4D97A

Salmonella typhimurium d-cysteine desulfhydrase with d-ser bound at active site
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
328
structure length
327
Chain Sequence
MPLHHLTRFPRLEFIGAPTPLEYLPRLSDYLGREIYIKRDDVTPIAMGGNLRKLEFLVADALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLDLFNTQIEMCDALTDPDAQLQTLATRIEAQGFRPYVIPVGGSSALGAMGYVESALEIAQQCEEVVGLSSVVVASGSAGTHAGLAVGLEHLMPDVELIGVTVSRSVAEQKPKVIALQQAIAGQLALTATADIHLWDDYFAPGYGVPNDAGMEAVKLLASLEGVLLDPVYTGKAMAGLIDGISQKRFNDDGPILFIHTGGAPALFAYHPHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords D-cysteine desulfhydrase
publication title Structural and Mutational Studies on Substrate Specificity and Catalysis of Salmonella typhimurium D-Cysteine Desulfhydrase.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 121
structure length 327
sequence length 328
chains with identical sequence B, C, D
ec nomenclature ec 4.4.1.15: D-cysteine desulfhydrase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d97A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d97A02
1WDWB 4ZU1X 4NU8X 5T6MA 1BKSB 1WKVA 4AECA 5J43A 1CW2B 1KFKB 5B36A 5DBEX 5I7RA 1PWHA 1F2DA 5DVZA 3IQHX 2D1FA 1FUYB 1O58A 4L27A 4D99A 2ECOA 3R0XA 3V7NA 2EFYA 1KFEB 2V03A 1C8VB 1KFCB 5EY5B 1CX9B 2ECQA 3CEPB 3HMKA 2Q3CA 4HPJB 5IWCA 5BW6B 2TRSB 1RQXA 5B1IA 4D9MA 2CLLB 1TZ2A 3SS9X 3VBEA 5I7OA 1J0AA 1VE5A 2Q3DA 2CLMB 2ZR8A 4HN4B 4ZU6X 1TZJA 1K8YB 3X43A 2ZSJA 1BEUB 4D9NA 1FCJA 1A50B 4HPXB 4AIRA 5B55A 4HT3B 2CLOB 2TSYB 4D9CA 2C2BA 2CLIB 5D85A 5DBHX 1Z7YA 3VSCA 4HO1X 1V71A 2CLKB 3PC2A 4D8TA 3VSDA 4JBLA 1K7EB 4XUGB 2RH9B 3BM5A 4D96A 3AEXA 1C29B 2GN1A 2ZPUA 3PC3A 1TTPB 4D92A 1PWEA 1K8ZB 4LMAA 5I7HA 5CGQB 5C3UA 5I7WA 5IXJA 2TYSB 1K7FB 1TZKA 3L6CA 4ZQCB 5B1HA 5I7AA 3T4PA 4OFXA 4Y6GB 1TZMA 1QOPB 1TDJA 4D8WA 2PQMA 4D9KA 1KFJB 2J9ZB 1J0EA 4H27A 3ZEIA 2JC3A 5DW3A 5JJCA 5E0KB 3RR2A 4D9EA 1A5BB 2DH5A 1TTQB 1A5SB 2GN0A 4L3VA 4D97A 4D9BA 1J0DA 3DWIA 1UBSB 2BHSA 2O2JA 3TBHA 4F4FA 2RHGB 4L0DA 1JBQA 3IQIX 4NEGA 4COOA 2BHTA 4D9GA 1KFBB 1X1QA 3PC4A 1K8XB 4D9FA 5B3AA 4LI3X 5B53A 3AEYA 5CVCA 2GN2A 1K7XB 3R0ZA 2EGUA 1WBJB 1K3UB 2CLHB 1OASA 1Y7LA 5D86A 2C2GA 4D9IA 5DW0A 2O2EA 2RKBA 3L6RA 3DKIA 5J5VA 3X44A 1Z7WA 1VB3A 1UINA 3IAUA 1VE1A 1TJPB 3DWGA 4LMBA 4QYSA 3PR2B 2J9XB 4I1YA 4OREX 5IW8A 1E5XA 3IQGX 1KL7A 2WSYB 4PCUA 3L6BA 1M54A 5JISA 1P5JA 4D8UA 3VSAA 1J0BA 2CLFB 3SS7X 3VC3A 2CLEB 5D84A 3SPXA 5D87A 3FGPA 1A5AB 1TYZA 5KZMB 3FCAA 2ISQA 4JBNA 1D6SA 5HBGA 5I6DA 2DH6A 4KKXB 1QOQB 5KINB 1C9DB 2Q3BA 1V7CA 1UIMA 1V8ZA 4IL5A 2J9YB 4L28A 4WX2B 1J0CA 1WTCA
chains in the Genus database with same CATH superfamily
5BUCA 1PF7E 5KNDH 3B1JA 1LPNA 3F3SA 4KI7A 1NVFA 1LNQA 5HPYB 2VDWA 2XGGA 3FPJA 3NV7A 2OHHA 7ADHA 5CFQA 4RK0A 4Y6OA 3YASA 1J21A 2ZRLA 4ITUA 2BP7B 1TVKA 1H6DA 1GRNA 2VF7A 2WHRA 3CGWA 4BVAA 1JEQA 3LYHA 1YR2A 2QXTA 1E2JA 3AB3A 3B7PA 1VHTA 1KI2A 3QEKA 5FI5A 4B6JA 1YCDA 4OM7A 1A96A 3BGIA 1BS2A 2PMKA 2ZRAA 5JXGA 4KXNA 3KE9A 1YK1A 3EIUA 3JQPA 2R8ZA 3PRJA 3RYTC 4BV3A 3NDRA 5BW4A 2HA2A 5CH3A 4IW3B 5CLLA 3SC3A 2A3RA 4ZYTA 5AW7A 4DBLE 2R47A 1SRQA 3OE5A 1OX4B 3EPHA 4MVCA 2XRYA 3HLTA 3LPNA 4N47A 3EEIA 4GWGA 4W8HA 4CQMA 1Q0QA 4NMXB 1EVIA 3QSYA 1DVRA 2IYQA 3FLAA 4REQB 3SEZA 1DFGA 1NUPA 2W2OA 2XTAA 3AKYA 2NW6A 3IJ5A 3SR3A 3DMNA 1MRZA 2Q9UA 3F8WA 4MV5A 5NULA 1ECLA 3DNFA 3L4BC 4N9WA 1L7AA 1M1XB 3ZG6A 2AN9A 2SKEA 1W1UA 3X1KA 1P4GA 3P19A 3FYUA 2FSHA 5EWLB 4P93A 5KOJA 1G55A 5JEEA 4CQJA 3RFFA 3BKXA 1AGXA 5HIIA 4MQBA 2VTVA 4MDEA 1HO3A 1EK1A 3U7RA 2QN7A 2MSWA 3C6XA 3KYIB 3SHVA 4ENTA 3BAZA 3IEKA 4TL6A 1MKYA 1Z5UA 2GEDA 3ESZA 3MWGA 5JIBA 5K8LA 3RSZA 1D0IA 1L5OA 2XSZD 1SHJA 1EA5A 3C4QA 2AFIA 2H9AA 3C97A 3NTUA 5JVDF 3DLPX 1SC6A 2XNCA 3CO5A 3L4JA 5DM1A 4IG9A 4AJJA 2QB5A 3C39A 4NL4H 3TD6A 1Z0UA 3A6ZA 3FMPB 4XARA 1HKUA 3B2NA 3EULA 1QIKA 4I81A 4NFHA 3WGHA 3WRXC 4LV5B 3ESBA 3FFAA 3EWAA 4IMIB 1GFZA 3NHSA 4IKPA 4OJMX 1DLJA 4LHZA 4KL8S 3BTSA 4S3MA 5E6UB 3WLAA 2BFPA 4LMRA 3L7KA 3SSMA 3VOSA 4NZYA 1F17A 4WBSA 4TLBA 3EQ6A 3GFOA 1R74A 4EITA 2BH2A 1QS0A 3X44A 1KIAA 3P5BA 3S2SA 4F7DA 1NF8A 4DV2B 5DU2A 1VG1A 4LW8A 5THQA 3ZIAD 1XHEA 1K7CA 2G1AA 1WM1A 2ABWA 3F74A 1QJCA 3PI7A 1RDFA 5FTNA 5K2OA 3M4JA 5ECWA 1T36A 3VR4A 1JDPA 1FFXA 2QUZA 4EECA 2FPKA 1CUGA 2CNWD 5A02A 3W5VA 2OGWA 1U3UA 2EXXA 3L4BA 4JYBA 3A9TA 1MBZA 5HE8A 5IDQA 1D03A 4K2AA 4PQYA 3W5DA 3VKVA 1XKTA 1EXMA 2WNIA 4GO1A 3U4GA 3TG2A 1J23A 1N1EA 2P3LA 3ZWWA 3OT5A 4ZI3A 1Z83A 4YAUA 5EUBA 2YXBA 5A4DA 1K98A 5TC4A 4KZPA 1YV9A 4EUSA 3AM4A 1X1DA 3PGJA 3W2TA 1HK7A 1P0CA 3MIIA 4JZYA 4NFSA 4BVBA 2DSNA 3H4TA 2SBTA 1BXGB 1ZGZA 3AGQA 2ATXA 4S0ZA 4P53A 3BXFA 1JL3A 3W1VA 1CUIA 3C1TA 3CNHA 4RTJA 1O5TA 5CD9A 2H2GA 1SOVA 2C9BA 2O2ZA 3MXOA 3GPIA 1HYHA 1UZLA 4YBZA 3UJ7A 4EYEA 4KGDA 5F9HA 4Q0MA 3K0FA 4JXZA 1LBSA 1QQ7A 4H31A 2F8MA 3WRXA 2NO4A 4OXRA 2LP4Y 2RC6A 1LDGA 4E13A 3BXPA 2HQSA 1GTG1 3GAAA 3CMMA 3TH5A 4UPDA 2D7DA 1ZS9A 4L6IA 3WSVA 1NIJA 1IVSA 1GUBA 1TZJA 3H42B 3IKVA 2A5LA 3HKBA 3O5AA 5CA0A 4F7WA 1I0ZA 5CD1A 2IKSA 2XDAA 5KC9A 1IBLB 2AYYA 4II3A 2CLOB 1M7BA 2FUKA 2IKQA 2CLSA 2HH9A 4X3OA 2XYGA 4I55F 1HDCA 3Q1LA 