4D97A

Salmonella typhimurium d-cysteine desulfhydrase with d-ser bound at active site
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
328
structure length
327
Chain Sequence
MPLHHLTRFPRLEFIGAPTPLEYLPRLSDYLGREIYIKRDDVTPIAMGGNLRKLEFLVADALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLDLFNTQIEMCDALTDPDAQLQTLATRIEAQGFRPYVIPVGGSSALGAMGYVESALEIAQQCEEVVGLSSVVVASGSAGTHAGLAVGLEHLMPDVELIGVTVSRSVAEQKPKVIALQQAIAGQLALTATADIHLWDDYFAPGYGVPNDAGMEAVKLLASLEGVLLDPVYTGKAMAGLIDGISQKRFNDDGPILFIHTGGAPALFAYHPHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-cysteine desulfhydrase
publication title Structural and Mutational Studies on Substrate Specificity and Catalysis of Salmonella typhimurium D-Cysteine Desulfhydrase.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 121
structure length 327
sequence length 328
chains with identical sequence B, C, D
ec nomenclature ec 4.4.1.15: D-cysteine desulfhydrase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d97A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d97A02
1UINA 3T4PA 2ZSJA 4COOA 4AECA 2ZPUA 4LMAA 1WDWB 4KKXB 4D9FA 3IQGX 5B36A 1J0EA 4ZQCB 1KFEB 5J43A 3VSAA 4D9EA 1C9DB 1V71A 1BEUB 1O58A 3TBHA 4I1YA 2DH5A 3V7NA 3HMKA 2CLIB 1TJPB 2CLEB 2CLHB 1TZJA 3FGPA 5B53A 5B55A 1J0CA 3VSCA 1UBSB 1KFBB 2D1FA 2DH6A 5DVZA 5D87A 5HBGA 1A5BB 1PWHA 1Z7WA 2JC3A 4HPXB 5DBHX 4HT3B 1M54A 2WSYB 5DW0A 1UIMA 1JBQA 1QOQB 4ZU6X 4H27A 4PCUA 5JISA 5IXJA 2BHSA 1J0AA 1FUYB 2CLLB 4NU8X 2CLMB 3DWIA 1RQXA 1J0DA 1C8VB 1TDJA 1K8XB 1TZMA 2J9XB 3IQIX 2EGUA 3L6CA 4L28A 2RHGB 4L3VA 5DBEX 5I6DA 2J9YB 1J0BA 2CLKB 2GN0A 1TYZA 1X1QA 5KZMB 4D9BA 2O2EA 1K8YB 1A5SB 1TTQB 3AEYA 1WBJB 5J5VA 2GN2A 2Q3CA 4XUGB 1P5JA 3FCAA 3VC3A 1A50B 5I7RA 3DWGA 1TTPB 4OREX 5D86A 5IW8A 2BHTA 4D9MA 1CW2B 4D9CA 1Y7LA 3BM5A 2RH9B 5EY5B 4HPJB 5E0KB 1Z7YA 5CGQB 3PC3A 2CLOB 3VSDA 3PR2B 1TZKA 5CVCA 4L0DA 3X44A 4IL5A 1K7EB 1QOPB 1TZ2A 1KL7A 4NEGA 4QYSA 5I7OA 5IWCA 4D8TA 4D9KA 3SS7X 4OFXA 1WTCA 1BKSB 1WKVA 2ECOA 2J9ZB 2ISQA 3VBEA 2V03A 3IQHX 5C3UA 4D9NA 4JBLA 3ZEIA 2C2BA 1F2DA 2Q3BA 1K3UB 2TYSB 2RKBA 3AEXA 4D92A 2TRSB 5DW3A 5BW6B 1CX9B 3SS9X 4D97A 4D9IA 4HO1X 1PWEA 5D84A 5JJCA 4D8WA 1D6SA 2EFYA 1KFKB 2ZR8A 4WX2B 1V7CA 1VB3A 2ECQA 4F4FA 5I7WA 3X43A 1K8ZB 1E5XA 5B3AA 2C2GA 1V8ZA 3R0ZA 5B1HA 1C29B 1FCJA 3PC4A 4LI3X 1KFCB 4JBNA 5KINB 4HN4B 2Q3DA 4D99A 1VE5A 4D9GA 1K7XB 2O2JA 3L6BA 3L6RA 5I7AA 1KFJB 2TSYB 3SPXA 3PC2A 4LMBA 2GN1A 5B1IA 1VE1A 3RR2A 5D85A 5T6MA 3IAUA 3CEPB 4D8UA 2PQMA 4Y6GB 5I7HA 4ZU1X 1A5AB 3DKIA 1K7FB 3R0XA 4AIRA 1OASA 4D96A 4L27A 2CLFB
chains in the Genus database with same CATH superfamily
4ARAA 2L2QA 2I4LA 2B99A 3OU2A 1G9SA 4R0MA 4O4JA 3VPDA 2VYND 1IN6A 2WUWE 5DNUA 2C4WA 1A5ZA 3EHEA 2J6CA 1WL8A 4A15A 3OM0A 1E3JA 4N82A 4WK0B 3AVXA 2JAQA 3K70C 3W5DA 2SHKA 2B7BA 3H19A 3L0ZA 1YRLA 3F9IA 3L7BA 5KHAA 2Y05A 3OQ1A 3CEMA 4FEYA 1VSVA 2QW0X 1CUEA 4R1OA 5HFNA 5BVGB 3MOSA 2WUEA 4WAUA 2CDBA 1BXRB 2H5LA 4KQFA 2R47A 3B13B 5DTJA 2D8AA 1E3LA 1LTHR 2VP6A 3LVFO 4XJTA 1CVIA 2BMFA 2W6IA 6GPBA 2CHVA 1E9VA 1E4OA 3LBYA 5I3ZA 2NU8A 4HH1A 2JAOA 3CB4A 2V4MA 4OO3A 4BFSA 3A6PC 2J0VA 2PSSA 3DA8A 4M7WA 5CT5A 3T41A 5LJLA 1VJGA 1X7XA 3MGBA 4JVMA 4PTLA 5GZ6A 1QRUA 1BX0A 2P4SA 1S8OA 5TPWA 1E2DA 5K3BA 3NDRA 2O6HA 3I9JA 3EISA 2F3TA 3OURA 4MZXA 3SIWA 4YRBA 3DL4A 4OYYA 2WJPA 3ANSA 4LWPA 1U2GA 4JJKA 4N18A 2W6PA 3GVXA 3ZXIA 4DQKA 1HZZC 3ASYA 1Z6AA 1MF7A 1A69A 1UWKA 4RWZA 3RS0A 2XXAB 1YDHA 2ZRNA 4YAFA 2WOJA 1HE5A 3BE5A 4F21A 1JR3A 4BMYA 3CCFA 5BV7A 1DBRA 1AF7A 3P4XA 2R00A 1ZI9A 2J09A 3N8NA 4GEGA 5TMDA 2BEVB 2ZBEA 3GBPA 4CNQA 3RUEA 4YJHB 1ITZA 4WZBB 3AZQA 5ALTA 2C04A 2PEZA 2QF7A 3F7OA 5JDCA 1CF4A 1SFRA 2A9JA 2X5JO 3AHEA 4MW1A 5DM2A 4YMSA 4B3TB 1PSZA 1MIOB 1SY7A 4PF1A 1EX6A 4MYHA 4KQEA 1QCZA 3AFMA 3FCYA 2I4RA 3ACCA 3EPPA 2ZXFA 3KBOA 3U3XA 5F5NA 3CGWA 3ZVKA 3OTHA 4CEJB 1EDZA 3EIEA 5D01A 1QFSA 2ASEA 3KV1A 4H08A 1ZN8A 3KUDA 4MKFA 4Q18A 5K0ZA 3P2YA 1I2BA 4NZPA 1T6ZA 4NMWA 1Z4OA 2Y1LA 3WNZA 4FCCA 3VVBA 3JQFC 4A8JA 1KS9A 1MVLA 3FB4A 3G85A 3IP7A 3JV7A 1XNGA 3VDRA 1Y8RA 2BWJA 4R01A 5IABA 1BRTA 1D2EA 2EZ9A 2XTAA 3S40A 3AW8A 2IP4A 4DJFC 2P9HA 2C99A 1L7MA 5T64A 4KYVA 9LDBA 1X1DA 2ZYGA 4O4HB 5BWMA 2V8OA 1SVWA 2P1DA 3W6OA 1Z17A 4EB8A 3IV9A 5EKDA 1SELA 2EEZA 3ZLVA 1HURA 4TTPA 4TXLA 4OF4A 4DJTA 2OSBA 3HZRA 2K6GA 2FRVA 3K9NA 2YZNA 3A1FA 1XNHA 1WXEA 3QMVA 4K26A 2PXCA 4MHOA 4RZIA 2QOEA 3R2JA 5F1YA 2PQMA 3ID6C 2JZCA 5DGTA 3ZJYA 4W8HA 4A26A 1W29A 5I7HA 4G6ZA 1CF2O 1EGAA 4MAFA 2OBBA 5EE1A 4FE4A 1MJ5A 5ESWA 1RXVA 4LAFA 1XQWA 4TSFA 1OX4A 5IC6A 3CX6A 3CEAA 2H54A 3GGOA 4JLAA 2VJDA 3AV3A 2GM4A 5K3AA 1CTQA 3H6HA 2M9MA 2O1EA 2P3OA 1XVTA 2VF2A 3JR7A 4FWIB 4QAJA 3OE4A 1MJFA 2Q1UA 1MOZA 2GSDA 3BH6A 3DZBA 4EH1A 5BQFA 1YTUA 1Z0ZA 4HRXA 1DIHA 3ZCPA 3KG2A 4OGKA 5KNBA 4N1AA 3E7XA 3KCNA 4KMOA 1K1EA 1ADBA 4HLCA 5EL0A 1EZZA 4P22A 3RKUA 4JD5A 1X7YA 1ZH6A 2X9NA 5AVVA 1MEJA 3VPGA 5K6RA 3LGAA 2P9EA 3PDHA 5EZYA 4ZT5A 4ZYVA 2OCDA 5K8TA 1XU4A 1TQ6A 3HP4A 3PJGA 4P84A 2E89A 1C1YA 2GBPA 1LC0A 2OCGA 1AO3A 1TLLA 1JQKA 2B3DA 3EEBA 1XMJA 1D6MA 2WIFA 3IIJA 3HUEA 1Z83A 4G84A 1NULA 4IV0A 