4D97A

Salmonella typhimurium d-cysteine desulfhydrase with d-ser bound at active site
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
328
structure length
327
Chain Sequence
MPLHHLTRFPRLEFIGAPTPLEYLPRLSDYLGREIYIKRDDVTPIAMGGNLRKLEFLVADALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLDLFNTQIEMCDALTDPDAQLQTLATRIEAQGFRPYVIPVGGSSALGAMGYVESALEIAQQCEEVVGLSSVVVASGSAGTHAGLAVGLEHLMPDVELIGVTVSRSVAEQKPKVIALQQAIAGQLALTATADIHLWDDYFAPGYGVPNDAGMEAVKLLASLEGVLLDPVYTGKAMAGLIDGISQKRFNDDGPILFIHTGGAPALFAYHPHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-cysteine desulfhydrase
publication title Structural and Mutational Studies on Substrate Specificity and Catalysis of Salmonella typhimurium D-Cysteine Desulfhydrase.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 121
structure length 327
sequence length 328
chains with identical sequence B, C, D
ec nomenclature ec 4.4.1.15: D-cysteine desulfhydrase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d97A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d97A02
5J5VA 5JISA 3IQIX 2CLIB 1K7EB 1P5JA 2CLHB 5E0KB 2C2BA 5I6DA 1J0DA 2TYSB 1FUYB 5B3AA 4LI3X 1UIMA 3BM5A 5CGQB 3X43A 5C3UA 1D6SA 3R0XA 4WX2B 4H27A 4JBLA 1K8ZB 4NEGA 4L3VA 4D9EA 1KFCB 1X1QA 1K8XB 2CLFB 4LMAA 3SS9X 1K7FB 1VE1A 4D9MA 5HBGA 1TZJA 2CLOB 1VE5A 2O2JA 1F2DA 2ISQA 2J9ZB 4Y6GB 1J0BA 1A50B 1TZ2A 4L28A 1QOQB 4IL5A 1BKSB 2RH9B 4PCUA 3IAUA 1KFBB 4L0DA 2ZPUA 4ZU1X 3RR2A 3VC3A 1TZKA 1M54A 1A5BB 5DW0A 2RKBA 5T6MA 4HO1X 2Q3DA 4D96A 1TDJA 3PR2B 4D9NA 2ECQA 2CLEB 5JJCA 2TRSB 1CW2B 5B1IA 5KINB 2PQMA 3CEPB 2GN1A 1WBJB 5I7OA 4D9IA 4XUGB 1KFJB 2DH5A 4AIRA 4ZQCB 1TZMA 5B53A 1Z7WA 1KL7A 1FCJA 2JC3A 3T4PA 4HPJB 4OFXA 2J9XB 3DKIA 1Y7LA 3L6RA 4NU8X 4D9CA 4QYSA 5D87A 4D92A 5D84A 5DBHX 3VSAA 1BEUB 5EY5B 5B55A 1UINA 4D9BA 2WSYB 1A5SB 3HMKA 2EGUA 5I7AA 3IQGX 1V71A 5B36A 1C8VB 3L6BA 1RQXA 3FCAA 2ECOA 4ZU6X 5IXJA 5D85A 4D8UA 2ZSJA 2O2EA 3L6CA 1K8YB 1KFEB 1QOPB 1J0EA 4HPXB 3PC2A 4D97A 4KKXB 1C29B 2DH6A 3IQHX 1V8ZA 4F4FA 3X44A 1OASA 2J9YB 2EFYA 2D1FA 3DWGA 3VBEA 1PWEA 3ZEIA 5J43A 4D9GA 2V03A 4D99A 2Q3CA 4HN4B 4LMBA 2GN2A 4D8TA 5IWCA 1J0CA 3V7NA 2CLLB 1V7CA 2TSYB 4AECA 3AEYA 4I1YA 4D9FA 1UBSB 1TTPB 1WKVA 5DW3A 3TBHA 1WTCA 1KFKB 3VSCA 2RHGB 5I7HA 5DVZA 3SS7X 4L27A 1TYZA 1TJPB 3DWIA 3SPXA 2ZR8A 5B1HA 4HT3B 2BHTA 1WDWB 2CLKB 5DBEX 4D8WA 4D9KA 1J0AA 1K7XB 1O58A 1PWHA 5CVCA 3R0ZA 1C9DB 5KZMB 1Z7YA 5BW6B 2BHSA 1E5XA 1CX9B 1TTQB 5D86A 1K3UB 1JBQA 2GN0A 5IW8A 1VB3A 2Q3BA 4COOA 3PC3A 4OREX 1A5AB 5I7WA 5I7RA 2C2GA 3PC4A 3AEXA 2CLMB 4JBNA 3VSDA 3FGPA
chains in the Genus database with same CATH superfamily
1FF9A 1GFWA 4O2LA 5A03A 3W5AA 1BFDA 2JFOA 2BFCB 2VJCA 3HCRA 3OTWA 3QE2A 4FLEA 2D2FA 2R1UA 3HCAA 4X6YA 3WJ1A 1OZHA 2J85A 4B35A 3FR8A 4Z7OB 3O03A 3AVYA 4EB8A 1BCSA 3IAS6 1KVRA 2JGFA 5CGQB 4CMGA 3B6EA 4G8CA 3BRCA 4OKSA 4EW2A 4IG9A 3WGKA 4HX2A 3WJ2A 2QX4A 1OXXK 3IV6A 4WY5A 4F3YA 3H17A 3TBFA 3IMKA 3PXDA 3TLAA 4ZJZA 1KJZA 3MB8A 2R751 4G25A 5MGBA 2C3YA 3UWDA 3BA1A 3FTCA 1SU8A 2QYTA 4D1YA 4DA0A 2HWKA 1WB9A 4M83A 4R4JA 5CDYA 1GGNA 4ARUA 1KO4A 1OTHA 3VQTA 1E2QA 5HEKA 3DDHA 4E2FA 2QZ4A 4DLPA 3K6KA 4EENA 1NTRA 3EARA 5KQGA 2E4YA 3DDNA 2F6RA 1GARA 4D4KA 2GK4A 3PNLA 3TK1A 2GARA 5JSUA 2CYCA 1KZ4A 4XDZA 2ZTMA 2CW5A 4QWWA 5ERGB 4MR7A 3ZCQA 4PC1A 5HK8A 1RP7A 1ICIA 2IZ6A 3CM0A 3JALA 1VL0A 5TF4A 1N32B 4Q1VA 1M1ZA 1WHTB 1EHIA 3H1BA 1HA3A 1R0BA 1LSJA 3LZCA 4BLPA 5K9ZA 2DQKA 2BIFA 2F4NA 3IQZA 4QXRA 1Q44A 4LFCB 4QFMA 4TLCA 2EV9A 3TGWA 3EGDA 5LJIA 3BD6A 1XEWX 1A9YA 1ZUWA 2DR0A 3T9FA 4DIBA 1K5DA 2LVBA 1YKSA 2BELA 2AOTB 2AS0A 4NZNA 5DNCA 2EP8A 3NLLA 5JBIA 1CCWA 5BUSA 2HYIC 1Z4NA 2GD6A 5M2QA 1MKYA 2BR3A 2PVCA 3MTBA 1IBLB 1EGAA 4URYR 4M1QA 1NN0A 5BRAA 4CLXA 5EJ4A 3ZZMA 3TSZA 5JNRA 3EVNA 3ZKAA 2HK6A 2VJYA 1V8PA 1JV2B 4A8JB 6CHYA 1HLFA 2IYQA 5JJLA 4FIZA 4AYWA 2B35A 4GWLA 1TU0A 1XX6A 2YHBA 3NX4A 1GNPA 1J09A 1IEXA 4D0LB 1Q1QA 2RAVA 2YV4A 3PPIA 4NFLA 1UEJA 3X1ZA 1U8XX 4UCQA 2APJA 1A69A 3CB4A 4NI5A 1QP4A 1JTFA 1TIBA 2P8JA 3PEVA 3TZ6A 2FW6A 3RSOA 4JJKA 1W5TA 3GFTA 4DMLA 3EWNA 4HUJA 4I4TB 4JBYA 4ES6A 3ZCSA 2Z6QA 2HI0A 3DNMA 3FMPB 1X7YA 2QT1A 4ALMA 4ENPA 2UV8A 1SUEA 3E3OA 2XEXA 1L6RA 2CDRA 3BEOA 4HQNA 4KRGA 1XHEA 1RAAA 1T1RA 4UHEA 4WESA 5CRIA 1BWSA 1YO6A 1FZQA 5K51A 1FSSA 2H1WA 3FDXA 2HA6A 3P4YA 4CT0A 1P3DA 4NEHB 2PZBA 1IWBB 1DAPA 1OIXA 1YQUA 3INGA 2OCAA 4EUNA 3RHSA 3KU4A 4WCFC 1Z2OX 4QXPA 1W94A 4Y2SA 1X7HA 2IUEA 1R3DA 5TB5A 4MA4A 1VRCA 2QJFA 1AN9A 1C7RA 3MS2A 4MMYB 3W04A 3G9TA 4CIWA 1AB6A 2YJNA 3OWXA 1EUCA 2E3JA 1O87A 4U00A 4WIAA 3UJ9A 4IQ8A 4EAAA 3GLGB 3M70A 5K6AC 3VV2A 5EG5A 1ODTC 5C80A 3ZJYA 5IJ0A 5JWRA 3I1FA 1Z16A 1IY8A 3L43A 3SYRA 5DNWA 2GKSA 2GXSA 2JAXA 3GMTA 3WGVA 1X1QA 1NOIA 2IEDA 3G0IA 3HJGA 1MDFA 3L7LA 4LY3A 4O1IA 4OYLA 5AJUA 1N3BA 3SJCA 1YB7A 5ALDA 3VR5H 1Y9JA 3BZBA 1KKUA 2D5AA 4G5XA 5G2OA 1NM5C 1U98A 2R65A 2EHDA 1Z22A 2W98A 3BXOA 3K2IA 4Y2QA 3AVXA 4EJSA 2L0XA 1GGJA 3PIRA 1A4UA 2LWIA 1C7ZA 4QJ3A 2ZBEA 4AUMA 4TPKA 1L4HA 2E5FA 4F2HA 3T5TA 4JA0A 3I0MA 4KDRA 2W93A 3FWKA 3PR2B 4F97A 2DPGA 2VNKA 3GJ7A 3AR6A 3C3WA 4JX8A 4WFIA 1HDIA 1IDN1 