1G5TA

The three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo-atp form
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
157
structure length
157
Chain Sequence
ERGIIIVFTGNGKGKTTAAFGTAARAVGHGKNVGVVQFIKGTWPNGERNLLEPHGVEFQVMATGFTWETQNREADTAACMAVWQHGKRMLADPLLDMVVLDELTYMVAYDYLPLEEVISALNARPGHQTVIITGRGCHRDILDLADTVSELRPVKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords COB(I)ALAMIN ADENOSYLTRANSFERASE
publication title Three-dimensional structure of ATP:corrinoid adenosyltransferase from Salmonella typhimurium in its free state, complexed with MgATP, or complexed with hydroxycobalamin and MgATP.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 53
structure length 157
sequence length 157
ec nomenclature ec 2.5.1.17: Corrinoid adenosyltransferase.
pdb deposition date 2000-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02572 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g5tA00
1XCGB 4XVQA 5FOSA 2Q3MA 1QG4A 3D7MA 2JLQA 4J0QA 1GKYA 1Z08A 3GEEA 3NDPA 4RD4A 1HTWA 4KO8A 4OQXA 4TLCA 2FSIA 2R2AA 2QP9X 1GDDA 2AWOA 3KTAB 4LV8B 4QGGA 3RANA 5HZHA 4LJ4A 4G0NA 4F91B 3FKSA 2W2VA 1KMHA 1W44A 2WJIA 4XOIA 2GXUA 4NDZA 1UKVY 5EZ6B 5KSZA 1HYQA 1US8A 3K0AB 3A4NA 2OXRA 1E1QA 2V7QA 4WZAE 2GZHA 2FV8A 4O25A 2LWIA 3BIFA 1TX4B 4OBEA 4JLBA 2IYTA 4TMKA 1N6IA 1KO1A 4BRWA 3U7EB 1NP6A 2ZRBA 3VHXA 1W36B 1IY2A 1L2TA 2FZ4A 4LBYA 1GIAA 3KQHA 2G3YA 1KI8A 1TAGA 4DEXA 5EZ5A 3A37A 5K8TA 1D9ZA 2ZPTX 5BQ5A 2NZJA 3WMFA 3QF7A 2IYXA 3CUEF 2F43B 3V00A 2G0NA 3TW4A 2ZUBA 5DYGA 3LVRE 3AF3A 1MH1A 3NEYA 1MR3F 1NY6A 4K81B 1BOFA 4O3MA 2HLDD 3CR8A 3Q9LA 1D2EA 2IX3A 4RD1A 4TYPA 4AYXA 1G64A 1KK1A 3TR5A 4GDFA 2WAYA 1RYHA 2G88A 1GITA 3PUXA 4B3XA 4OKSA 1SXJC 1NRJB 2B7CA 4Q03A 5FL7D 4IDPA 2IXEA 2QY9A 3THOA 4G1UC 3W6OA 4NYMQ 4DSTA 4BZQA 3BBPA 3O8BA 2REXB 4EPXA 2GETA 5FI1B 2QGNA 4G5GA 1FP6A 2DPXA 5FUYA 3FHOA 2OUKA 4CEHB 1TEXA 3B5JA 1E1RA 1IJEA 1Z06A 2OLKA 4M1YA 2D7DA 2NGRA 3GCGA 3U61B 3MMPA 4XD7A 2WKPA 2ATXA 2JLXA 2PX3A 1MO4A 2VF8A 1AA9A 2JJ8A 4C0QC 1YR7A 4URXR 2JIZA 3WYAA 1HQYE 2WHXA 4HATA 5HZKA 1J2JA 5JHHB 1W0KA 3OIVA 2WV9A 1CU1A 1NVWQ 4IHQA 4V0LA 2QAGB 2VEDA 5HE8A 4PHFA 2LKCA 1J8YF 1Q0UA 4Q02A 3AKDA 4BLPA 2DB3A 3U3OA 1M2OB 4QL3A 4JJZA 3ZD6A 4P4SB 4XIGS 3QKTA 4ZI3A 4PPNA 2W6IA 2VIIA 4AC9A 2ZSAA 1S96A 