3MJRA 4OHMA 4Q19A 1J0BA 4IWNA 1KVTA 2ZI3A 5IJAA 1E4VA 2DLDA 2VJYA 3TNLA 1J21A 3WGOA 3MS2A 3B6JA 3I09A 3ND7A 4LV6A 4RZ3A 1XI2A 1WVGA 2GN2A 4EHNA 1J0XO 4ZAZA 1Y89A 1CETA 1DKOA 1E4YA 4KDRA 1P6QA 1UH5A 4H4DA 4BLWA 5C7LO 5EERA 3WIUA 1CHDA 4C3VA 4MW6A 4F5WA 4GOXA 3FDZA 1HM5A 1DADA 2G8NA 2NM0A 3PUJA 4FEGA 4UTRA 4MHTA 3VJLA 4V0KA 1U2SA 3PS9A 2HF7A 2CLOB 1FNBA 5K3DA 3GGSA 7ADHA 1KVUA 3BK2A 5JJIA 1TZKA 3GFFA 3UA3A 5CXQA 3K8OE 3U1BA 4OGWA 1M75A 4O2AB 2BCEA 1L7OA 3Q9SA 1NI5A 4PG5A 3RS4A 1SXJE 3SD7A 1KL7A 1S2GA 1YR8A 3IUMA 5EJ5A 5IVKA 1D0SA 3L93A 2GYUA 1SKAA 3I6MA 5FBZA 2WM8A 5ADUS 5K8VA 2BMVA 4ZPXA 1B74A 5CLHA 3L92A 1GGNA 2JFYA 1NVTA 3CVJA 3OT1A 4ND7A 4HEA6 2ZBRA 3FYHA 3IJ5A 1KOJA 1E6UA 1GGMA 3T6KA 4JH0A 4YWHA 4DBZA 5BXYA 1U0GA 3QGMA 3W5SA 2P9CA 4NG5A 3GLGA 2RHHA 2DUMA 4B4WA 1J2YA 1I32A 1BMTA 2D7CA 2ZE5A 4H59A 4W7SA 1ZKDA 4HGYA 4JK3A 4X71A 5ABPA 3GN1A 3K5WA 4TZ6A 4CL8A 2Y99A 3DOFA 2C9CA 3DW1X 4XVCA 1DEHA 4XI9A 4BNVA 5H3LA 1HEUA 1X86B 5DM4A 5JRZA 4AI6A 2VQSA 5EMLA 1GLNA 1W8DA 4A6XA 4BTVA 4DR1B 5JAOA 2XB2A 4ZQGA 4J2OA 1N6LA 1BAPA 3U7QB 1JXOA 3A26A 3DOJA 1H9AA 2WU1A 2YBDA 4FSDA 1KIAA 2OWEA 1QQ5A 2YMPA 4WXEA 3R8XA 3FOWA 1ULZA 2X8JA 2XEDA 1N7HA 1KK2A 3Q1LA 3WSVA 3II6X 5C8ZA 3HLTA 1JQEA 1NRIA 4Y2GA 2Q4OA 1MW9X 2XUPA 3QBDA 4IIDA 3DE4X 1AZLA 5IUJC 1ENPA 1JXQA 5IZCA 1CYDA 3EZFA 3RGWS 5L3SA 3KSRA 1CJUC 3GU3A 2X7XA 4RACA 2HK8A 5KU7A 3Q40A 4MR8A 1XWWA 2IZ1A 5HWSA 1LTKA 2IXDA 4QRDA 1PR1A 5I9LA 1FL9A 3U7RA 1E61A 2WWHA 1G6Q1 2Z95A 1OH5A 4C3ZA 4YJGA 1XTRA 2CFIA 4YAIA 1GILA 2V6FA 4JS0A 1JKJB 1NIPA 1OLXA 5EUMA 3H84A 4EGFA 3UAZA 3F3KA 5GJBA 4GAEA 4AZSA 1HSZA 2WBLC 4KJXA 4DRXA 3HDJA 3EPHA 4DCUA 1J97A 1VA5A 4RLFA 3CRZA 3GCXA 1G6OA 3LP6A 4ZVKA 3VGJA 3VO1A 4BNNA 1F2VA 4B3XA 5K03A 2FRDC 1GGEA 4KVFA 4RZHA 1YQ9A 5F5LA 2ONCA 3RSFA 3MZ0A 3ZLTA 3TNYA 3B12A 5HMLA 1HGXA 4IEEA 2WAXA 3C3DA 2DP4E 4YT8A 1EHYA 2XMDA 2NSLA 3PKJA 1XT6A 1LWNA 4FB4A 1DKNA 4HH4A 1NXOA 4HZUA 4JBWA 4QSHA 3SEZA 1XD8A 5JNWA 3L07A 1HLDA 1T13A 5KB3A 5KOIA 4PANA 1BEZA 3ZS8A 2B2XA 4RIGA 1IHOA 1Z5VA 2G77B 4GYJA 4LNUB 4OLFA 1M5UA 2D7JA 3PDIB 4CM7A 3HABA 1RZRD 4O4LA 1X8XA 2WIKA 3TPZA 3UJBA 3E9CA 1S8FA 1J09A 1MTOA 2FV8A 4MYDA 2RGBA 1SXGA 3SQOA 4EG5A 5AW4A 1PRYA 1VIMA 4R2HA 1Q57A 1P2SA 3V1LA 4ZMRA 5D86A 3M49A 2D59A 4EUFA 2YR0A 5KYXB 1DRWA 3DFUA 3L0PA 5FPHA 4Q4CA 3PXDA 2MTBA 4UTVA 2D4AA 2PN1A 2D1YA 5BNWA 2N47A 4H6XA 1L5KA 1R0WA 2AOUA 4NPCA 2ZKIA 3WOVA 4ALMA 3HP7A 1PZXA 5KJEA 3R9KA 4FE3A 4XYBA 2ZB8A 4CM3A 1B0PA 1SUBA 2XUKA 1EESA 4M1WA 2OMEA 1QPGA 2XMCA 3Q7RA 3Q5EA 3QYFA 5DGDA 3H86A 3OAAA 5CW1A 3A7EA 1NQTA 2H3HA 3U62A 1E9AA 3CLRC 4C2BA 3FVQA 3A2NA 3Q3CA 1KQOA 2W71A 3I2JA 4KX3A 2OKGA 2HXSA 3EB9A 4G5FA 1ECLA 1QAMA 4N01A 4GGPA 1HFKA 2H1FA 1SB9A 2F17A 3GUHA 3P32A 3PUHA 4M1ZA 5DCUA 3GLIB 3LBFA 4B3RB 2AEFA 1OPXA 1E7WA 5JJCA 4EENA 4JL5A 1UPUA 4KYUA 2R7MA 5DNAA 5DBFA 2FZCA 1YB1A 4EJSA 1QX3A 2L17A 1T0UA 4P7FA 4JDUA 2Q5HA 2GDZA 2PX3A 3C70A 1WE2A 4US0R 5AK4A 1NE7A 3H13A 4G1VA 3TLEA 3FHCB 1CUJA 4Q1DA 3QFCA 2P2YA 2X0IA 1LNQA 3JWPA 3D5TA 1QHYA 2ETXA 3SYRA 3QNUA 1FTWA 4CUKA 3DAYA 4DILA 1ZJ5A 3MMXA 3KLOA 4X1IB 1J9ZA 4M1EA 5FUMA 1F5SA 1XZDA 3OLCX 2XOKA 4UEOA 1T35A 3NBQA 4E1AA 3OZDA 3D6TB 5BSMA 4EEZA 3G3EA 3P2KA 2QTFA 2NYAA 5J2TB 2AMVA 4CF3A 1FQKA 2QNRA 2XLCA 1G3IA 4PLWA 2JBWA 3NHAA 1FUUA 2V54A 4GKAA 3AY3A 3KEOA 5EQDA 2YIDA 1NX9A 3KKEA 3HG7A 5DLEA 3VV2A 1FFSA 1UINA 2ACWA 3TEJA 4C0SA 2IXEA 4UE3S 3IUBA 1PLJA 4W7IA 1NN3A 1APBA 1IIBA 1MXFA 3LF1A 5L9AA 3ZIDA 1ORWA 3EYAA 4C07A 1EBUA 1ATIA 2GWRA 2I1QA 3FLMA 3K0CA 4KXNA 3U4QA 1SBZA 2BUBA 2P69A 2PZ8A 2A9QA 4YDQA 3BIXA 3PEWA 3GVIA 1KXJA 2X8AA 1LVUA 1P2GA 3ENKA 3PGJA 3VISA 2Q5LA 1FS6A 5H81A 3AF6A 3IVGA 1EX9A 2C5AA 3WQSB 1D1TA 2N0SA 4J94A 2IPXA 5CA1B 2YYSA 3CUVA 4RAQA 4XTRA 1WHTA 4ECAA 2W6OA 3F4KA 5K8LA 1GL3A 3D3QA 1ABEA 3CS3A 3FJYA 4RVNA 2P75A 5BY2A 3G2HA 2FFHA 2QG4A 2OD9A 2ZSHA 2JLXA 4EYKA 2HF2A 3KR0A 3BDAA 4N7MA 2HRQA 2EKBA 2KW5A 4QUGA 1Y4SA 1K3FA 1VQ1A 1POWA 2GSWA 2ZJ2A 3OUUA 4GMGA 4AJNA 4B4VA 5B1YA 2CXQA 3OCJA 5TQ2B 1GPYA 4DYHA 3D3KA 4HDKA 1BW9B 4XLTA 2DPXA 5FBHA 5ADVA 3R0JA 1F17A 5JAHA 4JB2A 4R1SA 4OJTA 2AZMA 3UOWA 1NKVA 4I5IA 4H0CA 2QLMA 3K53A 3HCCA 2R68A 5I7RA 1NJ1A 4TWRA 5DHUA 1OXTA 3R41A 4P7KA 1CZKA 3V1NA 3V1TC 3G9QA 2KPOA 2IYTA 3FSJX 2I29A 5I8WA 4I2NA 3VVMA 2INGX 1E63A 3FGNA 2J3EA 1PG2A 3DCJA 3OPNA 3IKTA 3BM5A 3I53A 3JZIA 2ODQA 3HYTA 2NTNA 2PWYA 4YRPA 5LOVA 4ZODA 4DMHA 2B61A 2ZJ4A 3ED5A 5T8KA 3HVUA 4P1ZA 1D8TA 4QOJA 2AQ8A 3RRNA 3U9TA 4ZVMA 1EIWA 3L6OO 3FKQA 3D4PA 5ERXA 1BO6A 2NTJA 2AFVA 3MINB 2ZT6A 3HXQA 3WLHA 2IWRA 1E58A 1O95D 1UPFA 5HE8A 1SU6A 3QVGA 4QM6A 3KJEA 3Q3JB 3I34X 4L2IB 3PWTA 4MWOA 4OLJA 5IDVA 4KPEC 3R9XB 3NYQA 3LC1O 4GOND 4LDPA 4CHTA 4D97A 4F4FA 3KT3A 3LGSA 5EYPB 1KHHA 1SC6A 2BONA 4CHGA 5A4JA 2CXXA 2QD2A 3BUSA 4WY8A 5AVRA 3PGLA 1M0WA 4HDNB 1HEIA 1R16A 2C78A 3URMA 5MGNA 4AU1A 4LZNA 3TUJC 2Q5JA 5JIBA 3G2JA 2IUFA 1Z2PX 1MRZA 2HV9A 3OZTA 1NLUA 4CLXA 2CXSA 4KXWA 3SOZA 4EVSA 3SZRA 3FSRA 1V9LA 1QB8A 4FILA 5LQMA 1Z2AA 5BUZA 1GVNB 1FFGA 4MLCA 4O63O 1JFRA 2PU5A 4MR9B 4OB8A 1GD1O 4OQMA 4JI3B 3VR3D 4PLHA 3NO4A 4LV5B 3R0IA 4NBVA 1XTJA 