4D97A

Salmonella typhimurium d-cysteine desulfhydrase with d-ser bound at active site
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
328
structure length
327
Chain Sequence
MPLHHLTRFPRLEFIGAPTPLEYLPRLSDYLGREIYIKRDDVTPIAMGGNLRKLEFLVADALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLDLFNTQIEMCDALTDPDAQLQTLATRIEAQGFRPYVIPVGGSSALGAMGYVESALEIAQQCEEVVGLSSVVVASGSAGTHAGLAVGLEHLMPDVELIGVTVSRSVAEQKPKVIALQQAIAGQLALTATADIHLWDDYFAPGYGVPNDAGMEAVKLLASLEGVLLDPVYTGKAMAGLIDGISQKRFNDDGPILFIHTGGAPALFAYHPHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mutational Studies on Substrate Specificity and Catalysis of Salmonella typhimurium D-Cysteine Desulfhydrase.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords D-cysteine desulfhydrase
total genus 121
structure length 327
sequence length 328
chains with identical sequence B, C, D
ec nomenclature ec 4.4.1.15: D-cysteine desulfhydrase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d97A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d97A02
1KFJB 1WBJB 2CLIB 4QYSA 5DW0A 1C29B 1KFBB 3R0XA 5BW6B 1J0BA 3RR2A 4L3VA 2DH5A 2J9ZB 2CLFB 3X43A 1TZJA 2TYSB 3PC3A 4PCUA 2V03A 4JBNA 2WSYB 5D84A 3FCAA 1RQXA 3L6BA 5CGQB 1Y7LA 4D8WA 5I7AA 2CLEB 3L6RA 2BHTA 1KFEB 2BHSA 2GN1A 4KKXB 5B3AA 5IWCA 3L6CA 1VE5A 5I7OA 4NEGA 2C2BA 2TSYB 2TRSB 5IXJA 1TJPB 1BKSB 1KFCB 2C2GA 2ZR8A 1K8YB 2CLMB 5I7HA 4OREX 3T4PA 1VE1A 4HN4B 1K7XB 4D92A 5JJCA 1Z7WA 2ISQA 1TZ2A 2ZPUA 3DWGA 1WDWB 1VB3A 1BEUB 1FUYB 4NU8X 4XUGB 5D86A 4LI3X 5I7WA 4D9IA 1CX9B 5D87A 4JBLA 5B1HA 2JC3A 2CLHB 4LMBA 4AIRA 2ECOA 4D97A 1TZMA 3AEYA 4IL5A 3TBHA 4D9MA 5CVCA 1TTQB 4D9EA 2CLLB 4ZU1X 4HT3B 4D9BA 5JISA 5HBGA 3ZEIA 4ZU6X 1UBSB 1FCJA 1V8ZA 3PC2A 5B1IA 2RH9B 1UINA 5B53A 1C9DB 3IQHX 1QOPB 4COOA 1KL7A 1X1QA 1TDJA 2ECQA 2ZSJA 5DW3A 3V7NA 3IAUA 2EFYA 2DH6A 5J5VA 1TZKA 4F4FA 2J9YB 1JBQA 3DKIA 4AECA 1A5AB 3R0ZA 5IW8A 1J0EA 5I7RA 5KINB 3PR2B 1WTCA 2CLOB 4I1YA 1PWHA 3VC3A 1KFKB 3CEPB 2O2JA 3PC4A 1K8ZB 1D6SA 1WKVA 4OFXA 1K7EB 4Y6GB 5D85A 2O2EA 4D9NA 4D9GA 2RKBA 3BM5A 1Z7YA 3SS7X 4D99A 1TTPB 1OASA 3HMKA 4D96A 4HPJB 4L28A 5DBHX 4D9KA 5T6MA 5DVZA 3AEXA 5E0KB 1C8VB 1A5SB 1PWEA 2PQMA 1K3UB 2Q3BA 3IQIX 1O58A 3FGPA 1E5XA 4D9FA 2D1FA 1TYZA 3VSCA 4D8UA 1J0DA 1A50B 4ZQCB 1UIMA 5KZMB 4L27A 4LMAA 1J0CA 3DWIA 2Q3DA 5B36A 5J43A 1F2DA 2Q3CA 2RHGB 4H27A 4L0DA 3SPXA 4D8TA 1P5JA 2CLKB 1K7FB 3VBEA 1M54A 3X44A 1V71A 3SS9X 1V7CA 2GN0A 3IQGX 2J9XB 5EY5B 1J0AA 1CW2B 3VSDA 1QOQB 4HPXB 5DBEX 2EGUA 3VSAA 4WX2B 1A5BB 5C3UA 4HO1X 5B55A 2GN2A 5I6DA 4D9CA 1K8XB
chains in the Genus database with same CATH superfamily
1RJEA 3HVHA 3UJAA 3UXEA 4YV1A 5FBWB 3E9EA 1QDLB 3DM9B 1XZEA 2EWMA 4L73A 3T3HA 3DBHA 3AY6A 1ABEA 1N33B 3U4GA 1D4FA 4ESHA 2A7QA 3HZZA 3VTAA 4PLVA 4Q1FA 5FKJA 3GRAA 4FT2A 1G3RA 5GZ3A 6AT1A 2FRDA 1UPAA 3H2KA 1LSOA 1AMUA 3C7DB 2HDNB 3RYFB 4KWTA 3W2FA 1WJGA 1ZHOA 2Y77A 2QVGA 1NE7A 4KUHA 1CC1S 3Q7IA 4LJLA 3SEQA 1QPZA 5COAA 3ND9A 1PR3A 2AFIB 2V6BA 3PHBE 4KR0A 3M6MD 1RKVA 3GUHA 4Y2QA 4MGZR 4P4SB 4EG1A 2J41A 5KOHA 2D1SA 4W63A 2GFIA 3MCWA 1ISRA 4WLNA 4XCVA 3K16A 1ZN8A 2ZANA 4GT1A 1NW5A 3ZXYA 2C7BA 3DPIA 2X7JA 5BNZA 1MIHA 2BR3A 4HDNA 2R0QC 4HRAA 4IVNA 1UQUA 1HFWA 1NJ2A 2H63A 4YJ3B 3WK6A 1PSZA 3RFVA 1RAEA 4F2PA 1Z12A 2A7XA 1V1RA 4YJFA 3NMUF 4H1VA 2CDCA 4RELA 3A9VA 3FMVA 4KG7A 3R7WA 1SFRA 3H0CA 4J4HA 1G6OA 5KSWB 2ZDQA 4YRIA 2BOVA 4U6SA 4KMRA 3C8HA 2A9FA 3KQTA 4MW9A 2YX1A 5BNIA 1SC1A 1W76A 3PC2A 3P9SA 3WQHA 3ID6C 3EPLA 1ES9A 2A5DA 2ZZMA 1IDOA 5EQJB 4B3CA 2R96A 1T2VA 4XDYA 3JQ7B 1UWLA 3GYBA 4HMQA 3QKWA 4QM7A 3TOVA 1JWLA 1HQDA 2JIZD 3MIIA 1I94B 5EJ2A 1HO3A 1U0LA 1VSTA 2WHQA 2ZREA 5KNCD 1JZSA 1AS3A 4BX9A 1NP7A 5KPJA 2HA5A 4MJ7A 3A2LA 3ZE7A 3NDIA 3D3QA 4LJAA 2QZ9A 1KARA 3OZBA 1Y5NA 2OXRA 4M9XA 1KTVA 2EG5A 1YUMA 3O8OB 1N5LA 3PRYA 4FC6A 4Z0TA 3VC2A 3D81A 3K94A 2QW0X 1ILEA 4Z0NA 2ZI7A 3LCJA 4R3UC 5CXUA 3ANXA 4CW7A 3CMCO 2IW3A 4MW7A 3HQ4O 1XRLA 3F9CA 4OLJA 1XN4A 5KYUA 5FOWA 3VDMA 5IUJC 1H8ED 2WVGA 1V16B 2HPAA 2HRCA 1QVZA 3GZJA 3RVPA 5C80A 2OAP1 4YT8A 2EBWA 3IUJA 1JALA 1G20B 1LRKA 1LBIA 1Z2NX 4HDRA 3CX4A 3ANTA 3ILYA 1M1YB 5KYYB 2XXJA 3NIWA 5DEIA 4DA7A 1UMBA 3HABA 3AHIA 1JEOA 3IE2A 4LA4A 3A4LA 2C61A 3B53X 4WZAA 2XGMA 2Z43A 1KYTA 2CXNA 2W6ID 3MBIA 4N49A 2JFGA 2CV2A 1DAMA 2ZB2A 1VMEA 1P5JA 4H3SA 1IPEA 4MDHA 4MWSA 4B34A 5IASA 1E3IA 3HL0A 1DEKA 2VP9A 3L3BA 3NIGB 3LRXA 1DV2A 1H8HD 4KMOA 3TR6A 1Z2AA 3GLGE 3CZMA 3BL5A 1N3BA 2B2CA 2K87A 3SEZA 5HG0A 4CFSA 2XI4A 3ONNA 1NA5A 3KPUA 3WIBA 2FRDC 4M0MA 1K7CA 5CBPB 3Q3HA 4OU4A 1JHDA 3ETHA 4NVRA 5KX5A 4BNNA 1Q1AA 1OF1A 1FDOA 3UMRA 2JHFA 1YFZA 3SXUA 2X0DA 1WB9A 2FF5A 3I39X 2X0FA 4QZVA 4BGIA 2BEJA 3U1VA 2HNKA 1Z38A 3KHSA 2QNRA 3FY4A 4O4HA 5D00A 3TRFA 1TFUA 3CNHA 3A10A 2XUHA 3D3WA 5EIBD 1FYXA 1QIHA 2EU8A 5CFMA 1SRRA 2GN1A 1T43A 2VBIA 2YHBA 2ZU6A 5AJHA 5TF0A 4H35A 4EQZA 1T91A 1U28C 4K6CA 2I67A 1BU5A 1KQGA 2P0AA 5PGMA 4ZHQF 1HDZA 3A1NA 2W48A 2ZEJA 2J0UB 1WSWA 3I6ZA 1SKYB 3IHWA 4P5PA 4LKRA 4ZOCA 4BNLA 3GA5A 1GAQA 2B5WA 3HCOA 2PWAA 1AQ6A 3DP9A 1KMHA 3TD2A 1JYSA 2HN9A 3WKDA 5DH9A 4BHTA 1QNFA 5HCUA 3EY4A 5HUHA 1CULC 