2IIPA 1U3TA 3B36A 2K4MA 4PLZA 1A9SA 1FP4B 5AKJA 5FOVA 5SICE 3U37A 2JFQA 2WZDA 4E5PA 2MINB 3FWYA 3W4KA 4FGUA 1C50A 5BW8A 3AUJB 3AW8A 1X7ZB 2PKYX 1GZ6A 1CY8A 1XTJA 2J3QA 2JLAA 3L82B 3N8GA 4EG0A 4BE9A 5AKYA 5KI6A 4GAEA 1CT9A 2FEOA 4QYSA 3JR7A 2B5WA 5ALKA 1ZUNA 2JB9A 4GC5A 3RANA 1OI4A 5ICFA 3HFGA 3T38A 3WLLA 1DEAA 1EGVB 1USGA 1USIA 5REQB 2RH4A 1D1SA 2ENUA 1C8VB 2BMAA 4RHYA 1WZUA 5IZCA 2VYFA 1Q3TA 4B9EA 1VMAA 1WY7A 1JIIA 3S1SA 1G2OA 1WZIA 2XZDA 3MINB 3NHJA 4K6CA 1U0OC 3P9XA 4LXUA 1NJ1A 3NEJA 4RSGA 1GKIA 3H1PA 4WFQA 1TD1A 4OQXA 2ZIUB 5IKOA 1VOTA 1JEJA 4CQNA 3CLTD 3HG7A 2BMVA 2JJ1A 1D3AA 1M1NA 4MA0A 3BMXA 2PJUA 2Q1WA 2DPYA 4OQYA 4UCWA 2GCEA 2GBCA 3U7QA 5E1BA 4HFRA 1MZPA 1PJ2A 4KFSA 1P4AA 2QGNA 3MN1A 2FX3A 1JJVA 1F9AA 1FVHA 2ZYSA 4I55F 1FFGA 3LY7A 4WSOA 2FPKA 5B7NA 2BFFA 1U2GA 2ZAIA 3AZOA 5EESA 4EPRA 2EIHA 2HF7A 1YQXA 4CFYA 3MERA 5DW3A 4LTNA 5A4FS 2IY9A 2VHYA 1GPNA 4YQZA 4L4RA 3U5ZB 2A5FA 4NECA 1QE5A 4BE4A 1W4AA 1QV7A 1PSDA 3KJXA 4OMUA 1MHTA 2IOFK 5JRJA 1II0A 1CUEA 3LJKA 1WDWB 3GG9A 3LE8A 4JLBA 2PR2A 2AC4A 2I6XA 3DTYA 3FOFC 1TPYA 2C98A 3L0YA 3R7WA 3GAMA 4AVYA 4U7TB 3PEWA 3SKVA 4EFNA 1QJ4A 2Z43A 1KE1A 4POOA 3P2IA 1UZMA 4TT8A 4YLYA 2ZB4A 3H5NA 2RJOA 2HLDD 3FOZA 5EP3A 5U4XA 4WZAA 1ML4A 1Q16A 2PHZA 1V4VA 1WB4A 2FW1A 4MUBA 3W2GA 4ARBA 1V6SA 4IJQA 1E2IA 4PXYA 4C3UA 1OX4B 3AH8A 1CUFA 3DL2A 4PPQA 3RRJA 2BHLA 5K3DA 3F4LA 3QLTA 4YXWA 2WT8A 3T5CA 4BASA 1IM8A 4DBVO 4AJ4A 4FGSA 2PS0A 3ZQ6A 1QZTA 3I45A 2C4MA 1N1MA 2B2NA 2HAEA 2O1EA 1MJHA 1Y5NA 3FPEA 3I04M 4LI3X 1K89A 4HJXA 1W6RA 3EGIA 2PQ0A 3P19A 1Z47A 2R48A 3O2NA 5KYXA 1Q0TA 2IWHA 1E1QD 3I92A 3HACA 5FH9A 1YRBA 4DCOA 1XXHB 3B3JA 1V43A 3LY8A 4EPYA 4CKCB 5CPFA 4Y9RA 1LDGA 2ZPTX 3ETGA 2X7JA 2YW2A 3GEMA 3L0OA 4J49A 1SN7A 2Q2OA 1TUIA 2R62A 3NT2A 4C3OB 4MKXA 4R1LA 4XM0A 2CYBA 1EXWA 3L9WA 4I50F 5HHTA 4XYEA 3MYYA 5IKEA 5LQCA 5DHAA 4DL9A 4K9DA 2IZZA 4JT2A 1ZXBA 3K1AB 4FFBB 3IKJA 3DV9A 4Y6OA 3ZXSA 3M9WA 4JGGA 4MW0A 3NWOA 1QG0A 3PVCA 2DLDA 3FCSB 4P36A 2P6PA 1UC5B 2VHCA 1SELA 2I55A 3GPBA 3KLNA 4F5EA 1THMA 4WL0A 1P7PA 4MUEA 3AF0A 5KC9A 1JEQA 2NT4A 3EAGA 1V16A 1SEPA 1NYTA 4G5QA 2BKAA 2G36A 2YWDA 2GZDA 3OJWA 5G4LA 3W7AA 5IHXA 3SZOA 1Z68A 4HGQA 2UZ1A 4MLZA 4HLUA 2FJ0A 4LW8A 2Y1CA 1QQ7A 3WG9A 1JPUA 4L8FA 1M6EX 3LW7A 4IIFA 3BWXA 4FR0A 4IFTA 1SAYA 3EEQA 3WFJA 4BGEA 1IEVA 1SG9A 1WR8A 1ZMTA 4H3KB 4YREA 3DAYA 2F55A 2PUTA 3A6DA 1N9KA 5K8JB 2ACKA 1O4WA 2D1RA 3DZJA 3JYOA 2HJ9A 4JEUA 1P5FA 1JAYA 4N0DA 2UUOA 3CZ4A 3LGXA 2PUEA 1GSIA 3LX6A 1TM5E 2J32A 4OGKA 5ULLA 3KSMA 1WXHA 3QHAA 3QKSA 2ZBRA 4UASA 4D57A 3THSA 2QB5A 1P31A 4AW9A 1IJEA 1UBFA 1XEXB 1O89A 3HXPA 3EQ8A 4B8ZA 4ZKEA 2R8ZA 1WDKA 4V03A 1OJ7A 4B71A 1ZBQA 4YUYA 1YBMA 4ZYWA 3H2BA 4RL4A 2UUAB 3D0RA 2OGTA 2OORA 3EFOB 3HCDA 1GRVA 1CEQA 4PSAA 1BE8A 3F97A 3HJUA 1UBSB 3EH2A 3WA7A 1VYHA 2QYSA 1OIVA 4JLNA 4DAOA 4OHYA 5KVVA 2FI1A 2W5UA 2VP9A 5H59A 5HZHA 5J59A 2P9YA 1Z36A 3DXZA 1G64A 3FVQA 3HKBB 4LWQA 5G4KB 5C7IO 3DTVB 1PL8A 4N5IX 2G9UA 4XSHA 1F0KA 4U9HS 4CF5A 5MFPA 4OFZA 2PWPA 3I39X 2WB2A 5A9TA 1RXIA 3W7VA 1NF9A 1F51E 5HUJA 5EA2A 4UU1A 1UEXC 1E2DA 4AM8A 3B48A 2PANA 4BIMA 3V2UA 1H0KA 1Y8AA 4FX5A 3QBEA 4JUCA 4PSKA 4CR6A 5AKKA 5I5GA 2XD4A 2IU4A 1Z2EA 4BIIA 4BNKA 3PC3A 4OQQA 1V8DA 1U7ZA 1RI4A 3UK0A 4DMCA 1RZVA 3UKOA 4LDRA 3ZHQA 1A8HA 2OZVA 3HNOA 2PQ6A 4Q24A 2WMYA 5IDWA 3L1IA 3OFNA 2P35A 3CKKA 4YRLA 2VK4A 4IJ5A 2F9FA 4YC7A 2YXDA 2VF5X 4P4UA 1EFCA 3L7BA 5CLFA 3NT5A 3VZBA 3NHZA 3LTEA 1KMNA 4ND7A 4TTQA 1PRYA 4H1HA 1N2IA 5A6VA 3VTZA 2VP2A 5BQXA 1PBTA 3LSYA 3D9QX 3UFXA 3E9ZA 3KTAA 1S1MA 3M6FA 4G5HA 4PRKA 4A8JC 1I0LA 1L1FA 5JDCC 2JGAA 1CZUA 3T7KA 4RXUA 3TUZC 2PXCA 4IMJB 1M6NA 5AW7A 3EIXA 4QU8A 3AL0C 3QVLA 2B1QA 1Q74A 3X1JA 1V5GA 1NJ5A 1IWOA 1W46A 2ZUCA 2J9ZB 3S1AB 4CLEA 5LKRA 3IIKA 3F9IA 1ZU4A 2ZYGA 1P17A 2PTGA 1Y8QA 1UBCA 1QRTA 2FWPA 2J67A 3KUUA 4G5SA 2JD0A 2PWBA 3PTZA 4GWKA 4TMYA 1DRJA 5CH8A 3PB3A 5K0NA 1L5LA 3VH4A 3W6PA 4H7KA 2QL6A 5KYWB 2WHXA 1KTIA 2C7GA 1ZH8A 4F9TA 5E7JA 1DKMA 2JK1A 3I9LA 1CP2A 2VZ8A 3PRJA 5KCZA 2I8AA 3HDTA 4WECA 2XCIA 4URXR 4LGYA 1GHTA 1E18A 2GFQA 3AR5A 3FPSA 4NFYA 3SXJA 3IDZA 4J16A 3OT1B 3ZWDA 3NHAA 3QBJA 4DLLA 3OD1A 2JBAA 2WAYA 1G8SA 3EXG1 3KWMA 3FIJA 4YGXB 5DOVA 4FDMA 2O7RA 2IS1A 2X41A 3U40A 1VGQA 3IAS1 2F3SA 4B40A 2G72A 4ZQIA 2NVUA 1QFYA 1NFFA 2A58A 2D8AA 4QODA 2B1GA 3FLMA 3J81A 3RYCB 3P94A 2WKQA 1BA3A 3JWPA 5CA1B 2X40A 1B74A 1IVNA 1NHGA 1UMCB 4Q1CA 2QIPA 1S8NA 2RGBA 1Z2PX 1NZJA 3MA0A 5IXJA 1C0PA 4MEJA 1DDOA 1FU7A 3EHEA 3FBTA 5E1DA 5TJHA 3PHGA 3IHLA 5DLEA 4RV4A 1PNOA 2OZPA 4IBOA 2Q62A 3T1VA 2DBRA 4C4ZA 3JTEA 3LZ6A 2PZGA 3HWSA 3MRVA 4R8VA 3GVPA 4X0EA 4PFQA 1IZ8A 4RKFA 3HJRA 4C04A 3NVAA 1BE6A 2QSZA 3QBDA 5F2NA 1AV7A 1Z07A 5L4LA 3ZCXA 4NG4A 4P33A 3CLKA 3U39A 3WKCA 1L1RA 2RARA 1SU4A 3ZTYA 1OKKD 3ZHUA 3DAHA 4GOND 2VF7A 1RSZA 2OOSA 3LVRE 2W9XA 5JFOA 5CT6A 3ZQKA 1OBOA 1MX9A 3QUAA 1TI7A 3OT4A 3GDHA 1Z37A 1PFGA 1T36B 5DXFA 4BFYA 1IN7A 2BF4A 3LXRA 1NUSA 4UM9D 2G0AA 4E31A 5K0TA 5CM9C 3C5HA 3FMOB 3O8BA 3OURA 1TOAA 3IP5A 4JJZA 5LA6F 4JIGA 2O3RA 4QDKA 1HZZA 1DAOA 2Y68A 2PU7A 3IE2A 3DMPA 1CDOA 3NBUA 4H31A 3D1VA 2GF0A 3K0CA 3NWPA 4K6KA 