4D97A

Salmonella typhimurium d-cysteine desulfhydrase with d-ser bound at active site
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
328
structure length
327
Chain Sequence
MPLHHLTRFPRLEFIGAPTPLEYLPRLSDYLGREIYIKRDDVTPIAMGGNLRKLEFLVADALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLDLFNTQIEMCDALTDPDAQLQTLATRIEAQGFRPYVIPVGGSSALGAMGYVESALEIAQQCEEVVGLSSVVVASGSAGTHAGLAVGLEHLMPDVELIGVTVSRSVAEQKPKVIALQQAIAGQLALTATADIHLWDDYFAPGYGVPNDAGMEAVKLLASLEGVLLDPVYTGKAMAGLIDGISQKRFNDDGPILFIHTGGAPALFAYHPHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mutational Studies on Substrate Specificity and Catalysis of Salmonella typhimurium D-Cysteine Desulfhydrase.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords D-cysteine desulfhydrase
total genus 121
structure length 327
sequence length 328
chains with identical sequence B, C, D
ec nomenclature ec 4.4.1.15: D-cysteine desulfhydrase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d97A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d97A02
1K3UB 1VB3A 1WKVA 2PQMA 3VC3A 5D87A 4F4FA 4L27A 1V8ZA 4L28A 1D6SA 4PCUA 1K8XB 5CGQB 5B3AA 2EGUA 5IWCA 2C2GA 4ZU1X 1Y7LA 4Y6GB 2WSYB 4JBNA 4D9KA 3FCAA 5DW0A 4D9IA 2O2EA 5I7RA 4LI3X 4WX2B 1WDWB 5EY5B 2DH6A 3SS7X 4D9BA 2EFYA 1TYZA 2C2BA 4ZU6X 4HPJB 4NEGA 5IW8A 2CLKB 4AIRA 4D9FA 5I7AA 2CLHB 4NU8X 5JISA 1QOQB 5T6MA 3RR2A 4D8WA 1KFJB 1O58A 2RHGB 4OFXA 2TRSB 4D99A 1RQXA 4D9GA 1K8ZB 1TZKA 4IL5A 5B1IA 1K8YB 5CVCA 4L0DA 5D86A 3R0XA 2GN0A 3SS9X 2CLOB 3IAUA 2RH9B 1Z7WA 3VSCA 4ZQCB 2JC3A 4KKXB 5I7HA 1WTCA 4D9EA 3SPXA 2ECQA 5DBHX 1C9DB 3L6RA 5C3UA 1TZ2A 2ECOA 2ZSJA 1JBQA 2ZPUA 5I6DA 2Q3BA 1TZJA 1A5AB 3X44A 1TDJA 5D84A 5B53A 2GN2A 1Z7YA 4LMAA 1PWHA 1CW2B 4HT3B 1J0BA 1UIMA 3DWGA 1A5BB 3HMKA 4D8TA 2DH5A 1TZMA 4AECA 3X43A 5D85A 3ZEIA 1J0CA 3L6CA 1J0EA 5B55A 2CLLB 1X1QA 4HPXB 1K7FB 1UBSB 2GN1A 3L6BA 2CLEB 3DWIA 4D8UA 3IQHX 4HO1X 4HN4B 1KL7A 2TYSB 4D9NA 5DW3A 1A5SB 2CLMB 5DBEX 5IXJA 3PC2A 1KFBB 4D97A 2O2JA 3VSAA 5I7OA 4COOA 1V7CA 3CEPB 5HBGA 5B36A 1FCJA 1VE1A 4JBLA 1KFCB 2D1FA 2ISQA 1BEUB 1QOPB 3PR2B 5KINB 3PC4A 1BKSB 2CLIB 1E5XA 1CX9B 1WBJB 5KZMB 2Q3CA 4D9CA 3DKIA 2J9XB 5DVZA 1J0DA 5J5VA 3V7NA 4OREX 5E0KB 1VE5A 1C8VB 2BHTA 1KFKB 4QYSA 1V71A 2Q3DA 3TBHA 4XUGB 5B1HA 2J9ZB 3PC3A 1F2DA 1TTPB 1UINA 1OASA 2V03A 3BM5A 5J43A 3IQGX 3T4PA 5JJCA 2RKBA 3AEYA 1K7EB 1TTQB 3VBEA 5I7WA 1A50B 1TJPB 3AEXA 4D96A 3FGPA 1C29B 3R0ZA 4H27A 4D9MA 1M54A 1PWEA 2TSYB 1P5JA 2BHSA 2ZR8A 3VSDA 5BW6B 2J9YB 4LMBA 1KFEB 2CLFB 4I1YA 4L3VA 1J0AA 3IQIX 1FUYB 4D92A 1K7XB
chains in the Genus database with same CATH superfamily
3R7WA 1WKVA 1YMUA 5AJXA 2WNIA 2Z4TA 1AQJA 5EJFA 1PS9A 2ZIGA 4L4SA 3TOZA 1X1BA 3VYTB 5AM4A 4F8JA 5KTRA 2QLFA 4AJ9A 3VC1A 4DM4A 5C4GB 1SRQA 3GLVA 1P9LA 3MB8A 3MRTA 5TGZA 2D1YA 2ZATA 2WZBA 3BTOA 1NJ5A 3NHWA 3DQZA 1Z3IX 2H4WA 1ISSA 2I2DA 3HV0A 3OIYA 4P9NA 5C34B 3LY7A 3R09A 4BUJA 4DNFA 4XGRA 1DJNA 1R00A 1WU7A 2GHTA 2CNNA 1YHZA 3COZA 2IZ1A 3AVQA 5G41A 4EJ2A 1IZZA 5LQMA 5JFTA 1AD2A 1YHYA 5EUQB 1ZNWA 4K6FA 3DV0A 1WHSB 2WP8J 1N8NA 2OORC 2YMQA 2XGMA 3F2VA 3L1UA 5KDOA 3A1SA 3O2NA 1QGAA 4HLDA 3OHSX 4MUYA 4V39A 1UAGA 3L8HA 4R9UC 2I67A 4B6SA 1HK7A 4WKPA 4RPIA 3WIBA 3Q3IA 4DPLA 1T3TA 5K3CA 1E5QA 2GBCA 1Y4ZA 4Q7KA 5BMVB 4KKXB 3GRRA 2HMSA 2GCIA 2CEAA 3J81k 1GNVA 4J0CA 2CBGA 1FJHA 4MVJF 2J67A 2XYQA 3VGPA 2M6RA 1W0KD 2E1RA 2YS7A 2ZYWX 5JPIA 4BBJA 2XWSA 3H4TA 3NORA 1HZZC 1WR8A 1C3OB 1N4DA 2OHIA 5FPYA 3BK1A 5TLSA 3G9UA 5KJ6A 3BSWA 5HJ5A 1B41A 1W5FA 3J81A 1LQUA 5KTNA 3KK0A 4HLUA 2OTCA 3UPUA 3R9XB 4TYYA 1RWXA 1UFOA 3Q88A 5EC8A 2YKGA 3Q3CA 2GHIA 4LZLA 1HFJA 1JG1A 1YTLA 4MVJM 3ROXA 1WZIA 1B6RA 1JT9A 2C82A 4EKGA 3UKDA 2FJPA 2ZRJA 4B4VA 2X22A 2CK3D 4G4SO 3VSAA 5C4IA 4HZUB 1U3TA 1R0WA 2VCYA 4ZCSA 2LCQA 5T4HA 3M70A 4ZGWA 1XRMA 2ZIFA 2P6NA 1U02A 4RO0A 5BSVA 1Z5WA 3C3YA 4LC9A 3FRJA 1X2EA 3E9YA 2PUVA 2HRCA 3NWOA 5CCEA 1GRRA 2QD1A 3DBLA 2PLFA 4Q24A 5CM8B 4DV3B 3RS8A 3TD6A 2XMZA 1F1BA 1Y8AA 1JSZA 3D1VA 4MMZB 2HFJA 3F67A 1MIOB 4IOMA 3U6BA 4AF6A 3ZVKA 2RGRA 3N0RA 1KWGA 3R44A 1QB8A 4BASA 1L5ZA 1OA1A 1P2DA 1XCMA 1ISIA 2GETA 3DOEA 1Y1RA 5AI5A 5DDIP 4CQMA 2EKZA 3NUZA 1PZGA 1VSVA 3BM5A 5CNIA 5JUWA 2HREA 1ISHA 2FZGA 3NIBA 5F4ZA 2GD0A 4HXFB 3JXEA 1BXZA 1BSVA 1Z28A 2VTBA 1DARA 2XGJA 1MDFA 3VSEA 2CNDA 1FMFA 1Q0ZA 3R0ZA 5FCDA 3VU8A 3UYLA 1U0GA 3KOWA 1E2DA 1NQXA 3DMGA 3C3DA 3F5SA 3O91A 2CXSA 4E4RA 1ZM7A 4A6XA 5K20A 2XRFA 1L4BA 5LZ7A 3TQRA 4TLEA 2J32A 2O2DA 3GGJA 3P9SA 5HGXA 5HM8A 2Y0CA 3WQBA 4AM8A 1PR2A 4RZIA 4C20A 5KYYA 5LUBA 2Q62A 4L8WB 4LPKA 4O0MA 1IQPA 1J24A 2HUNA 4BMXA 3OY2A 1QLHA 3HM9A 1ZH6A 2P3QA 3AFGA 3U56A 2CLCX 4IG9A 2G0TA 3QJYA 2QX6A 3B13B 4LJLA 3ZWYA 4C3OB 4EB3A 3G2NA 5AVQA 3JVIA 3EEQA 2EWWA 2ZE5A 1CUVA 3CKYA 2BEKA 2JAUA 3GEMA 1L7EA 3GO4A 1NVTA 3VZDA 3UIEA 3HDQA 5IM4F 1CR0A 3I62A 4JQOA 3AEKB 2WUEA 3NBFA 4MV9A 1XL1A 5FWAA 4BNYA 1HDYA 3HYTA 3TTSA 3OOHA 4URXR 1M8PA 4MYUA 1SOUA 1K7SN 2AHRA 2UVPA 1Z5OA 3RYIA 3CT4A 5AW6A 1VI5A 1HT1E 2YJTD 1TECE 3JV7A 1B74A 5F77A 2BI7A 5EXPA 3OIUA 4NOKA 4Y2TA 5MF6A 1BRMA 2C9CA 2J0VA 3ZWPA 4C4PA 4LWPA 2JLWA 4YJ2A 1JFFB 2FW9A 