4RIHA 3DZBA 3ZWVA 1XQWA 3TKYA 4ND4A 5ESWA 3O6VA 5DGHA 1GGEA 2ZJFA 4EHIA 1F5NA 1MAAA 2C59A 2CLHB 2ZRPA 1MPXA 3EXEB 3GFTA 3I1JA 5HGJA 3GR6A 3NM5A 5IJ9A 1DC6A 3AUJB 3DYBA 5IXSA 2DKFA 2PPLA 1T26A 2PSHA 3LQYA 3LX8A 3MWFA 3MTDA 3I52A 1I5OA 2EVWX 3I2HA 1H1DA 3OPYA 2VP6A 1PG2A 2EP7A 2VVTA 1YA6A 3QBEA 2ODWA 4ZDIA 4W9MC 3HCFA 1KL7A 5CXSA 4I1OA 2ZSJA 3WSWA 2A92A 1OU4A 3SR4A 1SKAA 4F5EA 5CT6A 2G67A 4ZT4A 4P4LA 1XDSA 5CYOA 3U48A 4HDAA 2PMKA 3OD1A 5IJZA 2WW8A 3DC7A 4PC1A 5EOVA 3V42A 5BQXA 2NNLD 2PK3A 1AUPA 2OMEA 4ZYWA 1KSFX 5HIJA 2ZUDA 1DMSA 2WHRA 2ZGVA 3BEDA 3VC1A 2HR1A 1QIDA 4QPJC 4D9NA 1NG1A 1E9RA 3V8QA 5LDDC 4H7JA 3K09C 3NNSA 4N3NA 3LTEA 3HC7A 4MJ3A 4KNVA 4DIKA 3MGBA 5E3IA 2J4CA 1OASA 4F60A 1S2IA 1WZCA 2AJLI 2WLTA 3HA7A 1DKNA 4IRMA 4H60A 3WLIA 4DIEA 1E0KA 4RXTA 2W9XA 3KXPA 1Y8QA 1KYXA 1OLSB 3SBXA 5HCIA 2IEBA 1KJNA 2OHHA 1LBHA 4H4EA 4HNSA 4YLEA 1ZK1A 5A6SB 3ROGA 1IOVA 1NPYA 2NXJA 1TYZA 2Q0SA 3N7UA 2G6TA 3NVDA 2QR5A 4JH0A 1FLNA 1RM0A 3KUCA 4L5BA 4RSRA 2JFWA 3CLUD 4DF3A 5CBPA 1WSBA 3LUBA 3U09A 1B8VA 2OBLA 1YZVA 2W7TA 1H85A 1ULBA 3S3TA 4ZVMA 1V7QA 1W47A 4DKXA 1W35A 4X1IB 4F38A 2DGDA 4KACA 5B7QA 2UZ1A 2XTZA 1T9HA 1D0VA 3T1VA 1WDLA 1QUEA 2KWIA 4H7PA 4ZAWA 2X9QA 3B78A 3MWKA 4US0R 1LD3A 1T0BA 4HCJA 1G66A 1O6BA 1JEQA 3NHUA 1P77A 3JPYA 3UWPA 2DBVO 3OM1A 3BC1A 1Q0TA 2PL5A 4CIAA 2GZDA 1E6EA 4DBLE 4FS3A 4K9RA 1UBJS 2QMZA 3A26A 3IXLA 4K3UA 1WSDA 5BORA 1WBBA 2B9VA 2GSDA 2IS4A 2PZKA 3ZDDA 4FMCF 4HFJA 2PUDA 2JCSA 5E7JA 3QWHA 1N57A 3RGWS 1DAGA 1II0A 2NZJA 2Q7XA 2QG4A 3HYTA 4IDOA 5EXXA 3WDMA 3VHXA 1CS0B 4ZYUA 2GTHA 1B73A 2NO6A 4A8JC 5A4JA 5SZJA 3V1LA 4BMSA 4TRMA 1T2AA 2F1OA 2JEYA 3VU0A 3I58A 1DKUA 2YVQA 3OX1A 4NYMQ 1CY4A 1ZESA 2EYUA 3LKZA 2OGTA 3V6MA 3DMHA 3LRTA 2RGNC 3HA5A 3QGMA 2ZIZA 3O4GA 3P8ZA 1EXVA 2VI5A 1G18A 3NC4A 3W77A 3X1YA 3DDCA 4NENB 3IR6A 4AD8A 1FTSA 4PC2A 1UBFA 4ARUA 5B3JA 4PO8A 2G5PA 2IY7A 4JB2A 5E2AA 1I7NA 1GYRA 4YP9A 5JCPA 3K0SA 3AVVA 2NUAB 2BSXA 2XUFA 1JAYA 3ZDEA 1SIOA 4TSRA 4XR4A 4CT5A 3MMXA 2YRFA 1QYIA 1ZINA 3VO2A 4DCOA 1BE8A 2A6PA 2YZ7A 3FZYA 2FX2A 3C3PA 3R4CA 4UMVA 2ZJBA 4UU1A 4JAVC 3RJMA 3TE6A 1Z56C 1XDWA 2VJAA 1CUFA 1HL7A 3IIEA 3TBHA 1K6MA 1WHSB 1K2VN 4IHJB 3W7VA 3S81A 2W4QA 3UAGA 3PQ4A 1QGYA 4QRDA 4CTOA 2BH2A 2LIPA 1YMUA 4CM4B 3ZCVA 5K3AA 1E9BA 2XXAB 3D8HA 3EXIB 1X80B 1W94A 2RSLA 1RXEA 3PFGA 4L0QA 3RWOA 1C9KA 1P8JA 1D6NA 1PCXA 3KJHA 4H0NA 3QU2A 4K9DA 4BZQA 1WM1A 2UZAA 2R6DA 3PJDA 5HIKA 2GHIA 1L7QA 4RHCA 3IRUA 4G5RA 4PGAA 2I29A 1FRNA 4CVNA 4O4IF 4KH0A 3I5MA 3WZMA 3CNEA 4RU1A 3HZOA 3VGPA 3IIJA 4FJ1A 2OB1A 3HY3A 4BVKA 2ZRKA 3AB3A 1L8AA 3VRHA 2O7RA 3EPJA 1U31A 1WHTA 4D45A 3M4XA 1IY8A 1ZS9A 1HT3A 1UBHS 2QVBA 4RF5A 2O2GA 4UJ5A 4K05A 3WYAA 4BLUA 4YAUA 1P9RA 2JD2A 4A0RA 4NXMB 4QRIA 3UOGA 2YY5A 4XQ0A 2FEXA 1JG3A 1OWPA 4WK2B 3VR4H 4G0OA 1QHXA 1BQEA 4L28A 2HYIC 2QN9A 3SBEA 1RWWA 4KFSA 1XQ9A 4WLUA 3O2NA 1EUCB 4M0FA 1JR2A 3FUUA 2FWBA 2JA1A 2Z8ZA 3GNSA 3R5TA 1FDSA 1YOVA 4XM1A 5TPWB 4EPXA 1TCUA 3REQB 1SU6A 3UCEA 4ZD6A 4E46A 4WNAA 4X44A 2GBFA 4IMJB 1AGNA 3S55A 5LD2C 4BJ6A 4U7DA 5CD9A 3JAMA 4KWHA 4AZTA 4BS9A 3L4BA 1JQEA 1Y1KE 1JHQA 5CFQA 4H18A 1WEKA 5AJWA 3TJZA 3TZ6A 3PEYA 1J2EA 1VG1A 1WXQA 2V4MA 2VPQA 3D0QA 1Q3KA 4MH0R 3WJAA 1IWOA 4BV8A 4UZEA 1Z34A 3GCZA 1CLUA 1OX4B 3MFQA 4OB8A 2P68A 3LHKA 1XOIA 2BKLA 5C35A 3AXSA 1OT5A 1Y4DE 1I30A 1UL1X 2WQZA 1G8KA 3EA5A 3MJCA 5I9TA 3QFCA 3I04A 3OA0A 4LSGA 4FW8A 3BK1A 3ZI0A 1FF9A 3RSCA 1LFAA 1F0NA 2R44A 4L3VA 1JTFA 5BQFA 1C8LA 4FOLA 4UXJA 5KX5F 1DLJA 3IHLA 1P19A 1JV2B 1NJ1A 4NYIR 1XZFA 3JD3A 3TRIA 2HH9A 4HAOA 1B8PA 2H4FA 5ICFA 1YJXA 1QQAA 4Y2GA 4RF4A 2O5RA 1ZUIA 1CSEE 2VA9A 1T5IA 4N5DA 1RD4A 1B15A 2AJCA 2R7NA 2QE7D 3D4LA 2F8TA 5JZOA 1AE1A 1QU2A 3GDWA 1M7GA 3B8EA 4NG4A 1UJBA 4WZBA 4YDSA 1R88A 3ELUA 4WL0A 1E79D 1E6WA 1ZP6A 1T5SA 3C45A 1E5DA 3AT1A 5J63A 4JASB 2V1UA 1PGNA 2XYGA 2PU5A 1X3SA 3M8KA 1E99A 3AKYA 2ZW9A 1R6BX 3FLBA 4EFKA 5F76A 3MCZA 2BFBA 2CXOA 4B17A 1AB5A 3EFHA 5HZHA 1OTYA 4KQKA 1S4MA 4X1KB 3BE6A 4IWYA 5IVIA 2OHVA 2OO7A 1EVQA 2RHJA 1L4FA 2PZFA 3C4JA 3DZKA 4KP7A 3STXA 3AR9A 3P2MA 4JHXA 1MO3A 2D3TA 4PS1A 2BBSA 4JUBA 2PXAA 3QKUA 2C77A 3A1SA 3ADDA 1W25A 2Y4NA 5FI0B 5AESA 1W87A 5KQLA 3SN6A 3ZDAA 4U7FA 4D9HA 3IBSA 5C32A 4R8VA 1SOMA 5FTWA 2ZI5A 3KYDA 4AJEA 1AC5A 4D4HA 2PIAA 2VWQA 4LFBB 3M49A 2E55A 4HTAA 4JT4A 2FOIA 3WAJA 4BAGA 1ECFA 1IM2A 1N2CB 1YUNA 2GAFA 2FEOA 3CF2A 3DG9A 4IEFB 4DBLC 4RVNA 3WLFA 2GEFA 2CW5A 3L07A 4AN1A 2UXBB 2ZRFA 3L46A 1U0TA 3RS2A 1X3LA 1H8HA 2FPPA 4Q6WA 4Q4HB 4BWGA 5IT4A 4BJ3A 2OESA 4HZUA 2VK4A 2KSQA 1S3SA 2P5SA 5CGZA 5H0IA 1DQYA 3JVVA 2HPVA 3N2KA 3EARA 2G7ZA 4DSZA 1PDVA 3W5JA 3C15C 1PL0A 3HEMA 2IU6A 3SYTA 5I7VA 2OVFA 3TZQA 2VWPA 3HKDB 3K9NA 3ZXXA 1P7VA 4HQ0A 2AR9A 2PL9A 4PEVA 4C22A 3MN1A 1KQFA 4FYHA 4HADA 2WYHA 4K40A 1KH3A 4KE7A 1ZSVA 2C0CA 3KOZA 1BMFA 2NZ8A 2HQRA 2NPFA 5C7LO 3GLTA 1GSOA 5CVUA 4MGYR 4LMAA 3P5SA 4BIIA 1K08A 2AYZA 3L4KA 2UYQA 2PVSA 5KJFA 2EAUA 4G6ZA 3ELDA 1ND6A 1W36B 3PQDA 3PRKE 1DQPA 1Z07A 4RK1A 4W7IA 2R85A 2PKRA 2RK4A 5TARA 4CIYA 1J2UA 4L4ZA 3WLTA 3HJHA 4HPXB 2FW1A 3E7WA 3SQOA 4YQZA 1DWPA 2EERA 3CONA 3GJ6A 5DCWA 4RWEA 1IU9A 3V8PA 