4B6SA

Structure of helicobacter pylori type ii dehydroquinase inhibited by (2s)-2-perfluorobenzyl-3-dehydroquinic acid
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
158
structure length
158
Chain Sequence
b'MKILVIQGPNLNMLGHRDPRLYGMVTLDQIHEIMQTFVKQGNLDVELEFFQTNFEGEIIDKIQESVGSDYEGIIINPGAFSHTSIAIADAIMLAGKPVIEVHLTNIQAREEFRKNSYTGAACGGVIMGFGPLGYNMALMAMVNILAEMKAFQEAQKNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-DEHYDROQUINATE DEHYDRATASE
publication title Mechanistic basis of the inhibition of type II dehydroquinase by (2S)- and (2R)-2-benzyl-3-dehydroquinic acids.
pubmed doi rcsb
source organism Helicobacter pylori 26695
molecule tags Lyase
total genus 55
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2012-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01220 DHquinase_II Dehydroquinase class II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dehydroquinase, class II 4b6sA00
1H05A 2XDAA 3U80A 3N59A 1J2YA 2WKSA 5WRFA 4B6OA 2XD9A 3N8NA 4B6RA 2C57A 1GTZA 1GQOA 2Y76A 2BT4A 4CIXA 2C4VA 4B6SA 4CKYA 3KIPA 3N76A 4V0SA 4CIVA 5B6PA 4L8LA 4RC9A 4CIWA 4CKXA 2UYGA 3N86A 3LWZA 4KIUA 4ZC1A 3N8KA 2C4WA 1V1JA 2XB9A 4CKWB 2XB8A 2DHQA 1GU0A 1H0RA 4RHCA 1H0SA 2CJFA 4KIJA 4B6QA 4CKZA 4CKWA 2Y77A 4KIWA 3N7AA 3N87A 1D0IA 4CL0A 4B6PA 1GU1A 4KI7A 1UQRA 2Y71A 4CIYA
chains in the Genus database with same CATH superfamily
4MH0R 4ND3A 2CXTA 5AFSA 4QBHA 1ANKA 4D8UA 2NU7B 2PGLA 1N2JA 4R7ZA 1FDRA 2F1RA 2GFQA 4HGRA 2JGEA 1U3TA 4X71A 5FFMA 3E0XA 4HTAA 5K3SA 5JS1A 4BCBA 4ZJZA 4F04A 4J16A 1XQXA 1D7OA 2B6NA 1XP5A 1U7WA 1Y7HA 3BSSA 4AIIA 3HDQA 4CVNA 1FPMA 1XZDA 3GWZA 4N6OA 5ILOA 3H84A 1U63A 3QU5A 1PJZA 2FQ1A 4O4JA 3PTZA 1L7VC 3CH4B 4NMLA 1Q57A 5TE9A 3P0EA 4D3FA 2GPTA 1P45A 1NXPA 2JAUA 4RHCA 5IVKA 4KPYA 5DBIA 1NDUA 2PS3A 4J0IA 4OBWA 1DDGA 5G1PA 1DRUA 1ZCBA 4QM6A 1P72A 1M8KA 2Y71A 4NLLA 1RAGA 3IOMA 2EFGA 1BJRE 2YWJA 2A9FA 3H3FA 4U9IS 4KU4A 3K9CA 3HFSA 4HWGA 4XYLA 5A3RA 4TM7A 4WY5A 5I7VA 1N2ZA 1R0KA 2MMCA 4INZA 3F0TA 4OH1A 2PWAA 3T9BA 2XBMA 1NF3A 1Z4NA 1V37A 3OQPA 1YOBA 4UAUA 1SIOA 2HRQA 3DV0A 4LKRA 5DX0A 4CMGA 1J4AA 2IX9A 3OURA 2E21A 1EFLA 4WACA 1TCAA 2Q07A 3S99A 3N8GA 3BQNB 1V1RB 2BIFA 4GKVA 5HFAA 3ZCUA 1PWHA 4ITUA 2CNWA 1N92A 1IVSA 3LDUA 4OUKX 5AK4A 4X44A 1L6IA 1DL5A 1B0ZA 1FFGA 1L4LA 1T2FA 1VPTA 3HJAA 3PFHA 3COSA 1JLHA 3RVOA 3T7IA 4M88A 3WY9A 4MUHA 1TGYA 3DBLB 4IILA 5CDTA 4I19A 1Z88A 3HABA 1Z3CA 2ZATA 1H3NA 1UBMS 3LV8A 4E12A 4G0PA 4CF3A 3HLTA 1H8HA 1GGKA 1EAYA 4K0KB 5ENVA 4AN4A 1ZVQA 4EY7A 3CFYA 2V5VA 3L01A 2ZFUA 3W2HA 4BEBA 3B1FA 4NDAA 4UW9A 4YPOA 3NORA 3QA9A 4GZLA 4HXGA 4E5NA 1BGWA 1G19A 1KO5A 4GKKB 4OI4A 3T9FA 4B4KA 5KYTA 3PPIA 3QBEA 4WI1A 4FWTA 1NMXA 1BVUA 5A9TA 1OIVA 4BFVA 2Y92A 3NHYA 3RVLA 4CI0B 2C7RA 4D0NA 4C7OB 4PYQA 4JLBA 4JUIA 5FBWB 3UJ7A 3MPOA 3WDLA 3T99A 2ESRA 3JALA 3EGIA 3D7KA 3FNBA 1LF5A 4Q03A 4LX0A 4MB0A 2J1LA 4UFNA 2HHHB 2W37A 1Z6ZA 1H42A 3H5WA 4DV2B 1N1MA 2VXYA 1GTG1 1XLTA 1EUCA 4TL9A 1KZ9A 3TQSA 4MLCA 1A9PA 2IHKA 2MR5A 1ZNWA 2ZSIA 2EBUA 4XPIB 1DQRA 2QM0A 2IXFA 2P27A 2WJZB 3BRCA 4O1MA 5AP9A 4CLXA 4BLRA 2REQA 3PNYA 2Y1GA 3LA6A 5KYYB 4LG1A 2QNIA 4XQ9A 2GETA 4FDTA 1DS6A 3WFJA 1SHZA 1WMSA 4PLVA 2HLHA 1NVKA 3JZDA 3NIBA 1CUGA 4HFNA 5ESWA 3OTGA 2FWRA 4XQ0A 3RS4A 3PL1A 2DB3A 2WWVD 1B93A 4UNQA 2NUTB 1S4QA 5KZMB 5JJ5A 1RCTE 1YFKA 3E23A 1LRLA 4OAOA 1KFCB 2NZJA 2Y66A 5TEWA 1XQYA 3G2KA 3OZXA 3REOA 4O0LA 3UGTA 3TVTA 3WNZA 1IM8A 5JW6A 2A5FA 3GGOA 4UU7A 3V00A 1Q95A 1XQVA 1NSTA 1AGXA 1THZA 3OEYA 2PAAA 4PCVA 4DTCA 2GN1A 1U04A 2IL1A 2HK7A 2NU7A 1Q0UA 1TO1E 4UHJA 4K9DA 2E9SA 2QD4A 1I13A 5H3HA 5IDVA 3FHTA 4MTLA 3ADBA 1NHWA 3BMNB 2FR0A 5JOQA 1PTKA 1HY3A 1RPTA 3Q8XB 1VC2A 4UQPA 1YCDA 2QRZA 5DBHX 2FRVA 4ZCSA 1DRWA 1JBQA 4PE5B 1ICEA 1W0JA 4TLEA 4INJA 5JNUA 2V9PA 3NTQA 1C1XB 1S9DA 3IPAA 3MJCA 2WAXA 2VYCA 4EELA 4I2VA 4F5EA 8OHMA 3X0DA 5IM4A 1CVIA 3NJ4A 3FYHA 3OBBA 1H1TA 4ENTA 5DNYB 5I7SA 5SYAA 4TWIA 1OASA 2GPNA 4HPXB 2C1EA 4KO2S 2X2PA 4X6UA 1LDMA 1Y9AA 3Q41A 2ZIZA 4Q4AA 5BNFA 3GDFA 1J2JA 4HUTA 3EPRA 3ZE6A 1LDYA 2QU7A 3ZCSA 1S1CA 4OHFA 5H3CA 4ZI5A 3LMKA 3O8QA 4FKBA 1ZW1A 3B85A 5FTNA 1GPAA 1ZNZA 2J48A 1PQWA 1R6BX 5LOVF 4UQLA 5FPKA 2ZUWA 1ZXXA 2C99A 2G1JA 3WKAA 4C0WA 1HDRA 4PRKA 3ZHRA 4CIWA 2NZWA 1KS2A 2OQIA 3F96A 1IN4A 4X6LA 1P2GA 3BGIA 1WHTB 3LVRE 3TR5A 5JZ9A 1X8LA 3UT0A 1TIKA 1LVHA 1E77A 4R2MA 3C6BA 1RADA 4YCCA 2PUFA 3CW2A 1EVZA 4G1VA 1WEHA 1DUVG 1X3LA 3DF9A 2EQBA 4O4IB 2VDMB 1NNEA 1Q1EA 4MGHA 2CDBA 2VYVA 3KQTA 4MK4A 1AMOA 4OHKA 4YMIA 1HM5A 3DBLA 4DR7B 2JLVA 2Q46A 3JR3A 3B53X 1CUXA 3IP9A 2UZ0A 5DXFA 3TZKA 4BN0A 1NNLA 1RU3A 2DQ4A 3D3JA 4I5IA 3ZTTA 1MOSA 4NEGA 3SBOA 4HQ6A 4D8VA 2JLRA 1P4SA 1JR4A 1ZD4A 3E0QA 3WHLA 4ALMA 2VWHA 4X41A 1R4AA 3UANA 1RBQA 3P19A 4BPRA 1FTQA 4AF7A 5SZHB 1H2ZA 5JCOC 3RQIA 2AG6A 3JD4A 3L4BC 3V8EA 4C7OA 1ECPA 2Q2NA 3F7OA 2RJNA 4IMJB 5IN4A 5K99A 3C3EA 2DETA 2ZRFA 4CIYA 3ETEA 2JRCA 3E1SA 3G59A 2WY2D 3VZSA 4HNSA 5JY6A 1U8EA 2AEFA 2G63A 4FT4A 4RKYA 1QH8B 5LQUA 1YA6A 3UPUA 3UHFA 2OECA 1COWA 1QZ3A 4M9CA 1R0YA 1C0KA 4EJFA 1CQZA 1ZM9A 2H29A 3AYXB 4DLZA 2OV2A 4OQ4A 3DEFA 4OGWA 