4NBSA 5D3MB 1XMJA 2NOAA 3T5GA 2JAQA 3P1JA 2A5YB 1COWA 1W4CA 2ZI7A 3BWDD 1GP2A 2CK3D 4XSGA 3VU9B 5FH9A 2OV2A 2WBLC 1XD9A 4XSHA 3RDPA 2ZRFA 1NVUQ 4QRHA 4OYHA 2AFIE 5TVKA 3SJAA 3G0HA 1GILA 4LUCA 1E2JA 2RB4A 3K70B 4OK6A 2GZDA 5JJIA 4LHWA 4RD6A 5J4HA 1SVWA 3LW7A 2WJHA 3JZMA 2MSDB 4GOKA 1U0HC 2ZROA 4U00A 2OFOA 3U3MA 1T0HB 4JLAA 5GADl 1ZBDA 3VX3A 4NL4H 2NO1A 4GZLA 2IYQA 2ZSFA 3IIKA 4Q4LA 3IGFA 1TU4A 2GEDA 4BECA 1E0SA 1KKMA 3NVAA 2WOOA 4EJSA 3O8CA 2OCAA 4Z54A 3QBTA 3B6EA 4XWKA 2OFXA 5FPHA 4D81A 2FDCA 4YDSA 3PVSA 3VTKA 1OSNA 4QBGB 2XB2A 2ERYA 4ZV4A 3F8TA 2Z4SA 2OAP1 5LB4A 1HQCA 3AV0B 4D0GA 3GJ0A 4MYHA 4HSEA 4JZKA 5GJWC 2OFWA 3AVPA 5BXQC 4D26A 4PPFA 1NN3A 5FFMA 2QN6A 1F2TB 5DH9A 4PSAA 3RRYA 4AG6A 2JLRA 1VPLA 1W46A 3SYLA 4DUGA 4ERNA 3BERA 3AF0A 3B60A 3I5XA 2BBOA 2H18A 2VP6A 4B33A 2IK8A 4HAWA 4I1VA 1KDTA 4M1SA 1G6HA 2QUZA 1G291 3AVWA 1IXSB 1E0KA 3MG9A 4DLSA 1G7TA 2ZJBA 1D6JA 4C9BA 3OEEA 3TSWA 4Q19A 5JFGA 3MWLA 4P3YA 4WZ6A 5SZKB 2QM7A 2G77B 4JLMA 1Q1ZA 5JS8A 2NQ2C 2D06A 4ASUD 1JBKA 3A1SA 2XZLA 3U2QA 3HDTA 3VR4A 2GWHA 3TLXA 4Q1CA 1N6HA 1NN1A 4HYYA 1RRFA 2YHSA 2V1XA 1YZGA 3K0CC 1ZD1A 1N5IA 4UJ5A 2ZYUX 2GXAA 3EWSA 2ORIA 2RGBA 2QTVB 4DBLC 2BJVA 1KNXA 5FPYA 4JL6A 5CJ2A 3VFDA 4JL5A 4JBWA 1D5CA 1R8QA 1KDOA 3R9IA 1NSFA 3EA0A 4S35A 4E22A 1R7RA 3AP1A 3LY5A 3VR2A 1I4DD 2QMOA 3I62A 1J99A 1QHNA 1S1CA 1ZUIA 4MGYR 3FKQA 6Q21A 3A4MA 2BC9A 2VTKA 4K46A 4QBIA 2Z5FA 3QF4B 1UAAA 3QUSA 2YV5A 2ZRGA 5P21A 4P4TA 5L3QA 3GPLA 5AJWA 2C04A 4EFLA 4LYAA 4Z1MD 1EXMA 2ZRNA 2Q9AA 2OCPA 5SZHB 4LHZA 1E4YA 2CEAA 1JR3E 5TMPA 2V6JA 4PO8A 1E9CA 2ZJ2A 2XXAB 4TT3A 1MABA 2IC5A 2EWWA 2WWFA 2QTFA 3ND9A 4JBYA 4Q9KA 4Q4HB 4WXRA 1XEFA 2RGNC 4NH0A 4V03A 3THWA 2PLRA 4LC0A 1R10A 4PFSA 5AWFC 3AKCA 1E2EA 5F9HA 3CR7A 4M1OA 3KDSE 2YNMA 2NPFA 4QKQA 3SDZA 1DO2A 5FR1A 3H2YA 2HV8A 2WPDD 4DB4A 3GFTA 4HZUB 2WJYA 1WBDA 4ZDKA 1GM5A 4RD3A 1BMFA 2BJWA 1XZPA 3QEJA 2FPLA 4ZCIA 5CYPA 5EE3A 4GP7A 3GLHB 5JI3E 1Z0AA 2F1JA 1TQ2A 5KDOA 1UKYA 2GCNA 2OCBA 2FG5A 2HDNB 2ZYVX 3MLEA 4N0EA 2KB0A 1LW7A 2P5TB 2J45A 4V02A 3TQFA 1YRBA 3EZFA 1CR0A 2ANCA 1U99A 1KO4A 2X2FA 2JLSA 2MMCA 2NIPA 3MWKA 1GZSA 4AG5A 1JB1A 2JJ2D 1GKIA 2XNDD 3GJ4A 3MWYW 2V55B 1FPMA 3OFND 2IWHA 2XAUA 4ZIRA 3CF6R 3KX2A 3UWKA 2RGEA 3UATA 1JPJA 2WICA 3A36A 4OHYA 5EXTA 3CRVA 4NHOA 3UMFA 5CIWA 3HYTA 