1I7DA 1DVRA 3HHEA 2H52A 1YD7A 2GPAA 1V96A 1K8XB 4MARA 4KO2S 2C4WA 4DXHA 1V4BA 4CFZA 4QOGA 3EA4A 4HR7A 1M2OA 4EG8A 4ENPA 5DK6A 5K09A 1YIDA 2O2DA 3MFYA 2VUSA 4IJ5A 3HXOA 3UJBA 4IQGA 1IJFA 5T64A 4DS3A 1D0IA 2LCFA 3CC8A 3I5YA 1QTQA 4L4UA 5FNVF 3UGTA 3ZWYA 2RI0A 1C9MA 2DCMA 3PPWA 5AXAA 1PX2A 3I9LA 1X1TA 1GTRA 2MYPA 4J3FA 1ORRA 2V7QD 4YQEA 3IEKA 1E5QA 4Z0HO 4BVEA 2YMLA 3P20A 3UPDA 5T4BA 1HOXA 4ZRNA 1VRWA 2QLLA 1MABB 1Q7BA 1JH8A 2H2FA 1ZOOA 4HUQA 4UM9B 3T9CA 1MBZA 1HMPA 1X74A 4V0MA 1L5RA 3GAMA 3JZFA 4QDUA 5HZMA 4F6RB 4LK3A 1C41A 1UDWA 3OD5A 4IIDA 2NG1A 3GZ4A 4M1QA 5KKNB 3KQVA 2W5UA 5AI6A 2CFRA 5BURA 3ELYA 3OC6A 4DV4B 1XZMA 3NFRA 3KPYA 5D5QA 3WKEA 2WVJA 4JXKA 4LTNA 3LZ6A 2VK2A 3FRHA 1PUJA 2D1QA 2JIBA 1IZ9A 4YACA 2RJ3A 4A2QA 2ZRQA 4HNVA 1CEQA 2QTVB 3R40A 3PDWA 4K03A 3VH2A 2CLLB 2OC9A 5GINE 4PTYA 3IKMB 5H5JA 5DHFA 3U6KA 2OTCA 3HUEA 2QROA 3JX9A 4RPHA 2I4OA 1DB3A 5E6RA 3DP7A 4KE6A 3WAKA 4HAXA 5T7BA 2C3YA 2F55A 1P75A 3CSDA 4M86A 2O8DA 2AIRA 2IZ1A 3ND6A 3IIIA 2KB0A 3PL1A 4NIMA 3TDMA 2CMKA 2CE2X 5BN5A 2OFPA 3QU9A 2ZRDA 5EQFA 5L7TA 1G5IA 1TZKA 2F1IA 3RT9A 1ZNZA 3H84A 2YQ5A 4O6VA 2WE7A 3MJEA 3D31A 4N39A 5LZ2A 4REQB 3QBVA 4B79A 1HX7A 5AW7A 4OHRA 2BI8A 3GPLA 2JGDA 2FK7A 3O91A 4HRXA 4NMLA 1K1EA 2QMYA 4BP1A 2P9ZA 3CH6A 3WADA 1UPCA 1N3IA 5L3SA 3S27A 4B45A 2GD6A 3UN1A 2DQ4A 5T41A 2B5OA 1GCUA 3DEAA 1K4KA 3AESA 1MCZA 1Q3HA 2V7XA 1BX3A 2QI9C 5C53B 1JQ5A 1ZUNA 4O4LB 1NFRA 3DOUA 1HGXA 1BS2A 4PFKA 5JW6A 5F2EA 2HTFA 1ARZA 4FZ3A 2Y92A 1IBKB 1A71A 1C2TA 3WGTA 1FNNA 2HT1A 1ZBQA 2NAPA 3B1JA 3F6BX 4Q7LA 3VNQA 2ZSKA 1X9GA 4RVUA 4MKGA 4RF3A 4MEBA 5TVGA 4TWAA 4HSEA 1KJWA 3GUVA 1H9BA 4PYQA 4X45A 4FS8A 4ND7A 1Q16A 2SHKA 1JHUA 3W7BA 1GKLA 4A6XA 2VKTA 2Z58A 3M4ZA 4FGUA 4HATA 4Y2JA 1P44A 5LL6P 1FMTA 3BZBA 1FFXB 3VR3A 2BZ0A 1VPDA 4YUZA 3H4MA 1DP4A 4HS9A 4D9CA 2QE6A 4X20A 1BKDR 2FP4A 2HT6A 4UBMA 3PGA1 2E2WA 1PW7A 2R25B 2R4TA 5FJIA 5GVRA 8MHTA 3BMCB 2FQ1A 1ZNYA 3DE5X 3IC5A 3QPUA 4RH0A 3SJUA 3FETA 4PXYA 2WF5A 4N5MA 1KQOA 3NASA 4KR7A 5IZ4A 1J9GA 1M34A 2PUJA 2W22A 2QTMA 1AN9A 1JW9B 3GLSA 1FRVA 4HAZA 4O2BB 4Q4LA 2JLZA 4JVLA 4ZI7F 5HGXA 3VYTB 2AR0A 3LGAA 4DTIA 4HUTA 1C4OA 4AYXA 2G9VA 3AQ4A 4YAOA 1KOJA 1MIOB 2MINB 5H4GA 3T38A 2Z57A 1DINA 4JOCA 4B85A 5A03A 4L5JA 4AAYA 1TQ6A 4D4JA 4E7OA 3JRXA 2ZDHA 3TSYA 4ZDWA 2ZIVB 4ER7A 5K3FA 4Q1VA 2QORA 3U37A 1IZ8A 3GN1A 1B16A 3H65A 3ICPA 4YFYA 1H0RA 3W3AD 2W58A 4YTEA 3RFTA 4AULA 4XEHA 1BS9A 1PWXA 1ZWLA 3UJPA 4CM3A 1M73E 3CLTC 3LCMA 1K89A 2FOXA 2VCEA 1RM4A 4G1VA 4C0SA 1WV1A 4YRFA 4MQEA 4CMIA 4FNAA 1UMDA 2MWMA 1JLSA 3E84A 1GA4A 3MD0A 3E27A 3QFTA 3V2GA 4ADSG 5CB6A 1JT2A 1HLDA 4YA6A 5DO9A 3RIHA 3QEAZ 2QLMA 1YB5A 2I6SA 2O5CA 4I1VA 3FGOA 4ZEWA 4AZ0B 1E2LA 1UKZA 3B82A 1ECCA 3ZDFA 2AZ4A 2HD4A 3FSEA 4CG0A 4NDAA 4Z54A 3CZ5A 1VA4A 3P96A 1R6UA 1MA3A 1UKAA 3TXAA 4BFVA 3QRWA 3A6LA 4DRYA 4TV8F 2NO9A 3L6DA 2QPTA 3VDNB 2JIQA 4GX1A 2EW2A 4WJKB 5E2BA 5B30A 2QSUA 4FGJA 1F7VA 3GRKA 3OLVA 4ZOLB 3M81A 2GAOA 5THKA 3QBTA 4RGVA 1RMYA 1PJLA 1S8NA 4QO8A 2C58A 5ERXA 2R8ZA 1YB1A 1E9VA 2C5AA 4KDCA 4RPKA 3UVEA 1YTUA 1X9HA 3VH1A 4O2BA 2AK2A 1X77A 3NJ4A 3HN6A 5H02A 4G0MA 1OZAA 3FKSD 1C30B 3DE2X 4Y2HA 2FG6C 5LCXA 3Q9LA 1JKMA 4Z2YA 1W1IA 2FLVA 4L0CA 1WVMA 3QE9Y 1LNZA 4Q3CA 1SXQA 3DLHA 4OHYA 3MLEA 4JN6B 5B7NA 2FP4B 3IDFA 3EA0A 3AR2A 3E9CA 4ZPJA 2ZE6A 4QUJA 3BA1A 3GFOA 3QEBZ 5IYZB 4TQGA 3NFYA 5TMBA 3O2JA 1G3QA 4G56A 4P4TA 2H5IA 5AW8A 1SZCA 5CB8A 4JYAB 1EBFA 4DCTA 2ZM5A 4IUBS 2PJUA 4U2EA 4F0JA 3G0HA 5DMXA 4F2DA 1FVHA 2II6A 4EVIA 3TLBA 2NM0A 2OT3B 4HVLA 1AS0A 3Q6NA 2J46A 5HKKD 1KYIA 2FZEA 3FFXA 1Z4KA 4H7HA 3RVNA 3EIEA 1RZUA 5IC6A 2GKGA 4V0NA 3NALA 1FQJA 1XHFA 3OUTA 1OT3A 1I1NA 1JVNA 1ZLYA 3AGPA 5E4FA 2F8LA 3QUTA 4KLZA 5K4GA 1AKEA 1N7GA 3F1LA 1DG1G 1HT1E 4MVJG 3AF6A 1X7XB 5IKXA 1T8UA 1MNAA 3HP1A 4UHKA 1XTSA 2X2EA 5HTKA 4JT8A 3E18A 1EFVB 5G0UA 1FRZA 3F5DA 3PJRA 1OJLA 1EFPA 2QTGA 5L3SB 1P4JA 2YV2A 5G0SA 3E9RA 4A7PA 5U9CA 5CB4A 3FWZA 2WJPA 1C0IA 4CLDA 2XJ9A 4UNRA 1HY3A 1NN0A 4RQUA 3DT8A 1NVKA 2I3BA 3EOZA 3KYCA 2OGWA 1S7GA 3BG5A 2ZZNA 1QV7A 1YDWA 4BCCA 2W37A 2IXBA 2HREA 1Z0JA 2R6R1 2GK6A 1XEAA 4X90A 1N77A 3ET4A 3S99A 3P71T 5CR9A 2WD8A 4EO9A 2PKQO 3SQLA 2JCVA 1CQJB 5KJCA 5F2KA 4WT7A 5JNLA 3C48A 2ZIUB 3FWPA 5SYAA 1QORA 4BMDA 2N42A 4L95C 1D8AA 2BKVA 4F91B 1Q19A 2OM2A 2QVCA 1COWD 5FUWA 1MN6A 1YU6A 2GB4A 3GUCA 2L42A 1A9QA 1IHUA 1T2EA 3WXBA 4HGOA 4II7A 4O1HA 1Z88A 1PK7A 2I54A 2YWXA 3DEYX 3RJZA 1NX9A 5I01A 1UDBA 1SHJA 1FS4A 1RPNA 1X1BA 1YJ8A 3R75A 2DB3A 4B6QA 1E1MA 2R84A 4XM2A 3DZDA 4L72A 3TLGB 1E7SA 2JCXA 3PDJA 2B8TA 1VDZA 3U3DA 4OY3A 4HFRA 4OP1A 3SD7A 3KOOA 4K0KB 1GKUB 4O0LA 5JT1A 2BFFB 2XLCA 1HFJA 1DKOA 3KJFA 1T4CA 1HBJA 2IYWA 3B60A 4QASA 5C5CA 1LBTA 3UMFA 1RAAA 1NTOA 5C51B 1N2IA 3L5KA 4FFVA 3INRA 1G6KA 4TLBA 2FPLA 4JQOA 2ZRNA 2WSSD 3SX4A 4ECEA 4JLVA 2ZWVA 2F17A 3LT5A 2B8WA 1STOA 2I1LA 3I12A 1UR5A 4FFNA 2O8CB 1NKSA 5DBHX 2NU9B 3BWDD 2AJTA 4DIMA 2QMEA 3WLPA 3GP3A 5DP2A 2FZLA 2J0SA 3JASB 3VBCA 1UCFA 1GG9A 2FPUA 3JYNA 5LBUA 3H1EA 3TI9A 1N8SA 4YMGA 2IOYA 5DLEA 3QNUA 4D8UA 1KIAA 4ZTBA 4IDGA 3OZXA 3CFYA 3T4UA 4ND5A 5MGNA 1BNCA 1C9YA 1ZYUA 2O3SA 4L9RA 2E4UA 