1SK8A 2QKYA 1KYXA 4IICA 3S29A 3T7DA 1K7EB 3LYUA 3NAQA 3HCBA 1O0SA 3MRXA 2H1CA 3ORQA 1ZP6A 2Z2YA 4KJXA 4UAGA 4P08A 3T7IA 4MV1A 4WKCA 1P4RA 2VDPB 4KIJA 4AX4A 5D5PA 3G5TA 2JA2A 4PG7A 4GGMX 2B1QA 2Q2VA 1QH8B 1JQEA 4NIMA 2BSAA 3D2AA 1EFRD 4X1KB 4WADA 3W3ZB 4ACBA 3E48A 4G86A 2Z4SA 4LY6A 1QIHA 1E2HA 4H16A 4NP6A 1NVMB 1XXHA 1BCRB 1GRQA 2C4WA 3OEED 4Q82A 2D8MA 3SXPA 2ZW9A 1IM2A 2HEIA 3G8BA 5K8JB 2MDTA 3L06A 1ACLA 2IYYA 4YJ2A 2I4MA 3DTTA 5JD5A 3FIJA 5CX4A 4OSOA 1VPWA 1CU1A 4Z9YA 2BEVB 3HDHA 3DFZA 3OIFA 2GYVA 1E7QA 2VOJA 1XCPA 1YRQA 1UPCA 5KYVA 2D0PB 3QG5A 5TS3A 5GIOE 1LBQA 3KO8A 3PPYA 4JMLA 3ET5A 2A0FA 3DPSA 4N39A 4QHYA 5B53A 2F8SA 3ER8A 3G02A 3R1IA 2HA5A 1NU6A 5AVUA 3M1YA 3WLMA 3ZXXA 5BY2A 1KDYA 4R69A 5K8CA 1QCZA 3AM1A 3KZNA 4C22A 4GKAA 2JARA 3NS7A 1MA0A 4LYJA 3W9YA 5F2EA 5DMHA 4B45A 1ZNXA 3RS3A 4CIXA 3EYWA 4EY5A 4AQ7A 1YFJA 1NONA 3EBOA 3SR4A 2OD2A 4HRAA 3SF8B 1VLHA 3H2HA 4DZZA 4AZ0B 3MJVA 1RYHA 1FIUA 2OECA 1U9ZA 4RY0A 1TAQA 3FPHA 1G5HA 2GZSA 1UAGA 1XVUA 3B52X 3CLKA 2JFZA 4UUBA 3WLHA 4B7AA 1J2RA 1F12A 4OHFA 3TUZC 2PVCA 2XH8A 2KQUA 5FV4A 4G24A 5EXDA 3CLTD 1TRHA 4W5HA 1GRVA 4J7CA 3DWEX 1MDBA 3OCVA 5IKOA 1URPA 4MR9A 1NHWA 3IV9A 1YOVA 4RVUA 5C1IA 1WPRA 1RADA 3OA0A 3RC1A 4ABTA 1SZCA 1OJ7A 4NNOA 1L4GA 3ZWOA 5KQSA 1A7KA 1V5GA 3MWDB 4RKEA 1EM8A 1IHOA 3UHAA 3I3SR 3OG9A 5FJIA 4E08A 3EPRA 1U0OC 4TYQA 5EMLA 3TOXA 1U1EA 1G291 2MSEB 4FE4A 1H2AS 4YONB 1XCOA 1JYSA 3K5WA 1NW9B 2FWMX 3O84A 3OFJA 1ZL2A 3N2LA 3UIEA 2JIBA 3IMCA 4IGIA 1VG8A 4CFSA 1CZLA 5DYTA 4Z1MA 3WGVA 3ANXA 2XCLA 2ZIEA 4UZEA 4B76A 4K9MA 1L4BA 5FA8A 5IWCA 2FZGA 4B34A 2R7AA 3DHNA 3CTPA 1U7DA 3H8VA 4MVJD 4N5MA 3NNSA 5AHKA 4FYJA 3OOYA 4CI0B 1LWNA 2PH7A 1B6GA 4IV5A 2H3HA 4BNGA 4RVCA 2D4AA 2DPXA 3CFYA 4HGOA 1M8KA 1E5LA 2EZ4A 1USVA 1DKQA 4A5OA 2IEZA 1EUDA 2BBSA 5D7NA 3JWIA 1QQAA 3PHGA 3A4TA 3DZGA 2QHXA 2QMHA 3THRA 4AF6A 3OTQA 4NRDA 3EZ9A 4D74A 1FLVA 1RP1A 3ZJYA 3CTMA 5CA1F 5CYPA 3REGA 4ON9A 1KGSA 2R4UA 1PJ2A 2FJPA 4NDZA 2HAEA 3GVIA 3UUWA 4NE2A 3MGGA 1ONOA 3DE2X 3UMJA 4NCIA 3BQNB 3FUCA 4XGIA 2QQEA 5BW8A 4H77A 1BIFA 3EW9A 2P5UA 3QU5A 1G21B 1MH1A 4MGKR 5F1KA 3G2MA 3K96A 1CE8B 4IDPA 1Z6YA 4MQ4A 4NBLA 4G4SO 1OXTA 5J59A 5ALKA 2A0UA 4RSGA 3KP1A 4EAQA 4MVXA 3MWJA 3ZPXA 1BWRA 2OSVA 2NTVA 1M7GA 2JASA 1S3SA 2XD4A 4QO7A 1WD5A 2W2MA 1AKYA 4D9GA 4UC0A 3STXA 1FJGB 4FJ1A 1PDWA 2Q1WA 3IEIA 4M99A 1UJNA 3FYDA 1I1NA 1AV7A 4JHXA 3LTNC 3FG9A 4WN9A 3K0BA 4RJJA 1HX7A 4ENUA 1JFVA 1JTVA 4AY2A 1KEUA 3C4JA 4ZU3A 4C07A 1H0SA 2PZKA 4HDOB 2C7PA 4IRUB 1EFVA 2JHPA 5TGDA 3CMCO 1K4KA 1QMPA 2EWVA 1ZSNA 3SOPA 4C3OB 3L3BA 1U2ZA 1X0XA 4AYWA 5IP5A 3TTTA 3NDBB 3WI7A 4L85A 2Q28A 2GPAA 3K92A 3I53A 5LYJB 3B1VA 4RIEA 1J42A 4YR9A 2NACA 2DHRA 2QBYA 3L9WA 4XVCA 1J1ZA 1FPMA 4L57A 4TTRA 2YWFA 4PW0A 5DBOA 1TECE 3FMFA 4QULA 2IEDA 1J20A 2ZYRA 1ARZA 1VGVA 3GJTA 5FUWA 2GEUA 3FVTA 2NTYC 1N8NA 1A4IA 1SIUA 2C95A 3LHIA 4Q16A 4B1FA 3R7NA 1EP9A 2GNAA 3TCNA 3FPLA 2V6GA 5KOHB 3EZLA 2C59A 4FGZA 1OB2A 5KTTA 3MMZA 1C7JA 3OOWA 2W6CX 1G5QA 4RNCA 4Y67A 1SAYA 4AKEA 3C3AA 1A8HA 1G64A 1GUAA 2WRZA 3B3GA 1GAEO 3F8TA 4JDUA 1NRWA 4OP1A 4HDKA 1DC4A 1T0JB 4L08A 3IAHA 1P7YA 2ORYA 3LY8A 1IIRA 4Y7DA 3WS7A 2QA5A 1GT91 2CE2X 4QTZA 2Q3HA 1PW5A 3K0AA 1N92A 3H9QA 2GCNA 3FWHA 1Z2NX 4ZCMA 1WCXA 2GWRA 2Y27A 1COZA 5EMHA 2GEJA 4XWWA 3GT0A 3U80A 5ALMA 2E7ZA 4KDCA 1MPXA 1SELA 4WBXC 5KC8A 2DUMA 4MGYR 2X1LA 1THZA 1N6PA 5GONA 2HMUA 4DMFA 4PZ0A 4LRQA 4XYLA 3PA6A 1NURA 2DU8A 3AJDA 2GZHA 1F2UA 3A3NA 3QU7A 2JLRA 2P65A 4AO7A 1AKEA 3GFFA 5KTSA 3C6MA 5AVWA 5I7VA 4GRDA 1GKIA 1VIVA 3UJBA 5BVGA 3CF4A 5EQFA 3U9LA 4HLDA 2R751 5BWCA 4S1WA 3EXHC 2HF2A 1UJMA 4FBLA 5DTQA 5TVKA 3DO8A 2R65A 4IP0A 4KP7A 3NPMA 2HLPA 2BGJA 4PQGA 3BHNA 1RE0A 1T15A 2BGMA 2CVHA 2VTBA 5BN4A 1XRLA 5FTWA 4DLPA 1Q1AA 1K4YA 2P4EA 3O2SB 4FNOA 4DLVA 4D81A 1GNTA 1N6OA 3C48A 1FSZA 3MQ2A 3LT4A 1YR6A 5A5VA 3OKFA 1P1BA 1CS0A 3HJUA 4LF8B 3WVNA 1KJNA 2PO5A 4FFDA 3HTXA 1JLLB 4ZRMA 3KT8A 5IHXA 1ZD2P 4RD3A 3MMXA 3ZQKA 5L7TA 3CSSA 1P19A 3CURA 4UXHA 5BWOA 2PUAA 2CC2A 3R7WA 3ZCQA 4R1SA 2WEKA 1YJQA 3N0WA 1YR1A 4MTCA 2AZ4A 2ZWAA 3LC2O 4C2UA 2AEFA 3CSUA 4S1TA 4ZIRA 2ENWA 2O0MA 3RSQA 4DLTA 2BR3A 2OORC 1LFDB 3O1LA 1UMDA 3PNQA 2CHUA 1MOQA 3BIFA 4H4CA 4EHNA 3PX7A 1KFBB 4FYIA 3WIBA 3TL3A 2HCTA 5KTMA 4OAQA 3P1JA 2OV1A 2Q5EA 1Q95A 1TO2E 1RKQA 8ABPA 3SEQA 2XZOA 2HK6A 2EF0A 4JUDX 3B9QA 2XODA 2ACWA 3Q88A 1VMKA 3BF7A 4M9QA 4E6EA 1JIUA 3BIJA 1G3IA 1ZA1A 1U0EA 3AY6A 4Q3KA 2CDBA 3DVRX 2B37A 3SZRA 3AR5A 2JLYA 2H4YA 3AG6A 4MUGA 3EXHA 2J9XB 3CNLA 4HDRA 3BJIC 5HKAA 1MC1A 3KYDB 4QIHA 4UAVA 4Q15A 5CRIA 5H82A 2AQHA 1NIPA 2QN3A 3CYFA 3HHEA 6REQA 4G0XA 3PDIA 1J0BA 4PV7A 3I9JA 4DJJA 3FGPA 4YP7A 2GQ0A 1E79D 4MK4A 4TWIA 3BEDA 3WIOA 3DEZA 3X1DA 2JAQA 3GN2A 3PEWA 1Y3DE 2EX4A 1XYYA 2WD7B 4WESA 3IKTA 2HQBA 5F4ZA 2YV1A 4C4SA 3I73A 2J9YB 3G0DA 5EKDA 4WBNB 1N5KA 3R44A 5FB3A 2H4ZA 3IX7A 2B99A 1P7ZA 3B3QA 3BN3A 4HS9A 3HB7A 4YT4A 4Z4FA 4DTCA 1QZ3A 1S6YA 1IH8A 2J5KA 2YWEA 3KFVA 2CJYA 1GTRA 1QTQA 3VU8A 2VPXA 1RI4A 4DHEA 3FZQA 3IL2A 1ETUA 1J49A 1JEAA 1FPQA 1NW7A 3A6LA 4M21A 5E9WA 2PL5A 5TE9A 2PX8A 5T3YA 1LF0A 3G2QA 1WU8A 4OJQA 2OORA 5AVQA 2M6SA 2B9VA 