3DTYA 4ZQCB 1ZGJA 3O8OB 3RDPA 2AOTB 4G1EB 4KO3S 3JAKA 4XYMA 3CRZA 5ADWA 2GASA 1VPTA 1NNI1 2VYND 2MR5A 4GQIA 5KSOA 2ID7A 3G23A 4NCIA 1Y3CE 3K0KA 4GEKA 3UVEA 3V4LA 2JCGA 4QYMA 3C6YA 1V1JA 2XGGA 4I2VA 1U5CA 4IIVA 4KKVA 4IOJA 4W1RA 4A1FA 4ES6A 3GHYA 1PDWA 3GA5A 2P9EA 3H2JA 3OSUA 4WBNA 2W6OA 5L8VA 3DTVA 1WXDA 3NWJA 3PZBA 3UMRA 3T0IA 3B3GA 1DIBA 5FWXA 4KQEA 1T9CA 3SQOA 5JNTA 4HPXB 4Z9XA 4ENTA 2Q5HA 3R0QA 1MF7A 4W7SA 2DHRA 1LTKA 2DFDA 2GPTA 1QV9A 1VL6A 4JFRA 3W2EA 4JUIA 2HD4A 4QRIA 4ARAA 2BFBB 3NM5A 1Z25A 1LXCA 2AX3A 4MR8B 3EFOA 1PSWA 4KJZA 5G4KA 3T1QA 4QO8A 2I8CA 3FOZA 3DHEA 4LDAA 4NBNA 4YRGA 1COZA 2C5FA 5EEHA 1NRIA 2PZGA 4K28A 3RU3A 4B3MB 1HDGO 1PR9A 4MR9B 3G0CA 5F52A 1NP3A 5IXYA 4ENRA 1NVVR 3K9HA 1YVDA 3WYEA 4OBWA 5BR4A 2VJNA 2GA9A 4IFBA 1K5HA 4NJEB 4KN6A 1CQIB 5CP8A 5UKDA 3JX9A 2EZTA 1I3KA 2ZYUX 4G5FA 1GEGA 4PX9A 3ZCXA 4ZZ0A 2CV1A 3RVDA 3PNSA 4HH4A 1XO1A 4HWOA 5BSMA 4MGIR 3H42B 1M2KA 4B3CA 4EWLA 1FDUA 1P7VA 2JHAA 2YC2C 1DKNA 3OLQA 1SCUA 4MAAA 1DKUA 4DIKA 1IQUA 4JLUA 2Y9MB 3E1KA 3IVCA 4HNRA 4UUNA 3ZGVA 3ZWWA 1Z2EA 1H8ED 3PFNA 5BPFA 3VR6H 3A37A 1XVUA 2OO3A 4IDGA 3KU1A 2WJYA 1CDOA 2DWCA 4IX1A 1SKMA 4BVAA 3G2PA 3OZ7A 1S4MA 1Y98A 2XNDA 3A6KA 3HLYA 4MA5A 4UATA 4PCVA 1MEJA 1XB2A 2MTBA 4L9SA 5HXAA 3NHUA 3O1JC 5LA6F 1ZH8A 4J2TA 1N3BA 1ZGCA 1OHHD 3QFFA 4GW3A 1I7PA 1UKEA 3OCUA 4BE4A 4JLDA 3WLKX 4GF5A 4QOEA 4QJ3A 3HH8A 2RGNA 1FFHA 1XZGA 3OBBA 3E7XA 1EFPB 1QAOA 5BT9A 2X2OA 1SC1A 1N0VC 3KSDO 3FNEA 4GM0A 3WISA 4KSBA 2IYXA 5HUJA 4G3XA 3Q7IA 1D0SA 5GJCA 1RZRA 2WJJA 3BDVA 4W9NC 1QE0A 4K8RB 3SS7X 5JVDF 3WGQA 4U7TB 1ZQ1A 4N5NA 3VI3B 4CQNA 5EJ8A 1B8UA 4F5YA 1LS6A 1FFCA 2IYUA 3CLVA 1JPJA 3Q4GA 4OK6A 4PLGA 3LPMA 1LLFA 4TMXA 4NF2A 1AF7A 1DDOA 3LIIA 3LYUA 3ND6A 5K3DA 1BW9B 1EVQA 1HDCA 3AINA 5T4EA 3KJEA 4ZVSA 5JDCC 4Z86A 1KQGA 4UBOA 4RGYA 4EPXA 4TS4A 1WSWA 4HOYA 5KWIA 1ZUNB 2PFKA 2PFGA 2GI4A 2I2AA 3EC7A 3EDYA 4N0QA 3GJ8A 4BPRA 5AK4A 1M2EA 2J41A 4MPTA 5AKEA 2J30A 1UADA 1VBNA 4Y9TA 4YMUA 2ETVA 1U11A 1E6KA 1JBQA 2F9FA 2ZYHA 4FC7A 2HK7A 1GTMA 2ZWAA 1VC2A 1W88B 3DBHB 3UJ9A 2P90A 3QIVA 1E5VA 4YBRA 4Y0NA 1ES9A 2H4JA 2OE2A 3QPUA 1LSOA 2O8EB 4WZAA 2LP4Y 2YCLA 3CWZA 4WCVA 2J3KA 1JHOA 1BMQA 2QKYA 2C54A 2G40A 1T8PA 1YQXA 3ITDA 3LUFA 4D8XA 4YGXB 1EXDA 3GLGB 1ZHOA 3OMWA 9MHTA 3WGHA 3KJNA 3QVUA 1EWQA 2BP7B 2Q8NA 4QHTA 3NRJA 3HR7A 3S29A 5KEIA 3C5CA 4ZCPA 5IJAA 5IT4A 2IBTA 4QEZA 5DLEA 2G9QA 4WVFA 5BWMA 2QTWB 2P9GA 3N0XA 1KEPA 1WD5A 1NDHA 2V74B 5U9CA 3TLBA 2AUNA 3CUUA 3S5UA 3UW3A 3TYXA 1ZCAA 4QHYA 2PT9A 1J9ZA 2HNKA 2ZWVA 1WV0A 3V8MA 4BPBA 4MQEA 3GXBA 4NCJA 2BMJA 2Q5FA 5K3OA 5LCXA 3U4MA 3URMA 2QVLA 2RHRA 2V98A 3EA4A 3G9ZA 4DT1B 4YYZA 3ZD6A 4OQXA 1IPEA 2B7CA 4RZXA 3DDZX 3GIDA 1ZSNA 1PG0A 4M83A 5AI6A 3TIIA 3ZU3A 2XXJA 5CVEA 1F4LA 5M2QA 4RTSA 2V6FA 2Z98A 4UU8A 4D46A 5FADA 4REQB 4WZBA 1FX0B 1NAIA 1NW3A 2H7CA 1LLDA 4FEGA 1F4PA 4Q4DA 2P41A 4E30A 3D7LA 2O07A 4OHRA 1GT6A 5C5CA 5L51A 2QE6A 3AHCA 3KEGA 4CMGA 3AL2A 4F1WA 3EEBA 1RLJA 1HEYA 1AKUA 4HZIA 1H2FA 1HYHA 4HCJA 5BNFA 2D2FA 1KWKA 5J43A 4NG4A 1IB6A 1GPDG 1N2JA 2B1JA 2IT1A 1KH3A 3H4VA 3D0KA 3O4FA 5LU9A 4HUTA 2G88A 2ZYAA 5A05A 4ZYLA 2C9DA 3NM4A 3SR0A 4DZRA 4EMSA 1GR0A 4JJ8A 3NR2A 5CCXA 3A14A 3BCHA 2TS1A 4DVJA 4U7JA 5J47A 1RABA 3E9ZA 1GZSA 5DRYA 1CF4A 1AUVA 3OFNA 4RTLA 1YT5A 2YWCA 4ZKEA 3BDAA 1KYIA 3LT5A 2V0NA 2V8BA 2HBQA 4KUHA 1MPXA 4QVGA 5B3AA 2P2YA 2V97A 3DOFA 3O8DA 1BA3A 4O8CA 5DULA 2FYTA 4IJ6A 1FVOA 4DRZA 3CZ5A 4HDNA 2H92A 1KNXA 4N40A 5J2TA 3MWKA 1XYYA 2IIBA 1FMCA 4PNPA 3W2FA 3FNFA 4DDHA 2AEFA 2C2YA 4LXYA 3WK7A 3C45A 3K5WA 2OCBA 2J0SA 4C5CA 3TKYA 2H8KA 2IRWA 4YUWA 1SVLA 1K86A 1U1GA 4ZQGA 1XKTA 1ID8A 1E6EA 4EDHA 4NI5A 1X8JA 2BP7A 3PKIA 4H4CA 3EJ6A 4NQRA 3RE1A 1FLAA 3GVPA 4NWIA 4GLFA 4Z7NB 3BXFA 3KQLA 2G71A 2UZ4A 3FFAA 2FEXA 4JC4A 3CX4A 1SH7A 3OJWA 3FZGA 4MICA 4PSVA 4RXMA 4R8MA 4MIEA 4FMDB 3LUPA 5IEBA 3BIFA 1QRRA 2IH2A 5LQSA 1STOA 3AILA 5B53A 4G8CA 1ZY2A 3EAFA 3L7IA 3DLBA 2ATCA 2HM7A 3F5FA 3SGLA 2WSLA 3AW9A 1CUSA 2QIPA 2QRVA 4GYKA 4O4JA 3KKEA 4TMYA 4Y1RB 5DO9A 1Q7TA 3HMKA 4B2IA 3HRHA 1YS1X 1YSCA 2V6GA 3EXEA 4DDTA 3AB7A 4HAUA 3BJEA 1CK4A 4ZT6A 4PN3A 5JR3A 3FH0A 1K0UA 1O4VA 1JFTA 1WOMA 2Z58A 5FBKA 3MTGA 3Q8XB 2X8LA 4PQFA 1QTNA 3OZTA 4EBBA 5BV0A 1XRJA 2B1IA 1QGZA 1MPTA 1F0NA 1OT5A 3H17A 4KHZA 3LX8A 3L8ZA 1ZOLA 3EMVA 3L7AA 1QQAA 3Q7SA 4YO8A 3L05A 4OA5A 5ALKA 3A1TA 3EVBA 4OQYA 3ZCVA 1NDUA 5JXWA 2GYWA 5L3VA 1BYUA 1G4AE 4IP0A 4U9IS 2FPIA 1PJSA 4MH0R 1UQTA 3GZ4A 1BEUB 3BWDD 3U60B 4IDBA 1ECFA 2OXCA 1A1SA 1BEZA 1VJ1A 2VDPB 1DNPA 3QVGB 5LXTB 1RE1A 2EQ5A 1XYGA 3CEJA 4F04A 5CK4A 3CPSA 1B16A 4WASA 1XQ6A 4RVUA 2IS4A 4IHAA 1NXSA 4IYRA 3B5JA 5FRDA 4LHXA 4EABA 2B4TO 1F8UA 5GIOE 2EC5A 1CUIA 4AP6A 3VGJA 3FSRA 3DB2A 1QO9A 4R2JA 2PS1A 3MFYA 2J9ZB 2J3EA 1WCXA 2H2WA 2ORVA 2GSDA 3KLMX 4D3SA 8ATCA 1DEKA 4OHXA 1YDHA 5FNZA 4OCZA 4P2GA 4KITB 3QFCA 3D1LA 2AMVA 3GFBA 4XCQA 7REQB 4E1VA 1ULHA 5CPFA 2IHKA 3WGNA 3FGPA 5JCPA 3OQVA 4K81B 5IVIA 1EI9A 5H3HA 5A9SA 1FDWA 3HE3A 3DH0A 1W0CA 5D5PA 4BN0A 2YYSA 1O7JA 1FUEA 1RWWA 4PYLA 2A0YA 1LRKA 4IDOA 4MRPA 4NJOA 3MRSA 4ZGGA 3JPWA 1NUUA 1V9SA 3BG5A 3MTDA 4K9MA 1OZFA 4LX8A 4P2BA 