4Q3KA 1HEUA 4HQNA 4B9AA 1OUMA 2DQYA 5ERYA 4JBWA 4RHFA 4DQDA 5GADl 3ZD8A 5KHAA 3V8MA 5ECWA 3TGWA 2YRXA 5BN3A 4QPPA 4MPTA 1Z2DA 3EQ7A 4LYDA 3ZQKA 5JO0A 2G5GX 3AYZB 4I2NA 2C5HA 3AVPA 4CLOB 4JXXA 3OOSA 4Z8YA 2NT4A 3CVUA 1F8GA 2PD6A 3EWAA 2IYEA 2V54A 3GDOA 3PZRA 2W2MA 4F46A 1RJGA 3NQ41 3BERA 1GARA 2GR9A 4GDMA 4JLMA 5TB5A 3UPTA 1KDRA 1KFJB 2XIQA 2O5VA 5CYFA 4HGPA 5CT5A 5EXSA 1Z22A 2PR7A 4U3JB 1U6KA 1FU7A 3RI3A 4AWAA 3L6OO 3KSDO 1W85B 2LXNA 3LYLA 3A4VA 1ENZA 1XROA 4D3XA 5FHRA 3ZCTA 3D4OA 4LBWA 3GJZA 1DC8A 4AP9A 4CZ2A 2IS2A 1G21B 3GARA 3TIFA 2FPKA 3PPXA 4LY9A 1KI2A 1QM5A 3G2PA 1HE1C 4KIWA 2JJ2A 4EPTA 1FNMA 1PL6A 2O4CA 2V4ZA 4WXEA 4OQFA 1TLTA 2BM8A 4MIEA 4X95A 3MGKA 1N0WA 1QQTA 1T10A 5ITSA 4LXGA 5AXCA 2JF0A 3LDAA 1PJCA 3TLEA 1YZUA 1VFPA 4HLNA 3VH3A 3GLRA 4C5CA 3RADC 2FZ5A 5AWFC 1M8GA 1FFAA 4MPPA 3ZWPA 4RACA 1GTVA 3L4SO 2MSCB 5HIMA 2Z4TA 2IELA 3ZR4B 4GRIA 1LBEA 2I22A 1EE9A 2FPWA 5LZ4A 4Q21A 3IR7A 4Y1GA 1PN3A 3D8NA 3EASA 1T29A 4NONA 1HE8B 1PZNA 3IKTA 3UF0A 2Q1SA 1OPXA 2X86A 2CK3D 3BE4A 3IRVA 4NESA 4RYDA 1JHPA 4BRUA 2FN8A 4GBED 5ITZB 3B3AA 2EEPA 4X84A 1X7HA 4C06A 2CL0X 3S1LA 1GP2A 3KXLA 1SXJB 5DLDA 3BJMA 1XWIA 3GJ7A 4NBUA 2Q5IA 5JSYA 1IBLB 2ZB8A 4PPQA 4TUYB 3BRSA 4FGLA 5DM2A 1R6AA 3IIMA 4II2A 5HJ2A 4G5GA 4C21A 2AT1A 5PNTA 5B4TA 4Y3UA 5JVDA 1SVOA 5L3QB 5JAMA 4WN3A 3ONEA 5LQKA 4KO3S 4M53A 2UYCA 5IW8A 4RJKA 3HK2A 5KHOC 4KQ2A 1A76A 1LFDB 1KBQA 1Z17A 3FCUB 1BXRA 3Q2IA 4GG1A 2Q49A 3V2IA 3ZK8A 5ECYA 1ZMOA 5FBHA 3LY5A 4G63A 3PSHA 5G1PA 3G88A 3IPLA 1J97A 3OQOA 5CEJA 3RWMB 1UM8A 2H1LA 1VPTA 3N1UA 3E9YA 1V5GA 4MRSA 1CY2A 2A0YA 1FX1A 1AURA 1DZ3A 1VMDA 3K1TA 1W29A 3ZY2A 5K6AC 4OQZA 1DBQA 2GFQA 1RT9A 3VX3A 3KD2A 4OM8A 2KI5A 2AMFA 2I9KA 1XKXA 4ZXFA 5HM6A 3MWEB 4KVGA 2BW0A 3QJYA 2P2GA 3VHLB 2Z6QA 4PANA 2VKQA 2BGUA 4HDSB 5INTA 3WKAA 3DXZA 3E82A 2Y1FA 2VUIB 1JSRA 2UV8A 4I81A 2EZ8A 2FR8C 1ZK2A 3ZGYA 3P9NA 4BFZA 1OW3B 4Y9TA 1IY2A 4TUYA 1P7ZA 2R1UA 3F1KA 4GC5A 3SHFA 3HBFA 4TRRA 1HFEL 3QKSA 4O2LA 3BMNB 3REQA 2W6IA 5FUVA 3BFPA 3VPSA 1W5TA 5ADVA 2BE7A 1M8KA 4WLEA 1Z4QA 3F3MA 5K7SA 1A8UA 3EW7A 1PJSA 1XU7A 2YHIB 2HXYA 4GUDA 3ESQA 4Y6RA 3NCHA 4ZARA 5BRNA 3TX2A 3LT1A 1U2GC 3FPGA 3O0TA 4AMYA 4F4IA 4S1VA 4FX2A 1KVQA 1P0FA 1EVEA 3FPEA 4S1OA 1XTJA 4RJJA 4Y67A 4IYJA 4X41A 4JJZA 4XSHA 1GG5A 4Y6PA 5DGCA 1V45E 2VRCA 4YYZA 3D4PA 4ZCRA 3TOSA 2W2LD 3AZQA 2GAJA 1M2EA 2CNBA 2ZB4A 1GTG1 2YJTD 4RKEA 1FVFA 4KXUA 5JXJA 2C5FA 1U7OA 2ORED 3KM0A 2AOTA 3MA0A 1GUFA 1MH1A 4G5HA 4ZT5A 3RRYA 4EY4A 3HCBA 3IBGA 4AUEA 3COVA 1O08A 2QN6A 4OTZA 1A8SA 1EQAA 1YRBA 1TUEA 1U7XA 1QLJA 4FKBA 1PR0A 3PKJA 1DAHA 4NK5A 3V8EA 4NOMA 4AROA 4FDLA 2FPRA 3LI2A 4Y30A 6CHYA 3WYEA 5EI5A 5IT0A 1RCUA 3V1MA 3WNBA 4DR4B 4IG4A 4Y1FA 2ZIAA 3OAAA 3ITDA 2I4MA 2BSQA 1EXNA 4BLVA 1RRPA 3CVJA 4OHKA 3SXJA 1SPXA 2BMDA 4GPIB 2VJDA 4IJMA 5CTJA 5JSKA 5A3QA 1E3JA 3GLHB 1B7GO 2JG3A 3LDFA 1NULA 2YJ3A 4IIBA 4A10A 3IP9A 4H16A 4DSOA 4UAUA 4LDJA 3VZBA 1INLA 2A59A 3MERA 2ZJ4A 1Z5ZA 3DXFA 1VGQA 5E8JA 4DC1A 1KSJA 3KB8A 2VQ3A 4L4SA 2Q07A 3SZGA 2B4RO 3CEMA 2NUAA 4Y9DA 3RKRA 3C3BA 2OLEA 2QQFA 5DTJA 1LI7A 3NRCA 1IB0A 4NENA 5DYGA 3TPCA 4BNHA 4MVJM 3CVXA 1CQZA 3AVXA 3Q7EA 2IYXA 2ZOSA 1LXCA 2Q3HA 3BWCA 4CIWA 2IH5A 3GGGA 3HKBB 4A73A 1EHIA 3ZWBA 3DEHA 1SWWA 4R8MA 3TKLA 2WKRA 3LQFA 3A36A 1ADGA 1ZHFA 5AW1A 1NVGA 2NU9A 4FMPA 4PZEA 3QW2A 8ATCA 4N65A 4D4MA 1VP9A 1J6UA 4NICA 3QY0A 3I2YX 1N0VC 1QQ6A 4P84A 4BNYA 1XE3A 4PYMA 2RGWA 3P9KA 4IH4A 4QJ3A 3OJOA 1WDMA 4BB0A 4AQ7A 3K9WA 5JSFA 1OHHA 5E95A 1QX3A 2Z3VA 3NUQA 4Q7KA 4GFDA 4PC6A 4EEXA 4RD6A 3ONDA 4KOEC 3UHJA 4BQPA 3D8SA 2CSXA 2C03A 2MSLA 4MS4B 2QUAA 4BE9A 5TC4A 5F4BA 4DR2B 2H07A 3A3OA 1WP9A 1U2DA 2C82A 3GMIA 3K4HA 2XUZA 4JT2A 3WQBA 4N6OA 5IVDA 1S7CA 2INGX 5A9SA 3LPNA 2R8YA 3K0CC 2RGBA 5A71A 2ZM6B 1H1LA 1TQHA 1J5PA 1XZNA 4EA7A 1NOJA 2WMOB 1D1PA 3FVRA 3RC9A 5KHLB 3KJQA 3PD7A 1GLGA 4ZQEA 2W6MA 1XDUA 1U8EA 1Z6XA 4A5SA 3UANA 1RWMA 2OWDA 4QUAA 4CM5A 1N8KA 3OCUA 4UW9A 5FLEX 1O5OA 4UQOA 2FMHA 1Z0DA 4KNYA 3LBIA 4LXYA 5JH7B 1LDEA 3PFNA 3D7MA 1Y8QB 1SBHA 3IT2A 4DV5B 1E3MA 1N0UA 4ENSA 5JU6A 3M4YA 1EKXA 1GKIA 2DBRA 2Z2ZA 3DZCA 3ZWCA 1OC4A 2C20A 1DUIA 2Q3MA 2AZXA 4LYFA 2P6OA 3R9XB 1AZTA 2ZSIA 4Q3BA 4MUNA 1KY4A 2Y0BA 4WEOA 1W5SA 4I6JA 3B70A 4BO8A 4FNMA 5L95A 4C6TA 1PX0A 3ENKA 3OFJA 5CVJA 2BHTA 2XE6A 3FPHA 3TSCA 4Z3DA 5AM3A 4ENWA 2DWQA 4FEAA 4YV2A 1VE5A 3A1TA 2WJJA 3MHTA 3ZGXA 3LCVB 4HYQA 2C8JA 2D8AA 2XWBF 4WY8A 3DTTA 1TM2A 4IIFA 4PRLA 4YAWA 4Q4CA 1D2CA 5FL7D 1AB6A 5ALLA 1C4WA 1AMNA 1JAZA 3I37X 4D92A 4EGAA 4IH9A 5FOUA 1XCGB 2FKNA 4IDBA 4M89A 4XX0A 2GI4A 4A15A 2H6EA 2LP4Y 1N5DA 1SRQA 1SJ9A 2BLNA 2QJFA 4W99A 3ZCUA 1J8YF 4ZAVA 3D7KA 1Z0SA 3JWHA 5FBVB 5AW0A 2RJOA 5AM0A 1CX9B 4G5QA 3CBGA 3W5BA 4YY3B 3TF5A 1KC3A 4W5WA 1RJWA 4YUXA 3ZWWA 1LK0A 1RPTA 3QMMA 1SVNA 4LJ8A 2FJ0A 4MB0A 1EQUA 4YB8A 2PL3A 3MBOA 3L8GA 4U63A 5G3YA 1CDOA 3STVA 5FTLA 3DVLA 1ZK3A 1R6DA 2WKSA 4LWZA 4FGZA 4HLCA 2XMBA 4L4YA 4MRVA 3AL2A 4PS0A 3BX1A 4DHWA 4CKBB 3O4JA 2MYNA 4XIJA 4N8SA 1J7KA 1UBEA 4M99A 3HKEA 4HZIA 4ZPXA 2H1RA 3ML1A 2G71A 2GZAA 2IE0A 1XDZA 4CQLA 2G8NA 5KTYA 2LBPA 4HVTA 3H7IA 4HSGA 2O0KA 1WUIS 4I8XA 4XIIA 