4F4UA 5EIXA 5FI5A 1D2MA 1WW8A 4JR0A 1ADYA 3O9MA 4IIBA 5C18A 1XXLA 1W4RA 3CE9A 1WB5A 4TWIA 2PT9A 1GGMA 2OQVA 1KK3A 2V6FA 4B6OA 4CFSA 3PUWA 3WRYC 1HMPA 2XBMA 1AQUA 1TB4A 5JCXA 3B1ZA 1N3LA 2GF9A 1V1MA 4UHCA 3V46A 1HDXA 1SD5A 1CUCA 2OD7A 3TIFA 4EO7A 3AIOA 4Q4CA 5TPZD 4Y2JA 2EOAA 3RTEA 4L9SA 2PV0A 1A8PA 2ZIGA 1MH9A 1OFIA 1IAVA 1I9CA 4E70A 1SO8A 4NH0A 1ZIYA 1CQXA 1JXAA 1R74A 3JRNA 4YAEA 5C34B 2CFOA 3Q5DA 4LV5B 4WBNF 3HGTA 5CBPA 1IN1A 3IPRA 5CH5A 1KSJA 4TL8A 1T0UA 3PJFA 4GVXA 2CGEA 4FE3A 2I7XA 4QOEA 4TROA 1T2UA 2POQX 5T4BA 1MFPA 2WAXA 3ZV7A 4BJ3A 1BKDR 3EZLA 5HOEA 4XVHA 3NVDA 4S2EA 5ESWA 5TJ9A 1FS6A 5CAEA 4NG5A 2G40A 4X60A 5EMJA 4XVRA 1TZKA 5D7BA 5T41A 3W5HA 2EATA 4BMVA 3LNCA 1VDZA 4S2UA 1TEXA 1EP9A 4W5NA 4LJRA 3M7IA 3P0IA 3K3PA 3COVA 3PLAE 2I91A 1B93A 3Q5EA 1NG9A 3RM3A 4B2IA 1J99A 2J5KA 5DCYA 1G2IA 3MPUA 1GV0A 3VHLB 1M9NA 4O4IF 4TVKA 4AYTA 3I5YA 1WUKS 1JDNA 5FNVB 5KKCA 4GZLA 4FK8A 1LBTA 1V5FA 1EDDA 1KORA 3GAAA 1ZUD1 4YIKA 3LGSA 1Z5ZA 4HH3C 5BNTA 5BXQC 3Q3JB 1FX1A 3ZCPA 4UAJA 4UNNA 3SLRA 3T8YA 1NVDA 4NS1A 1Z35A 3IELA 1ZN8A 3O91A 1PUIA 4K9RA 4Z5XA 2NZWA 2OVFA 2NU9A 2RGNA 1VL1A 1CUXA 3HK2A 5D85A 4GL4A 2I80A 4TXHA 1KO7A 1J2UA 4YJFB 3OZXA 1DAIA 1PK7A 3DMFA 5C31A 2G5GX 1VLLA 5DEIA 4BB9A 4B75A 1LLDA 4XTCS 4OKNA 2HBYA 4R1OA 2J3JA 1PLKA 2YOHA 3CKYA 3LDAA 2GYYA 3O82A 1VSTA 3OIYA 1K3TA 4BKPA 4IJ6A 2HWXA 3KYCB 3UB4A 1ML3A 4DQKA 2G09A 1FVXA 4JP3A 1LPPA 3QNWA 5CCDA 4HZUB 3FNIA 3TTTA 4CG3A 4Q9NA 1Z4KA 3FRJA 3H0CA 3LPDA 2B20A 3ZYCA 4GRIA 4EUEA 1MC8A 1NULA 1Q20A 2VKTA 3EQ9A 3BCUA 5DU2A 1Q7RA 4FHDA 3KJQA 3RYFA 1RRCA 2NU7A 2GD1O 4A6PA 4JB0A 5CFNA 3L5KA 2PH1A 3TW8B 1QHYA 3FNHA 1W1UA 2RH8A 3CVUA 2HU2A 4MW6A 5KQRA 1I80A 5BW5A 2NTNA 1TT7A 2PLAA 1XZIA 4MS3B 3CBGA 3F9CA 5DSZA 2O5RA 2CB9A 2YRFA 3WDMA 1GZ7A 3L8MA 1R8QA 2FF5A 3Q1KA 1VCHA 4ND8A 4RK4A 1P5HA 1P1IA 2N3ZA 4QEKA 4QQFA 1E0SA 1ZCAA 2FZGA 1YBAA 5HIJA 4D4HA 5F23A 3N2LA 4BV8A 1KOGA 4RY9A 3OIUA 2ADMA 3I37X 2R8XA 1EHCA 1UJ6A 3SYMA 4C78A 4D7AA 5JSFA 1Y6RA 1T4MA 2IU3A 4IEIA 1RJEA 1Y34E 1U0GA 3I0ZA 4BO6A 3SEQA 4MQ6A 2RBGA 4OG2A 3B6ZA 3OY2A 4A9AA 5JISA 1P1RA 2G17A 4QAQA 1AUQA 2MTBA 2J31A 3DEIA 4JB8A 4KQMA 2IYOA 3RRMA 5EHIA 3SC3A 3U3KA 1F5NA 2YXPX 4FDUA 2Z2XA 3OIGA 4LSZA 4ZEVA 1T1JA 2AF4C 2H1RA 2NW6A 1YRLA 1RYYA 3OZDA 1C14A 2G04A 3SX2A 2J3EA 1EDZA 2R6CA 1V1RA 2KX7A 4GPIB 1QZXA 2GX6A 4CM9D 3SS9X 3PYMA 3ANSA 3KC2A 1J2RA 4Y9SA 1T43A 4I9UA 1ADFA 3C6BA 4OHZA 1YU6A 4JC5A 4LXHA 1GAQA 1A9PA 4FJ1A 1GUYA 4BN4A 4FFDA 3A8TA 5IVIA 1A71A 2EW2A 2IK8A 4B4OA 2H7CA 4KSCA 5HRUA 1IY9A 3KPJA 3ZLJA 4WK2B 1XEWY 2MSLA 1X7XA 3G6WA 3A7DA 1U65A 4DRZA 3CE6A 1IUOA 3AP1A 5E4JA 1S7CA 3LKDA 3KSAC 2J0VA 1JUDA 2R1VB 1ZRHA 1NF2A 2PZEA 3E15A 2QVXX 2IOYA 1CTQA 1BROA 2VS1A 5LZ8A 3D1JA 4LN1A 1SKBA 3A9CA 1QYDA 3X1YA 3BOSA 4Q3LA 1QAMA 4CRWB 2B4YA 3I4CA 1P2SA 1IIRA 4WNAA 3ZE6A 4A23A 1H6DA 2MYPA 1XQWA 2X8WA 3BZUA 2OGWA 1ZM9A 2A78A 2QRKA 1E9VA 1W76A 3JPWA 4Y1GA 5IJ9B 4NVRA 1DJNA 4FFNA 4XWOA 5B6PA 3NUGA 1XDSA 1LPOA 2ZJ4A 2FRDC 3USES 4BB6A 3ESBA 4DQVA 2NUTA 1MV5A 1XU9A 2PS3A 2CE7A 4I8XA 4WXMA 3ZE2B 1G1AA 1U80A 3VU1A 2IPMA 4A16A 1YDEA 4TXMA 5FL7D 4WZZA 2RGAA 4I66A 3OCVA 1J23A 5HFNA 3SE7A 1OIWA 4ER6A 1Y48E 4B7AA 3IQHX 3WLTA 2HY7A 1FP6A 3C5CA 1XZGA 2AXNA 5CEFA 1OASA 3PHBE 1KMCA 1QLWA 2JBWA 3RADC 2OBNA 5BQ5A 3H5OA 2ZI6A 2AN1A 2FDRA 3NNNA 4O08A 4DIEA 4K6FA 4JHLA 3JD0A 5ADWA 3ZWCA 3UMBA 4Y1FA 4OMFG 2O05A 3WSWA 2AE1A 1CRPA 2OHXA 3R2JA 3CRQA 1ZD4A 3K4HA 1NF3A 4MNTA 4MQBA 1NBOA 2G0TA 1KO5A 1O7JA 1ZGJA 2V96A 2I7DA 1TA9A 1VL6A 1YDGA 3WNZA 1L7PA 5I4BA 1DC6A 1ID8A 2QJWA 1PX0A 1SQFA 2BP7A 1DELA 2FUNB 2GTIA 1OWLA 2J5XA 2KJQA 2FSIA 2QTFA 2FZWA 2HNBA 3AXTA 1DQNA 4MGKR 3JARB 4Q9JA 3A6EA 5E95A 1ONBA 5G41A 3SPXA 4Z7NB 6PFKA 5KSWB 3H9EO 3M4YA 1JAHA 4PAWA 1QNFA 1BS9A 1EWKA 1Y9EA 2WSLA 2R8BA 4KG7A 3GFFA 5EFOA 3C5EA 5EXPA 4U8HA 4RZ2A 4XZ3A 2WHQA 4WTOA 1CPYA 5EXDA 3PITA 2P2SA 2VPZA 3CUUA 4LBYA 1HH4A 4NBUA 1C2YA 1N2SA 4PLCA 3TAHA 3A3PA 2JLRA 1NXQA 4FZ3A 4XFKA 2I22A 3M6LA 1HDRA 1U11A 4Y6SA 4AS1A 4RA9A 4YJ2F 1G3UA 2ZKIA 2EQAA 3OA2A 4PTYA 1VKNA 2YYSA 3O74A 3T5DA 3QA9A 2W11A 3L8GA 4FSHA 5EC8A 1ECPA 1RKUA 4QL3A 4B3GA 1QRDA 4GC9A 4MVJF 4NYMR 4DLAA 4NV3A 1M1YE 2P0YA 3HABA 5UKDA 5LMNB 3SR0A 1VPWA 1HX7A 2ODWA 1TD9A 3DM5A 3L4SO 3N70A 3Q3HA 5JXGA 1P0CA 1Z4JA 4KLNA 4Q15A 1WCWA 4NBRA 2Q4DA 2JIOA 1Z83A 2XDQA 3BTVA 2YV2A 3QMMA 3L0SA 5FIUA 2XF8A 3CVXA 3DWFA 4CV1A 5EI5A 1JQAA 2GESA 2YVLA 1TMYA 2VXCA 3TL2A 3OETA 2RCNA 2N42A 4CKBA 1XN1A 3BRQA 4YMSA 1VMIA 1G8HA 2HK8A 2JJ1D 3F47A 3RSFA 2PMDA 5J1TB 1JL3A 1MC4A 1ST3A 4OVKA 3O84A 2I2BA 3PGMA 2X8LA 2WLTA 2BMWA 3CG0A 4IGEA 1K9SA 2IYNA 5BSVA 2GPAA 1Z8FA 1R0LA 2BM9A 4RVNA 1AUXA 1IXZA 1GZ3A 4O5OA 2WM8A 3UGKA 4IW3B 1N2JA 5ER6A 3L06A 2EFCB 1OWNA 3MTAA 3WIOA 3ZW7A 4K86A 1P5ZB 5A7GA 1J21A 1F2UB 1I2AA 1SBZA 3CCCA 1GR0A 2YZ2A 3E05A 3K8OE 5FYQA 3R9IA 4F3CA 2XTAA 4HQOA 1PJLA 4DZZA 4X1KA 3SJ7A 4JT9A 3RJZA 1V6AA 2PKQP 3QLVA 5J2TA 1GL7A 1W4ZA 4HP8A 4BMSA 2C5AA 2VRNA 4DSZA 1UINA 4PNPA 4MLCA 3JASB 2C4KA 1HSZA 3EVDA 2VDUE 1CZNA 3P71T 1E7YA 2PFSA 2JJ2A 1JYSA 3AY6A 1B76A 1HE1C 2Q1YA 2V3WA 5F33A 3STUA 1GIAA 2WIDA 4DV1B 2Y0CA 2C2ZA 4BYMA 