2PCJA 5JYCA 2EDAA 1XTZA 2CNBA 5JAIA 1EM6A 4MVJE 4NCIA 2PLNA 5DXFA 3OX3A 5LA6B 1TCAA 3STWA 1BROA 1YZFA 2L19A 2YN4A 3CTPA 3DV0A 2AYZA 2PL9A 3CF0A 3GIWA 1SQ0A 2GD6A 2HLDA 3I1YA 1KJNA 3GZ4A 2IU3A 3L9WA 4I4IA 3OZIA 4KXVA 5COQA 1V37A 4LRQA 4W5JA 2OSVA 2XNDD 4RTSA 5LB2A 3EVFA 4YDHB 5LYJA 3TLAA 1TM1E 4E4YA 4UREA 1YZ3A 4WOJA 1RCUA 4L9AA 1RJWA 2LIPA 2R6AA 3PGA1 2PS1A 5LDGA 2IU0A 2D4HA 4EGCB 1I2AA 1VC2A 2CK3A 5K3EA 2FW9A 2E85A 1L7QA 1KWKA 1U6IA 1CEEA 3UOGA 3LWBA 5TT0A 3ZNPA 1ETHA 4HQ6A 4MIOA 4GLOA 3PV0A 5B6IA 4MUEA 2YJ4A 4QOGA 2C92A 3H5TA 2FSGA 2IJGX 1CR0A 3WRVA 5ARDA 1P81A 1RWMA 2EV9A 3BS4A 3NQ41 4W8GA 5LXTF 4WT7A 4E6EA 5BQXA 5GVRA 2HNKA 3OUTA 1Z33A 2MYUA 3GC6A 3HL4A 4YV7A 2ZSIA 1XYYA 3AVYA 3C7CB 3ASZA 4GYKA 2BI4A 4J0DA 2VTVA 2W2NA 4YTEA 2VYVA 1M76A 4PXYA 2PKRA 1I01A 2GEVA 4ZQIA 3A9CA 3FCEA 2WRZA 5DRYA 5FL7A 4AZVA 3DULA 4XRGA 1F0NA 3OE7A 5K45A 2UZ3A 3ED1A 2KBFA 2C2KA 1EA5A 2WZQA 4IVRA 1W25A 5A1TA 3GJRA 2XADA 4C0AC 1AKYA 1TE2A 1PR3A 1RBYA 3IPCA 1P7YA 3U1VA 3ZQUA 4D6PA 2Q5IA 4EI9A 1QF6A 1ZS9A 2NW6A 2JFHA 4PPYA 1XCBA 3LOQA 4YACA 5CR9A 1X7WB 5AJYA 4KH0A 3HY3A 3WGUA 3G7UA 1CNEA 1ZGAA 3PFWO 3L8CA 4ID9A 1FDSA 4NQRA 2QU8A 3CNBA 3E9EA 5D3MB 3ZGVA 5JVDF 3D6MA 3FROA 4CQMA 4U4AA 4JQOA 2VDKB 3C5VA 2C2XA 5HILA 4QQFA 2PZJA 2IBTA 3EGEA 1VRCA 4DV2B 2HMVA 5EIBD 2IXTA 1XEAA 2J7PD 3JQBA 4ZOLA 4EY6A 5A7HA 5I4KA 2J9RA 3LCVB 2G9RA 2G1AA 2QNIA 3KEFA 3HKEA 4DCSA 3UFXB 1HQCA 1PR4A 1U99A 1QQ6A 3N7AA 1W2GA 5BN4B 5DI3B 4C1BA 3V4FA 4CU5A 3DBHA 4JP8A 3GBVA 4XGKA 4XZ3A 2C82A 2VCHA 5EP4A 4DL9A 4XX1A 4E5UA 3JYHA 2E6KA 1SCDA 4D9IA 3V5NA 1K4KA 1KP2A 3C7DB 4RFSB 2O8NA 2QSZA 3ETCA 3OCCA 4ZDKA 5FTLA 3L7JA 1YA8A 5D6OA 2M98A 4DCVA 4D80A 1MNQA 3LCJA 4A73A 3ET4A 3F5MA 1LGYA 3NHMA 2X7HA 1N5MA 4LZJA 5K3OA 1OREA 4FM9A 4V0NA 1GOTA 1E5XA 3N59A 4IGAA 4B8YA 5BYAA 3ZWVA 2XE4A 3CPJB 4UU8A 1QP7A 4Q1VA 4G5YA 4MUHA 5KINB 3ZX4A 3UUWA 3N8HA 5BYJA 3ZDEA 3GYGA 1SUFA 4Q9IA 2JK1A 2AD5A 2EWWA 4O5OA 3ZNOA 2PNFA 4AJ2A 4OQPA 1K63A 2B6HA 2BELA 4I1OA 1E9EA 3B89A 2ZJ6A 2E9SA 2FEOA 4QPCA 4U5QA 2HRCA 4FOLA 4CKCB 2LWIA 4OX9B 5F35A 2HBYA 2F8TA 4RTLA 4PLYA 2VHUA 2QYOA 3QF4B 4C4ZA 4ZMBA 3KAJA 1F8FA 1ZX1A 5KQMA 2ZR9A 4AP5A 4QQNA 2C57A 2E4AA 3GJ5A 4EB3A 1VE3A 3CW2A 1CZNA 1G64A 2PVSA 5CFQA 4B3FX 1N0IA 2VRBA 2X4IA 2VYCA 1W73A 3DB2A 3GEBA 3OTWA 4IQ4A 4TTTS 5PNTA 2RFLA 3G8YA 421PA 4BNIA 2YJ6A 1VMAA 4UVEA 4EUNA 3U7IA 1NW7A 4P93A 1E7RA 3W8DA 3DDNA 3BB3A 4G1CA 1R4NA 3GIDA 1NMYA 1JR4A 2NQ8A 3PXCX 3T8YA 4EY7A 4HSEA 1I10A 3FVTA 1WTAA 2C9MA 2F3SA 3ODPA 1KPHA 4N6NA 5CVEA 4P3NA 5AK3A 2KHZA 5IDYA 4QBHA 4ZAXA 1XHFA 1P4JA 1Z22A 2LDXA 3MUOA 4TTSA 3RIHA 1ZI8A 3W2FA 1YASA 4P5EA 3U09A 1I1NA 2P9ZA 2O7SA 3IV7A 3CZAA 3ER6A 3JX9A 2RONA 3MWEA 3OEHA 4KI0A 4WOCA 4CE6A 2DKNA 5M29A 2ZETA 4NBRA 1NQUA 3AIMA 3ILHA 3PIIA 2C1ZA 4DZZA 4NABA 4S1NA 3BB4A 2W6JA 3ORFA 1PV1A 2DQYA 2CLKB 1EE1A 2CL5A 2QXUA 3AHJA 3FRJA 3NZEA 3U4MA 1GAJA 2PM8A 1KZYC 4Z0TA 3U9SA 1FIUA 2XUAA 2ZOSA 2JEYA 3ONNA 2FEXA 1JTEA 3QU5A 5ESXA 4ARUA 3B9PA 1X9IA 2D2VA 2CZGA 2JB9A 4G1MB 1IQ0A 4L8LA 3ZC3A 5CDSA 4W9MC 3IUNA 2VWPA 4FS3A 1ESMA 1P19A 4IGFA 2F3RA 2O1SA 4ZCSA 3WQHA 2FPPB 3R3YA 3SHFA 3OQMA 1G8GA 1XDSA 1ZGJA 2XUZA 4FX2A 4L5IA 4BMNA 4XFJA 3Q7TA 3JQPA 4OI2A 4P35A 3D7SA 1VBNA 2GN8A 4I4TA 1E0JA 2Y92A 2ODNA 1J8YF 1YHZA 1W48A 4IAOA 2ERYA 4U1RA 4XDGA 4JOSA 4KH1A 1LX7A 4FR2A 5IKPA 5JT1A 5ALFA 3N2NA 2W0SA 3K1AA 4FYIA 4RADA 3VHXB 4EGAA 3GPIA 5HUQA 1KSJA 2BM0A 1M6YA 2H1CA 1JA1A 2BBOA 2NO4A 3Q72A 5CDFA 1T2CA 4ADSG 3GOQA 4RPCA 2R4UA 1JPJA 1DX6A 2ORYA 3PPVA 1OILA 4UPVA 3EWAA 4K2AA 4JBGA 2OD2A 3QXHA 1PL6A 3EG9B 4QEDA 4DANA 1VCMA 2WWRA 1EFAA 4HR7A 3TGWA 3MJCA 4WV3A 3JQ9A 5A3JA 1PV4A 2WNHA 2B4KA 1JHRA 3A37A 1LFDB 2FZKA 5BVHA 1FF9A 1PJBA 2GM3A 2OOKA 1P2DA 3S44A 2C2GA 1U8TA 1G2PA 5BR1A 5AW5A 3FKSD 4JBNA 4MI6A 2D1TA 2P0YA 3AONB 3HJGA 1U0TA 1SBNE 2P6NA 2Y1DA 2ZROA 3IOBA 1Z0AA 3MPUA 2ZIVB 3UUFA 2GD0A 3D2AA 2X7JA 1OYVA 1YQGA 1YJXA 1MABB 1BRMA 2FH5B 2LE0A 1DAPA 3JASA 5HKKD 2FXIA 5LD2C 3D1JA 1OC4A 4B9EA 3L7YA 4BAUA 3RYHA 4C0HA 2PL1A 1XRNA 4NOMA 5CJPA 1XP5A 2D1QA 2J85A 1S1MA 5C1IA 1EFHA 2A59A 4AO6A 4NDAA 3TAXA 4ENVA 4UHBA 4ZVPA 1WXWA 2Y77A 5JR3A 4Q4HA 1K97A 1ZBDA 2ZEJA 4X1KA 3TRDA 1BA3A 4L51A 5BMVF 2ZM6B 4CM4A 5AVXA 4AN0A 4RD6A 1QGZA 4DLUA 4NJEA 5ICEA 3KQKA 3F6PA 2PWAA 5KKCA 4Y9SA 1ZIDA 1XZ8A 3MT7A 5JJBA 2A14A 4L8YA 4L75A 1WUHS 2XGOA 4YDSA 4A0SA 1I2ZA 4BLTA 2R5WA 4C7OA 3HMKA 1P5FA 1NZFA 4KO1S 1I9CA 4O4JB 1OFIA 3R4CA 3G9TA 4RHXA 3NWEA 1NJ8A 4AUNA 2CVZA 3H99A 3ACDA 3MXOA 4OIMA 3WNCA 3KYIB 1NXWA 1S6YA 1WAMA 2EVWX 3E70C 3G68A 3SEFA 3WL7A 1JH8A 3JPYA 4O3MA 1QB7A 4LDZA 3SQLA 3HNPA 1NSYA 2FCAA 2IH2A 3ELYA 4UEKA 5ALOA 1W35A 2NO1A 4WEOA 3UCFA 5IK2D 4IY1A 1P7PA 3MWFA 1P7ZA 5BR8B 3BN3A 4YHHB 2P6UA 2C5FA 1VG0B 3G8DA 3LC0A 1TK2A 1C8VB 2ID7A 3KOYA 4O29A 4B0OA 1N2IA 2HJSA 1Q15A 1Z8NA 1ZIYA 2NU8B 4C4SA 3I5AA 2WYWA 3I8XA 3OJFA 4MW0A 3ZLUA 3OETA 3LP8A 4JJZA 4M88A 2VK1A 5TPWB 1ULHA 2H4YA 2IY9A 4ZCRA 5HKBA 1RQPA 4B46A 5B12A 5CXUA 4FSXA 5LU8A 5TQJA 2GX6A 1Z7GA 3THWA 3UANA 1GP2A 2A57A 3O8NA 4FFOA 4L50A 3VDNB 2R0QC 3SDBA 3CGGA 2Y27A 1CZRA 2V7GA 1Q6YA 1USGA 3EY9A 3NB0A 2GDJA 3WLEA 2K7FA 