4D97A

Salmonella typhimurium d-cysteine desulfhydrase with d-ser bound at active site
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
328
structure length
327
Chain Sequence
b'MPLHHLTRFPRLEFIGAPTPLEYLPRLSDYLGREIYIKRDDVTPIAMGGNLRKLEFLVADALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLDLFNTQIEMCDALTDPDAQLQTLATRIEAQGFRPYVIPVGGSSALGAMGYVESALEIAQQCEEVVGLSSVVVASGSAGTHAGLAVGLEHLMPDVELIGVTVSRSVAEQKPKVIALQQAIAGQLALTATADIHLWDDYFAPGYGVPNDAGMEAVKLLASLEGVLLDPVYTGKAMAGLIDGISQKRFNDDGPILFIHTGGAPALFAYHPHV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-cysteine desulfhydrase
publication title Structural and Mutational Studies on Substrate Specificity and Catalysis of Salmonella typhimurium D-Cysteine Desulfhydrase.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 121
structure length 327
sequence length 328
chains with identical sequence B, C, D
ec nomenclature ec 4.4.1.15: D-cysteine desulfhydrase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d97A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d97A02
2GN2A 4HN4B 3IQHX 1A5SB 1TZJA 4L27A 1E5XA 4HO1X 5CGQB 2J9ZB 4OREX 1BKSB 1J0EA 2WSYB 2D1FA 5B1IA 5DBHX 1FUYB 1UIMA 2TSYB 4WX2B 4D8TA 1TDJA 1KFEB 4XUGB 1O58A 1C29B 3DKIA 4D9BA 4D9MA 1K8XB 2CLOB 1JBQA 1KFKB 3IAUA 2RHGB 3IQGX 4H27A 1KL7A 4L28A 1K3UB 1VE5A 3FGPA 3T4PA 1PWHA 2CLHB 5DW3A 4D99A 5B53A 4HPJB 5B55A 4D9IA 1FCJA 1UBSB 1QOPB 1WBJB 3HMKA 4NEGA 2CLIB 3VBEA 3R0ZA 3VSCA 5JISA 1A50B 4AIRA 3AEXA 2JC3A 1TZKA 1K7EB 3PR2B 5B1HA 5I7WA 4PCUA 4L0DA 5HBGA 1J0DA 5JJCA 4D9GA 1D6SA 1J0CA 5I7AA 5J5VA 1K7XB 5B3AA 4COOA 4D9KA 2RKBA 5IW8A 4ZQCB 3CEPB 2V03A 3PC4A 3DWIA 1P5JA 1WTCA 1CX9B 1F2DA 1J0BA 5IXJA 5DVZA 2CLFB 2EFYA 2RH9B 5CVCA 3SPXA 4AECA 2BHTA 2Q3BA 1K7FB 2CLMB 5BW6B 4Y6GB 1J0AA 4ZU6X 1RQXA 3ZEIA 1TTPB 1PWEA 2J9XB 2C2BA 2O2EA 3V7NA 4D8WA 2Q3CA 1A5AB 2C2GA 5I6DA 3X43A 1KFBB 2GN1A 3VSDA 1VE1A 5EY5B 5IWCA 5E0KB 1C9DB 5T6MA 5J43A 2O2JA 2CLKB 5C3UA 4D9NA 4HPXB 1K8YB 1V71A 4LI3X 3L6RA 2ISQA 1V7CA 3IQIX 1TTQB 2CLLB 2DH6A 2Q3DA 3PC2A 4KKXB 1A5BB 3X44A 2ZPUA 4D97A 1UINA 3SS9X 4D8UA 5I7RA 1KFJB 4D9EA 3SS7X 5D86A 4D9FA 5D85A 4ZU1X 1TJPB 1CW2B 2BHSA 3DWGA 5DW0A 3RR2A 4LMAA 4D96A 2ECQA 1WKVA 1Z7WA 5D84A 2PQMA 5I7HA 4HT3B 1C8VB 5D87A 2ZR8A 1OASA 1X1QA 4D9CA 1Z7YA 2ZSJA 4L3VA 1V8ZA 2DH5A 2TYSB 5KINB 3BM5A 3L6BA 3PC3A 3VC3A 3L6CA 1M54A 1WDWB 3VSAA 5I7OA 4NU8X 3R0XA 3FCAA 2TRSB 1K8ZB 2ECOA 4IL5A 4LMBA 3TBHA 2EGUA 1KFCB 1TZ2A 4I1YA 2J9YB 5B36A 1Y7LA 5DBEX 4JBNA 4D92A 4F4FA 4QYSA 1BEUB 1TZMA 1VB3A 1TYZA 2CLEB 1QOQB 5KZMB 4JBLA 2GN0A 3AEYA 4OFXA
chains in the Genus database with same CATH superfamily
2EW2A 4KPUB 5BT8A 3ZR4B 6CHYA 4EGSA 2NUPA 1RM5A 2J3HA 1SVIA 2AN4A 1P74A 4J1NA 4CIDA 2VWPA 2W0MA 5B58T 4NFSA 1PNOA 3SLGA 4P4NA 2QZ4A 1IE3A 3G9QA 4AO8A 2JFOA 4DQLA 3PEUA 1GZVA 4U2GA 1KORA 4DQDA 1CRPA 2RIPA 4KK3A 2FKNA 1ZI6A 1T3SA 2KI5A 2BCJQ 3PXDA 5JCOC 4GU5A 4KLZA 3SXPA 2BEWA 4A6PA 1GG9A 2BDTA 2D5IA 3E8SA 2A3NA 2ZTUA 1ZP6A 5JHGB 2X0NA 3SNHA 1HV8A 2ZYUX 2ZQYA 4JB8A 2YHAA 3ROGA 3WMRA 1KO8A 1SOAA 3R40A 5D7NA 2VYCA 1JTFA 2X76A 2VPYA 3M9WA 2MSEB 4IVQA 4V2IA 5FUXA 4BNLA 2A5GA 3T9DA 4YP7A 2GT1A 1JA1A 2X14A 1UT6A 4KGVA 4PX2A 2VHCA 4P31A 2EWVA 1QVAA 4UBMA 1Z36A 4Z9YA 4B6QA 1ILEA 1ZGAA 1Y4ZA 4LBVA 1GVNB 1L7VC 4EGAA 2ZBFA 4Q3KA 2H2WA 4D9GA 3G82C 4DNPA 4EW2A 3IDFA 2K2QB 5G2OA 4Q3OA 1WX1A 1CQXA 5INTA 1TD1A 3GEEA 3VVBA 5AVWA 4AG3A 3KJHA 2AFRA 2P3QA 1E0AA 1J8MF 2HU8A 4MW1A 2A2ZA 4GOJA 3ROTA 2PJUA 3RS3A 4ERNA 2CV2A 1L7XA 2FFJA 2GJSA 2J4FA 3E35A 5CVVA 3MGCA 5CB4B 3NWBA 4RIHA 5HTKA 2V98A 2QRQA 3RSSA 4Y2VA 1DNPA 2XUPA 2Q3MA 2VJYA 3MINA 4J3NA 1YR6A 4WNYA 2ZDGA 4MI9A 3FTDA 3MTBA 2H06A 2O1WA 1FXWF 4ETWA 1UKVY 3CURA 3GLQA 4FFNA 3HY3A 1CC1S 2WK1A 3MOIA 4CMJA 1MORA 1NOJA 3TL2A 1V37A 2VH5R 4QBFA 3GCZA 3HNOA 4LX8A 1S2NA 4HMQA 1HZJA 3P0RA 4EZBA 3FVRA 2VDNB 4F6RB 4RLQA 1A77A 2ABWA 3FWZA 2AG0A 1NU6A 3QEKA 1VKNA 5BWCA 1UANA 2BFPA 4RVCA 3I58A 3ZHOA 5FBHA 1EESA 2ZRIA 5TQJA 1Q19A 1R8SA 3GAMA 3NYQA 5C7YA 3B1ZA 1E2NA 2C2YA 3LUAA 4G85A 3K5PA 5FAKA 2R1ZA 3ZGVA 4AG6A 4RIFA 2HMVA 4YJ2B 1B6GA 2BKXA 3TUIC 2CN1A 1FDUA 3WIBA 1RW4A 3AY0A 4KIWA 4US0R 3RT7A 1URPA 3AEQB 2J08A 3GUUA 1TA9A 3INTA 3IODA 3H2GA 3IUMA 2WTNA 3P0HA 1GILA 2H4JA 2JAPA 2O3TA 1NW7A 2H54A 2WYWA 2FJ0A 3JVEA 3HNPA 3OFVA 3OJLA 4MR9B 4YB8A 5JD3A 2BZ0A 3QA9A 5LXTF 5NULA 1QOZA 2NSLA 2VJOA 3F96A 2KBEA 3H2KA 3MT9A 4CM9A 2AJCA 4V2UA 3MG9A 4D3DA 2FLKA 2GO1A 5LKRA 4JT9A 1SB9A 1ZGJA 2J6IA 3M1YA 3U7IA 5CFMA 4QEDA 3NOOA 3ONFA 4H1WA 2K87A 2IW3A 3ZW8A 4C7KA 1HYBA 1Y1TA 3DF9A 3E7XA 1UCFA 2H1IA 3K8ZA 3N28A 2XLBA 1JV2B 4I1IA 1CVLA 3UENA 2ZRMA 3AESA 2E4YA 2B4YA 4DR5B 4BVAA 4GPIB 3ZOZA 3TIXB 1AKUA 5A05A 4DT1B 2IYWA 3PGXA 4EAQA 4YAWA 1HC7A 4H6WA 3NIWA 721PA 1GVHA 2FG7C 2IEBA 1YKGA 1YBFA 2SCUB 4OA5A 3OOYA 2CDAA 2J3DA 2QPOA 3AOEA 4HDNA 4EO9A 1O54A 4IGFA 1E6WA 3WNZA 4O1IA 1ZS9A 4KNVA 1L7BA 2Q4OA 1CS0B 4N7MA 1NUUA 3ABRB 4UZSA 4TUYF 4TWZA 2NSJA 1ZBQA 4DIOA 1PIWA 4MR8B 4L0DA 3RGGA 3BFXA 4YHHB 1PLKA 4C4AA 4P58A 2O8BB 3R44A 4LSWA 3SP1A 2OO5C 4JEHA 3THYA 1O95C 3GH3A 4I1UA 4R83A 2OWDA 3UWMA 3WB0A 3NHWA 1I0LA 3ISVA 