4DIUA

Crystal structure of engineered protein. northeast structural genomics consortium target or94
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
245
structure length
245
Chain Sequence
b'IVPPKPFFFEAGERAVLLLHGFTGNSADVRMLGRFLESKGYTCHAPIYSGHGVPPEALTRFGPEAWWQDVMNGYEFLKNKGYEKIAVAGLSLGGVFSLKLGYTVPIEGIVTMCAPMYIKSEETMYEGVLEYAREYKKREGKSEEQIEQEMEKFKQTPMLTLKALQELIADVRDHLDLIYAPTFVVQARHDEMINPDSANIIYNEIESPVKQIKWYEQSGHVITLDQEKDQLHEDIYAFLESLDWL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Engineered Protein PF00326
molecule tags Structural genomics, unknown function
source organism Synthetic construct
publication title Crystal Structure of Engineered Protein. Northeast Structural Genomics Consortium Target OR94
rcsb
total genus 94
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2012-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4diuA00
4BP8A 2AXEA 1N8SA 1GPKA 2OGZA 3VISA 5EIEA 5ALDA 3IB3A 3WZLA 1UFOA 3IUMA 2ZJFA 3BL8A 4G4IA 4H7FA 2Z8ZA 1XZEA 4FFWA 4Y2UA 3NGMA 1THGA 2VT6A 2IX9A 1U2EA 3WJ1A 3IIIA 4DNFA 5JZ9A 1EB8A 1G66A 2O2HA 1KU0A 1LLFA 1WHTA 4JH0A 1MX9A 3I28A 4TVKA 5CH8A 1XRQA 1IUNA 3L1HA 5CH5A 4KAFA 1GXSA 3ZV7A 5ALFA 2XUJA 1FJ2A 4QA9A 3MUOA 5AM5A 2OQVA 5AOBA 2XLBA 4NVRA 3V1MA 3QVMA 1SC9A 3AIKA 3DYVA 3SWWA 4DSAA 1C4XA 2O2IA 2RONA 5AI5A 3ESAA 1CLEA 1GPLA 4S0XA 3D5EA 4B84A 4KRXA 4YPVA 5JYCA 1ZD3A 3WWCA 2PM8A 4PNZA 3D0KA 2AJCA 1UK7A 1AUOA 4EY8A 3HZOA 2ZYHA 4HXGA 3CN7A 4W1PA 4NZZA 4UFNA 4MWTA 3R41A 2DHCA 4PQEA 4B81A 3A70A 5LZ7A 5ISMA 3V48A 3YASA 2XI4A 4U2FA 5IKXA 5JALA 4ZI5A 4H7HA 2ACKA 5C8VA 1GKLA 2C0PA 5AH0A 2GBIA 4AX4A 5K5EA 3PI6A 2B9VA 2WHPA 3V9AA 5HF6A 3W2TA 2GYWA 3DKRA 4OU4A 3NUZA 4W1SA 4H7DA 2VATA 1LBSA 1A88A 4C01A 4KAAA 1XRMA 4J0DA 3L1IA 2AJBA 4U2DA 4DMHA 4J0JA 3STUA 1Q84A 1A7UA 1CUDA 2DHEA 4W1RA 2D0DA 3QBJA 1ACJA 2RHTA 3QPDA 4QDUA 5AI9A 1XZFA 3M81A 4D9JA 2WG2A 5C8XA 1CV2A 2RGUA 3F97A 6YASA 1SOMA 5JAOA 5AI0A 4GXNA 1MTZA 2BKLA 2XUHA 2BGRA 1XZLA 3D59A 5IVKA 4H0CA 5ALVA 3WKAA 3DDUA 2GZRA 1VOTA 1QIHA 4DNPA 4Y9SA 1WB6A 2BCEA 5ALWA 3FLBA 3I6ZA 2DFPA 5T4FA 3RK4A 3FNBA 2WKWA 5A7GA 4Q1VA 5ESRA 5CT5A 4B82A 2PSDA 3C6XA 1XLUA 4FDMA 2JGEA 5A7FA 3H2JA 4ZRDA 5I7UA 4MYSA 7YASA 4X3CA 4EBBA 4AQDA 4BAGA 4EY4A 2BUAA 3G9UA 3RARA 2OCIA 3LIIA 1K8QA 4Y2YA 1TRHA 4PW0A 4IH9A 3IA2A 3ZLUA 5AM1A 2XQIA 2OG1A 4ITVA 5D6OA 5ALYA 4WJLA 3DCNA 1W6RA 4IQ4A 4QE3A 5LKAA 1WB4A 4OSEA 2ORYA 4OUKX 2XQGA 3N2ZB 1TCCA 2JGLA 3W9UA 1IVYA 2W6CX 3WYDA 2WUEA 3UUEA 3ZPXA 2G5PA 2VJDA 4LXGA 4Q34A 4N5IX 4XVCA 2AJ8A 1E8NA 2XUIA 4H18A 3C70A 3IUNA 4K6KA 4AN1A 4UHCA 4QDXA 5LIPA 2HA4A 3IVMA 4B7ZA 4QWWA 1HDEA 2E3JA 5IVHA 3OTQA 1SCKA 5HFAA 1XRNA 3WWOA 1GPNA 5ALNA 1TCBA 2UZ0A 4KE6A 1CPYA 4Y2JA 1CQWA 5AJHA 3PUHA 3DL7A 5JAPA 1VA5A 5DYTA 4KACA 5AM2A 2AJLI 3H18A 4F21A 2WG0A 4B0OA 1BE0A 2J4CA 3QH4A 4KE7A 4CCYA 4ZGBA 1TK3A 3STTA 2HDWA 2RI6A 3DL4A 2Y2UA 3EBLA 4B80A 1R1DA 1ODCA 4Y2SA 1XZBA 1ETHA 3FSGA 4P08A 2ZSHA 3BJRA 1CUUA 2ZSIA 2P8SA 1A8SA 3R3UA 1LPAB 1AC5A 1GQSA 4GI1A 3K9BA 4PO3X 1XZDA 3W06A 1DQZA 3C87A 4MXDA 3E0XA 3C6ZA 3G02A 1HLGA 3I6MA 1ZGBA 5AKHA 4J03A 3BF7A 4DM7A 4O08A 3DJYA 1CR6A 1BEZA 1ZI9A 4KRYA 2I3ZA 5K3EA 1W75A 3VJKA 1BU8A 3WK8A 5AHXA 4AO7A 1A8UA 4CIBA 1GGVA 3BE8A 5AO9A 5IVIA 1UK8A 4QNNA 1EDDA 3O9MA 4DNOA 3FBWA 4KE9A 1E8DA 2JGJA 2QR5A 4LIPD 3OPMA 4DIUA 2K2QB 3LS2A 4QDZA 5LZ8A 2XMBA 2BJHA 4X93A 4HXEB 2O7VA 5FRDA 4UHDA 1Y37A 3HYSA 5HFNA 3D2BA 2CZQA 4BP9A 1R4ZA 4H7JA 1EK1A 1N5MA 1QO7A 1ZI6A 3KWFA 2CUTA 4A16A 1W1IA 1P0MA 1CQZA 4X6UA 1D07A 1Q83A 2WU3A 3B12A 1XZJA 1Y7IA 2X5XA 1A8QA 3DLTA 4BCDA 1K5PA 2Z3ZA 4RNCA 4AO8A 1MNAA 1BRTA 5DWDA 3BDVA 2HA0A 4UBKA 5LLSA 3R0VA 3HLKA 1IZ8A 4LXHA 2FJ0A 3G9ZA 3O95A 2BFNA 4G8CA 4B9AA 2WFZA 1IUPA 1LPBB 4N8SA 3GUUA 3I2JA 2JGMA 4WFJA 2X76A 2WIJA 2WHPB 2VJAA 3ZLTA 4BAUA 1WM1A 4J0GA 2VJBA 4X95A 1H2ZA 1XLVA 5AOAA 1BN6A 4MQMA 5CW2A 1F6WA 1MNQA 1KU6A 2XMSA 1W4LA 1P0QA 4ZXFA 4KYVA 4JYMA 2R8BA 5LZ2A 2YXPX 4X92A 3WWEA 3LCRA 3QZUA 1DT3A 2XQFA 5A62A 4F0JA 2H7YA 3H2GA 2WU4A 5AIAA 2ZJ7A 2H7CA 3QPCA 2J3QA 5C81A 4X90A 2DHDA 2AJDA 4WFKA 1QO9A 1CVLA 1FFCA 5ALTA 3C5WP 3SC2A 1L7QA 4DLNA 2PU5A 3RM3A 4INZA 1DINA 2QT9A 1VXRA 2BGNA 3IULA 4FBMA 3WK5A 2XUKA 1HL7A 1C7IA 1LZLA 1ZICA 2OLEA 1CIJA 1FFBA 5CXUA 3F67A 2VT7A 5EHXA 4U2BA 3WKEA 3G0CA 1VZ3A 5JASA 4C4YA 4BCBA 4Y2TA 4A23A 1CUVA 1WCYA 1CUEA 1HKHA 1ZJ5A 2VF2A 3M3DA 1QFMA 3IUQA 2WQZA 3T52A 3WI7A 4BZZA 4Z49A 3I1IA 1R9MA 2JEZA 4XJVA 1QZ3A 1ZJ4A 1O6GA 2JBWA 2WJ4A 2WTNA 3ED1A 5JD4A 1RWQA 1XRPA 3OM8A 4RGYA 1XZHA 4KR0A 5HK9A 3D2CA 1CUJA 4L0CA 5HQ3B 3KD2A 1UOOA 1EXWA 2PU7A 5E4TA 1ZGCA 4X00A 3WJ2A 1W76A 4N5HX 4BDTA 5BV7A 3F9CA 3G7NA 4NS4A 4EZIA 4J0CA 1R88A 1AGYA 5CBKA 2QM0A 5ALRA 2YYSA 3FSGD 4WY8A 3HXKA 5I9IA 3PFCA 4FBLA 2Z3WA 3HI4A 4ARBA 3O4IA 2QTBA 3STVA 4E46A 1U65A 5AKXA 3PE6A 4PSCA 1J1IA 1QGED 3ESDA 3M82A 3R40A 4AZ0A 1JMYA 4GECA 1QIFA 3WKBA 1B6GA 2CKMA 5FP0A 5JARA 1SFRA 4Y2XA 1LBTA 3EIOA 4KEAA 4FLFA 2R11A 4K6HA 3ESCA 3A6ZA 1QIJA 3FYTA 3HSSA 5E2IA 2HFKA 2XMQA 1XLWA 3TGLA 1JI3A 2OGSA 4HAIA 2C5FA 4ZV7A 4EB0A 1BEEA 1H23A 2QUBA 4ZWNA 4CG1A 3PDCA 3AFIA 4GBGA 3G0BA 1YSCA 