2COKA 2RGNA 1I4WA 1R2QA 4KN8A 4D0SA 1F0KA 1GTJ1 5IAAA 1NBIA 2PWZA 3MT8A 5T4EA 3LNTA 1UJ6A 5DBIA 3I4FA 4D5EA 3AKDA 2NO5A 2CHFA 1W5TA 3I39X 1C9KA 3IVXA 3GRRA 4IIFA 5H0IA 2ZULA 1DQNA 1G21A 1W88A 2FGKA 3BE4A 2R8EA 5ALRA 4AULA 3IQDB 3NBUA 2YWEA 3IBTA 4M22A 1UBHS 2ZTHA 1G66A 3B8EA 3ITNA 3JWEA 3MGAA 5BWNA 2HD4A 1L5HB 5AHWA 4B48A 2OAQ1 1D8AA 2QSJA 3MJEA 5ED4A 5ITZA 2BBWA 1IPHA 1T9KA 4J0GA 1NLZA 3MJSA 3OX4A 4M0EA 4MGKR 3TD6A 5ARBA 2MR5A 2BGTA 3O4RA 1M66A 5SY9A 3U37A 2QI9F 3TZKA 5AO9A 1YB6A 4IIJA 1P9WA 3HGMA 4C29A 1GLGA 1Z25A 2GPBA 4ARBA 2OXRA 3EQ8A 1DJMA 4QPZA 1OFUA 2R1ZA 2R8BA 4FDMA 4TQUS 3TQHA 4A8JB 5A4AA 1V3QE 2PLWA 3QV2A 5GAJA 1Y8RB 5E6RB 3RAEC 2GESA 1V11A 1NURA 1SCUA 4Z1OA 1K9VF 2ORWA 2ZBGA 1YCFA 3EZLA 5TR9A 2B7CA 3UK0A 1JDNA 1F2TA 1KERA 3HBFA 1P2FA 2MSCB 1PJ3A 3QHAA 4MWCA 2JHFA 4BJ1A 1U0OC 5DRTA 1BOFA 4TV9F 2VDMB 1DG3A 2HADA 1W52X 2PS3A 2QZZA 3IBSA 4JU9A 3OY7A 4BLOA 1KFBB 2GN6A 2QRKA 1B14A 1QGUB 3FF4A 3IB3A 4UAVA 5LQUA 3JWIA 1P91A 1P1KA 3HYLA 4IUDS 4KKXB 1OWPA 2AJ8A 3LIPA 4G4GA 2MSLA 5DCWA 5EVJA 4ZANA 4RULA 1HDYA 3MTAA 4F72A 1VGVA 5JAPA 4IKPA 1CUYA 2XT6A 3MWKA 1TU3A 1AQJA 4R1QA 3PFHA 3SNHA 4AM8A 2CLHB 1IM8A 1OX4B 1D2HA 3EH1A 4QTUB 1VL0A 3N2IA 5E8RA 2XYGA 1FRFS 1NF2A 1RMTA 2BEWB 3W5VA 3ZTWA 1WBBA 3T1OA 3WC4A 4A36A 3PHIA 3RBZA 1Y1PA 4Q00A 3QPDA 1TI7A 4HHEA 4NULA 4HT3B 1A4UA 2AEJA 2RB4A 3GHHA 3MQFA 5KX5A 5AVJA 5J63A 3TW4A 5D00A 1E0DA 1N6NA 5T3YA 4Q3BA 4GECA 3ZU3A 2YHIA 2YJNA 2CVQA 4ERXA 4PAQA 4BN4A 2WAYA 5TC4A 5EPOA 1DEXA 1XLVA 1U6KA 3HFGA 4MAMA 1QGAA 2TS1A 4RQUA 1WVMA 1IDOA 1GADO 1ZSVA 2O05A 3FWNA 4HBZA 2GN4A 2GQ0A 2PUHA 4LXTA 2O2SA 4M8SA 2JHAA 5EZYB 2XF8A 2OB2A 5CDTA 2DR2A 4X61A 4U2GA 1CQJA 1J07A 5DHRA 3LUBA 2TECE 2RK4A 5ALIA 5CH3A 3ZVRA 4HAWA 1BGWA 4BRSA 1RYZA 4RETA 3SC6A 3WIOA 3CNLA 3H2ZA 4LQLA 4PRZA 1I5EA 2XUJA 1BE1A 1UJ2A 3N28A 1B15A 1EEHA 2GEDA 3PQFA 4DXAA 2OCXA 1XZJA 2VPWA 4R8KA 4QQ8A 3TO5A 1CEQA 3VMFA 4A9AA 3QE0A 3BE6A 3SLKA 5F52A 2IHUA 3FDZB 3GFGA 1QIEA 2ZRMA 3L0CA 3FHJA 4OJNA 4B75A 1JPVA 3GXBA 4TTJA 5EQFA 5EWLA 5FUWA 3LO5A 2HBZA 3QHQA 7REQA 2Z5FA 1TKBA 1SQFA 4TLLB 4Z8YA 1ZMRA 3QE2A 1JFLA 2WHQA 1SOUA 2HA3A 2PX5A 2YTZA 3S2SA 5CIYA 5FFMA 2D0OB 3O73A 3TJMA 1Z39A 2OMKA 3HCOA 4UAJA 1FLDA 1G16A 2DJIA 3PUXA 3KOZA 1V96A 1DEOA 1DKPA 4ZCQA 3LUKA 3I05A 3QVWA 4BVBA 5BP7A 4X3PA 2O19A 4BV9A 4P5DA 3F8TA 4GHWA 1JYEA 3CF6R 1EMDA 3T0IA 1M83A 2COEA 2WUVA 1OXSC 2E21A 3HR4A 3PBKA 3LQ1A 4KN9S 3GLGB 1XQVA 1QTRA 1B7GO 2X8BA 3K0AA 4Y98A 3SHVA 4FLFA 3TQCA 4AAYA 5K0FA 1VE5A 3ITEA 1YC5A 2EHDA 2GZRA 3IGFA 4M21A 1VJRA 2WJZB 4PCLA 1T2DA 2BTEA 1VCOA 4YAJA 2LRHA 2HA4A 2X5XA 3PNVA 4LMBA 5SICE 4JI1B 4ALIA 3NTRA 4X65B 1Y7IA 4F8JA 1LPSA 2VTEA 2VHJA 2EX1A 3A05A 1CR2A 3FNRA 2I2WA 1XKQA 3GZNB 2OZEA 2C98A 4ZGWA 2GCGA 2WICA 4M54A 3EA0A 2O59A 3IH5A 1NV8A 4TV8A 3PT9A 4BV3A 1XVLA 3Q10A 4TKLA 4CIBA 3PU6A 2ZUEA 3BT7A 2ZP1A 4LXYA 2BHRA 3I8OA 3MSXA 3C4VA 3NGXA 4PWYA 2X8JB 3QP9A 2PZBA 1JHQA 3H83A 5AM0A 1K4MA 3NBAA 1D0VA 1DZ3A 2DUUA 4LQDA 1QLWA 4I2VA 1RLMA 2PVPA 4OQFA 1LPMA 2PBLA 4IJMA 2HMWA 2Q5FA 4RPIA 4TQAA 5CFLA 5AK5A 2QB5A 4EUSA 1NI4A 1Z0DA 1D5WA 5JBNA 5K05A 1EFRD 4HXFB 3RVNA 5JEEA 3SIRA 2ZUFA 3FHOA 2NUBA 1LA2A 1UCFA 1Z9BA 2OHJA 3I01M 1THTA 4DQVA 1R6XA 5TQVA 5LBIA 4MR8B 2HSWA 3DBOB 1S8NA 4AYWA 3GLSA 3ROPA 1PJ8A 3NALA 3FBGA 4RD0A 2VK2A 3R5XA 2DRIA 5M3BA 1PFWA 4YJGB 5TPZD 4RY0A 1KNXA 3KT0A 2XGSA 3NATA 3ZDXB 3A27A 1ESZA 1JQJC 1OLXB 1QHGA 2JAHA 3EXIA 4CM9A 5A03A 3JW8A 3FUUA 2IU6A 3R9IA 4DC9A 1L1RA 4TYPA 4DRXB 1OSNA 1EX7A 2ERCA 4L3OA 2FJ0A 2J9XB 2VAXA 2E37A 4JVSB 1UC4B 4RJTA 3LW8A 4UOEA 5LLDA 3K8ZA 5C8VA 3PHLA 4PPGA 1C3XA 4N3NA 3O8CA 1G8JA 4HOYA 2YV3A 1RAAA 2JFUA 2EJUA 3L04A 3CC8A 5KYVA 5BSRA 4D4KA 3B6ZA 5KYTA 2I33A 3ZV4A 2XA2A 1POXA 3R1IA 2B94A 4DIEA 2FMHA 3QE4A 1Z08A 3PA8A 2XGMA 1CS0A 4OBWA 4QYIA 3ZW7A 4JBYA 1T9DA 1K7YA 2VJAA 1YONA 4Q39A 3G5LA 4O4LB 3G6WA 3SZUA 2PKCA 4IFIA 4NONA 3WP0A 4ZI7F 2DFNA 1H05A 1M3SA 2EBWA 3SWWA 3HUDA 2ZJ3A 1GYRA 4G0OA 4AJPA 1R4ZA 3QEKA 4N8SA 4UTNA 2KB0A 5MFZA 1ZCZA 2AG1A 4PONA 1NASA 2MYPA 4MIEA 3ZDZB 5JZ9A 4MCHA 2WT8A 3ZWNA 3QVTA 4G1BA 2YNMD 2IKQA 2AX4A 5HZHA 2VDQB 1R6BX 3CZ4A 1DC6A 4D82A 3JZMA 3TECE 1P8JA 4Y67A 5K6AA 2KSQA 3HJRA 1D2RA 4C4AA 3UUEA 4AROA 5HG0A 5DBGA 4Q7QA 5KTMA 1NQAO 4UDOA 1J56A 2IE8A 3IHLA 3DDUA 1OX6A 3OBBA 5TF4A 2C4UA 4KR9A 1ZHFA 1MH1A 1N75A 2Y1CA 3EGIA 3UMJA 4DLRA 3IO5A 2EFYA 2EC5A 3TZQA 3L2OB 1UBOS 5A0FA 4QODA 3VPFA 4GC5A 1ZD1A 3JD2A 2P5TB 1CK4A 2JJ1A 4RMIA 4TKUA 1YR1A 3QLEA 3NEYA 1Z7BA 4PFKA 3T1QA 4UUOA 1QO7A 3GJ8A 2OWDA 1L1QA 2ZRDA 5A05A 2VTBA 1MTZA 4BWYA 2JGNA 3A6ZA 4EJSB 3ESRA 5MN6A 3L6RA 4GE3A 4HDMA 4LF4B 5KNCH 2IOFK 3L4BA 3QTTA 1J8QA 1SK8A 2NZUG 3ZY3A 1U0SY 1OYWA 3BFKA 4ZAWA 3UQYS 1U6JA 3AC0A 4YRKA 3EAFA 3DDZX 4W5OA 3N7TA 2OFXA 3IP6A 1Z5ZA 1BHQ1 1QDUA 2R6R1 3EIOA 5KPDA 1LJUA 2X9LA 4IDOA 1DGQA 1DQZA 5DLPA 1EXNA 1YDEA 1RJ9B 1JEOA 1LPOA 4F6LA 5JE8A 2P9JA 1AN9A 2F8LA 2FZ4A 4RXMA 3THSA 4ZKEA 3VI3B 1L7XA 5GM2A 2EFJA 1GQQA 4J7AA 1N4AA 1C7FA 1Y34E 3CH4B 1C4OA 3ROEA 2ZLBA 3ZWMA 1GTSA 1KE2A 1NUHA 2PRIA 1ZYUA 2VIIA 4PU0A 2YICA 2WV9A 4DCTA 3WMEA 3U4QB 2WSIA 1A5BB 1UQTA 2WI8A 3LQQA 3GNQA 