5JYBA 3RNOA 3PXXA 1LC3A 2V6MA 3A7EA 1IK4A 1P9LA 4Q15A 2HLNA 7AT1A 2IHVA 3PRKE 3F4BA 4EZEA 4HVLA 1N8SA 2WAOA 4B47A 3BWXA 3EA5A 5EXSA 5JAOA 2O57A 1XPUA 4I81A 2E82A 3THYB 4ZVKA 5HGJA 2ZVJA 1OAOC 4O8ZA 5K0JA 4JI1B 3NNSA 3HVUA 2Q3BA 2EWVA 1VRVA 2LDXA 4WNYA 4P0PB 4LA4A 1ZD4A 3OF5A 3HKDA 1R12A 2YVQA 2P9ZA 1H8EA 3C8HA 4NV1A 5HJ7A 5I4BA 2RIRA 3AI1A 1ZWLA 3EVZA 5TIIA 3K6RA 1CUVA 1F5NA 5B36A 1WMEA 2AOUA 3LD9A 3NS7A 1D1SA 3AHDA 3CO5A 4MV4A 3OU6A 2ZT6A 2CF5A 1Z0IA 1O9BA 4EITA 1M9NA 1TIPA 1RWOA 2Y77A 3HJTA 4FFRA 5D87A 3ZHSA 4G5QA 4EHLA 5C80A 3D6JA 1PVDA 2CMKA 3LDAA 4FJ2A 1Y7TA 1Y1LA 5I48A 1NXQA 1EUCB 3IQDB 5FI1B 3ASUA 4OXQA 4LCEA 3C1AA 1WO8A 3DKPA 3PT9A 1N2GA 1IB0A 4B6PA 1D2GA 2NT3A 3E1GA 4G0YA 1Y98A 2P4EA 3CRNA 5DSTA 1FBNA 1B16A 2CLSA 2IEAA 3SC6A 1K5HA 2GSWA 3VPHA 1DC6A 4DZTA 1MB4A 1UC4B 2QJFA 3EIHA 3ZTYA 4A26A 5CLHA 5DM1A 1T2FA 3IVGA 5EJFA 2ZRGA 1GSIA 1YASA 2WU4A 2I66A 2ZRHA 1U7ZA 4DUGA 1BGWA 2RHRA 2N1MA 3CUSA 1Q7GA 3UATA 4D8VA 1NPTO 2QV7A 2XWSA 4E12A 2I76A 3JZIA 2O19A 1RQXA 3I2YX 4RHCA 3QMMA 5DNVA 5EPUA 3BRWD 4WECA 3W06A 5K3FA 4U00A 1JJ7A 3IVMA 1GPUA 4EPTA 3CLKA 2LV8A 3T9EA 4UCXA 1E4VA 4LZZA 4ZJZA 4BWFB 3ODPA 3QFRA 1HM5A 1Q50A 4YP6A 4B3RB 3FOEC 1TF5A 1FJ2A 2QD4A 1PLLA 3UWPA 3K15A 3NHYA 5DWQA 1S2OA 2WV7A 3T7RA 2GEBA 1NC1A 3LM8A 4FJ1A 3TIFA 4XAQA 5A0FA 4FUTA 3V9AA 2PUAA 3ETEA 1WCIA 4CGYA 4UU7A 3WBKA 2CJWA 2FOLA 5EOVA 1RCFA 1KVRA 3P97A 4DCVA 2XE7A 4F5ZA 4LVUA 3ND9A 2ODNA 1P2TA 1B6TA 5KIAA 3U4GA 2B82A 1ULZA 1GFWA 4QGBA 3TOXA 4M9ZA 1S4MA 3ER9A 1MDFA 2ZJAA 5KX5A 3FMGA 1YS4A 4R71A 1FP4A 3R7SA 4KOEC 2Q4TA 4O2AF 2MCFA 3C43A 3CKLA 2D7JA 2RBEA 4JUCA 1LLQA 5LP6F 1U3CA 4RXUA 4AXXA 5LL6P 4KR0A 1SPBS 2PZJA 2G09A 3FGPA 3NORA 5IJAA 2PPLA 3SBXA 3ZGZA 2O3JA 4TT3D 3M3PA 4LF4B 3UB2A 2UDPA 1H85A 4U9HS 3DEAA 1WX1A 5GY7A 1LX6A 2YWCA 2FAXA 1DC8A 1CTQA 3KOOA 2IHZA 3B38A 2BFNA 1W96A 4FBMA 4YXWA 5LBTA 