4W1QA 4AB1A 3CXUA 3FYUB 4FOLA 3PICA 4MYDA 1AMNA 3R3YA 1ZIYA 3WWDA 5HF9A 1XQXA 1BN7A 1EK2A 1G42A 2HA6A 2C5GA 3BWXA 4QWMA 4UPDA 1YASA 1O6FA 1OILA 5JAUA 4Y2VA 3I1YA 1EVQA 4DSZA 5J3JA 1QIDA 1QONA 1JU3A 5KWJA 1J06A 4FNMA 1QIIA 2PSJA 5D3KA 1TQHA 3Q0TA 4X94A 3H2HA 3VJMA 3C8HA 5T4HA 3WL8A 3I2KA 5IH7A 4W9RA 1ZD4A 3WKDA 1Q0ZA 2V9ZA 2XUQA 4C6HA 1K6EA 2C4HA 2EEPA 4B85A 1JU4A 4BYMA 4UHBA 5CURA 3DD5A 1E3QA 4L9AA 5FPPA 1EX9A 2DSNA 2O2GA 2XT0A 2C7BA 4C89A 1GKKA 2BUCA 3AILA 4QLAA 2JF0A 1PJAA 1DWPA 1ODSA 2PBLA 4UHHA 1XZGA 5HK8A 3G9XA 4BTLA 5JZSA 2OCGA 4UBIA 4E11A 5ALPA 3O0DA 2J4FA 3ZWQA 4CFSA 5LZ9A 5CT6A 3AZOA 3HRHA 4G9GA 5DYWA 2QZPA 2OCLA 2QJWA 1XQWA 3G8YA 3CCBA 1X70A 3R3VA 2JGFA 3WMRA 3E4DA 1VKHA 3I2HA 4K6GA 5SYMA 1J2EA 1ZD5A 2HA3A 4BB0A 4ARAA 2OAEA 4JUIA 5E4YA 1UK6A 2Y6UA 2RIPA 3WK7A 4DMKA 5BOVA 3C6YA 2HA5A 5JAHA 3MVEA 4U2CA 3I2IA 4HVTA 2HRRA 4J0KA 4EUSA 2DQYA 2O7RA 3AIMA 1B41A 4HTAA 2PSHA 1QIEA 4UFOA 3AINA 3FYUC 2XMDA 5AICA 4GWLA 4OYLA 1GT6A 1CUHA 4BRSA 1AKNA 1ODTC 2HIHA 1UK9A 3P2MA 3X3HA 1IUOA 5ALXA 1QTRA 4QDOA 5CXXA 1H2WA 4RPCA 3E3AA 1XRLA 1CUAA 4BATA 5FLKA 3TEJA 4G4GA 1E8MA 5AKIA 3W04A 4OCZA 3WIBA 1NU8A 5AP9A 1MPXA 5EI5A 4MEBA 4M0FA 4FTWA 4I4CA 2XLCA 1Y7HA 1YS1X 1QOZA 1GZ7A 3FYUA 4FHZA 1AURA 3LLCA 1QIKA 5ALQA 1XZMA 1E89A 1XQVA 1FFDA 5AI4A 5AM4A 3IURA 4OYYA 1MX5A 4YK7A 4YX9A 1RP1A 4I19A 1AX9A 4C4ZA 2RHWA 4L3WA 4QDTA 3KDAA 5AM3A 4FWBA 3WL7A 5AK4A 1UZAA 1LPOA 1OXMA 3UMJA 3O4HA 3B5EA 3WLAA 5AK5A 2WM2A 3U0VA 3C8DA 1PV1A 4Q82A 4X6XA 2VA9A 5IVDA 4WFIA 1P0PA 2GYUA 5HF8A 2WLSA 4MWSA 2WJ6A 1CUIA 2GBGA 4PF1A 4G1FA 2WHRA 3PF8A 3ESBA 1YS2X 5A6VA 4OD0A 2XQKA 1DT5A 3G0DA 2JIDA 5ALUA 2YASA 2Y6VA 3D2AA 5A7HA 3K2IA 1BCRA 1CUGA 1CFJA 4UBLA 5F4ZA 3DOHA 3HC7A 1WPRA 5E4JA 2FX5A 5D3ZA 2H7XA 1X2EA 4GLBA 1QJ4A 4XX1A 5AKYA 4FNGA 1MN6A 1ORWA 2QXUA 1ZOIA 4KAJA 4Q3KA 4J7AA 3HACA 2ECFA 2I03A 3DS8A 2OGTA 2Z5GA 3IUJA 4OU5A 5KBYA 3GZJA 3VVLA 4EY5A 1Z68A 4IH4A 3OG9A 3WQHA 4G8BA 5ALZA 2JGIA 1DX4A 2QVBA 3D3NA 1C7JA 3DEAA 4OPMA 2EDCA 5ALEA 3D7RA 4H77A 1YAJA 1IZ7A 3S2ZA 4HS9A 4KE8A 1CUZA 2ES4A 2QKYA 4MEAA 1EH5A 3O4JA 2QS9A 1DWOA 5ALMA 4LKOA 3R3ZA 1SCIA 4Y7DA 5ALHA 5AK6A 3G0GA 2QRUA 4XWGA 4AMZA 2ZYRA 4H7KA 2DQZA 1K4YA 5HKAA 1UKCA 4BDSA 1MU0A 4H35A 4RE6A 5A71A 1W52X 2XE4A 4BZWA 4QLOA 5CMLA 3M83A 1YA8A 1LGYA 5K3FA 4FKBA 5LKRA 3D4LA 1IMJA 2XUOA 1JJIA 1XQYA 1LZKA 3OOSA 1XFDA 4PSDA 3V1NA 4WDRA 4IHAA 3JYHA 3V1LA 3FVTA 1ACLA 4X85A 4ZV9A 4H7IA 1FSSA 4DNQA 5D7BA 3B3QA 1AZWA 3WZMA 4Y2RA 2ZJ6A 3EQ7A 2VAVA 2ZYIA 4BC1A 3PUIA 5CRIA 4CG2A 2XMGA 4HXFB 3F96A 1PFQA 5FDFA 1RYYA 5ALLA 2C0QA 4C87A 4MQLA 1LPSA 3STYA 2WILA 2OAGA 5H3HA 1F0NA 3C5VA 1R3DA 3WA6A 4DYHA 3UUFA 1UWCA 4GHWA 4J0IA 1YA4A 2PUJA 1BROA 1F0PA 4OB6A 1QE3A 5CT9A 1QIMA 4E14A 3R3WA 2FJPA 1GQRA 1L7RA 3AIOA 4LYDA 1MX1A 5K3CA 3L1JA 5T4BA 3HABA 3I6YA 3OC0A 4X71A 4HZGA 2B61A 2QXTA 3A2LA 2H1IA 1ZD2P 3QITA 4K2AA 3H1AA 5DTJA 3FCYA 5DNVA 1FFAA 4B0PA 1CUFA 5EIHA 2VSQA 4M0EA 4J0HA 1CUWA 4X7BA 1LNSA 5JD5A 3DKKA 1YCDA 1JFRA 3I2GA 1G4HA 1T2NA 2OPHA 4U2EA 1DU4A 5EIAA 3GROA 4MJ3A 3IBTA 5AM0A 4W63A 4IH1A 5AIBA 3R3XA 2OXEA 2WFLA 3WL6A 5KWIA 4G8DA 1VJ5A 4BVJA 1UXOA 3W05A 2RAUA 4DGQA 1OCEA 3WL5A 5BWCA 3ZLVA 4H7EA 3C6BA 3DQZA 4KJXA 4GDMA 5EHNA 2GBFA 3O9VA 2FUKA 2ROQA 1KEZA 4PV7A 2D5LA 4JYPA 5FXMA 4CIAA 2WIFA 3FWHA 2Y2VA 2CB9A 1DWQA 4BRZA 3H2IA 4CCYB 3GFFA 4UBOA 3RKSA 1TKRA 3A2MA 5HZGA 1WHSA 1MAHA 3A2NA 4B6GA 5CT4A 5JATA 1TCAA 1LPMA 3STWA 5ALOA 4UBNA 2J3DA 2HU5A 3ZI7A 4BC0A 3ANTA 2PSEA 3F8SA 4E15A 3WA7A 4EY6A 5HQ3A 1K63A 1U4NA 2Q0XA 1YB7A 1AQLA 4UUQA 2VJCA 2C58A 5EHQA 3WWPA 2NW6A 2G4LA 3ICVA 3LIPA 3VXKA 2XDWA 1XZIA 1UT6A 1ZIXA 2VTVA 2WIGA 4LXIA 4M0MA 4XIIA 2CJPA 1DTEA 3WK9A 4EY7A 1WPXA 1YB6A 2HRQA 4J3JA 2WG1A 1H2XA 3EQ8A 5AI8A 4OB7A 1EHYA 4ETWA 4C4XA 1JMKC 1FFEA 4N8DA 3VDXA 5AKZA 3H04A 4L72A 3E1GA 1LPPA 2HM7A 4F60A 4GEGA 3C43A 4V2IA 4EHBA 1U8EA 2X8BA 5HF5A 4UBMA 1THTA 4A5SA 1TIBA 2OCKA 4P92A 3FLEA 1UKBA 5AKJA 3QYJA 4JEIA 5C8ZA 3WK6A 3IDAA 5JIBA 4WY5A 4P9NA 1MJ5A 1EVEA 3RLIA 2QOEA 4UHFA 2HA2A 3LP5A 1M33A 5EFZA 1G5FA 1CUYA 1QLWA 2PKYX 3FLAA 3WK4A 3FAKA 1WOMA 3U1TA 4Q3OA 5ALJA 4TPKA 4EA6A 3VJLA 2IITA 1LPNA 3W9BA 1MO2A 4AZ3A 5DNUA 3AZPA 1QFSA 3TRDA 1N1MA 3F98A 5FKJA 5I8PA 3JW8A 2I78A 4B9EA 4IO0A 4ZREA 1XKLA 4DMFA 1N5RA 4BE9A 4CCWA 3MUNA 3AJAA 1BS9A 4UBJA 2PL5A 2QJRA 3CCCA 1XZAA 3QMMA 5HKBA 1SCQA 5LYYA 1EI9A 1YR2A 4FLMA 3SX4A 1UKAA 4LYEA 4GW3A 2G63A 3S8YA 1HPLA 3KXPA 3NWOA 2V96A 2LIPA 2V98A 4K5QA 4FFVA 1ORVA 5EHZA 2DCMA 2WFLB 1E66A 1UOPA 4AXBA 4UFPA 4OB8A 3KWJA 2JGKA 3BIWA 1J07A 4Y2QA 2JEYA 4AMYA 2HA7A 4BAZA 1HBJA 3H2KA 1NU6A 2WUFA 3FVRA 1TAHA 5LZ4A 1XRRA 2B4KA 5KREA 3Q8WA 4YASA 3WIOA 2PVSA 1CUSA 3JWEA 1CUXA 2CEKA 5SYNA 2IIVA 3MGAA 1ISPA 5CTAA 5CH3A 3T4UA 2CMFA 3HEAA 1XROA 2DR0A 3WKCA 5ALSA 4BVLA 1X2BA 2YH2A 2ONCA 5K3DA 2GYVA 2W22A 5LZ5A 4C88A 3GELA 3KSRA 3VKFA 4P93A 5AOCA 2WTMA 1CRLA 4Y2PA 3NOXA 4WDQA 1VXOA 1T4MA 5DYYA 5ALKA 1EB9A 5K3BA 4HRYA 3ICWA 1ZI8A 5AKKA 2WUDA 2PUHA 5C7YA 4QEKA 4G5XA 2WHQA 2H9YA 1S8OA 2VEOA 5DTIA 2XMZA 3SK0A 2WIDA 2OQIA 1CUCA 5K3FB 2BAGA 3H17A 5HCUA 1DX6A 3FCXA 2XMCA 1QTIA 5CT8A 2Y1KA 