3T1TA 1G7RA 1G8HA 3Q85A 3TVTA 1Z6AA 4V0ME 4PHTA 1Q44A 3ZIAD 4RVCA 1KMHB 3ZQJA 1YR6A 1US8B 1E79D 2QE7D 3MGCA 4Z51A 3VMFA 3TVDA 4CT4B 3LBIA 5KDDA 1NIJA 3REGA 5J4KA 2Z0MA 5C18A 3SHFA 1QHHA 4OQNA 1Q12A 1N6NA 4I4LA 4HLQB 5HKKD 3GLFA 1WE2A 2R44A 4CEJA 4A2WA 4DIEA 5CB6A 1XXHE 4MKIA 4C0HA 8OHMA 2HCBA 1TF2A 4DVGA 4TSFD 1Z5ZA 4OI1A 3RRNA 2IF2A 4Q5IA 1KAGA 5DYIA 2EFCB 1K5DA 1YZLA 3FTQA 2GF9A 4FMCB 4GI7A 1PLJA 1DELA 2VSOA 1R5OA 4JLNA 2XOKA 1SVLA 2ZRHA 1L8QA 1N6KA 2J87A 4AY2A 1P5ZB 2ZI4A 3DKVA 4PAOA 2H92A 1EFRA 1IY1A 3TAUA 4RD0A 1N6OA 3DVLA 1SHKA 1T8TA 1XEXA 3FMIA 1UFQA 4BZPA 4US1R 1GG2A 3WBKA 2WAXA 3TKLA 3L43A 4GBMA 1LB1B 5CIQA 3EZ9A 4MRRA 3RRMA 3ICEA 2ZSEA 3BORA 2CLCX 2XZPA 1CJKC 4PC7A 1S2MA 4ABYA 2GJAA 4JLJA 4Q1AA 1Q21A 3OE7A 4MRSA 3WNDA 2HEIA 4B3CA 1Q3TA 4L4UA 2FN4A 2JDID 4NKRA 2IHYA 3PJRA 1XJQA 1YE8A 2CVFA 3IDQA 4HAZA 4MYUA 3L8ZA 4IOMA 4NYIR 2IS1A 2F1HA 3UMSA 2ZR0A 1DAEA 3CZQA 2WIBA 1X6VA 2O8EA 3KUDA 3THYA 2ZJ5A 4BZXA 3AKEA 1AZTA 4JJKA 4KCGA 4CGZA 1OIXA 4C0JA 4EPYA 4DB2A 2CL6X 4HAYA 3TSZA 1RJ9A 4X8LA 3DO6A 3KJEA 1KJWA 1VIAA 2BM1A 3K0CA 1Z83A 1LF5A 2A5GA 3H84A 4IFEA 4BFUA 3U44A 3CX6A 1QRAA 1IXRC 3N2IA 4GPTA 3LQQA 5FOUA 2CLSA 2J46A 3PXGA 3ZZUA 1G8YA 2RCNA 5CLQA 2YC4C 1YR9A 4URYR 2QQEA 3Q72A 1G3IA 4KI0A 3BH6A 3KZ1E 2O8FA 2HJVA 1CLUA 1NLYA 4G5OA 1OHHA 3QEOA 1CJMA 3IUYA 4L16A 3LAWA 4BUJA 1Z6XA 2A5DA 2GZAA 5IT5A 1WQ1R 3VHLB 4JVNA 5C1BA 2H57A 3GLGA 4OJKA 2GILA 3QPWA 1RRCA 3RHFA 1Z3IX 5DN6A 2E9SA 1KK0A 4N3NA 3QIAA 2QL6A 5LPNA 1CR1A 1OFUX 4TQ9A 1OH7A 3CKLA 1E2FA 1ZIOA 4GMXA 3CH4B 2V54A 4PTLA 4EJSB 1F3OA 3KKOA 1E2DA 2OXCA 4D4KA 3SFZA 4UKDA 3QOFA 1NBME 2AN9A 4A0HA 3SJBA 2LKDA 1N2CE 3CB4A 1KI2A 2WZQA 4LV5B 4TLDA 1G17A 2JCSA 3LXRA 3R9XA 2F1RA 1JR3D 4KITB 1A5TA 3CW2A 3ETLA 4NYJQ 3TQCA 3A1WA 4PAMA 1E2PA 2XX3A 1X8KA 4B75A 1XX6A 2H17A 4LRWA 3S1AA 1OT3A 5C46F 521PA 2F55A 1QZXA 1GKUB 4Q47A 1TEVA 3SFVA 1HT1E 2Q9CA 3RWMB 3WNCA 5JI2E 2IT1A 4CW7A 3AF2A 5H70A 4G01B 1PJRA 2VHQA 1G21E 4ITRC 4EPTA 4RZ2A 2WWHA 3KXKA 2DCUA 3QENA 1P2VA 3OESA 5KSYA 1D2MA 2QMUA 3PEWA 1LVGA 2W83A 1CS4C 1KAOA 2UZ3A 2V4ZA 2EYUA 2JEOA 1N0UA 3BRWD 1IQPA 3CPHA 2PT5A 1EWQA 5BN5A 1SKYE 2BOVA 2IYVA 4F4IA 5JWHA 1L7VC 2LCFA 2DWPA 1KGDA 4FINA 3HJNA 1IOZA 3AVYA 4UXIA 4WA7A 1W36D 4TL6A 3SQXA 4B3GA 1N25A 5E7MA 3ASZA 2VL7A 4QHYA 4RCZA 1IY0A 2ZEJA 