3PFNA 3V7FA 3JU3A 1JIQA 3ZHUA 3R8FA 1VRVA 4AJIA 1IZ0A 1ZD4A 2VSFA 3ZIUA 3PXUA 5AD1A 3WLMA 2HQRA 4K6KA 2ODPA 3DT6A 5KWVA 3U16A 2H2WA 3TSCA 4ZK6A 2B3TA 1I33A 3FWKA 1HT2E 1RQXA 4X7PA 1MB9A 3GLKA 4N54A 1U3FA 4C01A 4MWZA 1OZAA 2C5BA 2VYNA 1EGMB 4LZWA 3C43A 3JAMA 4EO7A 3NVAA 4J7CA 5I9BA 3HEBA 1GQOA 4KZPA 1ACMA 1FDIA 2H5JA 2YV5A 4J1NA 3WAGA 4JV5B 2VAWA 3EEYA 1FMFA 3JQCA 4R1UA 3DUWA 4QAQA 3QLVA 1IYZA 2Z08A 4BEVA 4HDKB 4EO9A 1MZPA 2YWXA 4HAVA 5DK6A 4ETIA 1WMBA 1ODCA 1W96A 1ZK2A 4KYTA 4WBXC 3HE3A 1XLTA 3OD5A 4HL6A 2QU7A 4JEIA 1Z88A 4U7WA 4V02A 1ZCJA 1IWOA 2GFIA 3DP9A 4KQCA 5EHZA 4HTFA 1Q7GA 1C1XA 3LS2A 2VPXA 4A1FA 4YCMA 1RHJA 2TMKA 2QQ5A 3NOQA 4JFRA 2B36A 1ETUA 5D5HA 4QLOA 3AW9A 3UUGA 4CFZA 4L4YA 4YUWA 2O48X 5CD9A 5MF6A 5JNTA 5LL6P 4UOZA 1WTCA 1SURA 4CLHA 2QA5A 4IJQA 4YRTA 5LOVB 4O3FA 4GM0A 5BUCA 1VCNA 2PCLA 3WGNA 1X9GA 1AK1A 1N2CE 1RVDA 3NT5A 2R5FA 4PWZA 4OSEA 4MP8A 5FD8A 3DD1A 4QC2A 4AZWA 1I7SB 3C4JA 2Q3JA 3KFLA 3KZ1E 2WTEA 2QY6A 3NAMA 3MBOA 4Q7MB 3WLFA 4DLKA 4YRIA 2YXBA 4HZGA 3D7NA 2VUHB 1WF3A 3B1ZA 5KVQA 2Q2VA 2JA2A 2VRNA 3G89A 3I6IA 4OU4A 4EAQA 2EBHX 2ET6A 3RS3A 3RSLA 3ZXSA 1RLJA 3VJRA 4BC1A 5IVPA 3AR5A 2ZRQA 4X94A 3KJQA 2OOSA 4CDGA 3D64A 4LI3X 1QG6A 1C0PA 2YW2A 3LIIA 4YXWA 1QMPA 3DEZA 1BFDA 4JLVA 1VJTA 4PQFA 3SDSA 1M2VA 1N2HA 2CVHA 1L7DA 3I6BA 2RC5A 2C9ZA 3KEMA 1M2EA 1XXLA 1XFDA 3H2SA 1HV8A 3B7PA 4Q0MA 1V8DA 3LLMA 3GMTA 1KTVA 2Y1EA 4IDNA 4QYMA 1P7WA 4XUEA 4L5AA 4D6YA 5HUJA 1YUBA 5ICGA 4MLPA 1U28C 4H0NA 3LBIA 2PR2A 3OC0A 5IJ9A 2H31A 2QRLA 3BWDD 4REOA 5J40A 3NDBB 4WSOA 3VSAA 1TUGA 3LECA 3OECA 3EQ6A 5CT6A 3WNVA 3AKYA 3TRJA 4BQSA 3TSAA 3BC1A 3DV0B 3SLRA 1BMQA 5CXSA 4G9GA 4QG3A 4L4RA 3EAGA 4A0RA 3LRTA 2WZBA 3T5BA 3P20A 1NUAA 2BTQA 5LYJB 2BEKA 3HO8A 4XDYA 2H00A 3GVHA 4HFNA 1GU0A 2DTXA 1LTQA 1KZ9A 1YZYA 5A4MS 5LMCA 1U63A 4F3NA 5I8PA 1ORIA 2FRXA 4MRNA 2HEIA 4ND1A 3S2ZA 1XEXA 3TLXA 1TJ4A 2V1UA 5E0OA 2V0CA 2C2ZA 2WIAA 2H1SA 1BTOA 1Z0SA 2ZYVX 3G82C 1Y9DA 4OU5A 4FJ0A 3VHQA 5GVSA 2EKQA 2ISCA 3NJRA 4N9QA 4QREA 3WFIA 2FPGA 3DAGA 5IAJA 1YIDA 1H4QA 3RTDA 5JPDA 3B5JA 4MPJA 4YP7A 1DC3A 1VL5A 3BDIA 3OCUA 4RIEA 4DSNA 2BI7A 2R8XA 3WYFA 5JAMA 1YR7A 1PS9A 4C7VA 2FUG6 3HSKA 5K6TA 2XCSB 4RF3A 5H82A 4XUDA 1WZ2A 2HEGA 1LY1A 4ZGBA 1V1JA 4B76A 3ER9A 1T5TA 4CN9A 5IT4A 2HHLA 4PZLA 3K6JA 1WCWA 3KFVA 3FLAA 1YZGA 1DO2A 2V6BA 3EIHA 1KK1A 2EATA 2P9QA 2Q3LA 4ZDJA 2A3NA 2AMFA 4WXMA 1YUNA 4JA2A 5E3JA 3PC3A 4UHHA 1Z6ZA 4U39A 4F7DA 1P6XA 1NYRA 3E6AA 3F7NA 1KHTA 1WV0A 3GMDA 3QMMA 2D5BA 3PFBA 4HZIA 4YYZA 1W1WA 2GM9A 3BQ9A 4G67A 4WCFC 2PRKA 4Q7EA 1EGHA 3HMQA 4G5GA 4D9KA 2XE7A 4YRSA 3E03A 3AI7A 3X1MA 2A2ZA 1CUCA 2QT9A 1KYYA 4UCFA 4YJ2F 3Q2KA 3BKWA 3ZG6A 1L5YA 2O0LA 5B1DA 1KQPA 1M72A 1Z47A 4DM4A 2ZAMA 3ANMA 3B8HA 5C4GB 4CQMB 3NHSA 5HQ3A 2P9YA 4LJ9A 2PV7A 2AF3C 4LRYA 1QGYA 3DDCA 4ZV4A 4BFUA 1XDBA 1WUYA 2GTPA 4UBIA 5L7WA 3HVJA 4B0PA 4FINA 4U0JA 2P41A 2VDWA 3EVBA 4YC7A 5IJXA 4A27A 4ZYYA 1N9KA 4O2LA 4NU0A 4ZOLB 2DFVA 1JIKA 4KNWA 3ISJA 2XAUA 2GVDC 1RSZA 2XZPA 3AP2A 3DE0X 3K8YA 1Q7TA 2YHUA 3WNQA 2BGUA 1X7HA 1PO7A 4UXHA 4DV0B 3DBHB 4GOLD 1M33A 3BXGA 3HI6A 4KPGA 4R8RA 5HX7A 2N1MA 4HAOA 1LDMA 2II6A 2RG1A 3B2QA 3KUCA 1QVAA 3PRJA 4G5XA 4RTNA 4YQYA 1GPJA 1TTTA 2RGXA 2DG2A 3LZDA 2GRJA 2YYYA 4HN4B 4JLWA 4L6CA 5C5CA 4AQYB 5FAXA 1EUCA 1C50A 1I3NA 5HIJA 2O3UA 3RO7A 1MZVA 5CJ2A 1VJ5A 3CLRD 2D1RA 1CKEA 2WJ3A 1IBRA 5M04A 3SEAA 4QOFA 5GPBA 621PA 3WZLA 4RORA 3WHIA 4QWWA 5KNCD 4XUCA 3GT0A 1KR2A 1SUCA 1Z18A 4CF5A 4EY4A 3KB8A 1Q50A 3F8SA 2XCIA 3I45A 3K0EA 1UWLA 2B4TO 4R1LA 2PT7A 5DNEA 3CW9A 3JQRA 4JODA 4FW9A 4G0YA 2DOKA 2PD3A 5NLLA 5B7PA 1BCSB 4QFCA 1H6AA 1XRJA 4QATA 3SXUB 1PJTA 3CNQS 1N6KA 3U40A 2O52A 3ZS9A 1P33A 1FFWA 3PI6A 3KPUA 3QPBA 1W46A 2EGHA 4IHJA 2XZOA 1MHPA 4JLSA 1L5QA 4PSKA 2G5GX 2PTGA 4WKPA 3W9SA 1NUPA 1RWKA 5IN5A 1QM5A 1QFZA 3Q12A 1E2IA 2OENG 1AK2A 1J8DA 2GS9A 3OH8A 2EP7A 3VR6D 4HPXB 4GNRA 4RAOA 3CO0S 3LY5A 1O8CA 3INYA 4X84A 4YO7A 5F76A 3KNZA 1HQYE 2I6XA 4YCCA 3NXKA 3CEHA 1R4NB 5AKHA 4WZAA 2OZLA 3KU1A 2IUUA 2WG2A 5ENZA 4BQOA 5KTKA 1SC3A 4HDRA 3GAZA 2OBYA 5KSOA 5EJ7A 2C97A 3L8HA 4NMXB 3IAM1 1QYCA 1S3GA 3DEJA 1EA7A 3L1VA 2VP2A 3PFIA 2D74A 4EJ2A 1YU6A 2LCIA 1PQUA 1Q0SA 2GN0A 4O2RA 4PW0A 4URZR 4FKBA 2QG9A 4IXTA 3TTXA 4C2UA 1RWQA 5IH3A 4HGPA 3PWKA 3MWEB 2EDCA 1ZJWA 3F71A 2HXYA 5TNXA 3ZWPA 2QSUA 2X1HA 5J4LA 5E1DA 1I1QB 3P27A 3G2IA 2VWHA 1U0BB 2H29A 4FNMA 2NO6A 4RPGA 2D06A 1GPNA 1UBJS 2GCEA 3H5OA 3NYIA 4BX9A 5M5BA 5CLIA 2V7WA 3LQRA 4OVKA 5EOVA 1IN1A 1BS9A 1EQ2A 1UXJA 2F43A 2J4DA 2XA9A 1E1MA 3CUTA 4X8OA 1R6AA 4HGRA 3ZQ6A 9LDTA 1JX6A 2RCYA 1AB5A 1KGSA 1KP3A 1QOZA 2PMKA 3AI3A 4C7KA 4DCGA 2BMDA 1KH3A 4A16A 2QSYA 5ALNA 1X8LA 5SV2A 5A5FA 4B80A 4R8SA 2OCBA 4BVEA 3S2GA 1RXWA 3E81A 2AXNA 1MO6A 2FSFA 2VLBA 3TZLA 2HYDA 2RKBA 1O6GA 1RZRA 4DV6B 4D02A 2A1TR 5DW3A 1GN8A 3DOEA 1FVOA 2ECKA 4S1TA 3K1AB 3K7EA 1JWLA 5AHOA 1U98A 4LCJA 2J67A 3LHKA 4HNSA 2R8YA 5K0BA 3I4CA 1ZHHA 3RBAA 5FOTA 4HSGA 2B8NA 3DFZA 3E23A 4MQMA 4NYIR 3R9WA 1IQRA 1O9HA 1XXHA 3C4QA 1R3UA 2LCQA 3SZ3A 3TUIC 4CRWB 2NXCA 4M8LA 3AHIA 4IJKA 1Z73A 1DXYA 1S2MA 1T36A 2Z4SA 4G5HA 5DWDA 4RTOA 3VC1A 1NL3A 1JLLA 3VAYA 