4DIUA

Crystal structure of engineered protein. northeast structural genomics consortium target or94
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
245
structure length
245
Chain Sequence
IVPPKPFFFEAGERAVLLLHGFTGNSADVRMLGRFLESKGYTCHAPIYSGHGVPPEALTRFGPEAWWQDVMNGYEFLKNKGYEKIAVAGLSLGGVFSLKLGYTVPIEGIVTMCAPMYIKSEETMYEGVLEYAREYKKREGKSEEQIEQEMEKFKQTPMLTLKALQELIADVRDHLDLIYAPTFVVQARHDEMINPDSANIIYNEIESPVKQIKWYEQSGHVITLDQEKDQLHEDIYAFLESLDWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Engineered Protein PF00326
publication title Crystal Structure of Engineered Protein. Northeast Structural Genomics Consortium Target OR94
rcsb
source organism Synthetic construct
total genus 94
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2012-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4diuA00
4L72A 5HF9A 1M33A 1EK2A 5HF6A 2VJDA 3DYIA 4ARAA 2PSJA 1EB9A 5EHZA 4G5XA 4UHFA 1E8DA 5CH8A 1FFAA 1LPPA 3OPMA 3E0XA 5AICA 4C4ZA 3WK4A 4KR0A 4ZXFA 3FLEA 5BWBA 4J03A 3R3XA 4Y2TA 1CUXA 4N5HX 4MYSA 2DSNA 1YAJA 5F4ZA 5HF5A 1SFRA 2QJRA 4PO3X 5A6VA 5I9IA 1EDEA 2VJAA 5CBKA 4K6KA 4WDRA 1WPXA 2GYWA 4G1FA 4AZ3A 4Q34A 5K3DA 1NU8A 5HFAA 4C01A 1YS2X 4M0MA 5T4HA 3LLCA 4F5ZA 1UKCA 2GBFA 1ORWA 4MWTA 1CUCA 3L1IA 3CCCA 1E3QA 2BGRA 3WL8A 2NW6A 2YXPX 1YB6A 3S8YA 2WU3A 1K4YA 2W6CX 1ZD2P 1B41A 1QJ4A 3IUJA 1MAAA 4UFOA 4QDOA 4CIBA 2QRUA 4HRXA 2VQ6A 5HKAA 2H7CA 1LBSA 1R9NA 4QDXA 4J0JA 3OM8A 5J3JA 2WUFA 3M82A 4DSAA 3ZI7A 4EA6A 4LHEA 6YASA 1EVQA 2B20A 2QKYA 1ZOIA 1DT5A 1E8NA 2PSDA 3D2BA 4S0XA 4AQDA 4DMKA 7YASA 4FLEA 1BRTA 3Q8WA 4BE9A 1UK9A 1QTRA 1UXOA 3EF3A 3C87A 4U2EA 4WFKA 2OLEA 1QFSA 5FPQA 4OU4A 4E15A 3BF7A 2BUCA 1EI9A 1HKHA 3VVLA 1VKHA 2ZYIA 5AKHA 3U1TA 1UT6A 4FKBA 1UK7A 5CH5A 1VLQA 1UOOA 2J3QA 2XQIA 4C88A 2RAUA 1LPBB 2XLCA 2Y6VA 1W4LA 2WHPB 4U2CA 4MQLA 3AZOA 5EIAA 2PM8A 4BAZA 1GGVA 4Y2UA 5YASA 2ZJFA 3WJ2A 4W1SA 5ALSA 2ZVDA 3KWFA 1CQZA 4ITVA 4QLOA 3D0KA 3S2ZA 3WYDA 3H2KA 4BCDA 1H22A 1BS9A 2J3DA 1CFJA 1O6FA 5HF8A 1J2EA 2DFPA 2ZSIA 4LYDA 4LXHA 2HA7A 1L7QA 4U2BA 2PSFA 2XMRA 2XUPA 3PFCA 4UPDA 5EI5A 3FCYA 1P0PA 2HA0A 3IUNA 3UUFA 1CVLA 3VISA 5JZ9A 4B82A 2DR0A 2C4HA 4B0OA 4AZ0A 2W22A 1IUPA 4XWGA 1OCEA 2VAVA 2WIJA 4AN0A 5A7HA 5C81A 5IVKA 2WHPA 5JADA 5KWJA 4CG1A 1JU4A 3ZLTA 4U2DA 4BVKA 1W76A 5ALUA 1XRMA 1P0IA 2G63A 1HQDA 1MO2A 1DX4A 2AJLI 5JIBA 4GDMA 4ZGBA 2AJBA 3WKAA 1RWQA 1QOZA 4EZIA 4KYVA 4C4YA 4ZV7A 3FVTA 2XMBA 1AZWA 1EX9A 4DIUA 1MNQA 2CMFA 2P8SA 1EA5A 2OG1A 4HVTA 4N8SA 4V2IA 3R3UA 4UHCA 2J4CA 1AMNA 1XZGA 1ISPA 3LCRA 4WFJA 2XE4A 4EY4A 3A2NA 1XKTA 4FFVA 1LPAB 1S8OA 4H77A 5EIHA 4HZGA 1ZIYA 1IZ8A 2JGIA 3WK9A 2RIPA 4J7AA 3RLIA 4QWMA 4J0IA 4KAFA 5DYWA 2WQZA 3IIIA 2XUIA 2WFLB 4FNGA 4LIPD 5AOCA 3DNMA 2BCEA 4ROTA 5C8VA 3FOBA 2OGZA 3DQZA 2B9VA 1F0NA 5AI6A 4FLMA 2K2QB 3H17A 4BP9A 5DYTA 1EDDA 3HC7A 5ISMA 2WTNA 1CUJA 2GBCA 2QXUA 1K63A 3W9UA 3WK6A 1D07A 3HACA 5ALDA 3E3AA 1XZFA 3B12A 1QLWA 5FOQA 1HL7A 1ZGCA 4OPMA 2HU7A 1SCKA 3RM3A 1ACLA 1XRPA 4BVJA 1NX9A 1ZIXA 3WK7A 4GXNA 5ALFA 1Z68A 1XZDA 1ZJ4A 3M81A 3QM1A 2LIPA 3BJMA 3C45A 2ACEA 2CBGA 3ZPXA 5LZ7A 2WFLA 2PSEA 1IVYA 3FAKA 1UKBA 3B5EA 4INZA 4FBMA 1KEZA 1GKLA 3F98A 4EUSA 1VA5A 1EB8A 3K9BA 2HDWA 2IITA 3IULA 4DTCA 3RARA 4HXFB 1XRQA 1QIJA 1U65A 3STUA 5ALTA 1YCDA 1BE0A 3IUQA 2H7YA 2ONCA 2PU7A 4D9JA 2H1IA 4C4XA 1VE7A 1RP1A 5EHQA 3BIWA 5AIBA 5K5EA 5DLPA 1J06A 4BRSA 4BE4A 4AMYA 1TCBA 2FJ0A 4L9AA 4P08A 3FSGA 4M0FA 4GHWA 5ALVA 4AO6A 4H7HA 3O9MA 2OCKA 1CRLA 1U2EA 3WJ1A 4X00A 1AURA 1WB4A 3D2CA 1WPRA 2XQGA 4BATA 3NWOA 1PJAA 2V98A 1VE6A 4Y2JA 2Y2UA 2JGMA 4WY5A 3WIBA 3DL7A 1NU6A 3O95A 2YASA 1H2WA 2FX5A 4G4JA 5FV4A 4J0GA 5A62A 1TKRA 3BXPA 3KD2A 5AKLA 3WKBA 3G02A 3H2HA 4UUQA 1U4NA 3FSGD 3EQ7A 2B4KA 5AKYA 4CG2A 5CTAA 1BEEA 4H7EA 5T4FA 1THGA 2XQJA 4XVCA 1THTA 4YPVA 4KE8A 1XZEA 3C5WP 3CN7A 4DMHA 3MVEA 4OB8A 1BN6A 3WKDA 5AIAA 4HRYA 3IVMA 3DOHA 2JEYA 4K2AA 5FLKA 4NMWA 5JZSA 4Q3OA 1DX6A 1YSCA 5DJ5A 5JARA 2XMSA 5ALRA 1GQSA 3CXUA 4X93A 2WIFA 2WIKA 1MX9A 4BDSA 3MGAA 1AX9A 2VATA 3C8HA 1OILA 1QIHA 1QIMA 2HRRA 3ZWQA 4J0KA 1F8UA 4XJVA 1EHYA 5A7GA 2EDCA 1R9MA 4JYMA 5CT6A 4B80A 1CV2A 1BEZA 2OGSA 4P9NA 5DNWA 3WYNA 2XMZA 5CURA 1A7UA 2WUDA 1A88A 3BIXA 4UBLA 3VKFA 2XMQA 3RKSA 4XX1A 1CUGA 5DNVA 2XUFA 4JYPA 4IO0A 4K6HA 3WA6A 3W2TA 3AIKA 1GXSA 4H7IA 2IIVA 4EB0A 3WK8A 4J0CA 4UBMA 3STXA 1ORVA 3VJKA 1Y7IA 3NGMA 3QPCA 2FUKA 5D6OA 4B7ZA 4FFWA 1GPLA 2B61A 2OXEA 1VJ5A 1IMJA 3AZQA 1L7AA 4HTAA 5JYCA 1EINA 4LYEA 5AI9A 5LZ8A 1GT6A 5I7UA 4Q1VA 5AM1A 2Z5GA 4Y2QA 1QO9A 1XQXA 2OAGA 4M0EA 4X7BA 1JJBA 1A8QA 1XLVA 5DTIA 3TRDA 2VF2A 5IH7A 4O08A 3QMVA 4IQ4A 3WQHA 1RYYA 2HFKA 4OU5A 2EEPA 1IUNA 2ZSHA 5FDFA 1XZJA 2HFJA 2VSQA 1XQWA 1EK1A 2G5PA 2Q0XA 4C6HA 5ALPA 1ZD4A 3C70A 1W75A 2CKMA 5LZ4A 1ETHA 4TGLA 4HS9A 2Y1KA 2I3DA 4OCZA 1BROA 4GW3A 4BAUA 4Z49A 2OCIA 2FJPA 3PF8A 3C6YA 4X92A 1BN7A 5HFNA 1O6GA 2BKLA 3BE8A 3H18A 1HPLA 3G7NA 2HA5A 3FYTA 1XQVA 3TGLA 5LZ5A 2JGFA 2QTBA 4HXGA 1XZLA 2PUHA 3LIPA 1ZI6A 1DTEA 2QOEA 1YB7A 4B85A 3AJAA 5AOBA 3ICWA 1ZI9A 1PV1A 1IZ7A 4FNMA 1KU0A 4Y2SA 2QT9A 3C8DA 4KRXA 2CUTA 2O2HA 5EHXA 1XZBA 1L7RA 2DHCA 4KAJA 