3MMNA 4ICIA 4C0AC 2YYYA 3BSYA 2H1VA 2Z9DA 4UUBA 1XZQA 4DMHA 4GWKA 2RAPA 2HZ7A 5EJIA 4E4RA 3JQEA 4RVHA 5EZYA 2HMTA 5FPTA 2ZIEA 3LGSA 2FPIB 2QWXA 4TT3A 3EAQA 1R8SA 4KO8A 4ENQA 1NGSA 2IYTA 3AL0C 4G9GA 4G65A 4JITA 2AUMA 4QREA 4NZPA 4U3JA 3IMKA 3AEXA 1NPDA 1WXGA 2Y6UA 5KX5B 2FW7A 2HB6A 4NOJA 1F8YA 1TW2A 3HSSA 4NYIQ 2BEWB 3IERA 3RUFA 4ZMBA 2VTDA 2B61A 4I1UA 1WCWA 3QXJA 3ZBPA 3H1AA 2CLSA 1BG6A 3MMPA 3GC6A 4LI0A 3G5AA 2VDUE 1C7IA 1LU9A 1VBFA 3HZHA 3SPXA 3MOIA 4E2FA 3IAS1 3TL2A 4OHWA 3FI0A 4O1IA 1B74A 4XPIB 5CH5A 4WZAB 1M1YE 1U9JA 3EVTA 2HQ1A 1NVBA 1VMKA 3R6LA 4JI0B 1NU6A 4OJMX 5F21A 2FCAA 1T1EA 1PR9A 2BIFA 3WRYA 1KHHA 2X2OA 4MGEA 1OXVA 5D1NA 4QBTA 2WICA 1W49A 1OBHA 2HJGA 1VKZA 2YFYA 4AJIA 4Z1MA 3WB2A 2EC5A 2UVDA 5LIPA 2JGJA 4HC4A 3M6UA 1FNCA 1FS5A 3H4TA 1GPJA 2JDIA 5AH0A 3V00A 1PQWA 2P0EA 2TMDA 1J8DA 3IUBA 3LO8A 1FU4A 3K32A 3JQ6A 2JFUA 1F0KA 5KNDD 4Q4AA 4ABTA 1USKA 2NU6A 3O1IC 3AOGA 1QH1A 2DX7A 4FFMA 2ZS7A 2V7VA 3D4BA 4IIGA 4ZWNA 1JDPA 2B7BA 2ARKA 3DKKA 4A16A 4B44A 4URZR 2BKXA 3SYLA 1I4TD 3IHKA 3SSAA 4DC0A 3S7TA 4JIGA 5IJ0B 4WECA 1NXSA 2ZCVA 2GEJA 3M1YA 1TUBB 3IUSA 4XM0A 2C2GA 4LFCB 2D06A 2NXNA 2PT7A 1FXWF 1GZUA 2XF2A 3IYLW 4EH1A 5LSAA 4I55F 2AL7A 2YXDA 2G9NA 4XQEA 3HJTA 4M87A 1JSLA 2GUWA 2VAMA 2F1HA 5HCNA 3UY4A 3V8RA 3VZPA 3WTBA 2IWHA 4B80A 2XRYA 4YRMA 1LV7A 2G0NA 4Z49A 2FPIA 2YV4A 4BYGA 3I72A 3LCCA 4DSAA 1AHIA 3IAM6 4UARA 4BJ1A 4UM7A 4EF4A 4GYWA 4UM8B 1MXFA 2WD7B 1CRLA 1GL3A 3DZHA 2X0NA 4RNDB 3HDGA 3EWIA 3OM0A 5CM8B 4HT3B 2FUKA 2GPSA 2Y67A 3II6X 2Z56A 3LMKA 1SVIA 3ZXSA 1GSAA 5BSEA 3C3DA 4Z4GA 2VAWA 2FSVC 1NMQA 2WZDA 1HDXA 1QIEA 2V74B 2XNDD 2YBEA 3HA2A 2EJCA 3RVSA 2ZJ5A 3C3JA 3O75A 2ID4A 2J5QA 1YCDA 3B48A 3QXXA 3KQHA 3ICVA 2VJQA 5SZHB 2Y3IA 1WY5A 1ZA1A 5JSUA 1SOUA 1VE6A 2QT1A 3ZGLA 4JELA 3BXEA 2W6NA 2IYVA 1XAIA 5CNJA 1QF6A 2AE1A 3IH5A 3ZW7A 2EW1A 5CAEA 4KH1A 4CKYA 3WAGA 1NR7A 4DARA 5GTDA 4C0QC 5BMVF 3IBTA 4DCNA 4S1NA 1ICEA 1OH8A 2A9RA 3CSUA 3H11B 3JQQA 2C9CA 5AK0A 5BNWA 4N82A 5I4BA 2H3EA 4OGKA 2BEVA 4WA8A 2FFBA 2IDMA 3IMCA 4LDZA 4PGFA 2YJZA 3U7JA 1KK0A 4YHHB 5A4FS 3BTVA 3ABZA 3U3OA 1ZU5A 3OT5A 3WIUA 4BWVA 4ND8A 3NC1C 1Q0SA 2JGDB 1KRHA 4CMEC 4D42A 1VLZA 3UH1A 2R8RA 3DOOA 3F3KA 1KSHA 1E0SA 5C37A 3EFOA 1GCAA 2HQSA 2QZSA 3FGPA 3JPWA 3K3PA 3KCQA 4M37A 2Q5FA 3T35A 3EUWA 2PHZA 1PEYA 4ZO4A 1JJ7A 3GPDG 3IAM1 1JU3A 1KYZA 3DR5A 3JRWA 1EVYA 4EVSA 2WNHA 2F9LA 5ESXA 2AN3A 2W8BA 1EP2B 4RSGA 3K5PA 4PSAA 1GPLA 3GCXA 1RRFA 4ID9A 2WM9B 3C97A 1PJQA 2F3SA 2HCBA 5IDYA 5ARDA 3KOMA 4YHBA 1KEZA 3DL2A 4F3CA 1ZGCA 4ZALA 4HXYA 1Z0ZA 5IHXA 2WUFA 2PX0A 4WRRA 1RJFA 4A0QA 2LDXA 3SIWA 5CDTA 4CT4B 4P31A 4AM8A 5FYDA 4HGRA 3COZA 4U7WA 2IK8A 4BKQA 3U61B 1RHQA 4HKTA 1ADCA 2QIPA 4MZXA 5CDFA 3RAPR 3IB6A 4JROA 3N05A 2ODPA 2VYCA 1P7CA 1CE8A 3IP8A 3K0EA 1C30A 4ME6A 2WV9A 4NH0A 4Y2TA 3UV7A 2ACEA 4Z51A 3H9GA 1AQJA 2VTBA 2PSFA 2E85A 1YS9A 2ZB7A 4QAJA 3F7TA 3I9V6 4MV7A 3AP3A 4GLFA 4R3NA 5P21A 2F3RA 3UO8B 2H59A 3ET5A 3LFTA 4JC8A 3ILVA 3L7NA 5JCZA 5ADWA 2PA0A 1N8TA 2F1RA 5FPPA 2UUCB 1KJQA 4BP3A 2QW1A 2PD3A 4LJ7A 4BFYA 4YN3A 2MYTA 2OGZA 2VATA 4FBMA 3BD7A 4IJ6A 2OG2A 4NFYA 4XJXA 3RC3A 1SCKA 4XWWA 1UWCA 1F6DA 1UJCA 3SQNA 3FTFA 3W8NA 4HX9A 4ISBA 5F73A 4BMPB 1GFWA 3SE7A 4QO7A 1IQUA 4U0KA 4V0RA 3RW9A 5AHOA 3PFFA 2YW2A 3HP7A 1KO8A 1N2GA 4B73A 1WUJS 3KT8A 2C57A 3GB9A 5FORA 4FQ5A 4FBLA 4MV6A 2BCGY 3RTCA 5JARA 1TQ4A 1HPLA 4BNXA 4B46A 3G0DA 2OUKA 2ZI6A 5BMVB 5I3ZA 2CNWD 3E7FA 1XYYA 4UE3S 1N3LA 2AOWA 2AZMA 4IDEA 4KV7A 3IODA 5B1IA 1U2PA 1FYEA 1W88B 2RH9B 3BYZA 4LHEA 3ROEA 3S2SA 3IUQA 3ORRA 5A5EA 2H0QA 2V6GA 4FK8A 1EWYA 3C7TA 4U9HS 2W70A 3SU8A 4DYDA 1MX9A 4EFDA 1R0SA 3I6YA 4ZMSA 1EESA 2IYNA 4DIOA 3OLCX 4RCZA 3I0NA 4MVJA 2WWGA 2ZT5A 2CBZA 4PNPA 1VSQA 2AYYA 4WAUA 3GZNB 3UB2A 2ASVA 3ADOA 3B1FA 4XOUA 1OLOA 3EMVA 1U3GA 3IQWA 1UZMA 2KS6A 4Q9JA 4DFDA 1IBCA 2OD7A 3EDYA 3QELB 3L0YA 5JMPA 3W3AH 2WFLA 3MBKA 3MW8A 3Q85A 3LOQA 4ZO9A 4YAFA 4TUYF 2QKYA 4YC7A 2REOA 4DDMA 3FOCA 3T52A 1U0EA 3UWKA 1KY2A 1KDTA 1O4WA 2AXNA 3PJFA 1Y82A 4PINA 2HSDA 2PA3A 4MRRA 1FA9A 3O26A 3A6EA 5J1TB 1IQRA 1Y9EA 4C7KA 2RG1A 3GGSA 3OLZA 2EKPA 2H29A 3U0BA 1TKBA 1CZOA 4CKEA 3KELA 3HJGA 2RGCA 2G5CA 2RHWA 1YJAA 4G26A 2EKDA 4XB2A 4F2GA 3BAZA 3OZGA 3ABQB 1FFXA 2XBMA 4GAEA 3OLYA 2X5JO 1E63A 4TL9A 3TMYA 3F8WA 1TYEB 4F3RA 1DX6A 3T0GA 2AOTB 4KYUA 1ZGBA 2IPNA 3AF2A 3CRW1 2ZI4A 4BVJA 4Z7QB 5JQWA 3ANSA 3PDIA 1V5WA 4JB8A 5BOVA 4ARVA 3PCTA 1QYDA 1V2HE 2CWWA 4EJ6A 4YJ3F 5EHXA 1ST2A 3O2QB 3SM3A 1BWQA 4LE0A 2WYUA 2MSNA 4TPKA 4BQFA 4WN9B 2GETA 1NSFA 5UKDA 3V4SA 1ZVKA 4LJYA 5A4AA 1Q1GA 1ZM4A 1VCIA 2GKSA 3R1IA 5AKKA 4KPYA 2ZRCA 4A6PA 4YRNA 4BO0A 3BIOA 1P7YA 4NU6A 4X1KA 4QU8A 1XO1A 1NOIA 2XDYA 4RD3A 1KI6B 2BCJQ 1VQ1A 4EB0A 1O94D 1VJTA 3K8ZA 3QSYA 3T5BA 2NV2B 3CR8A 3OE1A 3LRPA 1SXJD 1AJEA 4YRDA 3KZ1E 9GPBA 1T2CA 1KS2A 2BC9A 2VRCD 3FNHA 3C7AA 2ZXEA 1TECE 5CW1A 4DBVO 2X22A 3DZGA 1UOPA 3K0BA 3GA7A 1ENPA 3MWDA 1QVRA 3CWQA 4ZK2A 3PQ2A 4E31A 5IWCA 2RB4A 4L07A 3VZDA 2JGMA 3HJCA 3Q8WA 4YK7A 3PTZA 4EY5A 5DOVA 4OA8A 1ZJWA 3VM6A 1NAHA 4C6TB 4ZJYA 4F8JA 3KR0A 1RR6A 1TA9A 1TJ5A 3AFHA 1O97C 2EQ5A 3H4VA 3QVSA 4HGYA 4JUFA 1RPJA 