1CNMA 2REQA 2C3MA 2I7CA 1TO2E 3HKEB 5JS8A 1KERA 2JS7A 1AIPA 3KEGA 2O8EB 4IEFB 4AP5A 5JFOA 2UXCB 3W3AH 2Y76A 2YL2A 3R5XA 4MVJH 1U4SA 3ED5A 4HUJA 4P3YA 4M8IA 4EB3A 3I2JA 3NDRA 2YWBA 3OZFA 4H1VA 2Q9BA 4GF5A 4IXMA 3I30X 4NKRA 2O8DB 3HABA 1EVKA 3CVOA 4CR6A 1S1MA 3N3AC 3C3YA 4GI1A 1AHIA 4ND4A 3VU3A 4NFHA 4RY8A 5DT9A 1SCUA 4ADSG 1J8FA 3DKPA 2Z0MA 4I66A 4LY0A 1KSJA 3STXA 3ZHQA 1OQAA 1UJMA 1HY3A 3V00A 3SBEA 3WLEA 4EBFA 5AKYA 3ESQA 1CV2A 1L9KA 5FULA 1WPXA 3DV0B 2FPIA 5BVGB 1FIUA 1R0XA 2BUCA 1ZD9A 1QYDA 1YFKA 2VPZA 2YC2C 1NMYA 3T5GA 4C0XA 1UWVA 2V8OA 1DC6A 3KT8A 4FEYA 2GQ0A 2JB9A 3AJAA 1TCUA 4XQGA 3UB3A 4EVRA 2BD0A 2IZ0A 2ODBA 3PPVA 4G07A 1OAAA 1X9IA 2JBHA 4J0IA 3IHLA 1KQPA 1RMTA 2DZDA 4P5EA 2O3JA 2QSZA 5HPYB 1UDBA 3TLCA 3NHYA 1JFFA 3N0WA 3ACDA 2BGJA 2HA0A 1TZBA 3G2IA 4WT7A 2R4QA 3DP9A 2Q5JA 3ICWA 2C88A 5T57A 5JS2A 2PUBA 1XDBA 3ZLVA 3KKOA 1ONBA 1YS9A 4KZKA 1VE9A 1XXHB 1H85A 2E4VA 1E64A 4IF4A 2ZB8A 3SBOA 3NBMA 3DDSA 4CLXA 4X90A 4JBWA 4G1MB 4YN3A 1E58A 5FJIA 3RO7A 3AB3A 1LFAA 5SICE 4Y2PA 2C4MA 3JVIA 4B44A 3VNAA 4FSXA 2P5TB 2YZ2A 1XTIA 1E5DA 1M33A 1FNSA 4XW2A 3ZWDA 4OY3A 1C9EA 1G3QA 2Q3LA 1XLTC 1L8QA 4HTFA 4JC4A 2F3PA 4PRYA 3WC4A 5JFTA 2JLWA 1CUIA 3BL6A 4MIEA 1R7RA 3M2PA 2VQDA 3A4IA 2VEOA 1OVGA 3QTBA 3RC7A 3U3RA 2C98A 2EERA 5DNYB 1Y9EA 4ANFA 3T7SA 5ER9A 1ZOOA 1CDZA 4HATA 5KOYA 4PCVA 4BY9E 5DTRA 2BI7A 3SM3A 4URXR 4BQQA 2JFFA 1F8XA 4M0PA 4Q03A 3CTMA 2GZ3A 4UEKA 4YMSA 4DMLA 4AQ7A 1KFEB 1HSZA 3LWDA 1N1GA 2WFZA 2UUBB 4FYYA 4Q7JB 1PZMA 3UT5B 5BSFA 3N6RA 4PHCA 5EHGA 2DKFA 4RQUA 1XJQA 5JXIA 2RKOA 1NL3A 3M4JA 4DIUA 5H9WA 1N7HA 5WRFA 1PWHA 3IBYA 4GDFA 1IU9A 2ODWA 1LZKA 2HTEA 3D4BA 5AI4A 4BNTA 3EG9A 2J0EA 1UBSB 4L51A 2DSNA 2JZCA 5I9NA 3O2NA 3S2YA 1P7WA 8ATCA 2Q1UA 3RV3A 3USCS 1R50A 1AXRA 2A9FA 2R1TA 3KB6A 3UATA 3DVQX 3EGDA 1U9YA 3FAZA 2D00A 4HNUA 3C6YA 4GPZA 2GJ9A 4JLAA 3TSOA 1ZVKA 2ICAA 2N9UA 1KDPA 3WV4A 2WVAA 5BW8A 1QYVA 2RKBA 4M0KA 2C97A 4CNBA 3RI3A 1SUFA 4P22A 1IBSA 2AFIE 1KY5A 2WVGA 4X44A 2DJ5A 4Y2HA 1F0PA 5B5SA 1OILA 2PGDA 4M2LA 4S12A 3GDGA 3KZOA 3JR7A 3NVDA 5LQJA 2OR3A 4MGHA 1AM4D 5EHNA 3BK2A 3SPXA 4Q3AA 4JJFA 2F55A 1NM5C 4PC6A 3VFDA 2H4YA 2WJPA 3ILSA 3RTDA 4WBNF 3KG2A 3WQRA 2V0GA 2Y0CA 1YVDA 2NXEA 3I5XA 1MOPA 2BEVA 1ODTC 3EFOA 3KXLA 4F4CA 4X3CA 5JSKA 2C0PA 1QFZA 3C6BA 2OORC 1ECGA 3MBKA 1ZIOA 1PEKE 3K9GA 3MZ0A 2OSVA 4N01A 4QODA 5THKA 3RU2A 1IBKB 5IKEA 3CONA 3L8ZA 3OWXA 4IVPA 1ZHHA 1WVIA 3H87A 5J4KA 4BNDB 1JIVA 1YZVA 3QVLA 3LA6A 3GBSA 5D85A 1I32A 3E58A 2ZJ4A 2G82A 2LKDA 3IP3A 3TJMA 3FNHA 3TRKA 2FWAA 4Q7QA 2P9QA 3M6FA 3EXIB 4BL5A 1X7ZA 1LSSA 1K4KA 1XAHA 4GGMX 5KUTA 3T9BA 4Q3LA 2P2YA 2WUDA 3QLUA 1TA0A 4X6YA 5FNZA 5JLAA 3WOHA 3DP7A 3EPPA 4BEVA 1A2QA 3HA7A 5MGNA 5HCUA 1P4JA 4M1MA 2H7VA 4CI9A 3B52X 4HDOB 1JTEA 1GAQA 2R4UA 3NPAA 4D4KA 2P8JA 1F2VA 2EDCA 1GG5A 2OCAA 3PS9A 4Y30A 1CUVA 3C14C 4DWVA 3V55A 2GRAA 5HIAA 3BMCB 3JVUA 4OQYA 2FJUA 3N8KA 2YVKA 3WL8A 1D2CA 4E09A 4P0QB 3DWFA 3H17A 3AY3A 4B0OA 4TL8A 4OFXA 2V7QA 4A0SA 4F9TA 3H9UA 1G291 3OZUA 1PL0A 4HN9A 3ABOB 4MQEA 4NFYA 2FZ4A 4F3TA 4HRVA 2QXUA 3AR3A 1J0EA 1QH0A 1OX6A 2PIAA 1KI3A 5FTLA 1EK1A 4FHFA 2ANBA 1XLWA 1PG5A 1G8SA 1XNHA 4KI0A 3OTWA 3T1QA 3V4SA 3O94A 5TPWB 1QRUA 4LN1A 4NZMA 2CSUA 1YONA 5BUSA 1FSZA 3H13A 5A4DA 4RZ2A 2W8BB 1JDSA 2WY2D 1DTEA 2F1RA 1PR1A 3HJHA 3AIOA 1BD4A 4PQYA 5AKGA 3T7AA 1EFAA 3CGGA 4GW3A 4U0JA 1YJQA 4P5DA 3P2IA 2I3ZA 5JEDA 2NXNA 3D8HA 4QIHA 4ZT2A 3T3EA 1FMFA 5LOVF 4IX9A 3R0ZA 4UNIA 5AHKA 2C9BA 4WGFA 5F51A 4I8DA 3PQDA 4FPXA 3R8XA 4IIBA 4XX1A 4NULA 3WKAA 1SHZA 2Q9AA 3N0RA 4C5BA 4DIKA 1B43A 4O63O 2BH2A 1U8ZA 5CDHA 3CUKA 1W25A 2B21A 5EMLA 2XNJA 1AXEA 2IODA 3LBYA 3LK6A 4UKDA 3QKSA 3S70A 1YE5A 3L8FA 5KTPA 3OIFA 2CT8A 3NAZA 5TJHA 5H4GA 2HJGA 4GL4A 4IIJB 4QGBA 4C6TA 4KSCA 3B78A 4MUIA 4AKEA 4DMHA 1P29A 2EZUA 4ZEMA 2QX4A 3HUUA 3QJ5A 4R69A 2HFJA 1EDBA 4XE5A 2KWIA 3IKLA 3ZWWA 3H5IA 1UKYA 3JQQA 5LBIA 2RH8A 1GXSA 2VN8A 2YMPA 1U63A 3ZCRA 3NG1A 4ZU3A 4NRDA 1T5LA 1YQTA 2QD5A 4C30A 3WFZA 1OYOA 4A1OA 3CM0A 3UHOA 4HOYA 3K0SA 4ZAZA 1U90A 5CIYA 1Z39A 3EZNA 4QKQA 1UJ6A 3OFNA 3ORRA 2G9UA 3SR0A 4OJNA 5K51A 1TTQB 2HN9A 3AEUB 3VDRA 5ICMA 4KBGA 4F5WA 1R5NA 1QANA 3OY7A 1U6KA 4MS4B 1FVHA 1VP9A 1GZHB 1KNXA 4KX5A 3W5JA 4U02A 2HCJB 2EAUA 2WJ3A 4GECA 4JOCA 2E5FA 1YTLA 4HH4A 1VG9B 3JD4A 3OFJA 1I2AA 4KZPA 2PWYA 4HFJA 4IG4A 4PEVA 2WHEA 4KEAA 4U7DA 1NF9A 5ELMA 2GK4A 5FOWA 5GIOE 3I2IA 1W8IA 2L42A 2ZUCA 4WHMA 2PJRA 1K6EA 4ER7A 2X77A 4QT4A 5D6NA 3PRKE 1RLUA 4UFNA 4JI6B 2V0CA 2QW8A 1UAAA 3HSKA 4L6CA 4N9QA 2JIRA 5JT1A 4A1FA 2E5WA 1KFCB 1KI1A 2EJVA 2V96A 4AROA 4Y9RA 3DB2A 3P2EA 4Y6RA 2VPQA 4X5OA 3LHKA 1W2GA 4JB3A 4AKGA 1JWBB 2KBFA 3Q12A 5LLSA 4DRXB 3U40A 1IN4A 1VL0A 1TKBA 1IIBA 3HKDB 1JMVA 2QTHA 4HZGA 3M4NA 3D59A 1ZGBA 1EB9A 1E5XA 2O50A 4MUMA 5HGJA 3UGQA 4B80A 1U9ZA 3FOEC 2H9IA 2WOOA 4XD2A 4UBKA 5EIHA 4PO8A 2AG5A 1JT2A 5AWFC 2D1FA 2OPHA 5B3KA 9LDTA 1D4AA 1MC5A 2ZYWX 1D1SA 3EIUA 3W5BA 2W6ZA 1JYFA 3PUJA 4KFRA 1MOZA 3KBBA 5CLFA 1V26A 2IEIA 1VJ0A 2N3ZA 1SKUA 3MELA 3O3CA 3G1WA 1CDOA 2AR7A 1UMBA 2HXYA 2IDZA 3P9KA 4PVDA 1E2JA 3TXXA 4M7OA 4TV8A 1OAKA 1RXSA 1RRFA 1S89A 2HK7A 3JATA 4D0NA 