4MQMA 3ED1A 1MX1A 3CN9A 2ORYA 1QZ3A 1FJ2A 4U2GA 1LBTA 4AO8A 2ES4A 3WK5A 3JWEA 1TCAA 4YX9A 1X2BA 3H19A 3HI4A 2JF0A 1BCRA 3V1NA 2ROQA 3WWOA 5ALZA 3U0VA 5JALA 2XI4A 3E1GA 4KEAA 1LLFA 1QIDA 2JGLA 4ZWNA 2BUBA 1VZ2A 3HRHA 2HIHA 1WHTA 2ZYRA 3T4UA 2PSHA 4IH1A 4Q82A 1LZKA 4A23A 1QE3A 1CQWA 3C5VA 4LKOA 5SYNA 1UK6A 1MNAA 3WWDA 2CJPA 2O7VA 5AKXA 3VXKA 3FVRA 5FUMA 3I28A 3WL7A 3D4LA 3G9XA 4PV7A 1UWCA 4EY7A 3FLAA 1YASA 4UFNA 3D3NA 2C58A 2Z3ZA 1B6GA 3K2IA 4DMCA 1TIBA 4OYYA 3G9ZA 4WFIA 4AMZA 1P0QA 5CRIA 5LZ9A 4Y2YA 2H9YA 1XQYA 1CLEA 2XMCA 3B3QA 1SCIA 5AK6A 2Z8ZA 2QMQA 4QDTA 5D3KA 1YS1X 3O4GA 3HJUA 5LKRA 2JEZA 5C8XA 4P92A 3P2MA 5KWIA 5D3ZA 2PU5A 4NS4A 4JH0A 1Y7HA 2C0QA 2WILA 1XFDA 5ALGA 1BCSA 3F96A 4EY8A 2OGTA 4GWLA 1EXWA 4BP8A 1H2XA 5HK8A 3H2JA 3WWEA 4KAAA 4DLNA 2QZPA 3I6YA 5AKZA 5AK3A 1GZ7A 5K3FB 4BCBA 2WFZA 4PSCA 1UFOA 4AXBA 5DTJA 3HXKA 1UK8A 2UZ0A 4DSZA 3AUKA 3R0VA 2HM7A 3EIOA 2ZJ6A 4X6YA 5AKEA 5AK5A 2ACKA 1ZI8A 3I2KA 4GLBA 4BC1A 2GYVA 5IKXA 2VJBA 4L3WA 2VJCA 3G9TA 4H7KA 3G0DA 3D59A 3DD5A 4EY5A 2WFMA 5C7YA 2VA9A 3QMMA 5JAUA 5D7BA 3M3DA 3ANTA 3WIOA 2R8BA 1CIJA 2AXEA 1QGED 3C43A 1XROA 1QONA 1FSSA 3V1KA 2Z3WA 3F8SA 4OD0A 3IDAA 2V96A 4KJXA 3ESDA 1TCCA 1JMKC 3ICVA 3L1HA 2Y2VA 3WL5A 2XUKA 4G8BA 4NZZA 3AIOA 4Y7DA 1XZCA 3STVA 5JATA 2XMDA 1ACJA 3WA7A 5ALMA 5K3FA 3AINA 2XB6A 1CUEA 3STTA 5CXUA 3I6ZA 2C7BA 3DEAA 4QDZA 3WZMA 3G0IA 1CUHA 3BL8A 1EH5A 1QIEA 3A6ZA 4X90A 4RGYA 4X94A 5AKGA 4BTVA 4ZRDA 2PL5A 1BU8A 2I3ZA 4QNNA 4X6XA 4J0HA 1ODSA 1U8EA 4QLAA 4BZWA 4X97A 3WZLA 1CUFA 1TK3A 1VA4A 2XUGA 4BDTA 5AM2A 5DYYA 5LP1A 5LYYA 1R1DA 1EDBA 1HLGA 1CPYA 3F67A 2QM0A 2CZQA 4W1QA 2AJDA 4JNCA 4UHHA 4KRYA 3R3WA 1DQZA 1E5TA 3GROA 4RNCA 3WI7A 3VDXA 4G4IA 5BV7A 1LPMA 4MEBA 1W1IA 3DDUA 3I2FA 5AM5A 3WKEA 3V9AA 5AH0A 2R11A 2WJ4A 4J0DA 3Q0TA 1WB5A 5AKKA 1QO7A 4DNOA 1GKKA 2OQIA 1P0MA 4B83A 3C6BA 4BB0A 4F60A 4BVLA 3DYVA 3FWHA 4K6GA 5AI0A 3TEJA 3W06A 1R50A 5JAOA 5A7FA 1J1IA 4L0CA 1XZMA 5SYMA 2DQYA 4H7JA 4MEAA 2V9ZA 4MJ3A 2WG1A 5I8PA 4MYDA 1LPOA 5LKAA 5AM4A 4B81A 5BWCA 5IVHA 2DCMA 1Y37A 3ZLVA 3HZOA 4Y2XA 1QIIA 1MT3A 3O9VA 3HSSA 5LIPA 3DS8A 1LNSA 3EQ8A 4UHDA 1XZKA 1G4HA 5ALEA 4N8DA 1UOQA 4QDUA 2H7XA 4OSEA 3BJRA 3PE6A 5ALHA 2HADA 1C4XA 1XRLA 2PUJA 3CCBA 3DLTA 1R4ZA 5EGNA 2QVBA 3R3YA 1PFQA 3AFIA 5AO9A 2WIGA 3AILA 4QZVA 3H2GA 2XUDA 2XLBA 4Y2VA 2QUAA 4AO7A 5FP0A 1JU3A 1XZAA 4WDQA 1XLWA 3SK0A 5CT9A 4X6UA 2VAXA 1ZGBA 4B9EA 3IURA 4J3JA 2Y6UA 1EVEA 1GPKA 1FFCA 2D5LA 3UMJA 1UKAA 5K3AA 1SC9A 2WJ3A 2OQVA 3V1MA 3O4HA 4KE7A 5E4TA 3E4DA 3SWWA 3T52A 4IH4A 3OG9A 3ESAA 3AZPA 5JAHA 2VEOA 1JJIA 1JI3A 1QTIA 3QVMA 4X71A 5BOVA 2PPLA 3N0TA 3UUEA 3OC0A 2ZJ7A 4KACA 5T4EA 4PSDA 4MWSA 1TAHA 3GFFA 4BAGA 2WHQA 2WHRA 5KREA 1DINA 2BUAA 3KWJA 2DHEA 3MUNA 1SOMA 1DWPA 5LZ2A 3ZLUA 3HYSA 4X85A 5CXXA 3G0BA 2X5XA 3C6ZA 2PX6A 4B9AA 1W6RA 5AI8A 3QMWA 2JIDA 3GELA 4W63A 2HU5A 3TJMA 3H1AA 3OTQA 5ALOA 3PF9A 3VJLA 3FYUB 3DCNA 4ARBA 5EFZA 1QIFA 5CT8A 1CUBA 2XQFA 3W05A 2WUEA 4EBBA 1QIKA 4Y2PA 3BF8A 4H7DA 5A2GA 4E11A 1K5PA 3A2LA 2OCLA 5ALIA 2RONA 5CW2A 5KBYA 1F6WA 2QUBA 3GA7A 3NUZA 3I2JA 2Z8XA 4CCYB 2WIDA 1XZIA 2XUOA 1T4MA 1IUOA 2C5GA 2GZSA 3R40A 5JD6A 5AI5A 1TRHA 1FFBA 3DOIA 2OCGA 2XDWA 5K3BA 4UHEA 3HEAA 4HAIA 4E46A 4G9GA 4F21A 5HK9A 2D0DA 3I2GA 4B6GA 2WKWA 3D5EA 1Q0ZA 3QH4A 5CMLA 3A2MA 2GYUA 4FTWA 4FWBA 3RK4A 4BCCA 3MUOA 2RGUA 4GECA 2EDAA 2G5TA 3QPDA 5AM3A 2XT0A 2E3JA 3FYUA 3I1YA 3SX4A 1CR6A 1AC5A 1N5MA 2WG2A 5AHXA 5ALKA 5K3CA 3I2IA 4CIAA 4DNFA 2RI6A 3V48A 5CT4A 5AOAA 2WTMA 3LS2A 5JZBA 4Y2RA 3ILSA 3I6MA 1XZHA 1MAHA 5EHNA 1QIGA 4Q05A 2V97A 5LLSA 2VT6A 3KOOA 5JD4A 1MX5A 4G9EA 1HDEA 3SC2A 5HZGA 4CCYA 5FXMA 4JUIA 4WJLA 2O2IA 1DT3A 4CCWA 5AI4A 1CUAA 3PICA 3PFBA 4LXIA 1TQHA 1LGYA 4RE6A 4W9RA 4UBNA 1WHSA 4DYHA 5HQ3B 4H35A 3ZV7A 3GUUA 4NVRA 5T4BA 4E14A 2WJ6A 4G8DA 4W1RA 1YA8A 3F9CA 3HABA 1KU6A 2J4FA 4RPCA 2OPHA 1VZ3A 2JGJA 2I78A 4OB6A 1ZICA 4RE5A 3I1IA 4QA9A 3G0CA 2GBGA 5E4JA 1K8QA 3O4JA 2XUHA 4PF1A 5JANA 3W04A 3QYJA 3H2IA 1T2NA 3PDCA 4I19A 4H0CA 1N8SA 2VTVA 2HA6A 5DWDA 5JAPA 1UZAA 5ALWA 5AP9A 2QS9A 4TPKA 5H3HA 4FMPA 1CUYA 2BGNA 5C8ZA 3LP5A 4K5QA 1CUUA 3R3ZA 4FOLA 3W9BA 3GZJA 4TVKA 1E89A 3IBTA 1MJ5A 1MN6A 4QEKA 3OOSA 2O2GA 5HQ3A 3ESCA 4C89A 1VOTA 3KSRA 1Q0RA 4PSUA 1G66A 1E66A 3F97A 2XUQA 1GPNA 1XRNA 5JD5A 4ETWA 4FBLA 1YA4A 3D7RA 3O4IA 5FPPA 4UFPA 3IUMA 5AKIA 2GBIA 2VT7A 1XRRA 4BYMA 2AJCA 2C0PA 2X8BA 2HA2A 1DU4A 3G8YA 2O7RA 4QWWA 1H23A 5ALNA 2IX9A 4BBZA 1ODTC 1G5FA 3WMRA 2ZYSA 3VVMA 4CG3A 1DWOA 3FNBA 5FKJA 1CUIA 4BRZA 2YH2A 5CT5A 4DM7A 3R41A 4C87A 4UHBA 4WCVA 3YASA 1JMYA 4GBGA 1AUOA 1WOMA 3OURA 5HKBA 3DKKA 4Q3KA 3STWA 1CUWA 3FLBA 3DKRA 2WU4A 4H7FA 1K6EA 4QE3A 4IHAA 3QPAA 1MU0A 1A8SA 4X95A 2HA4A 2I03A 2ECFA 3GBSA 2RHWA 3D2AA 2HA3A 3L1JA 4DGQA 2XUJA 3WWCA 2QXTA 3C6XA 4A5SA 3X3HA 1G42A 4IH9A 1LZLA 5AJHA 3V1LA 4BTLA 3N2ZB 4N5IX 2WSLA 5K3EA 3NOXA 4X91A 2RHTA 5IVIA 1R88A 3FCXA 2JGEA 1LPSA 2CEKA 4F0JA 4GEGA 3ESBA 1XKLA 5CH3A 4KE9A 1ZD3A 4HXEB 3PUHA 4ZI5A 1CEXA 2CB9A 2YYSA 4UBIA 2DHDA 2WG0A 2DQZA 3STYA 1SCQA 4EHBA 4N8EA 1CUVA 2X76A 2XUAA 1AGYA 2PBLA 3BDIA 4ZV9A 3WWPA 4YASA 4BC0A 1JFRA 