3ID6C 2RH5A 1JT9A 2PNFA 1AK2A 3TOCA 4HNUA 2YWGA 1E6EA 5IBQA 2BGWA 4MUAA 1UPTA 1WZNA 3X44A 4CJXA 4MVJP 2ID9A 3OY7A 5KSPA 3P2JA 5F7XA 3CJQA 3E7XA 4OKIA 3BRWA 3MS7A 3NTRA 3B7PA 3EUAA 1Z5VA 4WLFA 5E1MA 3W2IA 3JAKA 3OCXA 4P58A 4LX8A 1MJGA 5ECDA 1AUOA 1VXOA 2EKQA 4BNIA 3VH3A 1Q2XA 2CDNA 2VP4A 4NNOA 4J0CA 2V45A 3L7DA 3NALA 2IZ0A 4C30A 5BW4A 2V7GA 5A6SB 2AD1A 1WTCA 2IV7A 3Q8MA 4HDRB 3M49A 1KI2A 2Y77A 5I7EA 2NO9A 1R0SA 4KR2A 2IYVA 2JCBA 1C1DA 4RM3A 2QRZA 2E4XA 2Z1DA 4EA6A 1YL6A 2YN0A 1FTSA 3BF8A 2DP4E 5CB4A 1DBWA 2CV1A 4DQUA 2PK3A 3N75A 2BGTA 4LDPA 5L45A 3BN3A 5L95A 2FQXA 4BKMA 5LIRA 3EEFA 1KJIA 3LC2O 4IIDA 2X9QA 3R3ZA 5BSTA 3FY4A 5JFGA 3QVMA 1ZH4A 2H9AA 4FWIB 4RCZA 1BN7A 2Q4TA 1R4NA 1GZUA 3OIFA 1YFLA 1DT3A 2PH7A 4ZIRA 1JMYA 3KXIA 5I7WA 5J9FA 2EXXA 1GUAA 1XDZA 4HLCA 2H4YA 1WIWA 3O9ZA 5HQJA 4HXFB 2FFBA 3PIDA 4JLVA 1GPKA 3QPBA 3RVJA 2DPXA 2BTOA 1YHZA 3B9BA 1GCOA 1B8NA 1LBSA 4HWRA 4P4SB 3PKZA 4C2AA 1MABB 3EGCA 4RCYA 4NBWA 1KQ3A 3P1JA 3W8NA 4CLDA 5AQ1A 1E3WA 2TYSB 5I8WA 2V8BA 1QIFA 5DOZA 3ZXYA 2Q3HA 1K0FA 4C6TB 5EJ8A 2X5KO 1TJ4A 2HKIA 3H1AA 2GS9A 2PGJA 1YU9A 2VWPA 4PWYA 3QG1A 3H6HA 1ECFA 1Y1KE 4TS1A 5FWXA 4EY5A 3N53A 2D0PB 1F06A 5HILA 4KK4A 4OYYA 1J0BA 1L1EA 3N8HA 3PSHA 4D46A 2DOKA 1SVUA 1MQAA 4LDZA 3A2MA 4M8SA 5LXTB 3PF8A 4YEDA 3L0ZA 5GIPE 1I2ZA 2FMHA 3DVAB 1M8FA 4R83A 3RU7A 3SF0A 4MRMA 3MJFA 4Q82A 4Q9IA 1UT6A 3KJHA 3NBMA 4AUNA 1KRXA 3KZOA 1NZFA 3BBLA 4OXIA 4HGOA 8ATCA 3N76A 1K6IA 1AKNA 4FMPA 3RROA 1TECE 3DS8A 4KXUA 2H2DA 4ZTBA 2GDZA 2LRHA 2GBGA 3MT8A 3WVNA 2A7XA 4G01B 2E5LB 4Q4DA 5BUCA 1E3JA 1RABA 5FWYB 1VCMA 2PBFA 1E2KA 4RELA 1YHNA 3DKVA 2XDYA 3I2IA 4M9ZA 1DAGA 1EJ2A 5CHEA 1P9LA 4D92A 5DGHA 3UZUA 4RFLA 1JR6A 1XYGA 3WL4A 3TYXA 1EUZA 2QAIA 3U0VA 2DB3A 4HSGA 4MH0R 4DBLE 4B6EA 5CLQA 1QIKA 4LJSA 1P61B 2QSJA 1NYRA 4KQWA 4MCHA 5J2UA 4B43A 2DRIA 2WTXA 2ZBQA 2OR3A 3NVMB 1CDZA 1Y4SA 3HSYA 1OVGA 1UKYA 3C6XA 4PYLA 5D8DA 3WBKA 2Q99A 3LQQA 3I6BA 2WRZA 1H1DA 2R1TA 3PC2A 1I3KA 4RIFA 1H9BA 3NCTA 2VZLA 2OCPA 3MMZA 3MBIA 4NZOA 3ICWA 4Z4GA 1OE0A 1PNVA 1U8YA 2OQRA 3ANTA 4IQ0A 4D3SA 5CYGA 1JA9A 1O0SA 1PG0A 5BV1A 3AL3A 3MBOA 2LIVA 3GUZA 4EYOA 5IJXA 1CY6A 1TVCA 1KPGA 3O8OA 5EKDA 1YCHA 5EHNA 4QX6A 1ZUIA 3LSTA 3AESB 3ZV5A 1XZMA 5IXYA 1J0XO 2PGAA 1SRQA 4ZO4A 3RVBA 4I55B 1MRNA 5LQSA 4BFUA 1H05A 2P9JA 4G9GA 4O33A 4N5LA 3DT9A 1PAUA 2GNPA 1E32A 3ML1A 4ZYUA 2Q9UA 4L7QA 4PQGA 4TUYA 3RVOA 4A1FA 4AY5A 2Q4OA 4CLOB 4EKNB 3B9QA 1SUSA 5CTJA 4DRXA 3JQBA 4CKEB 1UPAA 3LU1A 5FOSA 1U2QA 4KHZA 4OK6A 4S0ZA 1ZD8A 2P1RA 3RC9A 4ENSA 3CVVA 4FYWA 5AJHA 1ZK1A 2X0FA 4PIPA 1XQYA 1VE6A 1AHIA 5CDSA 1ODKA 5TY0A 2QNBA 1M0WA 1E2HA 1AJEA 3PI7A 4PCAA 1I5OA 2XUAA 3GN1A 3K9HA 4NCNA 2I99A 2ZETA 5BYKA 1CK4A 1CFZA 3GV0A 4MIOA 5DHFA 2Q7OE 1Z15A 1XL0A 4P6VF 4WZ6A 2G5TA 2X0DA 4R8MA 4AKSA 1X8XA 1KGDA 4RDHA 1AS3A 2GEFA 2DQ4A 5DYWA 4EBBA 5LZ7A 4LRYA 3N3AC 3BKWA 1ZBDA 2PWYA 4YAJA 4F45A 3GHYA 2VAWA 4G1FA 4TLMB 4MRPA 2YVUA 4X7BA 1SUBA 1LVGA 2PA3A 2PSEA 4I19A 4ZAGA 4B4UA 3KP1A 2Z04A 2CEAA 4PO1A 5A4KA 3U6BA 5EE9A 4XQCA 2X86A 1NVGA 3RBAA 2VDLB 3WHKA 2XQFA 3NZEA 4AU1A 4ENUA 1BOFA 2BFEB 4QBFA 3C3XA 1EFAA 2JG3A 1D0SA 2XD9A 4EG6A 4F6RB 2OWEA 4R1SA 1HL7A 3JWIA 4X6XA 2I9KA 1AA9A 1W29A 5LQMA 2YJ6A 2RK4A 4I50B 5DN9A 4UHKA 3H83A 1CZKA 2E1PA 2G83A 4UTPA 1OLOA 1UOEA 4NAUA 2QRGA 3B53X 5DLYA 2OOKA 1M2NA 2VJMB 4RHFA 4D9IA 4X3OA 4UPEA 3EPHA 3WAKA 2FAXA 1GV1A 4HGNA 3IGFA 1QRAA 4LVCA 5AK5A 4L5IA 3DA8A 2JC3A 3OTGA 5HS4A 2ZSUA 1YQDA 1ULSA 5DYYA 3REOA 3MWDB 1T4DA 1OT5A 3GCGA 3PNBA 4P98A 5KYUA 3TQFA 2VQEB 2F8SA 4ACAA 1T1GA 2GRUA 3GYBA 2V0CA 4RANA 3MUOA 3HYNA 3SI7A 3QKRB 2PFKA 1G20A 2PEZA 4XB2A 1OYVA 2ADFA 2AXPA 1SOWA 2VT3A 3DOUA 4JD5A 4QPPA 4RORA 4UEQA 2WPDA 4XTRA 3U26A 5JNVA 5TQ2B 1YBHA 2RGRA 4QUDA 1C1XB 2OMEA 5EL0A 4QU9A 1JYFA 1Y3CE 4JGBA 5GV8A 3GLIE 4UBJA 2DH6A 4IUBS 3VPFA 4OQDA 5BV0A 1SHUX 3CF4A 1DZ3A 1X8JA 3ELYA 3QLEA 4ARVA 1PWEA 3X2EA 4NBVA 4YNBA 4O2BA 2RJNA 1LV8A 1LPAB 4Q5IA 3FGOA 2OD2A 2GBLA 1TQ2A 4P82A 4NYIQ 3RIYA 1ND5A 3Q0TA 3HM2A 4M9QA 3ZHXA 4D41A 5A9SA 3IPCA 3V4RA 2DUUA 3KOUA 3NXKA 4IX9A 4XWTA 4OHBA 3H1FA 1NNLA 1C7IA 2IXEA 2RGWA 2XB9A 3QITA 2QVBA 5FORA 5DM70 3RHZA 4IHJA 4GMHA 5HKAA 4ESHA 1XWIA 3IQWA 1Q3HA 4RYLA 4C0KA 1ABFA 3PRHA 4JI7B 4DADA 3F5FA 2PZMA 4PSUA 2XEDA 3BJMA 1Q1AA 2WIGA 1OX6A 4QASA 3W9SA 4BO2A 1CS4C 4HBGA 4UZSA 2A35A 1U2PA 3K7EA 3UTDA 3VVBA 3DKPA 3KT8A 1JBEA 1YF3A 1JSXA 1C9DB 3N2GB 4MVJE 1HDOA 1EP3B 4PCVA 5K6TA 2IP4A 3C3CA 4TMXA 3SIPA 1XTVA 3FYUC 3FRHA 1EUCB 2J3IA 2XUPA 4BO4A 2ID7A 4L51A 2ZIXA 3CLRD 2VQSA 4RPIA 4WHMA 1VMKA 1Z0UA 4X71A 4YP7A 4EH1A 3ONDA 1NU6A 1IK4A 1YA8A 3TLXA 4EEXA 2PJRA 3NHLA 1J5PA 3DE2X 3H2SA 4YUXA 1QCDA 4I08A 5JU6A 1RKXA 1G8JA 3ZVRA 4AKTA 2JKYA 1FLVA 2JGKA 2WWRA 3K5IA 4GEKA 4QECA 3EZXA 4GDFA 1JQDA 4IR7A 4ZOLF 1K2VN 2JFPA 2W0MA 3I6YA 1QPBA 4H27A 4R9SA 5KYVA 1X0XA 3DFFA 1K8XB 1KMHA 4WKNA 4EJSB 2FCRA 3GPIA 2FVYA 1OFTA 4WI1A 1T5HX 4ISBA 3JYPA 5HBGA 5I7FA 1OY1A 2SICE 3DMRA 3EQZA 4C0JA 2RD2A 3UUWA 2WYHA 2VFAA 4L6AA 2VHQA 2O0HA 1CKEA 1UPFA 2WJVA 1HR0B 2BSQA 3EVFA 3RFUA 4L8VA 1ESCA 2BKUA 5HTOA 1DCKA 4BJHB 1L4MA 1Z4OA 1M1YB 2FR8C 2ZYTX 4D4JA 3O8NA 5MN5A 