1W4AA 1OGYA 1XD2A 4YP1A 1X7WA 4PLFA 1FEZA 5K0JA 2BTQA 1M2GA 2WHXA 5E4TA 4E21A 1CUJA 1RRKA 3AG5A 4FE3A 3JU3A 1SHLA 1E2GA 5FYQA 3NORA 3V8RA 4K6MA 4BCCA 1R5OA 2YJ5A 4RVUA 4BGDA 2VEDA 1IPHA 3BMNA 5EE1A 2XZOA 2BT4A 2NO4A 3DR5A 5DEIA 4CF4A 2HI0A 4PZUA 4QGHA 1E4OA 1M74A 2OO3A 1T1IA 1RTKA 2PXAA 3CW8X 2J48A 3S6JA 1GIAA 3N8NA 3H6GA 3A3PA 4FEEA 4R7ZA 2VDQB 2WFLA 4KGZA 3WNDA 1UBUS 4U5QA 1U1IA 2QMHA 5HMMA 4DXHA 5JV5A 1PZFA 5DF1A 4QELA 1J25A 1Q91A 2W2NA 4RWEA 1CJUC 5KYYA 1RM0A 4RD4A 2FETA 1UEIA 1P5ZB 3BTVA 1JMKC 4MYTA 1BDJA 5CA0A 3PNQA 2VC2B 4BJ6A 5BRJA 4CJXA 3EDMA 2XR1A 2PCLA 1E9CA 1TAQA 1XDZA 3DYIA 3GP5A 3M34A 1VBKA 4D4MA 2UDPA 1IDN1 1RJWA 2INGX 2OGZA 3B85A 1V6CA 2Z5LA 4UZFA 4EKDA 1O6BA 4L8WB 1H3FA 3M6AA 3AHDA 4Q1VA 4RS3A 3UW1A 3BDAA 1TK3A 1OV4A 1V96A 2R7MA 2ZRNA 3D5TA 4FMBB 4KWIA 3B1VA 4FJ2A 2OWEA 4WK0B 4YHBA 4OXYA 3HLTA 3L0IB 4P2BA 3WTBA 3DLTA 4R51A 1Q21A 4RF3A 4R0NA 5CVEA 1ONPA 1WM1A 1Z38A 2GZHA 2HWWA 2VA9A 1HLFA 3HCRA 3MB8A 4MV8A 4YC7A 1A97A 2ZJ2A 1G59A 1II8A 1SQ6A 4RMNA 3FG9A 4UUPA 1IUNA 3ACBA 1UZMA 3NHMA 5J58A 2VP6A 4R71A 3JD2A 3UAWA 2P2DA 3HWRA 2E9SA 3DTTA 1ADYA 3G13A 4BMNA 2J0UA 2BFDB 4Z3KA 5HX7A 4LDQA 1D4ZA 2DQYA 1C1XB 3WGGA 1L7EA 3ETJA 2ADMA 3I1IA 3C43A 4G5OA 5LQKA 1FFYA 1P45A 2GCGA 2KS6A 3EISA 2XB9A 5E1DA 2WA2A 3B82A 5B4VA 1SXJB 4IGAA 4HSEA 1YAJA 3CVUA 1NUQA 3IMEA 2XCTB 2BI8A 2PQ6A 2QTWB 1VFNA 3I5MA 1M2VA 2IHKA 3GPLA 2R7NA 1NI3A 5EYPA 4C9BA 1O3YA 2J9FB 4N5MA 3WK5A 4MXDA 4WN9B 3THWA 5BSHA 1J5EB 3OLWA 1CXZA 1SOWA 4KHZA 5KNDA 5DWDA 2FZKA 4DLXA 1MH9A 4ER6A 4PC7A 3OUZA 2XY4A 4U8HA 1PFKA 1EJ2A 2FSVC 1W52X 3IP5A 1EG2A 3E48A 3FWKA 3A3OA 5CM2Z 2FFHA 1NJ2A 2P6MA 1B15A 2B0CA 3OPMA 2CXQA 5K8IA 4DA6A 5ISMA 3A9RA 1QAQA 3D6FA 4DEYA 1BDMA 3OCZA 1N2IA 4G5RA 2PSFA 2F3SA 3DGEC 5DYWA 5E9JA 4F1JA 5A1TA 3GZTB 3FZEA 3PX2A 3C5WP 3UXEA 2VCYA 5GOZA 4C0QC 1Q14A 1JU3A 3PFKA 4OLJA 2GXUA 1CK4A 4TXMA 5IS2A 4M1WA 4WV3A 1JE1A 1JLMA 3ZJVA 4GR9A 1BSVA 4XYGA 3G5TA 5KQSA 1IN8A 3F3KA 3D3WA 3BXFA 5FI3A 1NZDA 2XGGA 3L05A 3WGIA 4HEHA 1LGYA 2HT6A 1E8NA 2PSJA 3ELYA 2P8SA 4H18A 4ZOBA 4C0AC 4HLUC 3FOFC 5C8XA 3U4QB 3WS7A 5FLKA 2EFJA 2PS1A 3PWTA 5D3QA 4E2WA 1T10A 1BX3A 3V1YA 2AB0A 5AIAA 2ZZNA 2KE5A 1V4BA 1THZA 3RYIB 4EPTA 1ICEA 2Y9MB 2AJBA 4RAQA 4R6XA 4BNFA 4EUFA 5HCNA 3RFCA 4JYCA 1U7TA 1G0NA 1ODLA 1Z4JA 4QLBA 2DFPA 1ESZA 2ZJ8A 3HB5X 1L4UA 2PD6A 1XK6A 3Q3CA 2OM2A 3G2KA 5CUQA 3GFQA 3SJZA 1DT3A 5I47A 3I2GA 1QO7A 2IW1A 3OLCX 1Y5LA 3OCJA 4PG4A 1EXMA 4BFYA 3RHZA 3L0CA 3ORFA 4FHGA 1W36B 3IEVA 1W0JA 1ZM2A 5CEEA 2D62A 1XSEA 2GESA 4P3PA 4XVHA 4YXWA 2P9GA 2VYQA 2YHBA 4TT3A 3RT1A 1ECJA 1BHSA 5LXTA 4G36A 4GLJA 5DGIA 3BHJA 2XTJA 2WOJA 4WKNA 1RMQA 2YNMC 5FBWB 5FAXA 4ON9A 1AURA 4J3FA 5AW4A 2FR1A 5LMUB 3ZJYA 1HE3A 5A5GA 4X8OA 3CKKA 1WOYA 2FVXA 1JIKA 2Q3JA 4M1KA 5T8KA 4AZWA 1BS9A 4JL5A 4DNFA 4RSRA 4L76A 3K6JA 3LCVB 4HEA1 1KKLA 2RHRA 3DAGA 2AI1A 1AF4A 2C8LA 1RHRA 4RK5A 3I6MA 4C20A 4GWGA 5HK9A 1E8MA 2QRUA 2DUUA 2XUKA 3NAMA 3I0MA 4GC5A 4JMLA 5CNJA 3LPDA 4EAAA 1XZ8A 2HWYA 3FYUA 3R77A 3D8RA 4AZ0B 2G0AA 1JI3A 3C7CB 3MGBA 3ZKAA 4W9MC 1ZIYA 5I7EA 1S01A 1P9LA 2BFEA 4HMPA 4I4NA 4NBLA 4RE5A 4MR7A 2IOYA 4LSGA 2O4UX 1OLXA 3H3JA 4J16C 4ZYLA 3PI6A 1GPLA 3RUPA 3VDNB 2FPPA 4OFZA 5JSQA 3W9BA 2OVFA 4XSGA 1B1AA 3TW4A 1YCHA 1FW6A 3EZ6A 3I1JA 4Z0HO 3VRHA 2QZZA 4QYXA 2GETA 2GJ8A 2XODA 1ZOIA 1IWOA 1K4MA 1WXWA 2VT6A 5ALVA 4W5WA 4R54A 1W2HA 3PJFA 3K09C 4P9NA 2G7MC 4RK7A 3FDXA 3R8FA 4YVFA 1UAYA 3DZFA 3LQRA 4BZQA 1L5KA 1PJ2A 2X58A 1ZMXA 3TUJC 2JA1A 4WCFA 3COJA 5IVPA 1Y6FA 4WWHA 1M2FA 1ONNA 4ZT5A 5IJAA 3QLVA 2HA5A 2QSJA 3RODA 3HVRA 1L5SA 3E22B 1NKSA 4Y6PA 3SBXA 4BMOB 2VLBA 3IQEA 2QQ5A 3LCRA 1YUMA 1H8HA 5FA8A 5CW1A 5B4UA 1YBMA 4G9EA 3WYDA 4OQXA 2RK4A 1U11A 1CUDA 5BSKA 4PTYA 5TE9A 2ERCA 4J3JA 1XP5A 1P2SA 4G37A 3TB6A 3VR1A 3CTPA 4F92B 1IY1A 1B14A 2H6EA 2NO9A 3FFTA 2ZDQA 1A95A 1NSFA 3ENQA 1GPKA 2I9PA 2HLHA 3GLGE 5A0TA 2A1UB 2V7PA 4E12A 4O4LA 3MRVA 2IHTA 2JCBA 1T35A 1NQAO 1N3YA 1PQWA 1Z62A 2YVQA 5JHHB 1PWXA 1L5RA 1C29B 1EEXB 2VQ6A 4J0GA 3NTQA 3PXAA 2Q27A 2AVNA 2CV0A 5DHPA 1KFKB 1YASA 4AY4A 1X42A 3D8NA 3FGPA 3VPSA 1PGPA 4AMBA 2ZIXA 2AQ8A 4XDYA 4LXXA 5EMHA 5F3DA 3QPUA 1XTPA 1Y9AA 3G2OA 5A5VA 4HB2A 4O2AA 2C2MA 3IMFA 1JLLB 1QYIA 3H8SA 4O2BF 5F1OA 4HQ6A 1SBCA 3ZEAA 1E1DA 1G16A 1DAOA 1R16A 2WIDA 3UMFA 5B6PA 1H22A 1C7JA 2J3IA 2RG1A 1VLJA 1FDOA 1Q92A 4L4XA 4D2IA 1P75A 4ZI3A 3L1IA 2DPMA 1A9RA 1UPUA 4KIUA 4GE3A 1CDEA 1T4BA 4OL0A 5T6BA 1GZ7A 6PFKA 3DXYA 1EVIA 1KEEB 2JATA 3A37A 4DV2B 3E9ZA 4QDOA 1NXVA 1ZL2A 4F06A 1O9HA 3AF6A 4X1YA 2VH1A 2QYSA 2OGSA 3HV0A 4I36A 4AECA 4OLAA 3K9NA 1XROA 2V7XA 4LZWA 5TARA 3U9TA 3SQXA 3FSEA 2HB6A 2BFBB 4PZYA 5DEOA 1XVTA 2NIPA 1TTPB 2AEFA 4D42A 4MHTA 3IAS6 3CZ9A 2FNAA 4MINA 1MGPA 5KYNA 3NETA 5DM60 2YWDA 5KYUA 4CT4B 2XQFA 4A3SA 5CDYA 3K9FC 5GV8A 1VKJA 1II9A 1KEUA 3X2SA 1JFSA 4G4JA 4FKMA 4IQ4A 4BECA 5BPHA 1RRVA 2GPBA 4FMDB 1W34A 4JS0A 2HH9A 4J7XA 1NONA 2P67A 3VC7A 5HKKA 4KNYA 1K8YB 1V71A 3AUJB 3JQGB 2H1OA 2L0XA 1HDEA 3AO0B 4CF3A 4C7XA 5KNBA 4MQFB 3WLPA 4HGRA 2JH8A 1W9HA 3W2EA 2EDAA 4ID9A 1CIJA 2DPHA 3PU6A 4MWGA 1DG1G 1VSQA 2RG7A 4Q4CA 1PVDA 1DLJA 4EJ2A 1OFUA 2PZEA 3K2BA 