1EA5A 2XMRA 1MAAA 1VLQA 2B20A 2GBCA 2I3DA 3K6KA 2XUDA 4Q05A 1JKMA 4BVKA 2Z8XA 5AK3A 5LP1A 4N8EA 1EINA 5JZBA 4X6YA 2HHAA 5ALIA 2HU7A 5FPQA 5YASA 1JJBA 2PPLA 4QZVA 4PSUA 1CEXA 2WIKA 2V97A 5DJ5A 3STXA 1R9NA 4BCCA 4G4JA 3DOIA 1WB5A 4DTCA 3BJMA 3QM1A 5A2GA 4BTVA 3ANSA 1NX9A 2XUGA 4FLEA 3G9TA 4DMCA 4AN0A 3H0CA 2WSLA 4Q3LA 4TGLA 4UHEA 5DNWA 5AI6A 1P0IA 3DNMA 3BIXA 3BXPA 3H19A 4LHEA 2QMQA 1HQDA 3V1KA 1MT3A 1VA4A 1DQYA 2QUAA 3AUKA 2WUGA 4HRXA 5BWBA 5ALGA 2XB6A 3DYIA 1CUBA 3G0IA 3H1BA 3I2FA 2ZYSA 2XQJA 4RE5A 3GBSA 2WJ3A 2HU8A 1F8UA 4X91A 4U2GA 4ROTA 1QIGA 3TJMA 1EDBA 2HADA 2VQ6A 2XUPA 2XUFA 1E5TA 1JJFA 2BUBA 3EQ9A 4FMPA 2WFMA 4WCVA 3PFBA 4B83A 1BCSA 3BDIA 4JNCA 2HL6A 2EDAA 3WYNA 5FV4A 3CN9A 2G5TA 1VE6A 5AKGA 5T4EA 1EDEA 4CI9A 4I3FA 2GZSA 4G9EA 3KOOA 3C45A 2PSFA 4CG3A 5AKEA 4BBZA 2ZVDA 5EGNA 3VVMA 3EF3A 3AZQA 2VAXA 4AO6A 3OURA 4X97A 5JD6A 1YAHA 4BE4A 1USWA 5K3AA 5DLPA 4F5ZA 3GA7A 2PX6A 1H22A 3HJUA 3PF9A 4NMWA 5JANA 1XKTA 3O4GA 2XUAA 1VE7A 1Q0RA 5FUMA 3QMWA 1JT2A 5FOQA 5JADA 3ILSA 1XZKA 2ACEA 3FOBA 3QPAA 1L7AA 1H2YA 5AKLA 3N0TA 2HFJA 1XZCA 1VZ2A 1UOQA 1I6WA 3BF8A 1R50A 2CBGA 3QMVA
chains in the Genus database with same CATH superfamily
2JKYA 1OLSA 3NBUA 4TV8A 4BP8A 1GAWA 1N8SA 3P2OA 1G8KA 2PXCA 2L18A 3FNQA 4J75A 4OEHA 5LD2C 3U7RA 3F5MA 2OCDA 2NSLA 3QG1A 3ZD9A 3ETEA 3PEUA 3IDQA 5EKDA 1T4GA 1JHAA 4Q16A 4M9UA 2DKFA 3PQ3A 3TNJA 1LC3A 1YZUA 2J5BA 3CRRA 1EBFA 4MQUA 4PYRA 1DIRA 5FTMA 1N0HA 1XL1A 1NYRA 3H86A 3HVIA 3M9WA 4GUDA 1I6LA 4TRMA 3SR0A 4I8DA 1JR3D 1XALA 1TRKA 4NENB 3MA0A 1M1YE 3TAHA 4BUJA 1XZEA 7ADHA 3I9JA 2YOFA 4JS0A 3T61A 3ZCPA 2FPSA 1WCIA 3NGMA 4QVGA 4MINA 3ZHQA 1X87A 3U4DA 2IX9A 4GPIB 1R15A 3PTZA 2Q5QA 1NI4B 1ZD8A 3OPQA 4RVNA 3TN7A 3WJ1A 4DCSA 3DONA 3FOCA 2YYZA 4KWIA 4NZNA 3OJEA 4P38A 3F8TA 5I9SA 4B4KA 1KARA 3PUVA 1CB7A 1LA2A 1N7GA 1O95A 2JH3A 2QX8A 1Z56C 1EUZA 3KX2A 1ZG3A 2AC7A 3PE3A 4MYHA 1PSZA 1KU0A 1LLFA 1Y3HA 2ZGVA 3KB6A 3F8WA 2XT9A 1X1AA 3OLXA 4Z51A 1IHYA 5CH8A 1DZIA 2NP6A 3G7UA 1P4SA 1L1QA 2DQKA 2IYWA 5JO0A 3L1HA 2C7PA 4CM8A 6Q21A 4IIVA 1V6SA 5IJ9B 3PDJA 4YEDA 3QEJA 3B7PA 1GSIA 4JBLA 4YRBA 4AJOA 2CXHA 3O38A 1K4KA 4DJAA 1R7RA 4IG9A 2J9FA 1U2GC 1SC3A 2R6ZA 3MUOA 4DY6A 2DBYA 1RWWA 1YC5A 4MCAA 1HDIA 4M53A 4CMEC 4LPKA 1C0PA 3NVMB 4IVNA 4EMTA 2W6ZA 2HWKA 1PV2A 3QVMA 3V1MA 1NE2A 2Q5HA 3WK4A 5LQCA 3AVXA 3EUFA 2RGDA 2Z6QA 2GD1O 2RONA 1AQUA 4WOCA 1A9YA 1F60A 1LNZA 1KVUA 4S0XA 3KV1A 4MPJA 1HYGA 4P82A 4YPVA 2P3OA 1MCZA 4DV1B 2I71A 4TTAA 3V8PA 5DLDA 3WLLA 4XUEA 2AJCA 1YNOA 1MVOA 1AUOA 1KBQA 3HKBA 2P78A 3HZOA 4AYWA 1EWQA 1G17A 1I4OA 2ZYHA 4F85A 3AUTA 1WW8A 3RBXA 2C9ZA 3QE4A 2R85A 1SVWA 4OHXA 4W1PA 3SC3A 3DV9A 4UFNA 4MWTA 5JS6A 1MEJA 3JQGA 3SJZA 3B38A 3K15A 5ISMA 1N7JA 2XI4A 1Q14A 1IEWA 3EQZA 3DTNA 4G67A 2ZBDA 4OAPA 4ZI5A 4CFZA 2ACKA 5JALA 3K0CC 1PGNA 2C97A 1GKLA 3BKXA 1KI8A 3K0KA 1JEJA 4NQRA 4V38A 3H84A 2H4XA 2QLMA 3DFMA 5AH0A 1UBRS 4UMEA 3PI6A 4YRCA 4DVGA 1HF3A 3AETA 2AEJA 2IYNA 3W78A 1TEVA 4DR1B 5DRTA 1GYPA 2D5IA 5A9SB 2C9MA 2F64A 1TIKA 2BONA 2WQ6A 4DR3B 3CT4A 3DKRA 4FGLA 2CBZA 1V5GA 3NBYC 4W1SA 4OGGA 3BMOB 4MYRA 5GJWC 3LVBA 2CC2A 4C01A 3ZDBA 3I05A 2YOHA 4HXYA 4OKNA 1BGXT 2DFKB 4MWEA 1HDZA 1POXA 1YMVA 2ZDQA 3PITA 4BRSA 1RADA 5G4KB 3PXAA 1R0SA 5KJFA 3TSAA 2GTHA 1HMYA 2PXXA 4BLOA 4BWFB 1LVGA 1DO2A 3LUGA 4GMKA 1Z4QA 2ATVA 4JEUA 4ND3A 3N59A 5I9LA 3W5CA 2GPYA 3ND9A 1Y6GA 1ORHA 5JNWA 4WESB 4QELA 4F9FA 4EM6A 1F0KA 1V1RB 4CETA 2R7AA 3GVHA 2WYIA 3QBJA 1RXCA 1TO2E 2Z1DA 4BFXA 3V4SA 1BU5A 2FU5C 3QPDA 3RS4A 2QGNA 2GF2A 3IP5A 4BO0A 4MS4B 1DAPA 5AI9A 3TH5A 3M81A 1TO6A 3B2NA 5DHFA 2WF5A 3H65A 4FZ5A 4QJBA 1U2PA 2ZE7A 3NHBA 2FZLA 2RKOA 1WX1A 2BKXA 3F97A 6YASA 4KQCA 4EPRA 2JJ8A 1YK1A 1EJBA 1MD9A 4DEVA 2WJGA 4EYEA 3U6BA 2HW8A 5C5CA 4DJ5X 1MGPA 1T8TA 4GXNA 1SMKA 4O3FA 1C80A 3WHLA 3EISA 3GRRA 3U7HB 2X9NA 2XV1A 1F6BA 1WUYA 3V55A 5IVKA 3ZD6A 1P5JA 1NRJB 3CVYA 3RFXA 1XTJA 3BTSA 1W85B 3DDUA 1WW3A 3MG9A 2XPCA 3N76A 4FS3A 4DZZA 3QLVC 1P4JA 5HQJA 3TZLA 3WTBA 4C7XA 1QIHA 2JLRA 5ARBA 1VB5A 4DLKA 4DNPA 1A97A 3RADC 1VSUA 3M9LA 4C0XA 4NJMA 4XWYA 1PHRA 1K0FA 2DFPA 5IMSA 4MMZB 3FNBA 4R9NA 1HH4A 3A1UA 3O8RA 3OAAD 3D1JA 5M3BA 1NP7A 3CZ4A 4IJQA 4Q1VA 1U8CB 1IVSA 1S89A 3DE1X 3GBVA 4HY3A 3EH1A 3O8NA 1NR1A 2JKZA 3KALA 5DNEA 5BQFA 2VSYA 4TVBA 2I65A 2I99A 2YVKA 3C6XA 1H6CA 2ZXFA 4TV9F 2KBFA 1YKGA 4R1QA 4TXMA 1G4AE 1KFBB 2PH7A 3CPSA 1K8YB 3P5SA 5TRTA 3CG4A 2W42A 3SYKA 1IE3A 3IYLW 3ZCVA 2X1MA 5B36A 5A7FA 5H3LA 3UPTA 4ESHA 3FZQA 3L0BA 1YE8A 4XQGA 5EXPA 1HM5A 4BGIA 5I7UA 4TTQA 3KQLA 7YASA 4EBBA 5BUCA 1EFKA 1JVBA 2GBPA 1WTAA 2ZBQA 1OI3A 1V9LA 2YXLA 4RSRA 4BPRA 2MT9A 3INNA 2Z5LA 1DXQA 2P4EA 3G9UA 4PRYA 4KDFA 4Q4LA 2XB8A 4UM5A 3RYCA 1LLDA 2P2SA 2NTYC 3IUBA 2JFWA 1FPQA 3O3NB 3D4IA 2OXIA 2J31A 4KBGA 5IF9A 3N2EA 3F7NA 2OG1A 1GTZA 2ZT8A 1OV6A 3G5AA 4J6EA 4HYTA 2CLDX 2FQQA 3GJ0A 5D6OA 3TQHA 2VYFA 3DCNA 4IQ4A 2XT6A 3L7DA 2A0UA 5A05A 1FFXB 2YHIA 4B6QA 4F4HA 5D7NA 5DW3A 4B47A 4CKEB 1P18A 3MELA 3WMWA 2ZZMA 3JRWA 2Y0BA 3ABOB 1CQIB 4QE3A 4RZXA 2XKAA 2A1TR 1TLLA 4O3MA 1RKUA 1NVEA 3LHIA 4KTVE 5GIPE 3N2ZB 4PG4A 5BSVA 3W9UA 1TYEB 2AZXA 2DT5A 1OBFO 4PHGA 