1CUZA 2JBWA 4UBOA 3LIIA 1GQRA 1DWQA 4AN1A 3IA2A 1N5RA 4U2FA 2HU8A 1Q84A 2HRQA 1ODCA 2OAEA 4MXDA 4OUKX 4B84A 2ZYHA 3G9UA 1WB6A 1MTZA 3H1BA 4GI1A 4Q3LA 4PNZA 1WM1A 3WKCA 1VXRA 1E8MA 4WY8A 5ALXA 1CUDA 1N1MA 3O0DA 1LPNA 1J07A 1VXOA 3K6KA 4X3CA 4A16A 1ZD5A 1WCYA 4LXGA 3FBWA 4DNQA 3JYHA 3JW8A 2PVSA 4UBKA 1R3DA 1MPXA 1YAHA 2HHAA 3ANSA 1YR2A 1AKNA 4B0PA 4FLFA 5A71A 5IVDA 4Y9SA 2XQKA 5ALLA 3PI6A 1X2EA 4CFSA 4I3FA 3KXPA 1C7IA 2BJHA 1JJFA 4OB7A 1HBJA 4JEIA 4EY6A 1FFEA 4UBJA 2HL6A 4I4CA 1I6WA 1QFMA 3IB3A 2C5FA 1F0PA 1FFDA 1JT2A 5E2IA 4KE6A 2QR5A 2XMGA 4PQEA 3AIMA 1A8UA 2JGKA 5ESRA 3VJMA 1AQLA 3DJYA 5AM0A 4G4GA 4H18A 1CUSA 2WLSA 1XLUA 1W52X 5EIEA 5ALQA 5E4YA 2WUGA 3BWXA 2G4LA 5FRDA 3I2HA 3M83A 2BFNA 3QZUA 5AK4A 3FYUC 5DNUA 2BAGA 1ZJ5A 2WM2A 4ZREA 4XIIA 1OXMA 3DL4A 3H0CA 4AB1A 4AX4A 3WLAA 2QJWA 2GZRA 4CI9A 1UOPA 5ALJA 3PUIA 4G8CA 3QBJA 1X70A 3A70A 2PKYX 2AJ8A 4FDMA 4OYLA 1JKMA 3HLKA 5HCUA 4FHZA 5JASA 4DNPA 3EQ9A 1H2YA 5ALYA 3WL6A 3BDVA 3KDAA 4PW0A 3G0GA 3QITA 3H04A 4P93A 3R3VA 1C7JA 1DQYA 1H2ZA 1Q83A 4YK7A 5AKJA 4DMFA 4BZZA 4W1PA 3EBLA 1USWA
chains in the Genus database with same CATH superfamily
5JSYA 4J4HA 1K97A 2CNNA 2I76A 2L69A 3FOWA 3SQWA 4TVOA 1WB9A 5IYZB 1A9PA 2JLRA 1EK2A 4MJ7A 4P35A 4PYQA 3TN7A 4ARAA 4C07A 2PN1A 2YNMD 5IF9A 1GQQA 1BTOA 1ES9A 1K3FA 4JJ6A 4UAGA 5PNTA 1M5RA 3IKLA 3PKJA 1QB7A 1C9DB 1RQLA 3MD0A 5A0FA 3AFNA 3DZDA 4G4SO 4HDOB 3OQMA 4QSHA 3EXHC 4MVJD 2A30A 1Q3HA 3P19A 1KO8A 5KYXA 1V41E 2DG2A 4IDBA 3ZDBA 2V55B 5EESA 5KSPA 1BXGB 2JFGA 5BSTA 5T41A 4DILA 3E03A 4NABA 2F8SA 3DTYA 3TKAA 4A6PA 1IVNA 4TWRA 5JAQA 1ILWA 1N9GA 4FYPA 5SZKB 2JAUA 3WO0A 1ZYUA 4C4ZA 4E1AA 3KRTA 5FUWA 1PHRA 2CJFA 5HR5A 5EZSA 2ALJA 3MHPA 2H6EA 1CE8B 4ESHA 1XL1A 4X1YB 3WHLA 2NAFA 4FQ7A 2W6ID 3U49A 4GKBA 1JR6A 4GOND 4D9HA 5DISB 1MB4A 1N1GA 4N5HX 4MLCA 4MYSA 3F7TA 4WN9A 3ZXXA 5LVAA 1TVCA 3WMEA 1F60A 4PNPA 1HDGO 3EZGA 1V9CA 3UH1A 3EAFA 3LBNA 5FA8A 1E58A 5F4ZA 2XRFA 4RNDB 5KWVA 1EU1A 4H3VA 2L82A 4XB2A 1U02A 3OEYA 3IKVA 2HO5A 2I29A 4HEA1 3L6BA 4PO3X 1NVEA 3ZZTA 1EDEA 5BSEA 2PYIA 3GFBA 5ILGA 3KYCB 1WPXA 3KCQA 4O3MA 5B7GA 4BLTA 1K92A 4Q34A 1XCBA 1Q1BA 3W5HA 5K3DA 4RDCA 1VDMA 1E6LA 4D98A 4D9GA 4F5ZA 2GBFA 3EJWA 3PLRA 3Q10A 4G63A 4W9MC 2B4QA 1FP1D 1J8VA 3BHJA 2JGNA 4JT2A 5AJVB 2JHPA 3I09A 4Y9RA 3MOIA 2Q0QA 1E3QA 1EFPA 3WL8A 1RLJA 4LDAA 3MERA 1B8NA 4ZYTA 4DREA 5IYZA 1IXKA 1V7CA 5H5JA 3GPCA 2X4DA 4TZ6A 1K4YA 3C5HA 4F46A 5F5LA 2VHUA 3R6TA 4IIBA 1RHKA 1J8MF 1RSZA 5BPFA 2AG6A 4MV0A 1AUPA 2FSSA 1SMKA 3NBQA 4RVNA 1GYRA 1NW3A 1VSBA 4MO9A 5KAMA 4B4WA 2QRUA 3GLIB 4ASUA 4YPFA 1MD9A 3S99A 1M2WA 2FWBA 1BXGA 1EVJA 1SKYE 4XI9A 1X7WB 3VU0A 3ENQA 3EULA 2FP4B 5DX1A 5AFSA 1AQYA 3OPNA 3WBKA 5BW4A 2V8BA 1U7DA 3GRUA 1LBSA 4MRNA 4CUZA 5L45A 4QDXA 3UA4A 2WAMA 3A11A 2QBYB 5I8WA 3O84A 3F49S 1E9SA 4M1QA 3R7BA 4I0WB 5J3JA 2H2HA 3LY9A 3M82A 4CXMA 1CE8A 4D0LB 1OSNA 3HN6A 4RVOA 1UM8A 5G53C 4X1YA 4LHEA 4BJ5A 1IAVA 2OB1A 5GZ6A 5DHUA 6YASA 5D1HA 2YR0A 2QKYA 1XNJA 3KQOA 2BVNA 3SPXA 2PMFA 1ZOIA 2NXCA 3H1GA 3FTCA 4BMVA 3HJTA 1K7YA 3RFUA 4BX2A 2YIJA 2LCIA 3FPEA 3A6JA 1QTRA 3MJVA 4M89A 2FGJA 2XVXA 3FGPA 3PA8A 2I7TA 4ATNA 1E9AA 3QEJA 3CLTD 1N2ZA 3CZMA 3HKCB 4WFKA 4ALLA 3WGKA 3KYCA 3C7CB 2BUCA 3K0HA 4KQEA 1VJ0A 2J3EA 4MR9B 3CZ4A 2R8ZA 4QULA 5FUYA 3M0EA 4RLQA 1XMPA 2G76A 2XECA 2AH5A 1Y5LA 3HJAA 1IOLA 3O7WA 3QGMA 4KUGA 2WMDA 4RY0A 4O4LF 5I4BA 1FUKA 1R7RA 2O4UX 3FNFA 5K0JA 2EKQA 1TAUA 4RSMA 1ZBQA 2J0SA 3ZDYB 3L05A 2RG7A 4ZYYA 4V0ME 1JPJA 3LT4A 2GPAA 1SXGA 1A7JA 4N65A 3BWBA 1UK7A 2Y05A 2JASA 4FKBA 4MTLA 4S1TA 1F5SA 1VLQA 2WHXA 3VUFA 3AP2A 3ZLJA 3QBEA 2J3QA 3CPJB 3PNSA 4AZ0B 2CNDA 3EPPA 4MAMA 3A32A 3O74A 5CG1A 2OMKA 2R2GA 2X0EA 4Y2JA 3RTDA 3KB8A 3V1TC 2HHLA 4A0HA 1XQ9A 4ENTA 4ZCRA 1G18A 2Y6VA 1N8TA 3EZNA 3IERA 4WESB 5TT0A 1U3FA 1KRWA 3QVTA 4EMTA 3GLIA 1YONA 1JU9A 3HFJA 4MQLA 4XIJA 5ECDA 1UKZA 3CV3A 4AZWA 3RLFA 5EIAA 3IEPA 1J5XA 4DADA 4DBZA 1P1RA 1APBA 2YMPA 4JX9A 3JASB 5IZ4A 3CHYA 1N78A 3QVOA 2FP4A 4R3WA 1L4MA 2VLBA 5COBA 1WKCA 4C5CA 3R9XA 1M2FA 1RFLA 4US0R 1M7BA 1JIXA 4LQLA 5YASA 1YO6A 4WY2A 1U81A 5KPDA 3KUUA 2QBYA 3IUSA 1AQ6A 1GGFA 1QZXA 1RAIA 2HI0A 2IOHA 2ZSFA 3WJ2A 1U7ZA 2A5DA 4TKMA 3X44A 1IK4A 1XVVA 2OV6A 2V6IA 2HBQA 3TDNA 3UCXA 3S8EA 3H6GA 2Y71A 3K53A 4RPLA 3WIUA 4B6FA 4H17A 2JK0A 4EABA 4HB3A 1YRLA 4JOSA 4RJTA 4UQLA 3ZH9B 1DAEA 2OENG 2Y0BA 2V3VA 1A9SA 2YOHA 1YZFA 1I4EB 2OBNA 4AVYA 5I48A 1M72A 1H22A 3Q4GA 2Q28A 3UMGA 2FEPA 4DR3B 1VRVA 1FBTA 1XDGA 5AJYA 1RAEA 1P0CA 2AFRA 4LHVA 2NU7B 1RLUA 1AGPA 1MGPA 5HOEA 1CFJA 1DQNA 1O6FA 1C0PA 2P8JA 3BICA 3LQKA 4M36A 4B2PA 3HKCA 2IBSA 4JC4A 3KU4A 5DP2A 2BMJA 3DTVD 1N6OA 4S2EA 2HA7A 1L7QA 4MR9A 3BGDA 4RGVA 4UPDA 3VQTA 5EI5A 4YRAA 5H70A 2BFAA 4FHEA 3S3TA 2ODTX 4A6DA 3D8NA 2VDKB 1DS6A 5H0IA 2C2OA 4QGFA 2I66A 3UXHA 3F7MA 1CVLA 3JWGA 3ZJVA 4DV6B 2PFGA 5JZ9A 1F8GA 4B82A 4M53A 5HKLA 5D84A 2I7VA 3B2NA 3T99A 2VCYA 3RS4A 3D6UA 2IYLD 3ND5A 2AFVA 3HJCA 3PGKA 1D4ZA 3SSMA 5BQPA 4AZ0A 2BHTA 2W22A 3DXZA 3VI3B 1M3SA 1HDOA 2I1WA 3AFGA 1YR6A 1EP2B 1RABA 121PA 1I94B 2KLHA 3QIAA 1HX7A 4WESA 3PFIA 4M87A 5IKOA 3ROGA 3TVYA 3USCS 4OXXA 