3PDWA 3C5WP 1KOGA 1JJVA 5KYYA 3QXSA 3T7IA 2HPVA 1NVXQ 1HYBA 2N46A 1N2JA 1J9EA 2WKPA 2GBFA 1AKUA 1HDOA 4OBXA 4DPMA 3BEDA 3CWCA 2X0JA 1E7QA 3KOWA 3D6UA 5FCDA 4ER6A 1AO0A 3DKIA 5LZ2A 1PD1A 4LPSA 3KQQA 1B43A 4R2MA 4TRJA 3D2BA 1QP8A 2JFXA 1VJDA 4BGEA 4DG8A 1CP2A 3IDZA 3JASB 2CJFA 2QYSA 1AKRA 4W5WA 5GJCA 3RYHB 2LKCA 3WGJA 3GUUA 2NZWA 5IJWA 5MN4A 1TO1E 4LRUA 3ZHTA 1E60A 1NG1A 2PT6A 4HMPA 1PUXA 2GEJA 3CG0A 1KI3A 1Q1GA 4OYLA 3IIMA 4UNIA 1TYBE 3IERA 2XT0A 3LBNA 4DNFA 3I72A 4TYQA 1XZNA 1WW3A 1YJQA 1W85A 1BFUA 2V6MA 2WP0A 5EGNA 2XR1A 3C2QA 5I4BA 8ATCA 1W30A 1J8FA 1ZITA 2LDBA 4HTAA 3ZWDA 4TLBA 2UZ0A 4XWOA 3C7AA 1VKRA 2A4KA 1JHZA 4C7OB 1UIMA 4XWTA 4MA5A 1N0VC 1YIOA 4AMBA 1QHEA 2I3DA 5IHXA 3KLPX 4OHOA 5FOUA 2DETA 4IGEA 3AKCA 1N5KA 3AXSA 4LYGA 5FA6A 3UHAA 3KCQA 3RVQA 1Z2NX 2XXJA 4BX8A 2BEUA 4PSDA 1OW3B 1GZ7A 3IQXA 4U7FA 1F60A 3KVVA 1MGPA 2HU8A 2K4MA 1NVFA 4L76A 3ZYCA 2HWWA 3S70A 3AFNA 4F5DA 3TYXA 5C2JB 3Q9UA 3OHSX 3V48A 3TN7A 5DNCA 1RWBA 1TQ4A 3ZW9A 4JCCA 2JAUA 4PEVA 2DUNA 4Y6OA 1NXPA 1NWHA 2HMSA 4LC9A 1V5IA 2R9VA 4NK5A 3KE9A 3ZGNA 4EWLA 5EY5B 1HE3A 3S8EA 5DYIA 3BZBA 5CP8A 3BB1A 3MOIA 5BWCA 1XKLA 2YS7A 1KDZA 1YJ8A 2KLHA 1JKFA 2BGKA 4AWXA 2Z5VA 1G98A 3CXUA 4IL5A 4FT2A 1GM5A 2B4QA 3KAPA 3K6SA 4XAQA 3EF3A 4QO7A 3A3NA 2QQFA 1T9GS 2PT5A 3FLEA 5AW6A 1ZOPA 3DBLA 3MMZA 1FYDA 3UWOA 1KI7A 4BNYA 1ZL0A 1QXSA 4KITB 2ISQA 3L84A 2DB3A 2EFEB 4KI7A 4RTRA 5CT8A 2Y93A 2KM1A 1Q1EA 3RVMA 4NCHA 3HWRA 1YMQA 4WZ6A 1D03A 4IPTA 1EDBA 1J42A 2QV0A 4N0MA 2ABWA 4LEIA 2QAGA 2WFAA 1G21B 1W88B 4KLAA 3WIVA 221PA 3QKSA 4A23A 3EMKA 2OQIA 3FB1A 3RRFA 4I55A 2P8JA 4I4LA 1J99A 3DJFA 3E4CA 2O8FA 3GP3A 1R15A 2X9QA 3C3MA 5A4DA 5KSYA 5LMNB 3IA7A 2Q7OE 5ELLA 5YASA 1GPBA 2A84A 5JS7A 3NUZA 2QZSA 4FFBA 4GXNA 4QXOA 1R6TA 3A3PA 3O2SB 5ITZB 4OK5A 3PLRA 1LBHA 3QVJA 3V42A 3UWKA 2F59A 2FJPA 1G3QA 3IUQA 3QVXA 5AUPB 4NMLA 9MHTA 1ESDA 4BB0A 1RWVA 1YQTA 3REOA 5J2UF 1BWSA 2VF8A 3M3HA 3NYRA 4IIJB 4KAFA 5LQJA 2XECA 4FMDF 3IAUA 1P9LA 1S3SA 3DQPA 4F2PA 1O95A 2VJKA 4I6EA 1F1BA 3A9VA 1E66A 3GT7A 2QROA 5K7SA 3VNQA 2ZI4A 1QZTA 1PBNA 1SCUB 3A58B 4KXYA 2PQ6A 1VHLA 3BORA 1NVDA 3K9HA 3P4UA 2GETA 2QRNA 1WPGA 4ZO9A 1IEXA 3JD3A 5EJ4A 1F2TB 5IM4A 5H8WA 4ERNA 2MHCA 4YY3B 3WYGA 2NXJA 1H2RS 4NX2A 3VPBA 1VECA 3JVVA 4PZEA 1HNZB 1ODLA 1ADFA 4Y0NA 3RHFA 2AKAB 1QBGA 5GONF 4J2HA 3BRWD 3K1TA 4PICA 1JIIA 2GJAA 5FTMA 3TL6A 3AL3A 5C53B 1J2UA 2LXNA 4I50A 4RABA 1TFUA 1H9BA 2IZ7A 3H9CA 3ISVA 3M6VA 4QOHA 3IL2A 1C9NA 3HH8A 2FETA 1SXHA 1DTWB 1T5OA 2QM0A 3LKVA 3KSMA 4PLVA 4Z5XA 3H2GA 4OXQA 3I76A 4DT1A 3CVWA 4IJ5A 1OYYA 2QTMA 2GVZC 2DQKA 2PKYX 3OQPA 3E15A 4AT1A 4CT0A 5BUQA 4DV3B 1B00A 3AVVA 1UF9A 5B7GA 1P1JA 1UAYA 1ZJJA 1MX9A 2B20A 2VJCA 3NDPA 4BWFB 2A9OA 4PG4A 3SYLA 1OX5A 3A7DA 3E2PA 4E70A 1RW4A 3A6KA 1HZJA 3CRMA 2XNDA 4L28A 4C9BA 5HJ7A 3FWYA 1LQUA 1PWZA 1V43A 4RMJA 2CCKA 4FJ1A 5KX5B 3LKDA 2UUCB 1JZSA 1H6BA 1LSSA 4OHCA 3NJ8A 4PNEA 4RTQA 2FQ1A 3Q2IA 3SLGA 2YHIB 2HA2A 4A5OA 1MAHA 3IAEA 3AIIA 4NYJQ 1A50B 4RD3A 4UZFA 4REMA 2GGSA 1SU4A 3DOOA 4GP6A 2AQHA 3ZGOA 4F12A 3E8SA 4LC1A 1ZC3A 1BMDA 3NTVA 1BIFA 1W5EA 1WB4A 2GRUA 2ZSAA 3HXOA 2HWYA 3I9OA 3JD1A 3N87A 4NV0A 5EWMA 3OCXA 4DWOA 1OH7A 2MSWA 4Y0AA 2NZ2A 3X2FA 1EDDA 1CQJB 1M1UA 2QHXA 3RRZA 4PVDA 4AZ3B 5KVAA 2JCBA 1GPWB 1XCLA 3BCRA 3AWDA 1AUOA 5D5QA 4CV2A 4XCXA 2OCKA 2J3JA 3IVMA 3PPXA 4OJKA 5ALPA 3UV3A 1XMVA 5IBRA 5FWDA 1N25A 3LY9A 2EFHB 3UAXA 2H4WA 4NV3A 1U0HC 4K6FA 4UNQA 1N33B 1Y9ZA 5JAQA 3NW9A 4D3XA 3GLIE 4KB5A 3K6RA 2HO5A 4FFNA 2TYSB 3HKBA 5IUKC 4Q1CA 1WSWA 3HCFA 5GQSA 3DTVD 1G42A 2J45A 4F60A 4L0QA 4DSTA 4ZVUA 4JI4B 3UB3A 2Z9DA 3O8OA 1IXKA 1QQAA 2ZJOA 3C3EA 2VDLB 1S2NA 4MRMA 1K5HA 3AB7A 2VAVA 7REQB 5JQGA 4G24A 4GRAA 3H9QA 1P4GA 1NMSA 5KWJA 2GT1A 4RGVA 2PUFA 5B1EA 5LPNA 3VH3A 4E7PA 1NVVQ 4FFLA 4YS6A 3T34A 2HOQA 1BQ4A 2WAAA 4GBMA 4J90A 2HRZA 5U4QA 3ZD8A 4MMZB 3EVAA 4QDZA 3NP9A 2HCRA 1CULC 1FFXB 3EPRA 3RJTA 3UFBA 4RY8A 3Q41A 4MVJF 3UW1A 5JG7A 2AC2A 4ZIRA 2KX7A 2ZBPA 4MVJP 3LV8A 2W98A 1XJ0A 5CA0B 3K0AB 2PLFA 4G0QA 3ZE6A 2QRVA 3DVLA 1RHMA 3FPHA 5DZSA 1SVMA 1Y8AA 1ZPDA 3JYLA 3TH5A 3BJMA 4DDWA 1X38A 2HTFA 1BWRA 4OYHA 3C3JA 5EKTA 2IIBA 4S12A 2HWKA 1FS5A 2O1WA 4UQOA 1D4FA 1G2OA 3QY9A 1IAVA 4HLDA 4TV8B 2I7DA 2SKDA 2X5KO 3C3WA 1R64A 1KRXA 4WNAA 2SICE 4TN5A 3PRHA 4GOMD 2EJVA 2FHSA 3LZCA 4B44A 2R96A 1JHMA 5CEEA 1YBVA 5EP1A 4D4GA 4RMGA 2AC4A 5LIRA 2WTXA 4IKEA 4MUAA 2PX8A 3GB9A 4ZRDA 1OI7A 1NJFA 3WWCA 3PF9A 1IPEA 3HCRA 1X0VA 3HBLA 3NCHA 4N5MA 2YXPX 4J8PA 3IIIA 3RUAA 4KXFB 3RTAA 1XRRA 3PUWA 4ZI3A 2D0DA 4CKWB 5BW4A 3J80A 4M2LA 1E79A 1JFFA 4TYNA 4NCJA 5LP6F 1LUAA 4QSMA 3PFGA 3ZZ1A 5K0SA 5G0WA 2H65A 4IR7A 4ED9A 1TO2E 2F8MA 1X3LA 4UNNA 3SM3A 4D26A 2XHEA 4LPKA 2ZUSA 3EXIB 3LHDA 4NBSA 4A6PA 4GPD1 2FR8A 1SHTX 1R5NA 1MQSA 3TB4A 3X1XA 3Q8LA 3D3JA 1OI2A 3CZ5A 3OLVA 2Q1WA 2HFKA 4KPUA 2ZZNA 5KNDH 4S3MA 2N42A 2G9NA 4X90A 2RHWA 2FSPA 4DVJA 2HREA 4J0IA 4ACBA 2DT8A 3HV0A 3WWPA 4QECA 4CTNA 4MJ3A 1CZLA 2A1UA 3BXHA 4PNPA 5GADl 1J1UA 4PV7A 2B9EA 1H3EA 4U9UA 3SFTA 1TU4A 2C31A 4XIJA 5E1MA 1P0QA 3DMDA 4PIMA 5HKAA 3TW0A 2WSMA 1HBJA 3S1SA 3PRKE 4RS3A 4X91A 2FU5C 1DRVA 2SCUA 3AB8A 2J3MA 