3X3HA 3P2YA 3JS5A 3WYCA 1R4AA 2OM6A 4J2TA 4UNIA 3SZUA 2X40A 3ZOZA 2WUWE 2PGLA 1VSUA 5FHQA 1UZUA 1RI2A 1FW6A 1RZRD 4KBGA 2GF2A 3AUUA 3OZAA 4QOFA 2W70A 3V8PA 1ZIYA 4QYWA 5REQB 3KD3A 3VR3A 2M32A 3BHJA 1GV0A 3MK31 4G86A 1P74A 1QV7A 2JVJA 2HTFA 4WACA 4QLBA 3PHBE 4XVUA 4FPXA 4BO7A 4FGUA 1DDOA 1O8BA 2V7PA 4H7PA 3O4FA 2I0FA 4KNVA 1TM4E 3PYLA 3W2EA 2G36A 4BU1A 2WA1A 5B1IA 3WLMA 2CUKA 4UEWA 3WNCA 3WKAA 3ZH9B 5AVZA 2O0LA 3PGMA 4BEVA 5HIKA 3K6KA 1DTEA 1V0JA 3Q10A 1DAGA 1GL3A 3GEMA 4QA9A 5BWCA 2VAXA 2WMDA 1K7CA 1QPGA 5EXEA 3GLIE 2UKDA 1KQNA 1XROA 2ZPUA 1U2DA 1PT9A 2OYRA 4D1YA 3LDHA 3N76A 5IFLA 3AUSA 2IYYA 1VMEA 4B45A 2DEUA 2XUFA 4NV3A 4DMFA 1ZKMA 2ZAOA 3A0RB 3GIWA 5CYOA 2BDEA 3GMTA 5AW5A 5DLPA 1JMKC 5C8YF 4E5YA 1M2OB 1Z26A 4AJEA 2FSUA 1WETA 1U8ZA 1MT0A 1JR6A 3D31A 1G7SA 1CDEA 1YR8A 2BVNA 2OSVA 4FBGA 2B83A 2ZJ5A 3D4PA 4IF4A 1KTIA 3TW8A 3L1KA 2XTAA 2FMXA 5ELXA 3WWYA 4X1YB 3EC1A 4KG7A 4Z6KA 1E2DA 2ORIA 4GZMA 4BNXA 1X1EA 2XUDA 3HXLA 1RPNA 4MK4A 5D3MB 2J9FA 3CF4G 2BHSA 1G60A 3AINA 4MPRA 5LP6C 4DLWA 4FE3A 2AFIA 5KYYA 5EIEA 4KMMA 3OE1A 1KERA 2FK8A 3D8RA 4QBKA 4W5WA 3RVNA 4HMPA 3QE3A 1QP0A 4QTUB 5JJIA 4H1WA 4M0PA 2V9ZA 2FPXA 3ZV4A 5JNUA 5AYVA 3MTQA 3E5NA 3H4MA 3F7OA 4Q1BA 1P9WA 4N5MA 2QSZA 2P6UA 5BQOA 2IHUA 1TT7A 2ATVA 3L4BA 3WL7A 1C0EA 4C0WA 1XMQB 2VKTA 2YV1A 3PICA 1YB1A 4ZODA 3GJ0A 3AERA 3I5XA 4BNWA 2R65A 4YI3A 3WXMA 4B4UA 3PTLA 2FWBA 2FWRA 3FZGA 2R6ZA 2HD4A 1THGA 4Y9TA 1FEZA 1AK1A 4RL4A 2CDAA 2EFYA 3R9KA 1IQ0A 1W35A 1AZLA 2LIVA 2HF7A 2I3DA 4JEIA 3QH4A 3CKYA 2V0GA 1GTZA 1MC1A 1TW3A 3Q11A 2GCOA 4DLPA 4BQPA 1F0KA 3L6DA 3AW8A 3QFCA 3SIRA 2VH1A 1T1JA 5AMXA 2FCAA 2IXFA 2XYQA 3ZC3A 1I13A 4IDQA 2PMCA 3RADC 1VI5A 2K6GA 3THRA 1L4FA 1CUDA 5FO0A 4LF7B 2I65A 2NU9A 1CUXA 1GAJA 2B8TA 1FE8A 2HMVA 3RTAA 3DLHA 5B3JA 4MR9A 2IFTA 3UICA 4Q1FA 1H0HA 3C5EA 1ULUA 3IRVA 3OURA 4O2BA 3OFKA 1P2DA 4V24A 