5JADA 1DHTA 1F4PA 2YJ3A 3FYCA 3T7RA 4CG1A 1VI6A 4S1WA 2YC4C 4YRDA 4NICA 1E5VA 1GTZA 3JASA 1M6YA 3N3AC 1JSLA 1W76A 2BF7A 1Y89A 3BWVA 1IC6A 3VSDA 1CS0B 2NXWA 4Q9DA 3GR6A 5MFZA 4H1TA 2CJYA 2A1TS 3WVNA 1DX4A 2IPMA 5CVEA 4Q7MB 5JIBA 721PA 4CJXA 1MO6A 4MGHA 3QVGB 4URXR 3LPMA 1PWXA 5CDGA 3SHQA 3CRW1 1Y5RA 1GAXA 1QOZA 3RJMA 3KJQA 2WWVD 3S44A 1XWIA 1ZNQO 4R2WA 4EZIA 5HEKA 4JXZA 3RADC 2RGXA 4URZR 4C4YA 3FVTA 4Q4LA 3JAMA 2AUNA 2YVLA 3CZQA 1MNQA 1Z35A 1IDN1 3SYMA 5CLFA 2KM1A 2P8SA 2NU7A 4AI6A 1EA5A 1LXCA 1NIJA 2G0NA 2R0QC 2AS0A 1Q74A 1YFLA 4V2IA 2GERA 3ITEA 4W5OA 4DPLA 2P4HX 2J4CA 4JCOA 1KYZA 1SB8A 3I01A 4KLZA 1Z56C 2G83A 3QX8A 3VPBA 3JPWA 3CTMA 2E2WA 3ET4A 3A3YA 2CL0X 3STHA 2IUUA 4F2WA 1XZGA 1E5QA 3NZEA 2Y0EA 4E94A 3OH8A 1RHRA 1YDMA 1B8PA 3M6AA 4ZZ3A 3ANLA 4J7CA 3SD7A 1B8OA 1XF9A 4U9UA 3A2NA 1K6IA 2ZRHA 3GVCA 3DC2A 1L7MA 1Q0SA 2Y68A 4YCNA 4PPFA 1VDZA 3ISJA 4RIFA 5F3DA 3KEGA 3LLVA 3PX7A 4RQUA 3GV0A 5BPHA 2Z2YA 5HRCA 3HBAA 5FV7A 5EIHA 1SN7A 1D2GA 2A5JA 3MJCA 1JKJB 2IZZA 2VDPB 4CIXA 2C7QA 3RLIA 1TJ3A 3IMGA 1KGSA 3S68A 3C7AA 3ITDA 2ZWPA 1ISJA 1GNQA 3DZIA 4J0IA 4KGVA 3UGQA 4KAFA 1BVRA 4RL4A 4TUYB 2MWMA 5K6RA 5AVOA 1U7OA 1PGQA 4LIPD 4N4AA 2PGNA 3ZWCA 3BCRA 1SXIA 2DFLA 1CS0A 3EVBA 2BR3A 3GCWA 4Y2GA 2RGEA 5D7NA 2P9JA 1KTVA 1E2NA 4ROTA 2HNKA 4NDNE 2D5CA 4TTPA 5C8VA 3MFYA 2OGZA 3ZJTA 1LRLA 3DQZA 2DKOA 3QVGA 4Z99A 3KBOA 1N3BA 3JVDA 1S6YA 4CLRB 1F0NA 4JUDX 5TF0A 1U2DA 2X3YA 3JQFA 1M8KA 3IP1A 3QBVA 4HP8A 1SIUA 4IICA 1C1XB 4YLYA 2WTBA 2EBWA 4PO1A 4LY6A 4UNNA 3EK2A 5DYTA 1EDDA 2B69A 3E48A 1HNZB 1H6AA 2GN0A 5F7JA 2F1HA 2ENUA 1H4QA 3ELYA 3ITNA 3KPUA 5KSYA 3IIEA 4JKYA 4LE1A 2IS4A 3RQIA 3CW9A 1K63A 5E8JA 2Y0CA 4FSXA 3Q0IA 1Q6ZA 3HACA 4B2LA 3E3AA 1XZFA 1MQ9A 1OIVA 3PIRA 4FQ5A 2BGKA 3RUIA 3UOWA 2VKQA 2IE8A 2QX8A 5JSHA 5GM2A 2ZBQA 4BNDB 1P31A 1ZITA 1I1HA 1UL1X 2CJWB 3A26A 2RCYA 5DNYB 4ENRA 4X7RA 1NLZA 3GAFA 4G0VA 3COYA 4ZPXA 1XRPA 4BVJA 1NX9A 1T8RA 1ZIXA 4EI8A 1Y7PA 3IB6A 4FX2A 1TW3A 4BXOB 3UG6A 1UJBA 1NKTA 2ZI4A 3BQMB 4U00A 3TLXA 5CUQA 1DDOA 1LLDA 1Y34E 4ZGWA 4NZPA 1GUFA 1NN0A 2YJ4A 4KXWA 2LGJA 3UICA 1H8HD 2AE2A 4ZVRA 5AW5A 1RNLA 2R97A 1BMTA 1Z68A 3EAGA 3V33A 3RTGA 1O3YA 3HDVA 3V6LA 4X66B 1J7JA 1UKEA 4F06A 3LQ4A 1E7WA 4LYGA 5JMWA 4E09A 3J80A 3CVVA 2FDXA 3AL0C 3KZOA 1UUFA 3ZDQA 2NIPA 5AVYA 3DE6X 3L7BA 4XFJA 5HXAA 1PZMA 1FLVA 1IZZA 1W0JD 2ZPTX 4R40A 5IMSA 2YIMA 2AVDA 4TUYA 4BNFA 1XMSA 4EHLA 4ZVVA 5NLLA 2WJYA 3UWMA 2GH1A 5B12A 2PLAA 4RJKA 3SEZA 1GZ6A 4GZLA 4C4OA 1AMUA 3I5XA 4PANA 4WWHA 1H3EA 3EGOA 5A5VA 4B76A 5KC8A 4LXTA 2X2FA 1KEZA 3HY6A 3BZBA 3F98A 2VSOA 2C00A 4HLCA 5DHTA 4XSVA 2P35A 3AM4A 1VA5A 4EYQA 1EB8A 5KTSA 2FPLA 4A82A 3CJRA 4CLRA 1A71A 5C53B 4UEKA 2IITA 1NMEA 3IULA 3T5CA 4DTCA 1XA0A 4HXFB 2X5KO 4WKCA 1C1XA 3E27A 1S4MA 4PXYA 3QELB 4B1FA 1U3CA 1U65A 2K2WA 4KVAA 3D6AA 3B5JA 2GN1A 4OM7A 4OOFA 2AR0A 5LBUA 1P19A 3OQPA 1VYHA 1Z29A 4HXYA 2PU7A 1E2PA 4OY3A 1O89A 1P7CA 1UBFA 5TE9A 4D96A 5DTMA 5A04A 3L0OA 1GDDA 3EIEA 2R8XA 4WNIA 1I4OA 5K5EA 2VHQA 2FEXA 2XV1A 3PHBE 4BNDA 5K8LA 4BRSA 1OJLA 3KELA 2Z5LA 2B8WA 3PVSA 2CJWA 4PS0A 1XAJA 3WQQA 4AK9A 3TLMA 2BGUA 4BE4A 1TCBA 2PQ2A 4BNMA 4G23A 4MV4A 4ETNA 1N6IA 5C32A 4QUDA 1VHWA 3MEQA 1OZGA 1DIHA 5EWMB 3JQ9C 5IH3A 1KWGA 4BXOA 1Z2PX 3LYLA 5I9MA 4X8LA 3PPYA 4CDNA 1OXSC 4YJ3B 3CZ9A 5ALVA 4AO6A 3GRPA 1XUOA 5GVRA 3DE1X 1V25A 4S0ZA 3AUYA 4DV7B 2OCKA 1L8LA 1JNYA 2DP4E 4DZRA 1H0HA 5G1PA 2RDMA 2WJGA 1PTKA 4Q4CA 4Q1CA 2IYWA 1SVOA 3KLNA 3UXMA 4Z86A 1AURA 1KIFA 1WB4A 2YWEA 3ENZA 3V5NA 3BYZA 1JXOA 2FPPB 1SQGA 1SD2A 4MRVA 1JIUA 5AW6A 5LU8A 1CNEA 3F71A 3UTDA 4ZJYA 4KVGA 1HLFA 3VNRA 3WLQA 3SXUB 3RIGA 1C1HA 2BLLA 2MR6A 2YXEA 4GFDA 4WK0B 1T5DX 4BVGA 1U31A 1YOVB 2AW3A 2D1YA 5F1OA 2IYZA 4WY5A 2WTAA 1TKAA 5TC4A 4B75A 4YT8A 4ZMBA 2JCSA 1VYUA 4L27A 2EW2A 2Q6IA 3W3AD 1NU6A 3O95A 1A5ZA 3KTAB 3TAXA 1MOSA 1Q1EA 5EP1A 3NM6B 3GN1A 2FX5A 1XCJA 4RBNA 1PZFA 4J0GA 3NHPA 4G5HA 2WABA 2ZRMA 4H1UA 3FAZA 1Q11A 2R44A 1JDZA 2IYQA 1E0JA 5IBPA 1TKRA 1QVAA 3C48A 3RBAA 4JLMA 2IH4A 1OKKA 3FYHA 1U8ZA 3ZD8A 1NASA 3QELA 3N2IA 2G8LA 2AR7A 1QH9A 1IL0A 2RHLA 4YDRA 3WKBA 1GA6A 1F1BA 1BHQ1 5BNTA 5TGTA 3B1JA 4FPXA 3GP8A 3VSEA 1J9ZA 1BGWA 1FA9A 3HVIA 2B4KA 4TTRA 3TW4A 4B48A 5L3VA 1O6CA 3EUFA 3EZ7A 2LUOA 2CWDA 2I4IA 4FDUA 3HCEA 1I0ZA 4EQ6B 3U7FB 4LJRA 4I9FA 5GJVC 4ESVA 2XSZD 3OUZA 4Q1DA 1NC3A 5ECGC 3BGOS 4RJLA 2VJMB 3NRBA 5AVRA 2QRQA 2AIRA 1YVDA 2FK7A 4AZVA 5HQ3B 2E82A 4IX1A 3R7DA 4RABA 2VKTA 5IC6A 1V5IA 4M8IA 4TRMA 2FSUA 4E22A 5EWMA 1RI1A 4R9VA 2IH2A 1GZ3A 1K8XB 3CN7A 1FDUA 1G21E 3ZN2A 1A95A 2O3TA 4KZPA 4DMHA 1V4BA 2FUEA 3IBCA 3MVEA 4RS3A 4OB8A 5ER6A 3T1QA 3VX3A 5JC1A 3DBOB 3KXLA 4MWDA 3RU9A 3W5SA 5TQ0B 4HRYA 2HXGA 5AOVA 3UWDA 1QFXA 2J0VA 1EZ1A 2FSFA 2O3UA 3DOHA 2JEYA 4ZQEA 1GVHA 3G2IA 2HPHA 5EMKA 4CVNA 2FPPA 2QRNA 2WVAA 4A8PA 5EE1A 5COAA 2AWOA 1UJ2A 4RHFA 2VXCA 1OZFA 3WY9A 4IUBS 3SXUA 3ANXA 4EDFA 1W47A 1OKKD 4I5GA 1BXKA 3K8ZA 1SG9A 1YOVA 3GPBA 3HO6A 2XMSA 5EQJB 5ES3A 4BB5A 3PFKA 1DBQA 2I33A 1Q91A 3KTAA 2W93A 2W70A 5SICE 3UOGA 3ZQKA 2LR0A 2IKSA 4PN7A 1NP7A 1RXIA 1GL3A 5E0OA 3TXAA 4L57A 4GR4A 2PXXA 1QMPA 3GHHA 4QRIA 3R1IA 