1BYIA 3ADKA 5EUQB 3O8DA 2VLIA 1CTQA 1EFTA 3Q7PA 2QBYA 2F9LA 1UBCA 3EIQA 4LHYA 4RY2A 3GJ8A 3W6NA 1E6CA 2P2LA 4CYMA 1Z47A 1ZW6A 5FL7A 5G41A 3GQBA 5F2EA 1TF7A 4IJMA 1BYUA 4PC1A 1E2IA 2DR3A 1NLFA 2WWWA 3ONWA 4W9MC 3GLHE 1AZSC 3WYFA 2QPOA 1VG9B 4D0LB 2J7PA 1HY3A 3N2EA 1P9RA 5J40A 2N42A 5DIFA 1ZNXA 4M9ZA 4Q4AA 3GFOA 4IEIA 2O8CA 4DZZA 5AR1A 3UG6A 5JHGB 3RSLA 1JPNA 5L3QB 3KQNA 2ATVA 3QPUA 1ZM4A 2AHOA 5JECA 3LFUA 1M34E 2O5VA 3EPLA 1ZD9A 4RKFA 1IN8A 2J59A 2JATA 3QKUA 3GJ6A 3I3SR 5KSPA 1DAIA 4PC2A 2FFQA 3MJHA 3KQLA 1GL7A 1GWNA 3BFVA 4RKEA 1MABB 2QPAA 3THXA 5KHOC 5F3WB 4TN1A 1RC8A 2QSYA 1RRPA 5CLLA 1KSGA 2ZJYA 2EFHB 2E87A 2JGNA 2NO9A 3KFVA 4A6PA 5JEDA 1DADA 3ZGXA 1Z2AA 3THWB 2GBLC 2ZRLA 4O2LA 3DHWC 3I72A 3RNLA 1P2SA 621PA 1TTTA 1T3LA 3KKNA 4UXHA 1ZNYA 2QSZA 1KI9A 1IJFA 3TMKA 2DHRA 5EXXA 1WP9A 1UF9A 2A30A 4IEEA 2VPPA 1P4SA 1XTJA 1AQYA 3LLMA 3QKRA 2ODWA 2FSHA 2ZI6A 1FTNA 4W5HA 1JALA 1KJZA 1W2HA 1Z6GA 4G5RA 3UWOA 3B7GA 1XTIA 4RZXA 1G8GA 1E9AA 1ZM9A 1XF9A 3PEVA 4BWYA 4NYJR 1VG0B 2QZ4A 2IYSA 2GEUA 1JXMA 3CBQA 2C9OA 3OIWA 4PPQA 5TV2A 2VP4A 5L8VA 3T12A 4P33A 1AGPA 3WNBA 3OAAA 3ZZTA 1KNQA 1VTKA 2QRZA 2VP0A 4BFYA 1KI3A 3K09A 4NCJA 5JMTA 2WMOB 2EQBA 4AKIA 3K70D 3G5UA 3AP2A 2YVUA 4Q4JA 2R62A 3A1TA 1XPOA 2Q9BA 1NJGA 1Y63A 1G5PA 4C3ZA 1R0ZA 4ZIRB 4YMWA 3NBYC 4A15A 4YMVA 1LFDB 5K8IA 2YOGA 3BAFA 2H5EA 3AQ4A 4LJ7A 4BE7B 1OH8A 2O52A 1GL9B 3BH0A 4EPRA 2HJGA 1M74A 1XP8A 3BK7A 4TMVA 5DSZA 4DSOA 1FMJA 4MRNA 4D4JA 4II7A 1KO5A 4M1TA 4DKXA 2H7VA 4GT1A 5FTMA 3U60B 4FMDF 2HXYA 1VCMA 1KSJA 1Z22A 5EE0A 3CO5A 3DL0A 5G3ZA 1DAKA 1G3MA 5BYJA 5IHPA 3RC3A 2WWYA 4KFTA 1QHHB 1H8EA 3LVQE 3GLFB 4CEJB 1DO0A 1QDEA 5CK5A 2GK7A 5BYKA 4Q1EA 4Q66C 1C4OA 4QHSA 2HUPA 3C5CA 4B74A 1O87A 3GJ7A 5TARA 4B2IA 2ZS7A 4GMDA 1S4QA 1OW3B 1W0JD 3NBZC 3NKVA 2P65A 1Q3HA 3FHTA 4BLSA 1Z0FA 4Z8XA 1SULA 1KK2A 4Q1DA 1Z28A 2PCJA 1Q1BA 4GL2A 2JJ1D 4LYHA 3EPJA 2BKEA 3QVVA 3W3ZB 2WWGA 1N6RA 4WOPA 3V9PA 1G7CA 4HLUA 3C15C 3ADDA 4MH0R 2BBTA 5E3HA 4BFTA 4LPKA 1AKYA 1FP7A 1G41A 3QVUA 3W5IA 1NMZA 1H65A 4C0LA 1G18A 5CDFA 2OBLA 2ZE8A 3EG5A 1B23P 4CF7A 1NBMD 1W48A 4Q7MB 2B8WA 2ZJOA 1VYVA 4MKFA 3FYHA 1G16A 4D82A 2AXNA 4JLKA 2PLFA 3O47A 3UKDA 4OK3A 1LTQA 3AVXA 1II8A 1OV4A 1ZM3A 1U90A 2G0TA 4PHHA 4QGHA 2OZEA 2O8EB 4NCIA 2YWEA 2R6GA 4HAXA 3E2IA 4OK5A 3V4RA 4XVRA 