4MPTA 5HDBB 2F3TA 4J0FA 1HMPA 5DFAA 3W7VA 2FZ5A 3NH9A 3WIUA 4KPGA 1DKRA 4MWZA 9ABPA 2HREA 4L0DA 2DYKA 3UQZA 1NG1A 1U0GA 2QRVA 4HWSA 4G5FA 4I2NA 3DXZA 1K7CA 4ZCMA 2I80A 2W71A 3VAYA 3KC2A 4MDHA 4A8JC 3EHEA 3H6HA 3NC1C 3KQOA 4LXGA 3GFQA 3KOMA 1M7HA 5EFOA 3ZHXA 1RXEA 2IK8A 4OA5A 3SHQA 2VPZA 1KPGA 2I4OA 2R5FA 2VZ0A 2WJAA 2OPBA 2GJ4A 1SZDA 3O1HB 3TRKA 5JSZA 3WLJA 2A4KA 2QM8A 2ZJ5A 4FFSA 3U7GA 2PJDA 5AMXA 3ZC3A 4XM2A 6ABPA 3TTUA 5ELXA 1KGDA 3C98A 2JJ2A 4R41A 4AN1A 3I6QA 4G2TA 4B33A 4F06A 5MFPA 2YV4A 1U7XA 5FR2A 1CZHA 2RHMA 5EE5B 4Q0MA 1BKDR 1VIMA 1D1TA 4TVSA 3IVMA 3WNVA 1OC2A 4IDHA 5CK4A 1A5SB 2QVZX 2GCOB 3PXGA 5M7EA 4GXTA 1VIAA 1HDEA 1QR6A 1QFZA 2A58A 2YJ5A 3NIWA 1JPUA 3OTQA 4JP3A 2WYWA 5K0BA 5IVHA 2FG6C 1SCKA 4E51A 4MGHA 4RO0A 4OF4A 1JG3A 2RHCA 3WWOA 1GPNA 1W5TA 2FPWA 3U37A 2SKEA 1XELA 2VDQB 3O94A 2J9XB 2UZ0A 4CMJA 1DKOA 2HUNA 4UU8A 4Y2JA 3F2VA 4KQXA 4L8VA 3LF2A 4DCTA 5H80A 4IIYA 1CDZA 2GN4A 2ZSBA 3RVQA 3FJYA 4DQXA 4F56A 1JUDA 5BV2P 5L3RA 3PJRA 4W5JA 1GZVA 1YJ8A 3Q2KA 4N47A 3V7WA 4BFWA 1DEOA 5ITWA 1KQFA 3T4PA 3A1CA 3NHRA 4IWNA 1HYQA 3VPGA 4OHVA 5AM2A 4F21A 4UZFA 5EY5B 4B0OA 2VI5A 1BE0A 1AGNA 1L3BA 2PO5A 4KE7A 4OFZA 4U3JB 3U9LA 2JD1A 4DIOA 3QA9A 1WZCA 5J5VA 1VSQA 2DCUA 4O1MA 2RI6A 3DL4A 2Y2UA 4B80A 3LPLA 4MGZR 1U3GA 2IJGX 4PLVA 2ID8A 3AJ8A 2W90A 1TW2A 1QWOA 3NKLA 1ODCA 1DKQA 4Q18A 4WW0A 1PX2A 3L4BC 4QU0A 4Y2SA 1N2OA 4PM4A 3NUQA 3PQEA 4MCHA 4UVGA 5L7TA 3VSBA 4PO9A 4C2UA 1C4WA 2P8SA 1EFTA 2VDLB 2X5NA 1X13A 3OLQA 4W8GA 2GO1A 4BGDA 2XTJA 3IT3A 2HDOA 1AC5A 1JKJA 4GI1A 4KFUA 4PO3X 1XZDA 3W06A 3VSAA 3SSNA 3TR5A 3NHAA 2JJQA 4YP0A 4PINA 1Y89A 3ETJA 2Y71A 1QP8A 1SK9A 1W49A 4X63A 4ICIA 3E0XA 2YY6A 3DZCA 1GEEA 1DARA 1P7CA 3C6ZA 2CK3A 3R5JA 2B9EA 3RVKA 10MHA 1RLMA 2O0JA 4A0SA 1EIWA 1HLGA 4XPIA 4RQTA 2QSJA 4CMIA 1N1DA 1USGA 2WJJA 1FNMA 2FFRA 3PR2B 1M2HA 4QECA 1M8FA 3L7AA 3ZVNA 4KGVA 4M6WB 4R9UC 3DWEX 4J16C 4WXPA 1KP3A 2ZRBA 3RVSA 3IELA 4O08A 1FDWA 3QF4A 3HXOA 2PX2A 3ZKWB 4ACAA 3T0GA 4TKVB 1RAEA 1OYVA 3CTPA 2HEIA 1HQKA 2OT3B 4LI0A 1HK7A 4NPHA 1GPMA 1E79A 3KV3O 3WLQA 2OVFA 4OK6A 4OK5A 1J0CA 1M9NA 1O4VA 1BU8A 1NBMA 3NKVA 5EG5A 4AO7A 4B09A 2J3JA 1NP3A 2A5YB 5CVEA 1GGVA 1IBRA 1PS0A 3BE8A 3OA2A 4PLGA 3QX7A 1ZIOA 4M1OA 3UYLA 4EQ6A 5BMVA 4KNYA 3QXSA 2KQUA 1NLZA 4REMA 1TUBA 3L0IB 4MP3A 2VPYA 2YW9A 3RSSA 3CKYA 5JSKA 5DISB 4MUGA 1GD1O 2O7NA 3OJWA 2YBDA 4PQGA 3HCCA 3VZQA 2EJBA 5A3QA 5H68A 5BO5A 5BN4A 2I7CA 4LIPD 3KYDB 4RIGA 4GYWA 4CE6A 1SXJA 2Z5FA 3A1DA 2VJLA 2HK9A 2H51A 4HLUA 4FT4A 5ARCA 4TXLA 1FYVA 3I5UA 4MUJA 2XH8A 1Z6ZA 1T0HB 1Z8HA 3GGSA 3LRXA 4ZPJA 3LS2A 4CM9D 2PJRA 1JKJB 2X9GA 2P9CA 4F12A 1Q16A 3K6SA 3T3EA 3K32A 4PCAA 4DLYA 2ZM6B 3CVVA 1E3IA 3IXLA 4OFBA 1U0OC 2LCFA 1TECE 3DULA 1AA9A 2EJUA 4OQMA 2PNFA 3CEJA 4HXEB 4MSUA 3OCYA 1ZEJA 4RLFA 3NAZA 4MGKR 3SNKA 3FSRA 3EVFA 1F06A 3TECE 3I42A 4C7VA 3DTVB 4YJ2B 3L1KA 3GLFA 5THKA 3LYAA 1LVHA 3FDZA 4UNSA 2CZQA 1A5AB 1NN3A 4R9VA 1XVLA 1COWA 1LI4A 1IONA 4YV7A 3VPHA 4HNVA 2DZDA 2C88A 3QX8A 1Q0PA 1PTJA 4A16A 3OH8A 1W1IA 4NV1A 1P6XA 2CVFA 4UM9D 1QKIA 2J6BA 5KU7A 4AKIA 3MCUA 3PKJA 4N9QA 1QGZA 3IQDB 2IOFK 3P0FA 2H5LA 1OKKD 1D07A 4Z0HO 1WLYA 4AMBA 3PXCX 2WU3A 5AWFC 1ZAKA 1X7WA 4HFRA 3WSTA 1KF0A 3UUGA 2AYXA 4ZVRA 1NHGA 1Q3KA 3U49A 2HSGA 4MICA 2A84A 2E21A 4UU0A 1LF0A 2JDIA 4MVYA 1YR8A 5KPDA 1D2HA 4RNCA 2G6BA 3NTOA 3NHLA 2FWPA 2JIZA 3ZXXA 5L7YA 4J91A 3T99A 4B3XA 2RB4A 3BDVA 2OXRA 3AEXA 2HMAA 3JQ9A 4O33A 5EJAA 2OESA 1M2OB 4N01A 3B82A 5HPYB 4LOLA 1CJUC 2RBKA 5HILA 5IAOA 1U3CA 5LLSA 1U94A 4Y6GB 1GADO 2B94A 3LH5A 4B2PA 3PQ7A 4DG8A 4OLBA 5KI6A 4TLEA 5EQDA 4FDUA 4K6MA 4EG4A 3L8ZA 3REFA 2WSSD 1IK6A 4MR7A 3O95A 5FF9A 1RXSA 3PQFA 2WFZA 4M54A 2CL0X 3HJHA 2HKIA 4C0KA 1C41A 2Y4OA 2Z9BA 4GE3A 4PQYA 1REQA 2Z1NA 1XCPA 3QVSA 2Z58A 2CXQA 2VQSA 1N8NA 3ZLTA 3L1VA 4XD2A 3SKYA 4ASUD 1BHJA 4BAUA 2JLQA 4IV0A 4X95A 3NM5A 4KVFA 4RX1A 4Q15A 4JLMA 3LX8A 4JC0A 2H16A 3AU9A 1GWNA 1CZUA 3Q2IA 4G1VA 3PDHA 3CKKA 2ASEA 5CW2A 2QQGA 4CVNA 4HR7A 4ND1A 3NAGA 4YMLA 5E6SA 4CL2A 3UMYA 1KFKB 4FR0A 4CL8A 1N9ZA 1WABA 2F7SA 3ECAA 4ZQFA 1W34A 2QRJA 4ZTBA 1AGPA 3DOUA 3I9MA 4PC7A 5F3RA 5LA6F 1ECBA 1ZBDA 1PFKA 2DMRA 1N9GA 2QI9F 4JYMA 5LZ2A 1ZR4A 1JV2B 1HNWB 2C2MA 3C41J 5F2OA 3Q8KA 1OFUX 1TLTA 2B69A 3HMQA 4CT5A 5L3SB 1PQ4A 2IYAA 2HPVA 3SEAA 3CH4B 4LRYA 5K4HA 1UQUA 3BWYA 3WYEA 3WWEA 3QU7A 2GCNA 2XIQA 3EZFA 2PMEA 3DEZA 1N6NA 4IFIA 1LS1A 4CLOB 5L3VA 1ZD9A 2NNLD 4V0KA 1IN4A 2CDAA 1J99A 4PGHA 4WQMA 1BYUA 1YDGA 3B36A 2R6R1 3GOHA 2WU4A 4H1TA 4MX8A 5FI5A 2HV9A 3CLKA 3GUZA 4GL2A 1EUDB 4PQRA 1OX4A 3M5DA 5KKCA 3OT5A 3L8CA 1C81A 3ZE8A 2FMIA 4XDHA 5C81A 5JC8A 2DHDA 1L2TA 4IVPA 4PAGA 1H0HA 4DC0A 3KQTA 3L9XA 4WFKA 3OLVA 1Z88A 3HCWA 5DZSA 2VF4X 2C5EA 3K0HA 4TKLA 4HNUA 3BVPA 3JD1A 3SQLA 1CVLA 1W2GA 5KSWB 3C5WP 2BELA 3L77A 4H0FA 1YIOA 4CU2A 2GUWA 2JB9A 1GG2A 2WB4A 2WJVA 1XDBA 4U7JA 3ILYA 4HG2A 3EZ6A 4ZC1A 3VZCA 2QT9A 1DRUA 1XCJA 3GP5A 4JA0A 2D8AA 1PR3A 5CDYA 3Q7SA 2C2YA 4H3VA 1WS6A 4TKUA 1DQPA 1I80A 4IINA 1Y4SA 4RJLA 3OE7D 4AIIA 2CJYA 5DVZA 4XX0B 1THMA 5DKFA 3NHFA 3VPAA 1O2DA 3GLUA 3MJRA 5JZMA 3ZTTA 3ZE7A 3M9XA 3NHKA 5ILOA 5BW5A 1X80B 