3REQB 2AC7A 2ZTHA 3GYBA 1GPWB 4YR9A 4A8HA 4EOGA 1U2DA 2NLOA 5FX2A 4XLZA 2VAPA 2X9LA 4S1VA 4HFMA 4WZBB 4ZO4A 1IDOA 3VR4A 3AKDA 3MJHA 3T3DA 3B1FA 3SHTA 3HSSA 2XWQA 1AX9A 2Y4NA 1J7KA 2AJLI 3JWPA 4URYR 3R76A 3FROA 5ILOA 2N75A 4NCXA 4KVAA 4PYRA 3KQPA 3A1FA 2H92A 3LRXA 1RZVA 5ALZA 1EXWA 3EVEA 5HEKA 1L4MA 4LYEA 4XWWA 5B4TA 2PNJA 1J2TA 3FR7A 2D0IA 3ENNA 3H11A 5ARCA 3V5NA 5KNCH 4B09A 1NW9B 3LKZA 1KMQA 3ETEA 4FFWA 5EMJA 2DSTA 2AE1A 2VYND 4LOKA 1QIDA 4C4PA 4EO4A 5FDFA 5TQ2B 3UH0A 4CDMA 4JI2B 5GY7A 3ESYA 2C03A 3PPXA 1X1SA 3ZTTA 2TSYB 4H4CA 5FEMA 3QQ5A 5DMXA 2IBSA 1KDVA 4DSAA 1KI6A 1IQUA 3LWNA 2PXXA 5AQ1A 1BMDA 3HUDA 1HNNA 2WV7A 1DGQA 2EWWA 1C4KA 4FMPA 1XVLA 2OXTA 3VNSA 4BMCA 2VTBA 3M5DA 1MO5A 3I9JA 5I51A 5MFPA 1R3UA 2VJMA 1M7GA 1I2ZA 1R8YA 3PHLA 3UJBA 4D46A 2R751 3EYAA 5FWAA 5LCXA 1T3ZA 1MPTA 2ZBEA 1WMAA 3JW8A 2FR0A 1WBJB 1YCFA 2P2GA 4AJKA 2F1OA 3KRTA 5FT9A 3CB2A 4HUQA 3D3KA 4IXDA 5D8DA 3FPSA 1IPFA 4AIRA 3QE2A 2JC3A 3PR2B 2CC2A 4E14A 1E3TA 3T61A 1VHWA 4GEKA 1Y5MA 3FHJA 5A9RA 1U7PA 5I8PA 1UFVA 3G2HA 4LY3A 1G2IA 1DOZA 1DZIA 2JJ2D 4GOND 2PZAA 4A0HA 5HF6A 2PUFA 4FOPA 4L50A 2R6CA 1SC9A 2W00A 1ULHA 3T7CA 1TUBB 4JJ6A 5C8YA 1T2AA 2XOXA 3T9AA 1YR8A 1DKUA 5ANRB 1TRKA 3DZIA 4S1NA 4X66B 2IPLA 3HRHA 1IWBB 4U9IS 3E8MA 1GKYA 4LJ9A 4DQ0A 1AO0A 1EGVB 3BIXA 3FCOA 3W8EA 3E27A 3E1GA 1A3CA 2AC4A 4DLAA 3BTOA 3DC2A 3N39C 3SVZA 2FFAA 1Y5NA 2YXDA 4AB1A 1ZOSA 4I9UA 4FXOA 3D5EA 4TRRA 1AQIA 3MWLA 1FS4A 2VDJA 5A3SA 5HRAA 4KO2S 4ZVTA 4HNRA 1M1ZA 2QTAA 1SCDA 2CXSA 2DFTA 5DN6A 3PFCA 3P2YA 1KVSA 4BTVA 4EJSB 5LIRA 4D5EA 3VU1A 3C3KA 3E3LA 4CDNA 3R5SA 3DM5A 2ZRPA 1GGMA 4K9RA 5J9FA 2H08A 4EYSA 2Q3FA 1IRXA 1Z8HA 4O4HF 1F2UB 1JQEA 1ISSA 1WU8A 3PC7A 3QEJA 4IM7A 2Z3ZA 4F4JA 5LIPA 2WJGA 3KQMA 1HM5A 1ZVJA 3EUWA 4LJ6A 2J9RA 4Q82A 4LFAB 2C1XA 3H05A 4FE4A 1EBFA 1HORA 3LQQA 4KQGA 4UUOA 3ZNOA 1HBJA 1U1GA 2C7VA 2Z5VA 2ZI4A 4K5QA 3JZAA 5DGHA 3ZV4A 3BGIA 4B4OA 1PG0A 1XL1A 3PHCA 4ZT6A 5DM70 1KQNA 2BM0A 4AWAA 3TRIA 3WGKA 1E98A 1J7JA 4ZGBA 1T26A 2DH5A 4ZI5A 2VTKA 3NP7A 3UAXA 3L6CA 1KQ3A 1DINA 1QMGA 4HYEA 3PPWA 4ZV4A 3DE4X 4II7A 2AYZA 3QVGA 4ERXA 5SYNA 2JBWA 2ZWOA 3OWOA 3OX4A 5JNLA 2CLSA 3EXEA 4TUYB 4X1KA 5ALMA 4HDSB 2X5OA 5FBLB 2ZYAA 4YREA 4QUIA 5FB3A 1B2LA 5CITA 1UF9A 2ZB2A 5B7QA 3RLIA 2QOEA 4U2CA 2L18A 4ZEOA 3TTTA 3PIIA 5FBQB 3IQHX 1NE7A 1JG3A 1GA1A 2F8LA 3CLUD 3LVFO 1F5NA 4FT2A 4OL9A 3A10A 4GSYA 4OKNA 4B3JA 3LP6A 3V4RA 2RFLA 3K05A 3L9WA 1OLUA 4E6PA 5DK6A 2HQRA 1AU9A 1JIXA 1BYUA 1PR2A 1JQLB 1WXGA 2NXCA 4FBGA 2YOGA 1WULS 2ZBDA 4ZOAA 3IO5A 4B6PA 4MA5A 5T7BA 4GSLA 5DLDA 1B0ZA 1N57A 4W9NA 2REXB 3CLSD 3HO1A 2Q3EA 1SJ9A 4ZCIA 1Z5PA 1JDBB 2PQ0A 1S2IA 2XT6A 3CO5A 3ONVA 2H3EA 4GMGA 3SOZA 5GZ1A 1QMPA 3K92A 3UHFA 4D9BA 4Z1MA 3VNBA 5IANA 4DV7B 4MW0A 1DBWA 4MCHA 4PBRA 4QUJA 4TRMA 3UCFA 2MR6A 4K9SA 5BUCA 2IIBA 2FUG6 2VDMB 3N75A 1AQJA 1ZUWA 2JLRA 1U2RA 3GZJA 1CUWA 3VOSA 3E1KA 2R79A 5KJEA 2VAVA 3QXGA 2QLFA 3PP8A 5C35A 4X93A 2OBYA 4Y9SA 2C29D 2X1VA 4PRZA 1YFJA 4E0BA 4U7FA 2JI4A 3U4HA 3DOUA 2FJPA 2VWHA 4F96A 4PCUA 4B8WA 4NJOA 4W7IA 4P7BA 1M6NA 5CNIA 4GP6A 5E6UA 1V35A 2FUEA 2QP3A 4C5AA 3DO8A 3OQNA 3N2ZB 5KDLA 4EKYA 4ENWA 3WB9A 3WGZA 5GINE 2RH5A 4KUHA 3SJBA 4IDBA 4A9AA 2VYFA 1OZAA 4IKOA 3KT3A 1W44A 4LWQA 1HE2A 3RIEA 2O3QA 3IS3A 3ME5A 3RHFA 2QRVB 1N0HA 1ZPDA 3KHTA 1I2MA 4UDOA 4EUEA 3ORSA 5CFLA 5L7WA 1KPGA 5EESA 3H8VA 1BW9B 2BELA 3BXEA 4YRQA 1W75A 4IMJB 4F1KA 5IF9A 1OR8A 1OT3A 4YI3A 4S05A 2WPNA 5JZOA 2IGTA 2OXEA 4B4KA 2XVZA 2IWRA 1VQ1A 2CDBA 4ETMA 2B8JA 3WWEA 1J0AA 5CFNA 4TYQA 4CQNA 3WBKA 4FYVA 2X8LA 1TVKA 3VVLA 1RBYA 4IFEA 4A8PA 3GRUA 1JEEA 1KFBB 4PYNA 5EWLB 5EY5B 3RC3A 2VVTA 5SV2A 3WQHA 1HNZB 3AWDA 3IKJA 2VI5A 4MIOA 2AD1A 1W4BA 4N7BA 2CLKB 2WFMA 1IY9A 3A8TA 4BNJA 5LZ2A 1U0OC 2Q62A 1P7ZA 1EG7A 4L4UA 3PX3A 4LE1A 3VXKA 5DYGA 3EF0A 1V11A 3E5RA 2EFDB 3DAOA 2BKAA 1M1YA 2DR0A 2HF2A 2IJGX 2R6DA 4BYGA 5DULA 1MR3F 2KMLA 5IAAA 4QDZA 4XARA 3UAZA 4X92A 1E94E 2GYYA 3S2UA 4Z4EA 2G17A 3DL0A 5IVHA 1K3FA 2JD0A 3I4FA 2G9VA 2EX1A 5DNEA 3ZXUB 3G23A 1NHWA 2O3UA 6ABPA 1J00A 4TYMA 3IR5A 2EZ9A 3TWOA 3HLYA 4L22A 3QW4B 2H63A 4CT0A 2OHFA 1I9CA 5L45A 3ES9A 3O7WA 3PSAA 3A2LA 4UNPA 4B3TB 4AJ9A 1YQXA 3TSWA 3GLKA 1Q95A 1LDMA 3JQAA 4AZ3A 2NO7A 3UO8B 1YRHA 4M8KA 4N5DA 5BURA 4ZTUB 1DZ3A 3U4IA 1Z45A 4WZZA 1F8YA 2C5FA 3H7AA 5EZSA 4R9UC 2OV2A 3QPAA 4XXHA 2PD3A 3GWZA 3FDJA 1T4CA 2C8VA 4HNTA 1UWCA 3H16A 3R9IA 2GXAA 4TWAA 1L4YA 4EJ6A 4BVJA 5A4JA 2FA9A 2XNKA 5HWSA 1OZHA 1O1YA 4H7PA 4A0RA 4XRGA 4KV9A 5ALTA 4G8BA 2OD2A 4Q18A 5BNFA 3K8OE 3RK4A 1S5PA 4XSVA 3GLHB 4PFJA 2FH5B 3QY0A 1U1FA 3ODPA 4CT5A 3KYDB 5IABA 3ADBA 4PWZA 1G21A 2Y77A 3KB1A 3LLVA 1PU2A 2GVZC 1W29A 3EPKA 1QZ3A 3GRPA 2HY7A 2EHJA 4Y1RA 1D4FA 1QHYA 1XNGA 2MINA 3H2HA 3OOEA 2EZ4A 4GBJA 2JIDA 4IIDA 4AL4A 1JEQB 2NO6A 3W5CA 4DQXA 1E9EA 3CRW1 1K27A 1PWYE 4MWEA 1T0UA 2WIGA 1DKLA 3U37A 2CY0A 2R8XA 1YUBA 1JAXA 1DMRA 1WCYA 1VTKA 3AKCA 4LWOA 3CJQA 2HJSA 4JELA 4DZRA 1VXRA 2QD2A 5KVAA 2QE7A 2VNAA 3WHKA 3WRWA 1Y1RA 3R3XA 3VYVA 1XA4A 1L5LA 1NJFA 1W76A 1VMDA 5DX1A 1V7PC 4V24A 1TZKA 3VPCA 3CUWA 3FLBA 3WNQA 1Q0RA 3HU1A 3KELA 4R2HA 3EGIA 4Q12A 4RV5A 4YRLA 5AK6A 1ZK2A 