3THYB 2F9MA 2QRNA 2R65A 1T3SA 4FMDB 1G5TA 2ZVQX 1P9WA 3MJRA 1RJ9B 1KO7A 1M6NA 2ZU0C 3W34A 2X77A 4F93B 2OT3B 3QI2A 1CRQA 4LWZA 3VR1A 1XMIA 3FGNA 3QG1A 1I2DA 3QPVA 3RS4A 4D80A 5TB5A 3PUVA 3VR6A 4D25A 1EFHA 2ZJZA 1G4AE 3U44B 4JVLA 1KI6A 2IWRA 1BKDR 1T0JB 3RYTC 1S8FA 3CH5A 4R71A 2WTUA 3I8XA 4DDUA 2WPDA 4ESHA 2MSCB 3CX7A 3X1XA 2O8FB 3R7WB 3R20A 3R8FA 2C98A 1F2UA 5DGXA 3DM5A 4DWJA 1SVSA 2G1JA 2IYUA 1DTSA 1R0WA 4JKIA 2GCPA 4C4PA 3GLGB 2RHMA 2GXQA 4AKHA 3LA6A 4OHWA 3BB3A 2FOLA 3AF4A 4DXAA 4C30A 3RSOA 1UBFA 2J3EA 3L0PA 4LOAA 2QORA 1HEIA 2ZUDA 3JVVA 2NMVA 1TL7C 2A5JA 4ACBA 4B71A 1XNJA 1JECA 3UPUA 3EIEA 5JCPA 3RRZA 3LH5A 3U3KA 1L4YA 3BOSA 3OFNA 4M53A 1VYUA 3KQKA 1U8AA 1GNQA 2ONJA 3W9YA 4AKGA 5TXGA 2P0EA 2PZEA 4X8MA 2GBLA 1KZ7B 4KODA 1PLLA 2CNWD 1E0AA 2FFHA 1BH2A 2GJSA 3CONA 4HDOB 4OQLA 3RS0A 1W36C 4C0KA 1JJ7A 1YKSA 3KB1A 2J0UA 1VIYA 4IOKA 3F3YA 3ZIAA 1G19A 3EX7C 1I4TD 1X8JA 2ZU6A 2OM2A 4TMTA 1XTRA 2EFEB 1S1MA 1YZTA 2ZI9A 3EXAA 4NU0A 5J47A 3C41J 2IS4A 2XGJA 3S1AB 5AK0A 1UKEA 1Z0JA 1XZQA 1MO3A 4DLYA 2C78A 1AN0A 2YC2C 4JYBA 4EPWA 1OE0A 1F60A 4WAUA 3T1QA 1Q22A 5UKDA 1QHSA 1FUUA 3FKSD 3T06B 5HKKA 1ZP6A 2E1RA 1E2MA 2J9RA 2QROA 3KXIA 4MA4A 4ZCMA 3AVUA 1MRNA 2FPMA 4C0SA 3B8HA 5A4JA 1NG9A 2CCKA 2OHFA 1XB2A 5EQTA 1QHGA 1YR8A 2JA1A 3D31A 1D2NA 3SYNA 3ZVMA 3T34A 1FL9A 3IIMA 1RKBA 1RE0A 4IXMA 3IO5A 1XD2A 3LWNA 1KI4A 2Y8EA 2YWGA 3IILA 2F3TA 3K8YA 3NH6A 3E70C 4JVMA 4TL8A 4URWR 2BEJA 5J4YA 1YVDA 5EUMA 4PZZA 2EFDB 3E1SA 2XJ9A 3LXXA 3WBJA 4U02A 2WJGA 1UEIA 2ZRMA 2C95A 3MRSA 4V0NA 4A8JC 1NSTA 2CBZA 2R6AA 3BB4A 3L0SA 5FOTA 2QBYB 3SHWA 1GTVA 2A7QA 2ZRKA 4A0FA 1P72A 3SR0A 3TSOA 5BW8A 3TBKA 4DT1A 3FOZA 4QNMA 2QEQA 4A82A 2QAGC 1CR2A 4BFWA 5J4LA 2NO0A 1T9HA 3ZS9A 4KJZA 4C2TA 3Q7QA 4PC6A 3U6BA 4U7DA 2PJRA 5DO9A 4Q4AB 3WY9A 1QBKC 2O8CB 4N1AA 3D3QA 1VHTA 2PX0A 4EKDA 1JQLB 2RH5A 4PXAA 4QBHA 4QFMA 4Q9LA 1AQUA 4DDVA 4R2IA 4B48A 1KI1A 2IUSA 4LJ9A 1EG7A 3FMOB 2O8BA 2WVJA 1KTVA 5E95A 4PHGA 1E2KA 1XJ0A 4RZ3A 3FWYA 4IKEA 2RHDA 1NVXQ 3KJIA 4LDJA 3K70C 3I4LA 3SQWA 1A82A 2OE2A 1GL6A 1R0YA 3THXB 4OI2A 1ZAKA 2OLJA 4XTRA 3I73A 1Z6TA 3CNOA 4KSBA 1S3SA 1KYIA 4XD7D 3PCRB 1SXJA 4UNRA 2V1UA 3EARA 1TF5A 3GEIA 3VR5A 4D6PA 2JIZD 2F7SA 4Q01A 1RZ3A 3BC1A 4M9SA 2NTYC 2ZJAA 4MGZR 4NYIQ 3L82B 5M04A 3NWJA 4PC3A 4JYCA 4DLTA 1Q20A 3P20A 