4D81A 2GKGA 3FX2A 3NBFA 4BC1A 2XDYA 3KR2A 3HP7A 4ZJYA 3IL2A 1A4RA 3ENQA 5CYOA 1T8TA 2W42A 4EK9A 3RU3A 2PWYA 3DR5A 2Q8NA 4WVFA 2HGSA 3IKMB 5JASA 3PD7A 4CMEA 2HSZA 5G4KB 4DMFA 4QXMA 4S1VA 3PVZA 3O90A 1Q7BA 1MB0A 1XXHE 3CJTA 3BPSA 2QVLA 1WLSA 2GT1A 3OZIA 2EC5A 1I5OA 2JFXA 3BB3A 3ZY6A 3BGSA 1TTQB 4DQXA 3EWNA 2GA8A 4KYUA 3FUCA 3VNBA 621PA 2C7OA 4RENA 1CU1A 4N9QA 4Z2AA 1L4HA 1P9NA 4WX2B 3FR7A 4JFAA 1CUJA 1X9HA 9ABPA 2SICE 3KOUA 3DO5A 3OJFA 4MKHA 2NQ2C 2XQGA 2HHLA 4JCCA 3MB8A 1UXKA 3PEFA 1V8OA 1OH7A 3BMNA 4NS1A 1UJ5A 2WB2A 5FLEX 2WV9A 1UC9A 3B9RA 2IDKA 1A69A 3AI1A 4IWXA 3R41A 3UV6A 1QCCA 4G0ZA 4BBZA 1U6KA 3D6VA 3IHTA 1E4EB 3FB1A 1C1XA 3GPIA 3K0CC 1Q11A 3M1IA 4G8CA 3U4CA 3VTZA 1I6WA 4C1BA 2AZXA 1AMNA 1ZA1A 2YJ6A 4DTIA 1QGYA 1NSYA 2A5LA 2FZLA 2HQOA 3HPQA 4GOKA 2FDCA 4DYHA 3W0LB 3K0KA 3KHSA 1VSVA 2I2DA 4X0EA 2O8CA 2FGKA 1HQKA 4G0OA 4OJKA 3LX6A 1H93A 1Q6YA 2F1KA 2PJZA 4MRVA 3FTQA 1EU1A 2YIVX 2H4XA 4Q16A 4ZI7A 1H5UA 2XGSA 3KSRA 4N4AA 4G0NA 4BMOB 1OLSA 1EINA 1H2EA 3DPSA 1FRVA 2HA7A 1NDQA 4EJ6A 3F3SA 2AZDA 2I4OA 1U9YA 3MILA 4GDMA 1P60A 3WISA 4BMDA 1B6SA 1KXJA 4K6OA 1ESNA 3L8GA 3LGXA 5GONB 3IDZA 3SJBA 4EY3A 3O95A 2H92A 5EL0A 1N0WA 4LOKA 3T3GA 3WKEA 1MFZA 3HP4A 2PZJA 1Y6JA 3WYNA 1E4YA 5AM2A 4B47A 1VXRA 2JFOA 4PSVA 5DM60 1IEVA 1N5LA 3S29A 3MT0A 4O4IA 2PX0A 2X22A 1TC1A 4HGPA 2CXHA 2DT8A 2JI6A 2Y05A 4ASUD 3WFIA 2W6OA 5DTMA 4DR3B 2I2WA 1NL3A 2VT6A 1FSFA 4FONA 2UZ3A 3O9VA 1QU3A 4N8SA 3WRVA 1IUNA 1BRMA 1VE7A 3HI6A 4NNJA 3PC3A 4FSXA 4QIHA 3SZ3A 4C6SA 4WASA 4D25A 3BJEA 4KWEA 2WDPA 4N7BA 5H7XA 2PQ0A 5K6TA 1CUWA 1KYIA 5EKXA 3RI3A 4TGLA 3THRA 4CKCB 3LIIA 3HYNA 4GLOA 4QUHA 1XCBA 5CIYA 2A94A 1F20A 1YT5A 4CMBA 1SHUX 2Z6AA 3ENKA 3LKVA 3QLJA 4QYTA 1E79D 4O08A 1HEUA 2EFEB 2AOUB 2AW5A 3CMMA 3ILVA 1D6SA 1O95A 4JUCA 3HJTA 1Y4AE 2QAIA 2QV0A 4IQ4A 4XD7D 3TW8B 1W5AA 4RTJA 2IOFA 4NDZA 2QWXA 3V4PB 1E1QD 4DL9A 3CX4A 2Y2UA 1E2QA 3KXDA 5B1IA 3CR7A 1YCFA 1OZFA 2ORYA 3ICCA 4XUCA 5K8CA 3NVAA 4NJMB 5HZKA 3GT4A 4KAJA 4G97A 2HM7A 3C6KA 1DRKA 3H0KA 4O4HF 2XA9A 1GQFA 1N7JA 3CO0S 3CPHA 3NAZA 4RQTA 1Y5NA 3RGGA 4ER6A 4M89A 3QXXA 3BWMA 4GOND 4BFZA 2FV8A 1UDRA 2EQAA 4MULA 5EPEA 3UF0A 5EIBC 3V7WA 4BNUA 2JLWA 5T4HA 1W5TA 2QD3A 4LK3A 4I1YA 3UK1A 1K3FA 3ZNOA 4KSCA 1CR6A 4QVKA 1AN0A 2J4FA 1H2FA 1XRPA 2JHPA 3O03A 3QG5A 1JHYA 1FLNA 3B6EA 4P86A 3HJRA 3A1DA 1SQGA 3A4LA 1YL6A 3JXEA 3LRTA 2J0QA 2A0KA 1EUZA 1T3TA 3EFEA 4PLPA 4N01A 4QDJA 3VDQA 3TLGB 2ZJ3A 3PF8A 1RQGA 4FINA 1SURA 2AYXA 2C5GA 3G0BA 3SC3A 1DARA 5EFOA 4S2UA 3ZWVA 5FWXB 4AO8A 3BWCA 1E4EA 3M6LA 4JXJA 1R0RE 2V45A 1IBKB 4BB9A 1B00A 4XYGA 4ARAA 2A84A 1SBYA 4JQCA 3SKXA 4H3VA 3KSZO 2XQVA 3JD2A 5SYNA 2G71A 3L6EA 4J49A 2CSXA 4BN4A 2ZBQA 2AL7A 2JJ8A 4YXWD 4D4GA 2QTAA 4AM8A 3S5UA 4EHBA 2D13A 5BYBA 3EDCA 3EY9A 5F4BA 2GN2A 1XTVA 4JI5B 4OK5A 4E14A 2F6RA 4NK4A 3O1LA 3N2IA 4UTZA 4COOA 1ZUD1 3U17A 3CV3A 4L9SA 2JLAA 5FNVB 3VZRA 4C3ZA 5B53A 2Y0PA 4MWSA 4XVCA 5H9WA 3K1YA 4RK7A 3IEXA 3K70C 3HBAA 3MD0A 5G1OA 2VNIA 2NZUG 5U1PA 3DB1A 3JCZA 4Y2UA 1E7YA 2GXSA 5A05A 5KU7A 1HG0A 2IV2X 1SXPA 1MJNA 5F1PA 2ILVA 1KK3A 5ALDA 4K9QA 1MN6A 4YMWA 5HDBB 3NIWA 4DMUB 3PHCA 4B3RB 3QU9A 1XFDA 5DTJA 4JKYA 4Q00A 1H2XA 4H4EA 1VI2A 1C7FA 1HA3A 2F3TA 3ORYA 4LXUA 3GUCA 4R5HA 3ADKA 5GQSA 4FQ7A 1SPXA 1JZTA 4BMVA 5THXA 1ACMA 1NN1A 4WZZA 4TQGA 1IH8A 1TB4A 1VL1A 3L8ZA 2DUWA 2ZTHA 1ODIA 5BN5B 5C8XA 3PEYA 5E4TA 3JZFA 1TYDE 3WRXC 3BWYA 3MLEA 3UA4A 3GLHE 2WJAA 3PPYA 3EG5A 4K6HA 1T10A 4D9KA 3TGWA 1P3DA 4MUGA 2VK2A 4ND2A 4RDXA 1NN5A 1AKTA 1JH8A 3AQIA 4D56A 1ZH4A 2I3AA 1XK6A 2ZR8A 4Z8XA 5BORA 2IZ5A 1OXMA 3PK0A 4X7PA 1WR8A 3T41A 4CKCA 3STTA 1NRJB 2BBSA 4YR9A 4JWKA 5TC4A 1PYGA 3NHUA 1I6LA 5CDSA 3KPVA 2WYWA 1FJGB 2RHTA 2IBTA 1YQUA 4K9PA 3VO1A 5HEKA 3SY8A 3CJRA 1I32A 2BFAA 4ID9A 2AOUA 1BROA 2UUBB 1AKWA 1P74A 4ISBA 2C3PA 4WZBB 5EIOA 4UD2A 2OSBA 1ISIA 4L7VA 4RSHA 5DEIA 5DGTA 1D2GA 5CW1A 4NCBA 3TAUA 3R9XA 1ETHA 2ZJOA 4AG5A 2E6UX 3GLGE 3IULA 3ODPA 1G66A 4C5CA 1MEEA 4YLYA 5CFNA 2PKYX 3W8RA 2FW0A 2IDMA 3WDMA 4LXQA 3I72A 2QYTA 1NW9B 5DBOA 4I66A 2Z95A 3R7BA 2GHQA 2Q3LA 3B9BA 4A15A 3GCDA 1ECBA 4CM1A 2PRYA 5K8LA 3FNFA 1NXVA 3IPCA 1HK7A 5AVJA 1E3QA 3LSYA 4UBIA 5FUMA 5DXJA 2O2DA 4U7FA 1Z4JA 5JSFA 3MTGA 3EEYA 1FDSA 2Q7DA 1QQBA 1G2OA 1BA3A 4TTVA 5AO9A 1L7PA 4WGFA 4X24A 4ZRNA 2OTCA 3CM0A 4OTZA 2WTBA 5BNIA 5JCJD 3LYHA 1M5RA 1Z8HA 2EU8A 4ZAYA 1FX0A 3TR0A 2ZAOA 2F43B 2J6IA 3GCXA 2Y8EA 5FPYA 2OP1A 3WWOA 4CJXA 5KREA 1AKQA 2EP5A 3F5SA 3LP5A 3K92A 3PE3A 1Y1PA 3K70D 1EFAA 1EK5A 2W4QA 5FWXA 4MA4A 1D7AA 3OG9A 2X15A 4QQFA 4QSMA 2NO9A 1NLUA 1Q91A 1U8CB 1SC4A 3B1ZA 2AD1A 1OFUX 2NAFA 2ZB3A 4Y2TA 1HKUA 4M1WA 4DWJA 3OE1A 2YVLA 2YV5A 8GPBA 1FVOA 1KQPA 4LXGA 5JXGA 3L1HA 4NOLA 3S44A 2QRHA 3OKPA 1E99A 5J2TA 4PO3X 1ZGGA 4FDAA 4JLDA 3FWYA 4PHCA 4DFDA 3ERCA 1JR6A 1OU0A 1QIKA 2YOFA 3IT3A 4JYBA 3GUYA 4MVWA 5FNVA 1D4AA 2UYOA 4DDTA 3A36A 3UK0A 2WJWA 1NWHA 5KYVA 3LCCA 4UZEA 1VZ3A 4REQB 4ODIA 4QEZA 1DIRA 3NM5A 4ER3A 1ZAYA 1DO0A 2R751 2X3UA 5AI0A 3OCVA 3ZK8A 1JBKA 1ISSA 1Q17A 3S7TA 4OFWA 2YMMA 4EPWA 1LX6A 4HAXA 2VNJA 2J3JA 4B3MB 6REQB 1I2ZA 4ZP1A 1M9NA 3WHIA 2BZ1A 2HWYA 3DLBA 3NC0C 4HWOA 