4DIUA

Crystal structure of engineered protein. northeast structural genomics consortium target or94
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
245
structure length
245
Chain Sequence
IVPPKPFFFEAGERAVLLLHGFTGNSADVRMLGRFLESKGYTCHAPIYSGHGVPPEALTRFGPEAWWQDVMNGYEFLKNKGYEKIAVAGLSLGGVFSLKLGYTVPIEGIVTMCAPMYIKSEETMYEGVLEYAREYKKREGKSEEQIEQEMEKFKQTPMLTLKALQELIADVRDHLDLIYAPTFVVQARHDEMINPDSANIIYNEIESPVKQIKWYEQSGHVITLDQEKDQLHEDIYAFLESLDWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Engineered Protein PF00326
publication title Crystal Structure of Engineered Protein. Northeast Structural Genomics Consortium Target OR94
rcsb
source organism Synthetic construct
molecule tags Structural genomics, unknown function
total genus 94
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2012-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4diuA00
3R3WA 5K3EA 4PNZA 4UBKA 1VZ2A 3WZMA 1LGYA 5EHNA 4FLEA 1BS9A 4Q05A 2VEOA 4KEAA 3MVEA 2AJCA 4BATA 1P0QA 4U2CA 4WFKA 4X90A 1ZD5A 1LPBB 3BF8A 5AKKA 1N5RA 4H77A 2BJHA 5HKAA 4FLFA 4DMHA 1DWOA 1CRLA 1L7QA 1MO2A 1MU0A 3D2AA 1K6EA 4MQMA 3FYUC 3A2MA 2J3DA 4OYLA 1T2NA 4FNGA 1QO9A 1EDEA 1MAHA 5JARA 4FOLA 1DWPA 5ALSA 3I2IA 1E66A 2HADA 3DDUA 4ZV9A 3N2ZB 4P93A 3VVLA 6YASA 2QOEA 1CUFA 4HXEB 4UHFA 1WB4A 4L72A 2OLEA 1JT2A 4GEGA 2WUDA 4BP8A 2WUEA 2XE4A 3PFBA 3I1YA 5EIAA 1CUCA 4J0JA 4CG2A 1CVLA 3NUZA 1HPLA 3I2HA 1QJ4A 3DL4A 1CUUA 5AM0A 3A2NA 1FFBA 4BZZA 1IZ8A 4L3WA 2FJ0A 4AMYA 5AKGA 2GBIA 4Y2QA 2OG1A 3HEAA 2HA0A 5AICA 4UHCA 1UK8A 3R3ZA 5ALPA 5KBYA 4KE6A 2XUGA 4KAAA 4GECA 3G7NA 3E0XA 1E5TA 1EHYA 3WJ2A 5AP9A 3O0DA 3QMWA 4CG1A 1N5MA 3AINA 4B9AA 3F8SA 4J7AA 5A7GA 1VE6A 4GLBA 5AK4A 4UBOA 1LPOA 1ZOIA 3C8DA 3STVA 2WM2A 4RGYA 1CPYA 1SOMA 5FV4A 5AHXA 4DSAA 4F0JA 2VJBA 2HM7A 4E11A 1SC9A 1GPKA 3AZQA 4OCZA 3VKFA 5I7UA 3DL7A 4AMZA 2QVBA 5CT8A 2OQVA 3H1BA 4H7HA 2DCMA 3D7RA 4F21A 1R9MA 3IUJA 3L1IA 4GWLA 1VE7A 1WB5A 2GBCA 3FAKA 2HFJA 4C4ZA 2QZPA 1EVQA 3BIWA 1OILA 5EGNA 3IURA 1FFEA 3IVMA 3VXKA 3BWXA 5ISMA 3I6YA 4EHBA 3D0KA 2BUBA 3FWHA 5CMLA 3HJUA 4EUSA 2QKYA 1TK3A 1BRTA 5LIPA 5DLPA 3VJMA 4ZI5A 4F60A 1AQLA 5ALIA 5JYCA 5LKAA 4J0HA 2OQIA 1XRLA 1CUGA 1XZAA 5FUMA 2NW6A 5AI0A 3CXUA 4YX9A 4IHAA 4GI1A 3ILSA 3PUHA 4CIAA 1FFDA 3PFCA 2DQZA 1VXRA 5IVKA 4IO0A 3WL7A 1QO7A 3F67A 4ZV7A 1M33A 4W1RA 1KEZA 1TAHA 2QTBA 2HA5A 2G5PA 1DX4A 3H2KA 2JGKA 5K3FB 3FVRA 4DNPA 4Y2PA 4X6YA 3IBTA 4A23A 1EVEA 4C87A 2I78A 4Y2TA 3OM8A 2O2IA 4KAFA 1GQRA 4Y2UA 2G63A 2B61A 1VKHA 3RLIA 3VJKA 1UT6A 2WHPA 3LIPA 2PU5A 3LLCA 3DNMA 5K5EA 1L7AA 5JZSA 5JATA 2DSNA 3GZJA 3NGMA 5JAOA 5E4TA 3STXA 1VLQA 4BC0A 1BE0A 4KE9A 3ESAA 4B82A 2D5LA 2H9YA 2ZVDA 2XMRA 5ALQA 5EHXA 3L1HA 3BXPA 3AFIA 5KWIA 5F4ZA 3H1AA 3KOOA 5JZ9A 1CUEA 1AC5A 4X97A 5ALGA 2RAUA 4QDXA 4H35A 2HRQA 4X93A 1R1DA 1LPSA 1GPNA 3H2HA 2BUCA 4E46A 1QZ3A 4XJVA 1AX9A 5AM2A 4C01A 4XIIA 4L0CA 2XUOA 3DCNA 3VJLA 1T4MA 1J2EA 1HQDA 3F98A 3I6MA 3U0VA 2PKYX 3I6ZA 1W4LA 3QPAA 4JYPA 5HF5A 2W6CX 3WK8A 3B3QA 2OCKA 1DU4A 1WB6A 2PSJA 4AO8A 2C5FA 1EDDA 3G0DA 3GUUA 4PO3X 1Q84A 4ZWNA 4EA6A 2PVSA 4Y2JA 3D59A 1XZEA 3D5EA 2XUFA 1TIBA 4OB8A 2X76A 5AI8A 1YAHA 1R88A 4OD0A 3LS2A 1XLUA 3GBSA 4AQDA 3D4LA 3ESBA 5A62A 2Z8ZA 4AZ0A 5E2IA 2CUTA 2VJDA 5KREA 2P8SA 4BBZA 1HLGA 4LIPD 5E4JA 4EY8A 3QVMA 4CCYA 2C5GA 2WTNA 5AKXA 5AM3A 3ZPXA 4EY7A 4UFPA 1ZD3A 2JGMA 3EF3A 2XUHA 2I3ZA 3NWOA 2DR0A 2CMFA 4CI9A 3C6ZA 5AK3A 3JW8A 4FMPA 4GHWA 5AIAA 1XZDA 1GZ7A 4DSZA 2B20A 5HQ3A 1A88A 3QM1A 1EB8A 1QGED 1QIJA 1VXOA 3MGAA 4W1SA 3OURA 5ALWA 5BOVA 3FLBA 3ZWQA 1Y7IA 3WK6A 3IUMA 3PE6A 1HKHA 3F96A 4U2EA 4CFSA 1DINA 1QLWA 2QT9A 2PSFA 4KRYA 1YB6A 1IZ7A 1H2YA 3S8YA 1JU3A 1H2XA 3BJMA 1XRRA 1Y7HA 5LYYA 5JASA 3OPMA 3GFFA 1QIDA 3IDAA 5HK9A 1F6WA 3U1TA 4RE5A 4J0IA 5HK8A 2XMGA 5CXUA 2WKWA 3C45A 4GXNA 2HA7A 5HFNA 1PJAA 4HRYA 3YASA 2VSQA 3R40A 5EHZA 2PUHA 1DTEA 2BFNA 2BUAA 4FWBA 1UOQA 1YA8A 4B7ZA 5ALZA 4PQEA 4B9EA 1CQZA 5JAUA 1CUBA 4E15A 4WFJA 2BKLA 1YS1X 3G9XA 5T4BA 1XLWA 3AZPA 1A8QA 3FYUA 5LZ4A 3C6YA 3H17A 1QTIA 3V1LA 7YASA 2PM8A 4C4YA 4NZZA 1ZI8A 4K2AA 4BE9A 1GGVA 4F5ZA 1QFMA 1FJ2A 2PUJA 2XUQA 1N8SA 3FSGA 5JALA 1R50A 5ALYA 5AM4A 1UZAA 1MJ5A 1UKAA 1CUXA 3T4UA 3WYNA 3ESCA 3M82A 1XLVA 5KWJA 2GZRA 3L1JA 2JF0A 1TCAA 1KU6A 3I2KA 1CUAA 4ETWA 1DX6A 3O9VA 5AH0A 5DYTA 4BDSA 2PSDA 4G8CA 1QIMA 4W1PA 5LZ8A 1MN6A 3VDXA 1XRNA 4HVTA 4O08A 5FOQA 4NS4A 1XZKA 1WHSA 3FBWA 4Y2XA 4C6HA 3H2IA 1EI9A 2WHQA 4H7JA 5D3ZA 3AJAA 3C87A 3TGLA 5LP1A 1F0PA 3X3HA 1TRHA 2J4FA 3EQ8A 3RK4A 2O7VA 3E3AA 4DMKA 1SFRA 5K3BA 1E8MA 4UBMA 1MPXA 4LHEA 4QDZA 4UBNA 2XMDA 4EZIA 3B5EA 2BGNA 1BROA 3TJMA 4J3JA 3I2FA 3C6BA 4MQLA 1W76A 1BN6A 4UBLA 3CN9A 3WK9A 4A5SA 1W75A 4RE6A 1Q0RA 2RGUA 2C0PA 3WK4A 3QPDA 2WIJA 1WM1A 1X70A 2ORYA 1N1MA 4C89A 2XUAA 2WUFA 3K9BA 4BC1A 3OTQA 3RM3A 3QBJA 3F9CA 5JAPA 2XMQA 3BE8A 1H23A 4X95A 1QIIA 2QXUA 4N8EA 4P08A 2ZSHA 2XUKA 3BIXA 4P92A 3OG9A 1VA5A 5ALJA 5FRDA 1S8OA 4OUKX 5C8XA 5HF8A 5HF9A 1E8DA 1UK6A 4TGLA 2HU5A 5ALEA 2WIDA 3V9AA 4DMFA 5AK6A 2PBLA 1JJBA 2OXEA 1QIHA 2OGZA 3O4HA 2XUDA 4HXGA 2C0QA 4IQ4A 3WA7A 4AZ3A 3HLKA 4I4CA 1LPPA 3AIKA 5JAHA 5CW2A 2R11A 