2J0VA 3P4YA 1N0WA 1EESA 5EXSA 2BCJQ 4AURA 1A2KC 3P26A 5FUXA 4LV6A 4JS0A 2G9NA 4E03A 5DNYB 1OIWA 1E9RA 1AS0A 4WVFA 5FOXA 1DARA 1XCMA 2EWVA 1U98A 3A6PC 2OO7A 2GXSA 3PUYA 1W7AA 3ICQB 1G4UR 2XTZA 3WXMA 4DCSA 1E4VA 2UZIR 3QNUA 2BM0A 4E5UA 2CHQA 4KHZA 1GRNA 2JASA 4R9UC 4LI0A 3T61A 4ARZA 2ZJ8A 3L2OB 1ZUNB 4ILEA 1AK2A 1UJ2A 5JBQA 1ZMXA 2YJTD 3ZS8A 4G5SA 2CCJA 1Z0KA 2HF9A 1CJUC 3B13B 4Q4JB 5CB8A 3UIEA 5DHFA 5CYOA 2F3RA 3GJXC 4JLPA 4GOXA 4YLGA 5SZIA 1Z29A 2BMFA 4LY6A 3GMTA 1YJ5A 4BFSA 4QM6A 5DHAA 2J7KA 1Q1QA 3LNCA 4DDWA 1SVKA 4MYCA 3VR3A 1G8PA 4E07A 3H86A 5BN4A 2KI5A 1JR3A 1OXTA 1RIFA 2W6JD 4Q1BA 4TZ0A 2P6NA 3DDCA 3KXLA 2REBA 5G3YA 4MKHA 1W47A 4FWTA 4GNKA 2AKAB 3AF1A 2VHJA 3V4FA 3WRXC 2QMEA 1VYTA 1S9DA 3CM0A 3GFPA 2RGXA 3IIJA 1T3HA 1VG8A 1GVNB 4QC2A 4TLEA 1TU3A 1NN0A 3H1TA 2N46A 3M6AA 5FR2A 1R2QA 1RVDA 4LCBA 4LGMA 3IQWA 3EA5A 5FL3A 4LJ8A 5GJCA 1TQ6A 2QT0A 2G83A 2G1KA 3PITA 4BLTA 2C5LA 4ACAA 1OFTA 2GJKA 5DI9A 3KJGA 4AWXA 4IVQA 5IK2A 2VO1A 2IEYA 3GEHA 3GJ5A 2CE7A 4NONA 1N0VC 4M9QA 2AKYA 1V5WA 2ZRIA 4TL7A 3BJIC 1U0JA 1OB2A 4NCKA 4YQFA 2HYIC 5HCIA 4O2RA 3AGPA 3B1YA 1XPRA 5FPTA 1OIVA 3KKMA 5FUVA 4R2HA 2FFBA 2FJUA 1SVOA 4F4JA 4ESVA 4AD8A 1Y3AA 1R5BA 3D8BA 3PQCA 1KY2A 4EDHA 2HF8A 4V0KA 1UPTA 2FWRA 1RRGA 3RS2A 2ECKA 2OSBA 3AKYA 2FE4A 1H8HA 3W8RA 4OJQA 4CRWB 1ZRHA 2GCOA 5KOYA 1P2TA 1W4RA 1LS1A 2ZR9A 2ONKA 2P3SA 3X1ZA 2J0SA 4V0MA 5JEEA 2W0SA 1OB5A 2DY1A 2EYQA 1N5LA 1II8B 4Q21A 4A0GA 2IS6A 3UG7A 2WSSA 3KUCA 2I3BA 4P4UA 3WHKA 3RC8A 2GAAA 4A0RA 4B76A 2V6IA 1F6BA 2CHVA 3DMDA 1UDWA 3WMEA 4M1WA 1R8SA 2WWIA 4M9XA 1WF3A 2GVDC 3SBEA 3HP1A 2ZAMA 3DZ8A 4D0NA 1KK3A 2KBEA 4JBXA 4OQFA 4QJ4A 1FX0A 5L3RA 5CM8B 2EW1A 4B43A 4JIMA 1G8FA 4A8JA 2IBMA 1EFUA 4TWZA 2ZITA 1KMQA 3HU2A 1XXHA 3NC1C 3Q5DA 5KUTA 3JZAA 2QU8A 1E2HA 1E9BA 2W2XA 5AJXA 3SZRA 2Q3FA 3F5FA 1U9IC 1KI6B 4TT3D 2D3WA 3ZVRA 4ZI2A 5DLQC 3B85A 1K8RA 2VP2A 3WRYC 3SU8A 2FSGA 5FTLA 5B30A 1SKQA 5EE5B 2JLVA 1N6PA 3TRFA 4DIDA 3B1WA 5H68A 4DEYA 1WXQA 2KBFA 3VNUA 4HAUA 5FBRB 4EQ6A 1UM8A 2ODNA 3PEYA 2JLZA 3AVOA 2DFNA 2ANBA 1Z07A 3TUZC 1EGAA 3P27A 4IW3B 4KLNA 1WDTA 3B9PA 4HDQB 4B44A 2J1LA 3EC2A 1IONA 4JSTA 3LLUA 4WIAA 3H4MA 4ZPXA 3K0SA 3NHAA 5ANRB 4DCVA 2BKUA 2RGNA 3I1FA 1EWRA 3KJHA 3PR1A 3GLIA 2IXFA 4B73A 2RGDA 3FDIA 3QKSA 1TQ4A 4TMZA 4A9AA 3EZ6A 1W1WA 1MOZA 