5DYYA 3FOCA 5ADUS 1T4DA 2CDRA 2XQFA 4H3SA 5K8UA 2DERA 1Q15A 4FHFA 3EF0A 4G23A 5DHAA 1RTTA 4WFKA 1O0CA 2CVOA 1Z2DA 3AHJA 3L46A 3OCCA 5K8JB 1KMNA 4MXDA 2X8WA 4P0QB 2CZGA 4UBLA 3WL3A 1LW7A 2XTAA 3NHSA 3AIKA 1KYYA 1U9CA 4BGDA 2GO1A 8ABPA 2EX0A 2Y1EA 3RIHA 1K89A 4M1OA 4QDUA 4RK1A 3ACDA 3T9AA 3OQ1A 4EKDA 2BEJA 3R3HA 4P4GA 1KVQA 1V8PA 2AE1A 3CTMA 4P3NA 4Z53A 1N78A 3O4RA 1HC7A 4ED9A 5BWNA 4JBYA 4QUKA 3WIOA 3RVKA 3ABSB 3ZJTA 3LX4A 1U1IA 5C32A 2CVQA 2FDXA 2GBPA 1A3CA 1B6GA 2OBBA 2P2YA 4WFJA 3WI7A 5B12A 2XWPA 1RYDA 3IRVA 1G8KA 1D2RA 3HWSA 4PRZA 1GILA 4XUGB 2CV1A 1E1MA 2R79A 2ZR0A 3VAAA 1CRLA 4XH9B 3LUFA 1M1ZA 4Z51A 2BZ0A 1WU7A 4I4TF 4L3VA 3S55A 4DSZA 1VKOA 4Z3KA 3OZBA 3V4FA 2EKLA 3V8BA 4HR7A 5BURA 2DY1A 2BPOA 3R0QA 4JEIA 2XUOA 3U5TA 4JYPA 2LKCA 4JUDX 1ZCFA 4PTYA 3UIEA 1MVOA 4JU9A 1WUHS 1NASA 3OZTA 1IJEA 3C16C 3AUJB 5C52B 1R8QA 3PC6A 1OH5A 3D6AA 1U90A 2HU5A 1LRKA 3EG9B 1CF9A 3EZXA 5LZ2A 2J5XA 1XZ8A 1BVYF 3BGOS 5EEGA 4DIEA 5CBPB 2NMVA 1GEEA 3L7JA 2YZ7A 4PWZA 1T35A 2F43A 3KVVA 4PZLA 5AKJA 4GE0A 4QKQA 4BX3A 1NXTA 5J58A 3QSYA 4TROA 1G1AA 4J7AA 5CT4A 1ZH6A 4KJXA 2H5EA 2LGJA 2O7NA 1P80A 3HVJA 2R48A 3T94A 5A4JA 3FOZA 2GWHA 4IWYA 1JALA 1BXGB 1YIOA 1KJJA 1T2CA 2BP7B 1P1FA 2RC6A 2J9FA 3A0RB 3OO0A 1LSOA 3QVKA 2XZTA 1NZFA 1GAWA 1SCKA 3CC8A 4O59O 3RV4A 5DNDA 3TUIC 4U9HS 3PT5A 3UWPA 5ADVA 3ESBA 1XN1A 2GLTA 4YRQA 4MVCA 3EZ9A 5JBNA 5EZSA 4YQYA 1VDZA 3BQ9A 3RFCA 3B36A 3RROA 2H7CA 2MTBA 4L4UA 5AUQA 5IC5A 4EGAA 1SUDA 3IIJA 2O8EB 1CLEA 2F8LA 1B0AA 4B6PA 4CL0A 1MEJA 2WRZA 5EMMA 5FV4A 1P1HA 3C74A 5LA6F 1ZOOA 4MS3B 1SY7A 5GGXA 4O8ZA 2BJWA 4XQGA 2GERA 4A73A 1G20E 3UMJA 1WXEA 1PDOA 2IY9A 1DIOB 3TIFA 2DH5A 3VKWA 1OV4A 2AC7A 2E4XA 5J5VA 2XNCA 3ZWDA 5KYXB 1SJ9A 2X5JO 1DAGA 3VBCA 4QFBA 1J24A 1QGAA 2HDOA 1ULAA 3A32A 2BEVA 3HNPA 4J7UA 3FTCA 3AP3A 3IFSA 3L1IA 2V8OA 4RH1A 1EQUA 4V0SA 2FF5A 4MUXA 4DNXA 1G98A 2LRHA 4R1OA 3WAJA 1Q7CA 1GZHB 4RZQA 1MW9X 1TLTA 2GEBA 2OO7A 4MVJI 1QH0A 3KKZA 3HJNA 1SKBA 3MJ4A 3BE5A 4LRWA 3CRNA 3L84A 5DULA 3I6MA 3L4BA 2OXIA 4ASUA 2WI8A 1JIQA 3MIZA 4IIYA 1JSXA 3GA5A 4MB2A 4A8TA 1G7RA 1XD2A 4YV7A 3ANLA 4CM3A 4JWTA 5LD2B 2RK4A 3L0DA 1A9YA 3ETGA 1FDWA 1Y5RA 2IK8A 1LBTA 4F5ZA 2QPLA 4PG8A 3O7WA 3WTCA 5CLIA 3VPXA 5C4IA 3THWA 5B1DA 1GPMA 3J7AC 3AHGA 1SVOA 3I32A 3TUZC 2IH2A 1K6JA 1LWNA 4D3ZA 3I5YA 1NZDA 4M8KA 3M4NA 3BILA 1I3MA 3SBEA 3QYAA 4WXHA 1AM4D 2XUPA 3CNOA 1GU0A 1PZHA 1U0JA 3QF7A 4UCQA 2QI9C 4EKNB 5JS8A 1ODFA 3HXQA 2GF0A 3BFKA 1MORA 3NYQA 1EHYA 2C9MA 2Q41A 2WNIA 1WXXA 5FWYA 3ZLJA 3W3AD 4ZHQF 1V47A 3CLHA 3VGPA 3PNKA 2RC5A 4XD7A 5CNKA 4AC9A 3TIGA 2Z5VA 4ENUA 1QP7A 2AOXA 5C1IA 1E1QA 3UMCA 1B43A 2PGOA 4TXHA 4JAVC 4BLWA 5D3MB 1TU3A 1WZNA 4KAAA 4LYJA 5KINB 4EBFA 2ZJAA 1W19A 1MOZA 2WIBA 1MZVA 1NXSA 2AQKA 3UMVA 1QORA 4K86A 4AZ0B 2ONKA 4YMGA 3P0JA 1TVCA 5I45A 2RI1A 5DLDA 3DE4X 5GVSA 1OLUB 1JIUA 3FDJA 2V97A 4PYMA 5JZVA 2HXSA 2HF9A 5F5XA 3BKWA 2GRUA 2G8LA 2JAQA 3PC7A 4TMXA 4Z9AA 2JIQA 1A7AA 4HZGA 2XE6A 4I1IA 1Y7LA 3ABZA 4ZVSA 5J63A 1F1BA 3SLGA 4TKLA 4MW7A 3CUVA 4BU1A 2PSDA 1L8LA 3GXBA 4TS1A 2BMAA 1Y3IA 4L4XA 3HN7A 4WADA 5G3YA 3UJAA 3RS7A 3WLRA 4YAIA 5ALPA 2VR1A 3GBVA 3E2IA 5EJGA 2G06A 3R9IA 4RTLA 5KCZA 2GAIA 2VYQA 2HRDA 2PH1A 5CH3A 2FMUA 4C05A 3B6JA 4JP8A 2Q6KA 4RVUA 5G02A 2B3DA 4P31A 5FRDA 3NV9A 2ROQA 3CX7A 3LWNA 4NBVA 3DMYA 2BBOA 5GGYA 1I2AA 1GVHA 3L7CA 4JXZA 1JHPA 1XLUA 1Y4SA 3RUDA 4F3NA 1MB9A 4HS9A 4L3WA 3UHOA 4E5MA 4BMSA 1NBME 2X9NA 3DM9B 3DWIA 3KT6A 1CJCA 1JHXA 3EXHC 4FS3A 1HV8A 5D7BA 2OLKA 2GOYA 1SBCA 1O5OA 3DEAA 5CDFE 5LN1A 2O8DB 1XRRA 2VTDA 4OU4A 2O8EA 1N6LA 2JVKA 4I99A 2WTMA 1L5SA 2OCDA 4E46A 2BZGA 4MS3A 1QGUB 1WQ3A 2F17A 3CWZA 1S1MA 3C5WP 5TS2A 1SUCA 4TKUA 4H6PA 1V7PC 2PZKA 2OCLA 3PCXA 3SQNA 2VPWA 5D7NA 1FW8A 3HU1A 3K3PA 1IHYA 1MQ9A 4KNWA 4A92A 4L1KA 1L8QA 3LP6A 3DMGA 1VBNA 2MYNA 2P0YA 2PA0A 5LIRA 4HH1A 2FW7A 2I3ZA 1JA0A 2QUHA 3EQZA 1Y8QB 2WU0A 2XYQA 3TTTA 4DNOA 4DS3A 2OCYC 3FWKA 2XB9A 3TB6A 3O5AA 4GSKA 3TJMA 3OJEA 3TVYA 2AZ4A 2OV6A 2N1MA 3QFSA 5EMHA 2O07A 1X1TA 3Q2KA 4NPCA 3PJFA 1ZRNA 3G0CA 3NTVA 4CG0A 4R2KA 3W1EA 3H83A 4NTZA 1SBTA 1JT2A 1ZH2A 1FEZA 3OTIA 1FQKA 3RUIA 3I9KA 4OF4A 1I3LA 3LF1A 2YZNA 4AUKA 1FSZA 3EHDA 1NLYA 3ZU4A 1ISPA 1QQAA 2Q5CA 3ICVA 5LQDA 1J2EA 1A2OA 1WKCA 1XDUA 1G5TA 2I8AA 3L8CA 3KEFA 3QF4B 2J67A 3UG6A 4IUDS 1AKYA 3OIYA 2JLZA 5IJXA 1EWKA 2VDKB 3QJYA 2XZLA 2IZ0A 1EYZA 2H4JA 3L0SA 3OIWA 1SEPA 2WF6A 1BEUB 2K2QB 4GZ5A 2FG6C 2I71A 4O4JF 4XI9A 3AKYA 3WRYA 7AT1A 5IDXA 3U09A 1IB6A 4PAOA 4XIFA 1SRQA 5FT9A 3H2IA 1VE9A 4TL6A 1D0IA 1SUFA 3PPXA 2AN9A 1EDDA 5J5AA 1R6DA 3TGPA 2VSQA 1XRLA 3AFIA 2Q1YA 2QPOA 4DA4A 3ROZA 3GAZA 5JADA 3W5CA 2PT7A 1EWYA 3FMIA 5A06A 1ACLA 2B37A 3BXFA 3DVLA 4OHBA 3WLMA 3LQ4A 4K5QA 1GQSA 5K3AA 4BRUA 3DEKA 1N7IA 2JFUA 1ISJA 5IAEA 3QVTA 4KMSA 4NULA 4XAQA 3ZJYA 1BX3A 4R68A 3A0UA 2PUDA 3PJEA 4DM7A 1QUFA 1O6GA 3FNIA 3K5HA 3QMWA 3AP1A 5CA0A 3TOZA 3VMFA 5AVSA 1OLUA 3KOMA 4ROTA 3G6WA 1NQVA 3KJGA 4K88A 5CM8B 4NICA 3KUKA 2LZ0A 2VLIA 3NCHA 4TKZA 2W6MA 1U11A 1IY1A 2O7QA 5MGBA 3IH5A 4B4DA 4RTQA 1SK9A 4JBLA 3NT4A 3RFUA 3ICQB 3N2LA 1KHTA 3CY6A 4JLKA 4TYPA 5ALKA 5BO5A 3NNNA 4REOA 