2CVPA 3VC1A 4A9AA 4TV9A 1QYIA 1V37A 3VX4A 4MKRA 4KQ6A 3AHGA 2Q1XA 2VDRB 2QMOA 3EGOA 4Z4CA 1L8XA 5FOUA 3KUKA 5JAQA 1BE0A 3RODA 1NC3A 3WBBA 3O4HA 5JHGB 5DDIP 1Q1ZA 2WJZB 2V7GA 3JW8A 5CHYA 2RK4A 2JNWA 4LV8B 1MR3F 4KNWA 5D6OA 1YZKA 3OEYA 4QBTA 3U3DA 1U5BB 3RLFA 2ORED 3VO1A 5B7NA 4RLQA 3Q40A 4C06A 3HI6A 1WF3A 1P44A 4I9HA 3B1ZA 1YONA 3KT3A 1DAGA 1UKYA 2HQOA 3NRJA 3PXXA 4LZLA 1CQWA 3PHIA 3GOQA 3L77A 1MO2A 4RZIA 3EE6A 1DCTA 3ULKA 4R5MA 1QQ5A 2PGJA 1QK5A 1ZHHA 3Q2OA 1LV7A 2NUBA 2YOHA 2V4UA 4NE9A 2XB9A 2ZJFA 1JG4A 3QOYA 3QV1A 4MA5A 4TMWA 1TUBA 3UV3A 4BVHA 4FGJA 2GN1A 2JFHA 4P5DA 4M7OA 1ORWA 3E1KA 2W6ID 5KYXA 1QPZA 2UVPA 1K6EA 1X70A 5FI0B 1NBMA 1P0QA 5AXAA 5DIZA 5C80A 1IXZA 3UG6A 3WLKX 2QZSA 3FR7A 3K8YA 2P6MA 3TZEA 3FSGD 2C2YA 2JAHA 1JIKA 3AO0B 4CKEA 2PIAA 4FFMA 5ENDA 1OB5A 2V0NA 4QD3A 2Y4OA 3MCZA 1T5IA 2HUNA 4YT8A 4NENB 1TU0A 4MULA 4JEIA 5E0KB 3AUYA 3F9RA 3I2FA 4LBZA 5DYNA 1OZHA 1SJ9A 3ORRA 3KZXA 5K3DA 1VDZA 5IC5A 2UVDA 2LIVA 3T5DA 2J6IA 2QG4A 3NLLA 4W7SA 1GPMA 3V4OA 2QTWB 1VHJA 3MRVA 2GCPA 1QP7A 3PDCA 6ABPA 2HDOA 3AF0A 4HRXA 1X7YB 3KJQA 3VR6A 3AEUA 1GGFA 3RYIB 1TMGE 5A2GA 2NQ2C 5DNUA 2OL4A 4LZPA 1TYDE 2BL4A 2V4ZA 5CK4A 5GONF 4EA9A 1TM7E 1O94C 2B8EA 1OXBB 2YOFA 3UC5A 4PTZA 4RTMA 1DS6A 3MD9A 4NABA 1YWGO 5BW5A 3W05A 1KAHA 4M3NA 1JAIA 3QWIA 3B1FA 1EE9A 2JBAA 4YV2A 4GXQA 1KTIA 4DC0A 1RHJA 2KMLA 1G7TA 2PH5A 3E61A 2HRZA 2JIQA 2AC4A 1WCYA 2RI6A 3L5KA 1DHRA 1RLTA 1R16A 1CR1A 4TV8F 2XD9A 5L53A 1KI9A 2GFIA 3AY7A 3LBAA 5IBQA 1GQYA 4ZOLB 3SPXA 1DL5A 5F9MA 5A7FA 3C3WA 3COSA 4UHKA 4RENA 4PY2A 5ER9A 4K9KA 3EJ6A 3HADA 2FETA 2Q6IA 3EGCA 4X9XA 1X0VA 3NHBA 4YR7A 3AR9A 3T52A 1TRKA 4A6PA 2XUPA 1AZWA 2ODTX 1U1IA 2I34A 2J9RA 4DV3B 4JR2A 5DKFA 5LLSA 3IGFA 1R6XA 4JR0A 2QM7A 1RRVA 3WMRA 3H9EO 4JT8A 3EVDA 1BKSB 4GMHA 1WUYA 4MSUA 1LSJA 4BVEA 3CLSC 2AG5A 4QL3A 3I9FA 4DG5A 4G63A 3W7VA 3GEMA 5GADl 4R0NA 3D6JA 3OC0A 1GZUA 2C99A 3I8OA 3IUJA 5C1PA 3H6KA 1BHQ1 1G0NA 1NFFA 2NQTA 2IV2X 3ZHYA 5BQPA 3SN6A 2BRUC 1Q1EA 4EPTA 1LQ2A 1X19A 1FVXA 3W8RA 1KK1A 4UW9A 5E2BA 3EGWA 1K06A 1O94A 4FI3F 3K9BA 1G38A 5J5CA 1Y1PA 4R3UC 2C92A 2CLMB 2IUFA 2ISSD 2P79A 1Q83A 1ZLYA 2JVJA 4MMXB 1A2KC 5B64A 1QAQA 1H2YA 3GRAA 1WPXA 2PGLA 5CR9A 3T99A 3AFIA 1WPQA 1AF7A 2XUHA 1QIEA 3VR3D 5C46F 5AW1A 2G7ZA 2IGTA 4NCAA 4CW7A 1WDTA 4JMPA 2P11A 5JAZA 3I5AA 3KQSA 4XFKA 4KITB 1XMIA 2EFCB 2Z95A 1P73A 4JI0B 4E33A 1G42A 2Q1TA 1RQLA 1Q92A 1YB6A 2JFGA 3KJNA 5BYBA 3ICOA 4XDYA 1GGNA 4BQSA 4BUJA 1WHSB 2VA9A 4KE8A 1XHLA 4GVLA 3BWCA 2EZ8A 5ES4B 5JCXA 2WYVA 5I4IA 4JLSA 3BJMA 4QJIA 2XA9A 4U2BA 2AQKA 5EHQA 3OT4A 2ZYSA 5KSPA 1AUPA 1EG2A 3IHKA 4NAUA 3WL8A 3P0FA 2OILA 3ASZA 3VNRA 2GJKA 4R2JA 5FBWB 5CDGA 8OHMA 2NMVA 2PKYX 3ETGA 3UGQA 5JJCA 3LC7O 2OVFA 3DF9A 1K63A 3ROZA 4OXKA 4AT1A 4F9EA 5B6JA 3IQWA 4D97A 2O0KA 1PE0A 3NALA 4LXYA 4PX3A 3JQAD 1DKMA 3OLWA 5CBPA 2FV8A 2HOQA 1AHPA 1NQ5A 1X1RA 2FPXA 3E5NA 4IJ5A 5F1PA 4EQ6A 2BRUA 1FYFA 3QGMA 3QE9Y 5IKMA 4C0JA 1A2OA 3LO8A 1X3SA 4LI3X 2WABA 4IEEA 4QOGA 2JLBA 1B2LA 1SU7A 2HU2A 4R2XA 4AP5A 3I1FA 4M1MA 5CM2Z 4IDBA 1OW3B 4BASA 5JAMA 4EMBA 2MINB 1XZGA 2LUOA 3HEAA 2EAUA 4KTTE 2I4TA 5T3UA 5SZJA 4DCPA 4JVMA 4NCBA 4LYYA 1ZJWA 3QBEA 5ANRB 4ES6A 4ZZ2A 2ZM5A 1PT5A 1BE6A 3EZGA 3SHFA 5E6SB 4YRFA 3V1MA 4CLRB 3HM2A 2OO5C 4NVRA 1NMXA 3D6UA 4CT4B 1N6LA 4WA8A 2B7BA 2WG1A 4MVJH 3WGLA 1ZHFA 4QT4A 2AL7A 5JZVA 4HVTA 4HLQB 3TPZA 5KZMB 2P6OA 1IB6A 5HK8A 3ZIUA 3STUA 4B2YA 4Z6KA 3IO5A 3MAAC 1W8IA 5AVXA 3H86A 5LIPA 1OLSA 1UOPA 1U8XX 2J6BA 4LTNA 2O7VA 1E9RA 4RABA 4YCJA 3VU0A 3ZU6A 1PVOA 1JAYA 1NW6A 2YXEA 2G4LA 4Y8VA 1T4MA 2C5GA 3KSUA 3LOUA 1ODIA 4TN5A 1CR2A 2E85A 3D6HA 4KQCA 4Q9DA 1NA5A 4O4IA 3D0KA 3H5WA 3QWAA 3UANA 1AO3A 2AOTA 5CNKA 4G8JA 2G1UA 1SUWA 2W9XA 3UK6A 2NVUB 3N3BC 1PL6A 2O7SA 1MABA 2ESRA 3G82C 3VPSA 4X65B 4K0KB 1IULA 4YRCA 1P2SA 2QRQA 3PE6A 5IUKC 3D59A 1GQRA 2P9GA 3WL5A 5JSKA 3WYGA 5REQB 4NHEA 6CHYA 2ZR0A 1RRMA 1T9BA 1G4HA 3RSFA 4L3OA 2VSQA 3BK7A 3BQMB 1IWPB 4BRZA 1M10A 1U9IC 2IPOA 3OOEA 1V41E 4ZDWA 4AFNA 3R9XA 2F4NA 3LFHA 4N5NA 3C85A 4UBNA 2XQKA 1MNAA 1VTKA 3AR7A 4EBBA 1Y4ZA 1CP3A 3LVFO 4XWTA 3DQZA 5E3JA 5B3LA 5ADWA 1PL7A 3QHPA 2A0XA 2B20A 3PFHA 1MNQA 2OMEA 1I8TA 2OO5A 1P18A 2ZSDA 1Z37A 2VYVD 2CFSA 2QTNA 4KRXA 4MUFA 2BFDB 4UMDA 1ZVVA 3HU1A 3G17A 1D1PA 3D43A 1QFYA 4YJKA 4RTRA 1B8VA 2NYRA 5IKPA 1Y8RA 4IF4A 4PLZA 4YRKA 1HE4A 2A5GA 2FUG1 2R9VA 4YRIA 3TPCA 1IOLA 1B3BA 3M4YA 4FFPA 3GUCA 5FIUA 5CLIA 4ZXPA 4DTIA 5JW6A 2TMDA 1I5EA 4I5FA 4Y2YA 5B1HA 3UNXA 1NY6A 1RWPA 2JANA 1XVLA 3E9DA 3AF3A 3C6BA 3NHRA 4KR0A 1SC1A 2Z04A 2RONA 1M2HA 4E07A 9ABPA 3THWA 1ZUHA 4W9RA 3SE0A 3HJGA 2XKBA 3K4HA 2XWSA 4INPA 2Q6LA 4HAWA 1U7PA 2BEUB 2WM8A 3RSCA 4Z9BA 4IHQA 3ZV5A 2ZUSA 4A7PA 3B12A 4X24A 1MT3A 5DLDA 1BE1A 2JJ1D 3U3RA 3PD7A 3DT6A 4YXWD 1JAXA 1SU4A 2OEPA 2V65A 2VJCA 1DT3A 3D5EA 4COOA 5KJ6A 1OWMA 3FVWA 3BVPA 4NULA 4YFYA 4YUXA 5LA6B 2B5VA 3VO8A 4M22A 2VHZA 1QIFA 2E2WA 2WICA 1U9IA 1F2VA 3HVUA 3WHKA 2B4AA 1K3UB 1R4MA 2V7QD 4BN5A 5D86A 5AKXA 2JH9A 4N3GA 2WYOA 1M6VB 3ZTWA 4GI1A 1ZN7A 3BAFA 3L2OB 2RHTA 5ENZA 4OJTA 4PFSA 2IT1A 5JCJD 1A88A 4RTOA 4FLEA 5JJIA 1LRJA 3LMKA 3MINB 5LM3A 2WOJA 3ZGYA 