2HA2A 4PF1A 2ACEA 4MEAA 2Z8XA 3G9TA 3R3VA 3QPCA 1RP1A 4WY8A 5BWCA 4G4IA 4X6UA 4AN0A 2AJ8A 4BZWA 5C7YA 3TEJA 4G9GA 2V96A 1K5PA 1YS2X 3HXKA 3IA2A 3AILA 1FSSA 3P2MA 5HF6A 3A70A 1K63A 3FSGD 2QJRA 3G0GA 1U4NA 5AKJA 2IX9A 1IUPA 1OCEA 4EB0A 1CUVA 2QS9A 2ZYSA 2Z3ZA 2ZYHA 1U8EA 5I8PA 2JGLA 3D3NA 1Q83A 4B0OA 3KWJA 3SK0A 3WLAA 4IH9A 5AKEA 2X5XA 3KXPA 5EI5A 1JJFA 1JMKC 5JZBA 5HFAA 4UHHA 4EY6A 1XKLA 5A7FA 1JI3A 4BAZA 3MUNA 1MAAA 1ZJ4A 2WU3A 4CG3A 5CT6A 5LZ7A 1CIJA 4J03A 1WPXA 2O2GA 3WQHA 2WTMA 5CH3A 4H7KA 4QZVA 3LP5A 4PSDA 1O6FA 3WMRA 3IUQA 4ZREA 4X85A 2AJLI 4KYVA 2OAGA 1CUJA 1THTA 2OCGA 3R3XA 5AI4A 5CT4A 1ACJA 2VATA 3I2JA 1XZHA 5ALXA 2QMQA 1CFJA 1WPRA 1CUYA 3ZLUA 2AJBA 1MX5A 5JANA 1GPLA 1XQWA 4INZA 2GYWA 1CUSA 2VTVA 1HBJA 4WCVA 4G5XA 2HA6A 2DHEA 3BDVA 2VT7A 1G5FA 4BCDA 1ZI9A 1BCRA 1JKMA 3PDCA 4B84A 4OPMA 2H7CA 1CUDA 2WILA 2RIPA 5EFZA 2C58A 1ACLA 4FFVA 5DYWA 3PICA 5ALNA 1KU0A 1J07A 3QZUA 4RNCA 3G9ZA 4YPVA 4G8BA 3DKKA 5E4YA 5JD5A 3D2CA 3WI7A 3DOIA 2WSLA 5FP0A 1ORWA 5CH8A 5AJHA 5JIBA 1K8QA 3WWEA 1A8SA 3KD2A 2ZJFA 5AKLA 1ZIXA 5AKHA 1MX1A 2Z3WA 2J4CA 4UPDA 4LYEA 4B85A 4LKOA 1RWQA 4G4JA 3IUNA 4G9EA 3M83A 1QIKA 1Y37A 4P9NA 3I2GA 3GELA 2OGTA 4G4GA 5CURA 2W22A 4B0PA 4Y2RA 4GBGA 1SCIA 1YR2A 4HRXA 4ZRDA 2OAEA 2ES4A 4WDQA 3C5VA 2JGEA 3DEAA 5AIBA 3IULA 4NVRA 4U2DA 2AJDA 3W9UA 5T4HA 4K5QA 4KE7A 2B9VA 3IB3A 3M3DA 4Q3OA 4BB0A 1DQYA 1R4ZA 2XQJA 2O2HA 1ZICA 3AUKA 3IIIA 5BWBA 3WKAA 2OCIA 4QE3A 5FPPA 4HTAA 3ICWA 4MWTA 2Y6VA 4JNCA 2QXTA 3DOHA 1EINA 3ED1A 3KSRA 3M81A 4B83A 4D9JA 3AIOA 2QUBA 3ANTA 3FVTA 4JEIA 1PV1A 2IITA 2H7YA 3SWWA 4HXFB 1DT3A 3HRHA 2Z5GA 2VF2A 3QH4A 2XQIA 2X8BA 3KDAA 2FX5A 1UKBA 4I3FA 2GBFA 4FKBA 4CIBA 2YXPX 2WHPB 3PI6A 3C5WP 3FYTA 3HSSA 1XRMA 1DQZA 4QEKA 2GYUA 2HU8A 4BRSA 5EIHA 3MUOA 2Q0XA 2ZSIA 2JGJA 5DNWA 3Q0TA 4XVCA 2JIDA 1FFCA 3ZLVA 4DLNA 5A6VA 4N5HX 2AXEA 1XRQA 2DHCA 2WFLA 2ZYIA 1PFQA 3H04A 4FHZA 1ZIYA 3BF7A 1MNQA 2CBGA 2G4LA 2WU4A 4ITVA 1XFDA 4BCCA 2Y2VA 1DT5A 3ZI7A 4Y7DA 2FUKA 3WKCA 4QDTA 2WG1A 3V48A 2PL5A 3F97A 4FTWA 2CKMA 2XB6A 2GZSA 3DKRA 4FBLA 2ECFA 5DYYA 1XZBA 4M0EA 3O4IA 5A71A 3ANSA 4U2GA 3EQ7A 1VA4A 1QE3A 2PPLA 2H1IA 1U2EA 1J06A 2PSEA 3BJRA 5T4EA 5CH5A 3DS8A 1L7RA 2BGRA 2JBWA 4QLOA 5JD4A 3W05A 3JWEA 3HACA 4W63A 3O9MA 3FCYA 5HCUA 4AB1A 3NOXA 1XQXA 3S2ZA 3W9BA 2H7XA 1LZLA 1USWA 2CEKA 2XUJA 4DTCA 2K2QB 2QR5A 1NU6A 4Y2YA 1ZD4A 1ZGCA 2XQGA 1ORVA 3ICVA 2DFPA 1HDEA 1P0IA 5AOCA 5FKJA 5ALOA 4CCYB 1CUZA 3FLEA 1UKCA 5C81A 3H19A 2JGFA 2VA9A 1EA5A 4KRXA 5FLKA 4BVJA 1P0PA 5SYNA 4JH0A 3DQZA 5FDFA 4UHBA 3Q8WA 4MWSA 4LXGA 2VT6A 1AURA 3QMVA 1HL7A 5HQ3B 2J3QA 2ZYRA 4B81A 2HL6A 1QIGA 5C8ZA 3EIOA 1EDBA 5IVIA 5CT5A 1E89A 4DIUA 3DLTA 1GXSA 4X7BA 4H7DA 1QIEA 1R9NA 3I28A 2WLSA 3OC0A 3CN7A 5D7BA 1NX9A 3H0CA 1JU4A 3LIIA 1ETHA 3V1NA 4AX4A 2JEYA 3WK7A 1THGA 2QRUA 3V1MA 1IUOA 5LLSA 2DHDA 2DQYA 2RONA 3UUEA 4W1QA 3OOSA 5ALDA 2PU7A 1QTRA 3BDIA 3HZOA 2C7BA 4BDTA 4BTVA 4UBJA 4OYYA 3G0BA 3HC7A 4IH1A 2CB9A 1JFRA 3O95A 1C7JA 1EH5A 3O4JA 5DJ5A 2OCLA 3AZOA 2G5TA 1ODSA 2ONCA 5LKRA 5AI6A 4Q3LA 3B12A 4ZXFA 4I19A 2V97A 3WIOA 2D0DA 3FYUB 5LZ5A 2ZJ6A 2WQZA 2XUPA 3V1KA 1C7IA 3HI4A 1F8UA 1MT3A 4MYDA 4CCWA 5ALHA 4JYMA 3E4DA 3QMMA 1GKKA 4J0KA 4Y2SA 1LBTA 4XWGA 1ODTC 1XZIA 3TRDA 1XQVA 3CCCA 5K3FA 3STUA 4ARAA 1ZI6A 2UZ0A 4WJLA 1J1IA 1E3QA 2HU7A 3DD5A 3R0VA 5C8VA 1BU8A 1XZMA 2WIKA 4QLAA 1ZD2P 4N5IX 2Y6UA 3C8HA 5K3AA 1EX9A 2VJAA 4PW0A 4OSEA 2RHTA 3UMJA 2HA3A 5CXXA 3HABA 1IUNA 1FFAA 4H7EA 3HYSA 1LZKA 1CUWA 2WJ4A 3JYHA 2WJ3A 2V98A 4U2FA 5AM1A 3W04A 3K2IA 5SYMA 4LYDA 1VZ3A 4UHDA 1VOTA 5ALFA 1QFSA 4B80A 4V2IA 2JGIA 2HIHA 3RARA 4ROTA 2YH2A 4JUIA 1Z68A 3WL6A 2XMZA 5CT9A 2WHRA 1F0NA 3G9UA 3K6KA 2XQFA 2WFMA 2HFKA 1DWQA 1VJ5A 5D6OA 5DTIA 3R3UA 2EEPA 1UFOA 1BEEA 4BP9A 5BV7A 1LPAB 5AK5A 4HZGA 1YCDA 5ESRA 1X2EA 4BRZA 2XDWA 2XMBA 1AZWA 4J0DA 4AO7A 4C4XA 1Q0ZA 4GW3A 2R8BA 3PUIA 2JEZA 4Q3KA 2XLBA 2XMSA 3WJ1A 3WWCA 5ALKA 1B6GA 4G1FA 4ARBA 5AI5A 2XLCA 2Y1KA 4BE4A 4DM7A 4MYSA 4PSCA 4LXHA 3LCRA 2WG0A 2CJPA 4Q1VA 5AO9A 4AN1A 4KACA 3G02A 3G0CA 3DYVA 3WL8A 4MJ3A 4Q34A 1UK9A 3H2JA 2HHAA 3WWOA 5DTJA 2E3JA 5ALLA 4C88A 4UFOA 4EBBA 2WJ6A 5JADA 3E1GA 3C70A 4QA9A 2VAXA 1YB7A 1QONA 4WFIA 2XT0A 4B6GA 1UOOA 3D2BA 2EDAA 1XZLA 5AOAA 1G4HA 3WZLA 5DNUA 2PX6A 1MX9A 4FBMA 4H0CA 4K6GA 5H3HA 5FPQA 3WWDA 1XZJA 1K4YA 1H2WA 2C4HA 4X94A 4EY5A 3STYA 2PSHA 1H2ZA 5A7HA 4OU5A 1CUHA 2WG2A 3DJYA 5AKZA 5HZGA 1W1IA 1W6RA 3QITA 1RYYA 3STWA 5ALUA 3ZV7A 4OB7A 1X2BA 3C43A 4S0XA 4X92A 3BL8A 5ALRA 2VJCA 1BCSA 1GQSA 3FLAA 4M0FA 2QJWA 4X3CA 4UHEA 4DYHA 5K3CA 1SCKA 5AI9A 4KR0A 2B4KA 2CZQA 2WFZA 3VVMA 1CUIA 4M0MA 4IH4A 5T4FA 4WDRA 3I1IA 4NMWA 4MEBA 4E14A 1CQWA 3WKDA 1LPNA 4BAGA 3CCBA 4DNQA 3KWFA 4QDOA 2XQKA 5JD6A 4DMCA 3R3YA 4A16A 4N8DA 4HS9A 4PSUA 2HRRA 1JMYA 3WK5A 3T52A 1EK2A 1G66A 1EK1A 1I6WA 1ZJ5A 1BN7A 4QWMA 5LZ2A 3QYJA 1W52X 5AKYA 2EDCA 5AKIA 3SC2A 4BVLA 2Y2UA 4K6KA 1H22A 1BEZA 1WCYA 4TPKA 5D3KA 4FLMA 3R41A 1LPMA 1QIFA 5AM5A 3W2TA 2BCEA 3H2GA 1IVYA 5DWDA 2IIVA 2OPHA 4BTLA 4J0CA 4H7IA 4UBIA 2WUGA 5FXMA 4Y9SA 5HKBA 4N8SA 4ZGBA 4K6HA 4EY4A 1B41A 4AXBA 1ZGBA 5DNVA 5EIEA 3A6ZA 1AUOA 5LZ9A 