1A9XB 2YCLA 3R1IA 3W3ZB 4DANA 2ODTX 3EB9A 2GF9A 4JASB 2FETA 4W9NA 2WEKA 5ALZA 4DR1B 3GFGA 5JCJA 3HU3A 4A23A 2FLKA 2I6FA 5JTUA 3HH8A 2IOHA 2AFIB 2RHLA 1V2GA 3PVCA 4UVEA 4WZAE 4XJVA 1JILA 1GV0A 4A16A 4OAQA 1UMBB 2CLEB 2CYAA 1FTYA 4PTLA 4UEKA 3MTBA 5DHFA 5FEUA 1IZ9A 4FD2A 4ZRMA 4GI7A 3IUSA 2VPQA 3HXKA 5AW7A 5DN6A 3VR2D 2QTGA 1H85A 1L5OA 1RNLA 4S3MA 1Y8ZA 3UUEA 4KQWA 3SQOA 3AGQA 3DLTA 4KO1S 3ZW7A 1U8YA 2GKOA 5LJLA 2O8DA 3TLCA 4KV7A 3RFTA 4XLLA 1J2RA 2YWCA 3Q9SA 4UJ3A 2GNOA 3T3EA 4GQIA 2ZRQA 4AYXA 4K9RA 5AKIA 4GG1A 2E4YA 4A5SA 2V59A 1N57A 1YMQA 4RTRA 1M1YE 1Z2PX 3G0IA 3F97A 4EABA 2YXNA 4YJFA 3KUXA 1FFDA 1KY2A 4I4LA 3C5CA 3EVBA 3WB1A 2NV0A 1CEYA 5EPUA 4ZMRA 1ZUIA 2PFSA 3TDKA 2B98A 3IMGA 3ZHUA 2I9KA 2PKXA 2ZYVX 1VYHA 1MO6A 3ZCPA 3UAXA 4E31A 1Y8QA 2ONCA 5AW9A 3MWDB 3LT0A 2J33A 4NOKA 1QP0A 3FH0A 1MX5A 3M1YA 3ONVA 4LBZA 3U7FB 2BSXA 5MGNA 4HDNB 4TSKA 5KHOC 5A4IS 1ECGA 4BKQA 4FZJA 3MZ0A 3JQPA 2OXRA 4B6OA 5AM3A 1JSCA 2H4ZA 4OLHA 3DM5A 1B8PA 2IX3A 2ONYA 3EIXA 4IX1A 1KEUA 1EE1A 1NQXA 4GS5A 4QJ5A 5CFQA 3SJUA 3P5SA 1MIHA 3VC1A 3WL5A 5C7LO 3QF4A 2RONA 4S24A 3OOWA 2C3YA 2GAAA 1TAHA 2XB4A 4UEJA 3PQ5A 3OUZA 3OCWA 1GUBA 1K2WA 2NT3A 2RFLA 5AUPB 2OVFA 3W4JA 3FLBA 3PPVA 4G0YA 3LQKA 2ET6A 1Z73A 2FSIA 2H48A 5IDQA 1N0IA 1FFWA 4QT0A 1ID8A 3H8SA 1VP9A 3HB4X 1M6HA 1YU9A 2OP0A 5IHXA 1XAJA 3LA8A 4N0PA 1CDZA 5JJCA 5J5CA 1HE5A 1FJ2A 4X54A 4R01A 4X94A 4LQ4A 2WQ6A 2PYDA 4GLJA 1DC5A 2UVQA 2ORVA 1OE0A 2CHGA 4J4TA 5ICSA 1CJUC 2C0QA 1GZ4A 4EUHA 1X1BA 3RJ9A 1A8UA 2B0JA 2X4GA 3E9MA 5DBFA 3K2BA 3KZVA 1G2IA 4F8EA 3O8CA 3G9TA 1JSLA 1I0ZA 3C7KA 5F7OA 4DCOA 5M04A 2PFKA 4UM5A 1PI3A 3RVMA 1T4MA 3MW8A 3K0FB 1VGQA 1K4KA 1QOZA 3FROA 4QYSA 4FVTA 2H06A 1EXDA 1GGVA 3BF8A 1GL6A 4P35A 5IT5A 3R6LA 3RKUA 3MWJA 4AJ4A 5LBIA 3TIIA 2X4LA 4AJJA 4RPIA 1YJXA 4NCKA 3INYA 3OMWA 1SCQA 3INNA 3S5JA 2WYUA 4JIGA 4R6WA 2ZULA 4CT4B 1A9XA 2NXJA 4YECA 2I65A 3AI3A 3TCNA 4E88A 4PZDA 4IIDA 4BLQA 4QUAA 1V35A 2JFPA 3C6XA 1P4GA 4L16A 5EHGA 2CUTA 3H8WA 2W83A 1N8KA 4W6QA 2AFIA 4X6XA 1U3WA 3GV0A 3I9V6 4LVNA 4QM7A 2I22A 1JR3E 4MHTA 1NNUA 2MHCA 4Z0HO 2HEGA 4CM7A 1CERA 2XVMA 2XBLA 3DW3X 3H6KA 3G5UA 2XJ9A 5ESDA 1ULSA 2JLBA 1GU1A 4RZ2A 1U9IC 1ZZGA 4BE4A 1I5EA 2F3PA 2OBNA 2X1MA 3CZ4A 3FCSB 1VLVA 4L5AA 3WGQA 4DBLE 4Q7MB 5FH9A 3CVJA 4J6EA 4YP5A 4JSRA 5TRTA 4EHLA 1O7JA 3D8TA 3V8RA 4KXUA 3IUBA 4Q3EA 1A2BA 5T4BA 3L8DA 3VR6H 1T13A 2HPHA 3V8VA 2N3ZA 3ZE1B 2EX4A 1X2BA 3GLTA 1E2DA 4R8VA 1KQNA 5BP7A 4NCAA 1AUVA 1J70A 2CFRA 2WC1A 3PPWA 1UKEA 3QX7A 3R24A 4PYOA 3U3KA 3VR4D 5JR3A 1N2IA 1A5TA 3HA7A 3GY0A 5K3EA 2LWIA 1ILEA 1AZSC 2V96A 1J0DA 4XIGS 4FFMA 1NBEA 1NVUQ 1F2TA 1JKJA 3ZCVA 1Y7TA 4CKZA 1FS5A 5JNRA 3WL6A 2IA5A 2VPIA 3MWDA 4PIVA 5EKUA 3N87A 4ADSG 2UXCB 4KBGA 4LRSB 5IC6A 4KRFA 1RYNA 2H6EA 2CSUA 3JVEA 1U1EA 2V03A 1LUAA 1RM0A 5D3KA 2B0CA 2QRVA 1OAAA 1MJ5A 1VJCA 1YC2A 4OQNA 1JAYA 1QZXA 3HKDB 2QTVB 3Q98A 3V7FA 5CT6A 1Q0TA 4IVQA 5CRIA 4YRAA 1L7DA 2JAOA 5LUAA 1AJEA 2WOJA 2QENA 1ADBA 3DXYA 4NQRA 3U4DA 3P0FA 2PJUA 2XCLA 1J06A 3OZGA 5AI8A 1QKJA 5HA5A 3U4QB 1UFRA 4FGKA 2VS1A 2CJPA 1XYVA 3LNCA 1OX6A 3MAGA 5JECA 4D8YA 4OMCA 3I0MA 4BAZA 1VJ0A 5ECGC 1AV6A 4RPHA 2EF1A 2OG2A 5LZ5A 2OLJA 4N5NA 2WKWA 3PDIB 1QV7A 1Q5PA 5BSKA 3PFCA 2F67A 2WAMA 4E5PA 1R5NA 4OXRA 1AUQA 4BLUA 3SVZA 2G80A 3Q3HA 1BYUA 4DLUA 2IQIA 4J1TC 1UOOA 3ZZTA 1Y33E 2JCGA 4D8XA 3BEOA 4IJWA 5L3ZA 4GP7A 3ZC3A 3ETNA 4KDFA 1OBCA 3VU9B 4IGAA 1BN6A 3KAJA 5C2JB 1FP2A 2ICAA 1WXQA 2CV2A 4ZI7F 4HJRA 3OETA 4XYMA 1NRIA 2FYTA 2OAEA 2H3EA 3M33A 1TYEB 4FILA 1HG1A 4W5OA 4M0FA 2NSDA 1BU8A 1FFYA 2B25A 4G5OA 3MHPA 4W5WA 1ZN9A 1WDMA 3GHYA 2YWRA 2XB8A 3R3XA 4U3JB 3W3AA 4IINA 1EXVA 4G5RA 5A1JA 1PZNA 3PXBA 2ADFA 4KIWA 3WKDA 3STWA 3GQBA 2NIPA 3AVWA 1I4EB 1PGPA 2E4ZA 3VBEA 3HY4A 1O9BA 1OI7A 4ERNA 1LFAA 3TFOA 1E32A 1RRMA 2HIGA 1JV2B 4O4IF 1NJ6A 1XWWA 2C4KA 2QVXX 5G40A 1U2SA 4AQDA 3H3XA 1PL7A 4KYTA 1J0XO 2HQ1A 4XZ3A 1YA4A 2LUOA 3HC7A 2RK6A 2X1VA 3R77A 1A9SA 5H82A 2BOVA 4B31A 5IRCD 1HQYE 1IUOA 4LZAA 1SCUB 4B75A 4E5KA 2F1HA 5BQOA 5KOYA 4DV3B 3PX3A 3VOBA 3EXHB 3VTFA 1MT0A 4ZU3A 1R0WA 1USGA 3CT4A 4KQCA 1Y1SA 1CS4C 3AM4A 1U0GA 4L6CA 4BBAA 5DYGA 1PJCA 2X8AA 4PXSA 2MR6A 1J8QA 4ZODA 3T0IA 2C2BA 1ESEA 2XOEA 1W6UA 3INGA 4UHDA 5E2BA 4BNFA 2NZYA 4ETWA 3CVVA 1AKUA 1MQSA 2ZJZA 1EGVB 1UUFA 3ZPXA 4TYQA 3ST7A 1JEQB 1AHHA 1G4AE 1VB3A 2TSYB 4PLFA 2B8NA 5C1OA 4BO3A 3WGMA 4CT5A 3R6TA 4H18A 1V3VA 4DSAA 3QI2A 5CD9A 4Y2XA 3TW4A 4BO7A 3W9BA 2HWKA 3LXRA 4IIBA 3GAFA 1L5KA 1IXRC 2PJRA 1I51A 4IJMA 4OB7A 1G18A 3QYFA 4HFRA 5BVGB 1UMKA 1QAQA 3QKTA 4HMPA 1VTKA 5BRAA 1Q6ZA 1RIIA 1LPNA 1PR3A 1IBMB 2ENWA 3RSLA 4ZT5A 2P9GA 5I8ZA 2HZBA 5IKPA 1CG6A 4IMPA 4JJKA 5EP4A 1IIRA 2HXGA 1H4SA 2L42A 1II8A 4MYUA 1KZGB 2RCYA 3NYWA 5SY6A 4C76A 4ITVA 3WX0A 4U2CA 2BDEA 3ECAA 2LCFA 2C4NA 3W9UA 2WSIA 4CQMD 1PT7A 4C14A 1MFPA 1H6DA 1RZUA 3H2HA 3F6PA 3KNZA 4UHHA 4EG8A 2PY6A 5IH3A 1W94A 1V5IA 4CRWB 3U4QA 5JISA 2IEGA 1F8FA 1M1NA 2ANBA 1O97D 1IPHA 4FZVA 3EVTA 4G63A 4D6PA 4BS9A 4DUPA 5I8WA 1G6OA 1G2PA 2ZI3A 3HFRA 4N65A 4OREX 2XXJA 1D1QA 1YE5A 2JB9A 1JQ3A 4ICIA 4OU5A 2JLQA 4YJKA 5HCUA 1YNOA 3K7EA 3KQLA 1AGPA 4MLZA 4I1PA 