4YJHA 3RSLA 5JMTA 3Q8MA 5DCWA 2H8GA 1YKSA 2OHIA 4W7SA 4YRDA 3SDZA 2J3LA 4QXPA 1Q50A 1RC0A 4BB6A 4HV4A 3GEGA 5HQJA 1KI9A 4CLRB 3T3OA 2AL7A 4M0EA 1L4EA 2VDOB 4WNAB 4JUCA 4CM9D 1HE5A 1JG7A 1PR6A 2E2WA 3HFSA 4GYWA 1H1LB 1VKRA 3ZVLA 1EQAA 3HWSA 1NI4A 1V7ZA 1YC2A 1IN5A 3E6AA 1AKYA 1UMKA 1IAVA 2O0JA 4DJEC 4E3ZA 2W71A 4IX1A 3LUDA 4M7PA 1DXQA 2VHXA 4II3A 1W59A 3K20A 4EDHA 1MQ8B 2EGHA 3PD7A 3A6FA 3EHEA 1K68A 4V03A 2VO1A 3H83A 4XGQA 4BB0A 3KJIA 1DO8A 4G67A 4UE6A 5TXGA 3ZWYA 3EUEA 1MPXA 2FEWB 4RQTA 3ZNPA 5EHZA 2QVXX 4K2HA 1M2EA 2IFTA 2VHJA 4R1TA 3T7DA 3U3OA 5KAMA 4CDGA 1VJDA 2G67A 4RDXA 1PQUA 1IMOA 1CTQA 4OM7A 3AETA 2X8JA 3C97A 4U2DA 5GVRA 1XJCA 3QF4B 5D3MB 3NYRA 3LBAA 1CE8A 2WWIA 4M3NA 4EKIA 3OPXA 3GH1A 1E9AA 3EASA 3EVTA 3I3SR 4LSZA 2NV6A 4F1WA 3U3JA 2Q7XA 5ERXA 1A69A 1NPTO 4KO8A 4B17A 2ON6A 1HDXA 5CX4A 2BHSA 5CR9A 2NAPA 2IWHA 5CCEA 4WOPA 3RWMB 1FVFA 2VTDA 3PR1A 2RGUA 3DCYA 3L1HA 1DV2A 2PZBA 4UU8A 4EHNA 3EFEA 1OASA 3U7GA 1Q7GA 4ESVA 5TMDA 2PX3A 4YIKA 1NQUA 1EWTA 5KMGA 3VI4B 4J2OA 4CF6A 5A4FS 1UJ4A 3PFGA 5DU2A 1I6LA 3IXQA 4KRYA 4X54A 3STYA 2ZTVA 2H0QA 4ER5A 4HNSA 4OFWA 3V8MA 4R1SA 3TZ6A 4OSPA 2YASA 1MO3A 3QUSA 1Q57A 1MB2A 1P9RA 1J99A 1TF5A 1WHTB 3MFQA 5AXCA 4QYSA 3R4VA 1NBIA 4YUWA 3IPXA 4LWZA 4L8YA 1NJSA 1N2JA 4R9SA 3R7WB 1TKRA 4CL0A 1QNFA 4URUR 1G8AA 2EP5A 3S1LA 9ATCA 4JK3A 2JLXA 4NONA 3PK0A 4BIIA 3W79A 3GZNA 3DXXA 3T95A 1DWPA 3T06B 4TTAA 1KK1A 2IE8A 2ZIFA 4C5CA 3GJ4A 3JY6A 3HBMA 3OU6A 4I50F 4JQSA 4XH9B 2OENG 4XR4A 1RIIA 1JR3E 4LGVA 5LBUA 4N6OA 5JAZA 3EVAA 4GO1A 5H70A 3O8OB 3EZFA 1SO8A 4FSDA 3V3TA 1IBMB 3MFYA 2QMQA 2H4XA 4Y2QA 5IF3A 2RH4A 2PU7A 3SYRA 3RFXA 1K4YA 2AW3A 3FIUA 1G5QA 5DN9A 3EVCA 3X1MA 2VDLB 2OCBA 1DP4A 3G68A 1MQ9A 2FFQA 4CEJA 2MMGA 4GR4A 5HKLA 1QH1A 2PXHA 1OBHA 5CU7A 5REQA 3RW9A 4DM7A 2LV8A 4G8JA 1T5DX 1LSOA 4LDZA 3WSTA 2UZIR 2Q45A 2YFQA 2YX1A 3HCFA 2HREA 1Y8RA 2G76A 3LUJA 1J24A 3O5AA 5KHOC 2Y1FA 1LH0A 2I6QA 1CFZA 2P6NA 2PZFA 4HEJA 3A1SA 2MU1A 4TWIA 4UEOA 5E2IA 3ELDA 4WOBA 2Y6VA 1IBLB 2Z8YM 4RJKA 2WHQA 4IWYA 4ZYWA 3UQZA 5DCYA 4CMKA 1I7QB 2QN3A 2WKQA 2X3FA 4NYMR 5ED4A 2HSJA 2ZIEA 4DRZA 5JVDA 3ICOA 1A5TA 2IHJA 4WUVA 4RC9A 4GKKB 4YRMA 3D6JA 1TQ8A 2YVUA 4EPVA 4MOWA 2PBFA 2C2ZA 1N9GB 3IPYA 4FWBA 2HCTA 4YRTA 1DX9A 3V4PB 3B3AA 2WD8A 1TLTA 4K86A 4TLBA 1CQIB 4ENPA 1ATIA 1H5UA 1WR8A 3DG9A 3DMTC 1RIFA 2HNKA 4BNKA 4NCIA 1UJ2A 3WY9A 4HDCA 5HR5A 2G06A 2M6SA 2XQJA 4C22A 2O2JA 4OJQA 4F85A 1XPRA 1DKQA 2B83A 4YROA 1L5FA 1GRVA 2PAAA 5DH9A 4X84A 1M72A 4DMCA 4QM6A 5FOTA 1GNPA 3KJEA 3SX2A 3NHBA 2ZZMA 4XDHA 1N6KA 3MT0A 3OI7A 3OEEA 1OA0A 1ZW6A 4JMPA 3KFLA 4UTZA 4I4TA 4KQCA 5C4MA 5CT4A 5B2ZA 2HU2A 3G88A 1RJGA 3H3FA 5EWMA 3S81A 2BSQA 1I1NA 1SIWA 1YB2A 3T7JA 1TC2A 4DVJA 3AHCA 5LOVA 1Y8AA 2WWVD 4DW8A 5I4CA 2CVHA 3T5CA 4AJLA 2BEUB 4AY5A 3EAGA 1DV1A 2B3TA 3A26A 4INPA 3WQBA 3RASA 4ZGWA 3EGXB 2B0JA 3OLXA 1TXGA 4RPKA 2BAGA 3GLIA 1BA2A 1QC5A 2H5IA 3NEYA 3ZD8A 5LMCA 2VQFB 1LDNA 5K3BA 3NVKI 4MSUA 2A9OA 3NC0C 3UJDA 4OGKA 2GDZA 1Z33A 1X9HA 3NXSA 4I55F 2FRXA 1EK5A 4YMWA 1NUSA 1VIDA 1P5FA 2CLEB 2BW0A 2MSDB 5H83A 2IH5A 3AI2A 4PXYA 5AW5A 4CIAA 1UMDA 1BU5A 1JFRA 3ED1A 2BLNA 4LE2A 3MTGA 4LXYA 5FPYA 3ZJUA 1V1MB 3KM0A 3NJRA 2YZ7A 4HEQA 4YRZA 4FBMA 1LVHA 4FLFA 3RB8A 3UT6A 2W2TA 2EQ5A 2HCFA 3AB8A 5DTJA 3H5NA 3E05A 3WOVA 1G20E 1IBRA 5A71A 1CZHA 1J5PA 3UJHA 1JYSA 3SSAA 1PT5A 5A7HA 1IY8A 2YIJA 3WE7A 1RRPA 1GUYA 3IO3A 4G1EB 2JCGA 2YHIA 4PCLA 1XRNA 3ZWMA 4QPDA 1EFCA 2JLAA 3UPDA 5KX5A 1SUWA 1EPUA 1HL3A 3SHOA 1XZLA 1CY8A 1G7CA 1I0ZA 1TC1A 2CJXA 2EKQA 2HSDA 3E5HA 3I52A 2RHWA 4TMKA 2QP4A 2WJ6A 3ZU3A 1TPYA 3KALA 3W7BA 4TMWA 1EB8A 5FR2A 3T5TA 2VJLA 3ZIDA 5EIXA 5JISA 3L41A 4IICA 2Z1MA 3E5NA 3P8ZA 4QSHA 2R44A 3ORQA 3EAFA 4MAAA 2XT0A 1ZJ4A 2QLJA 3L7KA 4RTMA 3MJRA 4R8RA 2GF0A 4HDKA 4A8JB 1KDZA 1FFXA 5BYAA 4XLTA 5C3MA 5JS7A 5KQPA 3KAQA 3A6GA 5KYWB 3LUPA 4XSHA 3M3HA 3I6ZA 4MNTA 5B3LA 1V8OA 4UDNA 1O0BA 2V7QD 1R15A 3S7TA 1XDSA 4FD2A 4H15A 4AS3A 2ZANA 4F45A 2WTBA 4X95A 5IHPA 2JFVA 4PGAA 4QRIA 2FQYA 2IL1A 2QVCA 3ZV6A 3W04A 1BQ3A 1ZSNA 4GVLA 4NBKA 2OECA 5DLQC 4G1BA 1OGJA 2H2DA 2AG8A 1AVTA 1YB7A 3CVJA 3LDUA 2Q4RA 1TCVA 4KWEA 4LRUA 3IUSA 5EMKA 3TJRA 3IEPA 3H7IA 1C0LA 1HMYA 1KK0A 2C77A 3LVBA 4FI3C 2OEPA 3ZH9B 1V9CA 3Q2OA 1LJLA 2UZ0A 3VGJA 4H7FA 5AHRA 3JRNA 1KI4A 4BV3A 1FRFS 1JU9A 1NVWQ 1NWCA 3DSRA 1XCLA 1ESDA 1NY5A 1ZD8A 3DEKA 4FOLA 4FZ5A 3PNBA 5KJCA 4AU1A 5A4IS 1J2JA 4N3BA 4MI3A 2RGWA 2Q2NA 2FMKA 3HYRA 5GV7A 5F2NA 3S8MA 3W77A 1ZLYA 2ZBPA 2GN4A 2GZAA 5CPFA 3RU3A 3VU0A 4EY3A 1E2BA 4NZYA 3KUCA 1N2CB 3MSCA 4BQRA 4DLPA 3GJ0A 2F4VB 1LF5A 4KXQA 3UAVA 1ZR4A 3F98A 1G0OA 3H2IA 3TQSA 2O07A 5KSWB 4RJIA 3WRXC 1SFRA 2Q2QA 4AY3A 3FUWA 3LT0A 5CFRA 4HVLA 1WF3A 3I37X 4P08A 1X8LA 4MIYA 3AF1A 5GTDA 4L4ZA 5EIBD 2I2FA 2EW8A 3ER9A 1J70A 1P19A 2W11A 4IRXA 2FFRA 3OZBA 1P39A 2I1LA 1B8UA 1NPDA 3D2AA 1II0A 1NGSA 3ZJ4A 1RVV1 1RZRA 1EAMA 3M8KA 2XAUA 3DLHA 3THXB 1IH8A 5AI6A 2X7HA 2ZWMA 5AK0A 1C1YA 1F3OA 5DM2A 1KH3A 3QI7A 5DHFA 5G4LA 3C98A 3RS0A 4DCJA 3GRKA 1WB6A 4K8RB 5FWNA 3E53A 1C9YA 1XTRA 2CSXA 2GBIA 2Q21A 1UH5A 2YRWA 4HH1A 4PR3A 4X1OA 5DJ5A 4F60A 3BJMA 5K0CA 5KTMA 3UAOA 4MP8A 