2RHWA 4BVKA 4YK7A 5EHQA 1UOPA 4H7FA 4X00A 4Y2VA 3W06A 4FFWA 3FOBA 4GDMA 1WOMA 2YASA 4WY5A 4FNMA 1UK7A 4U2BA 1JJIA 5YASA 4Z49A 4OB6A 1TCBA 4UUQA 3UUFA 1R3DA 2LIPA 3WKBA 1MTZA 2O7RA 1C4XA 1XROA 5CBKA 1G42A 1TQHA 1TCCA 4QDUA 4OU4A 3EBLA 3PF9A 4KAJA 3WIBA 5IH7A 3O4GA 4X71A 1CV2A 1XZCA 1MNAA 3C6XA 1ODCA 2QUAA 1P0MA 4KJXA 5ALTA 2GYVA 4MXDA 2VAVA 4DGQA 2XUIA 4QNNA 4XX1A 1EB9A 1YAJA 3VISA 4DNFA 1CR6A 1YASA 3DYIA 5K3DA 2WIFA 4H18A 4X91A 3STTA 1A8UA 3WA6A 4Q82A 4DNOA 5ALMA 2I3DA 2FJPA 1LLFA 4L9AA 2XI4A 3WL5A 5CRIA 1YSCA 3RKSA 1XZGA 2ROQA 1XQYA 2RI6A 2YYSA 3EQ9A 4FDMA 1EXWA 3A2LA 4BCBA 2VQ6A 1D07A 1AMNA 5IVDA 1CEXA 1QOZA 2QM0A 2ZJ7A 3AIMA 1SCQA 3FNBA 2HA4A 4BYMA 1GT6A 4J0GA 1XZFA 3GROA 4W9RA 1UWCA 5IVHA 4YASA 1U65A 3WYDA 1GKLA 1XKTA 5A2GA 3H18A 1LNSA 2OGSA 4QWWA 2GBGA 5IKXA 1IMJA 4X6XA 1NU8A 5I9IA 4UFNA 2I03A 4PV7A 1OXMA 2WIGA 5J3JA 1YA4A 1UXOA 4KE8A 5ALVA 4TVKA 5AOBA 1O6GA 4AO6A 3ZLTA 1AGYA 1WHTA 3PF8A 3G8YA 3ESDA 3GA7A 3FCXA 1CLEA 1E8NA 2HDWA 3WWPA 2XMCA 3G0IA 1A7UA 4BAUA 3N0TA 4HAIA 1ISPA 1AKNA 1TKRA 1LBSA 2V9ZA 3SX4A 4G8DA 4LXIA 1XRPA 2WFLB 5CTAA 3WKEA 2ACKA 4RPCA 2BAGA
chains in the Genus database with same CATH superfamily
2IZZA 1WXEA 1FMLA 3DC7A 3H8VA 2Z2JA 3UWOA 3TMYA 4PNZA 4U4AA 4AF8A 1V6CA 4BNYA 1Z39A 1JR3E 1V8PA 1ZZGA 3GFQA 1NBMD 1QYDA 2JAUA 4QU5A 5FL3A 4BUZA 3REQA 2TECE 4ABYA 3OBIA 2OCDA 1REQB 1LGYA 4M83A 1D5CA 2PV7A 3HFGA 3BORA 2QWXA 5GY7A 5EHNA 1KYVA 1USIA 2P5UA 3FRHA 2XD4A 3U7HB 4O6VA 2F1RA 1Z5WA 3S2YA 2A9PA 3VU1A 3K1AB 3VAZA 3NHSA 2AJCA 1L0BA 5ITSA 4DYVA 2AC2A 1L7NA 4RLFA 5F12A 5F78A 5GTDA 2FZGA 1DZ3A 1E1MA 4GRAA 1HUQA 2C84A 3DAFA 4X90A 2G0AA 2Z4SA 2HRBA 1LPBB 3EZ2A 4BJHB 3F6CA 4OAPA 2D2EA 2VJOA 2NO5A 2JJ1D 2EP5A 4L22A 1J0AA 3CE6A 2BJHA 1XAJA 1AU9A 3IPRA 3OT1B 3IQWA 2IZ1A 1LRJA 1NZFA 2YW2A 4FLFA 4GICA 2D1TA 3LRXA 5CG1A 2PUCA 3GV0A 1NE2A 3B1VA 1SNYA 3HFSA 3QNUA 1MO2A 1MU0A 2VXBA 4I9HA 5EXDA 4AG3A 4Z3KA 1RCUA 4OYLA 5DNYB 1JF8A 4UZEA 1QO9A 3BZWA 2DPLA 4EJ2A 1JKFA 1RAAA 3H6KA 3CX6A 2XTNA 3E9MA 1DWPA 2V59A 4FOLA 1E66A 3EXG1 2HADA 4DR5B 2ID7A 1AKEA 3DDUA 4AG5A 2AH5A 1KYQA 2FRVA 5KHAA 1MAWA 1PTJC 2Y3IA 3LF2A 3H5WA 4I14A 5DO9A 1N7GA 2E6UX 2AYXA 4ZAXA 1QTNA 2FEMA 3EC7A 4L72A 3PS9A 4GI5A 4J76A 4LW8A 4QIHA 2OLEA 1JT2A 1QQ5A 3CJRA 4GEGA 1CNMA 4JJKA 4TWJA 1I01A 2ZPAA 3FKJA 3ZTWA 5AXCA 2ZWVA 1QHHB 1QC5B 3RBAA 4KGDA 3U48A 5B1YA 4DBVO 1JWLA 3KPVA 3EOZA 1CNFA 1CVLA 1WKBA 3NUZA 4ZPJA 5JAQA 1TVEA 3T5TA 3UK7A 1HPLA 2GJ9A 1JDBB 3I2HA 1QJ4A 5F76A 1RE0A 3G2HA 3BXHA 1LF5A 1Z4PX 2FQ1A 3K9GA 5JR3A 4DXAA 4EYOA 3N3AC 1QLHA 2IBSA 2NIPA 4KXWA 5BWNA 4X3OA 1NPYA 4AMYA 3K31A 2NV6A 2PXAA 2QMUA 1NW9B 1M6WA 1Q11A 1I7PA 2XB9A 4RF2A 1SZPA 4AAYA 1XZPA 2SCUA 3UJHA 4Z7JA 3GA5A 3C0KA 1Q2XA 1UANA 3OX3A 3PXUA 4DBZA 5I3CA 3QX8A 2GZHA 2R7NA 3TNJA 3KQLA 3D7LA 1D2GA 1L4HA 2H1CA 4NENB 5AICA 3WQBA 2R7MA 3UGKA 3Q6MA 2O1WA 3LD9A 5D3MA 5KBYA 3L79A 4KAAA 2HXYA 2NO6A 5CPFA 2VNHA 4YT2A 2IA5A 1QO0A 2YHBA 3E9NA 2SICE 1MV5A 3NHJA 3QVVA 3GN2A 1YGYA 3HDJA 3ZJ4A 4CM9A 1A71A 3LDGA 4Z2AA 1GN8A 4I36A 5CYGA 3E1KA 3O0DA 4GO1A 3SX2A 1NHGA 3AF3A 4NJMA 3D7NA 3VAAA 1X86B 1WETA 4KZPA 5BXQC 1BXZA 4EYKA 2R87A 4HPJB 4CG1A 3GLTA 1SMKA 3DW1X 3G85A 3OFJA 4MULA 5B37A 4Z3OA 1CKEA 1A8HA 2G40A 1AXGA 2JNWA 3GZ4A 4XYMA 3T9AA 4YJFA 2I66A 4B3DA 1Q7CA 5ILOA 3F8SA 2I6UA 4LV8B 4HRVA 1UDWA 4WW0A 2EOAA 4AZTA 2J30A 1GCIA 1LPOA 3PHCA 3C8DA 4YV2A 1M2GA 4MI1A 2V65A 3PV0A 4FIZA 1CSEE 2CUNA 2Q8PA 4CTMA 3KPWA 1AGRA 5AHXA 1IRIA 2UXBB 1LV7A 1OA1A 1YL5A 4FS8A 3PFHA 4C3UA 4PNHA 2HY7A 4A6PA 2PN1A 4KK4A 3WNZA 2VUTA 1GXSB 2EVWX 4P58A 4PXSA 4CDRA 4TLBA 3AZQA 1KWKA 4OLJA 1FTNA 2RBEA 4HDNB 3VKFA 4AMZA 3AX6A 2OQVA 2ZUDA 4PR3A 4RHCA 4Y0VA 1V45E 4BB6A 1O97D 2JC3A 4H7HA 4U5QA 3ANXA 1XNGA 4CN9A 3SLKA 3NT5A 1L7BA 1WUIS 2UUAB 3L1IA 4WPGA 4A6DA 3ACCA 4KQ2A 4Z86A 1WD5A 2VUHB 1SC1A 5KKAA 3VZRA 3L1KA 3NC1C 2HFJA 3FDZB 4QPJC 2REXB 3H2SA 1GGKA 4L2IB 4O2AB 3MN1A 1DQSA 2PEZA 4FHFA 3V6LA 2EKBA 4RA9A 5BP7A 1E3JA 2IUUA 1NQOA 2NAFA 1I51A 4DWJA 1EVQA 2WWWA 1QK4A 4TV9B 2OHVA 1E6EA 1T6YA 3EXFB 3MTIA 4M1ZA 2QL5A 1CQJB 5CK5A 1L5NA 4P4UA 1G41A 1FFEA 2NM0A 1SWWA 3C48A 2AG0A 1KC3A 1Q0UA 3GVCA 3GXOA 3IVMA 4L3VA 4ZT7A 2J3MA 3VXKA 1DRJA 4EHBA 1QZTA 4RMGA 5EMJA 4ETNA 5IJXA 3EAFA 1TEHA 3UH1A 4L5BA 4EUSA 3NR2A 4JBLA 3PRHA 4X62B 4CQMB 4DILA 5AVZA 3GEDA 4D3YA 3SJZA 4PONA 4ZJUA 4GYKA 1B93A 3QA9A 3C7CB 4WNYA 4H08A 1YC5A 1VJ0A 2WSIA 1N34B 3NHZA 3OIUA 2WD7A 4I50B 4OI1A 2B98A 1QHNA 1UC8A 2YHUA 3FOAA 3L46A 3QENA 3UMSA 2KSQA 1CHNA 5FWDA 4DDUA 4NXNB 1SUDA 3PQ8A 3NXSA 4ZI5A 3U62A 4F8JA 5CDYA 4JLDA 2PH5A 2D13A 2C4WA 5ALIA 2E5FA 4HAOA 3KTOA 4J0HA 1ONSA 4LNUB 3GC6A 3UHPA 3ZOKA 4DDKA 2UXCB 3LLMA 4QGHA 3PUYA 5AI0A 1KSFX 3CXUA 3KSMA 4HJRA 4YX9A 1B73A 3ZVRA 5HUHA 1SJ9A 2NTEA 3PUHA 4R3WA 4CIAA 1FFDA 4JC0A 4JGIA 3VTKA 5L51A 4ZVQA 2A14A 3W3AD 2D00A 1R4MA 2H63A 3BCUA 1POXA 2CXUA 2PRZA 4GC5A 1QR6A 4GZ3A 2QGZA 4IO0A 3WL7A 3BSSA 3ZZ1A 3KQSA 1DDOA 4I5GA 2B1JA 3OZGA 3A6GA 1E2PA 5DXFA 3UENA 4ZV7A 2YTZA 3WNQA 2QRQA 4RLQA 1NN5A 5SY4A 1OXUA 5EC8A 1TAHA 2C99A 4QOFA 3Q40A 3S2GA 3WYCA 4ZTUB 5EIFA 4Q4JB 4MQ4A 4RNDB 4UTRA 5K8IA 2YFYA 5L4SA 