4IDEA 5B3KA 4C2TA 1VPEA 1ZXLA 3PUIA 3QU2A 3C7CB 4MAFA 4F38A 1O5TA 3PHBE 2G1JA 1E96A 1PCXA 4KYVA 1IUKA 2HJWA 2QZZA 4P3OA 2EEPA 3I5UA 5KWVA 3T3PB 4PHGA 3W2GA 3QNUA 1Z38A 4J91A 4RHUA 1UBFA 4D9KA 1NYRA 5AW5A 4FQ5A 5EPEA 2Q2WA 1WHTB 2MR6A 5IU6A 4I9UA 2XTJA 3BWBA 4GICA 2QUHA 1VE9A 4N8EA 1G64A 3B7GA 2OFWA 1B0PA 1OAOA 3MJHA 5ED0A 2YZ7A 4Q02A 5GV7A 3IDAA 1M34E 8MHTA 1UZLA 4Z1OA 2CLHB 5AH0A 3SLGA 2WHXA 3FPGA 2AR0A 4PZDA 4NYMR 2A9OA 4RUKA 4JI8B 2W6QA 2P9ZA 3OF5A 2V8OA 2FN8A 5EJ7A 2I4NA 1KARA 2ZJ0A 1V0JA 2H7YA 4CM7A 1YUMA 1AK2A 2F3QA 3U09A 2PMKA 1XZQA 2WJWA 2CDBA 2DFVA 3DLTA 1USVA 3CF6R 2VNJA 3ILSA 3HBLA 4EMUA 1U1IA 1KYWA 1WAMA 4LJAA 2H11A 4AY5A 4D6YA 1Y81A 4OLFA 5CA0B 3I6BA 1U31A 2ECQA 3ZXSA 1JQEA 2G4CA 4WJLA 5KPJA 2ECOA 5KKNB 2ZSJA 3L0ZA 5GJWC 3B2NA 2QLMA 2W2KB 2FR1A 1E2FA 1U2GC 2A3NA 3GELA 3BXOA 4MW9A 1IY1A 4P4SA 4URWR 4BTLA 4JS0A 1YRYE 4CHTA 2BGNA 1K2VN 4BFVA 4ZARA 2Z6UA 4PXAA 4WA7A 1U3FA 4O5AA 2B20A 4KXFB 2CDNA 1EM6A 1RKQA 1SXPA 3G0HA 3GYBA 2UDPA 4EA7A 1GAXA 5JSZB 4DILA 2O4UX 2GJ8A 3CIFA 3H9QA 3RIMA 3ZD8A 1GNTA 1XDSA 1MR3F 5SYMA 2NU7B 2VRNA 3NQ41 4F06A 1MVLA 2A14A 2P78A 3DE7X 4ISCA 4NDAA 4BMCA 2OCPA 3L0CA 1RM3A 1JG2A 5B36A 4BWVA 4YPOA 4JLBA 1GG9A 2GCEA 1OJ7A 4BYGA 1ZJYA 2VF4X 5G1OA 1YK0A 4A0HA 2RHHA 3GRZA 2G67A 4K6KA 3WGLA 4D9CA 2Z43A 3NATA 5EJIA 3EZYA 3TINA 3NIDB 3AF4A 4MTLA 1FDTA 3UATA 2PJZA 1NNLA 1EX7A 5GONA 1N2SA 1T29A 2GXUA 4MULA 3WFJA 4C0KA 5ENZA 1INLA 5LDGA 1Z0ZA 5AM0A 1PQUA 3DO5A 5BORA 1Z0DA 1U8UA 3D8UA 1ZA2A 3O38A 1XUOA 2J46A 1SJ9A 1ISFA 1UEXC 4C07A 1TM3E 3OEHA 5LLDA 2IUYA 3LXXA 1ENYA 2PS3A 3TOXA 3BERA 1OFIA 3RRBA 4Z7OB 2OM2A 4WN9A 5L4NA 1RWPA 5IHPA 5B7NA 2SKEA 3QE4A 3R7DA 3GBSA 1X8KA 4G5XA 4XASA 4M7RA 5DIFA 7AT1A 1GPNA 3JTMA 2OESA 3L3BA 2PJRA 1NMQA 1O77A 2FN4A 3VAZA 1U3CA 1W5SA 1V7PC 1RRCA 2J48A 2PL5A 4Y0AA 1Z5ZA 1ESZA 3M4JA 2G7MC 2KWIA 1YOVA 2ZJ1A 3VPXA 3FNHA 3GDOA 1XHFA 1H2ZA 3VNBA 3ROTA 3B2EA 3MWGA 4LNUA 4XB6B 5CJ2A 4EYEA 1UEJA 2EKBA 1YMVA 3WB9A 1HE4A 1ZNZA 3KZNA 2Q9CA 4LV5B 1VCIA 2W9XA 1JLRA 2ZM6B 3E4DA 4LSZA 3EZ6A 1JA9A 4EGCB 1P0IA 3KZVA 4M22A 1GA4A 3QOWA 2A5LA 5DNYB 2ZPAA 1E99A 4F4IA 2QEQA 1F8FA 2RGEA 3QBTA 4DSAA 1V2GA 3PEFA 2ID4A 4MWZA 4NH4A 3MCZA 3ZQJA 1KH1A 1I2CA 2V0GA 1Z2DA 5KOJB 3RWBA 4FWTA 1E69A 3AI1A 4AQDA 4JGBA 2NYVA 3OUTA 4NOJA 3KE9A 4JN6B 5DN9A 5CA1F 4A0GA 5IVDA 1JR6A 3NDPA 4DQVA 1K8YB 1EQUA 2AYZA 1V37A 2G09A 2OG1A 2VKTA 2P5YA 5A0VA 1PD0A 1T8RA 3T7DA 2Y71A 1CUZA 4ZYTA 2Z08A 3L0YA 1SOWA 1UBJS 3BC1A 1N8TA 2Z2JA 4E22A 3U7HB 3PL5A 2PA0A 2FFJA 4X8LA 1JJVA 1O94C 3WDSA 2WF8A 3W9SA 1NNEA 2QROA 1WZEA 4JY7A 4UE6A 5FFNA 2O4CA 2XR1A 5IWAB 5K05A 4XGNA 1KZ1A 3H9GA 3ONVA 1ACJA 1NRWA 1PR3A 4FHCA 2VPPA 5TC4A 3S2EA 3T5GA 5KNBA 4MHTA 4HDSB 1B73A 2NZXA 1R9MA 1UXHA 2GXQA 1Q0RA 3GJXC 3M6XA 3NXKA 4HYQA 1A8HA 4MGZR 5DGCA 4EFMA 2O3JA 5FOQA 1JBKA 1V9CA 1E59A 2IC5A 2P9JA 3GJ0A 4BN4A 5B2FA 3FDJA 3DTVD 1WRBA 1XXLA 5KS2A 4KNYA 1BE0A 5JAZA 2UUOA 2RCNA 1QH1A 4KACA 5ALHA 5TVKA 3E5MA 3QQ5A 3COPA 1OWNA 4PY2A 3S6JA 5CDUA 1YTUA 3Q87B 1E58A 5GV8A 1J39A 2ZB2A 3GX1A 4RTQA 1ISGA 3AF2A 1KO8A 5FO0A 5G0UA 3PXBA 4W1QA 3V7YA 2XITA 3T4EA 5BXQC 4DV4B 1XPJA 1E7MA 3JQAA 5K9ZA 3G5LA 4JITA 1SOVA 2O2CA 3L2OB 4Q18A 2X8AA 3UBMA 9LDTA 2O2IA 1ZW6A 3DEJA 2WJIA 1SBYA 2A5GA 3R5JA 1Z47A 2J9FA 3ZY2A 1F2TA 5HHTA 1JR3D 3IL2A 4HUJA 3PEUA 2FRVA 1Y5RA 4BMSA 3NYQA 3DNMA 3H5IA 5BR7A 1JG6A 1YU6A 2RHDA 1YDFA 3OT4A 1VXOA 3RVRA 1QPZA 3P7MA 3EYAA 5CG2A 3ED1A 1YO6A 4ZVKA 2P68A 1X3SA 3CX6A 4DTCA 1XF9A 1XSEA 2CFCA 4DV2B 1VGQA 2ASVA 2Y0PA 3B1VA 1M1YE 2CY0A 1F3LA 1GGMA 1OIVA 4NHEA 1H5NA 1WO8A 3WIVA 3TGPA 4JK3A 3A6GA 3UUGA 3ZCRA 2REBA 3PA8A 4MWEA 4DUPA 1W96A 5K8TA 3KQKA 3RAEC 5BYKA 1HOTA 1Y3DE 3QMVA 5CAEB 3G5UA 1NUSA 3L06A 1JKFA 2HV9A 2X0JA 3A10A 3IQXA 1GKLA 2JJ1D 1GTZA 4ZQBA 3SHWA 3VNUA 2DPGA 1IHUA 4TWJA 3KX2A 5DTMA 2X5NA 3EWIA 4EK9A 1KOLA 1M5TA 1PV1A 2XEXA 3FZYA 4QUKA 5DRTA 3H0EA 1RI1A 4H9GA 1CZNA 1JDBB 2O6HA 4YS6A 1SR8A 4O6VA 1SFRA 1T5OA 1N5IA 3DVSX 5FO1A 1J09A 2DECA 2Z6VA 3RYCA 4Z9FA 5BSFA 3PZRA 2C9ZA 2GRUA 2P9BA 4X84A 3UK0A 3L4BC 3CRQA 3ZYCA 4AIIA 2LXNA 1U99A 1JAHA 3EXG2 4FI3C 1HZZA 3R3WA 3DQQA 2VK4A 3EW7A 3NNSA 4Q00A 4QPNA 4GPAA 5CT9A 3CLHA 1GWNA 1P74A 3TLEA 3CZMA 3MTQA 1RZVA 3HFGA 2H0QA 4IUCS 2XT9A 3I92A 1CFJA 1RE0A 2HHLA 1ANKA 2HRZA 3BGOS 3E35A 3KSRA 1K8ZB 2EBHX 4K0RA 4MR7B 3TZBA 2XOKD 3NX4A 2JI9A 2O0KA 4K9OA 3NAZA 1R15A 2O1WA 4M1ZA 4JI6B 2ST1A 2FFQA 2UUAB 1Q7EA 2GESA 4ZEWA 4C0HA 4II2A 1Q77A 3KHUA 3UA3A 5J59A 1GRVA 1DCTA 2VZEA 3Q3EA 1BFDA 2ISSD 2O8EA 3IDZA 4FYYA 4OMFG 2XSZD 1WDMA 4H3HB 1G6HA 1Y48E 1N3YA 1ZUWA 1CW2B 5JCOC 4PAOA 3NZEA 1I6LA 4BS9A 1RAAA 1UKAA 4EBFA 1JFVA 3LJKA 1P0CA 2C5HA 3GUYA 1L3CA 5B55A 1BHO1 3C3WA 2WHEA 3ICVA 4BX0A 1CE8A 4KIFA 2JFZA 1ICEA 4DSNA 4L4ZA 3R8XA 1B93A 2VI5A 2CE2X 2GH1A 2ZRMA 4BGDA 4HVLA 3FYSA 3KQTA 4M1EA 4NZZA 1VI2A 2ZRHA 4INOA 1APBA 2XZPA 1IL0A 2HWXA 1LRLA 4UMEA 2I80A 4DSZA 3GA7A 5H9WA 5JY1A 4MDEA 4DCJA 2C98A 3PRYA 2P2GA 3TXXA 3UHOA 1K9VF 2IP1A 2IYRA 5SV2A 5SY6A 3G2LA 4RMNA 5KINB 5KMGB 5CIWA 3QP9A 5K4GA 1LSSA 1DHTA 3PC7A 4J0IA 3IILA 2OV8A 5TPWB 4I6JA 3T7KA 3HCWA 3TGWA 3AFHA 1G3UA 3GFRA 3TMYA 3A9TA 3AUFA 3IP6A 