1Y6FA 3P2MA 4OEHA 4EL5A 3NMUF 3HB9A 4I36A 4PICA 4KZPA 2GJSA 4ZPJA 5DX1A 4UUPA 5P8WA 3G13A 1CULC 2GCNA 4MPTA 3AQ4A 4PVCA 1SIUA 2VI5A 1GFWA 8ADHA 4B6RA 4ZYUA 3F3YA 4NG4A 1SUBA 3VU9A 4ZI2A 3MUNA 3MF4A 4H2DA 1T24A 3Q0IA 3SSMA 1P77A 2F3UA 1BHQ1 4GYJA 1UEJA 4BB0A 2G9RA 2QRNA 3A70A 2ECQA 3GH3A 3KQPA 4DRYA 3CYFA 3NGLA 3PKZA 1JH9A 4U7GA 2HJRA 1FYDA 2PX5A 5EP2A 1UH5A 5J4HA 5KYNA 2QL9A 4U3JA 4CTKA 1KY4A 3NX4A 4N8DA 4DJJA 1U2QA 3FW1A 1FSGA 3FCXA 1U94A 5HHTA 4FP9A 4LK2A 3AC0A 3U7EB 2J9RA 2IV3A 3WNVA 1AZWA 2AZMA 1KI3A 4LJ4A 3EXG2 1R16A 1FE8A 1I14A 4R1MA 2JIOA 4KR6A 2Y2VA 5LUBA 3RYIA 1GQOA 1L7OA 2G9ZA 3EUEA 4NG5A 3W5SA 1PO7A 3IA2A 4WA7A 4R8KA 1ESDA 3KZOA 1EFDN 4AKGA 4MINA 4HV4A 4JSTA 1XNQB 1NM5C 2E4UA 3DE6X 3FYUC 3O2NA 3P97A 4LYHA 1JQ5A 1NT2A 2VQ3A 5AOVA 5LBUA 3WGHA 3S2UA 2WWYA 1XO1A 3EXHA 5CH5A 3ZXXA 2PUTA 1EWRA 3F90A 3WNDA 4CTJA 2R6GA 3A04A 3WMGA 2IS4A 4GC9A 3AKCA 2GEFA 2QL6A 3GZNA 4OKSA 3NWJA 4OP3A 5EHNA 1WX1A 2IUUA 4DLXA 4QTTB 1V5EA 3RUAA 2BI4A 3K0AA 3I23A 3NWOA 2HU7A 1YQTA 2DWOA 3H9GA 5AQEA 3UICA 2IE0A 5F7JA 3TZQA 2Q6TA 2ZRDA 3SI7A 4Y6RA 2VNHA 4C7BA 1V3QE 1CJVC 1P91A 2N46A 3A7EA 1FFBA 4XXHA 1SKYB 3VR2A 3K5IA 2LBPA 4L78A 5C34B 1LVGA 1FW6A 6NULA 1OAOC 5BVGA 2HMAA 2I4NA 4R16A 3JSAA 4HZUA 4BN5A 2Y77A 3GQVA 2QMZA 2EHJA 4I9FA 4GP9A 4NR0A 1DJOA 1DTEA 1XXLA 3PJDA 1RFGE 3FFTA 1GPH1 3Q9NA 3Q7PA 4BO8A 1KYVA 3BF7A 2LR0A 3LGAA 3V3TA 1NJFA 5IXYA 3VHXB 1NMEA 2WG1A 3VSCA 1M74A 3W2IA 2G6BA 1F4PA 2CWDA 1CJKC 1NQAO 2R8BA 5EJ4A 2Q45A 2H9IA 2X3YA 4EKYA 3A1WA 2V7WA 2VF2A 5HKOA 2WIFA 3DTYA 4QUIA 3GJYA 1FZTA 4TYWA 2C9DA 1NYLA 3ET5A 4G36A 2R6JA 2A86A 3FCYA 4CF4A 3EW9A 1OXKB 4F5YA 1XMQB 4L4YA 4M1KA 2AUTA 3OA2A 4PINA 4D96A 5MN5A 1O6CA 1T8PA 3JQRA 2QTLA 1R0LA 4I5FA 5DASA 4YYEA 3KDPA 3EOZA 3QGMA 1O5IA 2F4NA 1QDLB 1XU9A 3BK2A 4FZ3A 1E5QA 3T3NA 4J0KA 1EVJA 4HC4A 3U7RA 4TLLB 4W6ZA 1RRKA 2FZEA 2JL1A 4C0AC 4JJ8A 1HDOA 2VH2A 5EUBA 2B94A 3LBYA 2PX8A 4RZSA 5C18A 4Y2JA 5I4IA 2WLTA 2XUIA 4DCVA 1CQXA 4BNJA 4R8MA 1ZK1A 2PKQO 2VRNA 3IAUA 2R0QC 2NWQA 3P0IA 1CRPA 3B2EA 1PNVA 4H3HB 4MS4B 2XV1A 4Q3AA 3NCTA 5F3RA 1JEDA 1P4AA 3AVOA 2OSVA 3ZUGA 5J2TF 2X1LA 1C4XA 2O0KA 3JVVA 1MOPA 2CMGA 3CN7A 4A6EA 1OVMA 2F62A 1HE2A 1GPBA 4OPMA 3N8KA 1B15A 3ZGXA 3LT5A 3ZY4A 1VCMA 4F38A 1O8BA 2YZMA 3F6SA 4TXNA 3VXKA 1LSJA 2XDWA 3D4IA 2IF0A 3CUYA 4D43A 5AVVA 3QNMA 3CXUA 2VP0A 2WJVA 1YVPA 4E0BA 5HF5A 3VZDA 1J7KA 3NU1A 2HFJA 1RXSA 1NMQA 4LY6A 3W1WA 5J4LA 3NDBB 4L9RA 4N5LA 4RD3A 1AQUA 4UVIA 4F9TA 3S4YA 5JIBA 3ETLA 1U0LA 4RQAA 4B0PA 2R47A 2FH5B 4Q3CA 1NNSA 2GPSA 1RCUA 1XCJA 3BWEA 3BG5A 3A1VA 3OPMA 3SXJA 1YQGA 5JEDA 1UM9B 5IJ9A 3AF2A 4BLPA 1SG0A 5JRZA 3O9ZA 4DSNA 1PFYA 1YB6A 1GPNA 1OHHA 3HP1A 2H16A 3HO8A 3RBZA 4OA5A 3IUNA 4FHEA 2G83A 1GFIA 3DLCA 2C5AA 2QMQA 2RDMA 2RK3A 3EUAA 1E0DA 1OBHA 1Q50A 3H4VA 1JPVA 5JJIA 3VX3A 3ADDA 2A9QA 3O91A 1KVSA 4X8HA 3T54A 5G0UA 3RS8A 5K8VA 3M3DA 4NCIA 2AOVA 4BNVA 4EHIA 2LIVA 5FWDA 4WRRA 3RGWS 4GD3Q 4AJEA 1R0BA 1H2HA 3PQFA 3EF1A 4OKIA 4ZOAA 3RVSA 1Y1QA 1BDHA 4O4LB 4P80A 2VH1A 1I2BA 4R81A 4R9UC 4AN0A 2YXBA 3ITNA 4F3RA 4YHBA 1KI2A 2BGUA 1TIPA 1IQ0A 1FNNA 3ANMA 3Q87B 2WYVA 3KQWA 3MWYW 3SYMA 5MF6A 3LDHA 5BN4A 4PF1A 1YR6A 3KKPA 1FUIA 2JPDA 3NDRA 1NY6A 4ID3A 3G2MA 2ATVA 3L04A 5CX1A 1WCIB 3II6X 1Z7GA 2R6R1 2AMLA 1I7DA 2G9NA 3EZ2A 2B8EA 1U0TA 1OZHA 1GZDA 5I48A 2PPVA 2XPCA 4B3SB 5L7WA 1H4QA 4FB4A 1JX6A 4M0KA 5G0VA 1XQWA 4BFSA 4J4HA 2BTQA 1OZAA 2JHCA 2HC9A 5LBTA 2XMPA 1G0NA 4Q47A 3JASA 3TFWA 3VHXA 5LZ4A 2BISA 1SOVA 3VR4A 1S6YA 3OZCA 1CUIA 4CGYA 1AUXA 3CX6A 2I6UA 1FVXA 4JBNA 3WK8A 4EM6A 1IFXA 1YRYE 2V6BA 4F45A 1EP1B 2DY0A 1CFJA 5JXJA 1AURA 3A9UA 1I9CA 4YJ2B 3O93A 2NO5A 3OKCA 4TXLA 4UMFA 5F73A 4TS3A 3RC2A 1PK8A 2Q3BA 2HIMA 3TIXB 1ECLA 2HD4A 1ZY2A 3JPWA 4TMZA 5HMLA 1RD4A 2BHRA 2IXAA 2CDNA 2YNMC 4CQMB 4U2KA 3VR5D 2GVNA 4HF7A 1CEXA 4FMBB 5AKZA 5G2OA 5F3DA 3H2KA 1DV2A 5GMOA 1D07A 1X3SA 3GEHA 1L5VA 3QBJA 2NO1A 1W73A 4YXFA 2VJDA 2VRCD 3QY9A 4DLVA 1Z5UA 1NMZA 4CQJA 3WIUA 2ZYIA 3SF0A 3U9SA 5T3UA 1CY7A 3FCAA 3PGLA 4MS4A 2DWPA 1T2AA 2GPAA 5C8DA 1EQAA 2G9VA 4KDCA 3JQFC 4KQFA 1OQAA 4PBRA 4C0SA 1G41A 1FFXB 2P65A 4DIUA 721PA 1QE0A 3B82A 1W1IA 4NJOA 5JDCA 4UBJA 2YVUA 5JALA 3KUDA 3GOHA 1UWCA 2WINI 4YCMA 4HAUA 2ZRPA 3PNLA 5SZKB 3RVQA 3ZLTA 1M54A 2CYBA 2WZQA 1PJLA 2FEMA 4US1R 3BCRA 5FYDA 1CEEA 1JLLB 2H9AA 2COEA 1HMYA 1UXGA 2RB4A 3GDHA 1NIJA 2YHAA 5BVHB 4LQDA 3HJUA 3RIYA 2NYAA 1KVRA 3A6PC 5HG0A 1F60A 2ERXA 4EVRA 1KYZA 3ENWA 4K7JA 1EG7A 3QLEA 1SUSA 3L0IB 1YTUA 3QPVA 5FR2A 2VKTA 4CMIB 4LF4B 5A6SB 1H0KA 1HFEL 3AHCA 4HH4A 2G77B 3AL2A 4Y9TA 3VAZA 4YJ3B 3ZV3A 5KWEA 2UUAB 2IY7A 2OE2A 2QX9A 2XCTB 4Q9DA 3ETCA 3JS5A 2WU3A 2JI9A 3PX2A 1M75A 1B3RA 1X7XB 2B61A 2C98A 5CVUA 3SAJA 2FW1A 4LYGA 3WZMA 2R85A 2R84A 3NALA 2CDAA 3DR3A 1NQUA 5CXXA 5H59A 1UWLA 1F8XA 1XZGA 1YACA 1VJDA 1VPDA 1SMKA 2G04A 4GMHA 4MEAA 5IBPA 3QELA 3NETA 3JQCA 2LNDA 3KPYA 3A3PA 2QQ0A 2PD3A 4D79A 1K5PA 2Y76A 4FBLA 2Z8ZA 4O4LA 1E61A 3EDQA 5EYPA 1U99A 1F2UB 1R27A 4A2CA 3C3AA 1WXIA 4BRZA 1CZNA 1TDJA 1X0VA 4YAJA 3T61A 3LDGA 5EA2A 4JKIA 4GP6A 4EJ2A 3V1MA 4YIHA 3C87A 5L3SB 2X6TA 5J9FA 2QGNA 4JT2A 1EDEA 2D00A 