4LOLA 3LFUA 4MVXA 1DO8A 3VOSA 5F64A 3M70A 1ZCJA 5FV4A 2QA5A 1J5EB 1Y7PA 2AYYA 4IJUA 1SRRA 1A76A 5CIYA 3VR4H 3UKDA 4ZPJA 1WULS 2CL7X 2NTEA 3AWIA 3D7NA 2B7CA 3OI7A 1RZUA 1G9XA 2YASA 3W9YA 2PJUA 2ZRFA 3IPXA 4QTTB 5K3AA 3SVZA 1QOZA 5BSKA 4R41A 3VTKA 3ED5A 2VRWA 1Z8NA 1XN4A 1WHSA 4DLAA 1E61A 2EOAA 2I6FA 2R6AA 4HF7A 4B7CA 1AX9A 1GAXA 3W9UA 4J0DA 1VJ1A 3DZJA 1RQGA 4F04A 4DC1A 1M83A 4TTAA 4I4CA 4EA8A 3MIZA 4XLLA 4EGCB 2DXIA 1KQGA 2JDIA 4FDTA 1HX7A 1XF1A 2GPYA 4ALNA 3I1FA 4JI8B 1TAQA 3BRCA 1TK3A 3ZU4A 3K4PA 4GKBA 3ZWDA 4CQLB 3AJEA 4JOSA 4TMWA 1ADGA 5BN4A 1JIIA 4TLLB 3G5TA 2GJ4A 3WSTA 2FNAA 2ZXFA 1T91A 4UFOA 2DYKA 3TAUA 3ZGVA 4X92A 4CKXA 3IPCA 3OZRA 2DWUA 1JPNA 3JD2A 3AR4A 3FOAA 3KO8A 1F8XA 1SWVA 4CM5A 1T6NA 2D0IA 4HAUA 1KYWA 4UAGA 4C6TA 4OBXA 2SCUB 3AKZA 3D7LA 3DJYA 3LBIA 3CRRA 2X4LA 3CX3A 5GMOA 1M1UA 2R6GA 3SIWA 2QTCA 3OQBA 4MGKR 1TF7A 4DA6A 2GEFA 3O1IC 4XQGA 4URYR 1YZTA 4N1AA 2IS1A 1ZR4A 5A5EA 6ADHA 4W5JA 2CYCA 2SKDA 2BFCB 1K7XB 4NAVA 3TB4A 4LMPA 3WDMA 1ORTA 3GGSA 3UK2A 2ZWAA 4ZD6A 1X8KA 2O1XA 3A27A 1GGFA 4GBGA 5EYPA 3V1NA 1DC5A 1JA9A 1ZN7A 2ID7A 4J0JA 4RTOA 5B3AA 4RBNA 1C7EA 4LZNA 5AUOB 4PG6A 7ADHA 5LU8A 1X1DA 2JIMA 4I1RA 4O63O 4HXEB 5E1MA 1H0RA 4QG7A 3SGLA 1WXIA 3IAAA 3SK0A 1T6XA 2FN3A 3BWCA 2FW7A 1DAIA 3KLNA 3TYXA 4KR7A 1E32A 4FT2A 3OLCX 2R7LA 1EXNA 3SPXA 2IYWA 3GWGA 4FFWA 5HF9A 4AIRA 4RTPA 3EX7C 1EJ6A 4P6VF 3M81A 1V43A 1BW9B 4C4XA 4QXRA 5DYWA 4R8MA 5HNKA 1XEAA 1HK7A 1EJ0A 2YX1A 3GT0A 3LDGA 2Q50A 3SQOA 4CTOA 3DLAA 4JBHA 1E7WA 1XEWX 5CTJA 4KGZA 1LWOA 2DPHA 2R8RA 4PFQA 5K5EA 1PJAA 5KINB 2XCUA 5K8VA 1EDZA 1N5KA 2P9GA 1YIOA 4PCVA 5EIOA 4CMEC 4Z4FA 2ZZNA 2HF2A 3MWJA 4MJ3A 2CZGA 1BCSB 3D0QA 3I42A 4AZ0B 3A1EA 1EM8A 1O89A 4YLGA 5DNDA 3FIJA 1E1RA 1JJFA 4QFBA 4XJTA 3RRXA 2VAVA 1JBKA 2O20A 3C3YA 3TECE 1BVHA 1EFPB 1KAQA 2VAWA 5E0OA 4EX6A 5BUQA 1IXKA 3ROKA 2O8FB 4BLVA 5T3YA 4EWLA 