2XZOA 1OFHA 3HPQA 3SBDA 3CX8A 4BLQA 2JLWA 4Q9JA 2C9CA 2C2HA 2FGKA 2J0UB 1JEDA 2ODBA 3ASYA 5GVSA 2ZQ5A 1HV8A 2XSZD 4IRUB 2GHIA 3M1IA 2R6CA 4HAVA 4FWIB 4YMUA 2QP3A 5BWMA 1NF3A 3KKPA 2DYKA 4PR0A 5JZVA 1PVOA 1Z6YA 3QY0A 5FTKA 1FW6A 4CIDA 2IL1A 2FMXA 2IUTA 4HB3A 3C7KA 5FBQB 4QJ3A 1ELOA 4C2UA 4JKYA 2F1IA 3AUXA 4AK9A 5AUNB 1ESNA 2ZYWX 3F0TA 3LQRA 2A78A 1SGWA 4GZMA 1T91A 4O0MA 3IQXA 3JVUA 5JSZA 1U81A 1CIPA 2CJWA 4LHVA 3VKGA 3WP1B 2CLDX 5BN3A 4JT2A 1QHYA 2OILA 4FCWA 3DPUA 4F4CA 2OBMA 1XD2B 1II9A 2IYZA 5HTKA 2HLDA 2JJ1A 2GJ9A 4TLBA 3RWOA 2BEKA 3DZDA 4P31A 4EAQA 1OXUA 4B3FX 2BV3A 2O0JA 1NMXA 4QHTA 4POAA 1P6XA 4W7SA 4MKGA 5HCNA 3X1DA 4XWOA 4M2LA 3FMPB 3BB1A 4FN5A 4IFBA 1LV7A 2ZE7A 2YOHA 2GK6A 4LBVA 2BCGY 1J8MF 3DM9B 2AK3A 4DT1B 1NMYA 5TDHA 1XRJA 3A4LA 4GFDA 4C0BA 2ZRDA 3FE2A 4B35A 3SJZA 1YQTA 1NBMA 5EE1A 5LB2A 4PZLA 4YC7A 2VHCA 4Q48A 3CRRA 3LBNA 4P32A 4PPGA 3I5YA 4EFNA 4TMXA 3ZVNA 1PUIA 4EUNA 3CIOA 4QGFA 3VX4A 3RS3A 1Z8FA 4OHVA 3B2EA 3NG1A 4TYWA 4PANA 3EW9A 2GNOA 2IYWA 1AS2A 1DEKA 3CLVA 3K9HA 5FPSA 4UQOA 1G1MA 5FTJA 2O8BB 3VAAA 4F7WA 4MDEA 1ZIPA 1Z0DA 5DI3A 4B3BA 2FFAA 2AD1A 1AM4D 2GF0A 4LZZA 2GRJA 5E7JA 4WXPA 4LJAA 5LBIA 1XWIA 3OEHD 2NPIA 3MCAA 3HR8A 5G53C 1W4BA 2WWXA 4DSUA 3SE0A 5CITA 4IDOA 3TGPA 1W4AA 1SXJB 3NDBB 1VCOA 4JLVA 4ZO4A 5E7IA 4FXPA 1ZCAA 1OPXA 5SZJA 2CK3A 5LD2C 2QA5A 3ZVLA 1CEEA 1OH6A 4EJSC 3BE4A 4H9GA 2CDNA 4QGAA 2A3RA 4FIDA 4W5WA 4RFSA 1VCNA 1G20E 2GVZC 4F92B 2ASEA 2C77A 2WJJA 3MFYA 4PSVA 4GRAA 1WBBA 2GKSA 3ADBA 1OFIA 4IVPA 1OKKD 1N3BA 1B0UA 3AVVA 1TMKA 3G82C 4YXWD 4ARZB 4LSGA 1P7CA 1OHHD 3ZDQA 1QHXA 5C2JB 1M8PA 3C5HA 3ZYCA 1RFLA 3N5CA 1U8YA 4QBFA 1ANKA 2VQSA 2GAOA 1V43A 1PUJA 4MUBA 1GSIA 2ZUCA 1KDRA 2VA8A 2YKGA 1CR4A 4LBWA 1U9IA 2FSFA 2X8AA 3K1JA 1XJCA 3NH9A 1D9XA 3DOEA 4B6EA 4R7ZA 5HPYB 3M0EA 3K9NA 1OF1A 2A9KA 5G40A 4JMPA 2CXXA 1X1RA 4NPHA 3EPHA 2GEVA 2VHUA 2XITA 4FD2A 4MITA 2OESA 1DPFA 1L4UA 5JWRA 4M22A 3T35A 2AXPA 1HA3A 2FPKA 2IF0A 2DFTA 3CWZA 4IDNA 1C9KA 4PQRA 5CM9C 2VBCA 3HR7A 4S2EA 1J7KA 2H16A 2GTPA 2Q6TA 4MRVA 3K0FA 3NHBA 1OXVA 4TLAA 5IRCD 2RGGA 3AP3A 2D4HA 4ASUA 3H0KA 5B58C 4YMTA 1P9NA 2AFHE 2ZM5A 4TYYA 5JLJA 4XWAA 1J70A 3I8SA 4HUQA 1JR6A 4IOJA 4KFUA 2IEZA 5H1YA 4OHZA 1ZINA 3P4XA 1XFAA 1XEXB 2ZS8A 1DAGA 3PFIA 4NZYA 1M7GA 3WMGA 2BMEA 1WCV1 4HB2A 4NP6A 4OL0A 4X8HA 