1I8TA 1NFQA 3CS3A 5HKKD 1KTIA 3CE9A 2BTQB 1PYOA 1DC8A 2BZSA 1RQPA 2IPAB 2KM1A 3C14C 3QY9A 3T7AA 4DR6B 1ONNA 1QIIA 1Z17A 3IJRA 1P5HA 1H2BA 3LDFA 5FTKA 4EJSC 3X2SA 4KXUA 4PZPA 5LYJA 4FW8A 4AZTA 5BNZA 1FJXA 2AZTA 3EXAA 1Z6XA 5FOWA 1OI7A 3DLAA 4B35A 4WOKA 3W6PA 3HP1A 4DQKA 2AG0A 4MB0A 5EQJB 1B2RA 2VAWA 1E9SA 3RIGA 4M2LA 5IDQA 3ANNA 2CUTA 1FP4A 3G13A 3HP4A 3F0TA 4WXEA 3DMRA 3F1LA 3ERCA 2ZR8A 4CTJA 4ZJZA 3NO4A 3NV9A 4PPFA 1OWMA 5D6OA 2QT1A 1DQZA 1MG0A 1C8LA 5ULLA 2AQIA 3AFOA 4JUCA 5DGHA 5KYTA 2PQ0A 3K9CA 1IEQA 4X1YA 4J1SA 3A1DA 5AVXA 4ARVA 4KZPA 2BGTA 4J16A 1E2NA 4M0MA 2UYHA 3MJSA 4HX2A 5K0NA 3SFVA 5B1EA 2RGUA 1NBMD 1O9HA 3F97A 3P9ZA 4MLDA 5A6SA 2IYYA 4W9NA 1HG1A 1CNMA 2HMTA 3BMQA 4KXVA 2WF9A 2ZE6A 3DM9B 3L7JA 1ML4A 1UMDA 3CTPA 3F4LA 3PE3A 4J49A 5EE9A 2A1UB 3VPSA 3BBPA 4CI9A 1IFXA 4HLQB 2Y0EA 1O1YA 3NHLA 5IZCC 2ZJ8A 4BLQA 3AUKA 4BLSA 4DG8A 4ZAGA 2DQ4A 1P6QA 3LC7O 3BJRA 3O1IC 5JAOA 4EX7A 2AOXA 4EGQA 3VRHA 2A6PA 4JEIA 2IPOA 2GKGA 3EY4A 4B6QA 4HNGA 4UNPA 4CIVA 1MX5A 1U7TA 5BW4A 3CV3A 2XY4A 4TSKA 3WZ2A 4YMVA 2C84A 4J6EA 3STXA 3FDXA 1G98A 4YP5A 4I8XA 5AW8A 3IKJA 1BCSB 2R1VA 1HEIA 1U0EA 3E3NA 3P4UA 3BB1A 4OQ4A 3TRFA 3HKEA 1B26A 1GKUB 1M1ZA 1QMPA 4LYDA 1NRJB 5KHAA 5L45A 1WTCA 2CL0X 3ZU4A 2HA3A 2JGFA 5DBOA 4AKEA 1NY5A 2DX7A 1MVOA 3ASZA 4BEJA 1V5GA 1I1NA 3D6MA 3FDFA 3VU0A 3ZXYA 4RLQA 2HCBA 3NC0C 4EL5A 4LOKA 1T24A 3R7NA 5F1KA 3DL2A 3T9BA 3V46A 3WL7A 4AU1A 5BSHA 4GOLD 2NAFA 3QG1A 3D02A 3T35A 1FP7A 1KSFX 4BNGA 3ZY3A 4WK0B 1C7EA 2DH5A 2P2SA 5FOSA 1ZLYA 4JBGA 3RQIA 1XN4A 1KQ3A 2CVQA 3JSXA 3A4TA 2Y1KA 1J0EA 4LTDA 1KY3A 2NTVA 4QDTA 1JRLA 1GNPA 1O95D 2WMOB 2C4TA 3VTKA 3TQSA 1JP7A 4GUAA 2C83A 4YJFA 5MN5A 2Q0HA 2QNIA 3F5DA 1TPZA 4B3TB 1Q19A 1COWA 2G9ZA 4XOUA 5B3LA 2PLRA 5FL7A 4RM2A 5HZHA 1DBRA 4L5IA 3I2HA 2BRUC 3MS7A 3PENA 1UK7A 3SJ7A 2XHZA 2FX2A 1IAVA 4XWTA 4PSCA 1OFGA 3BFVA 3FD8A 5CHEA 2W2OA 3GJ3A 3IAS1 3D3WA 3LX4A 3R6WA 4TV8F 3RS4A 3GZNB 1Z6YA 3JRWA 4L2IB 1NN1A 1G1AA 1A97A 5IUNC 1CUYA 3TTTA 5GIPE 4M7WA 4OYRA 1D2MA 4B09A 3EZ2A 1HMYA 2C3OA 2Z6AA 1M10A 3AIKA 3F73A 1KJIA 1GCGA 1WEHA 2NU9B 4KQ9A 3PEEA 3DZGA 5GJVC 4AL4A 3K2BA 4V0LA 5M7EA 4C3VA 2CBXA 4ML3A 2WLTA 2RKBA 3KSMA 4Y67A 1Z2PX 5B6JA 1L5GB 3WLHA 1DC4A 2I7VA 2XQIA 1RRMA 2PWAA 4MS3A 1L3IA 1A9ZA 1L5HA 3LLMA 3I9JA 4LC0A 1CYEA 3QOYA 4P34A 3PTAA 4TKUB 2FQQA 2VP2A 4MGKR 2O8NA 2CYAA 1XWFA 2GVNA 2ZJYA 3LCJA 3N75A 4GDMA 4IJ5A 4M8NE 5LBTA 4M4SA 2CMHA 4JA0A 5ISMA 1EGVB 1R8JA 3AVXA 3KP1A 4X97A 3WGJA 4ZCRA 3NHPA 1ZHFA 2XMRA 2YIVX 3GMDA 3FMOB 1YS6A 4F6RA 3FVQA 3GJ5A 2IZ0A 4LRTB 3E1SA 4YASA 4RFVA 1OFTA 4D25A 2IS2A 1UM9A 5HIJA 4GU5A 4Y98A 3P4YA 2IPXA 2QRJA 3ENVA 4MUBA 4EL0A 2Q5QA 3FI0A 2Q1XA 4ALIA 1TZBA 4R3UC 1UDBA 4RF2A 3HLKA 3I1YA 3V2IA 1FFEA 2OT3B 1DXQA 1JTVA 3PFIA 1W29A 4QNRA 3W4KA 3IDQA 5C1OA 3RADC 1SVSA 2CF6A 3ENWA 1IK4A 2Y1WA 2CFOA 3P26A 3F74A 4HPJB 3ZC3A 4KLCA 3ZBPA 5IW8A 4FR5A 1NWCA 2ABWA 2E21A 3R3YA 5A4DA 3SOPA 4LDQA 1WETA 4G1MB 1MB3A 3DZBA 2OYRA 2G5GX 2TRSB 4GNRA 4E2ZA 4JP2A 3HXTA 3RSGA 1QFJA 2WWIA 3PNMA 3HZZA 2GFQA 3AZOA 4JYCA 1QE3A 3WJ2A 2WYOA 2VRCD 4CGYA 3DAPA 1R6DA 4G5GA 4BBAA 3WAGA 1YRQA 4N7MA 3JU3A 3PEWA 1XU4A 1NN3A 5E7QA 5E9JA 5K3BA 1G1MA 2VJBA 1RXSA 3VR2D 3CSSA 4LTMA 4PU0A 1IBRA 2II6A 2X7JA 2COEA 1EUDB 3EZNA 4QJ5A 2EARA 4AULA 4Q34A 5SZKB 1SU8A 1RHJA 2YY6A 3A9WA 4G2NA 3FGZA 4R1QA 4UTZA 1MLDA 2ZANA 3K4HA 4D4KA 4IRUB 3GVXA 4FINA 5DI3B 1U1CA 4EKIA 4CR7A 1VYUA 4GPBA 2X7XA 2BJHA 4MMXB 1ZLXA 2ERXA 2YZKA 1TA9A 2XMBA 1NVKA 4G0MA 4QDUA 1C81A 2M1XA 3LVFO 4CMIA 1CY1A 1OXMA 2FUKA 2E4AA 1YBMA 1K1EA 1YNSA 2KSQA 1KEZA 1JSXA 3R3SA 1PUJA 3DP9A 4L78A 4UCFA 3EXG1 3RC1A 1EYZA 5FH9A 1J0CA 1I2AA 1XTTA 2QAGA 4F2PA 3EQ8A 1QFMA 1X1QA 3GEIA 1X1RA 3TB4A 3KWLA 3QZUA 4DMLA 3IVXA 3F1KA 2C42A 4DCSA 1KVUA 3T54A 2GK6A 3WLFA 1AKQA 1GNRA 1VBFA 5DNUA 5EQTA 1O0BA 1KF0A 1SXJE 4A03A 1G8HA 4N3AA 3WC4A 5E9QA 1HDZA 4BJ1A 1O03A 4UEKA 2R8ZA 1L5HB 3FUWA 3RYHA 3T1VA 4QREA 1CS0A 3BFJA 3BL5A 2ETXA 3KKPA 3FVVA 1E3JA 3TAXA 1GFSA 3OT1A 4HADA 5U4QA 3P0HA 1AZTA 1E9CA 1GFZA 3EISA 1Y33E 4BNUA 1XG5A 3PCXA 4FE7A 1JECA 4MI6A 1YFJA 3GUHA 3LO8A 2A0XA 1NOKA 4GM1A 2Z0MA 3QSYA 1E4EB 1V48A 1OVMA 3HACA 1E63A 3KTAA 3LS2A 3JS5A 2LRHA 2XZLA 5K2OA 1FS4A 1GITA 4JC8A 1YJQA 4YP1A 5GTDA 2H0RA 1UEIA 1ZBQA 3DWFA 2ZSDA 3C6MA 3AXTA 4HPWA 1OX5A 3RK0A 3GRUA 4R2HA 1QFXA 1FSZA 3I04M 3BQNB 2PSFA 1XCLA 2K87A 3MRXA 3H6GA 4L50A 4PO1A 2HZBA 2FWRA 1IVSA 2Q5LA 2V6JA 2HADA 4ZC8A 5TMBA 3MINB 4O4LB 4EHAA 3H0CA 5FFMA 1HYQA 2JGEA 2NACA 2BMFA 3LZDA 4RQUA 3TM5A 3MFQA 4OJMX 2VPQA 2FR8C 3JPYA 4H31A 2DJ5A 4QT4A 4L28A 3OQIA 2JASA 2A1UA 3AHHA 4IPTA 2RSLA 4IGAA 1KEWA 3T3GA 4E09A 3FR7A 1I24A 1DOAA 1ULBA 1XFDA 1K8RA 1MB4A 3CNEA 4L5AA 5JU6A 1ZHHA 2XDQB 2EFDB 2JHPA 3EWSA 3U3XA 1FNNA 4NX2A 1EWYA 5A9TA 3VI4B 2YCBA 1JHQA 4MVYA 1QVAA 3LLVA 1DJQA 3L04A 3O9ZA 3FNRA 3KT0A 1W2HA 1XZKA 4JU8A 1JIXA 4DA7A 1QIJA 1QH0A 3G88A 3W8EA 1T4DA 2CZGA 4IHJB 1SG0A 1ZMXA 2JIMA 2GDZA 2HQRA 2Y1OA 3Q98A 1H6BA 4IDAA 4JLSA 4M0PA 3MGGA 2CV0A 3BPSA 4KVAA 3PHIA 3NGLA 3P0RA 4GKBA 3T06B 1FP1D 3GLIE 1N6NA 5EXDA 3OQ6A 1M2HA 3PCRB 3PEVA 1Y1PA 4KU4A 5AHKA 4L0CA 3OPVA 2H51A 2OO7A 4FGJA 3RUIA 