2G5PA 4NG5A 4P4GA 1H1TA 3NMUF 1AKTA 2OHHA 2R44A 4KWHA 2ADMA 3BFPA 3F4BA 3MILA 3MLAA 5K8LA 1T4CA 4CMIB 3M1LA 4CHGA 3NVMB 2HMWA 5C18A 1P75A 1G8JA 3TE7A 3WLEA 1Y1LA 4BO5A 1E69A 2GCOA 4EG0A 5CB0A 2QLJA 2EKDA 3IBTA 3HKEA 3MW8A 1ZP6A 2OD9A 4EL5A 4G1EB 4C87A 2VQDA 2O3JA 1FP4A 3GDFA 4Y2TA 3OM8A 2FKNA 2O2IA 3IMEA 1E6WA 1XEAA 2XXBA 1OXBB 3A25A 4HDRB 3SHOA 4WZBA 2YC4C 4F85A 5M04A 1DUIA 1PJRA 5LP6A 4WACA 1EUDA 1QAMA 2OC9A 2VOJA 2D2IA 2XQVA 1DDGA 1VKHA 4FGKA 4M37A 3F8WA 4PZEA 2HYDA 3DBIA 5A05A 3RYCA 2AXQA 4WCFA 5DLEA 4EB3A 4YJ3F 2Q9UA 5FO0A 3AM3A 3GFSA 4KUGA 4TTJA 2WHPA 1NUHA 4FE7A 4O2BB 1KEKA 3R2JA 1O0CA 4J29A 3HZRA 1NM5A 3UOWA 3PR1A 2PZAA 4OBBA 4KQFA 1NMZA 4H1HA 3TEFA 4Y2GA 5BQ3A 4KGZA 1RWMA 4BV8A 5FX2A 1DBSA 4G25A 3NS7A 4M7WA 4K6OA 1E1RD 2I6SA 2QJOA 3UGQA 5K3OA 3GZJA 5FQNA 1LB1B 1P18A 4DZZA 4KQEA 4LHZA 5JAOA 1R6AA 4JJEA 3STXA 2C00A 5DI3B 3V5NA 1HE1C 4R54A 5B3JA 5AXDA 1XPUA 4O4JA 5L4NA 3QI7A 1NT4A 4DIEA 3U16A 3LDUA 1BE0A 3FLMA 1NKVA 1TUBB 4XGIA 1FX1A 3F9IA 4B6JA 3V6MA 2N0SA 4HNVA 5BVGB 3N8GA 4IICA 1UBRS 5DPMA 4MP6A 3RANA 3W7AA 3O8LA 4CHTA 3MAJA 4F1JA 3A4LA 3L1HA 4OREX 5H80A 3BXPA 3AFIA 5FBZA 3MA0A 2XB2A 3KS9A 4GPAA 1G8HA 4EAQA 2IK8A 3RTDA 4F71A 4OFZA 1UJBA 1ZNZA 3KOOA 4EEXA 3IYLW 1OLXB 3OHMA 4X97A 4HFMA 5EQJB 3KEQA 1BX0A 3I01M 4H35A 2O19A 3V32A 3ED5A 2EW8A 2VSOA 4D97A 2N46A 1PP4A 1S9DA 3AB3A 3KKEA 4R1SA 2JLWA 1C41A 2O8EB 1T0JB 1FW6A 5IG2A 2Y71A 4JJAA 6CHYA 4Q01A 1NLUA 1V5WA 1UZNA 1Q1EA 4M7OA 1XWWA 4G0NA 1EAYA 1ZD8A 1PVOA 1BIFA 1D1PA 1E0SA 3VPCA 1M2OB 3PFNA 4AJHA 4KMRA 1QZ3A 4FDAA 3DZFA 4RDIA 2O8DB 4B4WA 4XJVA 4QGFA 2OP0A 1CS0B 1IONA 4CM9D 3ISJA 4REOA 4DIKA 5C37A 3ENKA 1T8RA 1Y8QA 4C4AA 3VA7A 2XUOA 5DH9A 1PWEA 5CIWA 3HGTA 1F2UA 1UBEA 4CEJA 1IK6A 3RS9A 3IELA 4M38A 4MCAA 4OL9A 4CMBA 2QVXX 1JHDA 2ZYVX 2YWCA 3TLCA 2GHRA 3JAWB 3P19A 2FUNB 4AJEA 3R0JA 2DAPA 4UVHA 1R6BX 4CF3A 4DR1B 5DM4A 5F3WB 5LWQA 2AI1A 2W6CX 4CM6A 9ATCA 1ZHFA 3JARB 4Z6KA 1DU4A 3MS7A 3NB0A 1NBIA 5E9WA 1OV4A 2CLLB 3NOQA 1BKYA 5REQB 5EUQB 1OASA 1N3LA 3OM0A 4BMYA 1ODFA 2IXAA 3N59A 3NTQA 4OOEA 3SFVA 3X0DA 4B79A 3AKDA 1W0CA 4WNAA 4DA7A 4Y2JA 3H11A 5LXTB 1CRZA 3LDFA 2NU7A 2VSYA 2RI0A 3C3AA 1SQ5A 5IZ4A 2AOWA 3KZ1E 3U3OA 1CF2O 3K20A 5HNKA 1T9HA 1PRYA 1TIBA 4IXMA 3JQGA 1SGWA 2W2QA 2FE1A 2X76A 2IXFA 2PX0A 2ZIFA 3IESA 1O95D 3NBUA 1KORA 1P7PA 1R88A 3SHVA 4CTJA 1M6HA 2ORVA 1RHRA 1XLUA 1HM5A 1GUBA 3GIWA 1N6LA 3MMNA 4P4TA 3QU2A 4X41A 1Q50A 2W2OA 3O92A 4B47A 3QFHA 3N2KB 621PA 2FVYA 1VPDA 3CPEA 3EEQA 3FVVA 3T7KA 4B71A 3FMPB 4RVCA 5J2TA 2Z8ZA 2UU9B 1RQGA 3Q2KA 2IY7A 5E2IA 1U7PA 5AVXA 3ZZUA 2W00A 3ZU5A 1JNYA 5SY9A 3B7PA 5JHGB 2VDMB 4D46A 1D8TA 4Q0MA 1E7WA 5C3UA 2P8SA 1QH8A 1RI1A 2WP8J 3O8OB 4NBNA 2EJWA 2O1SA 3H9GA 1H2HA 4X7RA 4IHJA 3S40A 4DUGD 4UAJA 6Q21A 1BEUB 1EM8B 1OPRA 1DXHA 1Z8FA 2VDOB 3RWBA 3VNBA 1JE1A 2F9FA 5M5BA 4EY8A 4QJ3A 2QAIA 3RYFB 4F8YA 1Z2EA 1KS9A 1S3GA 2C5GA 2WTNA 3ZCPA 4K0KB 3A36A 4Q4LA 2FX2A 3ZDRA 4D92A 3I5MA 4JAVC 1NMEA 1VYHA 2C7VA 2H1LA 2XYVA 2YWJA 4KIWA 3DWGA 1OX6A 4EY7A 3DKIA 4X1YA 5BWLA 1I6MA 4HR7A 4X7PA 1W93A 2ZWMA 2BFCA 3QPUA 5ERYA 1D1QA 3R7SA 1X39A 2A78A 4ZPXA 4EPYA 1JHRA 2I34A 3EFOA 2I3ZA 5CVDA 3JD3A 3KSAC 3L7AA 1U28A 2B1IA 1UKZA 4HSEA 3MUEA 1SUAA 1LVHA 3WFJA 5JRJA 2WD8A 1E2HA 2FR1A 4CI9A 3E4CA 1CR4A 4XSHA 4GYYA 4YI5A 2C94A 3JW8A 2XMPA 3G5AA 1IOZA 4ZGWA 4Q7QA 3AV0B 1XV5A 4ARVA 1MORA 2MIIA 3Q3IA 4LY3A 3UJ3X 4F2PA 1GZ7A 2Z4RA 2P6RA 3VKHA 3QLUA 4ALIA 1A88A 3QM1A 1A7KA 1C7RA 1EB8A 2OMEA 4JDUA 3KM0A 4KQCA 4QPPA 3NPAA 5ESWA 2XYPA 2MR6A 5KU1A 3ITDA 1WQ3A 3CVWA 4LDAA 3NT4A 3KUDA 4JP2A 4UJ5A 4R16A 3LT2A 5DBIA 1WBDA 2YRWA 3S2FA 2C1XA 4A2CA 2ORED 4TS9A 5ALWA 4M1OA 5FIUA 4BFSA 2W6PA 3ZWQA 5JI3E 3H65A 3ML1A 1G8MA 3ZC3A 1B8VA 1L4GA 3QA3E 4CFSA 3DBLB 3IBYA 4LE1A 4N7MA 4C7OA 1HV8A 2MJLA 5IJ0A 1Y6ZA 2QT9A 3X1JA 5JS1A 1BX1A 4KRYA 4FGJA 1XYGA 1JBEA 5HRAA 2JEOA 4OGFA 2NQ2C 5CJ2A 1EFUA 4LZNA 1UJCA 4ZCLA 4HDMB 4RXMA 4CXMA 1O5TA 4GKAA 1H2YA 2NGRA 1R0BA 1K6XA 2XTZA 3BJMA 1KH2A 3WBJA 2WSMA 3A1DA 3ICPA 3OPMA 3GFFA 3IKTA 1EMDA 2IXDA 4PVCA 5TY0A 2B6NA 4LAFA 5TEWA 3TLBA 2A1TR 3U1TA 1N6PA 4RE5A 5B7NA 4DLXA 4EKEA 2ZUUA 2P27A 5AD1A 2BEKA 5KDDA 1Z4MA 3SXUA 4JITA 1ZD1A 3JX9A 3AHDA 5IMBA 4A5OA 1H5UA 2IP1A 2JLQA 2PEYA 5CXUA 4ZC8A 4Q3EA 4ZQIA 3TLZA 2PRSA 3AONB 2HA7A 5HFNA 1L5HB 3AXTA 2IF0A 1BYIA 5EHZA 3TZHA 1HRDA 1M34A 2PNFA 3F3SA 4DYDA 1N2XA 1AZTA 4Z0NA 1LU9A 1P91A 3RVRA 3MHPA 5ALZA 3BB1A 2DPGA 1OYWA 1RHUA 2YHIB 3H99A 4MQFB 2WNSA 4S0ZA 3WYAA 4BFLA 1NMSA 4E15A 3K30A 2Y76A 2BKLA 3UCXA 1RKQA 1PR1A 2ADOA 3AHGA 2LP4Y 3KVNA 3M4XA 3MT8A 4KO4S 5DOVA 2HCBA 1MDFA 4HUJA 3O8NA 2OVFA 4G24A 1E5LA 1N2OA 2HMYB 3G9XA 5T4BA 3AZPA 2OHIA 3AESA 3O47A 1R0CA 2G82A 2I7CA 2VXCA 5FL7A 5H1YA 2JLVA 2H4XA 4RV4A 1U04A 3WIUA 2Q8QA 5EJFA 3QFRA 4G86A 3H0KA 2XE8A 4UARA 1G64A 4ZDWA 2ZIAA 1HE3A 4PHGA 3EDOA 3WRVA 1VI2A 4J0FA 4R1NA 3H8SA 5J1TB 1L1FA 3NRBA 4G0ZA 3VOBA 4S05A 3PXBA 3SC2B 4QAQA 3AFOA 3JQGB 3P45A 4KX3A 2G9VA 1L1QA 2DKOA 1GGVA 2PZ8A 3OJWA 3HYCA 3LHSA 1XD8A 4U1RA 4RIFA 5E6RA 3ELWA 3FBTA 2IFTA 4YMTA 1XIVA 4K9NA 2PUJA 4R3UC 1VI5A 3PWZA 3J7AC 4P5EA 3FSGA 4JLJA 4F7DA 5ALYA 2RGBA 2FPRA 