5KKAA 5LVAA 3FFXA 3O90A 2V5AA 4G0NA 3I0NA 4TQUS 2CF6A 1J5EB 2QV7A 3AKEA 5CNKA 3IESA 3JQRA 1T5IA 1V3UA 4BFYA 5KQPA 1EFPB 5JUWA 3PQ4A 5E7QA 3E9RA 2YWRA 4YONB 4ZDWA 3DOOA 2FR8C 3RYCB 4PC2A 2VT7A 2VHVA 2RK4A 4TKVA 2BP7A 1TEHA 3M6XA 3A06A 4U5QA 1K98A 5DCUA 1VKZA 4BKRA 4TYPA 1E2BA 5AVKA 1ZRNA 1E2LA 2GH1A 5C35A 4C4YA 5JASA 1S2IA 2QTZA 3C3MA 3D6FA 2XNKA 3SZGA 4Y2TA 4R0MA 5CIQA 5KU1A 2X19A 1CUVA 4XEUA 1CUEA 1GRRA 3PJFA 4OL0A 1ZL2A 1I3OA 4KH0A 2A92A 1KH1A 1USUA 5CFRA 3FZGA 1EVJA 3PNPA 3OO1A 3ZDEA 4DE5A 3NVAA 2Q4BA 1JLSA 2PLWA 2XMPA 3TZEA 2AG0A 3RSCA 1DLJA 1WVGA 3MYYA 3Q15C 4LZNA 2Z2IA 4IXTA 2C42A 2AHRA 4N0MA 3L92A 5IYZF 3SY8A 4EPTA 4Z49A 3ZXYA 2QQ5A 2BFBB 5G4KA 1IN1A 5EXDA 3GAFA 3ZK9A 3ROXA 1ZJ4A 1H0RA 1IEXA 3HXLA 4H17A 4Q19A 1DHRA 1EX1A 1VPEA 2GTIA 2WJ4A 1AZSC 2WTNA 3GRUA 4D0RA 2QMHA 4XGIA 3TOVA 5KZMB 4JP1A 4OHMA 3S81A 1K5DA 3LPDA 3U39A 3H9CA 1V4NA 1Q44A 2A14A 2DKNA 3MBOA 1X14A 2KM1A 3M2PA 3EDOA 5CDUA 4UE3S 1ADFA 3CZRA 3DEFA 4L0CA 5HK9A 3V8RA 5SYAA 2VDWA 1UOOA 2PU7A 1HO3A 2GS9A 1D1PA 4QUIA 4UEQA 4R7GA 3WJ2A 1HEIA 1W76A 3VHXA 2JLXA 1XJWA 5BV7A 4ZJZA 5TMPA 1FVFA 3G7NA 3TNFA 1Z15A 4KZPA 1I14A 3H9JA 4K7JA 4PYQA 4W8HA 1EFUA 4KGXA 4NDNE 4EZIA 1M6WA 3QLUC 3EJ6A 3WXMA 4CN8A 4ZOLA 3ZVKA 3P9QA 4D74A 2YYSA 1E9AA 4D26A 4KLNA 2WJIA 2VYVA 1QP0A 2EGGA 1RMTA 1OZGA 3KO8A 1ADGA 1H42A 3FSJX 3C6QA 4ND5A 4GBMA 1HGXA 1U9JA 4EJFA 4Q4HA 3HXKA 5DCWA 5I9IA 3O03A 4KZKA 1NIPA 4LJKA 3HI4A 1BE1A 4JX8A 4XQ9A 3HXMA 4A36A 1FP4A 3ZIAD 2AVNA 5FWAA 3EOBI 3STVA 1KDTA 1KZYC 1HYHA 3AHIA 5AKXA 3V4FA 3AFOA 5IJZA 4ADSG 2CV1A 3BA6A 2HK7A 3AYXB 4S24A 5EP3A 4GS5A 4ODIA 2J87A 1UXKA 2H1VA 2ZRGA 4I1VA 5DEOA 4JBIA 3WRXA 3KSBC 1LBEA 2NUAA 3EIUA 3T0IA 2XVXA 3VSDA 3ESDA 2VDVE 2HO4A 1XIVA 4AZ0A 5K0JA 4DLAA 4DIFA 3QELB 3GLGA 2C00A 4CR7A 2A9RA 1V35A 1GZDA 3E9QA 1J5XA 2HD4A 1GR0A 2QMOA 3DVAB 2CNDA 4XQCA 4K3VA 1QBKC 3PDIA 3WKBA 3ICEA 4ZA2A 3FY4A 3OX1A 1DAGA 3HR4A 3OZVA 4Q4DA 3P2IA 3VKUA 3VDRA 1XDWA 3CONA 3IKJA 3O92A 4M2LA 4CDRA 2DX7A 1LI5A 3OZ7A 5LQAA 1DCMA 1TTQB 1LBTA 1Z2CA 2D2IA 1T9GS 1V41E 2KJQA 5DX0A 3KELA 1HETA 1YVEI 3PWSA 5DLQC 3V1UA 2ZRIA 4E6EA 3FYTA 1LDEA 4XDZA 2GXAA 3PNKA 4OXKA 3AR4A 3H5LA 4YJGA 3HGMA 1E2IA 3PENA 1QANA 3L49A 5B57C 3AM5A 4S1PA 5FNVF 4C0QC 2G04A 5E9QA 5B2ZA 4JQYA 4BMCA 5BNIA 4DIDA 2Y76A 5AVWA 4US1R 2Y1GA 3L79A 1DAKA 4GLOA 1W36D 1GCAA 1NR5A 4JB0A 1XTIA 3SYMA 1I8TA 4PG5A 1AUQA 1H23A 1EMDA 3DNPA 1RLJA 4JASB 4EG5A 2Q2OA 3P9ZA 1KO8A 5EIWA 2J41A 3M6LA 1QE5A 1GTSA 2O48X 4NK5A 1AQYA 3BB1A 2R8PA 3OQHA 2D59A 4IX1A 2WSYB 1XP8A 3VBCA 2QT0A 2ZG6A 4P54A 3N5KA 4C1BA 4IUCS 4Q4CA 4AJHA 1KOGA 4GBGA 1H93A 1SKYE 1JXOA 4G81A 5FHQA 2H1OA 2DUJA 3B6MA 3CEAA 4OJMX 3P4YA 2X1HA 1KYZA 3UT6A 3SM9A 2JIQA 1PR2A 1PI3A 5L53A 1A9ZA 4KDCA 5DN6D 4QXPA 2JAXA 5FUQA 4OGKA 4L73A 3FYUB 4FOLA 1P4AA 4NATA 3ZK7A 1AMNA 1BMFD 1DKNA 3CEHA 2JAWA 4OY3A 4URHA 4BKMA 2REQA 1QZUA 3DEHA 1CS0B 1DQRA 4GL4A 5KC9A 1XQXA 5DP2A 4DLTA 2SBTA 1NHWA 1B1CA 1E58A 1SD5A 2ZDGA 2QTMA 2G09A 4MW0A 3F0TA 1OX4B 4UNQA 1YACA 2C5GA 1MB2A 1VYUA 3EMVA 5BPFA 1ID8A 4R16A 1JHXA 1RWBA 2ZPTX 1QQ6A 4K9NA 4KQ1A 4QGSA 6GPBA 2SNIE 3AQIA 3OFNA 4OBXA 4P4TA 4QWMA 4BZXA 1U6KA 2VH2A 3HNOA 1VLVA 4C08A 2IP4A 4OP2A 4YS6A 3EWNA 3GT7A 4EGCB 2PUGA 1V5WA 3HBAA 3LV8A 4JJ6A 2QJTA 1AKTA 2WKRA 3SN6A 1EVQA 1Q11A 1XQ1A 3LX6A 2RG7A 4QXQA 2CXUA 3H16A 4DSZA 3KVVA 5A9RA 2CUZA 2KS6A 3WGLA 4GLFA 2QG9A 4ZCPA 2OBYA 2H5JA 2IXBA 1QIDA 2AI3A 3FHJA 3KZNA 3MJSA 4CEIA 1R8QA 5KWJA 2H2GA 3HV0A 3IAUA 4YAGA 4FGZA 4QFMA 4FNMA 5BRAA 2R6DA 3KVRA 4I4TA 1E2MA 5D3KA 5F7OA 4F91B 4X94A 4F8JA 4RA6A 3PJDA 4V1CB 4BLVA 4BGEA 4PNEA 4YRLA 2H3HA 3N3BC 3NYQA 3MWYW 3EPKA 4H1HA 5T4HA 4ARSA 1AA6A 3AUAA 1NVFA 4G41A 1JDZA 1TTPB 1Q5PA 3I64A 3H11B 1XTKA 5GY7A 2B92A 3RWOA 1SB8A 1ZD4A 3NG1A 4QQ8A 1MQSA 1VJGA 1T6YA 4LNHA 2VEDA 1CSEE 7MHTA 4OGFA 4CF6A 3K5PA 4Q9NA 3MJCA 1Q0ZA 2EAUA 3AR8A 2V9ZA 5AW0A 3MB8A 2IKQA 2C4HA 2QYTA 1NVWQ 1QVZA 2RGGA 1V6CA 4MS1A 1SKUA 1G0NA 1BMTA 1JU4A 3H7AA 4FE4A 1L5KA 1A5ZA 1IEQA 1OWMA 3F6PA 2YN2A 3H5IA 2ZSUA 3AI2A 4MUAA 3UK7A 4C0JA 4EHLA 5CURA 3DD5A 3HM2A 2QE7D 3MS2A 3OC6A 4F2HA 3GLIE 4EJSA 1CYEA 4BB9A 2PFGA 4GI2A 2GD2A 3AV0B 5EZYF 1M2OA 4CV1A 3TNDA 1QLJA 4QTUB 3K1TA 4YMIA 2PZEA 4FDLA 3SHOA 1H2AS 2DSNA 2O2GA 1AHNA 4NMHA 1UQTA 3BSWA 721PA 3QX3A 3UBMA 5HZKA 4C89A 1L5FA 1CXZA 1YU6A 3CE9A 4ZYZA 1ZM7A 2HCJB 1Z12A 1KQ3A 2FEAA 3EYAA 1WMAA 4CM6A 2BUCA 3IOCA 1R9JA 1VE3A 3OHSX 1J56A 4FGKA 1Y6JA 1Z3IX 4PLFA 2QTGA 1KO1A 1FDVA 3K0AB 4GG1A 3AV3A 3C74A 3W34A 1PZGA 4QLAA 2WJYA 1XD2A 1PJAA 2ZQZA 5IEJA 3OKCA 3IUEA 4UHHA 1KPIA 3JYLA 4JMLA 2WBLC 4LMPA 1ZZEA 3W3AD 1NKSA 2IFTA 4F6CA 1RXWA 1XMPA 1JDJA 3P32A 4JJAA 2I33A 4UBIA 2PXHA 4S04A 3FTNA 4O2BA 5E2BA 1I5OA 2YQ5A 4PTLA 3X1KA 1EUDA 4KDRA 2BTQB 3O0DA 2VNSA 4EHAA 1ZOLA 1XZQA 2ZZKA 4A26A 1U2GA 2BF7A 4GPAA 3SG0A 3SR3A 1T8UA 1V1MB 3IVGA 3QRWA 2K4MA 4IDAA 3SICE 3QKUA 4EYGA 5LZ9A 2H31A 2VXYA 4JI3B 3U1BA 2WVAA 1GAJA 2AEFA 2O2EA 2C59A 2QGFA 1DRKA 3LRPA 5EE0A 3TDMA 1A9TA 1JDBB 3CSDA 1TLFA 1E7RA 4CDNA 3ROMA 4AZWA 2ETXA 3BS4A 4FYVA 1XQWA 4MRMA 1IY2A 3G8YA 2X0EA 1DG3A 5JJ5A 5K0NA 3L93A 1GU0A 3T1YB 2Z08A 2IZZA 4ZT4A 5T7BA 