2ALJA 5FUVA 4UARA 2DECA 4L4SA 3V4SA 2D3WA 2WJGA 2IH4A 2PPLA 4JJ4A 2WHEA 3BB1A 3M6UA 4QXQA 1E5VA 1RS0A 2FOLA 3DLTA 5HIMA 2WEKA 3PZRA 4DIOA 4NHEA 3T7DA 3AHHA 4LF8B 5IF3A 3G6KA 4GMDA 4D3DA 3EODA 1T0BA 2XDWA 4UD2A 1W8IA 5ALLA 4ZO7A 3VX3A 4JBXA 5A05A 5EWMA 1PVOA 4X7PA 3T06B 2I1LA 2H52A 1NP7A 1WLSA 1YIAA 2IYYA 2QD1A 3FA2A 3B5JA 3GJ4A 3OQIB 2NU8B 4H16A 1Z6YA 5J40A 3RYHB 2OUKA 3A3YA 1UDXA 1U2TA 3DCIA 4IRUB 5FYDA 4N39A 4GPZA 4JYZA 5IS2A 3TBKA 1AE1A 5IDQA 2YHIA 3A58B 1VKHA 2VRCD 4LPSA 4CU2A 1SVLA 1GUZA 4LKRA 3LCMA 2KHZA 4QLOA 1ZZEA 2NZ2A 1G5PA 2WW8A 4UQPA 1PSZA 5L4SA 5DT2A 4H6PA 1K8QA 4CEIA 3SZUA 1M2OA 1MVLA 5BURA 3BMCB 2X8JA 4E46A 1Y5RA 4BO7A 3VPSA 2BFDB 4IZOA 3A9TA 4BQSA 3QOFA 3RNLA 2FF7A 4RQUA 3WKDA 1A9RA 3AC0A 2O8DB 3KLMX 4QJBA 1RTTA 3BT7A 2VBIA 1JR3A 4IKPA 4DCCA 1MIOA 3I9MA 5A2QA 2ZT7A 4A7PA 3H8VA 2ZB7A 1ZDMA 2PKQO 3C98A 3IT3A 1K4YA 4BU0A 3FCYA 3I76A 4BDSA 1XJCA 4HHEA 1M67A 3KS9A 5I7HA 1PJ4A 1T24A 4B80A 3PENA 1FC0A 3GUCA 3MD0A 4ISCA 1GTL1 3D4NA 3EUWA 3NT4A 5F78A 2LNDA 4L5YA 1W19A 5LA6B 3KUCA 1HURA 2JLXA 1R9JA 3F7TA 4KH1A 5I4CA 4YUAA 1VL5A 4X66B 1XTIA 1Q22A 3L8HA 2CSUA 1A1SA 3CLUC 4NR0A 4DV2B 3L1JA 1XUOA 1AZWA 1H2FA 3CINA 4OLJA 5CYOA 2H92A 3CPEA 4JUAA 1CUJA 3C97A 1L7AA 3AU9A 1LLCA 1VKZA 2QI9F 3VOTA 4BGIA 4YA6A 3PD0A 1XD2B 3T3IA 2GGSA 2V6MA 5LCXA 4ZVLA 1XNHA 4OQEA 3MT0A 4HEA6 1V3TA 1KKLA 2Q5QA 4K2AA 2IP2A 4KWTA 3S27A 1RC0A 5C1IA 4NKRA 4DUZB 1MOPA 2ZRMA 3QE0A 4RADA 2HRZA 1RZRA 3MTJA 2IHKA 4KKVA 1CLUA 2JGDA 3P9NA 1T3TA 3IVXA 4WBNB 3RSHA 1K4KA 4MW5A 1EZZA 5F1OA 5TVKA 5DTRA 2XRZA 1QOQB 4Q1EA 1IPEA 5K3FA 1RADA 2OCDA 2X5NA 1JHUA 3H9JA 4YQYA 3WWOA 3M1LA 3ZJTA 2CNKA 2OM6A 3ROEA 2O7QA 1F4VA 2XTMA 2A9PA 2P2YA 5KPDA 4BKRA 3GRFA 2XRMA 3B1JA 3TW0A 5JI3E 3HKEB 5AK6A 2OO3A 4QVIA 5FWDA 2QVZX 4BDTA 2HEIA 1IQ0A 4YT5A 2NPIA 2JLYA 3O1JC 3DV0B 4N6OA 4ZEWA 4RIIA 4DCSA 4LC1A 1D2NA 2XRYA 2ZE6A 3KAPA 3T4PA 4O4IB 2YDXA 3DMHA 4PYOA 1ZD2P 2XA2A 4PNEA 3DAFA 1U94A 1QP7A 2VHZA 3INTA 3RV4A 3IAHA 3J80A 1K8RA 1ADBA 2M6RA 2OY0A 3RASA 2W2MA 4OOEA 1PT5A 5LWQA 1I4WA 2HDHA 2J6IA 5JRDS 2FR1A 2EBUA 4G07A 4R3UC 3F98A 2QN2A 3EC1A 2RI0A 3CH5A 3L7NA 4YCSA 1RXVA 2JLVA 2PYZA 3UV6A 1AK9A 3LV8A 1DX9A 1DX4A 5KTKA 1KVTA 3B6JA 4BRUA 4TT3D 3FHLA 3UGTA 4HPXB 1I7SB 5H4GA 3BTUA 3FHTA 1USVA 2YNMA 1NRXA 3B8EA 1HWYA 5C5EA 1VGVA 3DGFC 1KSGA 4IHJF 4PN7A 1DC7A 3AVQA 2AR9A 3PJEA 4TGLA 4ZO6A 3ZXIA 1N57A 1TADA 1G4AE 1T0JB 3M5PA 1GAXA 2EJCA 3H9QA 3L8CA 4BECA 2EX1A 1LBEA 2HW8A 1NVMB 4OH7A 3ME5A 1ZOSA 2VLBA 4E94A 1GQRA 1I30A 4QOHA 2V74B 2VSOA 5TQ0B 1S89A 3TNFA 2BE7A 4NARA 3ZU3A 2ZM5A 2A9VA 2AHRA 4JXXA 1AGYA 2QUJA 3A1WA 5FFMA 4UE2A 2CSXA 3ISTA 2C0CA 4JT8A 5JMPA 1MMFB 2R6R1 2ZULA 5KNDH 1AMNA 4FFOA 2QPAA 1V2GA 1R9NA 3U1TA 4N3NA 3UWKA 3D3NA 4DIMA 2G6BA 3INRA 4KRFA 3QPUA 4EG8A 1MGOA 1NIPA 2VUTA 3L2OB 1G5TA 2EF0A 4M9CA 5IM4F 2G1UA 1FTNA 1N36B 3TQHA 4ARZB 4NCJA 2HEGA 5F77A 3TRIA 5FBRB 4IWXA 1DZIA 3RUHA 4HN2A 1X15A 3DOEA 3ESCA 3HY6A 2ZTHA 2ATCA 4K6HA 3E8MA 2CWWA 4GX2A 4IHKA 4LTMA 4WZBA 2WIJA 5CB8A 1U28C 4YFYA 5KWIA 3ZIUA 2VVTA 2ATIA 5K8IA 2A9QA 4LOAA 3N8NA 2WTUA 3FTEA 3X2FA 3ZGOA 5HQTA 4S1VA 1DG1G 4F9GA 3BH6A 4GOOD 1DMSA 1I4LD 2XTZA 4QARA 4HLNA 3K8ZA 9ATCA 5CM8B 3FTPA 2H2AA 3F8TA 1NBEA 1QHNA 2JLQA 4AP6A 4F46A 3RLFA 1NGSA 1CE8A 1GKLA 2CZQA 2GJAA 2P4UA 2QRQA 3IA7A 1H4TA 2YX1A 3SF8B 3SJBA 1U7DA 4ZD6A 2HQRA 4FNOA 1E3EA 4W8HA 5AHWA 1PZEA 4PO3X 4CHGA 1WMDA 2ISQA 4KJZA 4PQEA 3ZD8A 1X2BA 4BKQA 1ZCFA 4MS4A 2ZUBA 3BRWD 3DBVO 3BHNA 4R6XA 4BVBA 4ZT7A 3F3MA 1E4EB 2Y0EA 1MJGM 5KOYA 1T25A 1KYZA 3HKDB 2VWHA 4X7RA 3A70A 3MJDA 2QP4A 4REQA 3AEZA 5K01A 1OAOC 5KYNA 2C03A 5HIKA 2V1XA 3OKFA 3DVLA 4PAOA 5JNUA 3WICA 4BFCA 1CQIA 4GXQA 4OXKA 1UDWA 2PLWA 2QZ9A 1ARZA 1K1EA 3KR9A 4CCWA 1QK3A 5GGYA 4YRSA 2JCVA 2HREA 2WUWE 3B12A 5DGCA 1ZJ4A 5D7NA 3CF4G 2GJ9A 3WQQA 4DLRA 1H65A 1QKIA 1T8TA 3DL4A 3G2IA 2VHVA 1U0HC 4INZA 3QELA 1CWUA 4CF6A 4WGGA 3UHPA 2WSYB 3ZLBA 2Q8PA 4AJHA 4EYEA 2QUZA 1LB1B 2UYCA 1MPXA 4LRTB 3I6MA 3OE7A 3DDZX 2P9FA 4K9KA 2FRXA 2NUBA 2IDMA 1Z3IX 4Z9BA 2IUTA 1GJRA 5E0OA 3D3KA 3GO4A 3GLFA 3GOQA 3LP5A 1UOOA 4WACA 3UH0A 3GJ0A 4ZRNA 4EW3A 3IALA 4FYIA 4AJJA 3H18A 3G89A 3I58A 3EVBA 1T3GA 1T2CA 3G7SA 4E08A 2D1FA 2KS6A 5CFMA 2FX2A 3L4BA 3D8RA 3WS7A 4ZC8A 1BNCA 4AJ2A 3S3TA 3VAYA 2C1EA 2WVGA 3I2FA 3LKBA 4HWPA 4QDTA 3OO1A 4EL0A 4YCMA 4GZ5A 2OKGA 4OI2A 4DYDA 4YBRA 3DSRA 3E23A 2VQFB 1H8HA 3TCNA 3OMLA 4LZPA 3VR5A 4BVGA 3AB8A 2QRVA 6ABPA 1DWQA 1SCQA 4IJVA 4X97A 3OFVA 1SVKA 2BOVA 2WABA 4LOHA 1NWCA 4U2FA 4WVFA 5LUBA 1XZEA 2X1VA 2SCUA 2O48X 3ABSB 1PNQA 5JMWA 3GLIB 4K88A 1F12A 3OE1A 4JU9A 4K0KB 4ABYA 1NVFA 4X7MA 3LFUA 4NU5A 4HB2A 1UKZA 4GVLA 3R4CA 4KDEA 3WB9A 4DA8A 4KUHA 2HMYB 3WSVA 4BVEA 3TZEA 2QDXA 2CD7A 1YRWA 3BD9A 1OB5A 1EE9A 2NQ8A 3C1UA 2MSEB 4BJ6A 2QAGA 2H1CA 2O8NA 3FZYA 1VYUA 1W35A 1SXIA 3DFMA 4FC7A 4M37A 3GRVA 4O3FA 1N8SA 5FTKA 5TDHA 4MWDA 1MW8X 2C2OA 4LCBA 5HE8A 1MOQA 2OE2A 2Q41A 1DAKA 2QSUA 3VDRA 5TMPA 4DEVA 3RVKA 1RPZA 2TMYA 3TVTA 1OXSC 2PO5A 2CUZA 2A6PA 4NBLA 3KBOA 4YJ2B 1OXMA 1U7UA 3QYFA 5E0KB 4NXNB 2GHRA 1WCYA 3WHLA 1Z34A 1EK2A 1JILA 2GM5A 3VDMA 1R4AA 3EEIA 5KAMA 3ZU2A 5BN1A 2JFBA 1NONA 2A5GA 