4H3VA 3QYJA 4M37A 2YVUA 2MWMA 1GQQA 1Z7WA 1YRWA 5KNCH 1NYTA 1U2SA 2PX4A 2UYOA 4LCEA 2H3HA 4RMIA 3ENKA 2QZJA 3DOIA 4JSYA 4RY8A 1LF5A 3MN1A 5KTYA 1Z9BA 1HE8B 4OI1A 1FSPA 3PLNA 2EP5A 4F97A 2HA4A 3Q5EA 2ZT5A 1FYXA 1U7PA 4OSOA 1ISPA 4X20A 5GQSA 3UK7A 1CZKA 1EFHA 4FIZA 1OU0A 1WMEA 3STUA 4XUEA 5C4MA 3BRSA 1EDDA 3LOUA 4MYDA 4DHEA 2PS0A 2OGUA 5BV8A 3I05A 4E2YA 3ND5A 4G0WA 3ELWA 1UDRA 4WNCA 3NHRA 1KIAA 1E3EA 3VZBA 4HEA1 4NPAA 3UXMA 2W7TA 2X1LA 3KXDA 2VT6A 3LE8A 4CQMD 1RLTA 2WFLB 1XCOA 4FDTA 5CXQA 5FLXA 3DXZA 4TKMA 2X5XA 1TD9A 1YJAA 2IIPA 5K09A 1QIEA 4IGEA 1FY2A 3H6KA 4JH0A 5BN3A 4BP9A 2AS0A 1ESMA 3FSEA 1NPDA 1IJBA 3X2FA 3F9IA 3ZJUA 3AM4A 3AETB 3B6EA 3DT9A 1Z22A 3BD9A 5KSWB 3ZNPA 2DQZA 1P0PA 1LWNA 3HCDA 5JE8A 4YIHA 1IQ0A 1P0QA 1SB9A 1Z5VA 3TSAA 5AD1A 4C6SA 1TK3A 1UKYA 2PMFA 3QIAA 4OOEA 4JJFA 5CM9C 5EKXA 5E3HA 3C3BA 2J5XA 3HY6A 1ZM9A 2YV1A 1GU1A 3FNGA 4AY3A 2JLUA 1QV6A 2WQ6A 1NE2A 2GZDA 3C3EA 3WO1A 4B7ZA 1QUEA 1XTQA 2HF2A 3IULA 4B76A 4CL2A 3AVWA 3SQDA 1Z2OX 2ZYSA 3MGKA 1QDEA 1U94A 4Z5XA 2G17A 4K6GA 1GGNA 3LVRE 4IEIA 2E4YA 3C24A 4P81A 3WQSB 3WRYC 4BB5A 4GLBA 4DLXA 1EUQA 4MR9A 2QN2A 4C4RA 4XM1A 3SF0A 2G8LA 2GFHA 3EQ7A 1QGDA 3KOYA 1ORWA 2PL1A 1FRNA 3T9FA 5JDIC 3BSSA 1D2AA 4KQMA 1BH6A 4UUMA 3LPLA 3QV1A 2WKRA 1X1AA 4Q1DA 5IRCD 1RXYA 1RI3A 4ABTA 1G8YA 3CGGA 1TCCA 1RADA 3MCWA 4B73A 4BYMA 3QBDA 2RBEA 2RH9B 5JH7B 3RAPR 2M32A 4H60A 3TD9A 1J8DA 2R6DA 1JDSA 2JFYA 3BMOB 2YNMD 1NKTA 5AYVA 2NSJA 1XTUA 1B1CA 3A1VA 2R68A 1BKDR 1Y7LA 3BH7A 4JSTA 4D81A 5CFLA 1L0BA 2BAGA 4QEDA 1VI6A 2YWEA 1ODJA 2R8PA 4JVNA 1EG2A 3O4IA 5JROA 4ONEA 4I9HA 4X45A 2Q28A 4HGYA 4DMMA 3VZSA 1IRXA 1M7BA 1P1IA 4G84A 2XWBF 4WFIA 1P72A 4ZU6X 3T7EA 4AY6A 2QRGA 2O8FA 4KGDA 3GA0A 3K9BA 5FUVA 4D8WA 4QOIA 3I30X 5EWJB 2YXNA 4P58A 4Y1GA 5K6AC 1PJ2A 3GCGA 4Z53A 5M04A 1NFRA 2Y3IA 3FTQA 2D2VA 1A95A 5IJ9A 4KIWA 3G2IA 1O97C 5EUBA 1YJ5A 3C3KA 2WYUA 3IAFA 3PQ6A 2UZAA 2YUTA 2CJWB 1NLMA 4MEJA 1DCFA 3IA7A 2YXDA 4RY0A 1Z0AA 4RBNA 1NM5C 4ZN6A 2WLSA 4NU0A 3I23A 1P2VA 3IIIA 3T9EA 2JJYA 1U0FA 5LZ2A 1E0DA 4LBYA 3K0AA 2GNOA 2VAVA 3WIDA 5EZ5A 1J7JA 2F62A 4F5DA 2YR0A 4RESA 4FDLA 4FQ8A 1R5NA 4UHDA 4PIPA 1FFXB 3O8QA 4CL3A 5A3SA 2AB0A 3DOUA 4R69A 1YC5A 2Z2IA 1DKPA 1T3ZA 3H19A 1AQUA 2NYRA 3OZEA 1IHOA 3SC2B 4C22A 1ECBA 5DYYA 2FI1A 3GW8A 1P29A 3JVDA 5AM3A 1W36D 3MMPA 3T7SA 5F5NA 1PJCA 5IC4A 3WGIA 4TLCA 5MFPA 3JQ8B 3D8SA 2BF4A 4HRVA 4KL8S 4MQLA 2AEJA 3ET5A 3I9LA 5JNRA 2FP4A 4KXXA 4C89A 1FX0A 1C30A 3FUUA 2FPGB 1IEWA 3JYPA 2KS6A 4QYTA 1CX9B 3VTFA 1A8UA 2KJQA 3HCAA 3EAGA 2RGBA 2VRCA 3DZHA 3P2JA 5EUMA 3WNZA 4RQBA 2XBUA 3CXUA 5KQPA 3B9PA 3CUVA 4NBVA 3VR5H 5C7YA 3OKAA 3S7ZA 1E0KA 3PQ4A 2ZTLA 3I01M 4CLRA 2FPPB 1EP2B 1OV6A 2HJSA 2Y27A 1UANA 2R8BA 4DXHA 1RJ9B 2DGDA 1W1IA 1KO7A 1OZAA 3QTTA 3WHIA 4AROA 4CYMA 1AO3A 4EENA 4GC5A 4GRAA 4GX1A 2CL6X 4IGIA 2M98A 3I0NA 2BBOA 4RA9B 2R7LA 3D3EA 2PXAA 4U5QA 4D6PA 3HP7A 3J80A 5JYDA 2WM3A 2PKWA 3U44A 5LIPA 1D2HA 1L7AA 1OYWA 5IKMA 1P8JA 1TU4A 4JASB 4HRXA 1SKAA 3PUHA 1JQBA 1QYRA 3GEGA 3KOZA 2R85A 4UUBA 3ZV7A 5T8KC 5JSQA 5KYWB 1T0BA 4ETIA 4O1MA 1G8GA 2ZXUA 1QGED 4P4NA 4DCGA 3PXGA 3EUFA 4L75A 1TT5A 4F7DA 3SCZA 5LLSA 1KRXA 4DM3A 3KAJA 3L0IB 3O75A 2OAQ1 2R0QC 5B1SA 3WB1A 1IXSB 2BE9A 1F06A 2GZ3A 4HAVA 1C9YA 2VF7A 3BMXA 2OPHA 1EWKA 1GGKA 3OFJA 4DLBA 2FSFA 2IU6A 1Z0SA 4IKEA 4FBGA 4MYTA 4KCGA 4RV9A 1P2SA 3U31A 2IS1A 4TTJA 4B31A 4PC1A 1X94A 1QGYA 2JRLA 3JAWA 4G07A 4M1WA 3W1VA 2NO5A 4NS1A 1KP2A 5G0WA 4G24A 2YBDA 4MLZA 3D81A 3LK6A 4Z3DA 1P1FA 5BN3B 1DRVA 4U9UA 2ZWPA 3RC3A 3U61B 2IYPA 4H08A 1C7IA 2DWUA 2QF7A 2X6TA 3K8ZA 4ZDIA 2IP4A 2XZTA 2D13A 4IXMA 1P2GA 2JARA 1LPAB 2O0HA 5ESWA 4WY5A 2ICAA 2QUBA 4JBIA 1R5BA 5K3SA 3RUDA 5LMUB 2QVZX 1ZJZA 3A6DA 2BEJA 2E6KA 2BDTA 4CG2A 4CV3A 2XI4A 4XLTA 3QU5A 4O2AB 4W99A 5TE9A 2PUFA 3JQ6A 1XDWA 5ES4B 1G17A 1V5EA 1RIFA 2NM0A 1IM8A 4D4HA 1G5HA 1GPUA 4R9VA 1BCRA 1Y63A 2IXBA 2W00A 4RVFA 3LT2A 4KB5A 4LSMA 1Z7YA 4N4AA 3IXLA 5HGJA 4A6EA 1WZ2A 3BFKA 2L0XA 3NU1A 3WHKA 2HO4A 2PZMA 4I1OA 3INGA 1F20A 3LGSA 4UW9A 4AECA 1BX3A 3THXA 3KQHA 3L7DA 4LJKA 3ZIAD 1HYEA 4PAWA 4Z3OA 4TWBA 3UWMA 1UBSB 3N6RA 4U9HS 5EWJA 4M54A 2WWGA 3GFSA 2WYHA 4L8FA 2O1EA 1AC5A 3IUBA 2FXIA 5DW3A 1F38A 3PUZA 3IODA 4JJIA 1TKBA 4NCXA 5KQRA 3DM5A 4XCXA 2H59A 2E6UX 5H59A 3D2CA 2H7XA 1W1WA 3GDFA 1NVDA 3W9BA 2VZ8A 4TWRA 4G63A 2RIPA 1T0IA 3HFSA 4BIMA 3DAGA 4ZOEA 4RY2A 1PR5A 1JQKA 4EA9A 2ZG6A 4I1SA 1UBOS 4UPDA 4P3NA 4TTQA 2HY7A 4DG5A 3IIKA 5KREA 1PS8A 4HEJA 3L8EA 3FSGD 5ARBA 2OC4A 4GX0A 5FOXA 4MROA 5JZVA 2AOUA 1GRQA 3R41A 4LGYA 3T95A 4HWGA 2VXBA 2ZI4A 4DADA 1GZDA 1T3SA 1MIOA 5CT4A 5AIAA 1HC7A 1D2NA 4ZOAA 3D5EA 1ESEA 2VWGA 1LPOA 2CNOA 1KVSA 2Q41A 4GD3Q 4MR8A 2QTZA 3DLPX 3L7YA 2BFBA 5CVVA 3ANXA 5BUZA 4TXMA 2VHUA 2PZAA 3QQPA 1P81A 3A3YA 3R5HA 4MPPA 1BMTA 1NBIA 2JGRA 1U8ZA 2JVKA 3O74A 3S2GA 2FQXA 4EECA 2NZWA 2HCJB 4TVKA 3UCXA 4EKDA 1RW4A 1LJUA 1TW3A 4C5BA 4LMBA 4DXDA 2ADOA 3CLRD 3PHJA 5K8UA 2OOSA 3KEFA 2I66A 5I9SA 4BB6A 3VZRA 4ZAWA 1VL5A 2J5KA 2I87A 1N0WA 3KUXA 4JXKA 1KEEA 1CEEA 1N5MA 1N2XA 3LZ6A 4XPIB 4R2IA 3OJEA 2DHEA 3KJQA 3DE4X 9ABPA 4FMCF 4CUKA 1YZQA 1J5PA 5JASA 3ZDFA 3QLJA 4HNAA 