1Z06A 3I6IA 2P6PA 4K6GA 4BX3A 3P9PA 3ECSA 1NBME 1LW6E 3EYWA 4D56A 4MPRA 3CZAA 2HA3A 2Z4TA 2WJPA 5BXYA 4JUIA 3NHPA 2FQXA 3SYNA 3WK7A 4QHTA 3MT8A 3T5MA 5BOVA 2BSAA 4FGWA 5I7FA 2WU1A 1JHVA 4J7CA 1XMJA 1U3DA 1XTPA 3DMGA 5JAHA 4DA4A 1CZOA 2YR0A 1U7WA 2XVYA 3IOBA 4LG1A 3TM5A 1WA5A 1DIHA 3BMNB 2PX3A 4J0KA 3L04A 4QULA 2CEAA 2PRSA 4XGQA 3QKRA 5CPFA 3UAVA 1DAFA 2WV7A 3KUKA 1E96A 2JFHA 2P41A 3AIMA 3OWHA 3U2QA 4H0NA 2VAWA 3WX0A 2BE9A 3U3ZA 2ZE5A 2H0RA 3I37X 4UFOA 3K9LA 4CMBA 4ZCTA 1HDCA 3EVGA 5EUBA 5EJ6A 1JKFA 1UXGA 4MVJF 1NBIA 4FSHA 3A4YA 4CXMA 3IRUA 1GT6A 2AGVA 5KYYB 3EFBA 3BORA 4WA7A 1XA3A 2NZ8A 4MYUA 3C1AA 3TFQA 3TW8A 4ZCIA 4RD4A 2CNLA 3FZEA 4MI6A 4DR2B 3MLAA 3AHCA 3TE7A 1EUCA 4TQ9A 3X3HA 4MV6A 1IUOA 3SI7A 3VR5H 1JDUA 2FETA 2Q6KA 4LE0A 5DO9A 1I7NA 3RR2A 4A4DA 2IXFA 4EP1A 1DV2A 4C4TA 1YJQA 2F8MA 4OBWA 3L0SA 1MHPA 4QDOA 4RK6A 5CXXA 1H2WA 2K7ZA 2JZNA 2NQ8A 3AVOA 4RFSA 4ZMBA 3EUEA 4KXYA 4RLQA 1FMFA 2G88A 1XRLA 4EMSA 2NT3A 4NNPA 5B4TA 2Z6AA 1F2UA 4G84A 1WEHA 1BNCA 4LDJA 3BXHA 3TEJA 4ER3A 4Z4IA 3R0QA 1FRZA 3VKWA 4ZT2A 3IOYA 3HN2A 2VOEA 5H3CA 5AKIA 3W04A 4OCZA 4NH0A 1VI2A 2XYRA 3NWJA 2BMAA 1VJ1A 3KWLA 4GRIA 3L6UA 5AP9A 3LUHA 4URUR 3RS0A 3LBFA 3LHDA 4LGCA 3C7DB 5GINE 1JNYA 1E9EA 1XJCA 3CU5A 4KX3A 4Y6PA 2UUCB 2R47A 1EBBA 4D9CA 1H1LA 1P2UA 5IC5A 1PYGA 4W9NC 1W0CA 1KDOA 2AJTA 1UEXC 1G9TA 2FZVA 3QF7A 1YHYA 4DLUA 4FPXA 4HAZA 5LCXA 4EHHA 5AHKA 4D9EA 4QTZA 2ZBGA 3MQ4A 3GDWA 1RC8A 4D25A 3OCWA 3MCAA 1NASA 4BNVA 1YS1X 2P4HX 1GZ7A 1BA2A 3ZOKA 2F67A 4EFLA 1XCMA 3MPOA 1T1JA 2OO7A 3WSVA 5CK5A 4RXMA 4FHZA 4W5NA 2OBBA 5GIOE 3GA0A 1OTYA 1X19A 1AE1A 4Q1CA 4TYQA 3F4KA 4FEYA 5CP8A 4C6RA 2VK2A 2ZRMA 3EZGA 3V6LA 4A0QA 3AF5A 3AR9A 2ZSJA 3MGBA 1QQAA 1T9CA 3CCFA 1XZMA 3O47A 2PUAA 5E8JA 5GM2A 1B0AA 2WTXA 3GVPA 4ZVPA 4AFNA 4EHFA 3T8YA 1FFDA 4UCXA 5A3RA 1W0JA 2XWJI 2YNMD 3AVYA 1ZCJA 5DLYA 3N7AA 4BMPB 4ZAYA 2OTCA 3IURA 5CLJA 4OYYA 3PHLA 4I5DA 4YK7A 3K70D 3WMGA 1KYTA 3HJAA 3HCRA 5JSYA 5F4BA 4UE2A 4CM4A 1F2UB 4F3NA 2BFAA 4HX9A 3W8FA 2RHWA 1DEKA 1NBWB 1F2TA 4QDTA 1UBNA 2H7VA 2DT8A 5LP6F 4JBXA 2WICA 3H5AA 3A1FA 5KOHA 1OXMA 1TZMA 1JQ3A 3RYFA 3PRYA 1RQGA 3Q3VA 2FOIA 4LZAA 2ZCJA 2R6JA 3C8DA 2HHCA 4WBXC 4YRIA 2OORC 1AMUA 1S2NA 4Z1MA 4G36A 2HN9A 4Q82A 5F7XA 4KP7A 4WN9A 2VYCA 3K5WA 5JI2E 2Z2JA 3QFCA 2R6HA 4Y6SA 4V0ME 3FXAA 2WWRA 1I5EA 3G23A 2QPTA 3A25A 1C3OB 4D2IA 1G3MA 5HF8A 3ZS8A 1IJBA 3IP1A 3L84A 3OPXA 4GZMA 5AVTA 4MRRA 3EOAI 3S55A 5KYWB 3CBGA 2CNKA 2FZWA 2GBGA 4G1FA 4HX2A 1EP2B 1LDGA 3LZ6A 4AQYB 4Y1RA 2HJRA 1UJ5A 2AF3C 4M1EA 1SXHA 3ETCA 4JI5B 2GNOA 3FNHA 3CX7A 2PZJA 4MP6A 5A6VA 3OZTA 1U9IA 2O0HA 4JLAA 3UMVA 1CY0A 2IYSA 1RXIA 3QVWA 2H1RA 4E6PA 3G0DA 1J49A 3EXFB 5C5EA 4I50A 2E6UX 3CX8A 2Y6VA 3D2AA 3GJ4A 4UVDA 2I8AA 3H9QA 1IM8A 1FFXA 1M66A 2X0RA 1CFJA 3PSHA 2OZLB 4PZZA 1X7YA 4Q5IA 3CB4A 1Z6GA 3DOHA 4JR1A 2ZYVX 1E63A 4XGNA 2K6GA 4B7XA 1PK8A 4YJHA 1Y1PA 3T5BA 3NGXA 4BXOA 5LWHA 1ESZA 2QRZA 3VOBA 4D8VA 4DDUA 2JJ2D 2RAFA 3UB4A 4CT4B 4EHDA 3JVEA 3E3NA 4M3NA 5A03A 3E9ZA 1P75A 4HNTA 1OWLA 3GLKA 3KZMA 3S2FA 4KIJA 3H1GA 5K2MA 4XX1A 5AVRA 3URMA 2XE7A 5EWJB 1ORWA 4J4TA 4Z9BA 3AC0A 3T7DA 2R00C 2QXUA 3BEDA 4KPYA 4CQLB 2NLOA 3VH3A 4WRRA 4KYUA 3VI4B 5HW0A 1KJIA 4KAJA 4LJ7A 1GTRA 4ARVA 1WKCA 5BW8A 3IBCA 5IKEA 4GE0A 3SVTA 1Z6TA 1FYDA 3A4IA 5AHRA 2OGTA 2Z5GA 1DIAA 1LH0A 2JFGA 4R0NA 2LPMA 2O7SA 3RANA 5BOSB 3DDNA 7GPBA 3UWDA 4OU5A 1K2VN 4W5QA 3L6BA 4M36A 3KQKA 3UJNA 1E3DA 2A0FA 1TVKB 2VT3A 2CFCA 2EOAA 3Q1KA 1EJ0A 4G0UA 3TJRA 3WAJA 3JYOA 1M5TA 3LK6A 4Z9XA 3VVLA 4AK9A 4J2TA 1V11B 2ATCA 1PGOA 3WQHA 2QAGA 3DAPA 5AESA 4FCTA 2J9ZB 2Q8NA 1NBOA 1SBCA 1W47A 3PXDA 5CM9C 1Y4AE 3K1AB 4CM1A 5A04A 1P7ZA 1MH1A 1QDEA 2WF8A 2XHEA 3ICPA 2JAQA 1H5QA 4ER7A 4EB0A 1SRQA 2Q62A 5ALEA 4I1IA 2XRYA 1JTVA 2WYHA 4Q7KA 4DDKA 4H77A 1YAJA 1IZ7A 2IP2A 3BIOA 1OFHA 1SUIA 1XMSA 3N58A 2QY9A 4C03A 4BV3A 3LCJA 1V9CA 1ECLA 3ZWPA 5AM3A 2TYSB 3SYLA 1EQ2A 4MEAA 1T1EA 1MENA 2BVNA 5K6AA 2A5LA 2BFEB 3VOSA 5M04A 3U7EB 4YUZA 4A8TA 3OJXA 4DKXA 1SKMA 4JZYA 1H4TA 1USIA 1DQSA 1DXHA 2DP4E 3R3ZA 3FMIA 1M1UA 1SCIA 3PFNA 3K2BA 3TLCA 4XVRA 1JYEA 2P0AA 1T6NA 2OORA 3RV4A 3I5XA 1SG9A 5E6UA 4ILKA 1IVNA 1MFZA 1G1AA 2QVCA 3I12A 3P19A 1DEHA 1L4KA 3DFUA 1XXLA 4AJPA 4H7KA 1Z22A 4HAOA 3OQBA 5LQSA 3U62A 1BWQA 4XJSA 3HCOA 2YV2A 5E6RA 3PXBA 4ZI7A 4BDSA 2WWTA 2PRYA 4BKOA 5B2EA 2HQRA 5EUMA 2OILA 3ZWVA 1N75A 1P80A 1RRGA 3AU8A 3NBQA 2AT1A 2JHCA 4RE6A 4NEGA 4DVJA 2PH5A 4URXR 1HT1E 2XE4A 1J5PA 3DHEA 2D7JA 4IVQA 2UDPA 5JS8A 1U0BB 3CV3A 2OEPA 1UJ2A 4UM9B 3D02A 3EBPA 1OIXA 1X7XB 2YX1A 2R48A 3M83A 2NTNA 5CMLA 1VRVA 5BRNA 3OZCA 1ADBA 1LGYA 1ONSA 4OQLA 4BJ1A 4W82A 2QTHA 1D2CA 1PR6A 3H2BA 3UO8B 2ZTMA 4JB2A 4OQYA 1RI1A 4PZCA 3ZKWA 4C4SA 2NYRA 1EM8B 5DBIA 3EEIA 1E0SA 2J6IA 5C80A 4GGOA 4AYTA 2DY1A 2HIGA 4AZSA 1ZSVA 1PT6A 1PP4A 2B0JA 3BMOA 3ND8A 4HRVA 4NLLA 2C7QA 3Q85A 4N76A 2JK1A 3HGTA 3M3HA 1J00A 4LRUA 1LZKA 3OOSA 5GV8A 1Z5NA 4TTVA 1GP2A 4ZVLA 1D4AA 1GSAA 1JXMA 1S5PA 4OLHA 3SQOA 3RH0A 2PS0A 2Q99A 2ALJA 3LDHA 3DM9B 3N2YA 1HX7A 2A0XA 1NV9A 1MXFA 1CY8A 4HDRA 3V1LA 5JI3E 3O26A 1MB3A 2EQBA 1ACLA 1Q1EA 5IK2A 4X85A 4Q47A 3K72B 1RAIA 2C4MA 