5LFAA 3H13A 3IBGA 2XE7A 3ZX5A 5BMVF 1E2NA 2NG1A 3TX6A 3ZD6A 5CAEB 1N1EA 1UQUA 2QX9A 1IZ9A 4AJNA 1DTSA 2GILA 3X0DA 1U7TA 2EWWA 3FZQA 5HG0A 4JUIA 4J4HA 4Q39A 2FUEA 5ENVA 3HN2A 1TZ2A 4G26A 4C20A 1A72A 1MCZA 5EIWA 3EK2A 4O29A 3BXEA 4NBKA 4D56A 4ZN6A 4JYAB 2HIHA 5L3SB 1UFKA 4YRFA 4MI3A 3NFYA 5CB6A 2FW7A 2HF8A 1CQPA 5E9WA 3SHFA 4G0WA 4RS3A 1RKBA 1BX1A 4NEQA 3EVEA 1U2RA 3IBSA 3L77A 1P1BA 1Q11A 4ZVKA 1B0PA 3UK1A 3W9BA 1G59A 4L73A 3WMFA 2EKDA 4Q7MB 2F2TA 3JVDA 1JDUA 2J48A 1WXGA 1Q0SA 3A0RB 4JL8A 1NRIA 2VJDA 1YDMA 4PHFA 1NR1A 4PHCA 3DXXA 2IBTA 1Q57A 3E9QA 1LS1A 4P93A 2F8TA 2CN1A 3OCYA 5JXWA 3RSSA 1M83A 5F98A 4MYSA 1Y63A 1ADGA 2ZVPX 2X4IA 3C3EA 4C2BA 2ZSDA 4ARSA 3Q15C 3HR8A 1KS2A 2XQGA 3HVUA 3JRXA 4M38A 4M9RA 4MR8B 3RCBA 1D8TA 3OQJA 4RGVA 5F1PA 4KFTA 5BVHB 4P1ZA 3IRUA 5ADUS 1IL0A 2AJ8A 1P7ZA 5ICEA 4HPWA 1AKVA 2BSXA 3YASA 1QVVA 2FW8A 5HKOA 4F86A 4HQKA 1XWFA 2J08A 1WSWA 1K5GA 4ZT3A 2NPFA 3OC6A 1KEUA 5IH3A 1JJFA 3MLAA 4GIBA 3I23A 2GPBA 3QLUC 4J7CA 4X8OA 4OATA 1MFZA 3V8MA 1E77A 1Q19A 3K9LA 3NH6A 1FLAA 3GD7A 5KAPA 3LTNC 4RSMA 1YCDA 3U81A 3ZGXA 4HATA 2AFIB 4L8GA 4PINA 5DI3B 3O8LA 1Y1TA 2EJWA 1NBAA 2VEOA 2A5YB 4MYRA 4GYWA 5EP2A 3RRBA 1PJZA 3BXGA 2FSFA 1SA0B 5J23A 3FMVA 3N2KA 4QLAA 3LO8A 5E7IA 1LLUA 4B7ZA 4QO7A 1SBHA 4MW1A 2IFTA 2QENA 4XYGA 5AJVB 3ZCRA 4E7OA 4MMZB 1NBHA 4W9MC 4P92A 1FFYA 3OT5A 5CIQA 5AR1A 1P1CA 1VYVA 2JIDA 1W44A 3CRMA 1XQVA 4D8WA 1KEKA 4IHAA 2B7BA 5HTKA 3UG6A 1PFUA 2QN9A 4FQ7A 4B33A 3TVDA 5IVHA 3CSDA 3DZGA 1TA4A 2R5NA 3L7JA 3WGIA 4YGYA 4ZK6A 4IVPA 1OAAA 3WMWA 2YINC 3HCCA 2QMYA 3LOQA 4UULA 2GM9A 2NPOA 3NGXA 2K2WA 3HO1A 1QH8B 3VGJA 4Z4FA 1GITA 1Z3CA 5JYDA 3RS8A 1ORDA 2EWMA 1DC8A 4US2R 3PC8C 2JKVA 3FGPA 3KLPX 1UPUA 3D6NB 4GQIA 4GE3A 2GA9A 1V1RB 1ZNXA 2IIVA 1JQBA 1HYGA 1KYVA 4MJLA 1L5RA 3MTIA 4MDHA 4WLNA 4P3XA 2G1PA 2Z56A 5AW6A 4UREA 5FPKA 3VOBA 2QVCA 3KTOA 4OL0A 3OQMA 2N47A 1JLMA 1D4AA 2Q4BA 3D0OA 3EUFA 2AJLI 2FQWA 2YQ5A 2ZYRA 2D13A 1N8NA 2JKZA 2FE4A 1RCTE 4JC8A 1CIPA 1NURA 1RYFA 2E89A 4B3SB 4JNCA 3AEQA 3SJZA 2B9VA 4I4LA 2HIMA 4YFVA 1NLZA 5EE0A 3C6YA 3BE6A 2Q7DA 1XEAA 5DTIA 1SQ0A 2VYND 3H16A 3TSYA 4DLXA 5TARA 3NIDB 4MUIA 1TPZA 1KJWA 1R4MB 2OQ2A 3JVUA 4JLMA 4QFDA 4S12A 1PJ3A 2HA4A 4HTAA 1CULC 1Z39A 2CXRA 4DNOA 3ENVA 1EX7A 3OM1A 2C7PA 1IFXA 1E69A 4Q3EA 2I34A 1CG6A 1XEFA 4GWGA 2P3LA 3D6AA 2Q29A 3QVOA 4HDNA 4G67A 2YMLA 3UGJA 4HEA1 1WEHA 1YL7A 4HV4A 5NLLA 1FSZA 2BY4A 3TD9A 3JVIA 3ZWNA 3SQXA 2PRYA 2XRFA 2PXHA 3JSAA 3RT9A 1R9MA 2P90A 1XNGA 1YJQA 3T7EA 2OYCA 1OGIA 1QIMA 2EGUA 3L6OO 1Y98A 2RAFA 1BE0A 2P2DA 3N05A 3RVQA 3T4EA 1SIUA 1UK9A 4MIKA 4CNBA 2GYWA 1ADCA 3KSZO 5AVZA 1H2ZA 1JEEA 1S02A 2C97A 2JRLA 2ZB8A 3KVVA 5F5NA 3IXMA 4EG3A 3K4QA 4ZCLA 5K99A 3LVFO 2AZMA 3EG9A 3MG9A 1UEIA 1R8YA 1RAGA 5HZKA 2AFVA 1PKEA 1TEVA 1ZHHA 3A25A 5IYZA 1R6DA 2QZJA 1YCGA 3P0RA 1GRNA 3P32A 2H7XA 3GIWA 5J43A 5DMXA 4D99A 5F9HA 4IDGA 1C80A 1AQ6A 2G88A 3RRFA 4NENB 1YI0A 3ZY5A 4EA9A 1VJCA 2ID8A 2XVXA 1XB2A 3HBJA 3OLWA 3V5NA 4AL4A 2GCIA 2H85A 3O4GA 4ZP1A 2XXBA 1WKVA 2OCIA 4YK7A 4R3WA 3RHFA 4DWWA 1JS1X 2C9BA 3CNQS 3LX4A 3SGLA 3LP8A 1PLJA 1KFKB 2C78A 5T8KA 3V8BA 2HQSA 4CM4B 5DVZA 2DHRA 2WZBA 5TV2A 4TMWA 1MJNA 3DQZA 3DBRA 4LOKA 5B1HA 4Z1MA 4MROA 4C08A 3MLEA 4DPLA 4AF8A 2H00A 1S8AA 3AKEA 1J7JA 1MW9X 3I2GA 4O4LF 2Z0MA 2P9EA 2BSAA 3ZHCA 1AMOA 2IZ5A 2HH9A 3EZYA 2PN1A 4TWRA 2WQ7A 3ZE1B 3NTLA 4JP5A 1KYWA 3JQFA 3FUCA 4DTIA 1KMQA 2DTDA 1UZLA 1TUBA 2HIGA 3JW8A 5FFNA 2ECFA 3N7UA 4I1SA 4JODA 4R54A 2CVHA 3T3GA 2BGRA 1F4LA 1PCXA 3DNFA 5DP1A 1YE5A 4O2RA 4C5BA 3HSKA 1Z5GA 4H77A 4CKXA 3RBVA 2V98A 1E9SA 2WHPB 3O4VA 4EX7A 4Z4HA 3VH2A 5EIAA 5KTRA 2A84A 1U1DA 4N18A 1DIHA 1GGHA 4EMUA 3NAGA 4MS1A 1N6RA 1E1RA 4OHKA 3PVZA 3OZBA 4HH4A 4KODA 2ONCA 4KFCA 2MSDB 3N0VA 5ADHA 1V5WA 2H3HA 4AJLA 1M34E 3I1JA 2DUMA 4GI1A 4EYSA 3VNVA 3EXFB 3S40A 1C7JA 1FMFA 3VTAA 4QTUB 3A6GA 3SHOA 3QPWA 4RGBA 2YWCA 3ZY4A 2PT6A 1KI8A 2CXTA 4I8IA 2DUJA 3JQGB 1KYIA 4JI0B 5CYFA 2PMEA 3FW1A 3RH0A 4YCNA 1L9XA 1QVWA 1XZKA 2NACA 4X1YA 3K5PA 5DW0A 2B4KA 2IKQA 1II8B 3CF2A 3R7SA 3W06A 2A2ZA 3H4IA 3PQ4A 4ND5A 4HR7A 1O5TA 2A33A 1MRZA 1GTSA 2ACWA 1JH9A 3R7DA 2VUUA 1F6DA 3FPFA 1PT7A 2RAPA 1QGUA 2Q4RA 4Z2YA 4BFWA 3M5DA 1YMUA 3E1KA 3A4IA 2Y1FA 3M33A 2GEBA 1RACA 3BPSA 3H0KA 3PDIB 1H2WA 3UG7A 1YNSA 3KE8A 1NX9A 5I01A 1CYDA 2VTKA 5CT9A 4J1TA 2YBDA 4FYXA 1BN6A 2YYAA 4QJ5A 2VWGA 4LQCA 5DGXA 1IE3A 3RB8A 1KGSA 1I5RA 1NFRA 4QU5A 4FYYA 3WLAA 2I2FA 4F71A 3G1TA 1H2BA 1W4LA 1GG8A 1UCFA 4WW0A 5FADA 1EFRA 5KNBH 1QP0A 3LUHA 2Q5FA 2WIFA 2G70A 2AMYA 4TKVB 1IQRA 2ZYDA 2M6LA 1CDDA 2BVNA 3VU0A 2XADA 1RLOA 1EBFA 1O6FA 2L82A 2XKAA 2PLRA 3R76A 3D4IA 1ZIXA 3B1XA 3U31A 2R6ZA 3R9XA 1EVZA 3VKUA 3ZE0B 4XGQA 3U4MA 3OOHA 3JAKB 3MFQA 4GEGA 3SWWA 1YQEA 3QFHA 3LUGA 4TKUB 5DN6D 5KO2A 2PX2A 1YZYA 4PLGA 2BT4A 3QFRA 3R5SA 2V58A 2Z2ZA 3IP6A 3OZVA 3EGXA 1ISRA 1MAUA 2C7BA 4OB7A 1ZP6A 2Q27A 2XCRB 3TOSA 2GCPA 2V5VA 4PLHA 4AZWA 1IBCA 3V00A 3T1HB 3H65A 3O8QB 3FB4A 3R0IA 5G4KA 3T3HA 2GZAA 3V55A 2QJOA 4WKGA 2A94A 1W5EA 3RUCA 5TGTA 4XX0B 1IJKA 1GPWB 3F8WA 2PUFA 1PT9A 2FQQA 1NJ2A 4R81A 1G6Q1 3H5AA 2JI8A 3GYGA 3RJTA 4PHTA 3ON5A 3EFBA 3T4UA 1RRGA 