3BEOA 1K0UA 3OICA 1L4GA 1T0IA 1ICIA 3EASA 1GTJ1 2B2NA 3PQ3A 4KKXB 2ONCA 4RKRA 2BEVB 1CPYA 4UTXA 4CN8A 4QUBA 4G36A 2VUUA 2OHFA 1EVQA 1NQ5A 4O4JF 2WTEA 1Q77A 1T3SA 5CPBA 2IRWA 3S2EA 3ZUPA 2X8AA 3PDIB 5JQGA 1U3FA 3C6KA 2P3LA 4R8LA 1GUYA 2PR7A 3IOMA 4AI6A 3AEQA 2WVJA 5DNEA 4M76B 2ZBVA 3WISA 4DMUB 1J20A 2VG8A 4XLTA 2EBWA 4RFSB 1A5TA 2OO3A 2W42A 2J7PD 2B5OA 2MR6A 3HS3A 4YP5A 5IJWA 2VXCA 4YT8A 3QPVA 1MAVA 4H3VA 2TSYB 5C9ZA 2ISQA 5DGCA 4F38A 1UFRA 1XHFA 3AKYA 1ZINA 4CG1A 1F8YA 4PSCA 1GGKA 4Q1VA 2QTRA 3MHPA 3LT4A 3E5MA 2AR0A 2PJRA 4Z7QB 1JVBA 4ER0A 5EIFA 5FBQB 1JKFA 1QB7A 2FR0A 3LCRA 3GEHA 3OO0A 3FZEA 1MAUA 4C2AA 3FCXA 1HDIA 2BGJA 4MB2A 4P83A 3T3IA 3BCUA 1B4DA 3RODA 2DFLA 1EHIA 3LXRA 3UMCA 3CO0S 3PLRA 3L8EA 1J49A 2PCLA 4C7VA 2C2YA 4KWEA 4L6AA 4KMOA 4WKOA 5K0TA 4C7OA 4PG5A 1P5HA 1W5EA 4TLCA 1R74A 1QIEA 4Y0NA 1HQCA 1K5PA 1ZSVA 3UMFA 2YXDA 5HRCA 1FRNA 1NMZA 3VKWA 2HMAA 8OHMA 5BOVA 3TOCA 4D81A 3THWB 3EY9A 5AI6A 1DBVO 1F2UA 2Y0CA 3AR3A 4MV7A 4DPMA 2HIGA 2WG0A 2EJTA 2DLNA 3B60A 5CVUA 2A94A 2MT9A 4LRTB 2R00A 4PAQA 5A2GA 1H4SA 1VLHA 1WXHA 3IPLA 1GLGA 2GBGA 3UMBA 4PZZA 1EG2A 4G0XA 2VEOA 3JYOA 4BVAA 2XB4A 3PDHA 1BKSB 1K6EA 2BGLA 2VZ0A 4QWMA 4TKUA 4A1OA 3DFMA 3MGKA 3B9RA 2JLBA 4FI3C 5HCUA 3V4VB 4ZCIA 1VCIA 13PKA 1FFBA 4JBWA 4B4WA 4ZYWA 5IPFA 2BKEA 4A7PA 4P2GA 1C5KA 1N1GA 1XDSA 5AXCA 3RQIA 1QIMA 3TEJA 1VM6A 4TTJA 4LSWA 2XIJA 3IALA 3UANA 2FW0A 3KVYA 3V2IA 2KBFA 4DLTA 3NHFA 5JEEA 1TIBA 4J07A 2J5QA 1GZUA 1RYZA 3DP7A 4Q18A 1USKA 3PIIA 2V6GA 3FPSA 3CB4A 2KMLA 3M33A 4FFNA 4KQFA 1U3TA 2BY4A 4WJKB 2QUZA 4Y9UA 4RGQA 2NU8B 3BDVA 1Y6FA 3KOMA 1E79D 5AOAA 2ZETA 3HBAA 3GDHA 3TM4A 3DMNA 3I09A 2AUMA 4XB1A 2C5LA 4HWKA 1XXLA 3B70A 2EZ8A 2VTBA 4LVCA 5FOTA 2ZYTX 3HH8A 5GM1A 4KACA 3JWIA 1A4IA 3WSVA 3KWFA 1J4AA 4FYWA 4UNQA 2H18A 5AVQA 3IV7A 1BEEA 5E4FA 3JQAD 1C0PA 3OEHD 1WP4A 1XD2B 2BHRA 4ZKEA 3GJXC 2Q62A 