2OILA 1Z6YA 3CRVA 3F6EX 4PYMA 3C1AA 5ANRB 2QUHA 3T1OA 1N32B 1LLUA 1UZAA 4YRCA 4TLAA 3UVEA 5JNSA 1XCBA 4C0SA 4JUAA 3S3TA 2X5NA 4HTFB 1QKKA 4KQWA 3T4UA 3WYNA 4UUOA 3DC2A 1C9KA 3HA2A 2BGTA 3DXYA 2C88A 3M82A 4B3JA 4LOKA 3L5OA 4AWAA 2OGUA 3L1JA 3FCEA 2UZ3A 2JF0A 3O38A 5KWJA 3PJRA 4L9SA 3RWOA 1R6UA 2I8CA 4L5JA 3KJNA 4XCVA 2ZI7A 3RTBA 4EM6A 5BRNA 2NP7A 2XCOA 2QI9F 4FFNA 2QTLA 3BB4A 4S1OA 4PGFA 3RC1A 3V4SA 4A8HA 3HBMA 721PA 4F92B 3CNEA 3AW8A 1EFVB 3PYLA 4ETWA 2KE5A 3LVFO 3K6SA 4KH0A 1XD2A 2OB2A 2HCTA 1R74A 4FZ3A 4CJXA 4KNWA 2ZT8A 2CFSA 2JLYA 4Q6WA 5KYYA 3KTAA 5KVSA 1T26A 3QHQA 4J7UA 3DM9B 1JLSA 4G8CA 5B7PA 1U2QA 3ZDCA 5FWYA 4O59O 5EEGA 2NU6A 1HZZC 2UYQA 4DVJA 5ITZB 4GG1A 3EPRA 2H1SA 3PENA 4O08A 4MI9A 2OECA 5IUNC 2AVDA 3NJRA 3A4MA 3ORYA 1WHSA 1UEXC 3CLVA 3FBWA 3SNHA 3OWOA 1NR5A 1C4WA 3I9NA 3WWYA 1P4SA 1U2ZA 3ZIUA 1EI9A 2WHQA 2Q1YA 3AJAA 3UYLA 3OF5A 5E1OA 4UOEA 1DBRA 3ITNA 3NYWA 3RYTC 3E7FA 2WWYA 4C0HA 2L2QA 2CXQA 4J90A 1TRHA 2J4FA 3LQ2A 4AWXA 3RK4A 1JEOA 3E3AA 3RUIA 3KZNA 1X7XB 5K3BA 1E8MA 4UBMA 1MPXA 3KJGA 5A4KA 4F4CA 3OIYA 4XM1A 5FBLB 2ZYTX 3I8SA 2OA0A 4DWOA 4BRWA 2VOEA 2WHXA 3IALA 4KWIA 5BVHB 1ZH8A 2XMDA 4UBNA 2UVPB 1ZA1A 2PS0A 2YVLA 3BILA 4BNLA 1BROA 2C07A 2ZXUA 1PDWA 3BTVA 2XBLA 3EIQA 4LI0A 3W6OA 4V1CA 4PCUA 1E5DA 2TMDA 3QG5A 4IIFA 1RYHA 3V4FA 4A3SA 5HIIA 4PFKA 3KLNA 4A15A 2C03A 2REOA 4JOCA 1I2CA 3UMGA 2Y05A 2ATEA 2EHDA 5CLFA 4MRMA 1GUZA 1W76A 4U6NA 1JFFA 3ZI0A 4B6SA 4UBLA 1JR3A 2WZBA 3QLJA 1N2CB 3EXEA 1E92A 3FVWA 2IUEA 1ST3A 1Q0RA 4RE6A 5K0BA 1YQTA 4JQZA 2RGUA 2WT4A 5AW6A 3OZXA 3QE0A 4Q9NA 4AG6A 2G88A 5DULA 2WIJA 2IUFA 1WM1A 3QKRB 4MUNA 3B89A 4PC1A 1X70A 2IYYA 3HCRA 2I33A 4MMZB 3TK1A 4E5PA 1ZJWA 3A3OA 3H05A 5KO2A 1QYRA 2VPPA 1O5IA 4P0TA 4ENSA 2XUAA 1WDKA 3N9IA 4BC1A 2Z6QA 3FGOA 5KTRA 2QDKA 3QBJA 2O5RA 1U9YA 3BZUA 4ESVA 4Y0NA 3LQ4A 4GZ5A 1YJ5A 3UFBA 1YQDA 2XW6A 1IMOA 1W581 1C7EA 1GZVA 1H23A 3KZMA 1HSOA 2ZVQX 3IPYA 3B9BA 4TT8A 3SE0A 1ONNA 1XALA 1CJKC 2AZ4A 4L9WA 4RY2A 4ENPA 1NVAA 4MWBA 2PD4A 1SVNA 3BIXA 1BMDA 1G8FA 3NV9A 3RYHA 5J47A 4XH9B 3OG9A 3WFZA 2IYNA 3U44B 1VYUA 3SQWA 5C7LO 4QQ8A 3BTUA 3CLUC 4TL8A 2J32A 3E82A 2BOVA 1XF1A 4H31A 1KZ1A 2JHCA 4M89A 5D00A 4BB9A 5T67A 2C5EA 2PMDA 2Q4BA 1N2GA 4HDKB 1E9SA 4TGLA 1CETA 3ZQJA 1CJTC 2YZGA 3BMNA 4H59A 4ODIA 5DM2A 2G07A 4OO3A 2WIDA 5F5XA 3V9AA 4DMFA 3Q3GE 2IW3A 3P0JA 2H1RA 2PBLA 1VGVA 2VBFA 2VNAA 4HQKA 1Z7GA 3V2IA 4CNBA 3HA5A 4XIFA 4FQ7A 1NY6A 4O3MA 1M2FA 4GOKA 3EVZA 2OGZA 4GPZA 3O4HA 4I2VA 4HXGA 4Z7QB 1Q0PA 4FOOA 3C1TA 4HWSA 1GCOA 3I04M 5H9VA 3WRWA 4HVAA 4K86A 3G8CA 3ZH2A 3UKDA 1NLYA 2AI3A 3K1TA 3TBFA 3HLKA 3NYIA 1GU1A 2XBMA 3C3MA 5EUCA 2FZLA 4IIHA 4I4IA 2JCXA 1JLKA 2V6BA 4MRPA 2ZTLA 4PG4A 3WGOA 3HY6A 2GLTA 2OO5C 1XC7A 3BFJA 4CLDA 5DYNA 1YFLA 1S2OA 4PF1A 2HA2A 1K66A 2IH5A 5LOVF 3VKGA 1YCHA 2VZ9A 1PZXA 3MQ2A 5F21A 4GOND 3CF4A 5FL7D 4FC7A 4CF7A 3QVSA 3TM5A 2Z8XA 4PYJA 1GL3A 2BGKA 3RJ9A 2NXJA 3G9TA 2G1UA 3R3VA 3PPIA 2B8TA 4Y3UA 3EMKA 4GGMX 4OSPA 4EGCB 4NJEB 1KAGA 2YQ4A 3N05A 4FYPA 3W8NA 3QPCA 1SC4A 2P9TA 4O4JF 4M0UA 4WY8A 1WCWA 5I01A 1FMTA 4C0KA 4X6UA 2GD6A 3TKYA 3VSDA 1VLVA 5LQUA 4RZUA 1HNZB 2E49A 4P5DA 1ORIA 4WN9B 2OCPA 1FSZA 1O9HA 3KX2A 3O1JC 4L8YA 5IP5A 3FYSA 1UUFA 2QT0A 4GKBA 3UPTA 3HXKA 1YK0A 3AILA 3IA2A 4LXQA 4CNQA 5K03A 1O87A 2V7VA 3KQPA 4TT3A 4LF9B 1F5NA 3KJHA 4H17A 3FSGD 4ZODA 3G0GA 2F3TA 3BWDD 5DV9A 1UL1X 1BVRA 1AHNA 4UM8B 2PYDA 5AKJA 4EYEA 1QTQA 2C97A 1IUPA 4W8OA 1OCEA 2X4GA 2ZWPA 4EB0A 1CUVA 2NUPA 1ZGJA 3BRWA 1W96A 2QS9A 1K27A 2ZYSA 2UV8A 1LJ8A 1Z74A 3T5BA 2MMGA 1QGYA 4LISA 3LW7A 4QOIA 2Z1MA 4KNYA 1H5NA 4HYTA 1S7GA 2Y1EA 5JV5A 1XN4A 2YKGA 2JAQA 3M5PA 4QOJA 5A1TA 3VPDA 5HYVA 5IAKA 5DF1A 2O3TA 1SH7A 4RPIA 4X54A 3TTXA 1YK1A 4WKNA 4DLLA 6LDHA 1LTQA 1FQKA 5JEDA 1BMFA 3EGWA 4NS1A 5EWMA 4AICA 2LD4A 1JMKC 1JDPA 1K5GA 2WJAA 4BO0A 3LQ1A 4OQMA 5HFAA 1E1QA 4YCSA 2GFIA 1G59A 4UHHA 4QBHA 3U56A 3NRCA 3SVTA 2KQUA 2OV1A 1NPTO 3JWPA 5SZJA 4HKTA 3ZHRA 5AVRA 5GJBA 5E6UA 4UUNA 4CG3A 1J70A 1PJSA 4PTYA 3QNWA 2IPAB 1Y98A 4XLTA 4XB2A 1CIJA 2COEA 1WPXA 3AETA 3HBFA 4F4FA 1YQEA 4BY9E 4LF5B 3OEYA 5EPEA 2O2GA 2Y67A 2G4VA 1AE1A 4NYMR 3DMFA 4RXUA 3K8QA 4P82A 2XX3A 5TX7A 1SUFA 2HPHA 4H7KA 5HUQA 2MU1A 3R3SA 5JQGF 1QV9A 1MOZA 3OJXA 3Q7RA 4PZZA 1HDIA 4HYEA 3VJRA 4RS4A 1U98A 2C9CA 3U09A 2FEXA 2QMZA 2W2LD 4BQIA 4I1PA 1O6FA 4AMBA 1UADA 5JWHA 4KV9A 3WMRA 3ZHQA 4DCVA 3LRPA 1QGUB 3IUQA 5MFPA 3NETA 3DWIA 2YS6A 1SKQA 3WTBA 1TZBA 2QY9A 1DJPA 4KYVA 3ZCXA 2W4MA 2OAGA 4H6VA 4OFWA 4HX9A 1KFCB 1SBHA 4BJ3A 2B35A 5JVDA 1VL5A 5U9CA 1Z5ZA 5F3DA 3IDSA 2E4VA 3T7IA 1U9IA 2XTMA 3OQHA 1G60A 3AEKB 3AERB 3CIOA 4UTPA 1ACJA 1T8TA 4BQFA 2ATXA 3K6RA 3I2JA 4OHBA 4QXAA 5E38A 3A6PC 3M1IA 1E1CB 4MWOA 3E18A 2OP1A 2WZQA 4GBED 2NADA 1OZ0A 2GFHA 2ZM6B 1XR3A 3S5JA 4L57A 1WPRA 5FNVF 2IEAA 4ZQHA 3LYUA 2AJBA 4NDNE 1U7OA 1SBNE 2JHAA 3NHPA 1IEVA 1JR3D 4INZA 3GH3A 2PUVA 3AVXA 3L0PA 4RLHA 2VTVA 4O4IA 4X1IB 4AUNA 1KAOA 1YJ8A 1P19A 5C1IA 3J80A 3INYA 8AT1A 4FFBA 2R6FA 1ZMTA 5HOEA 3BMNB 4GX5A 1RI3A 3BH7A 1HK7A 4N40A 1L5LA 5EHGA 2V5UA 1UMBB 3VZCA 2DUNA 5JCZA 1ZI9A 4Z4GA 1NRJB 1ZW6A 4HWTA 4CV0A 3QBEA 4BKUA 3T4XA 