3DCNA 4CMKA 1DDGA 1LQ2A 2ZBVA 1G17A 2FVXA 2QEQA 3DFKA 2R4QA 2CVQA 5HJ7A 1LWOA 2ZI3A 1O97D 3BWYA 2VP6A 2ZITA 4KNYA 3BEDA 1YDFA 4NBSA 5E8JA 1CJSA 3SQDA 1WUHS 3DJYA 3LW8A 1QX3A 4E5NA 1K6JA 3FCOA 1N5MA 1KAOA 2Y8EA 4G0NA 1OLSA 5HRCA 1FBNA 4RVHA 5I9NA 4S05A 4HGRA 4I3HA 2RB5A 3D6MA 5A5GA 3CZCA 1OLXA 4QOJA 3G5TA 3GAZA 4NICA 4QM6A 4EKYA 3GEIA 5K3CA 1SC9A 1A2OA 3E61A 3GJ5A 4R2MA 4XVCA 5EERA 4Y3UA 1XTZA 3IP7A 3R3UA 2UZ3A 2HC9A 4EMBA 3P0HA 3D8BA 5LB2A 4RE6A 4HVLA 1O0CA 1EG2A 4TSFA 1SCUB 4MV8A 1AXRA 4E6PA 2HIAA 3T1QA 2ZAYA 4EKDA 3HM9A 1B0UA 4ZOLB 1RLJA 5CX1B 3BWCA 4MQLA 1JLSA 2P75A 3JSXA 3D3JA 5A0VA 4P2GA 4TS9A 1EWRA 1L5HA 2YNMD 2YWFA 3PNYA 2GZSA 3A4NA 4IDHA 4R1UA 3W2HA 4AS2A 1OXUA 4UUAA 4TWZA 3V48A 1RPNA 4XPIA 5K0FA 3F2IA 2I3DA 2CMDA 2VH1A 4LJ9A 3T1YB 2W8BB 1T13A 4L07A 4RD1A 1YRQA 2E4WA 2XYGA 3E18A 4DLUA 3TECE 4ZHQF 1Y0BA 4Z4QA 3TTSA 5LOVF 2PQMA 621PA 2NYAA 4JCOA 2W4QA 5CDFE 3GUHA 2CD9A 1EK5A 4M8IA 1RI1A 4X20B 1RYBA 4XUGB 2X9NA 1BS1A 3O7WA 5CVVA 3V4PB 4TMKA 2VOJA 3WDSA 4A5OA 3R3WA 2NXEA 3KEQA 1RJFA 5CVEA 1JHAA 3ZX4A 3D6HA 2AK2A 3QA3E 5EQFA 2JLZA 4G5FA 4DYVA 2BEUB 4X8MA 3RS9A 1ZD9A 1L5OA 1GTVA 5ITZA 3EW7A 1TM1E 2BRUC 1FX0A 1QCZA 1MA0A 2MMCA 5I8ZA 3K9GA 2ZJBA 1KHHA 1NVUQ 121PA 5AVSA 5E3IA 1YRYE 3Q87B 2BCEA 5IYZF 4ENVA 3P20A 1QM5A 2HA3A 4HL6A 1D5CA 1P8JA 2I0FA 5A3SA 2R87A 2H9YA 2OXEA 3Q11A 1B1CA 2GT1A 4F4IA 3ZJUA 1ZJ6A 4PBTA 2Y9MB 4LOIA 1QH1B 3ZY3A 7ADHA 1QTQA 5TX7A 4FINA 2O8CA 5ALQA 4KYIB 1Q15A 3C41J 1BGVA 5BN5B 1ZA2A 4AF6A 3I9KA 4UUQA 3VKFA 3ICEA 4GL2A 1XVAA 2PEYA 3U7EB 1XCMA 5LYJA 2P4SA 4HDSA 5JEDA 3B52X 1B7GO 4ME6A 1X42A 4KN9S 1KI9A 3ROQA 3S55A 1N0VC 2G77B 3KM0A 4HQFA 5CX4A 1XWWA 5AVRA 3C7DB 1TM7E 4HY3A 4X54A 2F1JA 2XGMA 2I6QA 3W5SA 2D74A 5C7LO 5CIWA 1A8QA 2Z8YA 3CU5A 4RK1A 2GJKA 2XYHA 4M21A 5DGIA 1G18A 2CDBA 2J7PA 2RHMA 3DTNA 4LSMA 4TTJA 1CR6A 2W0SA 4JR1A 3P2MA 1EA5A 3WLFA 3TR6A 3GDOA 4BZPA 3IUQA 4DZTA 3TPCA 1U3UA 1MP0A 4X85A 4WXHA 1N33B 4DG9A 1L5SA 4K3UA 1BZYA 4CODB 4R84A 4DA7A 1KBOA 3I9JA 3D7NA 3R5JA 5EYPB 1S8OA 5C1DA 4TRJA 2P68A 4OV6B 5J4LA 1ULAA 4EPVA 1MB9A 5JROA 4ATNA 3C1AA 2ZIEA 5EMLA 3LPCA 1DEOA 4P81A 3LXUX 2AQHA 1JP7A 3KEMA 4M36A 4HNHA 4QGFA 4RPJA 3U4CA 4IQGA 3VR2A 3GGGA 1YS2X 1UJMA 1ZI6A 4FKMA 4P53A 4XYBA 5EJ6A 3M6AA 2PUCA 2H1LA 1KIFA 2WMDA 4X8LA 5G53C 4GQBA 2I2DA 3PFIA 4UTRA 2Q6KA 3H9BA 4I1IA 2VR1A 3DKRA 4KI0A 2CNWA 1UDBA 1GAWA 2DM6A 3HY3A 4JBGA 4C0LA 1L4GA 3PYLA 1QDEA 1QR2A 3I52A 5C8YF 1ECBA 3DLAA 4M87A 4MP3A 1G5HA 2XGSA 1FSPA 3ERCA 2D2XA 2Q5JA 1LVUA 2QX7A 2IHBA 3GFOA 3H1EA 3K5HA 3EZNA 1AOXA 4GHWA 3WKEA 2CZGA 2HB6A 5FUWA 3E4DA 1JI3A 1TQDA 3S1LA 1USKA 3IB3A 4X1IB 4YRGA 5CDTA 3RJ9A 4CMIB 1JQ5A 2XUIA 4PXSA 4X1OA 2QORA 2VNJA 3TMAA 2B7CA 3ADCA 2FN9A 5BWLA 4IIJA 1O94C 4E11A 4XQ0A 1GCGA 3TD2A 3VPAA 3RJ5A 4HS4A 4KR6A 2EX0A 4NFHA 2JFHA 1A76A 1H8HD 3JPYA 1ODCA 4MJ7A 2NZJA 3A1DA 4UHBA 3UICA 3VR5D 3TI7A 4B3BA 4DV3B 3NBZC 4MQEB 1GZSA 4MUFA 3PKIA 4JQCA 3D8NA 2K2QB 4MRAA 1OI2A 4Q47A 3K94A 3IPLA 4OM8A 1D0VA 2IVZA 3FPGA 3IOCA 1UM9B 4C4OA 4YXFA 1YR6A 5A3JA 2AOUA 2DBVO 1LRJA 3JS5A 4N82A 1ZVMA 1RI3A 5J47A 2I3ZA 2Q1UA 3AZPA 2JIQA 2RAUA 4N9QA 4P2BA 1TVKB 4PC7A 1VLQA 3Q9SA 1ILEA 5E6UB 3KYDB 3MXTA 2PX0A 2CBGA 2OV8A 2YY5A 1S8FA 2QE6A 4Z3DA 2DETA 2W6MA 3O8CA 2OK8A 4M7PA 4DUPA 3DHWC 1Z8NA 3PD1A 2B34A 1R6TA 4PPGA 5A0TA 3QVTA 3DOCA 1E2PA 4BEBA 5SZJA 4DMHA 3AF2A 4NCBA 1NW4A 3MW8A 1QBGA 3MB5A 4ALIA 1TMOA 4M9UA 4DR7B 1G2PA 2PRKA 1CVRA 1UMBB 3B9PA 3HBFA 2FPPB 4M99A 4JI4B 1AXGA 5EUQB 5ARBA 2QD5A 3CMCO 2C0QA 4YT4A 4M22A 5KVQA 3O3MB 2IYFA 1N0IA 3G1UA 4Q93A 2NUAA 2IGTA 3WIDA 3KSBC 3OPMA 3HWX1 4RY8A 4E13A 2O14A 2R5WA 1DU4A 5K20A 1SMKA 2O6LA 5K0GA 2KBFA 3DLCA 3AY0A 2IBSA 4DF3A 1EFPB 2X9LA 2ZJ5A 4KMMA 4MYCA 2O19A 5LDGA 2X6RA 2I7VA 4IG4A 4M0CA 3WK4A 4IV8A 4QBHA 4EM6A 1Z0ZA 3QTBA 4FI3F 2ZRFA 4JLKA 4N5HX 4W5JA 1QQ5A 1BFUA 1N2CE 1K7XB 3CUSA 1SXQA 3RC1A 1MC5A 4XSGA 2FUKA 3IIJA 5IAOA 3EXIA 2WJAA 5H3HA 5FUBA 4UEWA 3L0IB 2A67A 3MSXA 5TMDA 1QC5B 3JQAD 3KB1A 2X8BA 3PQ5A 5EJMA 2IYUA 1JA0A 4YMIA 1IQPA 4ZVQA 3BJEA 2HA7A 2VF2A 3LQYA 4EQ6B 5I9IA 5JEEA 2FSVC 5EJEA 5TT1A 2NVWA 2WKPA 2C2BA 3UMGA 5JWOA 4X8HA 3UUEA 2Y93A 1DTEA 4GLLA 3Q3IA 1YFZA 1S0UA 4P83A 5GINE 3K70D 3UK2A 3ANYB 4F11A 4KFRA 5KYKA 2RCYA 1W2HA 1WP9A 2FKAA 1QG2A 2ZDQA 4XEUA 1X9GA 1LBQA 2GXUA 4XASA 5T67A 1D07A 2A9RA 5E4FA 1QIIA 4QZVA 2AOWA 2JARA 3FUTA 1ZX1A 2JH8A 5JYEA 4BO8A 2CFIA 3KU1A 5B58C 1ZQ1A 5JI2E 2IE0A 1ZK4A 1KEEA 2DLCX 3ZDRA 4Y6GB 3U19A 2HPHA 4BZXA 2A1TR 3T3OA 1DAMA 4RF3A 1ZCZA 4XJSA 1HXHA 3PUKA 4B44A 5U9CA 3W0LB 5C0OE 1UP6A 4LISA 3FKQA 4ZVSA 3P9KA 2YFQA 2O4UX 1NBMA 2D06A 2QM3A 3CWQA 3ZN2A 5KINB 2PH5A 2ZRDA 4MWSA 5TIIA 1IBMB 1T2NA 1K0UA 1ATIA 3UENA 1W88A 1UAYA 4Q9HA 1M34B 2QPTA 1SUCA 5AW9A 2XT9A 3RG8A 1XLTA 4NY1A 2ONKA 3D54D 5K6AA 2HSZA 3HJCA 4KNVA 1W0KD 3OLQA 4OFXA 4PZAA 5IT0A 1T9GS 1NI5A 4DCVA 2O8EB 2GEUA 1DCMA 1OT3A 2OMKA 2JJYA 3TJMA 3WYAA 5LZ5A 4BNLA 3NORA 1V48A 4TSRA 1PEYA 2C31A 3LYAA 4UJ5A 1BSVA 1ZAKA 4BFLA 5JOQA 1NM5A 4AUEA 3ILVA 2R7LA 3WLSA 1HOXA 1B16A 2YXBA 4ZAZA 4G65A 1MJFA 2YZNA 3IQFA 3OU7A 2WU0A 2WWFA 1VSQA 4UDOA 4ARCA 4IS2A 3TX2A 4YO7A 4QUBA 3OEED 2OECA 