6YASA 2H9AA 5CNKA 2YUIA 2C4VA 4DRXB 3NBXX 2XITA 3KQUA 4ESVA 3LXXA 2GEBA 4I55A 1QPBA 1NFFA 1RWQA 3M9WA 4FHCA 3DDSA 3P32A 4TMKA 5KC8A 3EUEA 5JFTA 4DV6B 4ZVSA 1Z63A 1DBIA 4U02A 5EFZA 2PQ6A 3LLUA 4B6OA 4X64B 4UUMA 1H2BA 2HDHA 2QTCA 5TE9A 3JYPA 3ZHZA 1JFTA 1ZOLA 3GI1A 3FIUA 4RD2A 4R51A 3HXMA 1U5BB 3L1IA 5G3ZA 2B83A 2ZVPX 1I3MA 2HWYA 2XMZA 2VNAA 4RV4A 3DW1X 5GJCA 3UMMA 1G8JA 3RFFA 4OXRA 1OCEA 4YDRA 1P9LA 2WOOA 1EK0A 1HYEA 1H3NA 1Q2UA 1SBNE 1J9EA 1P0MA 2ECQA 2QRQA 3O7WA 3OE7D 3AF0A 4ZU3A 5NULA 4G0UA 1NZDA 2ONJA 4LF9B 6REQA 3DWFA 1K8RA 1WXIA 4N8EA 1AOXA 4GR4A 1ZGZA 3GEPA 1NURA 2IFTA 3HA3A 2VF4X 2B3TA 4YS6A 5DISB 5IJ0A 5L3VA 1C1DB 3Q8KA 4NYJQ 3U5ZB 5GONA 1C3OA 2J3MA 3OQ6A 1IIRA 2A35A 3PE6A 3THOA 3W9YA 3MJHA 5EJFA 3Q1KA 5KJ6A 5G41A 3U60B 5IDVA 1MV8A 1W5EA 1XTUA 1ZGJA 2CVHA 3LBAA 5I9SA 4RVDA 3DAPA 4DV3B 1DCFA 3H9EO 2CMGA 3E2PA 2QZPA 1HG1A 1GILA 3G79A 1CY1A 1PZGA 3ZOKA 2C2WA 3PI7A 1KXJA 4WFQA 2VJCA 2H2GA 3RHFA 2FW0A 3VNSA 1OAOA 1MW9X 3C6KA 4IHKA 4MGIR 5IUKC 1QFYA 3NP9A 4F3KA 1KZGB 5CURA 3BSWA 4GI2A 1PGPA 3AHCA 1GG8A 2F3PA 4BQOA 2D1FA 3PXGA 1F17A 1QMGA 4L5CA 2QD5A 3MS4A 1GQ2A 4IUCS 4Z4QA 4HEJA 2HSWA 4RIEA 3W6UA 1GQSA 1NQUA 4L7VA 4QICA 3V4ZA 3LBNA 3DUFB 4X92A 5K0CA 1JKFA 4L0DA 1FUUA 2MSDB 3KNZA 1OXTA 4LSZA 3WBJA 4NAVA 4PO9A 4NCXA 1P31A 4PONA 5D1HA 5EKTA 4GOMD 5EY5B 2WAYA 2XUDA 4UAJA 4XGQA 3MUNA 3I8XA 1K5PA 1WD5A 2ZWAA 4AMGA 3TZHA 3W5VA 3BUSA 4M9CA 5GONF 3N0TA 1RMTA 3WG9A 1DZIA 1GNQA 2BEWA 5B1YA 4QUIA 4RUKA 4QWWA 1T34A 3PFWO 1ZVMA 1ADJA 3HBAA 1HMYA 2I2DA 2OWEA 1U80A 3PNYA 4P54A 2G28A 1T8TA 1PV1A 3L7YA 3KL4A 2G9QA 1NJGA 1GGFA 1X6VA 1G60A 4HEA6 3D4NA 1WOMA 1EP3B 3IAHA 4HI0E 4PCUA 4RENA 1W8DA 2C9DA 4XDZA 1HORA 1VOTA 4A82A 2JA2A 3EXG2 4AS3A 1V1JA 4ZKDA 1BQ4A 3GLHE 1L5WA 3PUHA 3W5AA 2QY6A 1FP7A 5AK3A 4WW0A 3HCCA 4DLKA 2GGSA 2A4KA 4R8SA 5CLIA 1T0PA 2XUPA 2I3DA 1HDIA 2RHDA 3DLPX 1QHHA 4RD4A 2V58A 2QN8A 3FF4A 5A9TA 5KTOA 1RQNA 2B36A 4IYRA 3NI2A 3D8RA 1G64A 1KO4A 2VAXA 4O4IB 5COBA 4E94A 4K6FA 2WYWA 4JYPA 4BATA 1QGOA 2J3DA 5FOQA 3UB3A 1YJQA 4HNRA 4KQWA 4CODB 1T4DA 3DL4A 1LLFA 1N2CE 2EDCA 3GK3A 3GY0A 2Q5OA 5K0SA 3IDAA 2GTPA 2I34A 2WIDA 5ALMA 1MO2A 1CUJA 1PNOA 3INTA 4KV9A 1L4NA 4OH7A 1NUHA 3Q8XB 3IMGA 2QX7A 4CF6A 2JFNA 4AZVA 3OBBA 1GY8A 5HKBA 4JJIA 1N6RA 1IJKA 4TSFD 2X3UA 3WK9A 4CEHA 2VC2B 4YP7A 3LBHA 1T6BY 4X71A 2IZ7A 2ENWA 1VJ5A 3KYBA 4QSMA 4GXTA 4B2PA 3TEJA 2C31A 3HJBA 3TQQA 1M66A 1B43A 2XJ4A 2ZU0C 4BN0A 5EP4A 2IZ6A 1ID8A 3E5MA 3IT0A 2X5KO 2LGJA 1RWNA 2OCPA 3CUVA 3EZ9A 3L43A 3HTXA 4OLAA 2VWGA 3LOPA 5ELLA 4C88A 1NVDA 3WK4A 2GPNA 3NO4A 4OQPA 5SZIA 3VVMA 4YDQA 3NTRA 2JLQA 4G0YA 4OYHA 3UOAB 4MA0A 1V7ZA 2O2YA 5KSPA 1U5BA 3A2KA 2XNJA 1LY1A 4GQIA 1EM8B 1OILA 4W9RA 5A4KA 5A6SA 4TMXA 4MITA 3CVVA 1M2HA 4WPGA 1U4OA 2WK1A 3PGMA 3S2FA 1IXSB 1UJ2A 4JNKA 2AX4A 3EF1A 4I2VA 1V3QE 2VXCA 1L5SA 1PZMA 2WG0A 2R62A 3GPIA 4LWOA 4PX3A 3ZWOA 2GVNA 3FRJA 2WPDA 4WXRA 4AG3A 3FX2A 1C3JA 4A3SA 2IKQA 5KQRA 1C3EA 1M74A 1U0JA 5B58T 3W2GA 3HCWA 3WOHA 4C4OA 1HURA 1RXYA 3OT1B 3N8IA 3RH0A 4COOA 3LUDA 4B7UA 4BUCA 2FN7A 3RAGA 1AUXA 1TKRA 1BXRB 5KCZA 2VH1A 3HFGA 3VKFA 2E87A 1DS6A 1E1QA 1US8B 3FTDA 4TS9A 1V8DA 5AJUA 3ZJVA 4MULA 3UWOA 3OX4A 4ISCA 5IN4A 5EJ9A 2CHFA 4OUDA 2NW6A 4AUKA 3GGCA 2IOQA 3OIGA 1H22A 4GGPA 4JVSB 5CW2A 1GNSA 3KUKA 2VZ0A 4RJ2A 3RG8A 4CGZA 1VL0A 4BEBA 1OI3A 1ETHA 1MB0A 4F72A 3KS9A 4FGKA 3F71A 4UM5A 4NATA 3HPQA 2QN2A 4LRSB 1SUIA 4M9ZA 4CE6A 2CEKA 3OJLA 4ZU1X 1Z18A 4UU0A 4OBXA 5BSUA 3QFSA 1UDCA 3E0XA 2J3HA 4B5LA 4W5OA 4WH0A 1QHFA 3HB0A 4P22A 5CX4A 5KU1A 4O1MA 2EQAA 1YASA 5B3KA 4GPTA 4UTRA 2EF1A 3BFKA 4PSVA 1SXGA 2A88A 3FWHA 4WOPA 4YCNA 3TEMA 3EIQA 1WHTB 2J0UA 5F9MA 1MRNA 1EFCA 1ZOIA 2GN6A 2CUTA 4OA5A 2HRDA 4A92A 4NPHA 4V39A 4F9GA 2WQ7A 3C3EA 3FIJA 2DTEA 2OPBA 3KV3O 2H8GA 2WSMA 2AXPA 3RTDA 5C8YF 3VR1A 5CFLA 1BKSB 1D9XA 2F3TA 3VTFA 1EDBA 3LLMA 3LT4A 4X6UA 3UHFA 1L5YA 3WIDA 3WK8A 1PI3A 4YV7A 4O4HB 2Y1GA 4FFWA 1BDJA 2Q2QA 1E7RA 4RBNA 4CKCA 1I01A 3EXIA 1Z0KA 2BMJA 2H11A 3JTMA 1W85A 3WDLA 4J1TC 1USIA 1ZJZA 1KP9A 4JEHA 3T7SA 3LC1O 1I3KA 5GV8A 4DE5A 1L8OA 2DC1A 3ZCRA 3OJEA 3O82A 4IWNA 1VPVA 2JAOA 1RI5A 2I6XA 1VKNA 1IVNA 2PBZA 2ZWIA 1XVIA 1X1CA 4WA7A 1QIGA 2RIPA 1N2OA 4QECA 2JLAA 4Q9HA 2F9MA 1WMSA 4BZPA 2G88A 1W2HA 1LPOA 3OU2A 3RD5A 1CIJA 1MX1A 1XTVA 3C6XA 4X7RA 3MWGA 1QH1B 4MMYB 1T1SA 2QM8A 2NU6B 4HMPA 1QO0D 4L1KA 3P26A 3A6DA 4W7HA 3VPDA 5J4KA 3UBTA 1KDZA 1WRBA 1CP3A 1NW4A 3R23A 1J2RA 4MW5A 3SNKA 5BWBA 4RV9A 1SURA 1FC0A 1A2OA 3N39C 1QHYA 1UKBA 3E5RA 4LDRA 4DEVA 1BW9B 2QQ5A 1KZ4A 4KPGA 3G8AA 3K0HA 2R6ZA 2Q46A 10MHA 1K4YA 3ZWAA 1WCIA 3LK6A 4B48A 4CCWA 3PKIA 4YAKA 3TFOA 2XODA 4PIPA 3GJQA 3A3NA 1AKYA 2O2EA 4DWVA 4D9GA 3RT7A 2EEZA 2IS6A 4GH5A 5B37A 1N4AA 4RE5A 4R5HA 2Q2OA 2UUBB 1DXQA 3O8DA 4JR2A 1LTQA 4D1YA 3FD8A 3ITKA 5A2GA 2V7TA 3KZMA 4D02A 1JSCA 3AI3A 3JQFA 1SCNE 3ABIA 2VOEA 4KX3A 1COZA 2FX5A 1D6JA 4MHOA 1OBCA 2MR5A 4TMFA 3USES 2AW3A 2DLCX 3L8MA 4B3FX 2VJLA 4J76A 1NVEA 3NNNA 3QYFA 1U0OC 4X6YA 3G0BA 1UFOA 2MINA 3FKQA 4EL5A 1C1DA 2X1HA 1P1HA 4GEGA 1UXOA 5JJKA 1QF9A 1XTBA 2ZJ2A 5CJ2A 3WGKA 1DARA 5IDWA 1ORDA 2CEAA 3HNOA 1HSOA 3EW9A 1U65A 2C95A 