2RGAA 3PDCA 3QEKA 5LL6P 4OPMA 3ELUA 1WBBA 1BDIA 5A4JA 2HV9A 4MV1A 5JNVA 2HF8A 2ZTHA 1K7CA 1XVLA 2C1ZA 2BT4A 3E1SA 5EFZA 1K7FB 1LD3A 2GAIA 5DYWA 3CG0A 3WMWA 3CZ9A 2JKVA 3K0CC 3NKLA 5A3RA 3PICA 2OKGA 1TLFA 3L8HA 4CF4A 2JAHA 2PLNA 1FB5A 2W9XA 1KU0A 3ER9A 3DFIA 3CZRA 1KAEA 2ZDHA 2QTCA 3QEAZ 1IY2A 3IQGX 3NU1A 4RNCA 4C2BA 3G9ZA 2PO5A 4XRGA 4JUCA 4IM7A 1Z36A 4G4SO 1W88B 2CSUA 1MC5A 2Q29A 3F5MA 4PFSA 4KN8A 4R7GA 3TTWA 1WIWA 2N3ZA 5JD5A 4K03A 3WI7A 3ROQA 1EVZA 4TRNA 5FO1A 3ZJTA 4E08A 5FP0A 3WJ7A 1FDRA 4ZZ3A 3HYLA 1B0UA 2VJLA 5H16A 1T1EA 5CYFA 3U4DA 3N2YA 4PLYA 1CF9A 3MPUA 3G0HA 4JFRA 1OA0A 3UYKA 2ZUSA 5AJHA 4ZGGA 1ORHA 1ZRNA 3JATB 2D1FA 3DEHA 2RKWA 3EBOA 1UEJA 1UPUA 3C5HA 4FI3F 5E9JA 3NDJA 5DWVA 1MQSA 1P61B 3FGZA 1A8SA 3H0EA 1UDRA 4DIOA 3SYRA 3T3OA 3N6XA 1Q77A 1P1HA 2WQ7A 3GD5A 1PWYE 2P5TB 4LS3A 4REMA 2JPDA 4C0BA 1KVUA 2Z3WA 3OQPA 4A2QA 2AFIA 2FPMA 1ZM9A 3OCWA 1DC5A 4MWEA 2M6LA 3S1AB 4BVBA 5EJ8A 2KI5A 5EPOA 3ZWWA 4UXJA 1R8YA 3LT5A 1FTSA 3QE3A 4G9EA 4NU8X 1KJ8A 1A27A 2A0YA 4CL3A 1MJGA 2PZEA 2ZB7A 2CLFB 4RD1A 1Y37A 3S27A 3VSAA 4C14A 3HV0A 5EUBA 5EL0A 3SYTA 1FVHA 5A5FA 1XA3A 3HVKA 3L40A 4CKBB 1WVIA 3I2GA 4G1MB 1Y4ZA 5ADUS 4UEOA 3KVOA 2IGBA 2OWEA 3GELA 2NT4A 3PRJA 1DRUA 5CURA 2P2DA 5L3QB 4B0PA 1H8HD 4Y2RA 3PK0A 5CA0A 3OPYA 4WK4B 1ADYA 3VYWA 5IAAA 6AT1A 1BE1A 3CUEF 3I72A 4ZMBA 2WNIA 4UATA 2WLTA 4XTCS 2NSJA 3C39A 1V48A 3TJZA 1N5OX 1KI6B 3IAHA 1HQCA 3CUKA 3ROEA 3TQCA 3ZHBA 4ZK2A 2G77B 3U60B 2GRJA 3ANMA 1DOZA 5BUZA 2CLDX 4C7BA 2CDNA 3HR4A 2JZOA 3WYEA 2DU8A 4WDQA 1XEXB 3ACBA 3NIWA 3U7IA 2XVMA 2C5LA 1ZIOA 1TKAA 2JGEA 2H4YA 4UDYX 3ZV4A 2VS1A 5AIBA 4O29A 2K6GA 3SKYA 1PQPA 1V9SA 1FSPA 3DEYX 3TR6A 1X0XA 2JFGA 2SBTA 3BD8A 2C98A 4B35A 3WGJA 4AI6A 1EP9A 4U2DA 2H65A 2BGGA 1OT3A 3HU1A 5BT9A 5JJLA 4D43A 4Z0HO 3ZEAA 3LSYA 3CF6R 4D3XA 3W2FA 1TXGA 1OT5A 2E21A 5E3JA 3RUHA 1SC3A 2BEWB 2C2HA 4FP9A 2ISSD 4MW6A 1PSDA 1VPLA 2ZJ3A 4X60A 3R5KA 5T4HA 3I9FA 1ABBA 3TG2A 5HFJA 2WM9B 1TUEA 2BD0A 1DQYA 5EHIA 4MLPA 4BL5A 1KI7A 3KOMA 1YDWA 2AD5A 5L7YA 4BGUA 1GAXA 4DCTA 3QSGA 3HA3A 2BE9A 3OP1A 3SFTA 5BWBA 2E37A 1GNPA 3JWGA 1V1RB 2OBLA 1X8XA 1Z0DA 3GNQA 1BMFD 1M8GA 4HTAA 2OYCA 1FSGA 1TTHA 3G1TA 3GYBA 3PHGA 3NBMA 4HX2A 4MSUA 2Y6VA 2DUWA 4F9EA 3EGDB 4JNCA 5T6BA 4UEWA 2QXTA 3TW4A 4WZAA 1JG1A 3NC0C 4WK0B 2HTEA 3RU7A 5KSOA 3V8VA 4BN4A 4YIHA 4C21A 1E63A 4D9JA 2DFNA 4YXWD 5KNLA 3AIOA 3ZHOA 1ZSYA 3CNLA 1EVYA 1IN7A 1P77A 4RSGA 1I7QB 2P91A 3G2KA 3NKFA 2E1RA 4JU9A 2P9EA 2EG5A 2P5YA 2P9QA 2B7CA 4R83A 4AVYA 5F7XA 1XI2A 3I0MA 3ZE7A 2NVBA 5I45A 4JJ4A 2FH5B 3RIXA 1E3MA 3RRMA 3M5CA 1W36C 5EE1A 2H7YA 2ARKA 1ZN7A 1U4SA 1N8KA 3D6VA 1WTCA 3M6FA 3PJFA 4FW8A 4XR4A 1DKLA 1MR3F 3C1UA 2Z5GA 3OPNA 4NMXB 1PX0A 2ZUVA 2VF2A 3E9DA 3DV0B 1WULS 2XQIA 1XUOA 2CWWA 3DYBA 1K97A 2NVOA 3ZYCA 4CTNA 3A6JA 3JQ8B 2XNHA 4DSUA 2Q4OA 3FWYA 5HSGA 3QU7A 3SI7A 3LGXA 2OZLB 4I3FA 3RI3A 3HUFA 2ZYGA 3I0NA 3I42A 3ROGA 4E0BA 5BV0A 2ZRIA 4ZA2A 3ZV3A 4PXAA 3PQDA 4KFTA 4YROA 4N48A 2DFLA 2IHUA 2WVHA 1WVGA 1PL6A 1RKBA 1TJ4A 3WLSA 3SFZA 1DAKA 5BOSB 1YFZA 1W8DA 2BMEA 2O06A 5EXSA 1QBKC 5BQ5A 3HSSA 1XU4A 2O8CA 1CG6A 4UNQA 2IOQA 1EJ6A 1V1JA 4MW5A 4DR6B 4HVCA 1DQZA 1E2LA 1IZ9A 1FDOA 1HF3A 2APJA 4CL0A 3FOFC 1JZTA 4NYJR 1OIXA 1WEKA 4RBNA 3RSCA 3ZWPA 3ONDA 2HU8A 5TDHA 4ENWA 5BWMA 2ODWA 1GVHA 1SHTX 2AG1A 1IWOA 4G56A 2XZTA 3CV3A 4OL0A 3SDZA 5JWRA 3DE0X 4IBOA 3MUOA 4FYXA 5JJ5A 1J2RA 1ONBA 1HH4A 3C6MA 4PQYA 2B4TO 2EARA 4I5EA 3E22B 1LBQA 3HZZA 4NY1A 2FUG6 4X84A 3TINA 5DNWA 4N3GA 2QVGA 4XGRA 2ZVPX 5BWOA 3E27A 1JECA 2YV1A 4EVSA 3LP6A 4ZAWA 1XKXA 4Q1EA 2BGWA 1J8VA 4F6RB 3OHSX 2QORA 3QVGB 4BRUA 4CFZA 3O75A 4RULA 3NONA 4M0KA 1ADJA 1UFVA 5A4FS 3KKQA 3EX7C 1V4VA 2CJYA 821PA 1IJFA 5EZ6B 1U9JA 3I5UA 4RFSA 3HWSA 2B99A 3OEHA 4PFQA 4F4JA 3FYCA 4F9FA 1QCDA 4JR2A 4OQNA 4X7MA 3U4HA 1Z0SA 3NOVA 3DHYA 2CBGA 2NPOA 3WTCA 5TPZA 5FOUA 3MJFA 2G4LA 3VDRA 1PJCA 4YCMA 3MJDA 1PG5A 4UD2A 3HLTA 4I1SA 1MA0A 4ITVA 4MDEA 1PU2A 1XFDA 2KS6A 1FJHA 2Y99A 1NNI1 1U99A 2DTDA 2DM6A 2J4DA 3ECSA 1LF0A 2Y2VA 1DT5A 2FFJA 4MVJF 3X44A 1FFSA 3BHIA 4PRLA 2QSUA 1SCNE 2RHDA 4L85A 5M29A 3BS4A 1I1QB 1U2TA 2MYPA 2F3RA 3ZD9A 3NM6B 2E18A 1PZHA 1XTUA 3LPCA 1SKYE 5J2UB 3CONA 3OIDA 4HVLA 2FG7C 2WI8A 1JSXA 3PEYA 2WSYB 5CLJA 3F97A 2GN0A 2WMYA 3GP5A 2ZXFA 3OFKA 1W9HA 4RAOA 1CY6A 7MDHA 2QZJA 4M0CA 2TYSB 5ESXA 3SIRA 1Z2CA 3COPA 1KMQA 4QBIA 5GPBA 2RIRA 1N5JA 3B8HA 4X63A 1KYWA 4TKVB 1NXTA 1XZBA 1T2AA 1QM5A 1XLTA 3T0GA 1NOJA 1W4ZA 3D9QX 1E96A 3ORHA 1QE3A 2R65A 4HN9A 3UANA 4XWWA 5KYWB 1R15A 3RU3A 4B6EA 2H1IA 3E03A 4G97A 1WSBA 1T9KA 1U2EA 2QN9A 2VCHA 3BJRA 1WNTA 2OLKA 1XG5A 3CZ5A 4HO1X 4MCHA 2ECQA 1QR2A 1Z73A 3Q5EA 5BSMA 3UB4A 4BLSA 1U2GC 3N28A 2VPYA 4GZ6A 3BQNB 1DUSA 3KQNA 2BGRA 3X1XA 1F60A 2J41A 2B2NA 4QDKA 1FXUA 3OQBA 4R2HA 2OR3A 2Z9BA 3BPSA 4W63A 5D87A 5KSYA 4M7PA 4CEHA 4JB8A 4LE2A 1NXPA 4OP2A 5FORA 5A4DA 2HIGA 2WZDA 3NOXA 3ZXXA 5KSWB 3ND6A 5KX5B 4Y9DA 4AZ0B 4Q7MB 4R84A 2C78A 4B8ZA 2H7XA 4HMQA 4E4RA 4HNGA 4BHTA 3SKVA 1NKTA 1VJCA 2CEKA 4OMUA 1D2RA 4IVQA 3HADA 1KZYC 3IE1A 1NU6A 1DPGA 4OXQA 1V3VA 1X1BA 4Y2YA 3EZ9A 3G2PA 3W5CA 2XQGA 3M34A 2AQ8A 3I58A 4GPIB 