2DWOA 4C6RA 4RULA 1VIMA 4YRBA 1ZIPA 4YRJA 1MAWA 1OVGA 2WSYB 4ZI7F 4N3AA 2MSDB 1OX6A 2N1MA 3FMVA 4BVKA 1JJVA 1W4LA 3VTFA 4R0MA 3G2JA 3X0DA 3D4IA 1KIFA 1KMCA 1Y8QA 4XIGS 3L01A 3PNSA 2ZIXB 1JEDA 3OCJA 4FYMA 5IT0A 4GBGA 2VTDA 1ZC4A 3Q98A 1KO4A 4QVGA 3WK9A 2FPLA 5C8VA 3CLRD 1L4UA 3E7XA 4RK6A 2QD4A 3GAZA 4DCGA 3RYCA 4KPYA 4AMGA 1IMOA 1HE2A 3HYSA 4OO3A 1YUNA 3INYA 1X1CA 2W11A 2WKPA 4DSOA 1ZK1A 1QIGA 1UH5A 5AH0A 2VWPA 1NBHA 3C3XA 4LNHA 4RMNA 4N48A 2JCVA 1JZQA 4CJXA 3VKWA 2EFEB 3D2CA 5JPIA 3K1AB 3GAFA 4JLVA 2HK9A 3ZKWB 1M6EX 3EY4A 2CUTA 4XR9A 4KLCA 3DEAA 1TPZA 1C3VA 2C31A 3KKOA 3PQEA 4NZPA 3BRWD 3SSOA 2VHJA 4U5XA 2WM3A 3DBVO 1MJFA 2NV6A 4CM9D 3KUDA 1IHPA 1N2XA 1MMFB 5EY5B 3WRVA 4KVFA 3CWZA 5DNDA 4DPKA 1HRKA 2AZMA 3T9CA 3UMFA 9GPBA 3JQQA 1Z62A 4Z86A 2WIGA 1JQDA 1QRUA 2H6EA 2J0VA 2ODAA 4ZOBA 1G5FA 1W4RA 2L82A 2QNIA 4N1AA 3A1WA 5E1MA 5SZKB 1CNEA 2QTGA 2GMWA 5JATA 2C9OA 1FQOA 3RM3A 3D2LA 3JQ9C 5B55A 1IEQA 3G79A 4M8NE 3CWCA 2UV8A 3LRTA 3EXFB 4OXIA 1Y9AA 2VNAA 1H2WA 1CY8A 3F5QA 4FEYA 4KAXA 3OWOA 5IS2A 3Q9NA 3TS1A 4GQAA 4WZAE 4JLMA 2B94A 2WSLA 3TECE 4DQKA 3WP0A 1ZGHA 3KEFA 4R05A 1MH9A 1XKLA 1F4PA 4K9QA 1L4HA 2AW5A 2Y99A 1IXSB 3PGLA 1EFLA 2HGSA 3FXAA 4DR7B 2ERCA 1JDVA 2Z6QA 2C4HA 3CY6A 1YU6A 3DL2A 1AS2A 1C1XA 1ZNYA 2ORIA 1JEYB 3EZNA 3EC7A 3LWNA 1C1DA 2Z5GA 3I92A 3KU1A 1JYFA 4O4LB 4C5CA 4HUJA 4BEWA 4Q3OA 1MOPA 1U4NA 1YB7A 2HN9A 2ZSHA 4LTDA 2AR7A 4F2PA 4G0PA 3IKMB 2W4QA 4F6RB 3N28A 5EHGA 4EZIA 2OCGA 3D8RA 4M7RA 4XOIA 3S2UA 3I62A 1MC5A 5BMVF 2R8OA 2VT2A 3KAPA 5E6RB 3QX3A 1RYFA 3AL3A 4XQGA 1M0TA 4UVGA 4RGVA 3WA7A 5F4BA 1EJ0A 2B4YA 4AP9A 4IG4A 3R0QA 4MV7A 4NOMA 4RV5A 5FPPA 4JI1B 1TU4A 2MMGA 2OENG 4JLOA 3RKRA 5KYGA 4F4CA 1XCMA 2CJFA 1P1KA 1DWQA 1MCZA 2AC2A 2X41A 3FNQA 3JQ9A 1ANKA 1R5JA 4LVCA 3V8NA 3SEAA 3FZNA 2AC7A 4AURA 4C7KA 4E7PA 4EKYA 1GL3A 4I4TA 4C6HA 3GBSA 1KYWA 5B4TA 3HFSA 3BIXA 1C3JA 1ZH6A 3BGSA 1PEKE 4O4JF 4QARA 4AN0A 2Z1NA 4NMMA 3GZNB 3K6RA 1PNOA 2X23A 2HMWA 4Q1FA 4X92A 4QBKA 4G4IA 3PXGA 2I4OA 1DJQA 1I2DA 3TW8A 1G8MA 1E99A 3L0OA 1AUQA 1YL7A 4F38A 4JJ6A 2WFMA 1GU1A 3L0ZA 4Q6WA 6NULA 2NUTA 3EF0A 1YCHA 3PJDA 3FPGA 4V0SA 3ZWCA 1FQWA 4BGDA 3FFXA 3TO5A 1BOOA 3WAGA 4PCLA 1N6IA 1Q3TA 5FCDA 3DDNA 1CJUC 3CLUD 3JR3A 3OLZA 5AVZA 1CYDA 1UM9A 3IRVA 3PYLA 1JMVA 2AOUB 5LLTA 1LQUA 3BL6A 2JD0A 2IUSA 4B5LA 5AOCA 4HQRA 1P0FA 2WB2A 4IMJB 3HDQA 3HJHA 1GN9A 4YMWA 3SXJA 3AEKA 3V7NA 2IQIA 2HHLA 3N1UA 3W90A 1FFEA 4DILA 2DPLA 4RDXA 3Q6IA 4L5IA 2AN3A 4RORA 1DRJA 5H9WA 1KS9A 4ZWNA 3I39X 1W25A 1VZ2A 4GPAA 1UPTA 1Y5IA 3SYNA 1U1FA 3COWA 3NAMA 1V8OA 1K08A 4KLAA 4XLTA 1O9HA 4TWZA 4HFMA 4HLCA 4DLZA 5F77A 4BMYA 2ZSAA 4QU9A 3WGUA 1JHMA 1YIAA 3KOMA 1E8MA 1SD1A 3B9RA 3QY0A 1H0KA 1WXGA 2HMSA 1RW4A 4B6SA 5K3FA 4Q9AA 2J6CA 1YASA 4PG6A 5JQWA 3DCYA 4RZ3A 1FP4B 4U63A 2PZBA 1KR5A 5KVQA 3BWVA 4TROA 4Y6PA 1P29A 3GLRA 5TPZA 1Z2AA 4D0RA 1GPH1 4RF4A 1H3FA 2DBZA 1OYVA 2WZDA 4EG3A 3OF5A 2GDZA 2O14A 2NXNA 2SKCA 1EZZA 1JU4A 4IRXA 2X19A 4L4XA 4QECA 1Z74A 3OU6A 3BFKA 1AZSC 1F20A 3KKNA 5CB0A 3BFVA 2DQYA 3E58A 5ESDA 2H5IA 5HK9A 3U7GA 3DFFA 2P6RA 1WS6A 1KAMA 1DO0A 5E8JA 5LZ7A 1P91A 5F7ZA 3PSHA 1BE8A 2CXTA 1QB8A 2R2GA 2LVBA 4AJ4A 1Z0DA 3BH0A 4H7KA 2OBXA 4RPIA 2B4KA 1XT6A 5H59A 4BJ6A 3J80A 4OUDB 3TQTA 2HHHB 1GLVA 3C8UA 2F1KA 2I78A 4BBAA 1MD9A 4NQZA 2RGYA 3ONFA 4BP9A 2E87A 2NTEA 3M5CA 3COJA 4AU1A 1RFLA 5KYYB 2NWQA 5CLFA 4Y3UA 1P2VA 2PAAA 1DMSA 5H3LA 1N5JA 3IBYA 3GARA 5LP6C 1ISGA 1JHVA 2F9LA 5KCMA 2G3YA 2Q7DA 1H2RS 4ODIA 1O6ZA 4XUEA 3H0EA 4BQNA 4IHJF 5GY7A 1GKKA 2JI9A 4KQ1A 1RQ2A 4AJHA 1NXQA 4WFKA 5K0TA 2YVLA 3AM3A 4UVDA 4IJQA 1OXKB 1FMCA 4WK6A 3STVA 3HVHA 4CTKA 4IR7A 3H97A 1FFCA 4RIHA 5LZ9A 3DOJA 5ALOA 3G5MA 1AKVA 1EK5A 3NHAA 5BQOA 1RYDA 3TINA 5LDHA 1Z6ZA 2AMVA 2EW1A 1YQXA 4P4SB 1F0YA 1K6JA 2A1UA 4DWJA 5JCOC 2QIOA 3K9LA 3FWYA 2ATCA 4DY6A 3LKDA 5L3VA 3E1GA 4QOFA 1J6UA 1ZH8A 2MSLA 2R4QA 2G80A 1QCYA 1EVZA 3D1JA 3IDQA 2IVFA 2EL9A 4FTWA 5LZ8A 1HYEA 1AQNA 3FOEC 1MENA 5HUQA 2JGFA 1JQ5A 4RFLA 4EL5A 1ECGA 3AHEA 3KKQA 1UBRS 1MFPA 2MT9A 1P3JA 4R8SA 4KK3A 4W1RA 3PX3A 1T3ZA 3A3OA 3RTCA 3WK5A 1UAAA 2C84A 4V24A 3BBPA 2PMCA 1LQTA 3COPA 3TEMA 3GFPA 2O8VA 3LDFA 4LZAA 4TTQA 3UMMA 4P38A 1F0KA 1UKZA 2ORWA 3BGDA 4Z0HO 3T3IA 3WLQA 2V7UA 1EFKA 3DP9A 4X3PA 4I1VA 3WICA 4CMAA 4X97A 2YZGA 3ASVA 4R1LA 5J43A 5JALA 4CCYB 4AWAA 1BXZA 3CZ9A 3W79A 3DD5A 1G0OA 3GYBA 3GAMA 4Z7JA 5FOSA 2CL0X 5LP6A 2O8BA 2I9PA 4EIWA 3MQ4A 4DLBA 3AETA 2VDMB 4J1SA 1YBAA 3OUUA 4Y2GA 3G8AA 4HF7A 4KYTA 5FYDA 1NG1A 2P2ZA 3IHTA 5K4HA 1BXRB 1VGRA 2XUOA 4O4HA 1K6IA 1O1YA 3R0IA 4AYTA 3VBEA 3HP1A 1J39A 4KODA 3ZWAA 3THYA 4G07A 2GTHA 3KB2A 4LSZA 3CIFA 1KEZA 1XB2A 2ZRKA 1JXMA 3JATA 4F8EA 4L2IA 6AT1A 4IOKA 1W7AA 1EDBA 2YN2A 4ALIA 1LI4A 2H4HA 5HFJA 2X0NA 4ZGWA 2CLKB 3I83A 1TAUA 2VQ6A 3N7UA 1RJWA 4GC9A 1YMQA 4OAPA 4BBPA 1SUSA 1Y6ZA 4FW8A 5CTAA 3THOA 1TQ8A 1GU7A 1E62A 3LHDA 4KPUA 4EPXA 2QZ4A 2PUBA 1DOZA 2QVYX 4GHWA 4KFUA 2VPIA 4RQUA 2FX3A 2I66A 1N78A 5IKEA 1DIRA 1EP3B 3NHMA 5J2TB 2QRUA 5T6BA 4BB6A 2QX9A 4ZHQA 2QORA 1MJGA 3TRIA 3WIEA 4MP3A 4QYIB 4X44A 1J4AA 2JVIA 2CF6A 3O8OB 4AL4A 3UPUA 4Z5XA 1QH1A 5DHUA 2XT9A 3ZVNA 2IF2A 4MXDA 4KV9A 