2P65A 3T3MB 4DNQA 1K8ZB 2IDJA 4QUHA 1SOVA 2ZVJA 3L40A 2BFCB 4Y30A 1I4WA 1T9DA 3LTNC 2QTNA 2IYRA 2XECA 4C3OB 1E94E 1PSWA 2VAVA 1KY4A 3HJFA 5KSOA 1L5YA 3PUIA 4KG7A 4KK3A 4EFNA 4EGQA 1I2DA 4HUJA 4ARUA 2FW1A 4CG2A 2WP8J 4D9GA 3BE6A 4PLHA 1VE9A 4QD3A 1GYRA 4LZOA 2JLZA 1LPSA 1L4FA 5EAIA 1P44A 2WILA 3RUAA 5ES4B 1QF6A 1VG0B 1N4DA 1UOEA 4TL7A 3F6SA 2PGJA 1FUUA 3KSZO 4AD8A 3GJZA 1VLJA 1T0PA 3QTTA 3B1KA 3AP2A 1FU4A 4IUYA 3T94A 2WM9B 1WMBA 1XPOA 4DRZA 4WESA 2ET6A 3ESXA 5G0TA 3UUFA 1GAQA 1KI2A 3KVYA 4Q1EA 4ZJYA 2AN9A 5HKOA 1U28A 5KSPA 2ZE8A 4TMZA 1UJBA 4J0IA 1QYRA 1YA4A 5ECYA 5FWDA 3MLBA 1RRKA 2C2HA 5CT9A 2QXYA 1QIMA 4E14A 5PNTA 5EXXA 2ZWAA 2J30A 2ORWA 3A9TA 3FPHA 1E2QA 2ZKLA 4RVDA 2AXQA 1M72A 1SG0A 3R3WA 3ODGA 2FJPA 1BKYA 3Q6IA 1E3TA 5HMMA 1VL5A 1PL8A 4JLUA 4AROA 1AN0A 5K3CA 3L1JA 4UPEA 1XRSB 5KWSA 1SBIA 1JDPA 3HABA 3K05A 3MJHA 4K1LA 2FRVA 4Q4AA 4X71A 4AU1A 1ZXBA 4JP5A 4EKEA 2CV2A 4NMLA 3T3PB 1ZBQA 5FL3A 1M2VB 4B2IA 4OX9B 3FUCA 4ETMA 1M34B 4S35A 4EARA 4K2AA 1EG7A 2G4CA 3DGFC 5FUXA 3EPPA 4I0WB 4QODA 4TMXA 3SYTA 3MMSA 3FCYA 4R98A 4W7SA 3VU1A 3T54A 8ATCA 4LI3X 3NLLA 2PGNA 4B0PA 2ZR9A 1CUFA 2WF7A 4Z4EA 3EFOB 1NLUA 2PUTA 5HRAA 1H4SA 5LWQA 5EIHA 1X9GA 3JD2A 1MC5A 3ZHYA 1G6OA 2P2CA 2ZVPX 1B0UA 4NBUA 1VL1A 3JR7A 3HUFA 4J0HA 5EXTA 2QRNA 1CUWA 2WSIA 2FZCA 3I9KA 1U0EA 1NVVQ 2BFCA 1ZITA 3FDIA 5EHIA 3U81A 3BHNA 1MKYA 3H13A 1KDYA 3ILXA 4K03A 4UXIA 1DDIA 5JRZA 4Y1GA 2YIVX 1WDKA 4Z8YA 4I55F 1X8XA 2OYCA 4M0KA 4E5VA 1N1GA 1IN5A 1JFRA 1R8YA 2X3UA 1G3QA 3W4KA 4MW9A 4BMVA 2YINC 1G4HA 4NARA 4IJWA 1RM0A 1PJ4A 2DPLA 4Q3BA 1K5HA 4RV5A 4YRGA 4LCBA 1DU4A 1A77A 3GROA 5DYIA 1M73E 1WXDA 2IC5A 3AY0A 4W63A 4UC0A 3I04A 2OECA 4PG8A 1K88A 3HJTA 3OEEA 3KQWA 3WLNA 1ISGA 4K9PA 3MAAC 3VNAA 2OXEA 2WFLA 3AFMA 3FUWA 1QTQA 2BI7A 3K8ZA 2Q9CA 2IVFA 1V48A 1UJ6A 3WL6A 1TZBA 1WY5A 1Y9DA 1CP2A 2DPXA 1WP4A 2I7XA 1CY7A 2ZANA 1VJ5A 3BQ9A 3DOFA 3IMFA 3LUDA 4LHYA 4LRWA 4QTYA 3GPDG 4O2AB 3AL0C 5CU7A 1AXEA 3CUWA 4RJIA 1D6SA 1UKYA 2QG6A 3NT4A 1KFJB 3RGGA 3DT9A 3W05A 4JVLA 4G0PA 4DGQA 2ZYWX 4NESA 5CEEA 3QHPA 3GLIA 4WZ6A 5B5SA 3BQMB 3KZKA 1YBFA 3NTVA 3LI2A 5DBGA 2WD7B 4FN5A 4R71A 2W6JA 3WL5A 1KI6B 2ZT7A 1AS3A 4N03A 4UPVA 5HBGA 5JPIA 3ZLVA 4RORA 3L82B 3IEVA 3C6BA 3DQZA 4OHOA 1AKEA 2V6IA 2QN9A 3U9TA 5K01A 4HLNA 4TWRA 4PXAA 5DCLA 3TWOA 1H66A 1SU8A 1H1DA 3OPVA 1PNRA 3DZFA 2PMDA 3B48A 3TVTA 1KFCB 5B6JA 4DWVA 3F6CA 3KOWA 2IS2A 4TV8B 3W6PA 2PMCA 3QTLA 1OFIA 2X8LA 3K92A 4EKGA 4U5XA 1SXGA 4RF4A 2ERYA 1E4YA 1KEZA 2B34A 4GBED 2GETA 2I9PA 2EZUA 2QVYX 3BRWD 2HLDA 4NPAA 1F9AA 3VR6A 4CTMA 3CBQA 1ZEMA 1E92A 1VKJA 1EXNA 1WQ4A 1CULC 1KVRA 1MW9X 2LP4Y 2VPIA 2FE4A 3K8YA 4JUAA 4CIAA 5LC1A 3RTDA 1U63A 2BEWA 3UV6A 1JQKA 4CCYB 1Z2OX 1O5TA 2KI5A 1BWSA 2P2LA 1JVSA 3ZHTA 3E81A 1YVPA 3HR7A 4FX5A 4IDFA 1DCTA 3KU4A 4TKUB 2NVBA 1NTRA 5EOVA 1PJCA 2QUIA 4EYKA 1KKUA 4YCSA 2BP7B 3A2NA 4IDCA 1E4EA 3S5UA 1Z5WA 1PX0A 1RJGA 3TPFA 5AVUA 1H94A 4UREA 5BUZA 1QBGA 2WV9A 1HE5A 4L8FA 1UAYA 2L19A 2R9VA 1XLTC 2H29A 3CLSC 2J3DA 1EGAA 1WV1A 2HU5A 2V55B 3PYMA 2RHJA 3OLWA 4P1ZA 4E30A 1EUQA 4X44A 3WHKA 3RQIA 5C7OO 3LWBA 2MSEB 3QFTA 4O4HA 3TPZA 2G1UA 1QDUA 3ANTA 3F8SA 3I09A 4A8JA 2VH5R 1S4MA 4Z53A 4A8JB 1JAXA 4X8OA 3V8MA 1XTVA 4DSOA 1MORA 5ENVA 4J7UA 4YR7A 5JH7F 4OTZA 1E7QA 4P4NA 1RCUA 1WO8A 3ELYA 1U4NA 2Q0XA 4F4FA 3HVUA 3LHKA 4JWTA 5CA1B 4LE2A 3S0JA 2P3QA 3E3MA 3ECCA 4E12A 1AQLA 2D4HA 3FA2A 4BV8A 1UXIA 3BZWA 4QT4A 2BISA 3GB9A 2C58A 3QJGA 1JHZA 4CUKA 5EHQA 1TM1E 3KPJA 2EU8A 2AD1A 5P21A 4F3YA 2A67A 1G2IA 4H59A 2Q1UA 2XJ4A 3H5WA 2ONJA 5FBKA 1WUHS 4W7IA 4LXIA 2WIGA 5DRYA 1P2FA 1B2RA 1G8FA 3TTWA 4JD5A 2YN0A 5K8CA 3D8TA 1JFSA 4I9FA 3G85A 1X1BA 2IY9A 3RRYA 4K28A 2X41A 4C06A 4KPEC 3R5KA 3ESYA 5IZCA 2CJXA 3ZJ4A 4J3JA 2YFKA 3OCJA 4FZJA 3ZY5A 2VF8A 1H2XA 2H1HA 5K0CA 3EQ8A 2HCRA 3CS3A 4LJ4A 5AI8A 4G0YA 4B48A 2PE5A 4OB7A 3KJGA 3W5DA 2QLBA 4RZSA 3WFJA 3B6KA 5DBEX 3HM9A 1WBDA 2PEYA 3SBOA 2QA5A 4CM8B 2D4AA 3SMQA 1REQB 4Z86A 4YP6A 3D7LA 1I6MA 3TQQA 1QUEA 3D1VA 3IQHX 5AKZA 3VDXA 4BZQA 1AF7A 4ZYTA 2ZU0C 2HM7A 1Z7EA 1A69A 2Q3CA 4QGHA 2Q7DA 3NS7A 4F60A 2N47A 2ZJ8A 4PNPA 5E1MA 3GVXA 3KQNA 1RCFA 2EFEB 1Y3FE 4IMJB 2M6LA 2DWUA 1FS4A 3GJ8A 3TD9A 2AOXA 1AO0A 2UUBB 5CLLA 1SHKA 4EHBA 2F1IA 4UBMA 3CUKA 3UNXA 2ESRA 4JLJA 1KAGA 3C6MA 3TIFA 4A5SA 2WRZA 1C9YA 4LOIA 4EPXA 3EVDA 1TW3A 2AOWA 3QFSA 2Q49A 1LU9A 3KLBA 3PHBE 3Q5DA 1WL8A 1W30A 2QJFA 2B1RA 2Q3MA 3QBVA 4BLUA 2FQYA 3JU3A 4NY1A 1RJDA 4EB8A 1L4HA 1YCGA 5C1PA 3KT3A 4A03A 3IT0A 5C8ZA 1Y6FA 4KXMA 2HSWA 5ESDA 4M7RA 4QOFA 2ODPA 2F3RA 2CDBA 2QP9X 2XVZA 5EJ9A 1YI0A 3DDWA 5KTKA 2BL4A 4UTXA 4KRFA 2XIJA 4JVNA 1T2DA 1EVEA 4O4IB 2VKQA 3HA3A 3IHWA 3R3HA 2GEJA 4WADA 1KXJA 4A27A 3VFDA 2FR0A 1MC1A 2W7TA 5BV0A 2P5YA 2IF0A 4XRRA 2APJA 5IK2D 1IY0A 4S1TA 1FDUA 1YDHA 3TZ6A 2HT1A 4IKEA 3N0RA 2F1RA 4EW2A 5IM4F 3R9XB 3TNLA 3CC8A 2YRWA 4UXHA 1QLWA 2W93A 4FUQA 3BRWA 1M1NB 3FLAA 1WOMA 1P91A 1X92A 2IHZA 3JWGA 4Q3OA 5ALJA 4TX1A 3SF8A 1OGIA 4AJ9A 3GRYA 3RC2A 4NCAA 4IEEA 2GKGA 3W77A 4ZVMA 4Z54A 1WMEA 2P8JA 3W5BA 4GZLA 1AIPA 1SVIA 1KBZA 4YCAA 1GN8A 1PHPA 5DNUA 2CXNA 1TTTA 2HSEA 3AB7A 2ZWPA 2PO7A 3GMIA 1N1MA 