2XAAA 2XXAA 2HSEA 3H6HA 3C4JA 4PAGA 1YHNA 4IMRA 3OD5A 2HO5A 3WVNA 4JX9A 1RXIA 4RMIA 5AUNB 2BGMA 4KSYA 1VYVA 3L4EA 3ORFA 3ZLUA 2AD5A 1WTCA 1PWXA 1RHKA 2H5LA 2ZJ4A 5C80A 4NEHB 1KI6A 4KLNA 4EATA 1T25A 1U0RA 1S2OA 3EW7A 3W4KA 4YUYA 1M1UA 2CZCA 3D5TA 4YP6A 2HRBA 5LU8A 1V25A 1H9CA 1JDZA 1M0WA 1UK7A 2HF2A 3TBKA 5ERXA 3TS1A 1XTSA 5A9SB 1GADO 2Q0HA 4IEFB 4NHOA 3ZY3A 3BVPA 1H2RS 2BFEB 4O3FA 3T8YA 5I7FA 5NLLA 4PAWA 4Q9JA 2CWWA 3A26A 4YJ2A 3EPHA 3H11B 4CM9D 2HSDA 4KQKA 1RKVA 1VCHA 1Y1LA 2IOQA 2PSJA 3QPAA 4A2PA 4GQAA 2DFKB 1G5FA 3GRPA 1J5EB 1BVHA 3NKLA 1PNQA 3H1TA 2HPZA 3DL2A 3I73A 1A76A 4BLSA 2NX2A 4L3OA 4LHYA 1UBRS 1DWQA 4JVSB 5EC8A 5L9AA 4Q6WA 2KE5A 3B60A 1RLTA 5FD8A 1LEHA 1SXHA 1Z0IA 4CL8A 3ILYA 5KCMA 4Z4EA 1XGKA 2WABA 3HVHA 3EZNA 4MICA 5JCOA 4A2QA 1KOGA 4TMYA 2PLAA 4CL3A 3I83A 2WICA 3WSTA 3AILA 4ZQBA 4CCYB 4O3MA 5IS2A 2XITA 4HEJA 1CR0A 2XMSA 4OM7A 1GPYA 5LP6B 4BGIA 1MB2A 1ZESA 4NH4A 4RNCA 3ZGNA 1S8AA 2ZSUA 2G3YA 2W2PA 3NI2A 5EXXA 3ZK9A 3BD6A 5AYVA 3T3IA 5K9ZA 2MSCB 1X38A 3G2LA 2DKOA 3ZG6A 3MBIA 1JLLA 4BWVA 2AN3A 1L4GA 2W71A 1ZONA 2CMHA 4KR0A 4XIYA 5BVHA 4FB5A 3U1BA 4YIKA 3WGJA 2ZAMA 5CHEA 1JLSA 2ONZA 5LQKA 4DIMA 2BV3A 1VMKA 3ICOA 4U5XA 2FEOA 2VAXA 4MV9A 4JHLA 3RABA 5C7OO 5HUJA 3K8OE 4L15A 1ZMOA 2WFMA 3M5DA 1WW8A 4H35A 1R10A 1SG6A 1U2PA 3OECA 1ZFNA 4KQEA 4DARA 3C5HA 4P36A 5AVOA 2CXUA 1E2EA 1G42A 3KB1A 4LHVA 4R9RA 3H0CA 4KYVA 4ZKDA 5FUQA 2ID7A 2I1LA 4UMEA 3DEHA 1NI3A 2G17A 3DMDA 4G86A 1Z17A 4KUGA 1EWTA 2HEIA 2HTEA 1C3XA 4E22A 4HXYA 1ABBA 2BGWA 5DB4A 3DZBA 4JL5A 4QGHA 5F7ZA 1N2CE 3IODA 3PUXA 4QPJC 1KKUA 1ZGHA 3JYQA 1GT91 3HO1A 1N9GA 1F2UA 1OD6A 2AG0A 3V97A 1PR2A 1P2SA 3STHA 2D8AA 2VCYA 3RYCA 3BGDA 1AB5A 3KKQA 1Y82A 3I53A 3PNOA 1K75A 2C7QA 3ANSA 5HKBA 4IXNA 4L0MA 4DLKA 3OFKA 3A10A 3F67A 5FIUA 1MV5A 4PPQA 3WIEA 4RY9A 1BXKA 1B42A 1GZVA 3AZQA 3KLPX 5AKYA 1X7ZA 1SZDA 5GOZA 4Z4QA 1P9LA 1CUFA 1YS1X 5IANA 3FHLA 3MPUA 4EWLA 4LSMA 4MDYA 3X1KA 2WYHA 3SXUB 1J1IA 1IWOA 1KJIA 1T29A 2Z2KA 3IPYA 3U0BA 3KDSE 3THXA 1DXYA 4L95C 2BMJA 2IKSA 2ZCUA 4DDKA 3HVRA 3TEJA 3V4OA 2EJWA 2ZUDA 1QO9A 3OLZA 5E2AA 3HKCB 1T0UA 2ZIGA 3RANA 3SS7X 2DQSA 3JQGA 1LK7A 4CN8A 1U2GC 5A9SA 1AKMA 1DX6A 2PZAA 4NKRA 2DUMA 3IJRA 1M34A 5CA0F 1OILA 4L0DA 1BE1A 2BFEA 2C1XA 2R8PA 2DAPA 2QQEA 3AETB 1X1QA 2D1SA 2AIRA 3D7MA 3OAAD 3PNMA 1ZNQO 4HPWA 5HQ3A 3K1AB 4AS2A 3HB0A 1QHYA 2DHCA 2PFGA 3L0OA 5F23A 4I55B 1EJ6A 2WJYA 1GVNB 3DTTA 4J9UE 2IZ1A 2XNHA 4PLCA 5FWAA 4RHUA 1JB9A 2SKCA 1U5AA 2YX1A 4NH0A 1MR3F 4DDMA 1QYVA 1DPFA 1SKAA 2C9OA 4XIIA 3SNKA 1UJ4A 4ZVTA 4EW3A 3L93A 1JRLA 4ZO4A 6REQA 2FR1A 4EG6A 3MOIA 4MQFB 4Y0AA 1B6TA 3GLIE 2CD7A 3M6XA 3UJPA 2AOTB 1SN7A 1JEEA 4CCYA 5JNLA 1GTSA 1Q0ZA 3DKIA 3QHQA 3RARA 4A8PA 1LLFA 2LDXA 3G89A 4AURA 3VPBA 3FYTA 1HT1E 3RJTA 4K40A 3CLRC 2R97A 2WKSA 1KEKA 1I4DD 4D1YA 4K9LA 3AF6A 1VECA 2FFQA 4YRTA 4NFSA 3N2ZB 4LE2A 2JI7A 2QN7A 3ZWPA 4AKTA 1B2LA 1PKEA 2A9JA 1QYWA 4Q4DA 2XSZD 2GK4A 1V41E 1JHOA 3U2QA 5JZSA 3RODA 4AJ2A 3GFVA 4ZV7A 4B35A 4X1IA 2PGIA 4A36A 1JN0A 4DIKA 2JJMA 2OV8A 3HUEA 1ZD8A 1NM5A 1FYWA 1LQ2A 2F00A 4C87A 1WVIA 4JLAA 1ZCAA 1JKIA 3CMCO 3U4HA 5ITZB 1NDHA 2OHVA 3M89A 1P0IA 3B3FA 1QZZA 5AVYA 3F8TA 4F2DA 4CLRA 3GGPA 3QUBA 2D0DA 4KWIA 2M98A 1Z4OA 3DCYA 3THOA 5F3WB 2N1BA 2PV0A 1N75A 3SVTA 1JQLB 2O1XA 3MCZA 3QNUA 2C3OA 2YBEA 1ELOA 3O0DA 1AZLA 2OFOA 1V5FA 2HWUA 3QVLA 4HI0E 4NBKA 4ZCPA 1WSAA 1DC7A 2Y1LA 3EXFB 3IHKA 3D59A 2KX7A 4OHXA 2FUG6 4PWYA 1H6BA 1EBUA 4Z0TA 4ME6A 4N3GA 1X8XA 2IH5A 1F0PA 3JQ8A 2WUWE 4YP7A 4YAEA 3ZX4A 1O6FA 4QRIA 4UEOA 2B4YA 2JJ2D 3HWRA 5KSPA 1OWPA 1NAHA 4DVGA 1XEFA 4UMDA 2XNDD 4PNHA 2M9MA 2FUG1 3VHLB 4Q6BA 2G1KA 2ZT6A 4WLOA 1QGZA 1TYZA 1SXIA 1TU0A 3VYSB 2Z3VA 1KSFX 1MABB 4HVCA 3PFIA 4RK6A 5B4VA 1E9RA 2JIMA 1RXYA 3O8OB 1N3LA 1PUIA 4INAA 2XJ4A 5EVJA 2TMYA 1E9VA 1NY5A 2WHQA 3IERA 3IAAA 3Q0TA 4IDAA 5CGZA 4EKEA 3BM5A 4Y1FA 2B35A 5ALWA 5FX2A 4AY2A 4NENB 1JG6A 4WN9A 1ZVVA 2QMHA 3B7GA 3Q0EA 1NBHA 1HDEA 4NJEB 4DLAA 5HJEA 4MTCA 1G8PA 1IK4A 1Q12A 3SXUA 1KJQA 2L69A 2QY6A 2IYOA 4KXNA 3S1AB 5IMSA 3OJWA 3L8FA 4QJIA 8AT1A 4NE7A 2XCUA 4O8CA 4M4SA 1THTA 2JANA 3BA6A 4H60A 4RBNA 3PHLA 3DGFC 1FP4A 3CLUC 4Q4HA 1JDBB 4CE6A 2JA1A 3GYBA 4U6SA 1TUEA 3GVXA 1EHIA 3K71B 3BH0A 1LI4A 1KQ3A 4YCAA 4EA9A 1QNFA 4F3YA 1B73A 4IGKA 2XOXA 3V7YA 4B5KA 4BTLA 5ILQA 1Q3HA 3QPWA 4HKTA 5T3YA 2B4TO 2RHJA 3AIOA 3UBMA 2ZE8A 4FHGA 4OATA 3CVUA 2IHNA 4B45A 3M81A 4I55A 4QGSA 3TE7A 1L5GB 1PT5A 3LZDA 4DQKA 2VTKA 1SXJC 3L8EA 4CIBA 3KXLA 1GUYA 3RPEA 4MGYR 4NBTA 5HJ2A 1ZC3A 2VEDA 3M9LA 4F2GA 4OH7A 3VOTA 5HRCA 2BH2A 4B6GA 1JIVA 1PJ3A 5ALHA 3GWGA 1FS6A 2JCVA 4DABA 5JCZA 5LM3A 1E6LA 1NW3A 1CYDA 4IHKA 2QGFA 2EATA 3BMQB 4FFRA 1EFTA 4IDDA 4J4BA 4MQFA 3ZBTA 5EMLA 2R6FA 2AOTA 4FGUA 3VR5A 2NYUA 1H1DA 2ZDHA 3PQCA 4MW6A 3I3SR 3GK3A 5DOVA 2P7HA 2VRCA 4FI3C 2Y3IA 1TIBA 1RZRD 1NI4B 5DX8A 1PD0A 2J4CA 1DBRA 2QRQA 4CUZA 2Q5IA 1GCIA 2GFHA 3ISJA 3T35A 1BKDR 3QE0A 1I36A 2ZJFA 1Y3CE 1UM8A 4J0DA 4LWZA 1AKRA 4U63A 5B7PA 2EAUA 3SX4A 1DCTA 3ABOB 2FE1A 2YC2C 4GWLA 4FE4A 4QHTA 5E6RB 4KLRA 4ZEWA 3W5VA 5L95A 3BHNA 1B1CA 3D9QX 1ZMTA 3IVMA 4EGSA 3BB4A 4RD2A 2AH5A 2WSBA 5HQJA 3WB2A 