4DNQA 3E4CA 5BVGB 1MO4A 1G4AE 4MYSA 3T9AA 3TK1A 1JDJA 3AUYA 1QLJA 1QDEA 2IUSA 3KXDA 4EKIA 1HE8B 3B7WA 1BE1A 1GGNA 1NXWA 2BFBA 2CKDA 3B6JA 3KQQA 2VYQA 3WMEA 1KWKA 1RNLA 2HSJA 2DH6A 3AV0B 1T5TA 3R40A 4L4ZA 3WGYA 2W9XA 2E4YA 5IK2D 3LJKA 4X84A 4JP1A 1US8A 2O8EB 3V8QA 2YWBA 4QOHA 4FX5A 5CFNA 5K3CA 3MMZA 1R9GA 2Q9CA 2B0JA 3RFVA 3W90A 1UINA 2RONA 4Z5XA 3ZJYA 3Q6NA 2XVMA 5T4BA 3DZFA 4FGJA 2XT0A 3UOAB 2M1ZA 4CQJA 2H1OA 4TWJA 1TKCA 1CJBA 2PZKA 2Y4NA 3I4FA 3RAJA 4EHJA 5JDIA 3F96A 1RFLA 2R60A 3FNHA 1E0DA 4ZVRA 1JF8A 1NUTA 5BSHA 1D6JA 4Y6OA 2BM1A 2IU0A 2W2NA 3BXHA 5CD9A 5EJ6A 1NRWA 4G25A 1D2MA 2A3RA 5I5GA 1MJGA 1R0BA 1QGDA 2HT1A 1JE1A 3JQDA 2JCSA 1BJTA 3AZQA 2WFLA 3UXEA 2O5VA 1EH5A 3VKUA 1PFKA 3ZW9A 4B9EA 4QARA 4CF4A 1TVEA 1VKJA 2IZ1A 4HYQA 3ICOA 3BK2A 2C1EA 1JAYA 3OJOA 3P2MA 1QE3A 1K0FA 1KBQA 1GYRA 2PH7A 1A2KC 1TFUA 2RJNA 3PC2A 1XBTA 3HUFA 4AUKA 5BRJA 4Z4GA 1E5TA 2EW8A 3P4XA 2ROQA 5BWOA 4FW9A 2PQ0A 1H23A 3UAXA 3WK7A 1GYQA 4A8JB 2ZTHA 2O8CA 2FH5B 1SH7A 3RIGA 8ATCA 3PFBA 3O0TA 4WWHA 4D74A 5KQRA 5LUAA 4UMVA 1HFKA 3G13A 3UJHA 5CB4B 1CUAA 5DM2A 5CIQA 4HZIA 4WN9B 4EYKA 4MCAA 2NPOA 1NJ5A 1B0PA 4D56A 1PR4A 5F9FA 4MMZB 3IBYA 2VI5A 5KC8A 3MUOA 1LB1B 2PT7A 4G89A 2BW0A 1LFDB 5IAEA 1Q0UA 3JWJA 1NV8A 1VFNA 5C34B 3RJ9A 2VRBA 3ZHTA 1A4RA 1I30A 2Y0BA 4P9NA 4WV3A 2R1VB 3BMXA 1K8QA 1MOQA 2H5EA 3KKEA 1OLUB 4H1VA 2CFTA 1AIPA 2AOTB 3OKCA 4KDRA 5DW0A 3JATB 1Z75A 4M0LA 2ECKA 4RD6A 5IJZA 2DG2A 1D4OA 4WXPA 3ZDAA 5DM70 2HU8A 1U7DA 1YBMA 5FD8A 1WF3A 1XKLA 2ZR0A 4JLSA 3V1UA 4DA7A 1O1YA 2JGNA 4UEOA 3PZRA 4KREA 4PYOA 4JODA 4JYCA 1V1JA 3MOSA 1Q0HA 1F8UA 3AY3A 3LHKA 1E2FA 3MJCA 2YHIA 3OJWA 2Z2XA 2Q9BA 4P0QB 3D8NA 2D2XA 4JB2A 1VDZA 3DM9B 4Q39A 2Z9CA 1OAAA 4TZ0A 2CXXA 1EVKA 1C0IA 4ZQEA 4ZQIA 5CVEA 221PA 2OBYA 2O6HA 3GUVA 4ZK6A 2HJ9A 5EMLA 1H1LA 4I4TF 1NLUA 2PBLA 4L8WB 4L2IB 5LQAA 4OD0A 3Q6MA 1CEEA 2RHOA 