1YE3A 1BVUA 1GPYA 4BMPB 5KNLA 3HPQA 3OMLA 4HK4A 2GWRA 4NY1A 1JVSA 4DJDC 1XTKA 4NOLA 2FSSA 3QEBZ 4C4TA 3C7TA 5JWRA 3OFND 4JL8A 4J4HA 1B26A 1FX0B 3ANNA 3WK9A 2GLTA 2Z2IA 2NYVA 1C3EA 3R74A 5ECYA 2FN4A 4FNMA 4J7UA 3OZCA 4FFPA 4L8GA 4P38A 1D09A 4K3VA 2B30A 2XGMA 1RPNA 2O57A 3ZWCA 4F7WA 4C2TA 1O5OA 4TYPA 4YUZA 4XUDA 4RLSA 3HCCA 5J4HA 1QE3A 3EZXA 5C7IO 3MWDA 4XWKA 5AM3A 2HXGA 4ZREA 2VHVA 5C5DA 4CZ2A 4LMPA 4TZ0A 1QONA 2Y1DA 4RVGA 1JPNA 3FNFA 3HBLA 1A27A 2I7VA 1PD0A 3AHIA 3I83A 3PEVA 4XX0B 4BVEA 2GPYA 3EDYA 1R0KA 1CULC 4DBLC 3ABZA 3MWJA 4QBTA 5HBGA 1VLLA 2CJWB 3Q3GE 3HL0A 4WDQA 3KZMA 1TT5B 4Q66C 3BRWA 5E7IA 4DDMA 2JL1A 4XB1A 4OCZA 2CL5A 2H00A 4Z9AA 5LU9A 3T4EA 3UGKA 5JY6A 1OREA 3D7LA 1D04A 2XCLA 4O4IA 1QTNA 1A9QA 3A1VA 4GLOA 4J0KA 4JVOA 4MTLA 1KDYA 3U4AA 3JZDA 1QHSA 4B3MB 1A2BA 1Q7RA 4LOLA 1DKNA 4DMRA 5JCJA 1WLSA 4LYYA 5K3AA 2J41A 3BXPA 5CEFA 3ZQ4A 1ZAYA 5CG2A 2X9QA 3JXEA 4Q15A 3D0RA 1ITZA 3AVTA 3DNMA 4HGNA 1Q7TA 2O5VA 3AR6A 4C3OB 1MEOA 1OH6A 4CEHA 1KSHA 1E9DA 4KV7A 2IUSA 3BWVA 2H48A 4ZMBA 1P1FA 4GIBA 4RJJA 1MIOA 3LYLA 3VYRB 1X9GA 2AVDA 3PT9A 3FRJA 4BEJA 3HB0A 4O02B 1VCOA 1YI1A 1B2RA 2DAPA 1EP3B 3IAM6 4CM8A 1ECBA 1T1SA 3CPHA 4HJRA 4LRXA 4M21A 3VZSA 1UJBA 2IKQA 3IDQA 4BN0A 3OCYA 3UMVA 2JAHA 3WLNA 5KOHA 5DPMA 3U6BA 2WWGA 1DFGA 5D5HA 3RVDA 4DUYB 3CO0S 5ERGB 3ZK7A 4PFQA 1QSGA 2PJDA 3P9CA 4XDGA 1KI2A 1J8DA 3W0LB 2DEUA 2X5JO 1SD1A 1SD2A 1ZG3A 4GBMA 3L49A 2DKNA 2NTEA 1ZH6A 5H3CA 5P21A 3I5YA 2QX9A 1ZVMA 1FNCA 4JB0A 1XHEA 4JD5A 4JWTA 4L95C 4MCAA 1NZJA 3RFUA 3QHQA 3PUYA 1SKYE 4JC5A 4TN1A 1DCKA 4FHCA 3ZQ6A 4KXMA 1R10A 4YQZA 1EP1B 4O2BB 3CRVA 5ALDA 3KETA 2QG9A 1EI9A 4LMBA 3QWHA 2NM0A 4AZSA 4DLKA 5H3LA 3LUHA 4YRSA 1Z74A 4QQRA 2C2WA 2XUFA 3PENA 2W37A 4JU8A 2A9VA 3C5CA 4Z53A 2ZWAA 1NW6A 1SRRA 1O4VA 2A7XA 3EGEA 3EWAA 4NQZA 1Z4NA 3FUUA 4QOGA 3DW1X 5I9MA 3BRQA 1WNTA 3KCQA 1OX5A 3G49A 5FH9A 1U8UA 2AYYA 1TU3A 2ID9A 3OM1A 2IEYA 3LSYA 4O08A 1DIRA 3O4GA 1L8AA 4EGJA 3DBVO 3U0VA 4AF7A 2HA7A 3EQ2A 4JGGA 4IMPA 4L0MA 4XFJA 3ETNA 4P83A 2C04A 2CFIA 4UMFA 3AIMA 1G4HA 3BSFA 5GGXA 4DJJA 2ERXA 1VFPA 2HR1A 4C1BA 1Z18A 3SHQA 2FWRA 3BE8A 3OT1B 5AOVA 1OKKA 4NS1A 5HVNA 4MAMA 3MB5A 2WF7A 2X13A 4EYOA 4MW9A 3CRQA 4PG6A 3JALB 4L3OA 2E4ZA 4OQZA 3F4LA 2I7XA 3DBOB 3B7GA 4I19A 4CODB 2VNKA 5KDDA 1ECCA 1ETHA 2FW8A 3E81A 3BGDA 1NJGA 1MAVA 3PF9A 2V1XA 4LNUA 4H7DA 1R0WA 1NYLA 2QKYA 3KR1A 1VKZA 3A31A 5EZYF 1XZKA 4CR8A 1UPXA 2VXCA 4X7BA 4QYMA 4U6QA 4K0RA 2DVMA 1XZPA 2SICE 4C3UA 2WTMA 4QUEA 3TTXA 5KNDD 4N6NA 1ES9A 1B0UA 2A88A 3FVTA 1WB9A 1YK1A 4I81A 2ZBUA 4MDYA 1SOMA 5J4YA 5K0SA 2LIVA 5BY2A 3E4CA 4Q3CA 3UHPA 3JAWB 1NW8A 3ROEA 2LUOA 2RAUA 3RVRA 3N0TA 1JXQA 4K6HA 3UANA 1P60A 4DKXA 2FW9A 3SIXA 1J0BA 3NHSA 2VOEA 3CW2A 1WB5A 2SECE 3O9VA 4H7KA 3PFFA 4JU9A 4Y2UA 5J40A 4AUNA 1Y9DA 4ZDIA 3BWYA 3QFRA 2J7PA 3PQ3A 2B34A 5LLDA 3BWBA 3CH7A 2BV3A 3ABSB 1RXYA 2X8AA 1SUEA 3RC1A 3VO2A 4CM3A 1VXOA 3C39A 1ARZA 2LP4Y 1Q12A 2QR5A 5JAMA 1PDWA 1SK8A 3SZLA 1QQAA 4CEIA 3BKXA 2C7GA 3IYLW 3PC6A 5EG5A 4EHAA 5JIBA 2ZTSA 4OU4A 4QU0A 1U2GA 4DXAA 5JDIC 3W2TA 1G18A 1PJCA 3SXJA 3ETHA 3BD8A 5I9TA 1XRRA 1E2EA 3Q3JB 4WA7A 5BN5B 3QW2A 2D7JA 4PN3A 1TM4E 2NT4A 3MIIA 4XFKA 1T0HB 2XKJE 3ZDDA 2VDWA 2X3UA 1FUUA 4RD1A 3GPCA 3ZY6A 1AMOA 2DF8A 2HC9A 2H2HA 4WK6A 4E46A 2X5KO 3GB9A 1UPFA 1VIYA 3GA7A 2BN4A 3QUCA 4RGBA 5JNRA 3A9UA 3R5TA 3S28A 1N75A 3GGDA 5KKCA 1CRWG 4A91A 4YMIA 3CFYA 3O6VA 5KYXA 2N42A 1W0JD 4G09A 3O4VA 1BIFA 3AESB 4FLEA 3RTGA 4BQOA 4YXWD 1RMYA 1M2OB 1QHXA 1Y9JA 3LPMA 4TT3D 3GK3A 5JPCA 3NT5A 3T8YA 4BKPA 1Z88A 4FTWA 4DTCA 4KDFA 2XDQA 5H5JA 4OQLA 3MUEA 5JSYA 3SXUA 4WBSA 1VKOA 1SCKA 1T91A 1W5EA 5BOSA 2UZ1A 3G9XA 3F6YA 3NHKA 2GXSA 4BVLA 4CE6A 1EA7A 5BNWA 1Y7LA 5JD6A 4F4FA 3MQ2A 3EDOA 1F0NA 3LT1A 1FFEA 1CBUA 1N3LA 3BCRA 3CZRA 1HTBA 1GT91 1OYYA 3VO9A 2WIFA 3RANA 3WGHA 3C5VA 4NDNE 2WYVA 1PFQA 3H1AA 1JT9A 1Z6XA 1R0RE 3TR6A 1UC9A 4O33A 5T67A 3ZHRA 4RH1A 1P5HA 4PFKA 5CXSA 3TNDA 3W8NA 1VCHA 1VC2A 3W5VA 3G6KA 2C5AA 4NAVA 2EL9A 3D3NA 5P8WA 3KTAA 1AK9A 5SZKB 4KN6A 3LO5A 3SHWA 4OU5A 3A2KA 2IOQA 2PWAA 1CR1A 3HPRA 2F64A 5IBPA 3QVXA 1RAEA 2ZI5A 4EVQA 2XGOA 3X1JA 4BASA 4K28A 4DWOA 2BM9A 2A4MA 3DAPA 4UXHA 3E7DA 3HVJA 4UHKA 1N5DA 1Z08A 3ITNA 4N5NA 4B84A 4B9AA 4BNYA 1BGWA 2HBQA 2JLSA 4EY4A 3HR7A 2C5LA 1ZFNA 1BWRA 5JJIA 4FB5A 1SQSA 2IXGA 4M0MA 3TYXA 4GZ5A 2AFIA 4CLDA 1LC0A 1FQWA 4DCOA 2XMDA 4EZEA 3ONWA 5AH0A 3SWWA 4JASB 1K9SA 2ESRA 4W5RA 3HGMA 2IYRA 2CHFA 3K73O 5JJKA 1H8HD 2E7ZA 3QE4A 5JALA 1YI8A 1ZKDA 4Q1AA 2NVUB 2GAOA 3M1AA 1WXIA 1Y81A 3I28A 4P3NA 4RCZA 4Y7DA 4YMHA 1SZCA 4K81B 4CN8A 2PGIA 2QRHA 5G0SA 1DTWB 2H17A 3ZWXA 3H9GA 4F4HA 3M33A 2IK8A 4UQOA 2L82A 3ZE9A 2HHCA 1XXHE 2C7QA 1FP7A 2VDKB 4ENUA 1RXEA 2QMOA 2QUAA 4JJIA 4BKQA 3DB1A 1IMJA 3DEHA 2XSZD 4XCXA 1OOEA 2HQOA 3F4KA 4LKOA 4DEVA 5K8UA 1OBFO 4GXRA 3JCZA 4IUCS 1DCMA 3DV9A 3L1KA 5H0IA 4M37A 3RYCB 4TKMA 2GHRA 2NACA 4CQMA 2BR4A 5JMPA 3W5UA 3SVLA 4LI3X 4X71A 1IXKA 4DARA 3KDAA 3IQIX 1MA3A 3O95A 3ICVA 1EQ2A 1UM8A 4RY0A 4ZARA 3VA7A 1I14A 3WLJA 2PVSA 3PEYA 5FFFA 3OA0A 2JDIA 1XCMA 1QFMA 4JLKA 4KACA 4QGAA 2VF8A 3A4LA 1XI2A 3KQWA 4XVQA 3UFXA 4J9UE 1T9GR 5CRIA 2H85A 