3MGAA 5CCXA 2VATA 4AC9A 3OESA 3QNWA 1ZCJA 4CTMA 1Z17A 4XR9A 1LD3A 1OILA 2ASEA 5BW6B 2H9AA 1QIHA 4A3SA 1QIMA 3GI1A 3U16A 3ONFA 4B4KA 1RPZA 4JP3A 2A0YA 3ZWQA 2YJGA 1W4CA 1OHHA 1XEFA 2JI9A 2PY6A 3FJ1A 3MJ4A 3NWPA 1QZZA 4J0KA 1FNMA 1EHYA 5A7GA 5BV8A 4AXXA 4W4TA 1R9MA 4JYMA 3B3AA 1QAMA 5CT6A 1W4RA 2QTCA 1JX6A 4EQ6A 1BEZA 2OGSA 4P9NA 5DNWA 3WYNA 2XMZA 4WK4B 3NLLA 5CURA 5G0WA 5SY9A 1HT1E 3ZNOA 5L40A 3PC8C 5HS6A 1JEYB 1OFUA 2A67A 2VJMA 4OH7A 3MRXA 3IAEA 4JY7A 2FU5C 4MIEA 5EJ9A 3RVJA 1OWOA 1MT0A 3LKDA 3NW9A 3P97A 4IUDS 4XX1A 3TQSA 3RUFA 5KTNA 5B1EA 1KKLA 2ZIGA 2AUTA 2F43B 3KC2A 1GYPA 4FQ8A 1WR8A 1X7DA 3D3QA 1BRMA 1XMQB 1QV9A 3W1EA 1SUDA 3PPIA 4BYGA 4REOA 1IZ0A 2QUZA 2R7AA 3ZBTA 2IIVA 1KVTA 5F64A 4HNTA 5I4KA 2OK7A 4X1KB 5C8DA 2JANA 2EVWX 2QX9A 5IC4A 2YUTA 4DCVA 3TL2A 3TOXA 2QN1A 5TQ0A 5HM6A 3WGIA 2JAQA 2G06A 4H2DA 2F9FA 5EMMA 2HZ7A 4B7ZA 4RTOA 1GPLA 2B61A 4Z7OB 1UPFA 3QXJA 1SQ5A 3ER9A 1NVMB 1M8GA 4DJJA 3LTNC 3AZQA 2OD2A 4R98A 1J4AA 3SKXA 3NYIA 3K72B 3N6RA 3VHXB 5BNWA 1ZEMA 4WPGA 3LSYA 2WNIA 1I5OA 2RK6A 3HRKA 2DE0X 1OHHD 4RDHA 4XAQA 4ZVUA 4LOHA 2CYAA 2XWPA 1LQUA 2ZUUA 2OVBA 4LYEA 1QWOA 2XW6A 2XVYA 1TO6A 1XTBA 1RBZA 2Z2JA 5CLLA 4C43A 2HKIA 1GT6A 1R16A 1MCZA 3GPLA 1AA6A 1NWCA 3UAZA 5KQMA 2WM8A 1GGMA 4Y2QA 4D0GA 2OAGA 4UOEA 3FYSA 5EE9A 1BWPA 1QRAA 4IDGA 1KOFA 5CR9A 1A8QA 3WB0A 3TZKA 1KXJA 2EJBA 3HA7A 5JCOA 3RRNA 1YOBA 3VTAA 5AW7A 4P3PA 5FFNA 4WLEA 2C88A 3QMVA 2E89A 4IQ4A 1UFVA 1YJQA 2C2WA 2WIBA 2R96A 4RHEA 4D26A 2ZIFA 3IR7A 2ZSHA 3W4JA 2J3MA 5F9FA 2WF5A 2OXCA 4XWAA 4F97A 4HLQB 3K2BA 3P9RA 3OX2A 4Y6RA 4H7PA 4MCAA 3OEEA 4Q01A 1JEYA 2VZ9A 4HDQB 3EF1A 3SJ7A 2H52A 3GN2A 4MV7A 1SM4A 2G5PA 3CH4B 1DQRA 2YFQA 1J00A 2ZKLA 2H06A 4MDHA 2ZYUX 4Q19A 2F43A 1WXFA 3C70A 1TL7C 1JWAB 2A7XA 2A58A 4ND8B 3V8MA 3CSUA 4FYWA 4C0KA 2VH5R 4DMMA 4EJFA 2Z56A 1E6WA 5I9TA 3X0DA 3IDSA 3WLLA 2D13A 3GEIA 3MT0A 3VZQA 3ZDFA 3UF0A 4X1KA 1T29A 1EEXB 2QRMA 1QQAA 5K99A 2XD4A 1WA5A 3FPHA 5JD3A 3FNRA 1WE2A 3H84A 1HGXA 3I6BA 4KV7A 4L4SA 5I7WA 1BCRB 5C34B 3WXMA 2MSLA 3PXDA 4MVJM 1YDWA 5K6AA 4BFCA 5EP3A 3CKKA 4RLFA 1GEGA 2M2IA 3MTEA 4WCDA 2FMUA 1OB2A 2V7WA 1N8KA 3NYWA 3VHXA 3EOAI 1KXZA 4V03A 1I6LA 1O6GA 2IVZA 1ZC4A 5ANRB 5LQSA 5EIXA 1ZXLA 3G7NA 3ZXIA 1Q12A 2VNKA 3FYTA 1M8PA 3AM1A 4PAWA 4OQQA 1SU4A 2JGFA 3FRIA 2FFAA 5JJBA 4HXGA 2V0CA 1Z38A 4LOLA 1XZ8A 1ADFA 1LK0A 4MKFA 4NC9A 4IXWA 5LUBA 3TIFA 4RUKA 4Q7EA 1EG2A 4D81A 2QL7A 2HAEA 3LPCA 2UYCA 3GZTB 2D2VA 4K03A 1YZVA 2YV5A 1SULA 4AJNA 3ORSA 2Q3DA 3NXKA 1VJGA 5ECYA 4D7AA 5AOBA 3QV2A 1XYGA 2O0HA 4EMBA 3DFKA 3GDHA 1VPTA 3MW8A 3M1LA 1O97D 1P9NA 2W9XA 3IGFA 3LKVA 4QODA 4KJZA 5H59A 3RRJA 4UCQA 1CY4A 4WT7A 5H4GA 3N0RA 4Y2SA 5DCYA 3UKOA 3KFXA 5KTPA 1X9HA 1TMYA 4A2CA 1L3IA 5F2OA 2OBBA 1B3BA 2CUTA 4XYMA 5A0VA 1QVZA 1O94C 1PP4A 1DAKA 1JIIA 1CF2O 1X1CA 4L8LA 3O4RA 1J70A 4JLPA 2EKPA 5KNBH 2JIMA 2GAIA 1E99A 3EHDA 1RWPA 1VL1A 2NTVA 3ED5A 3INYA 1L7RA 4QYTA 2AG8A 2H92A 2P68A 2R84A 3Q72A 4KAJA 2CVOA 5CDSA 5DHFA 4L76A 4ND8A 3D3JA 2AUMA 4OHMA 3EEFA 1E3TA 2OQ2A 4C05A 1DJQA 1Z2OX 3CN9A 3TI9A 4IHJF 1ZLYA 4RJJA 3FFXA 4U2GA 2WSYB 5I9SA 2FW8A 2XB9A 2ES4A 1ABEA 1L7OA 2YMQA 3B60A 2V4ZA 3VKUA 2Q3EA 3LYAA 4RF4A 5SY4A 5HE9A 4OHVA 3ZHZA 1M2OB 4RZUA 5IT9A 1FL9A 3KVVA 1CERA 4QRDA 5JO0A 2DFNA 4AY3A 4LF8B 3VC7A 2ZI3A 3H19A 3PGMA 2JFWA 5BORA 3H11B 2VAMA 3HGTA 4KTVE 1BCRA 2G3YA 3UHJA 4S35A 3MMZA 5FQOA 2P9FA 4LF4B 3MWLA 2ZTVA 2ROQA 5FOSA 3LA6A 3IVXA 1VPEA 4HBGA 2PT6A 3DB2A 1YHZA 5FBHA 1HNWB 1NBOA 2R8EA 1Y3HA 3HVUA 4HNVA 1G9TA 2FFJA 2BUBA 1VZ2A 1YQGA 1T9DA 4R1TA 2PX4A 3DZKA 1ECJA 4RY8A 1RCTE 2GN8A 3EGVA 2BHSA 2E87A 3HRHA 3GCXA 3OCYA 3KYBA 2PUEA 4CR7A 2OM6A 1ZHFA 2A4MA 1ZD1A 4XLZA 5JXHA 3T4UA 2NTNA 3CVJA 1JA9A 1QH0A 4LAFA 2OC4A 1T36B 4K87A 1VYVA 1HH4A 3E9MA 1LUAA 2IYTA 3UT5B 1SVMA 1T1IA 2PNFA 4M9SA 1EXVA 3U6KA 3DJFA 1UJ4A 4BVFA 2IBTA 4GOLD 3E9QA 5SYNA 3K4QA 3UPDA 4C2BA 1JLSA 3AHGA 4XYEA 4RPHA 4FR2A 4N3NA 3RU3A 2CJPA 2O7VA 1EQUA 5AKXA 5HG0A 3WWDA 1IFXA 2WAYA 3OFNA 1W6UA 1LA2A 5J43A 1M0WA 1GD1O 3NOQA 2H85A 3CGGA 3U2QA 2VTKA 1Z33A 1NG9A 1A2BA 3Q5GA 3C1OA 4BIMA 3G9XA 2RHDA 1L0BA 2P41A 2CMDA 3S70A 1C8BA 4EY7A 1WETA 3RUHA 2D2XA 1HFJA 1CSEE 3OZ7A 5E6UB 4RTNA 3ZTTA 1ZAYA 4ZT3A 2M98A 2DC1A 2Z3ZA 4JIGA 3ORYA 2VBIA 3DR3A 1P61B 3KQYA 3HK2A 2W2XA 3W0LB 1G0OA 4LI3X 4B2YA 1Y81A 2NUAB 1MOZA 2ZTMA 3O1HB 3WX0A 4CLXA 4W5NA 3V8QA 3VR4H 1U1DA 2OAQ1 1YS9A 3JRWA 3PYXA 4DMCA 3GLFB 5FBQB 4W5JA 2V59A 2YS6A 2M6LA 5LNK1 4RKFA 3TNDA 1P0QA 5CRIA 4H1WA 4Y2YA 2N1MA 1CLEA 1M2OA 1GPBA 1CHDA 3KXDA 5FWDA 3SE0A 4P1ZA 5AK6A 5A3RA 1JTVA 4TWBA 4MW6A 3GJXC 3H11A 2RGNC 4GPEA 5FD8A 4YFYA 4NAVA 4LVOA 3UMSA 4G09A 1L5GB 1YS1X 1HA3A 3OEHA 1ZMOA 3O4GA 1KJ9A 1WXXA 1Z2AA 2GFQA 2XOEA 1WBDA 1ZUNB 1L1FA 1FXWA 4NCHA 1L7EA 4Z8XA 5C8XA 4RK7A 3P2MA 4HVAA 4LSWA 2Q9AA 4RF3A 4JLOA 1UKYA 5D3ZA 1U2SA 3FMPB 1ZWLA 2PU5A 5LFAA 3BKWA 3A4VA 2JKVA 4KBGA 4XDZA 4B40A 3BVPA 5LDDC 2ZULA 1O95A 3FCSB 2WYOA 3DE3X 3HUDA 1OZ0A 3E70C 2HY7A 1RAAA 1T36A 4N76A 1JAIA 3F96A 4FZJA 3PNMA 3UT5A 1CULC 2IELA 1UFRA 1YZ3A 3BTUA 1GWNA 1GTL1 2E37A 2JLWA 1KHHA 5HK8A 4OHWA 1LSUA 1Y5IA 2VIIA 5FI0B 1RQ2A 4YT4A 2EG9A 