2R8BA 1DTSA 1QU3A 1T9GS 4ZQHA 5K6RA 3WRVA 1NY5A 1YC5A 3AOEC 5JRZA 3ND8A 4MPDA 1DTWB 3AONB 3VSDA 5H1YA 3YASA 4EKYA 3UK6A 3R3VA 4HDSA 1V48A 3NVKI 4OMDA 2CNLA 1KVTA 3VR5H 4D46A 4YMLA 3U3XA 2ZBGA 3R7WB 2QAGC 2PWBA 2XWSA 3PUYA 1SCJA 3I4CA 4DGQA 3P9IA 1H3FA 1P74A 3OT1A 3AVYA 2WJAA 2IDKA 3CKMA 3H3XA 1AGXA 2AC7A 1L7BA 5I47A 3JR7A 2TYSB 1LJUA 1TJNA 4I8IA 4CR7A 4RULA 1XU9A 2J3IA 2XDWA 3WFIA 2DT8A 2OGSA 3TX6A 2UVPA 4YO7A 1O3YA 5FUBA 3A4YA 4MUIA 3I3SR 4ZYVA 1Q74A 1RHMA 2OL4A 1KAGA 1JHVA 3AUTA 3DEIA 1N8NA 3JARB 3ZH9B 2I99A 5K8JB 5CIYA 4O4JF 1LSSA 2AMYA 1CEXA 1RQRA 3K15A 4DSUA 3T06B 1ABBA 3SSNA 1ZI6A 2E1PA 2A14A 2NO0A 3A2MA 3L8ZA 4E88A 4F6LA 2DUWA 1IOWA 2FK8A 2HIGA 4XLZA 3WA6A 1IPFA 2W11A 4G1CA 3U3RA 3WMRA 2CC2A 1U0RA 1OYYA 1UT6A 3I2FA 1VE1A 1SXJC 4EHBA 4ZZIA 3HO6A 2ID7A 2HFJA 1HE2A 1TGVA 3OX2A 2V45A 3G49A 1E9AA 1Y3AA 1UH5A 4BNDA 2PL1A 3RHZA 5I9LA 4Q7JB 1EFVA 3BT7A 4OHVA 5F7OA 3W90A 2DR2A 1BOFA 3R09A 2WC1A 3GJ4A 1I3LA 4GXNA 1SWVA 1TZMA 1QWSA 2VQDA 3FOWA 1P2VA 4CEHB 2WHEA 1U1GA 1POWA 1UFVA 3LA6A 4IS2A 4XWGA 3TM5A 4DDHA 4ZAZA 1U9IC 2A3NA 2DSNA 5I48A 1HDCA 4QDXA 3GUZA 4ARZA 4LHSA 1SU7A 3EVFA 1SQ0A 5KAMA 3IQZA 4BO5A 2V3CC 1JEJA 4R54A 1X2EA 3U7GA 2FG7C 3KSZO 2V0NA 4HOYA 4ZJZA 2WA2A 4E15A 3AJAA 1L7VC 3FDJA 1E0AA 3JQ9A 2JHAA 1OHHD 3NHLA 5JOQA 3GJ0A 3GLQA 4WKBA 3OETA 2GRUA 3BJRA 1BHQ1 4GOJA 3SDZA 4DIFA 2VYND 1L7XA 3H9CA 1WVGA 2Q45A 1YO6A 1J39A 1OWNA 2A84A 5AUQA 4CKEB 1JL3A 3EGDB 5L4LA 1V43A 2B92A 3H97A 4IV5A 4NE7A 4NAHA 3G2OA 4WZ6A 5EWJA 5CK5A 2DTXA 3K1YA 1C5KA 1NI3A 2H4WA 4IXMA 2PRYA 4HAWA 2B6NA 1PWZA 2H7CA 5A04A 5FUXA 5CCDA 1YZNA 3RVQA 2M1XA 2WRZA 2QX4A 4QLAA 1TUBA 1MMFB 2X6TA 3IQIX 1YQGA 1NYTA 1DQNA 3D5EA 1Y3HA 3LVRE 4GGMX 4EGCB 2CBXA 1IWBB 1ZISA 3N59A 4YPVA 5AI4A 1U1FA 1WMEA 3Q3VA 4BLQA 1FUIA 3ANYB 1JE1A 3HWX1 4G5FA 5B36A 1ZR2A 1U6IA 2I2FA 4DRZA 4PQEA 1RC1A 4PZAA 3T7JA 4D3SA 2DHEA 1G5PA 1TLLA 3H5NA 1QOQB 1C7FA 1NM5C 3F46A 3UJ6A 1R0LA 3V4VB 3FI9A 1UMBB 1TM5E 3ZG6A 3PC8A 1NG9A 2DHDA 3VR6A 1G9XA 3FJ1A 4E11A 1A95A 4AF7A 3IIKA 3EEYA 4LXIA 1G20A 4HDRB 2ZBFA 2JLBA 1JHRA 3W4JA 2N0SA 1XFAA 4ZT7A 2CJWB 2JBAB 2WWHA 2WJIA 3BXGA 3TLKA 2FQXA 4A0FA 4P2GA 1V3VA 1YOBA 3R7NA 3E3OA 1IFXA 5MN6A 2OV2A 4X7BA 5TT0A 4MROA 1MEJA 1PKXA 3GGOA 3I8OA 2P9TA 1HEYA 1K92A 1PTKA 1CERA 1Z3IX 3HEAA 4RV5A 2JEZA 4DL9A 4P2BA 5I7OA 3NAZA 4F5WA 2IHKA 2CVFA 4ZN6A 4WV3A 3G1TA 2VT2A 3E9QA 4V03A 4Q48A 3CUYA 2IYPA 3O73A 4WCDA 3GLHA 3LIIA 4F9EA 2D62A 2YC2C 4FEEA 4W1PA 2DBZA 1NLMA 1AK9A 1XEXB 1IY1A 4WGFA 4OPMA 3FNQA 5F3WB 1N6PA 3FFTA 1TZ2A 1LW7A 1QLWA 1OXMA 4DPMA 1E6KA 1TADA 2OHGA 2XCOA 1DG9A 3JVIA 4KYIB 2GLTA 4IJUA 5K0LA 1SQSA 1RZRA 4KR6A 4RAQA 5JNRA 1T3SA 3RF6A 5KYXB 2AUTA 3EGDA 3IP1A 2R47A 4CMCA 1EINA 2G83A 2WM2A 4GYKA 4P34A 1H94A 3AERB 4U9UA 3WL3A 1HH4A 2PT9A 2PU7A 4JJGA 1PRYA 4MVYA 1JIUA 1K5HA 4TXJA 2IEAA 3W06A 2BF7A 5DXAA 4WVFA 2ZSFA 4BAZA 2OV6A 3WWCA 4AKTA 4BEJA 5A02A 3PHLA 5FBLB 2Q5LA 1EMDA 2R00A 4XWYA 3PX7A 3MB8A 1IAQA 5FL7A 4M0CA 221PA 4CUJA 4KK4A 4RHTA 5DT2A 3TQIA 1I0IA 4UPEA 2Y99A 1YR3A 4Z7JA 1QONA 5AJXA 4M0EA 3I5UA 2WWYA 1PJBA 4M46A 4UREA 5HF8A 3OQIA 3U62A 1DIBA 1LQTA 1WLYA 5ECDA 5AM2A 2QPAA 4QT0A 4DY4A 4RVOA 4QQRA 2XYPA 1NRXA 3BB3A 2O0JA 3EOAI 3N87A 4B5KA 1FP4B 1YFKA 1Z29A 4XGIA 3KL2A 3DVAA 3DVRX 4BASA 3MQ4A 1S5PA 3QKSB 2WI8A 5EIAA 1J1ZA 3U1BA 2VJOA 4W1RA 4Q15A 4NL4H 2GLUA 4CIBA 1Y42X 3C2QA 2OOKA 4NCAA 2GCEA 1Q0ZA 5DVZA 1BHSA 5C1DA 4OUDB 1W0KD 4LWQA 4M60A 1ODTC 5CT4A 1JPUA 4A8PA 4REQA 2WTUA 4UTPA 4C2TA 2J33A 1UKCA 5CAEB 1US8A 1UFQA 3KQNA 3DOHA 4G9BA 5EJ4A 3WHLA 4L6IA 1IIBA 1XWWA 3C1OA 4E21A 1N2JA 2BFWA 2FZVA 1PZXA 1T2FA 2RKWA 1KMMA 1MZPA 4GBGA 4X6XA 2LPMA 3R8FA 3EZGA 2GNPA 2J3LA 3BL8A 3SP1A 4YXWA 3PR3A 1V7CA 5EIFA 3HADA 3U9TA 4EG6A 4EW2A 4DCUA 3DBOB 4WKPA 3GCGA 5E6RB 3N2LA 2C96A 4G2TA 2GCNA 5I9NA 1SC6A 1NDQA 2HF9A 3DEJA 4DV2B 1JUDA 4ZZ0A 2DOKA 3QJGA 4JP8A 4B0OA 1W6UA 2QU8A 3TTWA 2GJAA 3AVUA 1X94A 3IEXA 2HGSA 1C3LA 3QWFA 4ZHQB 3CF0A 1HOTA 5JDIC 1AQNA 4DABA 1NNUA 1HLPA 4ACBA 1ZCAA 5M2QA 3STHA 4AKIA 4CEIB 1KAHA 2CLCX 2V03A 4QNRA 3HNPA 1JEAA 4PSUA 4KXMA 4HYYA 4PICA 4MLZA 3ZCQA 3VJMA 5F9HA 3LW7A 4RVCA 3AY3A 4I1PA 2HJHA 4WNAB 5C5DA 4U7GA 4QUGA 4XH9B 5CG2A 4WOJA 4AG5A 1DSSG 4FQ8A 4LGMA 1PQYA 1SBYA 1U2RA 4ZOLA 5EQTA 2EFHB 1LS6A 3CURA 2QVLA 4R71A 4K6MA 3EZXA 1AO3A 3E7DA 3VVCA 1JR3E 3NOXA 2PLAA 4OIMA 4LC9A 1DRWA 4S24A 3SAJA 5EJEA 3DLCA 3H8VA 5JC1A 2D74A 1S2OA 3C6MA 1JDJA 3JYHA 3T5CA 1T24A 5DNVA 1DCKA 1TIBA 3SIXA 1QB8A 3OECA 3EPHA 2MMCA 4DJFC 1AQUA 1BJRE 2B0CA 3WLHA 2OBMA 2QPOA 2SCUA 1NU8A 3C87A 4OKSA 3ESAA 5LQSA 1W4BA 4IL5A 1WCIB 4YMWA 1QIMA 3STWA 2R751 1QTRA 1SKMA 3ZLTA 2HHJA 4UCWA 4MKFA 3UUEA 4CV1A 5JYCA 4LFAB 3GFQA 3UKDA 1P62B 3L40A 4ASUD 3ZVMA 3BTSA 2D59A 5C8ZA 1D5WA 1KMCA 2ESRA 2HA2A 2IY8A 3JAWB 3IAUA 2M9MA 4PG7A 1S9DA 3PTAA 2HLDA 4RPIA 4PYLA 1I3NA 3TRHA 1EFRA 1AH2A 4QARA 3GFFA 1O95D 1E9EA 1MR3F 3DKIA 4RGQA 1U2SA 1QHIA 3H1TA 4QBIA 1VL6A 3KJXA 3LDHA 5EE9A 1JWBB 1ZXXA 2N46A 2G4LA 3HBMA 5EXTA 5JCOA 5K8TA 1QP0A 2O1XA 3FH0A 3KU1A 4FNGA 1JR3D 3PQ3A 4AXXA 3NHSA 3NHAA 2VTBB 1BD4A 5EPUA 2YFQA 4YRZA 3GJ5A 1PWYE 1ZI9A 4PV7A 5FNZA 4F3TA 3DKPA 3A04A 