3BILA 3FDZB 3JQBC 3NDJA 5LN1A 2B5WA 4E11A 3WAGA 4H6VA 3PXGA 3LQYA 5KTTA 4QYMA 1GGHA 2KLHA 4UEQA 2X9VA 4YAOA 2CGEA 2JGIA 4H7HA 3U7GA 3I9OA 3RHZA 4HRAA 1P75A 3HGMA 3LOUA 2HA3A 2XCRB 2VYVD 3RARA 3OQPA 8ADHA 5CYGA 1HUQA 2H2WA 4J0EA 5JZOA 3IQEA 4C20A 2DLCX 3CX8A 1EXVA 3RRMA 2YN4A 2IU3A 3R9XB 5TEWA 1QH8B 1U2GA 3NUZA 5TNXA 2NYRA 1RDFA 4BLQA 4GE3A 1EBBA 5DLDA 1ZVJA 2BTQB 4I5FA 3QF4B 1I6KA 1WABA 1W6RA 2Q46A 4JYAB 2DUJA 3TLGB 3U9LA 3P32A 1XVIA 1V4BA 1LK7A 2JGRA 3VSCA 1LV8A 1QS0A 4Y2UA 3NHWA 1U2PA 3HJFA 3RDPA 4IGAA 3G9ZA 2HPHA 3EULA 3KR9A 1EP1B 2O5RA 2BJWA 3EGDB 4LYHA 1U4SA 1GPJA 1HYQA 1SEPA 4JJZA 1UJ5A 2J6IA 2IA5A 4K6KA 5AWFC 4DLBA 3QELB 3A10A 1I2DA 3VC3A 4J3JA 1HE2A 2DBRA 4YMWA 4C4OA 1A27A 1L5WA 3WWZA 1GY8A 4UXJA 1K7EB 4E2FA 1T5SA 2RGXA 2Z8YA 4L5BA 1E2NA 3AUJB 4TKVB 4RE5A 3EVEA 2VBIA 4MV5A 3RKSA 5ADHA 1PYOA 4KE6A 3OKAA 4Q3CA 4B87A 2R4TA 3GCZA 2Z43A 4R1SA 2ESRA 2BTEA 2ZYVX 3L3BA 1DTSA 3TGPA 2LCFA 4EBBA 4MWOA 1C0KA 1N2OA 2L42A 4EEXA 3ZDRA 2NWQA 3VYTB 3LT1A 5DN6D 2ZB4A 4BMVA 1BX3A 1E66A 2GM5A 3EBLA 2B37A 3AXTA 3U48A 4AP5A 2YNMA 3JD1A 5CDFA 2RHTA 2P5YA 2F8MA 5IN5A 1QX4A 4A5SA 2H4YA 2IPOA 4FEAA 4AFNA 3I0MA 3RIHA 2VJAA 3T3EA 4CKWB 2E5LB 4V0LA 1NW5A 1LDGA 3GJTA 1BZYA 1FXSA 2J3KA 2CLMB 2QTHA 2FTKE 3L0SA 4PFJA 4MB0A 2ODPA 1QJ4A 4GP6A 2GZAA 4O4LA 3KYBA 3LC2O 1L5HA 4R9VA 4GUAA 2IXTA 3NAMA 4AZ3B 2J0VA 3CLUC 1AKRA 4DMMA 3VNVA 3EXHA 5DYTA 3A9RA 2ZE6A 5LBIA 1PZEA 4YJ3F 3PRJA 3GELA 1J0DA 4E4TA 5M3BA 1HNZB 1DG9A 4IDFA 4NG5A 1R37A 4RCYA 4V2IA 4XSGA 2J5RA 3ICQB 3VTZA 4R0MA 7YASA 1ZC3A 2CLCX 3NEPX 2WWHA 4UU1A 3EJWA 1JH8A 1FLNA 2VHZA 2PZ8A 2QRNA 4OXRA 3MLEA 4ABTA 4I1PA 2OVBA 1BJRE 1U7TA 1VBNA 1IHYA 3FHTA 2FUG6 2P6MA 3NT5A 5EIXA 1ZGAA 2XYHA 3C24A 1IBCA 4RA9A 1VDMA 3D5EA 1PK7A 1I01A 3SBOA 1H3NA 3MLBA 3IVRA 1V6SA 2ZQ5A 4A2PA 5I3CA 5JALA 1RYNA 1KMHB 5EGNA 2X0DA 1Z6AA 3KYCB 4HEA1 1PEDA 4GE0A 3UWOA