2OFOA 3I73A 4ZOQI 1A98A 2H7VA 2NO4A 2OVFA 5B2EA 3WA6A 4DJJA 3LX6A 3R24A 3C7KA 1RC1A 2COUA 4BC1A 3ZS8A 4Y1RA 5CEEA 4YP6A 1PJ8A 4KMRA 5FLEX 2VQDA 1R5JA 3FWHA 4HQRA 4P22A 6LDHA 2R9VA 2IYLD 4OUDA 3E6AA 2WG1A 3DE0X 1L5SA 3AO0B 4KDRA 3A4NA 2IEZA 4CLOB 5JISA 1DQYA 5DHPA 4RCVA 1TM4E 1EXMA 1IVNA 2DFNA 3L6DA 2HWUA 5EZYA 4TWAA 2V9CA 3A7EA 2ZVQX 3NHFA 2H65A 4FHGA 3WNVA 6YASA 1GNQA 3C85A 1T35A 1VSBA 1MAHA 2JFUA 5EJ9A 1A2KC 3LOPA 4Z8YA 4AMVA 3T52A 2FEWB 5C8DA 4KPFC 4WXYB 4TKZA 3HRIA 1H3NA 5AI9A 2YXEA 4TV9B 1RCFA 3I4CA 1NNUA 3U1BA 3M3PA 3IUNA 4L72A 5ALTA 5EKDA 3PD1A 2FEAA 2I29A 1YKFA 4FHDA 4K9DA 5DP2A 5EE1A 2QRNA 3A32A 1SZPA 4NE9A 5A3RA 1YGPA 2C4NA 1WOYA 1GL9B 3OM1A 4AZWA 4OXIA 2C3MA 4WCFC 2HQBA 5BWLA 4I5DA 3DE2X 2NU8B 4NAUA 3SBXA 1Z63A 3K4QA 2FOIA 3LQ1A 8GPBA 4DPKA 3G0IA 4ZIRB 4RULA 3A58B 4WJZA 4UCXA 3RAFC 4MA4A 2JGMA 1U5BB 4MS4B 1VPDA 3G2OA 1AXRA 3Q0IA 2G1AA 4RD1A 2YXPX 4Y7CA 3X3HA 5KYGA 1Y6FA 1P80A 1N5KA 1RJFA 3VHXB 3EIQA 3HJAA 5EZYB 4B2LA 4KVGA 5FNVA 2GEBA 2MSWA 3DT6A 3R75A 4HH3C 2P6PA 2R2AA 3KPWA 3PR1A 3N7AA 3RU9A 4E4TA 5IXSA 2YV4A 4KOEC 2IOYA 3IO3A 2I1LA 3FMPB 4NARA 4N3BA 1G9TA 4NCKA 3VOTA 4KRGA 4OUDB 5HRUA 1MB9A 1N7HA 3G0BA 9LDBA 1FL9A 1SXHA 3W7VA 1PTJC 2QRLA 5KYKA 1FQOA 1Z5UA 4FWBA 2J3IA 3E0QA 4UD2A 1PF7E 5L53A 2LV8A 1E1CA 2JGDA 4AP5A 4ZMRA 2QTNA 5ITSA 5IKOA 3FOCA 4CMIB 4LHSA 2E18A 2O2GA 3HZRA 5DI9A 5I8PA 4YALA 1VE5A 1UM9B 1KEUA 2OHXA 1CDZA 4P82A 4A0SA 1HYBA 1MOQA 1QTRA 1WXXA 1YB1A 3EH2A 2HMYB 4OI0A 2B83A 3R23A 3TGLA 1BS9A 1DFHA 4FT2A 2RMKA 4BQQA 3N76A 3T3DA 3IALA 3NOQA 1E2QA 3DF9A 4XVCA 5A4KA 4E13A 2BEVB 4HKTA 2W6MA 1TLTA 1KS9A 2BEVA 1DG9A 1E6CA 3PPXA 2CW5A 4NFSA 2QMQA 3GP8A 5JJKA 5BMOA 5D3QA 5BPHA 2JI7A 3PSAA 1R18A 3EBLA 3OIGA 4IF6A 4ASUD 1KEVA 3W5IA 1XPRA 3CIOA 5FUYA 4Y6SA 2E37A 2GTPA 4HAXA 5H82A 2WIGA 3I61A 2WQ7A 5AM1A 1HNXB 4QXAA 4YRCA 3RIEA 1PFUA 3OZUA 4Z4IA 2AE2A 2AKAB 2AJ8A 2WE8A 1UXJA 5J2TB 1OC2A 1X0XA 4CM5A 1PO7A 4WEOA 4ZJPA 3ZXXA 2Q3EA 3QXSA 1Y4SA 4I5IA 1EFRD 1SC3A 3WWOA 2OXRA 1AS3A 1BH2A 5H3LA 2H1OA 2JG3A 3IDOA 1TZCA 3ASYA 5IZ4A 4YT5A 2JANA 4GH5A 3STHA 1A96A 4PTLA 2CUKA 3DEYX 5A5DA 2QAGC 4GPZA 4P4TA 4UFPA 2MYNA 5CH3A 4X85A 2BIFA 3IBTA 3SKXA 4CFSA 1MBZA 2J09A 3D2LA 3QEMA 4JVSB 4NR0A 4IV8A 1VIMA 2K5UA 5JWHA 3OFKA 3ANTA 3AJ8A 3L6UA 2W2MA 3LHIA 4MV4A 5DM1A 1JR3A 1W35A 3GT3A 2OFFA 3CMCO 4B2PA 5CYGA 1C9NA 2PUGA 5LP6C 1LV8A 4BQPA 1H6AA 1HURA 2IYNA 2Q4DA 3PX3A 3USES 2G9NA 3ISJA 5BN4B 4F4DA 3C5HA 4E3WA 3OESA 4P3KA 5EWMA 2XIJA 2PL3A 5FPQA 4V0NA 4QODA 2PSHA 4TKVB 3PI6A 4JYAB 3OPYA 2WJVA 3JYOA 5CHYA 4YMTA 4V0OA 1XMVA 3UT5B 4BO9A 3NBYC 1NURA 1X19A 3VXKA 2IF0A 1SHLA 3CRW1 1EH5A 4OGKA 3V4PB 3WDLA 1ZD2P 1QTIA 3NPAA 3WTBA 4DE5A 2POCA 3RCBA 1S4QA 2HA5A 4R3WA 1AN0A 3WMRA 3BN3A 1W9HA 2QORA 3C7DB 3LL4A 1E66A 1FPMA 4GNKA 4OFWA 4OJKA 2P65A 5LIRA 4ER3A 1QP0A 1Q1ZA 2Z8YM 2OYSA 5K3EA 4F2DA 4GWKA 3ZI7A 2W2NA 5C2JB 1FPQA 1GZ3A 2XCOA 5CVJA 1SCAA 2Y2VA 5KKAA 3SBOA 1WEKA 2QQFA 1B3RA 2Y9PB 1X7HA 4NFLA 3L77A 2BSAA 2PVCA 5TSDA 3CVOA 2JEOA 2FV8A 3ADKA 1U3WA 2DP4E 2ZJFA 1CR2A 3K5IA 2EJBA 1EE1A 4MGYR 4OXQA 4QDJA 2JFVA 5IMSA 2K7ZA 1OREA 5KNDA 1T25A 4M6WA 1LZKA 2C4KA 1ND5A 3GP5A 3IURA 4X8MA 1PR6A 1YS2X 1KFCB 2LCIA 4GMDA 3KHSA 4I2NA 4N18A 5LNK6 3NP7A 4X63A 4BTEA 3BHJA 1E1YA 1GCAA 3GARA 3ZJ5A 4TKLA 2WTXA 4FIDA 4OHBA 1R74A 5A6SB 4KDFA 1XCJA 1CTQA 1DJLA 1EBUA 1TO6A 2GLXA 1ONPA 3ER6A 3FBWA 4KODA 4UHKA 3KYBA 4Y8VA 5SYNA 1A72A 3KNZA 1E8DA 2E89A 3UHAA 3W3ZB 4WGFA 2CHUA 2D5CA 1IY8A 1NULA 3WGVA 5GAJA 3UN1A 3PUVA 1OH5A 2D2XA 3RSZA 2IHYA 2C04A 3A6EA 1Y4DE 2C0QA 2BKAA 2G6BA 3SLKA 4QELA 3WGOA 4JBYA 5EMHA 4FK8A 1RFGE 4MCAA 2HLDD 4RK4A 3SIPA 2P30A 4P08A 4GT1A 4TVBA 1QP7A 2QI9C 2GZ1A 3EDOA 4RE5A 1ZVQA 4Q7QA 5BOSA 1HSOA 2E5FA 1SCNE 1IUPA 2O23A 2ZLBA 4ND8B 4UM5A 4LF4B 1Y8QB 3DMFA 4DIMA 5EFZA 4YRDA 3SZMA 3M5CA 3FCOA 1KMHB 1JLMA 1YZKA 3CEHA 3HA5A 3M6IA 4I55B 1EZ4A 1M7GA 4XQ0A 3ZCUA 1JG7A 3ED5A 3KCNA 3KSUA 1VOTA 1BCRB 2LIPA 5TF0A 3M1LA 2O7QA 1MEOA 1XEXB 3JQBA 3U48A 3ZHUA 2P6RA 1U9IA 4RD2A 2GZRA 2DWPA 5TS2A 3GLFA 1YDWA 4KBFA 1XLVA 3DFUA 4OJTA 2WJGA 1GTVA 4KQXA 4OPMA 4Q4HA 4A5SA 4W8HA 4EI9A 1P2BA 1QG6A 2WSYB 2LDXA 2JFOA 3L41A 4JCCA 4LMRA 3JARA 1USGA 5EHQA 1Z4MA 5F12A 3DMYA 5IAOA 4AI6A 1I32A 4BX3A 1LF0A 1UDAA 3WAJA 4BX9A 1T3LA 1RC0A 4GMFA 5TQ2B 4C0LA 3M5DA 2ERYA 5FBLB 1U0RA 1TMOA 3LGXA 2X14A 3ONNA 2ZPTX 4GKAA 5AWFC 4CTOA 4EITA 1IZ0A 2X7HA 1X6VA 3BSFA 4LHVA 2GPBA 2BC9A 3O8OA 2PGIA 3UK2A 1QO0A 2W8BB 4F4UA 4S3MA 4J07A 5TPZD 3ZDYB 5JO9A 2OOKA 3MCVA 4QXPA 4FMCB 3VPHA 4N47A 1GSIA 2G4VA 1ZD9A 4D0GA 5BURA 3RTGA 1PL7A 4CMAA 1YJCA 3CFYA 3OQJA 2EJWA 1CUHA 3CLUD 1MJFA 3LNTA 3ORRA 3OEED 3JQGB 1AF4A 1D7AA 3NHJA 1PKEA 3NKLA 4F3NA 3LKZA 2O59A 3KQSA 1IPHA 4KX5A 1ATIA 2V7QA 4XGQA 2QGZA 4ZO4A 4FEEA 4ZOCA 3X44A 5A4FS 5JEDA 1ARZA 2APJA 3LPAA 4QYXA 3DE5X 4J0EA 3V48A 2FN9A 4LXHA 5LD2C 2HYIC 4E88A 4NBRA 1W5TA 4NDNE 1SHZA 3BJZA 1JAYA 3AOEA 4EAQA 3F7TA 3IV6A 1X8LA 2H06A 4D3XA 4XR4A 5LP6F 1NP7A 2PKQP 2PKRA 3I6YA 1Z7GA 4WH0A 4M8KA 4EUSA 3E7DA 2Q9BA 3RLIA 5GWXA 3QBEA 3WBFA 2IXEA 5A2GA 1C1DB 3GLFE 1Q21A 1E3SA 1CUEA 1VPWA 1RYYA 2X9QA 4RD3A 4BVLA 4RDXA 3CA8A 4IZHA 2WSIA 