2AKAB 3HZZA 3BHMA 4M9RA 4OGLA 1NVVQ 2R0QC 3F4BA 3R3JA 4GWLA 3M5CA 3EXHB 3FH0A 5F77A 3N2EA 1HYQA 3IUQA 4D9CA 4D56A 1TIKA 5EWJA 3TLGB 3F8WA 4KN5A 4TM7A 2BM8A 2FSFA 3OM9A 4WGGA 3FGZA 4BDSA 1FUEA 3P0JA 4QTUB 5BR1A 1Z2EA 2VUHB 2WHYA 3TEJA 2WUEA 4LXTA 1C1DA 3JVDA 2HZ7A 5DBEX 1NRXA 3T7TA 3H97A 5FWXB 2OFWA 4Q47A 2HRBA 3O7MA 4KRGA 1ORIA 1C3XA 4LQCA 2XKKA 2J3EA 2EFCB 3WGVA 4X91A 4DUZB 4DG5A 3JQ8B 3MCUA 4PHFA 2A0WA 3D6UA 3GEPA 3JD1A 2PO7A 4JSRA 3CBGA 3C6ZA 1G7SA 1GJRA 5HKKD 4TKUA 4C4ZA 3VNUA 2WYHA 1QKKA 2I29A 5BQ3A 5KC9A 3FMGA 3L8HA 3CEAA 2YS6A 1K1EA 2GN6A 2Y0BA 3DMRA 2NNLD 2AK2A 4RMHA 3Q7EA 4WNCA 5E8JA 4AYWA 3A11A 2GXQA 3D6TB 2XTZA 1Z3IX 2Z5FA 4Q1DA 3AV3A 2XB2A 4DDHA 1HX7A 1JKJB 1X2BA 4IHQA 3M5PA 2UU9B 3IJRA 3HVKA 3PG5A 1T9DA 3MLBA 2QTTA 4UREA 1N0WA 4Y2YA 3KHKA 2YWGA 3DLCA 3O8DA 4M7WA 4CLEA 5AVQA 1XKXA 4BQNA 2QAIA 3W4KA 5G4KA 1K6XA 3L92A 4B3CA 2B9EA 2Z9DA 4MICA 2ZK7A 1UBGA 4NPHA 4MKGA 4HI0E 5CLQA 3QG1A 3VR4D 4UQPA 2CXRA 1M34B 1OU0A 3CZAA 3NTUA 4RETA 5J1TB 1D9ZA 5AI5A 4L8LA 1XX6A 4FFBB 4BPRA 3OPVA 1PK7A 2QRZA 3FKJA 3R20A 3B2NA 1KZGB 4U4AA 4S04A 1TUGA 1NXTA 1FNNA 4Q00A 4YJ3F 1HF3A 2ADOA 3GEMA 3W8RA 2OOSA 3V6MA 1JTVA 2IHZA 4EWLA 2IZOA 4YNBA 4EPRA 5IVDA 2QTRA 1EEHA 3ZY5A 4CCYA 1GZ5A 1VMAA 3MGGA 4PLYA 5ALKA 5MN4A 3QH4A 4ZHSA 5CW2A 5LD2C 4Y6OA 1ZRNA 2RH9B 3AP2A 5A03A 3IIEA 1M1UA 1ULUA 4QICA 5LDGA 5LP6C 4EY5A 4ZIRB 1BO6A 3JQFA 3PKJA 3C3CA 2OA0A 2A59A 5IT0A 1PZEA 2BRUC 2ZJAA 4FFSA 1EFVA 4MVXA 4RHTA 2CDRA 3FHCB 5TV2A 3TAUA 4F8YA 1MF7A 4E2XA 4CMGA 5KSOA 1OTXA 3TCNA 5F23A 1AS0A 5BMOA 1FFHA 4WAUA 3BZUA 1C5KA 4H6XA 3AJ8A 5ALSA 3IBTA 3KQNA 1WSWA 1MENA 1XU4A 5ALLA 1A9TA 1QGDA 2X9VA 1G8YA 3F3SA 2JIBA 1EUDA 3KAJA 4BFLA 4WLEA 3UHAA 2MWMA 2QMEA 2CNBA 5I4KA 2DQKA 4LS3A 4CI0B 1MTOA 1AGPA 4GZ3A 1NBEA 4GEGA 4O6VA 4TT8A 3EBPA 1MXFA 4OMCA 4P36A 5MN5A 4ZK6A 4MYRA 4Z0NA 4E13A 1BD3A 1DQSA 1NXPA 5FF9A 3U61B 2ZAOA 4V0SA 5AXDA 2UYOA 3MTIA 3ZDFA 4DSTA 4W6QA 1QFSA 3FLAA 4ARUA 4DDVA 2C4TA 3VO8A 1PZNA 4YCMA 2XCQA 3KPYA 1NUPA 4MH0R 2XA2A 5EI5A 2XUIA 1R0ZA 4J1SA 1QHNA 5CCXA 2XWSA 2F67A 1YVRA 3G7NA 3Q1KA 3EIWA 4XB6B 3N5CA 2B5WA 2OKCA 3T41A 3AEKB 3OQOA 2QLMA 3UQYS 2E6KA 5BQ5A 1UJCA 2V6IA 1M2JA 1WXXA 5AKIA 4V3BA 2XOKA 5DN6D 3NNNA 1AUQA 1RKXA 3GO4A 4MVJM 5IYZA 3WTCA 4MROA 3IE0A 2PL5A 2XVAA 3MW8A 4Q4DA 2WHPA 5IUKC 1Z5VA 5BQPA 4BNHA 4YLYA 1MW9X 3A05A 1TJ4A 5FI1B 4N48A 5FV7A 1OFHA 3LPCA 4DHWA 5CA1F 4RTSA 1ZJ6A 1KYXA 4FEGA 4KXWA 4EFDA 1JUDA 1UBMS 2K2WA 2WFAA 2DRIA 1HE8B 3DOJA 3NATA 1U6JA 2HPZA 4LX0A 4RK6A 3T1NA 3QKUA 1KMIY 1LA2A 4GXTA 2DWOA 2R6GA 1NQXA 2VSQA 3PEEA 4WOJA 4Y6LA 3SC2A 1N6PA 1LQTA 1EDZA 2ZE7A 4Y2XA 2VLIA 3DO5A 3IAS1 1CQWA 4NH0A 4F2PA 2B2CA 3RRBA 4G1VA 4TMZA 4AICA 3L0YA 4YXFA 2JJMA 1I5EA 2ZITA 4Q93A 3WYCA 4UZEA 4NMWA 3GFPA 2H5LA 4EQ6B 5AW7A 4R8LA 3DVAA 4WESA 4ZCQA 5HF8A 421PA 3ET4A 1GGVA 3LUFA 3KV3O 4BV2A 2DLCX 1SHUX 3I9FA 2JNWA 2EARA 1P17A 2CXHA 3O8LA 4AI6A 1VHTA 2C0QA 3EMDA 4G2TA 4LOHA 3GJTA 3WFJA 4QPPA 5C1PA 1EFDN 3DA8A 3PDWA 1T25A 3FMFA 4MLCA 4R2XA 1SIBE 5FL3A 3X1YA 5CB0A 5JDCA 1DOAA 4FUQA 2ZIAA 5H80A 4MRRA 2DUNA 4H6PA 4DC0A 3MWFA 1LBSA 1CEEA 4OYLA 2EATA 3ZD9A 4QTTB 1C8BA 3FZGA 1LUAA 1NWHA 7REQA 3KJZA 1IEWA 3LS2A 4LG1A 2K5UA 3E3OA 4LXQA 1KZ6A 2O0HA 5EGNA 16PKA 1VG0B 4LTNA 4REQA 3CLRD 3AX6A 3MC1A 3TQHA 4ZU6X 4PFSA 1P8JA 3K7EA 3AM4A 3GRZA 3HV2A 5K3FA 3Q8LA 1H23A 1ZJYA 1T0PA 1KGSA 3ETLA 3G0OA 3UEOA 1RT9A 2I87A 3FI0A 2X0EA 4Z1MD 4R5MA 4R8SA 2FRDC 3QG5A 1CVIA 2VXYA 1ZIDA 4R2KA 1NURA 1T8PA 4A03A 5C53B 3OSUA 2MSWA 1M0SA 1WBBA 3GCWA 3I62A 1ZITA 1I8TA 1QYWA 5G0WA 4RBNA 3CISA 4I50B 2ACKA 1ORRA 2PMDA 1FRQA 3L1UA 1BVHA 3QVTA 4AKIA 3CV3A 4EG1A 2HIMA 1MG0A 4V1CA 1DJQA 5C52B 4YCSA 2D1YA 3DMYA 1T29A 3HEBA 2ZJZA 1KAGA 2VK2A 5LQUA 2RJOA 3DPIA 1RYFA 2VHTA 3IUNA 1IFXA 1M6VB 3HFJA 1VDZA 1VYUA 3EN0A 3KZCA 1S7CA 4L3VA 5KINB 4E70A 2HMYB 3EIXA 1RYHA 3GUHA 1M54A 2HDNB 3IOMA 1WDWB 2E82A 5I3CA 5FHQA 3JATB 4UVEA 4E07A 1L3BA 1QQ7A 5EP4A 2D1QA 4NCHA 1WDMA 2HTFA 2I22A 3SD7A 3R75A 3TFQA 2Q99A 4FU0A 4D9JA 4ZOCA 4KR9A 2RGNA 5C5EA 1WPRA 1T3GA 2PGAA 3EXG1 1SG6A 4HHEA 2IEDA 2ZYDA 4OHRA 2IQ5A 1EE1A 3BS4A 4D8XA 1T1GA 5BWMA 3N0XA 1KEVA 2JPDA 2JLUA 4TQ9A 3RYFA 4C0KA 5ICEA 5JQWA 4MUFA 3PD1A 1OXKB 3PZRA 4QDKA 4JX8A 1UBFA 3L7MA 4M8SA 2HGSA 2X5NA 3DCNA 5ICFA 4D4JA 2AFHE 2WFLB 1SUAA 4QATA 1FU7A 2B3DA 2W22A 2YWHA 2GH1A 3QXSA 1RPAA 4FS8A 5ALPA 5AUNB 1KK3A 2BFNA 3ZCTA 2PX6A 5AHXA 3W90A 3L7LA 4NU5A 5KYYB 3ADCA 4TWJA 2A94A 2V4ZA 4BWVA 2NUAB 4BJ5A 2AJDA 4EHJA 3OECA 2WUFA 4NDAA 2YXEA 1NW5A 4EI2A 4DN6A 2MT9A 2EKBA 4A6XA 2PUEA 1KXZA 3M9XA 4RH0A 1H2EA 1CUZA 4BZWA 4Q24A 3B1XA 1M8PA 1JAZA 1RQLA 2YV4A 2ZR7A 1KIMA 3BHNA 2JIOA 3N74A 3QE3A 1AC5A 5K1ZA 1I3OA 4N12A 5JANA 2Z56A 1ZI9A 3QEOA 1Y34E 4G1CA 4I6JA 3W2HA 2Z98A 1DAKA 3SVTA 1LLDA 2AMFA 1PJSA 2OK7A 3F5QA 4G0NA 3JQAD 4CHTA 5JRDS 2XECA 2ZRCA 4BNIA 2YY7A 4TLAA 2WG1A 5TQ0A 5CNKA 3ET5A 4K03A 1S2OA 1FMLA 3SEZA 2GCOA 3ETDA 5EFZA 4PHTA 3WI7A 2J0SA 2PNFA 5LQCA 1GADO 1K7SN 4L5AA 1G3RA 2QAJA 4JV5B 5CAEB 2A0YA 2W2OA 2HFKA 3QU4A 2WUGA 3FDFA 2VKQA 3A9VA 4LTMA 3SYTA 4FYIA 1PR3A 4EYGA 1R6DA 4I9NA 1E9RA 3RG2A 1DBSA 4DCMA 2VTVA 2XE4A 3GLUA 1BXGA 