3KJXA 1PJRA 3BM5A 3I6YA 1Y9JA 5KZMB 2Q5CA 3TBFA 2Z6UA 3RIXA 3VTZA 1GZ7A 1FSZA 3PFHA 2QVGA 5K3FB 4BCBA 4B79A 2X6TA 4KXMA 4PSCA 1VECA 1BYUA 3A1DA 2ZWOA 3IEVA 4B3GA 4DM4A 3FCCA 5E6UA 5F3RA 1AKTA 4AXBA 1G291 3PXBA 1W5SA 5DKFA 3NTOA 1UK8A 2IODA 2GDZA 3P32A 4KBYA 1RDFA 4TKLA 2UZ0A 4WVFA 4ALJA 2NUAA 2XNSA 3AUKA 1FRNA 2FPUA 2DYKA 2M6SA 3GJYA 3I30X 3OEHD 5EPOA 5JZVA 1T35A 2QTFA 6ABPA 3GLFA 3QQPA 1L7DA 4X6YA 3L8EA 5AK5A 5FJIA 2MYPA 3KWLA 1C2TA 1KEVA 1ZA1A 1ZI8A 2VUUA 1W9MA 4MB0A 2GYVA 4FT4A 1WZCA 3DL0A 3T61A 3EDCA 3HXQA 1KOJA 1JIVA 3A1WA 3EEIA 4LNUB 1EXMA 2VJCA 3WTBA 1OD6A 3OX4A 2DUMA 1F8XA 3MT7A 5FAKA 1MHPA 1NBMA 2OPBA 3O38A 4R1SA 1HFKA 1CEQA 4YJ2B 1TO2E 5T6BA 5KU7A 1G55A 4KQ6A 4R6WA 5LOVB 5BP7A 2OP0A 5CW1A 1AS0A 1N0WA 5SZJA 3DD5A 4NYMQ 2WKPA 4Q6BA 5C7YA 1ZUNA 2VA9A 5CDHA 2IIPA 1F6DA 4W5RA 3U13A 5DNCA 5TDHA 1CRQA 4YUZA 1KZ1A 1XVAA 1JQAA 3WIOA 1RE0A 3FX2A 5KHOC 2A3RA 1CIJA 1HG0A 2CSXA 2QJOA 1NVVQ 3D4NA 4OFXA 5DXJA 1K9VF 2HGSA 4WOKA 1XU7A 1QGED 2B0JA 4AJIA 4EJSC 3AOEA 5C51B 1XROA 4RHUA 1O4VA 2BMFA 2WSMA 1PGJA 2XDQB 3D7MA 4RKQA 1XDZA 1PV2A 1KAHA 1QONA 1FSSA 1OZHA 4J29A 2Z3WA 2IYNA 3B13B 3CRNA 4J2OA 2YVQA 4RFLA 1NJFA 1PJTA 3L0CA 1K8ZB 4PYKA 3QK7A 1KK1A 1TCCA 3QX7A 3MOGA 1NKSA 4YRTA 4IXTA 4LRSB 4Q9JA 4WSOA 1JVSA 1KEUA 4QJIA 4LE2A 3G2KA 3WL5A 2WPNA 2OORA 2XUKA 3JY6A 4H15A 2KB0A 3AIOA 1XZCA 2B8JA 3OIDA 5LB4A 3V00A 4GX2A 4R41A 1SBTA 2GTIA 4K7JA 5EKUA 4ZMSA 2C07A 2P67A 3GAZA 4NS1A 1RU3A 5K3FA 1HT2E 3AINA 3ZU5A 2YN4A 3Q7TA 2I67A 3GAMA 1G8YA 3DVSX 2WI8A 3M6IA 1CIPA 4MV8A 3BB1A 5K01A 2ZATA 1NBMD 4NYJR 2CXTA 2X42A 4M1WA 3W5IA 3WIVA 4K46A 1VHTA 4CM6A 1JUDA 1R6DA 3FIJA 1U4OA 3G0IA 3GLGE 3BL8A 1RRPA 2CUNA 2ECPA 3GJRA 1VCHA 5CGQB 4C7JA 4B7AA 4AJJA 4R8RA 2NVBA 2ONYA 2GA9A 4RFSB 1SUSA 1QIEA 4INAA 4X90A 4XGKA 4RQAA 3W6PA 1KWKA 3MHTA 1VPLA 5DHSA 5EUCA 5FTNA 3L7NA 1C3EA 1Z9BA 4LNUA 4FUTA 2JH3A 4LJ6A 4ND5A 4HVLA 2PWAA 1XCMA 2Z1NA 3HU5A 3QUCA 1LRKA 2OEPA 4YJ2A 4GYKA 5EVJA 3Q6IA 1DELA 2R62A 4MHTA 2Q4DA 2XHZA 5CJ2A 3NT4A 2HIGA 1G2PA 3LHKA 1S2DA 2FKAA 2CNWA 4JK3A 1FRZA 4WOJA 1IIRA 5B37A 2NXJA 1ECGA 2R1VB 1L4BA 4B8YA 4EB3A 3NMUF 5IJZA 4WGFA 3SQDA 1Z4MA 3DC7A 3BSYA 1PE0A 2H4JA 2NYUA 4GXTA 4J0HA 4TT8A 4EWLA 5FOXA 2IU3A 4P54A 6NULA 4CZ2A 3W7BA 1AUQA 1NY5A 4X97A 1ZQ1A 2YZKA 4YDQA 2XDQA 5AVWA 1GARA 1ZH6A 4BDTA 3PQEA 1CJCA 4HEHA 5T67A 3B20A 1NM5A 1GCAA 4RJ2A 3SG0A 3ESRA 5LP1A 1SVIA 2FH5B 1ZU4A 4RVSA 1EDBA 3I01M 4ARUA 3OPVA 3L0BA 3UK0A 4JUAA 2CV0A 2N47A 5JNLA 2ODBA 3BRSA 4KNVA 4X84A 4F3RA 2RIRA 2LCFA 2NZ8A 4ZALA 3WG9A 2I2DA 3PDWA 5IBQA 3SLGA 3VKWA 4TYQA 2AJDA 2O1WA 1WBBA 3K6RA 4UKDA 3U3JA 2DUUA 3UA3A 4CMBA 4JNCA 2VDWB 4XLLA 3TLYA 3OJOA 1DKQA 1R5BA 1E60A 3R3WA 2HEIA 4UU0A 1JAZA 1DQZA 1D0SA 1ECFA 4LS3A 3WRYC 5TNXA 3WI7A 5ARCA 5C35A 3K0SA 5IWCA 5KDDA 4POOA 3EFOB 3K9CA 4RD0A 4KQCA 4IQFA 3NIFB 3K16A 4FIZA 4EYSA 2R6HA 4MEBA 3QWFA 3DDUA 5B5SA 1Q16A 1JMVA 2C7PA 2I9PA 1J24A 4QOEA 4O4HB 4DRXB 1Q19A 4RCVA 2CNWD 3SHTA 1L8OA 1N5DA 2AZMA 2WICA 2WJ4A 3N5CA 2IP2A 3IFSA 4RFSA 1K4MA 4IOLA 4DN6A 3AR5A 5AKKA 1QO7A 4RSGA 3EGCA 4DNOA 2OZKA 1KS9A 1IY2A 4TZKA 3BXOA 2BZ0A 3BTVA 2AVNA 1RYMA 2OZPA 3H6KA 1J1UA 3DYVA 4YUVA 1VL6A 3AHEA 4JROA 1PDOA 3ZGLA 2OAP1 3CH5A 4P0TA 2R1VA 4AY4A 4IR7A 2FCRA 4H31A 1DVRA 4NP6A 5HIIA 4PQRA 1M1YB 3V4OA 2ZZMA 4XD7A 5HE8A 3K1JA 4HFJA 3AT1A 4I4NA 4Y67A 2ZS7A 3RDPA 4RS4A 3TR0A 2NAPA 1WDWB 3ITKA 4D9BA 4L3OA 2G72A 2RSLA 5FLYA 4C0SA 1P3DA 1B6TA 1UXJA 1NF2A 2EFHB 3C4VA 5A7FA 1CNFA 3T4EA 2ERXA 3D6JA 3BHMA 2JI7A 5BN4B 1NVKA 2EFCB 1QFJA 3ZXYA 3IQIX 1BWSA 2DQYA 3NBYC 2V7TA 2VCHA 2EFYA 1U5CA 3GJ0A 1C41A 3V2IA 3IE0A 2V9ZA 5I9NA 1KK3A 2ZB8A 1B26A 5AW0A 3Q41A 4GC5A 4MUGA 2ZS8A 4Y1GA 2YZMA 2DLNA 1IWPB 1Q0LA 1EGQA 2PLWA 4I66A 4NFHA 1UEJA 5T64A 3QVLA 3SDSA 2XGSA 1TPYA 5B36A 2VDWA 4PHCA 2Q4RA 1UWVA 3S2IA 3VR0A 3ZGXA 1GR0A 2YMLA 4H27A 5G0UA 4MV6A 2ZREA 2DCMA 2X14A 5BOSB 1QGOA 1DCKA 1C9JA 2ZIVB 3DMTA 1RFGE 3HZOA 5KQRA 1ULUA 1NN3A 3EFOA 3M4XA 3OSUA 1XPOA 1RYBA 2PZEA 4NCKA 3SKVA 4JNKA 2FEWB 1AV6A 2P5YA 1SBHA 5BV0A 5IM4F 2I1VB 1LNSA 1DO2A 3P5BA 4O4HA 4UHDA 3ZCUA 4FFRA 4DRXA 1RKVA 3E3MA 4BNHA 2GD2A 3LSTA 4N8DA 5D2CA 1L5FA 1UOQA 4DMGA 2I99A 2R3SA 3CWZA 4QDUA 5CB4F 1ZHHA 4EO7A 2V7UA 2H7XA 4NCBA 3PTLA 4XD7D 4NEGA 3PC2A 3EH2A 4MR7B 4ZOLB 1L6IA 2FWPA 4ZQFA 3BJRA 3PE6A 3E2PA 4I8IA 5FBLB 5CA1B 4YR9A 1A2KC 2QTZA 3UPTA 1OYVA 4QBIA 2QG4A 4WKGA 3UK7A 1CJUC 1E61A 3TQQA 1DEAA 2PUJA 3CCBA 1XX6A 3DLTA 3VYVA 3HVKA 4OUDB 2B4YA 3CLUC 3ZNPA 1ECCA 1HUQA 1JDNA 1RRFA 4GQBA 2VLIA 1Z4NA 3EXIB 1QRDA 3NONA 4URVR 2ORIA 2UZ1B 5KNCH 2CDAA 4FYKA 1M1YA 4RCZA 2QVBA 1NZJA 4QXPA 3V2UA 2BFCB 5FOWA 2H54A 1JAXA 1FMTA 4FK8A 3KQPA 1L5QA 4HGNA 3SFTA 2PX5A 1ID8A 5JLJA 5C3UA 4IJUA 2ZI9A 4ALKA 1FU4A 3AP3A 3D6VA 3LF1A 2P2LA 5FP0A 5BN4A 1HF3A 2OZEA 2AOVA 2YJNA 4WDQA 4NBKA 4OV6B 3N2GB 1V45E 3OKFA 2AMYA 5CT9A 2VAXA 3LW7A 3SYNA 5JNUA 2AJTA 3F74A 1ONOA 3G5UA 1A9XB 4HGOA 3SR3A 3OLXA 1UXIA 1ZGBA 2Y9MB 5DNAA 3CRRA 3TNLA 1JSCA 1MV8A 3LDAA 1GL6A 1B0AA 2VJYA 3HUEA 1DUVG 3OECA 4RZ3A 3WAGA 3O4VA 4IMJB 4ZRMA 4L07A 3SLRA 1E6KA 2FI1A 2DPXA 4JI6B 4K6OA 4CCSA 5BOSA 2QAIA 1UKAA 5JV5A 2IW3A 