4O4IA 3SKXA 1CS0B 2O3SA 4JUFA 4QYIB 4MW7A 4TTAA 5EZ5A 3WMFA 1LS1A 1VJ1A 1WKVA 2OEPA 2XA1A 3LA6A 3IA2A 4DDUA 1RVV1 2HNBA 3I3OA 1XWFA 2GJ4A 2JFOA 2O20A 3F97A 3QFTA 1MPXA 4MZDA 1C9EA 1J1ZA 1CRPA 2EFGA 3PQ4A 4BCDA 2RC6A 4X7RA 3CBQA 2ZSDA 3AESB 1UZAA 5TY0A 5KC9A 3I5YA 2ZYIA 3P5SA 4MV1A 3VR2D 3I32A 4JKYA 4JN6B 5CX1A 4DZRA 2JCVA 4MKIA 1RDFA 2D3WA 2JIQA 4LZOA 1Q7RA 4LSZA 2XQVA 2CMGA 4KK4A 3KWMA 4UEQA 3U7EB 2R1VA 4GPEA 3WWDA 1Q0RA 3TZEA 2ES4A 2EKDA 4MVJD 1EDOA 1AMOA 4UFNA 1UDAA 2QL7A 4CXMA 3BDVA 1TZBA 1FY2A 3ILSA 1ZUNA 4JB3A 4OGGA 3U6KA 5DWQA 3P0EA 1NGSA 1YBAA 4AWAA 1Q1AA 3CX8A 2OFPA 3OO1A 4J4HA 4JNCA 3MAAC 4TKUB 3WQRA 3MHTA 1Y33E 4JROA 3IYLW 3H65A 2H9AA 2QUIA 3D0QA 3EXG2 4HMQA 2X0DA 1AG9A 3KDSE 4CEIA 2FEKA 2VTBB 4JT4A 1QMGA 4JELA 1GSAA 4IZIA 4DSAA 3EA5A 4XUGB 3IJPA 5FA8A 1JJAA 3MOGA 3RK1A 1U9ZA 4ZYUA 1RZ3A 5DIZA 4R84A 2E18A 1JJ7A 4HDMB 3GRCA 3GRYA 3KHSA 4GW3A 4M6WA 3QWHA 1O6BA 4CKYA 4BO0A 2A67A 4ZOAA 3VOTA 2PLRA 5A4IS 3ESAA 2GBLC 3OU6A 2OECA 3JAKA 2CJWA 4RLSA 4R2LA 3T7TA 4N39A 2CKMA 3FKSA 1VP3A 2XCRB 1FTSA 1D6JA 3H6KA 3W6ZA 1MB2A 1P9NA 3O4IA 2MMGA 3C14C 3AOGA 4D4LA 2H3EA 5HKKA 1M7GA 2FSUA 2IPAB 2F64A 3IT2A 4MGZR 2BVNA 4F4UA 1W47A 4GOJA 1GAWA 1P18A 3PQ7A 2EJBA 3ZWKA 2Q21A 1L2TA 3EQ9A 3HRIA 2CFOA 4RL6A 3UXEA 3B1JA 3HN2A 4E94A 5E4YA 1S4MA 2FZVA 4ILEA 5A62A 4TZTA 1RT9A 3N53A 5KBYA 4RBNA 3KD3A 2FR1A 3PEEA 1DOAA 2NTEA 2H5EA 2IYRA 4CV0A 2QRHA 1FXSA 1UC5B 3K30A 4YAUA 2X2FA 4YCBA 1EK1A 2O2EA 1TTQB 3AEYA 2X6RA 5AJXA 3U7GA 3TKYA 1T34A 4WACA 3AIKA 3FETA 5AXAA 2GK3A 5H80A 2B69A 5IW8A 4O2BA 4FD3A 1C4XA 2IZ6A 2QTCA 3UJ6A 4D9CA 2ZTMA 5KTOA 5AK6A 2F2TA 5HIMA 5JZOA 2H1HA 2RJ3A 1IUPA 2ZS9A 1YH3A 3LC2O 1OT5A 1EJ0A 3K2QA 1H3NA 1N5RA 5AW9A 4X45A 1A8PA 4HGOA 4R9UC 4F9FA 3OICA 4H6PA 4UZEA 1U31A 4V0OA 4J6EA 2LV8A 4QA9A 1J39A 2P67A 1ZW1A 3OCWA 1GFSA 1VPEA 1AURA 3FMFA 2QY9A 3N5KA 2DPHA 4DXDA 2W58A 5D51S 2BFNA 2YWJA 1OU4A 5JSFA 2BH9A 1UODA 2ZU0C 3UICA 2KQUA 3QFSA 1NVGA 1C1XB 4LY3A 1A8IA 1XAHA 2C2BA 4DE5A 4DXHA 4OP1A 1L9XA 3LFHA 4DCOA 4CG0A 1WXFA 2CHEA 2WIJA 1NLFA 4KRXA 4C0QC 5EIXA 3FHTA 1Z0FA 4UUNA 1SK9A 4OLBA 5AI5A 3W79A 3A1CA 2JL1A 1S2DA 4GMDA 4KUEA 5CVUA 3ROGA 1F8UA 1QWOA 2OXTA 1JQBA 2BJHA 1E3IA 3B3JA 5T6BA 5DX0A 5IJ0A 3GDOA 1DC8A 4Q7LA 4KMMA 2GA8A 2YUIA 1BE8A 1QP4A 1Y98A 1OROA 4IM7A 5FWYA 4MDEA 3OZAA 3LL7A 4DF3A 4GZ6A 2ZCJA 3ZIAA 1VKZA 4AC9A 4G0WA 3KQSA 4QTTB 2ADOA 2QZJA 3F73A 3KPYA 2GO7A 1WF6A 1WS6A 3NOOA 4KTTE 1H22A 3T94A 3MCVA 1A2KC 1BX1A 1IVNA 5KVSA 2HQBA 1GNQA 2PGJA 1K7FB 4W99A 3ZWWA 4K0KB 1DNPA 4QVGA 4DJ5X 4BBJA 1OWMA 5EE3A 3UGKA 4H7HA 4MICA 4MS1A 1F0PA 1GPUA 1V26A 4OKSA 4QUKA 3BJIC 5IMBA 3R77A 3S5UA 5LFAA 1DC4A 1TCUA 3DOIA 3SZLA 3ZBTA 4DREA 1A9YA 5BR7A 1UAGA 3RE1A 1V71A 2CXOA 2R8RA 4PYNA 3TTSA 5JROA 3OVMA 2I9KA 4LE0A 3S6JA 3ONDA 4Q16A 4DIMA 2JEOA 3COVA 1ZG3A 5IJ9B 1Y1LA 3ENQA 1XZPA 1KZHA 3I62A 3CSDA 1Z6QA 5FJIA 1R3DA 1BXKA 4DY6A 1MJGM 3BXZA 1ZOSA 1MB3A 5AW7A 4KDEA 5AKZA 3V1MA 3QX8A 3C6BA 2OCYC 1QH1A 2PBZA 3HXTA 1V3TA 4RNCA 1U0JA 4E03A 1T1JA 3ZDQA 2BTQB 4FFPA 4LHVA 4DM3A 3PD1A 1JMVA 4MV9A 2YVUA 2CYBA 2HGZA 4JQYA 1TDJA 1LZKA 2Z5GA 2ZDHA 2MCFA 1OMOA 1K8XB 4TL7A 4D3FA 2I2CA 1IBCA 3NWOA 5ISMA 4RVOA 1SBCA 2OE2A 1XJWA 2Y6UA 3BD8A 5J5AA 3CEJA 2FPGB 4H0FA 5JO9A 5KYUA 2F6RA 1XTBA 2XQFA 3MN1A 4HVCA 1SMKA 3HA7A 1R9MA 3HHPA 3OLWA 4NPAA 2PGOA 4MGHA 2FPXA 3NBYC 1DWOA 4TRMA 5GGXA 2ACKA 2FMFA 5BO5A 1K7SN 4H15A 1I30A 3UMCA 3QH4A 1U5CA 2F4NA 2NG1A 4DQ0A 4I66A 2IYOA 3FPSA 3PQ8A 4PYLA 2PS9A 4R51A 4BZWA 4Q4LA 1LQTA 1N3YA 4D4HA 2W5UA 3O83A 2VBCA 1XTQA 3UKJA 1O2DA 1P3DA 3CVOA 3AI1A 4F45A 1RE1A 1DMRA 3ROFA 1JEQB 4A0HA 1OXXK 2HRDA 1NM5C 3PQDA 4IOLA 1NBOA 2PFSA 3R6TA 4M99A 4NQZA 1ATZA 2XMSA 1SCNE 3GR6A 3RBVA 5LQAA 1QIKA 4JC8A 1CYEA 3ONWA 2IYXA 4K9PA 4XSHA 4WADA 4HAYA 1PNOA 1T0PA 5JMWA 4KV7A 1O0BA 3ZVLA 3OF3A 4HO1X 5KMGA 2YRFA 2GPJA 1ZA2A 2BR5A 1QV7A 4LVNA 3QU7A 4K40A 1E3QA 1C41A 1XZQA 2YFKA 3K9BA 1K92A 2FLVA 2GARA 1SD1A 2HMAA 3LU1A 5AJVB 3G17A 3CLKA 2QAIA 1YE8A 5IT5A 2VDWB 4Q7JB 1M6VB 2JGKA 3O47A 4PSAA 2G6BA 2HUNA 1TM3E 3C0KA 3IP8A 5F98A 3GFOA 3MCAA 3OLYA 4KE6A 1GDDA 1XIVA 3ZXYA 1F4VA 8ADHA 4ER7A 4UMDA 5AMXA 4DBLE 4R1PA 3NDIA 3N74A 5FTNA 5TV2A 5MFPA 3FTPA 1GNLA 3EODA 1O08A 2WG1A 1KEZA 1PEKE 3RRYA 4B4UA 1SBQA 2BOVA 3WNBA 1UUFA 2HSJA 3AUSA 1E77A 2WJGA 3SHTA 1EUCB 1JLHA 2O2ZA 2Y1FA 2Z83A 3B9RA 4G5QA 1GTG1 4GVPA 3ZTTA 1B76A 1JJBA 4MUJA 1MT0A 1YR3A 2IW3A 3T3OA 3KKMA 3HY4A 1I5OA 2XVZA 1BVUA 1Y3IA 4KUHA 3EUAA 4KQHA 4RA9A 4ZT4A 3T4UA 5BW8A 1TUBA 1DKUA 4GSLA 2HPHA 4GI7A 3BD9A 2GEKA 2WLTA 2DH5A 2ST1A 4LQ4A 5DM70 1FQOA 2Y1GA 3UH0A 3V97A 3ZDRA 4M0KA 2Y0BA 3DCIA 2VDNB 4DHWA 1YAHA 3JARA 3QSYA 3K2EA 3NWBA 2A9RA 4ASUA 1QYVA 2ZT8A 4EB0A 2WD9A 4WIAA 2PUEA 1PWYE 4DMKA 5FH9A 1OGJA 4RVFA 4PGFA 5LDDC 3F3SA 2XMRA 4M3NA 3GLFB 4IHJB 4LJSA 5J4HA 1AH2A 4KPFC 3CRNA 1E92A 2J9FA 4AUMA 4ZHSA 1CY6A 2QMQA 5JNLA 4UPDA 4PZZA 3WX0A 1PVDA 2HJ9A 3O7MA 4GMKA 4Z99A 2JEZA 3U39A 2AUNA 2RHRA 3SAJA 2YJZA 5JCOC 1JNXX 1EFVA 1NC3A 3V33A 1U5AA 3AL2A 1VG1A 2GJSA 1WB5A 3VHRA 2H1RA 2VKTA 4Q3KA 1HY3A 4GBGA 2DBRA 3HCNA 3O4HA 3OPVA 1SA0A 4K46A 2ORED 4OP3A 4WZAB 2OZLB 3NM5A 4F1JA 3SCZA 