2O2JA 4HN9A 4DBLC 5KYXA 3HVHA 4QECA 4X7BA 1OY1A 2DY0A 2ALJA 4ALNA 4NC9A 1X74A 1DAMA 1W49A 3ROFA 3L43A 2XCQA 3A25A 3ORSA 3BXPA 3KT8A 3OC6A 3V8BA 3UA4A 2XRMA 1YVPA 3L84A 2X6QA 3ROGA 1IY0A 4UVIA 2AA3A 3V7NA 1Y7PA 2YQZA 1IDN1 3EGXA 2FFRA 1KC3A 1IM5A 3ETLA 4ILKA 4JQYA 4PBRA 4YWHA 2EJCA 3KXPA 1MA0A 5ETJA 5ILOA 1YJ8A 4L6IA 2FEKA 3FPHA 4J9VA 1PNQA 3AUTA 2IHTA 1ZM4A 4ZEVA 1T8SA 4YCDA 4K05A 1XJWA 2AZMA 2ODEA 2HGSA 2BW0A 3MTJA 1I33A 1BTOA 1TA0A 2Q4TA 1Z0JA 2BFDA 1NI4A 3EVCA 3IBFA 1PNVA 5DISB 3I9NA 1EK2A 5FHQA 5HE8A 3MNFA 5EKUA 1QGUA 4OLHA 1H4VB 1GXSB 4DJAA 3ETHA 1QGOA 3GLHE 3ZWAA 4DA6A 2HF8A 2HN9A 4ED9A 1CQWA 1YKGA 4OQEA 2J1LA 2TECE 5TGDA 3MD0A 3QOXA 4A0RA 3OTIA 2FPOA 3KFXA 5IC6A 1RRFA 4R5MA 1FVHA 3SP1A 1EX9A 3HXKA 2BFCA 3LIPA 2FOLA 4JWKA 4EZBA 4B3FX 1VB3A 2C1XA 2ZRAA 1SXJA 2CEKA 2VZ9A 5T3UA 5LOVF 2FPPA 1AA6A 1Z0FA 4NYIQ 1XZPA 1MKYA 5JXJA 4WLOA 1ZDMA 1O9BA 1NU8A 2MYTA 2HAEA 1DG1G 2ZYGA 1L1QA 3PPYA 4M7OA 4X94A 4X44A 4B3HA 2QSUA 3BZWA 3P4XA 2C2OA 1V8PA 3UJBA 2J6CA 3P2KA 4MVJI 4JKIA 1ZK2A 2C2HA 4K6HA 3VQTA 5KOHA 3GFVA 4I3HA 3K1AA 3L7BA 5LQUA 3MJRA 4JAVC 4DABA 1CHDA 1LUAA 3ZVMA 1VKOA 4IHKA 2A5FA 2O8FB 4R1MA 3CUKA 3BJIC 3FYTA 4OL9A 5AVJA 1NBOA 3RS5A 1JKJB 1I1OA 4C7XA 5YASA 3CLKA 1NTRA 4R2KA 2WT8A 3T9AA 2WTBA 5E1OA 5FBRB 1PFYA 3RYHB 3H9CA 4FOLA 2B5VA 3DFIA 1HO3A 1PR4A 3OVMA 4Y2HA 2XDYA 5J23A 2XUFA 5JSUA 5FUWA 3P2IA 5HIMA 1LS1A 4GVPA 1U5AA 1D09A 2VDOB 2I4TA 3LQYA 2VWHA 4HDSA 4CLDA 3R6DA 4QQFA 4I4LA 4EUNA 1I4WA 3CEMA 3E0XA 1VLJA 1MAVA 1USWA 2H5LA 2IYAA 4I1RA 4KPUA 1JDJA 1OU4A 2H4XA 3CNBA 5EKTA 1WX1A 1ADYA 2VHJA 3HHPA 5F7ZA 1USIA 1OAAA 5E6RB 1RHQA 2XH8A 4O59O 3LU1A 1R6XA 3TW8A 3T38A 4F9EA 1BWPA 4LCJA 3BRWD 1X7ZA 1PQWA 4RVHA 1D4OA 3DYBA 4C0WA 4G5HA 3TPFA 1RP7A 1WSBA 3FHTA 3LQKA 3V2HA 4IBOA 1E3IA 3VHQA 1RP1A 2Q8PA 3A9VA 3QF7A 3STWA 2DHCA 3U0VA 4UFOA 2DR3A 1SA0A 4J94A 3ZR4B 4NY1A 3GZTB 1X1TA 2XX3A 1RXWA 1WB9A 2TMDA 1ST2A 2XPCA 1XQXA 3B5IA 4KVFA 3WMGA 1RU3A 2H5EA 2VDKB 3DOOA 4XYEA 2C77A 5ECWA 1H22A 3S27A 1KXZA 1XJCA 1FRQA 2VP0A 2CYCA 4XPZA 1QBGA 4D7AA 5KZMB 2Q3CA 4MGHA 5E38A 1EE9A 1YA8A 5JADA 2R1ZA 4DIOA 2ZBUA 4GM4A 4D82A 3JATB 4XDGA 2FF7A 1E9DA 2LZ0A 1L5YA 1DTWB 3DA8A 1YQEA 2BEUB 2B7LA 3TR0A 4BVHA 4RV4A 3IMEA 3QWBA 5L95A 4IH1A 4PBSA 5CXXA 5F33A 1IOWA 4LXTA 4D4MA 4N6NA 1OD6A 3R8CA 1ZCZA 3KRTA 4MVJA 3FB1A 2FW7A 3GB9A 3GRYA 1UINA 1WSDA 4BNTA 2P67A 1OASA 1QYVA 4LJ4A 4XTRA 4DNQA 4BLVA 2GO7A 1SD1A 4XVUA 1FLNA 3NRCA 4NBUA 2ZCJA 4OAOA 3DKKA 5J4HA 4P33A 4X61A 1KP9A 3F47A 3WRXC 2PN1A 3C7AA 3E2PA 3QK7A 1X2BA 1OFUA 3QLUC 3SHVA 1CUUA 5PGMA 4AZ3B 3L82B 4PYMA 4G86A 2Q6LA 2R6JA 3CJTA 5BUQA 1RBYA 5DM70 4IFTA 3RJMA 1FJGB 1F1JA 5LYYA 1TEVA 1WDKA 3V4ZA 3OPYB 1XQ9A 3KQOA 2XMQA 3ILHA 3EZ7A 1CKEA 2JHFA 3Q8WA 3TJRA 3ZDBA 1XPOA 2G25A 3IAEA 1UXIA 2JIBA 2P8SA 5TPZA 2J59A 3RBXA 5HIAA 1UH5A 1XZ8A 3ZZNA 1P4GA 4J9UE 2VP9A 1ZUIA 2FFAA 2NQTA 3F2IA 1SUAA 2IPMA 3LC2O 1JTEA 1CUGA 1XZBA 1W48A 1YGYA 1BD4A 5J63A 4FGZA 5C51B 1U6IA 2F1HA 1L7QA 2AW5A 1GKYA 4RMGA 3E82A 4PZUA 3CUTA 4YYEA 4DLPA 1OI2A 3IQZA 4P7KA 4TL8A 1RQXA 1XMXA 1J9EA 3BIOA 4LW8A 1JR2A 3KWJA 4FS8A 1SELA 4MRVA 4A8JC 2RH8A 4N3NA 1ZWKA 5D1HA 2X4IA 4MCHA 2GN0A 3T9CA 1IOZA 5D3KA 2JGIA 5TEWA 1J00A 1TYAE 4BEBA 2XQFA 4B9AA 4RPGA 3NDJA 5DPMA 1L4LA 1AX9A 2Q46A 3HB9A 4D9EA 1PW5A 3H86A 1NJ1A 1VLZA 2CXOA 2P5TB 3WK5A 2A5DA 2D5AA 3LHDA 3ZCSA 1P61B 1KPGA 2G1KA 4WAUA 2G4LA 3LKDA 3TQCA 1O8BA 3EEYA 1F5NA 1WMFA 2GN9A 4FSHA 5A3QA 2G0NA 2FPUA 4EPWA 3O0TA 4IH9A 2RONA 1S2DA 2ZSFA 2CD7A 4XIIA 2IYZA 3LLCA 4MZXA 4ZRDA 1SC6A 4LZWA 5TMEA 1XD2A 1VLVA 2YOHA 3BGWA 2GN6A 2DPMA 2ONKA 5A3VA 2VNAA 3H16A 1QQ5A 1A9QA 3PPVA 4WXHA 5CXSA 1A69A 5IULC 1IHDA 3FHCB 3LUCA 3BUSA 2V96A 5EKSA 1RIIA 1VIVA 3R7WB 2JI6A 2C94A 3EHEA 3SZ3A 3UBTA 2DFTA 5J4YA 3PC2A 4LSWA 4ZMSA 2FNAA 4Q5IA 2HDNB 4XYLA 1CEXA 4M49A 1W4RA 4HXGA 4LRUA 3VPCA 2PXHA 1QWSA 4EPYA 4FHZA 1IMOA 2OLKA 5AW9A 4QGSA 4KO8A 4HGRA 2REQB 4BO2A 5HR5A 2DUJA 1JMYA 5CYFA 5AESA 3JYLA 4TLMB 4CEHA 3H1TA 2J9XB 4DYHA 3K53A 3TQIA 4JLWA 3QENA 2HIMA 4LRQA 4UPVA 2OUIA 3PRKE 2FQYA 4IHQA 3OX2A 4J7CA 1YE3A 1C1YA 1QHNA 1YBVA 3ANSA 3R3VA 4IINA 4KAAA 3AP2A 2PX3A 2PU7A 4NBLA 1FRFS 1K92A 4X3CA 1CB7A 2PLAA 5JCJA 5E95A 3HUFA 4QOJA 1SBTA 2EFCB 3NYRA 3HPQA 5G0TA 5A06A 1AXGA 4YK7A 3LC1O 1JW9B 4BUZA 5C81A 1J97A 1Z33A 1Y7IA 3MTAA 4HJXA 4PR0A 2CXXA 1NN5A 4FNOA 1UKZA 3HSYA 3RVSA 3ULKA 3OCVA 1E7WA 3DE1X 4AUKA 5IZCA 4UBKA 3Q2OA 2Z95A 2FPRA 3F6SA 3SSAA 3Q8MA 1A0OA 2QN7A 1U2EA 3KJXA 1N9KA 4PG8A 5JHHB 1Y1TA 1GARA 4O1HA 5I9NA 4RKEA 3NGMA 1DLIA 1ZNYA 1SIBE 2ZT8A 2QW1A 5DLQC 2AXPA 3CKKA 1KK2A 4M8IA 4QIHA 4HEHA 2VDVE 3VVMA 4RPKA 5GONB 3L7OA 3VKUA 4EUFA 1Q0QA 5JS6A 4HLCA 3ABOB 3AFNA 3IT3A 7MHTA 3VR4A 5DTJA 1C0EA 1E2MA 2J07A 3RQSA 2PSEA 1O94A 1CJBA 1CR6A 2H63A 3BGVA 4R1PA 4RC9A 1FBTA 1M72A 4JXZA 4Q9DA 1MC1A 4OHPA 3AHEA 1BVHA 2H07A 1PZXA 1JS1X 1LVGA 1UZAA 2EP7A 2IIQA 1PR0A 2AG5A 2OAGA 4ITVA 3AFMA 2I3BA 4TVOA 3R76A 3NM6B 1DX9A 3OJOA 4M99A 1LFAA 5JZBA 1DI0A 1PYGA 1K9SA 4EUEA 5A4IS 1RKUA 1GCIA 2E85A 3ND7A 1AY0A 4ZAFA 2OK8A 4P1ZA 2GCOA 3RGGA 4B8WA 1FU7A 3MCTA 5A5EA 3PGA1 2P0EA 2HA0A 2FPGA 2YJ4A 3QEJA 4CCYA 4H7FA 2VNHA 