5EP1A 4NOKA 1W25A 5HJ5A 5EE5B 2PMWB 2YN4A 4PYQA 2X3FA 4YECA 3G3EA 3TLKA 4WV3A 2PZMA 2L69A 3D8BA 1X92A 2O3QA 3NBZC 3ZQUA 2E4AA 3ZH9B 1KDZA 3V33A 4EYQA 1N6OA 1Y9ZA 1KYYA 1ZSNA 2FZWA 2LIVA 1BHSA 5C81A 3ADPA 2BHLA 4ZJPA 4FK8A 2JGFA 1HA3A 1L5WA 1SK9A 2VA9A 3JZFA 4E22A 1KMHB 2AHRA 1RM5A 4AJNA 5H59A 1TDJA 1EA5A 4H4DA 5EJEA 5FLKA 2NXNA 4PAOA 1GPWB 1LEHA 4BVJA 2H08A 4MS4B 3URMA 1P0PA 2O0KA 4OYRA 4YJ3B 3R44A 2M98A 1BDHA 2TMKA 5FDFA 4I6GA 1QFJA 3NFYA 4KBFA 3RVMA 3WV5A 2P65A 3Q8WA 2O8BA 3V1UA 1DQPA 1CE8A 3BFKA 1OVGA 2VT6A 4MWSA 4CMEC 4D79A 4EABA 3E61A 3GLSA 4NABA 1U8YA 3FWZA 4JLVA 1AXRA 1IDOA 2AFVA 2J0EA 5ETJA 2OQ2A 2YVKA 2Q3MA 3NORA 5BY2A 5ELXA 3CR3C 5HQ3B 4X65B 3GLGA 4BMCA 3HN6A 1YBFA 3ORFA 3QNMA 1ZH2A 2GD2A 1H42A 3IQXA 3P7MA 4B81A 3EIOA 5IK2D 1GL9B 1I3NA 2EV9A 4R1OA 3DDCA 4IP0A 3MFQA 3HCCA 4IWYA 2QBYA 1ENYA 1N0WA 3HKBA 1D2CA 3JWHA 1OAOC 3CWQA 3STHA 4A10A 5E6SB 4Q4DA 4L50A 4ZK6A 3CUVA 3QYPA 1B8PA 4X7BA 2IRWA 1R9NA 1WUKS 3NBAA 4RPJA 2Z30A 3TKLA 4EA8A 2ESRA 5D86A 2I0FA 4FMBB 1R6TA 2HSJA 3O84A 4MS1A 4S24A 4PNEA 1ZN9A 3EZ7A 4TV8F 3ZWKA 1UBGA 3IODA 3P9KA 1ETHA 3PEVA 4N3NA 2HX1A 3GPBA 2GSWA 1MX3A 1EK6A 2JEYA 2YUIA 3IT0A 3IO5A 1KEEB 4KTVE 2P2LA 5LIRA 4DIBA 3RNOA 3HY4A 4EENA 1SKUA 4KKVA 2CGEA 2GDJA 4JVSB 2WJHA 4KXLA 3VYSB 2XB4A 1HTBA 2F8MA 4MVJE 1W9MA 2XCSB 4M1SA 1K4MA 3F46A 2X9QA 1O4WA 4OJNA 2OYSA 1ABFA 2R6R1 3LBYA 1ZXBA 3RS5A 2PXHA 4YP0A 5AJXA 4EPRA 3BDIA 3DEJA 1D2HA 2Y0EA 1X74A 1M7GA 2CV1A 2WAXA 1ES9A 1V7CA 3CSUA 2BR4A 4BTVA 4QFDA 2DYKA 4TSFD 4UBJA 4CU2A 2NO0A 2FEWB 1UC4B 4OKNA 4OYYA 2MSDB 4EECA 1CZNA 3HFRA 4IH1A 3QEJA 3HB0A 1JFRA 5AHKA 2XGJA 3M8KA 4ATNA 1RZRD 3PX7A 4M55A 2GAAA 4UHJA 2W6MA 4YT8A 1X6VA 3O26A 1X80A 2J6IA 3NEPX 1YI1A 2GERA 3F47A 5LKRA 2QUKA 1RP7A 4Q3DA 1RYNA 2AIRA 4KREA 4EGAA 4NBTA 3C14C 1PT6A 3P5BA 1JHMA 3W6NA 2WM8A 3B12A 3ZQKA 1MJFA 3OJEA 5DSZA 4PRYA 1U5BA 2Q3JA 2V54A 4ZAFA 1LDYA 3OZCA 4I08A 5KQGA 3B6ZA 4RKEA 4J0QA 3TECE 4HS4A 4L5YA 2XUPA 3V1KA 2BFMA 4ZDJA 1F8UA 4ZXPA 3RPEA 2OHXA 3IUYA 4CCWA 5CEEA 3IP3A 3KQMA 1QFXA 2VYND 1STOA 1SCJA 3D5TA 3R4CA 4IIUA 2G9NA 4B09A 2FW7A 3E4DA 3RVOA 1QNFA 2HC9A 2VHWA 5TPZD 4EF5A 3QSYA 4Y2SA 3UB3A 3K0AB 3I4CA 4Z99A 4LVOA 2A88A 3CCCA 3PHIA 5K3FA 2HUPA 4NZPA 4Q66C 4GR4A 4AKSA 3WQSB 1D4OA 3C3DA 3CRQA 1BHO1 2VUSA 3DMGA 1T34A 3EMDA 4KWEA 3DMPA 3VVBA 5BNWA 2ZM5A 4P7FA 2FEKA 4WJLA 4MITA 3WYFA 1N3YA 4YN3A 4LVNA 1FIUA 4BP1A 2VZEA 3H9BA 4GVPA 5HQJA 4JT8A 2IS4A 4R2MA 1F38A 2I6TA 2X22A 2R5NA 1VSVA 3KWMA 4URWR 1E3WB 1M2NA 2GPBA 1UKYA 1OQAA 1ZM4A 3RTEA 4QPZA 4YRSA 5GAJA 1SKAA 4BNJA 4QLAA 4CEJB 2Z5FA 1K7YA 2Y1FA 2Y6UA 3C8HA 1IWBB 4EKNB 1BFDA 1B2RA 1JHVA 1HLDA 3OIVA 5A9TA 3WLHA 1QP7A 3F8TA 4FCTA 3QKSB 1E60A 2QLLA 4MJLA 1SIOA 3GLUA 4PW0A 3ZW7A 2IXBA 4OXRA 3TRIA 3HU5A 5FOWA 1CB0A 4JXJA 3AUJB 3F6YA 2EFGA 5DN9A 2FX3A 2RHTA 4C0WA 2HJGA 1TTTA 1MTOA 2HA3A 2O8VA 5CXXA 5AK0A 3T3NA 1FU8A 2H4ZA 4LGVA 1FFAA 4JV5B 3HYSA 4XQ0A 2SNIE 5A1JA 2ZCVA 5EWLB 5AM1A 2HWKA 3LY5A 1JQ3A 4CGZA 2HPAA 5EMHA 4RABA 5EVCA 1E77A 3V4PB 3RSFA 4RK5A 3TLGB 4NESA 2CDBA 3OLVA 2AG8A 1H5QA 1EJ0A 4QYIB 4W4TA 4D4HA 2HNKA 3AI3A 2P75A 4B80A 4TVBA 4V2IA 4R9RA 1L6RA 1A9XB 1XJ5A 1VRCA 2EIHA 5FNZA 5TLSA 1ZR4A 1YTUA 4CLRA 1P2TA 2ZQYA 1DJLA 3IVXA 3ER8A 4HNQA 5DN6D 1Z68A 4NZMA 3THRA 5DE3A 2W83A 2Q5FA 2O52A 4MJXA 5CDSA 2O8FB 3KXLA 3MGBA 5AVKA 4ZRNA 4LFBB 1DV2A 1XHFA 2VL7A 4TKUB 2EU8A 3GJ6A 1D03A 4I8DA 4V1CI 2P9YA 2WHRA 3G9UA 2B34A 5J5CA 3HYNA 1C3OB 1XCPA 1X1DA 1ORTA 2XECA 4Z1MD 5KTPA 1KEUA 1N9GA 3N86A 2M1ZA 3VPAA 2F90A 3COJA 5CU7A 2ZR0A 2R84A 3HDVA 3PDUA 5L45A 3JTMA 5DTIA 3FNHA 5KB3A 1VHJA 2FEPA 3CLHA 3VX3A 2EEPA 1JSCA 2P4SA 3L2OB 2NUTA 4UVEA 1LQTA 1Q14A 4BP9A 4PG8A 2ZAIA 2F3QA 2A5FA 1DDIA 2NZYA 2ZQZA 4HZGA 5BSRA 4UDNA 4AQ7A 4FKMA 5ICFA 4CRWB 1RADA 1MUUA 2CUKA 2BFBB 2JIBA 3HJRA 2M1XA 3P9ZA 3ROZA 5AYVA 3TZBA 4B6QA 1SOUA 4MGIR 4PM4A 5T57A 3JRNA 5JROA 3BJZA 5IT9A 1Z35A 4PU0A 1IUKA 1IB6A 2CCKA 4ZVMA 3H9QA 4MCJA 3GEMA 2ZBQA 4AJ4A 3RHFA 1WZNA 4FB5A 2CWDA 2JEZA 3LV8A 3A9UA 3RSHA 2XLBA 2ZRLA 4BIMA 5IJ9A 3QELB 4BMOB 3MCTA 4C30A 2XMSA 3DUFB 4QXMA 3UMYA 3ZGVA 3SR3A 4URVR 2R62A 1RM4A 1Z34A 4G1FA 4II2A 1NP7A 2P11A 2ZBGA 4BWGA 4DVGA 2RHRA 4DZTA 2Y1CA 3SCZA 4D0NA 3FTEA 4ND8A 2Y1KA 2HLHA 1E1NA 3WR5A 3T9CA 5AHOA 2QQ0A 1RHJA 1NN0A 4DM7A 2FRXA 3BWBA 3IHWA 3MWGA 3OCYA 4LXHA 4M36A 1EFPB 2CJPA 4Z4HA 2G0NA 4OX9B 1PGJA 4JOSA 3N2EA 5AO9A 2AQIA 3C8MA 1OROA 3I12A 3HXTA 3EGEA 3GQBA 3N7UA 3ABSB 4M22A 3WL8A 5LQKA 4R1PA 4S1WA 2HGSA 1DOHA 1DG9A 2JAWA 2Q1XA 4QSHA 2XV1A 3JQDA 3SF0A 4CKXA 2F55A 4N7BA 4OATA 1VP3A 3RC7A 4CMJA 1M1YA 4BFTA 3PIRA 1WXHA 2DULA 3WWOA 4INPA 2W2VA 2DWPA 3C1OA 4KLAA 3VU9B 3CJTA 1USGA 2GVDC 4P84A 2YQZA 4DT1B 4U9IS 1SY7A 2HZ7A 2AG6A 1NGSA 2WVAA 4JQYA 3HVHA 3MOIA 4FYIA 4NPAA 4NNJA 4C88A 4CM8B 4RTKA 2JJ2A 3MD9A 2X9NA 1QQ6A 1OV6A 3CR8A 1G20E 1UAYA 2CNLA 2WJ6A 2C2GA 4H4EA 1GPMA 6PFKA 3DOUA 4IKEA 3A6EA 5HCIA 3KZKA 1XCJA 5DSTA 2FEOA 5AUQA 3IOCA 4MVXA 1JH8A 2QTRA 2BZSA 1MOQA 1JI0A 2WYIA 3KEOA 1QONA 4YAWA 4KRGA 4WFIA 3WAGA 3EY4A 4FOTA 1M6YA 3BD6A 3O93A 1FYFA 4JVMA 1FFHA 4CBVA 1C4KA 3RRZA 1XRSB 4BNHA 1HNWB 1ARZA 1GUDA 2ZS8A 4JP8A 3X2FA 