3IVXA 4QU9A 1S3GA 5IT4A 3ISTA 3KHKA 4N5DA 1QCYA 2ORED 2Q6IA 5ICFA 1H05A 4IO0A 5JJIA 3ONEA 1FP1D 2QN1A 3D8SA 2FH5B 2EKLA 2DFNA 5JLAA 4YMWA 2DSTA 3P9XA 3HXPA 3K73O 3MUNA 4BE9A 3H87A 3P0JA 1OI2A 2Q7OE 2M9MA 2YVQA 5TPZD 3RASA 5CCXA 3DBHB 1NUSA 2B30A 3B9PA 2D3TA 2H06A 2Q4TA 1FFHA 2PL5A 2B4RO 3JD0A 4FKMA 5G1OA 2QJRA 3REOA 1ZA1A 4RF3A 4F2WA 1JR4A 1DFGA 3QI7A 4WKPA 2RGEA 5L3ZA 2ZULA 4C14A 5HKBA 1CJTC 1PW5A 1XV5A 1SCQA 1BCSB 3FFTA 1EI9A 1WDMA 1YR2A 2B21A 3KYCA 3IPLA 3LUCA 4IFTA 1V1JA 2M6SA 2TRSB 3DMRA 4PYOA 4ZT3A 3SQDA 3SX4A 4BUCA 2LXNA 3KJIA 4M4SA 2P4QA 1VMIA 3S8YA 1L8QA 2IYVA 4HAUA 3THWB 3KXPA 1KJWA 4F38A 5K0GA 4PLYA 1UIMA 1Z2NX 3FCAA 4OGWA 3RFTA 4GDFA 3LT4A 1Y1LA 2WU0A 2FUEA 4A6PA 1ZN8A 2ANBA 4K5QA 4IIHA 2C83A 1XYVA 3B20A 3IJEB 2DCMA 4C0LA 2NV0A 3VR4A 1R0ZA 3M70A 1QX3A 2C82A 5B1YA 1IXRC 3CNEA 1C3VA 1J0XO 1H8HA 3RKUA 1PNVA 4GX5A 3UTCA 1ZM2A 4N0QA 5LXTB 4RKRA 2QR2A 4GT1A 4JJ7A 2MINB 3L7CA 4NYIQ 5KVVA 4XVCA 4ZARA 4EYOA 4X3OA 3RS3A 5KSZA 2YY7A 3RG8A 2JGKA 3BSYA 1Z5PA 3VPBA 4Y2QA 4ZDJA 2DR2A 3VYTB 2IUSA 1HBJA 4LC9A 1YBMA 1EVIA 3JY6A 1BFDA 1M83A 2BHNA 4G5YA 5BN3B 3FVRA 2J07A 2OVBA 5LZ4A 1IJFA 1W5SA 5FA6A 1P7WA 1T29A 1XDUA 1ZINA 3ZX5A 3N2KB 1CUSA 1AF4A 2V4MA 3KPWA 3VYRB 3UMCA 5A5EA 3RBZA 3E2IA 3M4ZA 4FHDA 4PE5B 4FYXA 2CEKA 4MZXA 1HR0B 1ZX1A 2PFKA 2N9UA 4X9XA 4L02A 4F6RA 4BXOB 2OSBA 4FP9A 3TR6A 4YV0A 2WIBA 2YXEA 3IODA 5U4QA 4CFYA 1TFRA 3TK1A 1XD2B 3MT7A 5LDGA 2A0YA 2CZGA 3PPXA 2WYVA 3T4UA 1XROA 1IM5A 5HM6A 1II0A 5EPUA 3TQCA 1POWA 2CV0A 3BSFA 3UAWA 1JAYA 4BVLA 4BVBA 1X2BA 2QZ9A 5HR5A 5IG2A 2YH2A 2MHCA 1G5TA 3HDVA 3QI2A 3QYAA 4YJ2F 1JU9A 4G25A 1HYBA 1B14A 1U0NA 1E3MA 3U4AA 5E95A 4Z3OA 1CR4A 1ODLA 3QOFA 1WVMA 2CFIA 4R1UA 5AOCA 1FTQA 3UATA 3R7LA 4GYJA 5FJIA 3WQSB 1T8PA 4V3CA 2O05A 3B1XA 3BCHA 5KVCA 1H6BA 2GHRA 3OIVA 3R9KA 3Q9SA 3ZOZA 3OOHA 3V4OA 4IS2A 5B1IA 4H1VA 1T26A 4P84A 3CZQA 4XFDA 1FBTA 5JD3A 5MDHA 3U60B 1L9KA 1U0FA 1NWHA 4KMSA 2PH1A 4ZEVA 1GG5A 3NOXA 4LJRA 2C2BA 4WDQA 2AW3A 3UGTA 2IVZA 3KZXA 2HTFA 1OAKA 2MMGA 4LJSA 4Z0NA 4Q9KA 1AT1A 1JI0A 2FWAA 4HVCA 1DC5A 3HP1A 4JYZA 1Y1SA 4PYKA 1IDOA 2G7ZA 3ICWA 4Q6WA 5JE8A 3GQBA 2WUDA 4UMFA 3K9FC 1UKVY 3A1SA 5NLLA 1DB3A 1JAIA 1L5WA 1GTVA 2PUHA 4PYLA 3DHWC 4IFEA 5WRFA 2XNDD 1KYIA 4QEKA 3TKYA 3F1LA 5C7YA 1HEYA 5FBRB 4JC8A 1SBZA 2P9BA 1SUCA 4RNDB 3AUYA 2FSUA 1CCWA 4DC9A 1UZMA 4DIKA 5TB5A 4MKRA 4Q39A 1I0LA 4Z9YA 3I45A 1IAQA 4I3GA 5JEDA 1JDSA 3B6JA 3DKIA 3TRFA 2KWIA 3R5XA 4A9AA 1WSWA 3MRSA 2F43A 5FFNA 1AM4D 1MVNA 2D2VA 3PTLA 4MV1A 3G13A 3ZZMA 5CDGA 1ND5A 3UHPA 3ZU4A 3EA5A 5KCMA 1WXGA 2Q9BA 1DX6A 2GK6A 2PYZA 1PDWA 3EGCA 4X62B 5K51A 4HX5A 3P9CA 5HYVA 1E7MA 3HRKA 5KAMA 5TQJA 3U4QB 5A3SA 3LCMA 2NSHA 3KK0A 4HNAB 2IYOA 4KN8A 4QM6A 4PPYA 1T6XA 3NIBA 4FMDF 4HAYA 5CNIA 2GBCA 4B87A 1W36B 2COUA 2GZAA 1J24A 1VP9A 2QLLA 4L76A 1IXSB 1C4OA 3LTEA 3ZBPA 3TCKA 4DLXA 4PSAA 3TLKA 1JKMA 1ULBA 1ZPDA 2IHVA 3JALA 1H1TA 2FWRA 2Z8XA 4LC0A 5LU9A 1P6QA 3G7SA 1WSAA 3BFJA 1KZ9A 1W5BA 1FTNA 1EINA 1TK2A 2CVHA 2FPUA 2HGZA 3H42B 4I4IA 4L5AA 2NVUB 4X6YA 3HKEB 2FMTA 2HHAA 2ZUBA 4R4JA 4ZU6X 4ALMA 4IZHA 5FPQA 4S1WA 3ESQA 4FNOA 5YASA 1G18A 2BPOA 2P9HA 2PPLA 2PVCA 3A10A 4IPTA 5BN1A 1A98A 2GILA 4KXQA 1AB5A 4P4SB 4PSUA 4UVHA 2GFQA 3ZU6A 2RGRA 2IXTA 2V97A 3A8TA 1TT5A 3ZHUA 1MHTA 2KLBA 5TGDA 1R9NA 3L6OO 1ILWA 1Y81A 3OQJA 1GZ6A 1TIPA 2H54A 1SKQA 4G4JA 5E1BA 3WHPA 3CTMA 4EG7A 2AWNA 2G1JA 2R68A 3CF0A 4EF6A 4X61A 3QM1A 3W5VA 3OZSA 4BTVA 3ML1A 3ANSA 3TUIC 1NW9B 1U8XX 2X8JA 1OXTA 5A2QA 2XCTB 2XUGA 3JS5A 4DW8A 1F5NA 2IW3A 1E2JA 2C7GA 1US8A 3NFRA 4RVUA 1WV0A 4WLUA 2Q2WA 3CZCA 2VUHB 3LYUA 4EUHA 5JISA 2Q50A 2VAMA 3P9IA 2XBMA 1Y33E 2IT1A 2QAIA 4Q3EA 5PGMA 3VNQA 1L4BA 3ZY3A 3RG2A 1K7EB 1K8XB 1P0IA 1J2YA 3CJQA 5AI6A 3DNMA 3BIXA 5AW5A 3RC8A 2O20A 3ZDDA 3TQOA 1ESCA 3P94A 3BT7A 5K2OA 2ADFA 4EQZA 2QMQA 4HATA 1V7CA 1HQDA 3A6LA 3IIMA 2AK3A 3PPIA 3NDBB 3FB1A 2L69A 4CCAA 1MT3A 3UFXB 4ZOQI 1FQJA 5FO0A 4YWHA 2BI4A 1N6LA 3O5AA 1VA4A 5GONA 1PUXA 3K6JA 2FB9A 5FX2A 1IHDA 1RNLA 2H17A 4D4JA 1LKZA 1N0IA 4IGEA 4I99A 1T5HX 2XB6A 4RZ2A 5EZSA 2P2GA 1AGXA 4JVOA 4QASA 2G9NA 1SULA 1ZRSA 3E9CA 2HB6A 3H1BA 4QT0A 2F8LA 2I4RA 4RE5A 2XQJA 4N41A 5F1KA 3GVCA 4CF7A 1CNFA 1E3LA 2PZGA 3DBRB 3GBSA 3L6RA 4KO3S 4YP7A 1ZD1A 4TQGA 2HJSA 4QOEA 4TZ6A 5DOZA 3HDJA 1I0IA 3QUTA 4JLOA 1CE8B 2B6NA 3RSHA 2AR0A 3IJ5A 3P20A 1NJ8A 1SKYB 4WV3A 4MQEA 5ETJA 3V2IA 1F6DA 2E1PA 2UU9B 3ZDYB 4CIDA 1RQPA 1JNXX 3PYLA 1V8BA 1YUMA 2AOVA 3CLTC 3SD7A 2C2WA 3MN1A 2XDQB 2KHZA 1E9SA 4GLJA 4Y6QA 4ZQGA 1E2GA 2PA3A 1M2VA 4QO8A 1XK7A 4UAUA 3DVAA 1I94B 2C4KA 2MR5A 2OAP1 2GF9A 3I04M 3JWPA 4QUAA 2VF5X 2VHJA 4L8LA 4QNRA 3VAZA 2J9RA 2RGBA 3UJAA 4PLCA 2R8OA 3SLKA 3BDIA 4O8ZA 4D8XA 4UAVA 4HYEA 2HL6A 3SCZA 2X7XA 2VPPA 3N75A 4Z7QB 6ADHA 1Y5RA 3OA0A 3KXIA 3L4JA 2FWBA 1UANA 2QD1A 4LRTB 3WFIA 4CI0B 5MFZA 3O4VA 3ZJTA 2YQ4A 5F7ZA 5KMGA 3ZD8A 2W2OA 5B1HA 1F0YA 2BBTA 4MVJD 1GGJA 3PFIA 2G9UA 1CG6A 4YT4A 4JXXA 4B3IA 1DAHA 3BRQA 1H8ED 3E6AA 2X77A 3L5KA 4J1QA 3GGCA 5C7LO 1CQPA 3W4JA 4CI9A 5CDTA 2GZSA 1V3VA 2NG1A 4GVLA 4KXNA 4DQVA 3N0WA 5CGQB 2PSFA 4QOSA 5JWRA 4MAAA 3TI7A 4BFTA 4CG3A 4HUQB 3EULA 1HT2E