4KK3A 4DJAA 3LKVA 1YQEA 4XQCA 5EWJB 3OCZA 4TYWA 1ESZA 3E05A 5D3MA 2EJVA 2ODEA 2H4HA 4HWRA 2R6FA 1S2NA 1ZH8A 2VQFB 1GUAA 4H1UA 1J99A 3CTMA 3EUAA 5G1OA 2I2BA 1ZIPA 1R66A 3BHNA 4FYXA 5BUZA 2D6FA 1XVVA 4IICA 4LRYA 2YDXA 4G0ZA 3O2SB 5LQRA 4O8CA 1MJGM 2BV3A 3DAHA 1DUSA 1S1CA 2R7KA 1XMOB 1GO2A 5FPSA 4TX1A 3LQQA 4M55A 5AM5A 2QV7A 4Q01A 4DHEA 4K1XA 1YJBA 4PZUA 1Y3FE 4NNPA 4LXXA 4LCBA 4KAAA 4B6JA 3ICEA 1E2NA 4D82A 2Q4EA 4JI7B 3C39A 1IRIA 3O5AA 2YN4A 1C0LA 1XELA 2H2WA 4KQGA 2XGJA 1UEXC 3LPMA 1AGYA 1X19A 2CHEA 4N48A 4TXNA 2DBQA 3U56A 4RTLA 4DPKA 3WR5A 4EKIA 3DUWA 2CXSA 1J0BA 1P7PA 1WXWA 4ITVA 4ZCSA 4ZGWA 4ZAFA 2B1QA 2DH5A 1XQ6A 4JXJA 4MKZA 5IUNC 3SGLA 3T41A 1M2VA 2OK8A 4LECA 2CYCA 3PRJA 2BGTA 4YRRA 3RV4A 5CIQA 3P2EA 2D4HA 5D84A 2OM6A 2WJVA 1IN1A 3K6JA 2HV9A 4RMJA 4LZAA 1BWSA 4NFHA 2Q41A 1NJ6A 3M33A 2AHRA 4AT1A 2G06A 2VHTA 2GCPA 1AA9A 3EVZA 5J40A 1H4QA 4J16A 3ABOB 1DXHA 2PRZA 3EVBA 3WWPA 4JBXA 5DCUA 4UASA 1NWHA 2RBGA 3WS7A 5LVAA 1HYHA 2ZR8A 1CNFA 4B74A 4BU1A 1VZ3A 4FCTA 3VR5A 1KAQA 1CJKC 3GZTB 3T4PA 4URUR 3T0IA 5CNMA 4KMMA 1ZH2A 4GZ6A 4L9WA 2Y0DA 5HKKA 4WFJA 4J1NA 4MAMA 5A2QA 1AK1A 5NLLA 3KETA 2JKYA 4BUZA 1NASA 1Y3CE 4ZQIA 3S4YA 3OP4A 1GWNA 2QV0A 5J4VA 3JSAA 1V47A 2ZG6A 1OZFA 2WD7A 3GP5A 4FJ2A 4K9QA 4LSWA 5JH7A 4B3JA 4ZTZB 1E6LA 2BN4A 4G4GA 4D9EA 1NQWA 3D7RA 1ODLA 3KYCB 1PDWA 3MWDB 1M0EA 1XJ5A 1Y1TA 4B4OA 3AJDA 5DSTA 1F5SA 1SCIA 1UK8A 5L3QA 1VPEA 1MDFA 3IPXA 3SJZA 4EZIA 4AP5A 4F6RA 5B1DA 2XGGA 2IBMA 2NTNA 1DKQA 4Z0PA 3V8NA 1VYUA 2ZJAA 3PYLA 2VJNA 1TW3A 1V1MA 2WMDA 4HEQA 4CTNA 3D0RA 3LUAA 3T95A 1DEHA 4H59A 3IA7A 2PVPA 3SKVA 3ITEA 5BUQA 2VEDA 1CUYA 5DOZA 3EF0A 4NZZA 4D57A 1OKKD 4Q82A 3EG9B 2G4CA 2C7OA 4LDQA 4REMA 3U26A 4B40A 3BWMA 2HAEA 3DMGA 5M7EA 1SZJG 4CXMA 3INNA 4OI4A 1M2OB 1V4VA 4ES6A 2R5WA 2W2QA 3E9DA 3ZD7A 1KZ7B 3UW1A 1OC2A 3HDQA 1F14A 1HRKA 1DCMA 4CHGA 1SKQA 3JQAA 3PGVA 4QUEA 5DCLA 1UPBA 4UU7A 3K0AB 4NBNA 3UAOA 3JZIA 4ZO6A 4C0WA 5IVHA 1Z75A 4PTZA 5HFAA 3HLKA 2UYHA 5T6BA 2WWRA 3ZKWA 4PG4A 5JE8A 3KUXA 3N8GA 2MYUA 4IO1A 3EIHA 3QWBA 4BX2A 3G7SA 3AM3A 3PK0A 1XC7A 2GYUA 3K6KA 4JK3A 1RYEA 4KTVE 1T2NA 3ENNA 3K72B 1JKXA 4NV3A 5FIUA 4MP3A 3W78A 1OR8A 1JKIA 4FGWA 3SZRA 3UHAA 3C6YA 1FTYA 3DCYA 3DJFA 3PU6A 4FLFA 1UXJA 3M9XA 4DMFA 3EVEA 1HR0B 1NQ5A 2B35A 4H7FA 1Z8NA 1YB4A 3VSAA 4W1SA 3K0CA 1VHDA 1A4XA 3F9IA 3IOBA 1AKTA 1B0ZA 1JLHA 3EGIA 1EFLA 4UDNA 2V97A 1CYDA 3NM6B 4LE2A 1TJ4A 4LRXA 4QUHA 1Y6GA 2NTJA 4X62B 1PFKA 2XUIA 3CVOA 3ZOZA 4R05A 1MB3A 4HNHA 1X38A 4C7MA 1TQ2A 2JFZA 4OLHA 4TYNA 4DCVA 3TFWA 2PS3A 2JGEA 3MZ0A 4PLHA 3ZLBA 1QE0A 1M6EX 4KDEA 2C3UA 1HDYA 3HCDA 1OIVA 1U4NA 4QXOA 3N2ZB 4TWRA 3VHRA 3RT1A 4CPDA 1TM1E 4BX0A 4Z5XA 4YJ2B 4IH1A 4O3FA 4PIVA 1CJCA 4LHZA 2VO1A 5KI6A 4QDJA 3AETA 4BO2A 1SB9A 1GLVA 1U3VA 4E4TA 2H65A 3UZUA 1SUCA 1Z8HA 2GN9A 2X1VA 2H1IA 2QTZA 1HQKA 4PBRA 3ZK9A 1TEZA 4WTOA 2BMAA 2VFAA 1C9NA 1RYYA 5KPDA 4K0RA 4X00A 2SCUB 4J0CA 3A31A 4L8YA 2QP4A 1ZJ4A 4GZMA 1XR3A 4CG2A 4CKBA 1E8DA 1Z39A 2X15A 1Z0AA 3UAVA 5CJPA 2XBUA 1WZ2A 4O02B 4UBJA 3R5SA 2ZT7A 5D87A 5KTMA 1RBMA 3CPEA 3N86A 3W4KA 1FFSA 4AI6A 1BDMA 1UDXA 2I4IA 3JD2A 3GPBA 2P69A 1MGOA 3HUTA 3QFHA 4PPYA 2AVDA 4ZI3A 3ZWXA 2YHIA 1T4CB 5CVCA 4DLPA 1AIPA 1C3OB 1P6QA 1SA0B 3PXBA 7MHTA 4KN9S 5BP7A 1V1MB 2VTVA 3H5OA 2BFBB 4N5NA 3FCYA 3ZEIA 2V5UA 3BMNA 3HU1A 3JZDA 1ML4A 4BTVA 4ETIA 4R3WA 3KKPA 4CETA 4PXAA 1R7RA 4G4IA 1RKUA 4JMPA 3V80A 2I3AA 3ER6A 5AVYA 2CKMA 2QRPA 3U4IA 4JLDA 1TK2A 4WD3A 1TJ3A 4EIWA 1QGDA 2HU2A 5MDHA 3OTHA 5EIXA 4WZBB 2C4UA 2JL1A 1J5EB 3AM1A 1XPRA 1SVSA 2V59A 3JU3A 5AJVB 3KR2A 1O7JA 5I9IA 4BKMA 4ILEA 3QE4A 1I4WA 1YBMA 3SSOA 1VHWA 2OCYC 2G17A 2PSJA 2PRSA 2P3QA 2XNSA 2PGAA 1KOLA 1LSJA 3AB8A 2Y27A 4RLSA 1OGYA 2MHCA 1MQ8B 2WTBA 1RWOA 1MC4A 4I6EA 3RUAA 4YJFB 4ROSA 1QANA 1Z4LA 4YREA 1QIJA 1JHMA 3PNOA 3T7TA 4DG5A 3PKZA 2EZ9A 1PVOA 1GAXA 1GPBA 3A32A 1E2HA 4RHEA 5KB3A 1H23A 5J4LA 2CB9A 1T25A 2NXCA 1EG7A 2PG3A 3HDJA 4ZVRA 4C4XA 1AN0A 1QJ4A 5K5EA 3GNLA 2UUOA 3JS5A 2C78A 4PR3A 3IQEA 5K3OA 3NVMB 3QEMA 1FYWA 5CLFA 3UKOA 1A5SB 3TO5A 5A05A 2FWPA 3EDMA 4UFPA 4TTQA 4AS1A 1NIPA 3G2QA 1UBOS 4X9XA 3DE7X 3EIUA 4MUMA 2AFIA 1G41A 4M0KA 5CLGA 2IU0A 4KDFA 3R41A 5JQGF 5KZMB 5ECGC 1KGSA 2RCYA 1VFNA 3KZOA 1MEOA 3KE9A 2NYRA 1KY5A 4US1R 2LCIA 1Y37A 2QGZA 4IZIA 3PNLA 1WEHA 3A58B 3IPAA 3MYYA 1RAHA 3Q11A 1FU8A 2OHIA 3H5TA 4BNMA 1A1SA 5JAZA 4F21A 1YB6A 3DBVO 4LV6A 3PEUA 1ZM7A 2Q1WA 4OSPA 3VPXA 4DDKA 5IT9A 2D1YA 5AUPB 3L7LA 4LS3A 1TK3A 1YOVB 1OV4A 4OGLA 3TUIC 3RFXA 1NY6A 4JC5A 4MS4A 4UCQA 4RD0A 3WGVA 3LW8A 4ZVQA 3KEGA 4YAJA 4FP9A 2ZYRA 1SD2A 1JE0A 1EX6A 1OX6A 1QXSA 1XKQA 2A0FA 1P4SA 3P0EA 4XVQA 2QK4A 5LLTA 1NYRA 4WGGA 4G81A 3V48A 2ID8A 3MK31 1JFLA 3WB1A 3IJ5A 3QEOA 4QD3A 3EGVA 2H08A 2ZKLA 4R1QA 5BN5B 2NO4A 2B8NA 1G8SA 3FCAA 3PDIB 2IYFA 2O14A 2RBKA 3LLCA 3M4NA 1N2ZA 4ZVOA 4EO7A 3TWOA 2B6HA 5B3LA 3CZAA 3FSGA 1RW4A 3OE5A 4IXNA 3SZLA 4YPOA 3KTAB 4P93A 3LC0A 3K0FA 2D2IA 1GRVA 2QTFA 4BNIA 5IYZA 4FSDA 4U6NA 5FRDA 5LN1A 2NP6A 4MV4A 3GLIA 4Q1DA 2NX2A 4FE3A 4KLCA 3WMWA 4DLVA 2VK8A 3I01M 3PX2A 1AQYA 3PUVA 5CMLA 3SCZA 2LWIA 4UUQA 3IS3A 1Y9ZA 1X1RA 3W2EA 1NUTA 2OHJA 3DWGA 1VB3A