3FVQA 1DCTA 5CYFA 4TX1A 3FZGA 1JHZA 5TGDA 2A9VA 2AOWA 1PFGA 4KE7A 2G1UA 5E4TA 3E4DA 4NBRA 3SI7A 3BSSA 3RRMA 3LUJA 5BWNA 4O25A 3RYHB 4IH4A 3S8MA 2YZ7A 1XQ6A 3PFWO 1MV5A 2J07A 1NDQA 2PLFA 3VBEA 1J8QA 2VOEA 4F12A 3NALA 1I3NA 2ACWA 1OFHA 2AN9A 3BWCA 3M2TA 1JXQA 2HRBA 1KHTA 1Q3TA 2EZ9A 1DUIA 2VEOA 1JJIA 3HU1A 2I8AA 4J1NA 3L6EA 4UTRA 4MR7A 3OFVA 4ZOLA 1YZGA 1JI3A 1KYXA 1M2GA 1SCBA 1XN4A 3CPHA 3LK7A 1JTFA 5IAOA 2VDNB 4HLUC 5CA1A 2UXCB 4ZCSA 1WW2A 821PA 3GARA 4TTAA 3U4HA 4RMNA 1KBQA 2HREA 1S7CA 1ZHOA 1U3TA 4PSDA 4OUDA 4RK5A 3BB4A 1RJFA 1TAHA 3GVHA 1T25A 4QBGB 2GPBA 3KSZO 5CHEA 1UINA 3EXIA 2WHRA 3JAKB 2UZ1A 3GEHA 4WNAB 1DINA 3LUGA 3UV7A 4P3NA 3UC9A 2BFCA 3F6PA 3KTDA 5T8KA 3DDNA 3VPSA 3R4VA 5JYEA 5MN5A 1I80A 2H4ZA 3PC6A 1IXRC 3QLUA 2DQKA 1EYZA 1V3UA 1FVHA 1TZBA 3FUWA 4M88A 4BNZA 3DM9B 4HQLA 4MVWA 1E6MA 3TRHA 4WH0A 4ZEVA 3HCBA 4LHWA 4NQRA 1WMDA 3GNLA 2ZSJA 1H6CA 3F8TA 1QNFA 2ARKA 1UBTS 3N2GA 4HNRA 2X5XA 4R01A 4EG8A 3C6ZA 3CYFA 1A9XA 1RTTA 3ONDA 1W6RA 2B1GA 2QN8A 2W83A 4A1OA 2F1OA 2GCGA 3QKSB 1MAUA 3GGSA 5AI8A 4NK4A 2RH8A 2O2EA 3A4LA 2B94A 3L4BA 4AF7A 2GLXA 4BJ6A 1XSEA 1B23P 4W63A 4P8RA 3RVDA 3T3HA 2PTHA 4G67A 3UANA 2CV2A 3P9CA 3L7DA 3O83A 1E4YA 3KJFA 2HU5A 3M6FA 3ZI4A 4AICA 1P44A 4PC3A 5CM2Z 4GP6A 1OUMA 4JJKA 1YB4A 3OJ0A 1KEEB 3OTQA 3A6FA 4Q03A 2WVGA 3A6HA 5ALOA 2GXSA 1NFRA 4LZAA 4EG6A 3MMSA 4EKDA 4W7HA 4GVPA 4I99A 4M0DA 2H1OA 1K27A 4RHTA 1CZOA 3KAJA 1P7YA 3FYUB 2XNHA 4YAGA 3PRHA 4RF5A 3OTWA 4ARBA 4EI9A 3RTAA 4IKEA 1LQTA 1YV9A 3DT8A 3RRZA 3RYHA 3TZLA 4CMIB 5JWOA 3ECCA 4YP1A 1QIKA 2QZZA 3NHAA 4ZAFA 2AKEA 4FFBB 5EKXA 3DFMA 1M73E 5FPTA 3TLCA 1V1RB 3HJRA 4EYGA 4YCMA 1AU9A 1KOLA 1K5PA 2WB2A 1RXYA 3A2LA 5I47A 1YFJA 1OBFO 1OIXA 2JS7A 4XIFA 2IJGX 3PXUA 4QUAA 3JYPA 5DGXA 1VFPA 4Q1EA 1KDZA 3T0GA 1N34B 2P4EA 5E1MA 1GM5A 4JR0A 3UJDA 4B4UA 2QP4A 2ZKIA 2QLNA 1FYVA 1WCIB 4IUYA 2UU9B 2J6HA 5FFMA 2QYTA 3JAKA 4WNAA 4EYEA 2Z8XA 5B30A 1CETA 3B6IA 2XUOA 3ASUA 1T4MA 3I34X 3MWEB 1IUOA 1OFVA 2C5GA 4F8EA 5BSGA 5JD6A 4XWWA 5I5EA 5AI5A 2OCBA 3PJFA 2W2QA 3EIQA 4TROA 1VKRA 5AVQA 2E5LB 1OGIA 1D1TA 4F04A 3RNLA 3JSXA 2OCGA 3FNHA 3LCMA 3OZAA 4HQFA 2VK8A 3HYTA 4J94A 3CNNA 4QECA 4QVKA 5HGJA 3FMVA 1HV8A 5K3BA 4GI3A 4Y6SA 3IXMA 3PC3A 4G26A 4YCBA 1OWMA 4G9GA 3EG5A 1VYTA 4FNAA 2D4AA 4I1UA 4J0EA 1F5NA 2ZUDA 4FDLA 3KUDA 4UXJA 2CDCA 1WHSB 3GF4A 2AT1A 4FINA 3D5EA 2NUPB 1F8YA 1R4MB 4JJFA 4QAQA 4LFCB 4DM3A 1RLOA 4F72A 3QKSA 5CMLA 3OU6A 1NR5A 2J32A 4ZDIA 3F73A 2GYUA 5EXSA 3WE7A 4IJWA 5H81A 5BW5A 2WUWE 3LVRE 3RK4A 1U3VA 4F2GA 5JAIA 2JLVA 1UT8A 5CX1B 2O0MA 4GECA 5IHPA 2FUG1 4QM6A 5BQ5A 3EN0A 3GRZA 1HSZA 1P91A 3MQ2A 4JAVC 1ITZA 1KEEA 3UMYA 2PJDA 4U8GA 3VU9B 2DH6A 4EYKA 3II6X 3QPDA 1ZOLA 3CLKA 2QVZX 2Y1DA 2IVFA 3DKPA 3FYUA 3DAHA 2A0XA 2XYHA 4HJRA 1W2WB 1ML3A 3RRBA 4R2KA 1E2DA 1V43A 2DZDA 2JFYA 4CMIA 5M29A 3HDHA 3OZUA 3PUJA 1NR1A 1N0UA 3BX1A 3RAPR 3DBHB 4NL4H 5DVZA 5AHXA 4FFBA 1FRFS 1ISIA 4CIAA 2YYYA 3W1WA 5JRJA 4F8JA 5BUZA 5J23A 1V1RA 2XOKA 3F7NA 5CT4A 5K8JB 3PVCA 5AOAA 1PSWA 3R75A 2WTMA 4YY3B 4K81B 4GAEA 4LRUA 4Y2RA 4Z7QB 2X3FA 3V7WA 2CF6A 5HMMA 4N7BA 4MRAA 1WP4A 3ZJUA 4P0PB 1NP6A 1QIGA 1DV2A 2WV7A 2RMKA 3KR9A 2CW5A 2V97A 1WCIA 2H1CA 3BZUA 3GJQA 3QVWA 5JD4A 2VHTA 4G9EA 1F8FA 4YB8A 4D44A 5HZGA 2H4XA 5EMNA 1GNPA 3NDJA 3A3OA 3WGJA 3DQPA 3MJFA 2XAUA 3QFHA 4J9VA 4KBFA 1WXEA 2NZJA 3MWEA 2EF0A 3KHTA 4R2LA 4RK4A 3T7CA 1CY2A 1P2BA 2Y67A 3ANMA 3VMMA 4CCWA 4U0KA 5IZCC 3NHMA 4LXIA 1VIDA 3O90A 3TJRA 3W6OA 5L6MB 2YV1A 3IPYA 4DDMA 2ZAYA 3OTOB 1EM6A 4NZ9A 2OO5A 5MHTA 1T9ZA 3H9JA 1GO2A 3GEDA 1RPNA 3GLTA 1L8AA 2YCLA 1DZIA 1HTTA 2ZB3A 1WHSA 4QOSA 1X38A 4KR7A 4MQEB 1GCUA 2P79A 3K1TA 3I1FA 2GILA 2AQHA 2NUPA 1R4MA 1U3UA 1X1AA 2ZWVA 4LWQA 4QXMA 1GOTA 1S2OA 1XEXB 1YUMA 1SOWA 2AGVA 2Q45A 1UFKA 2R6R1 2Z2ZA 4MS4B 4QHYA 5KJEA 4YAKA 5T4BA 1XCOA 8ADHA 3HNPA 1NOJA 1WUJS 1LJUA 3V7NA 4M60A 2E4WA 1S3FA 5CX1A 4W1RA 1YA8A 4I36A 2XIQA 3NT2A 3BFKA 1C2YA 2Y1FA 1PUIA 4K28A 3ETCA 1VZ3A 3F2IA 5ETJA 4V0LA 3TI7A 4DFDA 2IY8A 2PRSA 2XOKD 3VU9A 1XK7A 2I78A 4GH5A 5IK2A 4BQFA 1KRHA 2QVYX 5TJHA 3CURA 4R9SA 4TTIA 1GKUB 5AJXA 5AVVA 3I1IA 1I3CA 3OI7A 3ZH2A 4X24A 4MWBA 5E4JA 2HBZA 3E53A 4MW0A 4Z1MA 3CH6A 1JV2B 1Z7WA 3DBHA 3L9WA 4MAAA 1U3WA 4E5MA 5C4IA 1OMOA 3HB9A 4YMTA 4N0EA 1N2CB 2I7XA 4LJ4A 3VJRA 1SU8A 2XKJE 4F6CA 4FMBB 1ZL2A 2AOUB 4B6PA 5JJ5A 3QYJA 3UVEA 1UBRS 3NC0C 4PZCA 1ZUHA 2QB5A 1T2NA 2Z0MA 2XWSA 3ISTA 1Y8CA 4N82A 3TK1A 1CK4A 3L7LA 2VTVA 4L8YA 2QMEA 2HA6A 4PHTA 1L4LA 1NT4A 5AP9A 1MKYA 4H3SA 2JGAA 2W5UA 4GPD1 4QJ5A 2JB9A 1ZN7A 1YIOA 4TPKA 3CFYA 4IAOA 2FFBA 1HR0B 4FMPA 3QNUA 3W1VA 2BGNA 4TT3D 1LW7A 2FX3A 4WD3A 1NPYA 1OU0A 5C8ZA 3W9YA 4D1YA 4U6SA 3WISA 4A8JB 3ZVLA 5H9WA 2BGWA 3HB4X 1R0XA 4BL5A 3AFOA 4F45A 4UMVA 3HZZA 1W5FA 3IBTA 1MJ5A 5F4BA 4PPGA 4HQRA 3E0QA 3Q87B 5H82A 5TLSA 1Y82A 4NCXA 3CNEA 1CNMA 4LSMA 5DBGA 1T2CA 2VDUE 4MQEA 2XWQA 3ECSA 4PAQA 2B34A 2IYXA 3ZOKA 5B55A 3IXQA 5HQ3A 1GUDA 3E23A 3RQSA 4C89A 1XEXA 1R2QA 4WLNA 1NQVA 1LTQA 1W49A 4MS4A 5AJZA 3ZV5A 1ZOOA 1ULHA 2W0MA 3AW8A 3ADCA 3TTVA 1Q0RA 3FCAA 2V6MA 4G0ZA 1VBMA 4LW8A 5KYTA 2C5AA 4Z1MD 1E0AA 2QLMA 3KJNA 3OT1B 2FZ4A 