4X8OA 1UBUS 3MMNA 4DDTA 3DDWA 3B1WA 4EJ6A 5KYUB 1E1QD 2P68A 3FDZB 3HV2A 1HNWB 2RD2A 2XGMA 3OSUA 1K8XB 1EA7A 2DLDA 2V5AA 3EEYA 5G0WA 1FLDA 4E2YA 2D1QA 3SCZA 2QUAA 4F2DA 1R8YA 2I91A 3MXTA 4DWOA 3ZHRA 5EP4A 9MHTA 4X8LA 4B6RA 2FVYA 1L5GB 1QF6A 1J22A 4C0HA 3DGEC 2IV7A 5B7GA 4E12A 1ODFA 4RO0A 4KR2A 3GP3A 4NZOA 4UJ3A 3ANYB 1UWVA 2FHSA 2YICA 2ZSFA 5DM60 5C8YF 2I99A 5JSFA 1R8JA 3QE4A 4Q03A 3AVPA 1U65A 5F78A 5CGZA 3TQCA 2JKZA 4UU7A 1QORA 2P90A 2V9ZA 3VZBA 4Z4IA 3QHQA 1VJGA 4E4YA 4KFCA 1GA6A 2DP4E 4YMLA 4LJYA 3GVXA 4MVYA 2G07A 2V7WA 3O2JA 5B3KA 3GPCA 1FY2A 1C7ZA 2PUVA 4OQFA 2GK4A 4FDMA 4WEOA 3RS2A 3TLCA 1Z4OA 4DJAA 4Q5IA 4EATA 5L7YA 5AW8A 1TMYA 4IIEA 1KVSA 1OUMA 2VBCA 1RKXA 1ZU4A 1T8UA 3IQXA 3O03A 5DCWA 1IYZA 3ZK7A 3ZZTA 1P62B 1Z75A 3HCWA 1TQ2A 2FWIA 4RKFA 3K05A 1JH8A 1GCUA 1ESDA 1I5RA 3EASA 3RRZA 3LC0A 5IJ9A 4AS1A 2Q5IA 1MC4A 3UEOA 1E2LA 3KTOA 2WG0A 4BQIA 3FR8A 4RMJA 5K0BA 1NW3A 4K6MA 5ALLA 4NCJA 5KYWB 2P4QA 1HG0A 3Q12A 3PNVA 2JKVA 4GUAA 2ZS8A 1KH3A 3QEJA 4HFNA 4RZSA 3TNLA 4DDKA 3NOVA 4TYPA 3N2KB 4L6AA 1GLNA 4OU5A 4AG3A 2QP3A 2Q3CA 4MWTA 4V02A 3ZCVA 1FRNA 1SHUX 1A98A 3LRPA 5FA6A 3TPFA 4D4MA 1GKYA 1G6Q1 1SHKA 1XTVA 2EBWA 2ZGVA 2GB4A 4YRNA 1XZIA 5EIBD 5FUYA 4FLFA 1NQVA 2IC5A 4JBHA 4H7DA 1ENOA 4R8VA 4UXIA 4EHKA 5IF9A 1JBEA 1J8YF 3AVOA 2BCEA 3NBUA 4Y2TA 1T5LA 1FUEA 2A9RA 5AWFC 3WWCA 1EP1B 1A9QA 2PQ2A 4XM1A 5KNCA 1AD2A 2NXWA 3JSAA 3NKLA 3BA6A 3PIDA 2Q5JA 2BHLA 4YRGA 3RUAA 1QHHB 3EDRA 2VNJA 4GMGA 1Z8DA 3WKAA 3F71A 3OLVA 2Q4RA 3K94A 2WJ6A 5ECGC 3H9CA 1VG9B 4J4BA 2H07A 2VIIA 3THXA 1FS4A 1ORTA 1P8AA 2YNMC 2A9FA 3UJ6A 3AVVA 5F3RA 4PCVA 3HC7A 3K9HA 5DK6A 3SDBA 4NYJQ 5KTPA 4OQYA 2CUKA 2RH4A 3F6SA 4Y1EA 5DZSA 4WZAB 3RVOA 5FTLA 4IS3A 4NFYA 5MFZA 2DE0X 3DM5A 3RIEA 1Y3IA 1TKCA 3KZCA 5DGDA 4EY3A 2PQ0A 4MQ6A 3BERA 1LCIA 3ELWA 4WUTA 1L3CA 2OV4A 4IH1A 1NYLA 4B46A 5K6RA 4F1JA 4YH1A 3KBOA 1AKUA 1N0IA 2JGLA 5CJJA 3CCCA 3JCZA 10MHA 5JNSA 3EH2A 3INTA 4FYWA 1QX3A 1NUAA 2P4UA 3U44B 5DTRA 2I4IA 4KFRA 3W6NA 3UK0A 1WDMA 1XRRA 1C0EA 1P0PA 2ATEA 2YZKA 4XB1A 3FE2A 3ZN2A 3Q8KA 2NUPA 3L02A 2CJWA 1I9CA 5BSHA 2J5QA 1XZJA 2RGUA 4H9GA 2IXTA 4N03A 3RQSA 3C6ZA 1RXUA 2OE2A 4LSMA 4MJ3A 5ALEA 2ZYVX 4EKDA 1Y1KE 2ZRFA 2QE6A 4R8LA 3VDMA 3TM5A 4D41A 2ZYDA 2I87A 3IAUA 3NGXA 1PNTA 2X13A 4KB5A 3GDFA 4FC6A 1L4EA 5CVEA 3DTVB 4A15A 1FXWA 1GTSA 1E5XA 1U80A 3H87A 4RV9A 1PX0A 4LIPD 2C4UA 4L0CA 5B58C 4K03A 1NF2A 3I0ZA 3GEHA 1XZPA 1H0RA 1T1JA 2RKOA 3E22A 3WYAA 4P3KA 1WU7A 1T8SA 3C4VA 4PRKA 1FBNA 1BVRA 4DWVA 2X77A 2Z2JA 4LDAA 1WDLA 2QNRA 1XOIA 1HKHA 2YNMA 3KSMA 5ENVA 1UQTA 4IIBA 4HUQB 1BFDA 2VJAA 1X94A 3AR8A 5H02A 5BSWA 5KSWB 5ALPA 1NSFA 4PNPA 2PY6A 1A1SA 1VMEA 1BD4A 1ZUD1 1Z6PA 2C61A 4UTVA 4F3NA 1C80A 3GFTA 4CKZA 3IEPA 4G0QA 3PYMA 3MFQA 2NSHA 1XQ1A 3W0LB 1QIIA 4BLSA 3S8EA 4A0SA 4HH4A 4TSFA 3H3XA 4QUAA 4QYXA 3CR3C 3MJFA 4G9GA 2A9JA 1Z2DA 1WSWA 1WHTA 3G5LA 2VJMA 5FNVA 4D56A 3LQYA 4D99A 3RROA 4LS3A 3FNRA 2RK3A 1SCJA 2HB6A 1YK0A 2ASVA 4R68A 1UC4B 4JKOA 1CZRA 1ESCA 3ILHA 4W9NC 3RHSA 2IYVA 1O6BA 2AEEA 2AEJA 3IP3A 4YJGA 4D8XA 1ATIA 1JRLA 1RJ9B 1OLOA 4UEJA 2XMBA 1KWGA 1KH1A 1FQJA 3DUWA 3PHCA 4N5HX 4RD2A 3LECA 1TZ2A 4CG3A 5JRZA 5HTOA 3DE6X 1UBNA 1VIAA 3EOBI 2GPYA 5IAGA 3PL5A 2J3DA 4GM1A 1ZN9A 1QFMA 2P27A 4RHTA 4FYXA 5IYZA 4GR5A 2DWCA 4DCJA 1XTUA 3MIZA 1O6FA 3JARB 4LBYA 4RMGA 4HT3B 2A1TS 5JHHB 2CL5A 4BLUA 4ERNA 3WK8A 4YBRA 5T7BA 1NP3A 4EHHA 1PK9A 3NWJA 4BOYA 4I2NA 1EJBA 4OSPA 5PNTA 2PE5A 2NZWA 1EE2A 7MHTA 1QHSA 4FMPA 4XKJA 4XRRA 4F3RA 2KB0A 2IPAB 3O26A 3OEHA 1MXHA 2GZ2A 3KPJA 2V8OA 3QIVA 4TKUA 1D04A 3H11A 1IPHA 3SM9A 1XNGA 4V0MA 3V9PA 3W06A 3TUJC 3OHMA 1SZJG 4WDQA 1DIBA 4W8GA 1GCIA 3HK2A 3QVJA 2DG2A 3STTA 4L9SA 4X6YA 4ZCRA 5B2EA 1I0LA 4HX5A 4C4PA 4DC9A 5JR3A 4DEXA 4DR4B 3WFIA 3AUFA 2J9ZB 3E0QA 5K4AA 1REQB 2Z5FA 4UE2A 1ZW6A 2RE8A 3D4NA 2W00A 1N0VC 2H00A 3VPHA 3WGNA 1BOFA 3LY7A 4MUMA 1H9AA 1LTQA 2AW3A 1E9DA 1PHRA 4Q12A 3IOMA 3LYAA 3SC4A 1NQTA 2V1UA 2HZBA 5DYIA 3LVRE 3P71T 4W9NA 1F9EA 2A30A 3CPJB 4EJFA 5ADHA 4LCBA 4L5JA 4PNEA 1I7DA 4TV8B 4ZKDA 2O3RA 2P9QA 4F45A 3SQWA 1N2CA 3OURA 3JWEA 4YB8A 2X8LA 2WDPA 4TTPA 3TF5A 2REBA 3VVMA 2IHZA 2FP3A 1JWLA 3GGSA 3AJ9A 3JZDA 2FLWA 2MSCB 1E3DA 3SIWA 4DAOA 5KNBA 2YWCA 1FDRA 2N9UA 4M0EA 1GZDA 2ROQA 3ZE9A 4L4ZA 3KQLA 1VB3A 4TMTA 3OD5A 2Z9DA 2L69A 4OREX 3HV0A 1NJ1A 3IP5A 3PHBE 1JXQA 4JL5A 4CDMA 3CT4A 4MIKA 4V2IA 2DUNA 4RL6A 3FPBA 2O9JA 3ND9A 3URKA 3RT1A 1QG4A 1W0CA 2VBGA 2GM5A 1HQCA 4GEGA 5FWXB 3NXKA 4CEHB 1E94E 4II2A 3P4UA 1WCV1 3LPLA 1SO8A 1N9GB 5K3CA 1BA3A 1XLWA 2WINI 3KZKA 4RH1A 3WGYA 3MMSA 1YKSA 2I1QA 4PYLA 3LVQE 4NDNE 5I9MA 2PKQO 3DL0A 1C9KA 4G5YA 1TIKA 4U7GA 5EJ2A 1QGUA 3WQQA 4Q6BA 1LGYA 2W4MA 4KCGA 2DR2A 1DOHA 3ENWA 2WDZA 3FHJA 3LIPA 1PV2A 3EOZA 2IWRA 2BMAA 2G04A 2QT0A 1UJCA 2XWBF 4LF5B 4RKYA 2DB3A 2CDCA 1ZCZA 4WT7A 4QPNA 5AI8A 1KF0A 2QRNA 3H16A 3K70C 1FTSA 3TB4A 1R4NB 4G4JA 2JLZA 5KQMA 4R8RA 3C70A 3HZOA 4LCJA 1N5DA 3GRPA 3OE7D 3H17A 2AMJA 1PYGA 4B8YA 1L5QA 2M98A 3I4FA 4DWWA 3UF0A 2BF7A 4A8TA 1CX9B 3SX2A 3DVAA 1OFHA 2A7QA 3T1VA 4BV2A 3VPBA 4AXBA 1K97A 5BQ5A 3U9TA 2D7CA 5CCBA 3L7JA 2YDXA 1AS0A 1R6AA 2XDQA 1BMQA 2P5SA 1T4BA 