3JQGA 4HDRB 1E2KA 5HRUA 4NS4A 3CX7A 3OFKA 1EFRA 2Z4RA 1ID1A 4H77A 3QTBA 4AW9A 1V16A 1D9ZA 1GNVA 1GZ5A 2GFQA 2ETVA 3EIUA 5U1PA 2ID4A 3VZBA 1ECGA 2CL7X 1KR5A 1JR3E 2WIDA 3E48A 4OCZA 3WAKA 3EK2A 4CFSA 1ZW6A 2Z3VA 2A78A 3MLBA 5TPZA 4DIOA 2CYCA 4GDFA 2Q2OA 2X3UA 4KLNA 1TM2A 3WL6A 4OXKA 4NR0A 4M0LA 3K4HA 1AHHA 2C83A 1DKRA 4WUVA 3ZCUA 3SVLA 2K87A 1UJ4A 3OZEA 3SC2A 2D0IA 2NU6A 4Z53A 1YA4A 4FXOA 4V03A 5KI6A 1XNRB 3AUFA 1Y5NA 3C48A 1AXRA 2BJWA 3HR7A 4ZZIA 2F43B 1K3UB 2H6EA 4OSPA 4MV5A 5FORA 3AM3A 4KQ1A 3TPCA 2I9PA 1KJWA 4W63A 1CPYA 1GUYA 2RG7A 4DLYA 4UD6A 1E96A 4WLOA 1RRKA 2ZJ1A 1KFKB 3DW3X 3T3DA 4CCYA 5AHXA 1ZK3A 2HCBA 4DNOA 4E5NA 4TUYA 1GPMA 4Q03A 5FRDA 4XPZA 3RD5A 2YYAA 4AK9A 4NBWA 4KXQA 2H57A 2OGWA 3KYDB 3P5BA 3P9IA 2NUAB 3UXYA 5CB4A 1CY4A 3ZJ5A 2JZNA 3LFTA 3DPSA 4UAGA 2YS6A 5JZMA 1OXVA 2BDTA 5KOHA 1JFSA 1ZISA 3UF0A 4H1TA 3NAZA 4CQLA 1RIFA 2LW7A 1T6NA 1I4LD 2FPSA 4B4DA 4EG1A 1R1DA 3HKDA 3NXSA 4TROA 1HDIA 1XZAA 1WW8A 2RBEA 3PUKA 4PQEA 3SEQA 5BSWA 2DMRA 1HZZA 3F78A 2J32A 2O2CA 5AHRA 1W1IA 1DQYA 4E15A 2O8DA 1Y1TA 4TQGA 1T36B 3IEMA 4MA0A 3FIJA 4LHSA 5HIKA 1J70A 4QNNA 3ZR4B 3ZBPA 2YN2A 4YFYA 3IQGX 1ODFA 5AFSA 5ECGC 4DQUA 1PL0A 3QLTA 3REGA 1NXQA 1Y1KE 4E5KA 3A4VA 1DO8A 3HM2A 1UMBB 1RRFA 2I22A 5B3JC 6YASA 2YOHA 3L9XA 2M32A 3L0DA 1XRMA 3MWDA 4X44A 5TXGA 3V7NA 1L8AA 1U0NA 4CN8A 3BHJA 4UHEA 1G3MA 1WD5A 3E27A 5GIOE 1QKIA 2R97A 4BNWA 1XC7A 2AJBA 5G02A 3LQFA 4M9SA 5B30A 2I4NA 1PR0A 3TLJA 1UBSB 3SBDA 3QA3E 1RI1A 3BTVA 3ASVA 1SCJA 4HB2A 1HYEA 1I8TA 3DH0A 5AJTA 9ATCA 3IVRA 5DYYA 5B37A 3HHEA 2IVFA 2HF9A 2WSYB 2R60A 4IIYA 5BNZA 2JJ8A 2QPTA 4AJKA 4P0QB 1IZYA 1FDVA 2MU1A 1RLTA 1Y3BE 3Q9LA 1PBTA 1W6UA 1W85B 1PFKA 1WSDA 3OOHA 5K09A 3OZWA 4IXWA 3JQFA 4JVLA 1DWUA 3P97A 3UZUA 2BFPA 2ZIGA 4MKXA 5JZBA 1ZC4A 2O0MA 4BZPA 1RXEA 1RTKA 3E7WA 3QMPA 1GZ6A 2VJMA 2JLCA 3EQ2A 3GGPA 4FX5A 5A9RA 3ENWA 2LNDA 1J20A 4YPOA 5IT9A 3ANXA 4MLDA 2JDID 1JYFA 2W6QA 1U9YA 3GLRA 4DNPA 2PRSA 3M1LA 4V0SA 1FFDA 3FWHA 4IBOA 4LE1A 3O82A 1CUVA 1BC5A 2BEUB 5T4FA 4YO8A 2Q46A 5DX8A 3O03A 3RHZA 2Q28A 4BASA 4MINA 2I4OA 2P7IA 1T2VA 2RAVA 3ADPA 1XE3A 3DZJA 3PNMA 1ODSA 1UT8A 2FPIA 4FW8A 1MPTA 1HDZA 2AT1A 4LJ8A 3O0TA 3GEEA 5BRAA 5JYBA 2ZQYA 4EHDA 1SULA 1R8QA 4P98A 5DGHA 3R7NA 4RKYA 3AM1A 3C8UA 4C78A 5ALMA 1C7QA 4OMFG 1T15A 4ZVOA 4IJWA 3EVGA 1QC5B 3HJTA 4KFTA 1IG0A 2XDQA 4BTLA 3GRKA 3PE3A 4LGMA 4O8ZA 1VYTA 1W19A 2X3FA 3IQHX 4E0BA 3T1YB 1YC2A 4LJRA 2C7RA 2R7LA 3M82A 3T38A 4ZPJA 2OT3B 5BSGA 1VYVA 2UYYA 2M2IA 3K6SB 4TGLA 2TRSB 3TTYA 1OBCA 3HA5A 1N3LA 4CIVA 1A9XA 3U19A 4YI5A 3OZSA 3PHGA 1ZVQA 5EUBA 5C8YF 1WHSA 4U63A 5LZ4A 3E9RA 4OHKA 1CUHA 3GLGE 1EXWA 2A30A 3I1FA 4R6XA 3ZDCA 2C84A 3TOCA 2VHVA 2EOAA 2V0GA 2P5SA 5KHOC 3GQVA 5JFGA 4I6GA 1N6HA 3WGMA 1HT3A 1VLHA 3DDWA 2XCQA 4C21A 3FSGD 2FUCA 3BYZA 3I9NA 1M8GA 3QKSB 1YAJA 2R3SA 3HCDA 4RK1A 3VNAA 1ODKA 4MNTA 2GAAA 3HBAA 4Q15A 5SZKB 4BNFA 1FX1A 2AOXA 2QX9A 1FU8A 1QFXA 1TJ5A 1MA3A 4MB0A 1I6LA 5K8CA 1OIVA 1SXIA 2BF7A 4GP9A 4X41A 1XMQB 4TWZA 1F06A 5BXQC 1C9MA 4YX9A 4W5HA 3NKFA 2CVFA 5BPFA 3N8DA 4K9SA 1ST3A 1QDEA 2ZE7A 4G5RA 4LI0A 4JYZA 3AUKA 2OBXA 3LUHA 4PC2A 3RAGA 1KEKA 2GI4A 4S04A 2AXEA 1H2AS 3MCZA 3CE6A 1YZVA 5AVZA 2W0MA 3AEKB 1PX2A 2JIBA 4FXPA 1IZZA 4FMBB 4LCBA 2ZIZA 2ZUCA 4M89A 4MV6A 1W4LA 4ZOCA 3WGIA 1YS6A 1NIJA 5FNVB 5EMJA 1F14A 3RVLA 2HLPA 4PZ9A 1ENYA 3GCWA 5H5JA 3PTAA 1Y6GA 3OFJA 1GUDA 1JU9A 3M6UA 4LECA 2D1FA 2QUHA 5H3HA 1PJCA 1XEWY 3K94A 3EWIA 2HSDA 2J48A 4U0KA 3G23A 1HPLA 1Z4IA 2OL4A 3RNLA 5IKOA 3GMIA 4I50B 1CUZA 1EFTA 1PT9A 3HPRA 4LVCA 4QU5A 3K09C 1Z13A 5SYNA 4B3BA 1IH8A 3IEKA 1RCFA 5HQJA 4P31A 3JTEA 5FO0A 3AM4A 1KO1A 1QGOA 1XCJA 2CY0A 3N8IA 4JJFA 4LBWA 3Q3VA 3F74A 4MAAA 2NUPB 2ZRFA 4Q9NA 2EGUA 3FTFA 4DT1B 3RUFA 3BX1A 1H6CA 1KYTA 1XQ6A 1YULA 1UL1X 2P9TA 5M2QA 2BF4A 3QEOA 1DJOA 2I80A 2WKRA 4JLMA 3RSHA 3S8MA 1K2WA 4OREX 5F1KA 1AA9A 1BHJA 4IQ0A 3YASA 4BU0A 4D8VA 4TYMA 4IDBA 2J3LA 3OOSA 3GWZA 1E8NA 2RH9B 1VKNA 1W4RA 3RADC 1S3FA 4R9VA 4PX5A 1P0IA 4X60A 1VYUA 2DWUA 3LW7A 4BMPB 5LN1A 2EZUA 4LDJA 1TZ2A 3PNPA 4N3BA 4NYMR 4QBGB 4RO0A 3HM9A 4L4UA 3U7JA 2B1JA 1ODIA 4LHEA 4MUFA 1CY1A 3H17A 3CWQA 4RU1A 4BWVA 4RXTA 3EOBI 2IEBA 3KXPA 3BMCA 3VM6A 4E07A 4KZKA 2ZS8A 1FTYA 3N0VA 5EWMB 2AQKA 1DJLA 1OCEA 2G72A 5LQNA 1Q0HA 3KJGA 1FNDA 3W2IA 3DYBA 1QG2A 4GPBA 1TA4A 2HC9A 3A2LA 4TMZA 3LTEA 4XYEA 3ND9A 3TDNA 1I9GA 2ZIAA 3D43A 5EP3A 4UUMA 4QD3A 4KQ2A 2H4XA 1AKEA 4B4KA 3N7UA 4C2TA 4J75A 1H65A 3FAZA 3HKBB 4PX9A 2FRDA 1I36A 2P35A 1HTWA 3R4VA 1YXMA 4QXMA 2Y1WA 3ZCRA 3DONA 2XVXA 5BN3A 2JLWA 5JXJA 2YVLA 4KR0A 3EW7A 1F20A 1XQ1A 3O8OB 1WUKS 4EBFA 1P5ZB 3KRTA 5JQGB 5AKYA 2FX5A 2YOFA 3FMIA 4C06A 3L4KA 1UXGA 4UBOA 3DC7A 3ETHA 2GN1A 1GA6A 3NEJA 1E20A 4ICIA 1Q11A 2R25B 4PYRA 3VAAA 2JCYA 3RS8A 2OLJA 4M1QA 4P36A 3L7NA 3FDIA 3T3NA 3GWGA 1MBZA 2A1IA 1NP6A 2CNWA 3HJBA 1SB8A 3BQMB 5ALUA 1U3DA 4OFWA 2W7TA 1KIMA 3T61A 3NANA 4HQ0A 4OM8A 1K08A 3SU8A 5F1OA 3F49S 3ZVMA 3BMOA 4G81A 4ZHQA 2ZUUA 1P74A 1O4WA 1U9JA 2DQSA 4W1QA 2EQ5A 5C1OA 1RADA 4BXOA 3RTBA 4M83A 3W2HA 1KYXA 1Y7TA 1CY2A 2PZAA 4C5AA 1Q95A 1NJ5A 2WINI 5DV9A 3A3YA 4FIZA 2NSJA 5BRJA 2RKWA 5HZGA 2Y4NA 4JP2A