1RI4A 1MXHA 2AI1A 4YH1A 4YMSA 2WG2A 5D3QA 2YV1A 1YBAA 1EA7A 2H5IA 1YI1A 1JMYA 1FFHA 2KQUA 3OE5A 4PTZA 4GVLA 4TUYA 3HFJA 1IBRA 2HIHA 4DQLA 1WBDA 5BPHA 1Y98A 1NXXA 2OCBA 5E0OA 1CY4A 1OFVA 1MC1A 4NYMR 4UUNA 1O54A 3PDHA 1QAOA 1KK2A 2BY4A 3IDFA 4BPBA 2YYSA 2B34A 5AVZA 3OIDA 4Q1FA 3HXLA 4BVGA 3OX3A 3CPSA 2QR2A 3GRAA 2FUKA 2AR9A 4DMGA 3UK6A 4XA8A 1WY5A 2D62A 3SJAA 1LNQA 3PUJA 1JDVA 4YLGA 1R6TA 3LXUX 3PGJA 3UC9A 4M8IA 4HEA6 2PUCA 1G4HA 1FTGA 4L0QA 1MABA 5E7MA 4L6IA 3T7SA 3CF4A 3CGWA 4HMQA 3I2HA 3ZGLA 2XT9A 4BBPA 3O8OA 1VLHA 4FYHA 5IKMA 3ZS9A 4HEA1 3BDAA 3RDPA 1USIA 2P1ZA 4JIMA 1SD2A 1VFNA 1XAGA 2QOEA 3K09C 2OG1A 3C8ZA 1L4EA 3HWWA 4DQVA 1V6SA 4ETIA 5L4SA 4LOIA 3VC7A 5H8WA 4NENA 2GBCA 2VNAA 2D3WA 4LXTA 5E8JA 1TFUA 2WUVA 3DMPA 3GLQA 4AJHA 1OTXA 3NPAA 1L5ZA 3NTOA 3LQYA 1VCOA 1Y9DA 1EX6A 2FPXA 4RF5A 3S27A 1K6IA 1V45E 3LBHA 4WUTA 3AVUA 1SVSA 1PVDA 1SM4A 2I2FA 2YWEA 1MJGM 1MAAA 1E7RA 1NE2A 1ZLYA 2UVPB 1E89A 2V4ZA 3EISA 3FOAA 2B5WA 2V3VA 1YZLA 3NO4A 4HP8A 3ABQB 4JQZA 4V03A 5CVDA 5F1OA 1MTZA 1MRSA 3NTUA 2JH3A 3VVLA 5JAIA 1C7ZA 1AOXA 2ZAYA 1V7QA 5J43A 1UKAA 4N1AA 1P31A 1Z4QA 3S70A 2QD1A 2YHIA 4PX9A 3R76A 3X1WA 3ZDQA 4YALA 2QTWB 4V3BA 4BUZA 3G0HA 1WXGA 1XTBA 1FZQA 1ZBQA 4CTOA 3DBHB 4MA0A 5THQA 3HBLA 1Z6AA 3CPJB 1UXOA 2EKDA 3QX3A 1IZYA 3A2NA 1BC5A 3EDRA 2QDKA 4MUAA 3DE2X 1U8TA 2VTEA 4LJYA 3LUKA 2BLNA 3JQFA 5C1BA 9LDTA 1G8YA 2YWBA 3BFVA 4B4OA 2IZZA 1F2VA 5EG5A 4PGAA 3ITDA 4CM9A 5TMPA 1T6YA 1YI0A 3AUTA 1TRKA 2QG4A 1FXWA 1Z0DA 3NBAA 3LVFO 3BMQA 1JNXX 2WYIA 4Y8VA 3OTQA 4N40A 4GL4A 2Q2OA 5CFRA 1P19A 1U2RA 5TJ9A 4MPPA 5CLLA 5LMCA 2CL6X 2M6KA 4DCNA 3FM9A 1VKJA 3CPEA 1BKYA 2X42A 1GNTA 2ENUA 1U7XA 3NWPA 1HSZA 1NI4A 1PHPA 2HCJB 3P7MA 4I1SA 1ZOPA 3QJGA 4OQLA 4TKVB 2CL0X 5BT9A 1XI2A 4D9NA 2YV4A 2GDZA 2AN4A 4HYQA 4RA9B 1YVRA 1QWOA 4MUJA 2QZPA 1KDPA 4EO9A 4L8FA 1C3VA 4KG7A 5E6RA 4L4ZA 4U8HA 3I9NA 4YONB 2P0EA 1IOVA 2HJVA 5FOTA 5K0GA 3DWGA 4LMAA 3BL6A 1PX2A 4FXPA 2OV4A 4P6VF 4RGVA 5L40A 2FCRA 4NOJA 1J1ZA 2C95A 2QUAA 4B81A 4HFMA 1EGQA 4HH0A 3TZ6A 2JARA 5CG2A 4EI7A 3WOVA 3IEKA 5E38A 4JH0A 2A1TR 2NGRA 3T1NA 1DXHA 2J5QA 1NVVQ 3HL0A 4Q1AA 1IZZA 2W2MA 3CB2A 1ADFA 2AQ8A 3A1FA 3J81k 1UMCB 1LX7A 1OC4A 1YFZA 5DLPA 4KAFA 4X92A 1QCYA 1XMIA 1KI1A 3EFOB 1EJ0A 1D4FA 1TYCA 2AF3C 3SQXA 2WHYA 5FPSA 5JSQA 3WGVA 4BVKA 1RHMA 5EZ5A 2PVCA 4MYTA 4CFZA 5AT1A 5IJAA 2Q4EA 1GZ6A 2XUAA 3OU6A 4M0UA 2BH9A 1B14A 1JGTA 2WM9B 2RAPA 4WNIA 4X7BA 3CURA 1M2GA 2P6PA 1JHUA 2YWGA 1QPGA 2QI9F 3OTOB 1SVMA 3P2EA 3QKUA 10MHA 4QPNA 2D7CA 1K9VF 2I99A 2OZPA 2Z3ZA 1ZMRA 2Q5JA 4OBXA 3WA7A 5HF9A 1EA5A 1DIBA 2RHRA 3LDFA 4C6RA 1EVLA 4QU5A 4R71A 1R8SA 3NKFA 3WAKA 1W6RA 4DG5A 5JHGB 3IKJA 2XBUA 4P3YA 4WDRA 1WMAA 3A3NA 2ZUTA 4EI2A 4UVGA 3N74A 4HDSB 2FLVA 2L0XA 3L0YA 4M0MA 3OHMA 3FZYA 3SYRA 3GJ5A 1WCWA 1L4NA 3W6UA 2J3QA 4EW1A 2W22A 3RSZA 3I62A 1W46A 1E96A 1W36C 4IIFA 3H1FA 3QBTA 5IAKA 3L0BA 3MMPA 2EZ9A 4J2OA 2VEOA 3GRVA 5ALGA 3CW9A 1A97A 4BQOA 2QXUA 3VDRA 2PPLA 4IH4A 2YN0A 5FBHA 3WA6A 4MVJM 4N47A 4D9JA 4EA7A 2QRLA 4ZYWA 1N3IA 4M1TA 2XQKA 1ESCA 2H85A 1XJWA 3LBAA 3QWIA 3FUWA 4OXIA 1PBTA 2I7TA 4GKJB 2ZBUA 2IDJA 1T91A 5HYVA 1ZD1A 4OVKA 4H1TA 5K0ZA 1A1SA 4H7HA 3GN2A 2ZYRA 3OAAA 4PLHA 4YN3A 5FHRA 4BATA 2QJOA 4FMCF 1F3OA 3BGWA 2DFPA 1BVRA 3PQ2A 3DONA 4DWVA 3C6QA 3BHMA 3OHSX 3TNFA 5I7OA 4KITB 3DDZX 4Y30A 3UFXB 4EA6A 1YOVB 3V9AA 2HU2A 3I5XA 2QROA 3GU3A 1GLNA 2OBXA 2VH5R 3VU3A 3OJCA 4L2IA 4BZZA 4RVFA 1O9GA 3CNLA 4ZOBA 3WGZA 3GA0A 4TKVA 4L22A 2QW0X 3KU1A 4DLNA 1LY1A 4MGIR 3AEZA 5CIWA 2VJOA 1KMHA 1VG8A 1Y6GA 3ZS8A 1PLLA 4O2BB 3OCYA 4RA9A 4ZAXA 2RHBA 2QVBA 4AZSA 2NO6A 1Z5VA 3ITKA 3L5KA 5C8YB 3IAEA 2NVWA 3S2YA 2QN9A 1RRGA 4GM4A 4YP1A 2XUJA 4HJXA 4J1QA 3B12A 1U2TA 3I4LA 3ICEA 1G9SA 2ZK7A 1XG5A 3IOYA 1T1JA 2NTNA 1NVAA 2JFYA 4C0LA 5FI5A 3UXHA 3ZOZA 3CNBA 3KQOA 3EUFA 4YJGB 1OB5A 3T06B 3GEPA 4MCIA 3ZJ4A 3OY7A 2XSZA 5FYQA 4N18A 1Z33A 2WSSD 3C70A 3I4FA 5B2EA 3E58A 2O57A 2GO7A 3KYBA 3RFFA 3RG8A 3QX9A 3KFXA 1W4LA 4Q21A 3VX4A 2ZEJA 1EXMA 1HORA 4FOPA 3GMDA 1ZD5A 2IE8A 4LGVA 3C3JA 5FV7A 2QNBA 2VOJA 3OQHA 4UM9D 3R5XA 1CLUA 4JBHA 1ZJZA 1SWWA 1JDTA 1RFLA 1OSNA 1W49A 1DX4A 1JJ7A 2QF7A 4HGZA 1IUKA 1M67A 5GZ1A 3KVNA 1NBWB 4LZJA 5E6SB 2RIRA 5IZ4A 4C43A 2BN4A 3Q7QA 3ACBA 1L1RA 2VZLA 1JFFA 2ZRBA 1QUEA 4W5TA 4PSAA 4I3GA 2VQEB 4FLFA 3ZEAA 2CL5A 2OY0A 2J5BA 3PP8A 1U2DC 4ZZ0A 3AEKB 3OQOA 2JJ2A 1OJ7A 2X8LA 4XWOA 2CUZA 3OZFA 4LDNA 4TTAA 2DYKA 3NEAA 2WWWA 1NJSA 1RLMA 2XNDA 3BXHA 4YPFA 1V4VA 1XZNA 5A7HA 5IFLA 5GAJA 4TWBA 1XNGA 2PWZA 4JNKA 2GJ8A 4HDSA 1UANA 4P1ZA 1QE5A 2F48A 1DWUA 2JHFA 3KEGA 3MBOA 2WD7B 1W87A 1NVDA 1ZRMA 1US8B 1YQWA 3ETJA 5LYYA 5C3MA 1WA5A 1KZ6A 4ZYVA 3UCEA 3IQXA 3UCFA 1KOLA 4Q1EA 4ARZB 2I6XA 3HDJA 1N6HA 2VJCA 2ISCA 1N5MA 2XWSA 5K51A 3ZY5A 1NKSA 4TLAA 1CT9A 3CX3A 3DE3X 2X6QA 1UPFA 1GTZA 2ZSKA 2HW8A 3MGCA 1VDMA 2C4VA 3K0SA 1FVHA 5EWLB 1XNHA 1KF0A 2QZJA 4LECA 4RU1A 2BCJQ 2AJLI 5IVIA 2ZDGA 4X90A 5IYZA 2H1OA 5EP1A 3I1YA 2QLLA 4BFXA 3D8UA 5D5QA 3T9CA 1SXQA 3SSNA 1NOJA 2R4QA 1MRNA 1ZAKA 3IEPA 5L4NA 1HX7A 1RWNA 5KTOA 3CKMA 1BXZA 2YWHA 3LPAA 2QN6A 4TWAA 2OFFA 2RH9B 1I4OA 1P62B 1YRLA 3MFQA 2XA2A 