4D26A 1TK3A 3OCXA 3N8GA 2C00A 3CH5A 3QLVC 3K1JA 1Y9ZA 4G4SP 3RVLA 2BF4A 1J2TA 4CLOB 1PJ3A 4KNVA 3GFRA 3FMIA 2QW1A 3R5JA 4IDEA 4CKBA 1HQDA 3IP9A 3W3AA 3BBLA 4IX9A 5AW9A 1FRZA 4JBLA 3QKIA 1U0HC 4OK5A 5CDFE 2FQYA 3KTAB 3F73A 5SY6A 2R60A 1WWKA 1T6NA 3M9WA 1GZVA 4JLUA 4TL9A 1KJIA 1QSGA 3RT7A 3VISA 1TTPB 3S2YA 1QE0A 4W5OA 3IAS1 4O02B 3KM0A 1U2TA 4QJ3A 4PU0A 2I62A 4HX9A 2GEKA 2ODPA 3OPQA 4YAKA 2GXQA 1W85B 2VH1A 1AS3A 1GPNA 4QPPA 2A8YA 2GD6A 3QUQA 1JBKA 3E3MA 2X3FA 1AHHA 4I5IA 4M49A 3LUKA 2QQGA 2WSBA 3R8XA 5DW3A 4YV7A 1SH7A 1PTKA 5BNWA 1F2TB 2WMOB 4FN5A 4U8HA 1W6UA 1QV9A 1A4XA 3PE3A 1SVMA 2BZGA 2RHDA 1L8LA 1JJFA 1PEYA 2GASA 2X8AA 3KWJA 5FNVF 1T5SA 4JI6B 5KUTA 4P9NA 1KAEA 5CK5A 3WDSA 2XEDA 1FA9A 4PBRA 4CM8B 3EA5A 4ZJYA 2AA3A 3GYGA 2XDYA 3TLGA 4JOBA 4BCDA 4UTRA 3CX3A 2GZ3A 3M4NA 4JS0A 4W82A 4ANFA 5FAKA 2QPLA 1SUPA 4XSGA 2VDNB 3ZU4A 1FX0B 2JK1A 4E5SA 5EJ7A 3VR2D 1IC6A 5DTJA 2ALJA 1H3EA 3ZOKA 4ARAA 1PP4A 2AF4C 3QLVA 4IF6A 5JXJA 2IBSA 4U00A 3LOQA 4R1NA 1KU6A 1Q7CA 5MGBA 1WP4A 3O74A 2RHCA 2NO1A 4TQ9A 1FUIA 4XLZA 1XQ9A 1I5OA 2XYHA 2AK2A 3LP5A 3I2HA 3I9NA 1N34B 4X95A 1JG7A 3JWJA 1OFVA 1AGNA 1QRAA 1IBRA 4RCYA 3UC9A 4XH9B 4X85A 5JSHA 1DJPA 4HDNA 2DOKA 3O8QA 4MCJA 3FZYA 521PA 2HCRA 3VKGA 4DLWA 1RKVA 3I76A 4ZVSA 2BMFA 4IMRA 1FNDA 2WKQA 1MB9A 4XCQA 4CEJA 4MV4A 4ERXA 4RPHA 1QVVA 3S2FA 1NLMA 4WW0A 4HNRA 3TZKA 3EB9A 4WRRA 3AU8A 4QM7A 3K6SA 1ZR2A 1IY1A 3HYNA 3DB1A 3UH0A 2ZJYA 1LRLA 1F5NA 5F5XA 4ZU1X 3ENVA 2CUNA 4YIHA 2KX7A 2WYHA 1BQ4A 3LT1A 4Q18A 4PSDA 1W0JA 3Q5DA 2ZG6A 4TMXA 2P69A 2R6GA 3Q7IA 5HILA 2C88A 3WGGA 4FT2A 1JKMA 1F0NA 1D4AA 4TUYF 5EJFA 5JCPA 4HDMA 4YCAA 5AHRA 1JSLA 3BWYA 3MAGA 4Z9AA 4PVCA 2ECQA 3NVMB 1ZR4A 4IDDA 1RQXA 4DGSA 3LU1A 2NT4A 1RZVA 1XA4A 3PFCA 1J7JA 4E11A 1JPJA 2ZR8A 5DWVA 1JZTA 4QNNA 2YJNA 4EHBA 5AW6A 3A1EA 3OX4A 4FINA 4A8JB 5FPHA 1SC4A 1TW2A 1XA0A 4EJSC 4GYKA 5ALXA 4ASUD 5LQMA 5JANA 1IY9A 1T0UA 2R97A 3H2GA 3NEJA 4OXQA 1X77A 3RO7A 3TJRA 3W8FA 2VVTA 3PC2A 2GZRA 2VSXA 4MPDA 1KARA 3JQ8A 4ZKEA 3VR6D 3STYA 3FNFA 3QE0A 4P4LA 4Z9XA 1BDMA 2IPNA 2KW5A 4GBED 4OBWA 2W6PA 5JDIC 5EXSA 3P20A 3ESDA 3B13B 1F48A 4IV0A 2IS1A 1Z08A 4Q21A 5JARA 2PXXA 3QXSA 2QD5A 3MS4A 1IUNA 4LOKA 3LW8A 4EJ2A 4W6ZA 4RVHA 2Z9BA 2K87A 3RADC 3ENZA 1IRXA 2F48A 3QFSA 3IHLA 4X91A 2QW0X 3QKWA 3ZK8A 2XKJE 1MORA 5AXDA 2HF7A 2H5EA 4MKFA 4EB3A 5KB3A 1M2EA 1OE0A 4G0MA 3LSYA 2EYQA 2WM2A 1CQJA 1N1MA 4KDFA 5IAAA 2Q3FA 2R5NA 3QMVA 2REOA 5FBKA 1L5LA 1QZXA 3GEIA 2Y1FA 4EY6A 2B4QA 2PV0A 2OZLB 1NE7A 2B21A 2QJOA 3MVEA 1JKXA 2X42A 4OHZA 2PKCA 1Z4QA 2BEWA 3IP7A 1M9NA 4C7MA 4FEAA 2VOEA 1LX6A 5CFLA 3EX7C 5AOAA 4RWEA 1RE1A 2B8NA 3W2FA 4O2BB 4QNMA 1EUYA 4H60A 2P91A 2VXBA 1X8LA 1RZRD 4KUGA 4J1NA 3QQ5A 5BRJA 5JMOA 4MICA 3FPSA 1XDGA 2JAPA 1I2AA 4QFBA 2XXAA 4Y2RA 1IHYA 4EJSA 1U90A 2D1RA 3EG9A 4GF5A 4F71A 4HJXA 4ND8B 3IXQA 5FPYA 4E5MA 2FSUA 2VXOA 2VDLB 2ZBVA 5AKEA 4NCNA 3PJRA 2BTEA 4N12A 4U2CA 2F1IA 1FDTA 4RTPA 4B84A 3R3WA 1VFPA 1Z29A 3T5GA 4F93B 1LLFA 3O2NA 5JDIA 4IM7A 1L5HB 4I9UA 1GSHA 1O94D 1C7EA 2EIHA 1U3GA 2UYQA 4A82A 1AURA 1PV1A 2UUAB 2I6UA 2ZTUA 4OQEA 3RARA 5CXUA 2Q0QA 1E9EA 1I80A 5FORA 5BWBA 2YBEA 4KVZA 1E2DA 3V8VA 4ROSA 1H1LB 2X6TA 3SX4A 3WMGA 4B48A 1SOWA 2BHRA 4OQZA 2JGRA 1UZNA 3KKLA 3KJHA 5C3UA 1XFDA 3OUTA 5AKZA 3EXEB 3KQKA 2JZNA 3TRDA 3ECSA 2BJHA 4TS4A 5KDOA 2Q4OA 4DR6B 4WOKA 2B9EA 3IIKA 4EFMA 4FD2A 2C2KA 4ZZ1A 5SYAA 4ND7A 2XWJI 1DMRA 5JTTA 5HF8A 3UW3A 2P41A 3EUWA 3EUFA 3PR3A 1PT8A 4HH1A 1DG3A 2P0YA 2QE7D 1OT3A 2P6UA 3UB4A 3L7BA 1S2LA 4JI3B 3V2UA 4QG7A 2D06A 1H4QA 4W7IA 1NXXA 3ZI0A 3T5CA 5EJ4A 2JBHA 4MKZA 1ZMOA 1T2UA 2OWEA 2XT6A 3IO3A 2VPYA 3N0VA 2G76A 4MUBA 3RBAA 2IHUA 3ZHQA 3OEWA 4BJ5A 1P9NA 4DNFA 2FSVC 3OMLA 4ND3A 3CX8A 4F12A 3G0OA 2QMUA 4U39A 3ANNA 2XUAA 3VO9A 1WCIB 2IHVA 3TLBA 2GDJA 3BD6A 5DNYB 4CKCB 2WHQA 3FI0A 2VF8A 3H4MA 1GKLA 4N01A 3SDZA 4JKIA 4MKGA 5J1TB 3NGLA 5ADVA 1KJ8A 4B9EA 1V71A 1J5XA 1XDSA 1W0KA 2X9NA 3VSDA 4EELA 4DZRA 5HQ3A 3ETNA 4ARVA 5U9CA 3QPWA 5KX5A 1TI7A 2R8BA 3UV7A 3T5MA 5JNWA 4DNQA 1YOBA 2CMKA 3U1TA 3GJ6A 5KNDA 3QUBA 1XF9A 4RACA 1GYQA 1OHHD 3RTEA 1MQ9A 2P1RA 4FHFA 5FOXA 1BDHA 3F6PA 3PVZA 1TJ5A 1IQPA 1OYYA 4HP8A 1P1IA 4Q4LA 3LCMA 4KO4S 3V7UA 3R7DA 1UDRA 1E5DA 1V4NA 2CYCA 3ISVA 4I50B 2XOEA 3QU4A 4QEZA 1SCBA 1RRCA 1NWHA 4PC1A 5HFNA 3NTVA 1Z7GA 2ERYA 3PNYA 4KX5A 3C3CA 2NO7A 4JOSA 2J7KA 4HEA1 3E05A 1FJHA 2C3YA 5TPWB 4WOJA 4JJGA 4LXXA 6ADHA 4M8SA 2AFHE 4R3NA 3ACCA 2DWUA 1RQPA 3OKPA 1FB5A 1YZLA 2Q46A 1PHPA 2I6TA 2XF8A 3KBBA 3M2PA 3O9MA 3GNTA 1UBGA 1UFRA 1VBMA 3M9LA 5LOVF 2BHTA 5EVCA 2WFLB 1BNCA 3GFSA 4UM9B 1JKJB 1DTWA 1IBSA 2G08A 5ICGA 4WAUA 1QHXA 3PD0A 4E4TA 1PRYA 4GYYA 2GJ8A 3SP1A 3TL6A 3EEQA 4BTLA 1B8OA 2FSVA 4BWVA 3V4LA 4PGAA 4RJLA 3C7AA 3HCOA 1PFQA 3L43A 4OSEA 1VE1A 2H18A 1E3JA 2Q6VA 4OVKA 1Z0SA 2FFQA 1T34A 3CS3A 4B4OA 3EGDB 4JXXA 2CXNA 3TW6A 2XYPA 1SWVA 5H0IA 3PLAE 4YQEA 3P9ZA 5ELMA 1OROA 3HBNA 5IN5A 2FQWA 3LRXA 4W1QA 1O03A 3OBBA 3TVDA 4BKOA 2CVZA 4DZTA 3FHCB 5A9SB 2GF9A 2XUDA 5AK5A 4WE3A 2ZSEA 1D6SA 2PL3A 4KKXB 3BHIA 3Q6MA 4PAOA 4BO7A 1CSEE 4UNPA 4FE3A 5A3JA 5AW0A 5HIAA 5IJ0A 4RUKA 1W52X 1JQ3A 2JF0A 1PQPA 2ODNA 4R54A 3PFKA 