2UUCB 3WIEA 1G3RA 1VSUA 5E95A 4EMSA 2PS3A 4I81A 1V0JA 3P71T 2QYHA 5K0BA 4MHSA 2FP3A 2HBYA 4KXVA 4CQLB 3A05A 4IP0A 4O8ZA 4KNYA 1YA4A 3N6XA 3F5MA 1SUWA 2PL1A 2P9GA 3D7RA 3FDXA 2F00A 4C5BA 4JI5B 2E5FA 3AEZA 4BS9A 1KY5A 3IEMA 2FN8A 2G88A 2GJKA 3IUMA 2QGZA 3JD3A 5AKIA 3GVXA 4OJKA 3TZCA 4NAHA 4D4IA 4DR7B 4GR5A 1N2CA 5JPDA 4DLPA 4MQFB 2C94A 4QRHA 2AOUA 3TFWA 2A3NA 4EENA 4W8GA 1E2LA 2RHBA 1ZGJA 2DKFA 2W6JA 3ZDEA 5JBQA 5FWYB 3EEYA 5CD9A 5M5BA 4FFPA 4YDSA 1F12A 2FRDC 1X1DA 4ADSG 2EC5A 5FBWB 5MN6A 3OPQA 1I7LA 1T2VA 4B3IA 3PGA1 3V8RA 1OT5A 2UVDA 1DU4A 2ZTHA 1T2EA 1NW8A 3OOJA 4D9CA 3RAEC 5LU9A 4QWWA 5AXBA 2R48A 3DWEX 5LWHA 5DULA 2E6KA 3C8ZA 2YQ5A 2C2XA 5FUQA 2WTEA 3A1SA 4L9RA 2I3GA 3QPBA 4MW7A 5A9SB 4HRAA 2ZDQA 1PV4A 3GFTA 1YE8A 3Q9LA 4A8JA 1IH8A 3G6WA 3WMRA 4BWYA 2ZYSA 1DP4A 4EVSA 1VKOA 4CG3A 3PS9A 1HZZA 3LUDA 4F4DA 3TSCA 4MB2A 2C7OA 3NTLA 1CZRA 1CUIA 2FPSA 2P5SA 3FZYA 5ADHA 4BRZA 4TVBA 1WZIA 4DM7A 5DGDA 4C87A 4XWOA 1I9CA 1S1CA 3OZBA 4CDRA 1L5ZA 4TYNA 2ONJA 1QGZA 3VOSA 3LC0A 1QO0A 1T5SA 3YASA 4JENA 3VKGA 4NV0A 2P7HA 1MGOA 1J7KA 4NOMA 1JHMA 2F1IA 3KKEA 3OURA 4YCDA 5CTJA 2NP6A 3WGZA 1U1CA 3AR3A 3H0EA 3BCSA 3NB0A 3TD9A 1E62A 3MTJA 3STWA 2VQFB 3VVBA 3HN2A 2IXFA 3VR2A 3FLBA 1W7AA 2Z58A 3NBMA 4CQLA 1U8YA 1EFLA 1FUUA 4LNAA 4RSRA 5IJAA 1F3OA 4HN9A 3I45A 1EFAA 3LVBA 2WTXA 5DEOA 1IJEA 3S81A 4MUMA 3LCCA 1IBKB 2FG5A 3PWSA 1C3LA 3UFXB 2ZI7A 3TSWA 2I03A 1FVFA 1MEEA 3TSYA 1YDEA 4ZPJA 1MDFA 3FETA 4RHXA 1ODLA 2FXIA 4MQFA 1FQJA 1TJNA 1LX6A 1P4JA 2HWXA 4DGQA 5THQA 1VIYA 5FWYA 1J8FA 1AKWA 1E9DA 4UEJA 4A5SA 4JU8A 4BBAA 5AQEA 2W6QA 4DARA 1OR8A 3HU3A 1FEZA 1HFWA 2JW5A 2WOOA 3Q6NA 1VG1A 1ZGZA 2PSSA 1QE0A 1DIAA 4O0MA 1O94D 3MCVA 2BEVB 3UCFA 1IONA 1LZLA 4G0PA 4PS1A 1P8JA 1XLTA 1G6KA 1AXGA 2VQSA 5AJHA 2DPHA 1XJWA 4JSRA 1JEDA 4M9ZA 1PG5A 2WYUA 2WSLA 4LBZA 1H2EA 5A9SA 1I3MA 4RQBA 2FWNA 2FMHA 1T2AA 4JLJA 4NIMA 5IVIA 1Z15A 4AYWA 4D6XA 4DQVA 3BH0A 2BCJQ 4QQRA 4DHEA 3AF6A 2XKKA 2VL7A 2JGEA 1LPSA 1GZSA 1PW7A 5JRDS 4HWTA 2E18A 3C3KA 1QTQA 1T1SA 1JQ3A 4N0MA 4JI8B 2JDIA 4UTOA 4GOOD 5B7PA 1IN8A 4PLHA 4ZI5A 4BNYA 1DAIA 2G4VA 5EXEA 3DDWA 5A06A 1NJ6A 2FSVA 2YYSA 4UBIA 4WX2B 3WLIA 1JQEA 2W43A 3U7JA 2GNOA 1XK6A 3RROA 3ZWKA 4P7KA 3RTBA 2KPOA 1KMMA 2AKAB 4EHBA 5TRTA 4QPNA 2QT0A 1CUVA 3H1EA 3Q98A 4MPPA 3DE7X 2X76A 3HMQA 2G67A 3OCCA 4M1TA 5EIOA 5FL3A 1DO0A 2O0LA 3VVCA 4X44A 2XUAA 5J2TB 2YJ5A 1H2AS 1HZJA 3ICOA 2ZUCA 4TM7A 5BT8A 1A9ZA 5JH7B 1MH9A 2WZDA 1SUFA 2FR8C 4H3KB 5F77A 3WAJA 1Y98A 2P9EA 3NP9A 1U8FO 2AMLA 3SSAA 3GYGA 3L4EA 3WWPA 4GOKA 3FDIA 5E38A 3TXYA 1PHPA 4YASA 4ZJUA 2ID7A 3NG1A 1IBCA 2HF2A 3JPYA 4DQ0A 4L74A 2DWPA 3E7PA 2FWIA 3TIXB 4TZ0A 1QFYA 4G1BA 2AC7A 4GRAA 4CCAA 3UFXA 3EEOA 4CU5A 3LIIA 2VO1A 3BUSA 4N3CA 3UO8B 4QICA 4JQOA 4NV1A 2IP1A 2O57A 4H08A 1Q7BA 4OBWA 1EKXA 3QUSA 3EZFA 2ZYHA 2ZR8A 3R76A 3M3PA 2OT3B 3H6HA 3DMGA 1WXHA 4YT5A 3DCYA 4RWZA 4MUJA 2BEVA 2RG1A 3DMPA 3BHNA 4D9NA 3H1BA 4GI1A 4YMVA 1VKZA 2FPGB 4IQ8A 2JHAA 3A28A 1WM1A 1O58A 1PNTA 3WKCA 1VXRA 3RSQA 1NQ5A 2EGUA 2GD6A 1Y3FE 2IPXA 1GQ2A 1C9EA 3O0DA 1E6UA 2QY9A 1VXOA 1X42A 1T9BA 5BMVF 3C3AA 3TECE 2FX2A 5J4YA 3EC7A 3FMOB 2B2XA 4XB6B 4Y1RB 3WQBA 3ZZNA 4S2UA 4JZKA 3BGIA 1EJ6A 3GJ4A 3OAAA 4N6NA 1ZJZA 3GYBA 3FBWA 3SJUA 4BNGA 4RYDA 4MQ4A 4F2DA 5A0TA 1Z6QA 2C20A 2FXVA 2YZGA 1QMGA 1GG8A 2IUSA 2Y4NA 3MXOA 3ORFA 4V0QA 3SQMA 5ICGA 2IA5A 4TL8A 3PNQA 5J47A 4ICIA 4UM8B 2ZJ3A 1XQ1A 5KB3A 1YR2A 1ZVQA 2BI8A 5C1BA 1I6MA 1LBIA 5A71A 3LUAA 3BC1A 5IVDA 1TPZA 2FEAA 4WZAE 2IDMA 3PQ6A 2B98A 1CZLA 1QYIA 3DP9A 3GVIA 4HGQA 3RVPA 1UBSB 3JYQA 2HPVA 5J2TA 1T0HB 3H75A 1T34A 3ZCRA 4BZXA 4EHKA 4DR1B 3DOEA 2WJZB 5JH7A 5JXWA 3BE6A 3VR1A 2CMGA 1SOUA 1Y4DE 3G8BA 4HAXA 3UOAB 4BU0A 3DAFA 1NBAA 3PK0A 2GS9A 1DWUA 1A76A 1AQJA 3F2VA 4R7GA 1G8KA 4Y30A 1PDWA 1CP3A 3K7EA 3Q2IA 2VSYA 2WB4A 3KXPA 4CM8B 2JLZA 2GXAA 2G09A 3A1CA 1OBVA 3HGQA 4G37A 2BJHA 2JA2A 1HBJA 1YDHA 4JEIA 3DYBA 3CZAA 3ACCA 2CLHB 2RKBA 1K06A 4M7OA 5E3JA 1U3GA 1QBKC 1H2HA 2GVNA 4DSOA 1CS4C 1R0RE 4IWYA 1RXVA 5A1TA 4UUNA 2HL6A 2DT8A 3GDWA 3IPCA 5KCZA 1ZBDA 4MULA 3TL3A 3LDUA 3CONA 3IB3A 4U7DA 5KYNA 2JG3A 1Z5UA 3BGVA 4JB2A 2XEXA 2ZXEA 1RBQA 3GGOA 3L7KA 2VEDA 5L6LB 1EE1A 1VBKA 4EKIA 4CV0A 2FPGA 5IC5A 2CXXA 5LD2C 1GUAA 3H05A 1ZSYA 1KO1A 2AXNA 3OY7A 3G2PA 3B1YA 3SQOA 2QR5A 1RMTA 1LSSA 2NSLA 1IY0A 4QBTA 1ZVMA 3ZNQA 1NQUA 4BE7B 4EAQA 1LI5A 5KOHB 4W5QA 1Q1QA 3WNCA 1S8AA 3EDQA 4G25A 4YP0A 3MUFA 1Q3KA 5I5GA 3IIJA 4ZV4A 4Y1RA 4NMXB 2DFKB 3ONEA 3FTPA 1V5GA 3K05A 3MS4A 3JXEA 4K1XA 1BFDA 3SZUA 1PKXA 5FB3A 5JOQA 3R6LA 1SUPA 3RYFB 5K0LA 5IFLA 4G4GA 1G59A 1G8SA 1QPZA 2KX7A 4YAJA 4RVUA 4IJVA 3AV3A 2QX6A 2VYNA 1T5OA 1JFLA 1W52X 4LXQA 5EIEA 4CLOB 5G1NA 4FYHA 2X86A 4HDSA 1VI2A 2PZKA 3R24A 1NQAO 1G3MA 5E4YA 4AM8A 3T1YB 3N53A 1RIIA 1D9XA 2G4LA 5FRDA 3F5FA 5IXYA 4YRPA 5KKAA 2H08A 2SICE 3FUCA 4AECA 1VPWA 3I2HA 2QTVB 3SZ3A 2Q5QA 2BFNA 2YDXA 3GBPA 1QS0B 2Q3MA 3QVJA 5AK4A 1MO4A 4M0PA 6PFKA 1QYVA 3SHFA 1SCJA 3HV0A 2IUEA 5EZYB 3T1VA 3F6SA 2QZ9A 2BAGA 2D1RA 3I5MA 4IIVA 4DXAA 1ZJ5A 2WM2A 1ZH0A 1K7CA 3LC2O 1SUBA 1W29A 4YRBA 4XIIA 3MG9A 1RIFA 3RVMA 4CM8A 3CUEF 2IEDA 2GBLC 4DQKA