3IV7A 4GDMA 4L6AA 5EJIA 5HIIA 2QT9A 3T5BA 4RCYA 1IZZA 4HSGA 5IJ9A 3QX9A 4AJ2A 4H0CA 4GL2A 4IINA 1SXJE 1ZZEA 5KYKA 3CLHA 5EMNA 1G6HA 5TS2A 1LBHA 3PUHA 3K6RA 3CZPA 2HBRA 5JUWA 4RV4A 3C6QA 1UOQA 1LFDB 5BWOA 4A36A 3ND8A 1R0SA 2Q9UA 2Q49A 2REBA 3FYHA 3TDNA 2JLBA 3FBWA 4ZEVA 2QY6A 4V0KA 3B6EA 2NUTA 4EUHA 5AW8A 1YCGA 2VF5X 3M6IA 1USIA 2PMFA 3TZLA 1UKBA 1OU4A 4N3CA 3RVOA 3FHOA 1U3WA 1A0OA 2WMNB 3PCTA 1VSTA 4XJTA 4YJKA 2GBPA 1KEKA 2QE7D 1GD1O 1QP7A 1LEHA 1OXXK 4P92A 4FCVA 1TUIA 1TEVA 5JY1A 2JGAA 1KZYC 1LPSA 2GUGA 4B6FA 4B8ZA 3SKVA 1FNBA 2QQEA 1BG6A 3DFIA 1GN9A 3HI6A 4CTMA 4S35A 3LIPA 1FYFA 3IP1A 1Z7WA 3V8QA 3WMXA 1RLJA 4EW3A 3DBHA 1MVLA 2IUEA 5D87A 2CYBA 4QLAA 3BJIC 4QPCA 1KRWA 4KJZA 3WAJA 1IB0A 4WLNA 4I4IA 4JC0A 4ZVPA 4C7VA 1TVCA 2CXUA 2NXWA 1Z7GA 4ZXPA 3NUGA 4PZPA 3Q8XB 3R0XA 1ADCA 1U98A 2BP7A 3FFAA 2GEBA 1D07A 2G08A 5TVKA 2V7VA 5JBQA 1SVKA 1U0HC 3DUFA 1WZEA 4RDCA 3USES 3ZV5A 3LL7A 1FJHA 1BEUB 2OO5A 1JH8A 4CKYA 2ZI3A 1UP6A 1JG1A 2AI3A 3GLGA 1J39A 1DX6A 2QTBA 3L7BA 1FFBA 2QSYA 4KQIA 3TVTA 1JSRA 2GTPA 1P2UA 3KYCB 3R41A 4MDEA 4OTZA 3ND9A 3Q8KA 2XWJI 2PZMA 3BZBA 4K88A 4MVJF 4TRNA 3ZDCA 1Y80A 4IDOA 4ITRC 3F2IA 4QEKA 3DHWC 4LHYA 2QG4A 3IEIA 2QNIA 2ZI7A 1Z56C 5LZ9A 1CUUA 3QMPA 1GUDA 5JYCA 1YZKA 4DNOA 2IS4A 2BGMA 4B8YA 3RVNA 2WKRA 3M3PA 1LCIA 1L7MA 3L01A 4EA8A 2F6RA 2W93A 2CL0X 3GJXC 2DWPA 3ZDZB 4WKBA 4CKCA 1QG2A 3F7OA 1DKOA 3HM2A 3PQCA 2YWXA 1NU8A 4HWGA 3GQBB 1ISFA 1WW2A 3DE5X 4JP8A 3HY6A 2VAXA 2H4HA 5I8ZA 3ROPA 4V0NA 2ZWIA 3LUGA 3QFSA 3S1AB 1OAOA 1QF9A 1JILA 2WUWE 2A30A 4NEGA 1E1KA 2J45A 3QP9A 1HT2E 1T6YA 1TTHA 2DBVO 3UOAB 2DE0X 2QIOA 3ZLUA 3S3TA 1E4EA 3OOJA 4JT2A 1R8JA 3IP9A 2C4NA 1PRYA 2D13A 2H18A 4LHXA 4KO3S 1X1EA 2OQRA 3DHYA 2FZ5A 2VT2A 4B4DA 5AHWA 4GNRA 2GEVA 4DNQA 8GPBA 3H8WA 3N7UA 3X2FA 2ZI6A 1SVOA 1X6VA 4D74A 3ICEA 4KREA 4MDFA 2HWUA 2BDUA 1U7ZA 1J20A 1JAIA 1IG3A 2JFWA 3B3GA 4MCIA 5HDQA 821PA 4K1XA 4TVSA 4JQCA 1QF6A 1R6VA 3HJUA 4HAZA 5M7EA 3NCHA 1EUZA 4FD3A 1HDIA 1YI0A 2OGTA 3FETA 3KQTA 2UVQA 3W7AA 1ZCFA 3NV7A 5IKPA 1RADA 1WF6A 2P2SA 3EGOA 5GM2A 5A6SB 3H5VA 3O3OB 2ASVA 2I1QA 3T3NA 2W2PA 3C3WA 5BYJA 2IXBA 4CUZA 2JI6A 4WFIA 2FLWA 1B4DA 3ZZNA 1CJKC 1YU9A 1D6MA 1O97D 5GMOA 2UKDA 5UKDA 4WZAB 3K6KA 1BEZA 1GTVA 4IZ6A 3EDQA 2XCUA 3FUVA 1ILWA 4NV0A 3AILA 3L82B 2GHIA 1UP7A 2DC1A 3PYXA 4DSUA 2NQTA 3PNYA 4LC1A 1YMUA 3N2GB 3O3NB 2XNSA 2RSLA 1UFOA 2W2KA 3ONDA 3QFCA 4LYHA 1KO5A 1YMVA 3GIWA 3IVAA 2WQZA 3WLLA 5LSAA 3G5MA 2CL6X 3MWGA 1K8QA 2LGJA 3GNTA 4DLYA 4ZXFA 4ZZ1A 5F7OA 4NCKA 1Q0QA 1P7CA 2XKBA 4KE8A 1H1DA 2VBFA 4RMGA 4E22A 1YDWA 1OFVA 4LV5B 3ZHBA 4Y1FA 1RQNA 3QVWA 3PFIA 4IQFA 2QK4A 1AGYA 4ZYVA 2NAFA 3LMKA 3UVEA 1TLFA 3GT7A 3M4YA 1Z0AA 1XNRB 5HIJA 4D8VA 2HAEA 3NIDB 1C7EA 3RC2A 5BXYA 4YFYA 4D0GA 3DMDA 4NU8X 2YRFA 2TS1A 1BGXT 2EJBA 2YY5A 4ZOLF 3VYTB 5M5BA 4M0DA 1ZC4A 3BH0A 3GT0A 1GM5A 5DXFA 5G02A 4EF4A 4WDRA 1WUJS 1MX5A 3QA3E 2W43A 3NPMA 4URWR 5JAHA 3IURA 2QRJA 1FF9A 1IBCA 3D8UA 4TV9A 1ZXBA 1OJLA 2OZLB 4W7HA 4YRJA 2WUVA 2XVMA 4EW1A 2GVNA 5GADl 3UWKA 2VSOA 1ZVVA 1D2RA 1X7XA 1U5BB 1TZJA 5IK2A 1NDQA 1U0LA 1JJAA 3QEMB 3NTOA 2MJLA 2O0KA 5ALFA 3KOUA 3K0HA 1GRNA 3P71T 5FO0A 3HHPA 3OEED 1XD8A 2LXNA 4N47A 1YR9A 1UIMA 4II2A 5CLIA 4E6EA 1KAQA 3CZCA 2YFYA 3Q5EA 3UK7A 1LWNA 2QUBA 1VCMA 4CG2A 1O58A 1QLHA 2V8BA 2IDJA 5J4VA 2V5UA 2X2EA 3BZWA 4CFSA 2C57A 4IJQA 4MMXB 5HILA 1P4HA 1RYBA 1WSAA 3PUVA 4LZOA 2JAXA 4XIIA 3RJMA 2Q50A 2EFEB 1P2VA 2GEKA 1QIGA 4L74A 2WJAA 1UBKS 1XVAA 2J09A 2OHOA 3DDWA 1F6DA 2VDUE 3N59A 3PHHA 5A06A 2W2LA 3LL4A 4RFVA 4YGYA 4CTNA 3H6KA 2ZBQA 1N2BA 2A78A 4YWJA 2PQ2A 3VBEA 4AJIA 2Y93A 4YONB 1CZRA 2HJHA 2ILTA 1NJ6A 5LNK6 1GAXA 1F4VA 1SU6A 3DT9A 1QRDA 1D2HA 3R0VA 4OHKA 3PVSA 4RGYA 1RS0A 2WJWA 5LA6A 5KTSA 4UVDA 2I9KA 2D2VA 3NIBA 1APBA 3O90A 1CJTC 1NNI1 1K06A 2Z4TA 3WIOA 1HRDA 1V5GA 5EGSA 1M1NA 2VT3A 1OFUX 3GA0A 2ZETA 1HOXA 3P19A 2O52A 3DW3X 5CVJA 1H0SA 2YH2A 2AQIA 2JF0A 3DZDA 4NYIR 4P7GA 1NXWA 1C3OB 1YZQA 1LNSA 1GZ4A 2FZWA 4GM4A 3U44A 1KMHA 4OQMA 4D41A 2V3WA 4I5FA 3I9NA 4CM4B 4MKXA 4EZIA 3ESXA 4CG0A 6NULA 4Z7OB 2CXNA 1ZA1A 3ZEIA 4MZXA 4WZBE 3KUUA 3NLLA 4D4IA 1QS0B 2ATIA 4M88A 3M6XA 2XYQA 4NZ9A 3TKLA 3IA2A 1LPBB 3G59A 4TX1A 5TPZA 4POOA 3CUSA 5KVQA 4YUVA 3KQUA 1TZCA 2R6R1 4Q9HA 1YZLA 4ER0A 2EG5A 4ZFNA 4YCLA 3FWYA 3LYHA 5EN4A 4X20A 3A4TA 4PINA 3UJ3X 3OJCA 3G2LA 1E2UA 3WLHA 3MS4A 3JQ9C 4KI7A 2BMWA 3IDZA 4C76A 1XYYA 3IOYA 1CKEA 4GOMD 2FW6A 3SS9X 1XCJA 4CMEC 5EJGA 2W2VA 2OFOA 5HKBA 4M98A 2CE2X 4B6GA 2QUHA 2YUIA 4TKVA 2OY0A 4DG8A 1CS4C 5A7GA 2YJ4A 3DWGA 3NW9A 3KTDA 3HGTA 3N76A 3FLMA 4HAUA 1S8OA 2C96A 3CYFA 2VXOA 3K32A 1JSZA 2C54A 1KMCA 4ENVA 3EULA 4DQKA 2XEXA 4IDFA 2CFSA 1M6HA 3NTLA 4UM8B 4YRIA 5EZYB 1TEZA 4GSKA 1TKCA 1DC3A 4OGGA 4GZMA 3K6SB 1N2XA 2ZRJA 1W88B 4GICA 3JASB 3I4LA 2G83A 5HF5A 5IWAB 2BGKA 3AI1A 3JWHA 5BSVA 2ST1A 1YF3A 1MP0A 1UC5B 1EFRA 2E37A 3BMOA 3RRMA 1ZNYA 3TVDA 8ADHA 2O8FA 5E4YA 5C32A 1CUCA 1IUOA 1FLAA 3DFFA 2GJ4A 2EYQA 2JGDA 3L0ZA 4QFMA 1YB6A 1RM4A 5CD9A 3TGWA 1Y33E 3DF7A 2IH2A 1BCRB 3Q40A 4UU0A 1LV8A 4NE9A 4ZYYA 1RE0A 3UAYA 3VKHA 5FCDA 2IZ1A 4YJGA 2Q29A 1YR2A 2JLCA 1QZUA 2PKQP 3BF7A 3X3HA 2ZJ6A 5LQNA