4DY4A 1TM2A 2ST1A 3IUYA 3PQ2A 4AMYA 2HEGA 1GNRA 1VJRA 3LVBA 3OQOA 1YA8A 3CPEA 3EHDA 3ERCA 3G2KA 3GUVA 2HA0A 4R8MA 4DMGA 2IA5A 3OQIA 1L4FA 3TI7A 4GSYA 5A5DA 3CW9A 3P9QA 4ZYUA 2D2IA 5H1YA 1KEWA 1E92A 1A97A 5HEKA 4AYXA 1KI6B 3DSRA 4MAMA 1EMDA 3LWDA 3IAM1 2O1EA 4KZKA 2QAJA 3WK4A 1OFGA 2AJTA 7REQA 1JHQA 3VSEA 1ZNWA 2F6RA 3PFIA 3VR0A 1N1DA 2PM8A 2J0QA 2P5TB 3ZX5A 4E94A 4XWOA 4TWAA 2BGWA 1Z28A 1CUFA 1G2PA 1RBQA 1Z8NA 3LUJA 1XWIA 2G9QA 3ROXA 2C9MA 3ZXIA 1DJLA 1LLCA 1XZMA 3F7OA 3DOFA 5LDDC 2UYCA 3OLQA 1YGYA 1SULA 1BFKA 2XUJA 2PX6A 4BVFA 4OK6A 4M83A 3H1PA 2HNAA 3L6UA 3N05A 3QOXA 1NZDA 1N6RA 3TM4A 3ZHCA 3BMQB 2IOQA 1C3OB 4RZXA 5TF4A 2C4TA 1EB9A 3HP7A 3BDVA 4HOYA 3C16C 1T8YA 1U7XA 5FWAA 4MLCA 4G23A 1W46A 3BSWA 4Y1GA 2D2FA 4ZFNA 1C9EA 4X90A 4N6NA 5I7WA 2G6BA 1FFBA 1X7XA 5FUVA 3DMDA 1M5TA 2HU8A 4AUKA 2ZE8A 4GPZA 5TR9A 4JBIA 4R01A 2J3MA 2GCIA 2JLCA 3F6BX 5D3MB 2B4TO 1A8IA 2V96A 3VX3A 4RKQA 3H1AA 3N5CA 4QGBA 2VUIB 1L3IA 3W5HA 5HHTA 2Z0MA 3UOWA 4DMCA 3TUIC 3DWIA 3VOAA 3BD7A 2HSGA 4CLHA 3GA5A 4YCSA 5CAEB 1UM8A 1JHUA 2HLNA 1BU8A 1ZISA 3CN9A 1V96A 1YXMA 4I9GA 1SUCA 4YLEA 4PC3A 3V2HA 2PGDA 3JALB 4I9FA 5I5EA 3QYAA 5JZOA 2O7QA 3ZY3A 2H8GA 3T7TA 1HNZB 2WILA 3QUTA 2F2TA 1O95C 1BCSA 2VL7A 2RAPA 4H35A 4JNCA 1JG2A 2OZPA 4Z51A 3IE1A 3FTNA 2FWBA 3HN7A 3P9SA 3HXLA 3D7MA 3KXDA 3NHFA 2UYYA 1SCKA 3P9YA 1TUEA 5J5VA 4EFLA 1PWYE 1UC5B 3VU9B 3BWDD 3C5WP 3M6IA 4I4CA 5A6SB 4P2BA 1KSGA 4LC1A 3TYXA 4XQ9A 5JFGA 5JASA 1C7QA 1Y4SA 2CXPA 1WJGA 1SZPA 4C43A 4F3KA 2Y1LA 1PZGA 3M83A 2EQAA 1NTRA 5TIIA 2YL2A 2YVKA 5KX5F 1UBMS 4BO0A 3NIFB 3Q8WA 4QE3A 1UBLS 1UL1X 1JTEA 3NQ41 3ROMA 4XE5A 2D7JA 4B82A 4AO6A 2VFAA 2ZJ7A 1CT9A 1KO7A 1O96A 1SBIA 2A0YA 2I5PO 1EZ4A 1R0BA 4FZ5A 4MWSA 4NMWA 2BI4A 1B43A 2QL6A 3KZ1E 4NECA 5E7MA 4UFPA 5IM4F 1DJMA 3A9UA 4LYEA 3OO1A 3PUKA 4WVLA 4BLOA 4PR3A 2EV9A 5DCUA 4RMIA 1LTKA 2QAGB 3K0CC 4OQQA 4LHWA 1OBHA 1U31A 3SHOA 4AMVA 5FH9A 5FWYA 2C3PA 1XQVA 2OFXA 3MBKA 2M6RA 3CUUA 2NU8B 3T9FA 2JFNA 1U5AA 3IE0A 1KI1A 3IQHX 3P96A 5HS4A 4ALLA 4A36A 4IXTA 1E1KA 2OV6A 4YUAA 3A10A 3H75A 4G9BA 4JA0A 5CBKA 8ADHA 3SBXA 1AU9A 4JQYA 5PGMA 3O7MA 2ZRNA 2EEZA 1V25A 2KHZA 3OZ7A 2OB1A 1NUQA 3D1VA 4WWHA 2F3SA 3DZIA 5IJAA 4C7VA 1HL7A 3Q3EA 2YJTD 5DXFA 1BROA 1JSZA 1O95A 3DAHA 3RC2A 2XBUA 4F5DA 3ISJA 4E2FA 5C7IO 2Y93A 2ZYIA 1UUFA 2YHIB 2FR0A 5A1TA 2C03A 2B36A 1KWKA 5JMTA 4Y9RA 1E0SA 1U8AA 4MS3A 1ISHA 1S2DA 4I5DA 2IHNA 1NE2A 5AOVA 5FNZA 4BJ3A 1PIWA 4LOAA 4FGLA 1RSZA 4OJYA 2TSYB 3GF4A 1WUJS 4BLPA 3RNOA 2K7FA 1RABA 3ZS8A 1DQYA 4HXYA 3HVJA 3N2GA 5JH7F 1T9CA 1UDCA 2FE1A 1WUIS 1BW9B 2Z2ZA 1ICEA 1YVRA 1XK6A 1C29B 3F49S 3OETA 4LZNA 1LZKA 4P35A 1FDWA 1NTOA 3FCOA 4D3DA 2OCBA 2R7KA 2QTRA 1X80A 4O2AF 3AKDA 4CM5A 2XUKA 3RK1A 1EDDA 4NJMB 4ZI5A 4DCNA 3T54A 1JA1A 1ODTC 1IBKB 1NQAO 1TZMA 3BXHA 3GQBA 4NZMA 1W75A 1XR3A 4J0HA 4D46A 2AVNA 3WKDA 3K0CA 2H1HA 4WH0A 4OHKA 4JB2A 3KD3A 4PICA 1UXKA 2XT0A 3NOQA 4XPIB 5KBYA 2H0AA 3EZFA 4S1OA 1QG0A 1AUVA 2O2JA 2OUIA 4BL5A 3G1UA 5BXQC 4IQFA 5JD4A 3WFZA 4GDFA 4B4VA 4EEZA 2D2EA 1RXWA 4GXNA 4DVJA 2TMKA 2WFZA 4IUYA 1NI4B 2Z3VA 4RHCA 5CB6A 4DV7B 1PR3A 2FKNA 2CUZA 2YS6A 3MF4A 1G7RA 2FN4A 4D3FA 1LU9A 1H8HA 3P2YA 1K7XB 2ZXUA 2ZI4A 2JH3A 1IATA 1SKBA 3AHCA 1LX7A 4GBJA 1YDEA 2XTMA 5SYMA 3NJ8A 2AR9A 2WQZA 1ONNA 3A05A 3LH5A 4BXOB 1F8XA 1Z5WA 1DXHA 2KLHA 3A4VA 1Q21A 2PH1A 3IR6A 5M2QA 2HADA 2JFOA 3QA3E 1H4TA 4TTAA 1EFDN 5HZHA 1G60A 1AK2A 3IQGX 3UO8B 4GC5A 1FYXA 2RBGA 1AUOA 3SICE 1ZINA 4PLPA 1RMQA 1NMYA 4QO8A 1ISPA 1EWYA 3O4JA 3OCYA 2G63A 3F90A 5CEEA 3QH4A 3VC3A 2JGEA 4M46A 4G1FA 2HDNB 1XG5A 3V8EA 3EVCA 1J8QA 2QRVB 2RIPA 5FDFA 4LHXA 2VJKA 2BFCA 2UXCB 4DT1A 1VP9A 4JLBA 1P6QA 2WR8A 3AW9A 1PQ4A 2PGXA 2CNNA 2KBFA 2NV0A 3BMXA 3NGMA 4HYTA 4J6EA 4QOJA 4EG8A 2OAP1 2BMVA 2J8ZA 3GLKA 5LU8A 3DZBA 3PNMA 4KBGA 4KLNA 4PLCA 4G0UA 4ZT7A 1OIVA 3NNDA 1E0JA 4PSVA 2WWFA 5KAPA 3VR6H 1ZXLA 2BC9A 2BR4A 2D5IA 2OOSA 2WZCA 2ZVDA 2IXDA 3F46A 1VJ5A 3GGPA 4H7FA 1LNZA 2NXCA 4I1IA 3EA0A 1WW2A 4RIGA 4MGHA 4L0QA 5TQ0A 3RVJA 3BFJA 4TRMA 2P9EA 4QTXA 3U3JA 2Q29A 1G8YA 1V9CA 4W4TA 3U09A 1L6IA 3G8YA 3PPVA 1D6NA 3ZDDA 1DQNA 3R5FA 2RK6A 5EQDA 5AUQA 2GD1O 1RCUA 1VHQA 4MUXA 3SJ7A 4ZK2A 2W2VA 1E1CA 3QNUA 4P0PB 3BWXA 3LAWA 3I5UA 1JSXA 4MW9A 4O59O 1TE2A 1DJNA 3DE5X 4OLFA 5AM1A 3RWMB 1HOTA 4ARSA 1GNVA 1VE5A 3COYA 3JZFA 1Z5OA 1XXHE 2QTTA 4LC9A 5ITSA 3HJRA 4OHYA 2VP0A 3C1AA 1YMUA 3C7TA 2ZSJA 1NOJA 3JXEA 3LDHA 4HD8A 5BOSB 1SMKA 2HW8A 1OU4A 1JQAA 3NU1A 2VWQA 5ALSA 3DD1A 4I1SA 2O5VA 1Q1GA 3A4YA 3NBMA 3OUZA 3VZCA 4D4JA 1SHZA 2Y1CA 3MJCA 3GLTA 4MUYA 4LRTB 2WU4A 4QUKA 1KETA 3A04A 3DXFA 2PMEA 1D2HA 1EE1A 4WIAA 3AFHA 4BNUA 1V1RA 2CVQA 5JSZA 2MR5A 2WYUA 5JFTA 4FIDA 2ZWPA 4FD3A 1DXOA 1Q16A 4ZT4A 2VTEA 4JDPA 3CZPA 4L9WA 1Q3KA 4F84A 3VR5A 2JLSA 1DO2A 1P1FA 1RWNA 4PLVA 5IU6A 4WCDA 2BUBA 1T3HA 3GJ5A 4EZEA 5F76A 1GILA 1T43A 4PAQA 3GFGA 1MO3A 1H4VB 2JEYA 4K1XA 2P78A 2YQ5A 4W5WA 1Y5NA 3SYKA 4OMCA 3TFOA 2I1VB 3HI4A 4JVOA 3JD3A 3QWHA 2NAPA 3ONNA 5IVDA 3UBMA 4LFBB 3NM6B 4MS1A 1E61A 1JDBC 4D43A 1KRXA 1PT7A 1J9GA 1OWPA 2W6JA 3L1IA 3PQ6A 2UXDB 4RSMA 4AKGA 4DA6A 3B2EA 3HJAA 1EXWA 4MPTA 5A0FA 2JFXA 1CIPA 3E9QA 