1P72A 5LLTA 5KAPA 3PRYA 2WQ6A 4KBGA 3EGIA 1AH2A 2IWHA 1S1CA 2WWHA 1UBMS 3DTYA 2OG2A 2ZRPA 2CVZA 1Y80A 1M83A 4Q9HA 2XXAA 1WVMA 3W2GA 1XNHA 1YVEI 2A67A 4H0CA 2OCBA 3WWDA 2FDCA 1K06A 3AYZB 3ET5A 3RSGA 3F6RA 3DB1A 2NUAA 1CJVC 2NSYA 3VMFA 2IS6A 1ZK4A 1NFQA 4IUYA 2ZB3A 2IX3A 4EY5A 4P4LA 1DC7A 5FAKA 1K3UB 2C5SA 3WGIA 1M6VA 3STYA 4EB8A 2PSHA 3IP9A 2JIPA 3CX8A 2BDTA 1AQYA 3ANLA 4OHXA 3DL2A 3WKDA 3PC8C 3VYTB 2YV5A 3FWNA 4MR8B 2RAFA 2PMKA 2V7QA 2PRYA 1BVYF 1JALA 3BBLA 4POOA 2K7FA 2WG2A 1W1IA 2ZJAA 4RJKA 5L3VA 3IPCA 1WW2A 3WP0A 4YAOA 2YIVX 1ZWLA 1KIFA 2HBYA 2HSDA 2JD1A 3MGKA 2EBUA 3NDIA 3NEJA 4LSMA 1Z0JA 5LYJA 3ZV7A 3ITKA 4BNZA 4BNTA 3KZVA 3PNVA 2I7VA 1QP8A 4Y7CA 2HWWA 3N2IA 1Q20A 1SPBS 2VHXA 3H2YA 3BL8A 2XF2A 3MRXA 3PPWA 4IIJA 1Q3TA 4KYIB 4S0XA 5CUQA 1K2VN 2ONKA 3RD5A 1BCSA 5ICGA 1O95C 2WSBA 3FLAA 4M0FA 2HREA 1HQYE 1UXKA 2ENUA 3IV9A 4IOLA 2R4UA 2VDKB 1XO1A 4KV7A 3K71B 4F91B 3BJEA 2QRGA 1SCKA 4ZAGA 2P0AA 1J42A 3ND8A 2PMBA 2WJWA 1XB2A 3FCOA 2WFZA 4XX0B 1N7JA 3MJRA 4DSOA 3VVMA 5HOQA 1IFXA 1T2DA 3BYZA 4RESA 2IHYA 2R8XA 4DADA 2AKEA 2G9ZA 4PPYA 2OV2A 3ZE9A 2VQSA 2Q28A 2X41A 3MZ0A 1L5KA 3W5HA 5H7XA 5BURA 5CFRA 1RRVA 2HT6A 2IYQA 4F5WA 2IOFK 3ZWDA 2ODAA 2CV0A 1F1BA 2CBXA 2VO1A 4E21A 5FUXA 2C4VA 3SDSA 4B40A 1Y4SA 3KYBA 5B64A 1LPNA 1XMXA 4BAGA 1TL7C 1XVTA 4IOJA 4PC3A 4P0PB 4DNQA 3O5AA 4J4BA 3L5KA 1AF4A 2C5HA 2GCGA 4A16A 3VPHA 2J6HA 3KJXA 4N8DA 1ZFNA 2ZANA 4LDPA 3UPUA 4N4AA 2NZUG 1KY5A 3FDFA 4FMDF 1LS6A 1Z2DA 3GT7A 1JMYA 1OAAA 4K7JA 1UMCA 4YRDA 1HZJA 3HUTA 3OQ6A 3T52A 3P0RA 3WHLA 1V7QA 4A73A 3O8CA 1NQTA 3KOUA 3AJ9A 5KHLB 1Z83A 1I6WA 1ZJ5A 4UNSA 1WP9A 1KJIA 4OBWA 4CLEA 1GZUA 5LB2A 1W52X 3O7MA 4P38A 5DTMA 3HVRA 1WZ2A 5AKIA 5KWVA 1O6BA 1VSUA 1YZGA 1YACA 5C1PA 2ZJ8A 2Y2UA 5EMLA 1T25A 4K6KA 5J5VA 2O4CA 4LGMA 3O21A 3D8SA 3M4ZA 3FSEA 4TPKA 3UCFA 3R41A 1LPMA 3JQBA 3FKQA 2DBYA 1Z4OA 1TAGA 2RMKA 1GQ2A 1QIFA 3T0FA 5DGIA 2WICA 1DAOA 4DY4A 1Z63A 3EDCA 4ZVSA 4QYXA 3I5YA 9ABPA 1OBVA 1X87A 3BMQA 1E7RA 4TN5A 4P3KA 4E94A 4ZOQI 1AD2A 3BFVA 3QF7A 1JEDA 1Q7EA 1U1EA 4KG7A 1PYDA 2V58A 1QYVA 4JS0A 5DWDA 1E2UA 1Y4DE 3AY7A 2OPHA 4J0CA 1I30A 4RW0A 4H7IA 2JFYA 3WGZA 1KRXA 5LP6C 4Y9SA 4C05A 1JFLA 5HKBA 3LMKA 2EFEB 2VI5A 2A7QA 3U13A 4P6VF 3DE7X 4OUDB 3U7RA 3VVCA 2QT1A 4B31A 1GQFA 1NJ8A 1N1EA 2PA3A 3IBSA 4MJ7A 4W5WA 5JQWA 1PD0A 1ZBDA 3EG5A 2FFRA 3AJEA 4AXBA 2JLUA 3QP9A 1A50B 4IZIA 5JS7A 5LOVB 5K01A 4EG3A 3ZJUA 4I6EA 1RJ9A 5EIEA 4Q48A 1A1VA 4ED9A 1F9EA 3BCSA 3EZLA 3PVSA 3UZUA 4PYNA 1AUOA 1XVVA 1AHHA 2WVJA 1L5ZA 2E4XA 5CJJA 4QGGA 3H7AA 2FF7A 1NJSA 3D0QA 4H7PA 4JQSA 5DHRA 1G17A 4DRYA 1C80A 1II8B 3IB6A 4FHCA 2ZJOA 2P6OA 4HQOA 3OCCA 4ZV4A 5BSWA 2H17A 1CJCA 5ED4A 4ABTA 1UOPA 1EUCA 1VQ1A 2Z83A 5DW0A 1QSGA 4BNGA 1G3QA 2F59A 3QLVA 4AJIA 4X00A 3W06A 5I7VA 1DRKA 2QVYX 3AJDA 2WMDA 2AX3A 3NIBA 1KA9H 4EARA 3A04A 2F4VB 4NCIA 3PA6A 1J0DA 2YASA 1E3TA 3ZGYA 3KVYA 1I13A 1A8PA 3AHCA 4FNMA 4WY5A 4AW9A 1IBRA 4EW6A 4GI2A 4D0LB 4NZYA 3ILYA 3TYXA 4FT2A 1RRGA 4OH7A 1W1WA 2Q6LA 1UWKA 3F0TA 3I34X 4DABA 5KQPA 5YASA 3VZBA 2VHUA 4MV4A 1ITZA 1YKSA 1PGNA 2FMKA 4AP6A 4Z49A 1NI4A 4MH0R 1SU4A 4JIMA 4U3JA 4EQ6A 3EGXB 2ATVA 2E9SA 1M2EA 2Q4TA 1L3CA 3IEPA 3R5SA 2BFFA 4JP5A 3QUTA 2XGOA 4MW4A 3UUFA 4ZHQF 2O7RA 2W71A 1C4XA 1N6NA 4CVNA 4CIYA 3IJ5A 5CBKA 4G23A 1B8NA 5J4HA 3I09A 1I3KA 2Q5QA 3WIBA 3DZBA 2AV6A 1PZMA 5DHQA 5BPFA 1C0EA 2BY4A 3O2QB 4JYBA 3DAPA 5BN4B 4DA0A 2FW9A 1ESNA 4HDSA 5A6SA 2R4TA 2BSAA 2ZAGA 4PIVA 2GPTA 1RWOA 1AG9A 3P2IA 2Q9CA 2XWSA 1TUGA 2CDAA 3P4YA 1ODCA 2QUAA 1ZLYA 3HL0A 4L9RA 4WXHA 3ZWBA 2TMGA 4ZZ1A 2XEXA 4MKIA 1NXWA 3NWBA 3G8DA 3MWDB 1B0PA 1NLFA 3F5SA 4LVCA 2X42A 2H52A 4KJXA 2WB4A 3ZIAD 4D80A 2BPOA 4XR9A 1PEAA 2VDNB 5EJ2A 3ERCA 3KJQA 1L5YA 3SS8A 2CLCX 4M8NE 3R76A 1JX6A 3IUEA 2IELA 3HVUA 1YAJA 3QEBZ 4ASUA 1U9ZA 2GB4A 4HWGA 4BE7B 4DNFA 4RD0A 1Y81A 4ZI2A 4M9CA 1G3UA 4EPTA 5KTOA 3CNHA 1EZZA 4Q82A 1RABA 3FUUA 5ALMA 4M60A 3PQ4A 3V00A 2QR2A 3EVAA 3ZGLA 4EW2A 1DMSA 2DLNA 4E51A 3PEFA 3P2YA 4UVIA 3OZVA 1ZGGA 2XI4A 1TMOA 2ORWA 3WOVA 2AMJA 2LDBA 2ZZMA 4EGJA 1CQIA 2QIOA 1Y33E 4RJTA 1X38A 2H18A 1V2GA 4D4LA 5DNEA 5KUTA 2UZIR 3LC1O 3AR8A 4PWZA 4HNUA 1EK0A 2LKDA 3L01A 3ZY3A 3JCZA 1MGPA 1IE3A 2WJVA 2EW1A 3DZIA 3HCOA 3PGKA 4L6CA 5KQSA 7AT1A 2ON6A 4C6SA 4NCAA 1I6LA 4DSTA 3LVQE 2YRXA 4UVGA 2Z0MA 3GCXA 2QE7A 1F06A 1ZUNA 2A6PA 4JT4A 4YIKA 5FNVB 4ZT3A 5IVDA 4YRZA 5C5EA 3DO5A 3H5AA 3GLHA 2VAWA 1SHZA 3IUPA 4M1QA 2H0QA 2MWMA 4K1LA 2JGDA 4IOKA 4B4KA 3R3JA 2A8YA 3JQAB 4LE0A 4Y98A 2AB0A 1GT6A 4RIEA 5CFPA 1XZFA 2HSEA 1YCGA 1IQRA 1JJ7A 2EX0A 4W9RA 2F3PA 3RIEA 4DQUA 1ZVVA 2MYUA 3T99A 3CVUA 1AB5A 3R5XA 4HZIA 3I9V6 4YVFA 1FRFS 4Z4QA 1QH9A 1XKTA 3FN4A 4MUFA 2QE6A 4RPGA 3SHWA 5LQDA 4G0OA 1P8JA 4DV7B 1LNSA 4PICA 1J49A 3AWIA 4WWHA 1YL7A 1G5TA 4Q18A 3C41J 1JHYA 4LBVA 2GBGA 3RVPA 2XCIA 1U28C 1BYUA 2A9JA 1B14A 1G7RA 2JZNA 2V7WA 3FCAA 1EE2A 3LZCA 4P83A 3RRNA 1NU8A 4TWZA 1Y1SA 4UFNA 1SUEA 2I03A 1GTRA 5JPCA 2J5BA 3SBXA 4Q3AA 4XB6B 3PGA1 1ZESA 1J7JA 3MXOA 3OPQA 3PCTA 3DBHB 4XQEA 3ZX5A 2NUBA 2KHZA 3A7DA 4CLOA 3I5AA 4B3FX 2Y93A 4BEVA 4TVKA 1KF0A 4M6WA 3GBVA 4HLUC 4XARA 5D5PA 1FTGA 3VU0A 5A02A 3T1TA