3DL4A 5HKOA 1R4MA 2IYWA 3I5MA 4IIJA 1I4OA 3L8YA 3DEFA 3BCSA 3DC7A 4ZA2A 1OTXA 3TW0A 1MIHA 2EKPA 1GPBA 4DCNA 1K8QA 4ZI7A 1E4OA 4L4UA 3A28A 4FFPA 2ID9A 2XNKA 4HC4A 5ITWA 2DR2A 3G5AA 4CUJA 2XV1A 3BE6A 4IF4A 2VDRB 3LTEA 3W2IA 3ZOZA 2RHWA 4RZHA 1CLUA 4WERA 2HPHA 1MTZA 2UZ0A 1T1JA 3N0VA 4YO7A 3DUFB 4QM7A 2IEGA 1WZCA 2IDMA 1MW8X 2R4QA 4TS1A 5CT6A 1TUEA 2UAGA 3DTNA 2YZGA 3EFBA 3OPYI 1O6GA 2RC5A 3UC9A 4FFWA 3KEOA 1VLLA 3KLBA 3VPDA 2YHIA 4CLHA 2W4QA 3RS3A 1T1RA 3HJBA 2O0JA 2NU9A 2ODAA 3BTSA 3HR4A 4HS9A 4PTZA 5DWDA 4HVCA 2AHOA 3HKCB 3L0BA 1PU2A 3KPVA 1GPYA 4ZQIA 4GZMA 4PSKA 4QU9A 1UMDB 1EP3B 4G26A 4UBMA 4Z4GA 4CV1A 2ZAMA 1F14A 1DBPA 2GYVA 5ER9A 2DCUA 2HU5A 3FZQA 3MGAA 1VLHA 1J22A 3RLFA 4YCSA 3M4ZA 1KR2A 3I12A 4QBIA 2VC2B 2CNBA 1SQGA 3AV3A 3IVAA 3OETA 3O3OB 1DKRA 3O4HA 1LVUA 1ZAKA 4LZPA 5L7YA 4FI3F 3KAKA 2G36A 3H2GA 3FKSD 5DYWA 4BFZA 1T10A 2PTGA 3WYAA 3TZCA 3U4AA 1JILA 2XTZA 2GUGA 4V0ME 3ZWMA 1K7CA 1CF9A 3K0EA 2HU2A 4QPZA 2C92A 4M1QA 1O94D 4MK4A 4YPVA 3A3OA 4YAJA 5GJBA 1C29B 4X6XA 2BFPA 2L18A 2QMEA 1E2LA 2IELA 1X7XB 4R2XA 3IAS6 4E0BA 1M8GA 1JDNA 4MV7A 1QR2A 3CY6A 5G0SA 5JJLA 1NIPA 3FFBA 4DIUA 5C1DA 4LFAB 4PICA 3RFTA 3DZKA 3RT7A 1UJ5A 3FCUB 3HBMA 4EM6A 1ZGZA 3KAQA 2BTQA 2UYGA 3A0UA 1Q1GA 2EGUA 3FOWA 3I9KA 4LJ6A 4F11A 5HRCA 2IW3A 3JARB 5DOZA 4FDVA 1RAEA 5F2OA 1J70A 2ZWIA 1ADGA 1E8NA 3WK9A 1FTSA 5B4UA 4CKXA 4G81A 2RAFA 1JQ5A 1UODA 3PUKA 3I4LA 2QQ0A 3JWIA 2J0QA 1ZEJA 4PQYA 2AH5A 1P4RA 4OYHA 4PF1A 1U7XA 1XNHA 4MX8A 1M33A 2O2SA 2FZEA 2QD3A 3V32A 4BKUA 1KDTA 1YB5A 1VL8A 1WUYA 2Y1EA 3BCUA 3N87A 1JQAA 4TWZA 3SJUA 3THOA 3ZG6A 5BSKA 2HH9A 3PTLA 3A6JA 4L0DA 5ALPA 3DWEX 1EFCA 2F6RA 3IBGA 2WHPB 3GLHA 1CQXA 3NJ8A 5DF1A 3SC4A 2Z8ZA 1RXIA 2E4WA 3RG8A 3VYUB 3IESA 3Q6IA 2YWFA 3LHKA 4P8RA 2EJVA 3NNNA 3T1HB 3U0BA 1Y7HA 4DV1B 3LWNA 3P9NA 4JT9A 5ILGA 5AUQA 4FX5A 4WK6A 1ONOA 1Z2CA 3L7KA 5IH3A 5TQ2A 1XAGA 3ZX4A 4R7TA 1QWOA 1JXAA 4KSYA 1P1BA 2ILTA 2B4AA 2FAXA 3CW9A 3JRNA 3HEBA 4B0PA 4RADA 5CEJA 2GZ2A 4QFMA 1D1QA 3ZHSA 3GOQA 2WA2A 4G0UA 3AGQA 3LY8A 4LY0A 5AJHA 1XVVA 2DG2A 1IN7A 2Y0DA 4R84A 1WXGA 2ET6A 2BLLA 4A15A 1A9YA 4NMWA 1H05A 4W4TA 3BEOA 1GYPA 3TE6A 3D64A 3TRDA 4P7FA 4AYXA 1WV1A 5KJCA 4ZCIA 1QH9A 1JEJA 2N0SA 3E9CA 4R7ZA 4HAOA 1KRHA 5EGSA 1JSCA 3WNCA 1MGPA 1MV8A 3P9KA 1IQRA 1U81A 4HQFA 4KR9A 4RGVA 3IH5A 3HJUA 5HM6A 2RI0A 2C7RA 5EIAA 4U02A 2J4CA 2AC2A 1NFFA 1P1KA 3VZPA 4YGYA 1KFKB 1K98A 1WP9A 2XBLA 4H7EA 5AOVA 2JJ2D 3HB7A 4OQLA 2VAPA 2JAWA 4RPJA 4RH3A 1COWD 3S7TA 3TMKA 4MQ4A 3S70A 4X65B 1MCZA 4NK4A 1TQ6A 2I22A 3VR5A 2G72A 3NG1A 5KAMA 2Q8QA 4C4XA 4HGZA 3PJEA 1PS0A 4E2XA 2N47A 4WN3A 1J8YF 1K7EB 1YDEA 5EL0A 1EHIA 1YD7A 2GCGA 2QRUA 4PZ9A 1JV2B 4ID9A 4PC7A 3WTCA 4AZ0B 1I4TD 5DBIA 2Z5LA 3SYLA 1CRWG 3WYCA 1TTTA 3RM3A 1S8FA 2Z09A 1X0VA 3STYA 2Q3JA 4QJIA 5LYJB 4B46A 3KWFA 4GI3A 4WI1A 3NNDA 3AK4A 1HFKA 1PEAA 2XKBA 4JUAA 2GYYA 1LLUA 2NO6A 2PX5A 1OWOA 2GFIA 3ESYA 1J0XO 2ZAOA 4RIFA 1J2UA 5KNBH 5IWCA 3ZDCA 2DPXA 3T7TA 2EVWX 1QC5B 3RO7A 4PGMA 3L4EA 3S8YA 1CZHA 1V8OA 2XUGA 3IPCA 3JZAA 2QL7A 3R0JA 1KHHA 4MHSA 2F4VB 3GT4A 1SHJA 4Q9IA 4HDMA 4KOAA 4S1VA 2DETA 1VG0B 3HCFA 1AIPA 1JAZA 3RFVA 5HS6A 2GA8A 4DWVA 3NHMA 3WBKA 1IUNA 3IAAA 2WKQA 1VSUA 4NIMA 1QYDA 5FFFA 1VPVA 4CL8A 1BHSA 1JVNA 1RPTA 2VH1A 1Y37A 4X92A 3B38A 3B3FA 3RUEA 3F46A 2FUG6 1O5IA 2P8JA 2WD7B 2BUAA 4ZCLA 5TF4A 1ZO8A 4YJHA 4NYMQ 1QK3A 3I3OA 4YMHA 1Z82A 4E4YA 1WY5A 4LZJA 3AJDA 1SOAA 1BZYA 4D0LB 1NT2A 5HQ3B 2OGWA 1G20A 3VKWA 3WY9A 3L40A 2VT2A 2AYYA 5AOAA 3ZY4A 4F9FA 4IUYA 1HE5A 3LXUX 2PRSA 5H81A 2XF8A 1JHUA 1T3GA 1C9JA 2R2GA 1U9ZA 3C5EA 4RHTA 2WWYA 1NGSA 1ZK4A 1WVMA 1MOZA 2WVGA 3FFXA 1UAYA 2O1XA 2OP0A 2DHQA 3ENZA 3PRHA 3QUCA 3IAXA 4JJ6A 3VNQA 3WLPA 2HBYA 5DCLA 1E3DA 4PG7A 3W06A 1OR8A 5JLAA 2W2LD 3M4XA 2GD6A 3PQCA 5HDBB 1Q91A 4O2BB 3MIZA 1DIHA 1NKVA 1CIPA 2DULA 4RD6A 5ESDA 4ZHSA 2ZRIA 4QL3A 1V96A 5HKLA 2G5TA 4MQFB 3A8TA 4U8HA 1RI2A 1VGVA 4JLOA 1HTWA 3I04A 3R9KA 3FWZA 1V95A 3CUYA 5FR2A 1Z4JA 4WLNA 2XCIA 2F90A 4Z0HO 5I9MA 3N2GB 5KVVA 1JEQB 2EJUA 3FI9A 4MS1B 5KNCA 1QHHB 3H5NA 3QKRA 4OH1A 4L4XA 1N5DA 4LE2A 1XD2B 1OC4A 4RD0A 2NP6A 1JALA 5COAA 2YV5A 5PNTA 4B6GA 2XRZA 1YXMA 3JALB 2NNLD 4P92A 4CNQA 3PQEA 1I36A 4N6GA 4ZVQA 2JK1A 1F51E 1U6JA 1D2EA 2AFIA 1EFTA 1DHRA 1YR3A 1I2DA 2XVXA 2Q3DA 2F9MA 4N7RA 5DIZA 4RK0A 4YT2A 2QY9A 4CQMB 1UF9A 2BGJA 1RBMA 2HK8A 4YMGA 1CY7A 2KYRA 3HPRA 3RJZA 3D2BA 2C2ZA 5F51A 1F17A 5JPCA 1YQUA 4YUAA 3TSYA 4EZIA 4O25A 1A9PA 5K0CA 4NNOA 1XEFA 5KC8A 5LZ4A 5A62A 2WIFA 2IEYA 4XUDA 4OD0A 1RQ2A 1QCDA 2GGSA 5A3JA 3W5CA 1TYDE 1WHSA 1E64A 4OATA 4LXXA 4UQLA 1C5KA 1CQJB 3HNRA 1QCCA 1BDMA 1NQUA 3KYDB 2GM9A 3U7FB 4OK3A 2WSSD 1RPNA 2V7BA 1TRHA 3KKQA 3OWXA 1EPUA 4MS3B 2VYQA 2IXTA 4DCCA 4C3ZA 3AI7A 2BF7A 2DT5A 4LX0A 1JQJC 1R0CA 5DKFA 1LEHA 1G16A 3AR4A 2Q5OA 5FPPA 2ZKIA 2XOKA 3ROMA 2B25A 2QJOA 3BK2A 1LLQA 4U2EA 2DTEA 2RG1A 2V5VA 4TQ9A 3AR6A 4W5NA 1BWQA 1Q3HA 3UJ7A 4FUTA 4US1R 5AHRA 5FTLA 3PFKA 4LDRA 1KDVA 1YZHA 4ZEMA 1L4NA 3RTAA 4LKOA 4R2MA 2CD9A 4ARUA 4WV3A 3D31A 4NBKA 2WB4A 1KFJB 1XZCA 2AG6A 3IP9A 4CMEA 3UZUA 1B43A 4J0GA 5CVTA 3DDNA 3D4PA 1DKQA 3FF4A 4UBIA 4X7RA 2WV9A 621PA 5JMTA