3F5DA 3HRIA 4IDCA 5P8WA 4W6QA 1S3GA 1RRFA 1GPJA 3KVYA 5F12A 4ZVOA 2GHTA 1NVWQ 1M2NA 3WLFA 4PLGA 5AW4A 5FTMA 4RTQA 4FQ8A 4J1QA 4DSUA 4D9IA 1UJ2A 5FOWA 2BYTA 4FOTA 4YMVA 3QXHA 3KR2A 5ALFA 1IDOA 4XCVA 3WE7A 4QYSA 4BAGA 3LXXA 4IWXA 5G1PA 1V2HE 1AQIA 3LIIA 3GROA 1YC5A 3WHLA 5A4KA 5IEBA 4MYCA 4EZBA 4RJ2A 4LKOA 2POCA 5FL3A 5JUWA 3U61B 1JU3A 1CJMA 2UYHA 1RC1A 3BMNB 4DCOA 2WD8A 2JRCA 2WJ4A 3D54D 4NYIQ 4Q4JA 4A5SA 2GVZC 4IVQA 2XNJA 2WUDA 3T7AA 3TSAA 4FWTA 3TE7A 4EENA 4U9IS 3S2IA 3WLNA 3IUSA 1HEUA 3LDUA 4HTFA 4KDEA 4DR2B 4ZAXA 4EPRA 2XECA 3PSAA 1DFIA 2CJPA 3OIWA 2AK3A 1OSNA 2I22A 5LD2C 1N7GA 2ZULA 1M34E 3AGPA 1PGNA 4Z8YA 1G1MA 5T4FA 5IEJA 1TLLA 3WV5A 2PX3A 3HJNA 3SHTA 1G19A 3O1JC 2YH2A 3V8RA 3RB8A 4BBJA 3NH9A 3QVVA 2RHHA 4P83A 1KYZA 3LUHA 4A6EA 1VA4A 3AEQA 2WB4A 2VPQA 1SB9A 1Q7TA 1BRMA 4J43A 1PLJA 1OWOA 1ZJ5A 2BBOA 2QJRA 2FI1A 3COVA 1MO5A 3ON5A 1Z0JA 2OG2A 1VQ1A 2X5JO 3PXAA 4FONA 3TTWA 4F0JA 2ZBDA 2XI4A 5GGXA 3CVJA 3QHAA 3VAYA 2C5AA 3B8EA 5H4GA 1CUYA 1D6JA 1L5VA 3OZIA 3QX8A 3R7AA 3ZDRA 2BGLA 4OXYA 4ZVRA 3F98A 3VZDA 4ZVMA 4TMKA 3ZIDA 3O4IA 4H3VA 4V0NA 2OOKA 1QP8A 3PDHA 4MARA 5EHIA 3SXUB 4YUZA 5ISMA 3JQBC 3N8KA 2QTVA 4GW3A 2FRVA 5AUNB 3INGA 3II6X 1XU7A 5AR1A 2GJ4A 1V6CA 2D1YA 4QODA 3G2HA 4B33A 3FB4A 2A6PA 2J0SA 3D9QX 2XTJA 1E7SA 1JWBB 4EEKA 3I9LA 4ZQIA 1U2PA 1O89A 1I13A 1CF2O 1GCOA 4WZBE 1AXGA 4IJVA 1AN9A 1ULZA 5BRAA 5TQ2A 3W2EA 2TMGA 1US8B 4IO1A 1UPXA 4RFSB 4ARUA 4YCCA 2DHEA 1OLUB 1RP7A 3DUFA 3ISTA 4KIFA 4QYMA 1TX4B 3EGXA 4QSHA 4DQXA 2QIPA 1R3UA 1CY6A 3OECA 2FEKA 4DUPA 4PGFA 2A5YB 1NJGA 2FPPB 2XSZA 1ZY2A 1T5BA 4ZYXA 1ZN2A 1BSVA 1NM5C 2XQJA 3HU5A 3HO1A 3E7FA 1SIBE 3HY6A 4LA4A 1GGVA 2I2DA 2BTOA 2QMEA 4H08A 5B3AA 2GAIA 3RKUA 5YASA 1FJ2A 2REXB 4G41A 4LJ8A 1U4SA 2QJTA 4GPIB 1JHPA 4U7DA 3PU6A 5L4LA 4BYMA 2O8CA 1ZJZA 3T7RA 1SXJD 3GLIE 1YS4A 3DWFA 3OQHA 2XGJA 2NAFA 2YRFA 1H6AA 1XQYA 2DYKA 3JQBA 4UAJA 4ZO8A 3ZI7A 4C21A 4G0VA 3MGBA 2F55A 1NUHA 1QHEA 1UKCA 2I7XA 1U9JA 1E89A 3KELA 1IPFA 3HDYA 3T9AA 2VDKB 3QZUA 2R79A 4GX2A 4NPHA 1XJWA 5HW0A 2C7OA 2E48A 2OSBA 1IJFA 2CCKA 1DJOA 2WA2A 2CNWA 2VDWB 2X8JA 3FH0A 1O7JA 1FUUA 4FFVA 5B4UA 2PD4A 3B85A 3DMRA 1ZWLA 2LNDA 4QAJA 3UA3A 5CEJA 3JQEA 1MB3A 3NORA 4H6VA 4BFTA 5HM8A 5KSZA 2FJ0A 1TVKB 2FDRA 2H2WA 2R6AA 3JVDA 2VHYA 1GTJ1 1W2WB 3ND8A 4MV3A 4S1PA 1V8ZA 1L7DA 1X7WA 1NMQA 3HKDA 1I2CA 1C4KA 2EFJA 2PUTA 2XAUA 3CNQS 1X13A 1SCAA 4YCNA 2A1IA 3UICA 1E0KA 4CQNA 1E3SA 1T2DA 3D6MA 5DPMA 4ZC1A 4D0LB 1VLLA 2UZIR 3PPWA 2QRLA 4YA6A 1OWNA 1W36B 2P1DA 4K1LA 1X74A 5AOBA 5DBEX 3W5BA 1PWHA 3RANA 2CDNA 3LJKA 1SUFA 4BZPA 4F85A 1NM5A 2YYZA 1WUHS 1AQLA 1NNSA 4CQMB 3SWWA 2ZOSA 4QLAA 5DWDA 4H3KB 4TM7A 3QBTA 3PS9A 1KJZA 1VLVA 4KSCA 3MHTA 2R8YA 1IN1A 5T4EA 1O2DA 1DBRA 3U1BA 3ZLJA 1CPYA 4JB8A 1BEZA 4YAJA 5D3MA 5AD1A 1A9XB 1QZUA 3FYUB 5BN3A 5EKTA 2QT1A 1YE8A 4FEEA 5KOJB 4DN6A 3WJAA 4EVSA 4TGLA 4F96A 3QK7A 1NNEA 1VPEA 4KK4A 1E6EA 4K9LA 2WIJA 3RK0A 1OC4A 3G49A 2QTBA 1QK3A 4D44A 1N6NA 1RNLA 1I6LA 4QPZA 1I7PA 1QR6A 5DYYA 4B71A 2QRKA 1EI9A 3H5TA 4YQZA 1ADCA 5ED0A 4QWWA 1FTYA 2AFIB 2W83A 2JJQA 3M1IA 1W1WA 3ZDZB 4B0PA 3RC7A 3CH7A 1XNRB 3CLTC 2C7BA 1JJ7A 5BNZA 2X58A 1XDUA 2KSQA 1T4CA 3VJMA 1T9AA 1SVIA 2FF5A 4RVFA 1SXPA 3QXGA 3P94A 3UWMA 1EFRA 4NDAA 4LQLA 1O87A 4DB4A 1DG1G 4RK5A 1B74A 1YS6A 1TM3E 2WP8J 2YJGA 3ACBA 3NV9A 3OEEA 1PR9A 2PEZA 5G02A 3RGWS 5LQKA 4MRSA 3IP1A 4XPZA 5A03A 2FN8A 3GMDA 3KK0A 1QS0B 2CMHA 4Q34A 5JS8A 2LD4A 3MOIA 1GJRA 2R66A 3U1VA 1BJTA 4XFDA 4XIYA 1GPUA 1N9KA 3R3ZA 1CRQA 1K86A 1OGIA 4RU1A 2YS7A 5KHLB 5AESA 2I71A 2PS9A 1T36B 5BUQA 4TQAA 2I8AA 2YXPX 1N5RA 2P2YA 3ANLA 3B78A 3JZMA 5I8PA 2ZYTX 3CZRA 4YK7A 1QO0A 1JHOA 1II8A 3M3DA 1D8AA 1K89A 2FQQA 3OFSA 4KLZA 3FOFC 1T10A 1W9MA 1IM5A 4R9UC 1YUMA 1PN3A 3WWPA 2JB9A 1S2GA 3K8OE 1I4OA 2RMKA 3DBHA 5CT9A 3DJFA 1YMVA 4WXEA 1EAMA 1GPDG 2J3LA 3DMTC 3B82A 7YASA 3FRIA 3B5EA 2X5XA 3DULA 4LZWA 3WZLA 2ZUCA 4IS2A 2HLDD 1GGKA 2G0TA 4GOLD 3RV3A 1J33A 3U4QA 2C7RA 2ZUDA 5GVRA 3ICVA 4TWRA 3FCXA 1E66A 2AX4A 2VBFA 4PLYA 3K0FB 4HATA 4ETNA 3J7AC 2X7XA 2ID8A 2ZSKA 2DRIA 3QELA 3ZDXB 4R9RA 3EPLA 3S28A 5LBTA 4BE7B 4DEVA 4E32A 2BEVA 3GRVA 5A9TA 2PGIA 3K09C 3N0XA 4TWJA 2I67A 3M6FA 1TTHA 3E9YA 2VCEA 3HKBB 3LBFA 3OEHD 4KQHA 2BM9A 5CA0B 3IQZA 3VKHA 1N8KA 1QV6A 2AOWA 5A5EA 1Y1LA 3RG8A 1NBME 3F9IA 4O6VA 1MFZA 2I4LA 2YFYA 1KZ9A 3IODA 1A3CA 3INNA 4ML3A 4WEQA 2FDXA 5DSXA 2Z3ZA 4MVJA 2G40A 4MQLA 4NHOA 2VK1A 5JYBA 4OMUA 4ZVTA 5CUQA 2F90A 3JYNA 2PN1A 3KQNA 1ZVKA 4XD7A 1KOFA 4G85A 4DIMA 5BSFA 1XRSB 4MLDA 3DMTA 4IJWA 3RIXA 3U6KA 2JKYA 2H4FA 4E5VA 1XXHB 3LE8A 1B6RA 3IXMA 2I7TA 1X2BA 3JASA 3MYYA 4G37A 5H70A 2P2SA 4C88A 2DQKA 4DDVA 4YJ2B 4PQEA 3DW3X 3L4EA 1G6KA 3NTQA 3QKSA 5SYNA 1XMQB 2O57A 3V2GA 3O7WA 2I33A 1R4ZA 3W8DA 4CIYA 1HG1A 1Y98A 2PUCA 1VDMA 2XJ9A 1K9SA 3OJEA 4KMMA 4QDUA 1CJSA 3E9CA 4YPFA 3RRNA 1W4ZA 2AI1A 3QKUA 1UPAA 1H05A 2LTAA 3FRHA 1GGMA 1R15A 2J46A 3BTUA 2GKOA 2KE5A 3FFTA 3RU9A 1J00A 2XNDD 3S5UA 3ONDA 3AEZA 3GY0A 2JC3A 3SI7A 3K09A 3BMCB 1B1CA 2XE7A 1EHIA 2M1ZA 3PNKA 4NYMQ 4YRRA 3B3FA 5ARBA 1JXAA 2OLJA 2QUHA 5EL0A 1JVBA 2LBPA 3H9BA 3FHLA 4JXJA 3WHPA 4NLLA 3G0IA 3OZGA 2FGKA 4YCLA