2BKEA 4UM9B 1FUUA 3A1NA 4PC2A 3SQMA 4DWJA 4NJMB 1JQKA 2Z2JA 2FKNA 2O20A 3DE3X 5ECYA 5AW1A 1I10A 5LSAA 2XWJI 1QIHA 2R11A 3ROMA 4ZYVA 4GXTA 3C1TA 4QBGB 3OECA 1Z5NA 4FXOA 4QPDA 3T5GA 5JTTA 4I8DA 1QFSA 3LDUA 2Y1DA 3GFGA 4JUDX 2QM8A 2B5OA 3VO1A 4UUMA 2I65A 2YWJA 3N28A 5JS8A 1ITZA 2P6MA 3F2VA 4KE8A 1Y9ZA 4NZPA 4CM3A 4B87A 5SY4A 1UJCA 3UXEA 1CJBA 2UZ0A 1F3LA 3HU2A 1UXOA 4O0LA 4GP7A 1Z0DA 2X2OA 3K20A 1EWVA 2H57A 4DJ5X 1PJRA 5KOIA 2I2WA 4EEZA 3H9GA 1DWOA 3N2EA 4HEHA 4N47A 1TF5A 2VUSA 1PEKE 1CUZA 3EZ6A 3VKHA 4CCAA 3LKVA 2EJUA 5TRTA 1DE0A 2G4VA 4AB1A 2CFRA 2DFNA 2DE0X 3W6NA 2B98A 4OREX 4M54A 1A5AB 3K6RA 4ZJPA 3E7DA 3GVHA 1Y8ZA 2VKQA 1VP9A 2B37A 3CPJB 4EVIA 2VJNA 5M7EA 4HDMA 1DEXA 2ERYA 4IIEA 4PNHA 1QHGA 3A36A 1RQ2A 2OLEA 3I34X 1SOUA 4FZJA 3ZZTA 3M1IA 4G1VA 2XLBA 2G67A 3AHCA 4KPGA 1TYCA 1O9HA 4FJ0A 1L7RA 2JLCA 2XUFA 5SYNA 2PNJA 1FFXA 4ZT2A 4BS9A 1ACMA 3H05A 1KKMA 1RWBA 1HYHA 2BM8A 1E3QA 1YQWA 2W2KB 3ZHVA 3QMVA 5BMVB 4GNRA 4JYMA 2VQDA 1V26A 1ZI9A 3AHFA 2FB9A 1Z0AA 2VZ9A 4OAQA 1GGEA 4DA6A 4DWVA 5JV5A 4MJXA 3Q12A 5EWLB 1VFNA 3RTBA 2V6IA 3UCFA 3WFIA 4BQIA 2REQA 3KVRA 2NSHA 3OUTA 5BO5A 3T0IA 4G63A 4DLKA 1XV5A 4RD3A 5FAXA 3V1NA 2XMDA 1X2EA 2XE4A 5JANA 1INLA 1Z6XA 1P72A 4CIBA 3L7IA 3KQUA 2D59A 5KJCA 3OUZA 2X9VA 4R05A 1ADJA 2CJWA 2GO7A 3SJAA 4OMDA 5EKTA 4IUCS 4YCBA 3DM9B 4H15A 2JEYA 4L4XA 1Y81A 3KV3O 2OHOA 4LGMA 4HZIA 5DCUA 2VK1A 3BK7A 4DJAA 3NJ8A 3I9FA 2WVJA 3JAWA 3R3JA 2VH2A 4NU8X 2Y1WA 4QRDA 4XA8A 1JPVA 5DNVA 3LBIA 4EYGA 3UAZA 4G0VA 1OI3A 4BRSA 1U3GA 2BUAA 4FZVA 4I36A 3WB0A 4OB8A 5EGSA 1DRWA 2J9GA 3VAZA 5MF6A 2QZSA 3LO5A 3U80A 1WZCA 3FRIA 3QK7A 1KDPA 1MA3A 4AY6A 2QI9C 4QYIB 1L4FA 3DC7A 1JKJB 3U7JA 2QN1A 3ZE7A 2WU3A 1UFRA 4Q3CA 4WN3A 1XK7A 1Z7BA 2UVDA 3AFMA 4Q4AA 1U1EA 1LS6A 1TKRA 1KQNA 1VKOA 1YGYA 4KDCA 4OGGA 4CCYA 4D9GA 5LLDA 1HDEA 2C5HA 2QN8A 4I5IA 2WFAA 4NX2A 4CR8A 1E1RD 5E7MA 4ZT5A 4D8TA 2GAFA 4MV9A 2CXQA 5K8UA 1G8KA 4LHSA 5LMUB 4CEJB 4QGGA 1SXJE 2CK3D 3HVJA 3N07A 4FIDA 4C6SA 5BOSA 3RAEC 2DFPA 3CYFA 3O3OB 3LWDA 3QKUA 4G37A 4M6WB 2HWWA 4AP5A 3ZWBA 5A4JA 4TZKA 3DYIA 2GCOB 1Y1RA 1G3QA 1YBFA 3VSCA 4BLTA 4PG4A 5FX2A 5KSOA 2DEUA 2PAAA 2Y92A 4L2IA 4C0HA 2F00A 1JEDA 3I28A 4L5AA 1C1YA 2H29A 4LHEA 1PGQA 2W6NA 4A8PA 3U4GA 2BGGA 2BFCA 4K40A 1Y1LA 3RE1A 3AM1A 2DY1A 2RGXA 3CPHA 2AN4A 3DHYA 1P4HA 1MO4A 3H7AA 4DKXA 1RXUA 2W6PA 2CE2X 2DY0A 2V3VA 3GCWA 2COKA 2O1XA 1N77A 1NRWA 1PS0A 3S8MA 3E9DA 4KN8A 3E3NA 3JZIA 4NQRA 5AHKA 3TQTA 1RPAA 1QDLB 2X76A 3W05A 2M6SA 3AUKA 4I9FA 2MDTA 4BNTA 1DBVO 2FV8A 2O9JA 3W34A 4J1NA 4YMWA 2YIMA 4IVNA 3BXXA 1LNZA 5K8TA 1M2JA 4ER0A 3AI7A 4RK5A 1X6VA 4QRIA 2BFNA 2XZPA 1HE8B 1M66A 3MOSA 3EA0A 2GBIA 5DEOA 4V3BA 1CB0A 1ZG3A 1I51A 3C70A 1EFRD 3SQNA 4LRUA 4RTRA 1LK7A 2X4LA 4OQMA 2NUPA 2IX9A 1H1LB 2QMEA 2D7JA 1IOWA 5FV4A 3EMBA 2HPZA 2XAUA 2FLKA 2HLHA 4O2AA 1EHYA 3PVSA 4NBNA 5F3WB 3DMNA 4IOJA 5KHAA 3ITNA 3WADA 3N8KA 3FJYA 2PMCA 4LOLA 4B8WA 4IDDA 3VX4A 4E4RA 3EMDA 2A57A 4GP6A 3K0FB 1FE8A 1KY3A 3LMKA 4XGRA 5KWSA 1WHTA 3CPSA 3OCZA 3QUBA 4LSWA 1IG0A 1Y7PA 1NUTA 2YUTA 3EJWA 4X5OA 1R9GA 4TYQA 1C7FA 3C14C 4BQQA 3THWB 2WR8A 4CV0A 4RTOA 1GG9A 5FBZA 5A9RA 3E82A 3OTIA 1PL6A 2AOTA 5HM6A 3EX7C 1TMKA 2FETA 4IF4A 1G41A 1KWKA 2R7AA 1XR3A 1N6LA 1A9OA 1AVTA 4L22A 1JEYB 3IESA 4CBVA 4TVSA 5LIPA 4GBMA 1T0IA 1U3VA 2H5LA 3HB1A 1B3RA 3HN7A 3O47A 5B3LA 2BL4A 1QTRA 4A8JA 3M9XA 1W2WB 2YUIA 3GFPA 1SOVA 2IPAB 4QYTA 4XCVA 4BNDB 5JDCA 1J5XA 3IRVA 5E3JA 2CJYA 1T9AA 4ZA2A 5FP0A 2CYAA 4LDAA 3AINA 2W6JA 4RHTA 1YS7A 1XZ8A 4R9VA 3S0JA 5BUQA 1T2VA 5D1HA 1X7GA 3SY8A 2HO4A 1R15A 3IOBA 3RVDA 3MXOA 1RRMA 5B30A 3N3BC 3STTA 1EK1A 1YOBA 2HSJA 2ZEJA 2VNSA 4LZOA 3WLRA 1G0OA 3I09A 4F96A 1YH3A 2QF7A 5FR2A 4DCJA 1YI1A 2O1SA 2VRBA 2DCMA 1ZRNA 3OIVA 1N4AA 3SIXA 4NFSA 5C7OO 3FDIA 4UUPA 2P9GA 2ZP1A 4I4TA 4RU1A 3GELA 4FHGA 1N3YA 3I4FA 4RYDA 2R84A 4GG1A 1ZIPA 1G8MA 1N2OA 4B74A 2YZKA 4TSFD 4JLWA 3RQSA 4FR5A 4ZICA 4BUZA 1ZVKA 1KI6B 1UDRA 1VG8A 1NN3A 4M88A 3L01A 4QPCA 2VO1A 3WWPA 3WYDA 4C7XA 3KE9A 1HDCA 4GPD1 5HE9A 3LCRA 5CK4A 4BLOA 2R1ZA 3M2TA 4QG7A 1NX6A 3LWNA 3T1OA 1F6BA 1RWMA 2AKAB 2JZNA 3UUGA 4DIDA 1JAIA 1COWA 4QKQA 3T4XA 2C2XA 4NRDA 1WPRA 1AY0A 1IN6A 4UU0A 3FHOA 5D2CA 3VU9B 1TC1A 2ZXFA 1CJMA 3L18A 5EHQA 4BU1A 4ETNA 5BXYA 3VZPA 3GLGA 1P6XA 1AQYA 2IP1A 3FCXA 4BP1A 3R0ZA 4M60A 1CUBA 2I6TA 1GD1O 2QS9A 3QI2A 1HORA 2PS1A 1P75A 4EZBA 5H81A 4UVEA 3U7GA 4BOYA 3VFDA 4O4LB 2VK8A 3CLVA 2D1TA 5IMBA 2P5SA 3T3MB 1ZGAA 3Q3GE 3VNQA 5IANA 2FMFA 1IU9A 2XVYA 4NWIA 4ZZ3A 2J6BA 5EJAA 2B3DA 2WNIA 2YICA 4N01A 3L05A 2AI3A 3HJHA 3PU6A 1NDHA 4FDVA 4IIXA 4BVJA 1IC6A 3N59A 4B73A 4DE5A 3N7AA 4HVAA 1EQ2A 3KALA 3ORSA 2JI7A 4BV2A 1CNEA 3NASA 1CD5A 1N2CB 4L75A 5AOVA 5AVKA 5G1PA 2AT1A 3EVAA 2P2LA 1SJ9A 4LMAA 5ALYA 2ZUTA 2YIDA 4S24A 2FEWB 5ISMA 3L4JA 4K7JA 1FP4A 4XX1A 3CH7A 1SVNA 2MINA 2E5WA 5CFOA 1B6RA 1V9LA 4K46A 3RVRA 1X7ZA 4N7MA 4W5OA 4I4NA 1CHNA 2Q8NA 3NDRA 1KEPA 4XYMA 2VJAA 1JTVA 2G63A 2FOIA 1R00A 3E9MA 4TL6A 4M55A 4YQEA 5KJ1A 1E96A 1YB6A 4V1CB 3R9WA 1PYDA 4ROTA 2Z8YM 5REQA 3WRYA 2O2ZA 3RHTA 5DULA 1BRTA 2WAMA 4J6FA 4RENA 4RL6A 4EW1A 4Q7QA 2O5EA 1XDBA 4QEZA 3MINA 4MVJH 3IUBA 5AXCA