4HQLA 2I2CA 4BQSA 3A05A 4QXPA 1HNWB 1UIRA 4PFKA 4MW1A 4EY5A 3FOEC 4BEWA 5DWDA 3N9IA 3LLVA 4YREA 1KOJA 9GPBA 1SZCA 5FULA 2R68A 1IJBA 2C3MA 2R1VA 2VQ6A 4U8GA 3CVOA 5CLHA 5L4LA 2O0LA 1C9YA 4L8YA 4HGOA 5JMPA 5T4EA 1YL7A 3A4VA 5IAAA 4N8EA 4NBSA 1Y5IA 1SBZA 2DCMA 1CB7A 3U1TA 1A71A 1VHJA 5G4LA 4WKBA 4EVQA 2ZUVA 2Y27A 4O2BA 4CKXA 4QREA 2HT1A 5C8YA 1LS6A 5F35A 2EX1A 1KL7A 2BM0A 2JRLA 5BWMA 3WGLA 5DISB 1K8QA 1RMYA 2GB4A 1P0MA 1PKXA 1RZRA 2VZEA 4WZBE 2ZSBA 1W8IA 3I45A 3HGMA 3QENA 4URUR 4Q9IA 3RRYA 5A5FA 2CJYA 5K4GA 1E5VA 2B1GA 2QRKA 1EEHA 3T1OA 1QYIA 1GGEA 1HT3A 4YJGA 3FF1A 3B9PA 4IRUB 3PEVA 4IIEA 5KDLA 3KTAB 3F3MA 4YRRA 4DWWA 3O4VA 5IEBA 1CD5A 4EDHA 2JIRA 3QLTA 5FBVB 1VKRA 3THSA 4BMPB 4CFSA 1VI5A 1CY0A 1RI2A 1LSSA 3DEJA 3I2IA 2WILA 4R40A 4HB4A 1OWLA 2VVTA 1ZK4A 1NPYA 4MRRA 1EVIA 1TRHA 2PAFA 2QLNA 1VHDA 5CX4A 3GGDA 3OD1A 1UR5A 1GQYA 1PBNA 3HHPA 1KSGA 3R7WA 2PO5A 3OICA 3HB5X 1KJ9A 3FN4A 1E94E 1NBAA 3HYCA 4IICA 3D4PA 3CRW1 4IS2A 2B5VA 4GZ6A 4KDEA 4PCAA 4QOHA 5E6SA 3ENVA 4MP3A 521PA 4UCWA 3COPA 4B3TB 1XL1A 1MA3A 3I04A 4V0OA 2OZEA 5CB8A 2JD0A 1A8HA 1Y0BA 1R6XA 1Z56C 2QJWA 3OQ6A 4X93A 3WS7A 1KDOA 1TA4A 1PQ4A 1Z5WA 2Q5FA 1QO0D 2WDZA 2YVKA 3AEKA 4TS9A 2P62A 3UN1A 4NL4H 4UBNA 4PZEA 4IDNA 4A27A 1P75A 3QPCA 2QB5A 3EC2A 3P2YA 4QZVA 2D54A 3A3KA 5JS2A 1A98A 1IXYA 3IBTA 3L6BA 1OIXA 1LI7A 1SD1A 2WF5A 1WE2A 2ZG6A 3A9WA 3HDGA 4MWTA 4TMVA 4F85A 2ZBFA 5F52A 3CSSA 3CF6R 1ORRA 1BFDA 3IDSA 1O08A 3K2EA 4X62B 4QWMA 5I9LA 3TM5A 1WF6A 3JQBC 4OHWA 4XCXA 1US8A 2AEJA 5ALJA 1HQCA 2D4HA 2NQ8A 5A4AA 3ZGZA 1GZ5A 1TKAA 2ZE7A 4ARZA 2EGUA 5T64A 4YCLA 1TM5E 4BXOB 1HMPA 3DOUA 2A5YB 2JGJA 3JQ9A 3A6EA 1R3DA 1WMDA 1SXJA 1BE0A 1I7LA 3N6XA 4ENSA 2FW8A 2PDAA 2IYAA 4IGIA 1S2IA 3QIAA 4J75A 5DHSA 2X0NA 5U4XA 3E2PA 1EP2B 4MAMA 2IU0A 4RACA 1KSHA 2C0CA 1MC8A 2C5SA 4JUAA 2VZ0A 4YGYA 1HXHA 1IHXA 3KAPA 4D26A 2JCBA 2RKWA 4R5MA 3ZVKA 4YJDA 5BW4A 1HBJA 2X23A 4KI7A 1IAQA 3NW9A 4MP6A 3WK9A 3VJMA 4AY6A 3PLAE 4LVCA 1KC1A 2OGTA 3FRHA 3LW8A 3B8EA 4ND7A 5H80A 4QDZA 3Q5EA 3G23A 4D3DA 5T4FA 5CYPA 4YUZA 1Z8DA 5EXDA 3R8XA 5LQCA 4ZVNA 1YGYA 3LUDA 4I4CA 3SD7A 4OCZA 1U0EA 1J2UA 1Y6RA 2GJAA 3G1UA 3HEAA 3KCNA 1LLCA 3LLMA 3MGBA 3ZBPA 1CWUA 3IB3A 4XM2A 3U7IA 3JU3A 2PUBA 1VL5A 1YONA 3F9CA 4J0EA 1S3FA 3DYVA 3E3MA 1IY2A 2RSLA 5T41A 1PLJA 3E8MA 3EXIA 1ODLA 1T9CA 4EI8A 4BZQA 2OUIA 1E0SA 4BTEA 4G2NA 2JFGA 3ZDEA 4NNOA 4PAQA 4U5QA 4W1QA 4DUYB 1HOXA 2ODEA 1QXSA 1Z5PA 5HX7A 3V2HA 1U0OC 4I9GA 3Q7IA 3N0XA 3NS7A 4YT4A 2RKOA 1WABA 2YW9A 2RGUA 1Z15A 4WFIA 4EQ6B 1HNXB 3SIRA 4YMLA 3I8XA 1ZJ5A 4KUEA 1R15A 1KRHA 3O83A 4Y2SA 1X0XA 4PGHA 1D2EA 5BQ3A 1UKVY 4CCAA 3AFNA 1EE2A 1JU4A 4HEHA 3H9EO 2GMWA 1GO2A 3IP7A 2BM8A 4CNQA 5JNTA 1CE8A 1OTHA 4UXHA 4Y7DA 1RAIA 1T2UA 1HE3A 2ZM5A 4E33A 3QFFA 3KTDA 4OBBA 3C4VA 3DUFB 5T5QA 1PFUA 1K6MA 2DULA 5DSXA 1DHTA 3QEJA 2M1XA 5ADHA 3AHIA 4J0QA 1NUPA 2OHOA 5ARDA 2P1RA 3K09A 1VL8A 3AXTA 2IS1A 1LLQA 4MUNA 3OWOA 4MQEA 4I81A 3WNBA 3JVIA 3QKSA 2GAJA 4YA6A 1UMDB 3AEYA 5F9MA 3PUVA 1T4CB 2D5BA 3PGVA 5FDFA 3AOEA 2J6HA 3F6YA 1I3CA 3BFXA 3GLUA 4UPDA 2Z4TA 3FB4A 1JJFA 3M6MD 1GUZA 3KZKA 2A9PA 1U80A 2V6MA 4Q7EA 2ZI5A 1C0LA 3H19A 4OYLA 4P4SB 1RI1A 4YMTA 4WWHA 1AS3A 1Z2AA 1NNI1 4YT2A 1NATA 1XJ0A 2HWXA 3HB1A 1WJGA 1XZKA 4FWIB 3IUEA 3HE3A 3Q8KA 1LWOA 3DOEA 16PKA 1CRQA 2R6DA 3EEIA 3LHKA 1GYRA 4PG6A 4U6NA 1WIWA 1HYQA 2O2CA 2ZT8A 3KL2A 2ECKA 4NI5A 1P5HA 4BXOA 3BREA 3BMCA 4DMKA 3B1JA 5GINE 4WNYA 4JMLA 3L1UA 1M6EX 1QIEA 2EG9A 2RHMA 4Y0NA 3KFLA 2MYUA 4Y1EA 4AIRA 4EW2A 5BXYA 1EPUA 3T7KA 1IB0A 1YQEA 2J4DA 1MVLA 3B6IA 5IULC 2WVAA 4JXXA 4HS4A 1CBUA 1E2FA 4YTEA 4FS8A 2G09A 2JK1A 1T0IA 3AM3A 4K87A 1BCSA 3EMBA 3O1JC 1VYUA 4NDNE 2JKYA 1NVEA 1M0SA 2RHDA 1UBFA 2ZBDA 2OXCA 4X1OA 3GLRA 1ZM2A 4KXVA 5LOVB 4PGMA 5TS3A 3IJPA 2I78A 3VNAA 2P3OA 2JBHA 5LIPA 1XD9A 1TU4A 2H3HA 2VT2A 2HQSA 2WUEA 3BWBA 3COWA 4MQ4A 3IXQA 2W6PA 2VK1A 5BT8A 1XNRB 1K6EA 1L4MA 3VTAA 1M6VB 1KP9A 1RWKA 3KQVA 3C1OA 2IXBA 2O5RA 2WHPB 3OLWA 1IEWA 1A77A 1MLDA 2DF8A 3MT8A 1RS0A 3JQ6A 5JWOA 1YAJA 2Z8XA 1T3GA 4MYSA 3WLFA 2VATA 2BJVA 3G2IA 2P90A 3E3NA 2FWBA 2GZSA 3O8RA 1ZINA 1HDCA 3NRBA 1MJGA 3F3KA 3OZUA 2BELA 4MX8A 5J4VA 1YBVA 3VAYA 3M6VA 3CLSC 1NP3A 2P41A 3EPJA 1SBIA 3PD0A 5HFJA 2DECA 3DPUA 4AECA 2UYHA 3RLIA 3AESB 4FNMA 5KNDD 2H17A 3NIDB 3SZUA 4AI6A 3DDWA 4AT1A 5BV0A 1OIWA 1T8YA 4PZ9A 4EQ6A 4AS1A 3H8VA 5DBEX 1QC5B 2V3CC 4F4HA 3W8EA 2YV2A 1ULHA 1CUEA 1FUYB 2J8ZA 3O1HB 1PEKE 1PR5A 1KZ7B 1WCV1 2VDWB 5FA8A 2AR0A 2AJDA 1MZPA 3CGGA 4QTXA 2QG6A 1FNSA 2JGDB 4BDTA 1UBLS 4MUKA 3V7UA 1NUUA 1T1RA 4YFYA 1MB4A 4BV8A 2WSSA 4KR9A 1N5RA 3DE1X 1T5SA 3DUFA 2R2AA 3C1AA 3SIPA 3TRFA 3B2NA 2CVZA 3KB6A 4RE6A 4B82A 3K6JA 2WKQA 3AG6A 5DWVA 3IAS6 2AVNA 4ZO7A 1GGHA 1ONOA 2AHRA 3PT9A 3N7UA 4CM8A 3NHLA 1ND6A 2X77A 1UC4B 2W90A 3H3JA 4IQFA 1UMDA 4J76A 3TMYA 1YZYA 1WNTA 3B9QA 1T4CA 3GA7A 1N1EA 5JXWA 3IAS1 3AR9A 4QSHA 5FAXA 2JDID 4UTRA 1NW5A 1YIAA 2ZUBA 3PFFA 1J8DA 3C3DA 4FYIA 5J1TB 3WV5A 2NXWA 5BV1A 3W04A 2OC4A 2OMKA 4NZOA 2C7PA 2JIZD 5IT9A 2AX3A 2Q28A 1UL1X 3AOGA 3FVTA 2GNPA 2H5JA 2HJSA 2ZSDA 3GN1A 3F7NA 4IDEA 3TOCA 3W77A 4CNBA 3LX5A 4TWRA 5C51B 1BDIA 3STVA