3EC1A 1CXZA 1OLOA 2C96A 2ORVA 4TYNA 1Z63A 5A0FA 1XTSA 4L9WA 4M0LA 2B21A 2N1BA 1LY1A 2B6HA 1GNPA 2QT1A 2ZR7A 5AUOB 4L15A 2RGCA 4ZKEA 3K9GA 4OI4A 2UKDA 2OAQ1 1GAJA 1SVIA 1IAQA 3U3RA 2Z43A 1HE1C 1IM2A 4Y0AA 3ZLJA 2PEYA 4K8OA 1P73A 3PENA 4DLXA 3CRQA 1S9HA 4UNPA 4DLRA 4B2PA 4PZYA 2R9VA 5EE9A 2ZIAA 2GCOB 2BIFA 1CULC 4Z1MA 2FEMA 3MSXA 4TTPA 1GNRA 1PLKA 2UVQA 4M8NE 1P60A 2WM9B 5FOVA 1FNMA 2J7PD 3TE6A 4YMSA 1IN7A 1KSFX 3FFAA 4DRZA 1Q57A 5EP2A 1NL3A 2XNSA 5FOWA 2V9PA 1FX0B 1AIPA 1QVAA 4AYTA 4XVUA 2WIAA 2CE2X 4A8JB 1LS6A 3MD0A 1DAHA 2BDTA 1E9SA 1JAHA 1XXHB 2A2ZA 3WP0A 4KVGA 3QE0A 1NI3A 4MRPA 5KYKA 3HU1A 2IXGA 3W6PA 1R4AA 4TZ6A 3AEZA 1R6BX 3IBGA 2QMHA 3MUFA 2OCYC 1NG1A 3W8NA 3VNVA 3FVQA 1O3YA 1N5KA 1E94E 1ZYUA 2ZRCA 4UNSA 3X1WA 3U3JA 3AB3A 3U5ZB 2RMKA 4EQ6B 5AUQA 5FBLB 1T8UA 1NKTA 2JJ2A 5EXPA 4RCYA 5TY0A 4URZR 4B34A 3ZD7A 1RYFA 1FFHA 1G5RA 2BWJA 2XNDA 2O0KA 4I1SA 4IOLA 5AJZA 2YWFA 1ZNZA 4ZDJA 421PA 4C0AC 3RS5A 4OI0A 5AUPB 1ZVQA 1FMLA 2IS2A 2VYFA 4TQUS 3GLIB 2VSXA 1MT0A 1A2BA 2NO7A 2X2EA 2EVWX 3OAAD 4I81A 3QKSB 2YYZA 1JEEA 3K53A 1EFCA 4BGDA 4GP6A 2O8DA 4Q9IA 1S0UA 2W6JA 4XH9B 2B7BA 2HT6A 4US0R 1ZU4A 2QM8A 3BGWA 3SN6A 3U7GA 5JJLA 4XTCS 4PO9A 1E79A 1TADA 2QE7A 3AH8A 2Q21A 2J0QA 1YZUA 2D7CA 3I32A 5KO2A 3CNNA 2WKRA 1HE8B 1C1YA 2PH1A 2FNAA 1OJLA 5F98A 5GVRA 2PMDA 3AUYA 3I61A 1ETUA 2WOJA 5EJEA 2HXSA 2D2FA 4ZDIA 2FH5B 4Q7LA 5KSOA 4LBZA 2DBYA 1E1QD 2V7QD 3A8TA 2RAPA 2XTMA 3MAAC 4TSFA 4D4MA 3U4QA 3WYGA 2YWHA 3EPKA 5CJPA 1XMVA 5JSZB 2GDJA 2W58A 4DC9A 1QVRA 1ZUHA 2A5FA 2CJWB 4H1UA 1RPZA 3AVTA 1N6LA 1KJYA 1E3MA 4PQYA 4BFZA 1CBUA 2PMKA 4FCVA 5C4GB 1BS1A 3ECCA 3ZQ6A 1X3SA 2IYYA 1NLZA 1H8ED 4LYFA 3MWJA 4RZUA 1XDBA 1SXJE 4UXJA 4NYMR 3TK1A 4LJYA 1XPUA 1G3RA 1YHNA 2VSFA 3IPYA 1N5JA 2KWIA 5AJYA 3X1YA 4MGKR 1E32A 4D4LA 1G3QA 4IDHA 4HLDA 2AL7A 4C7OA 4TMWA 1U8ZA 4HLCA 1IN5A 3L0IB 2QAJA 1JI0A 2JDIA 4B6FA 1U0LA 2PBRA 4HI0E 4PSKA 5K8LA 1R0XA 5KPDA 2JLYA 3B82A 3QQ5A 1TPZA 1W5TA 2DWOA 1X1SA 5JJKA 2YINC 5J5CA 1W2GA 3BD9A 1UEJA 5L3SA 2V8OA 3IO3A 1EK0A 1GRRA 1XCPA 2PL3A 2ODEA 3J81k 3OHMA 5DI3B 5FBWB 1ZU5A 3U7FB 4AYWA 1E1RD 1UADA 2NO6A 2O0HA 2P6RA 3CRMA 3FFBA 5A5GA 3R8CA 1R5NA 1AKEA 3IHLA 4KSCA 2PT7A 1JJVA 4FMBB 1T4GA 4CEIA 2PZFA 4PX9A 2AD5A 4ZCLA 2MSEB 3KKQA 3EWAA 1E2GA 1E96A 1W0KD 2ZAOA 3EZ2A 4TQAA 3K9LA 4UNQA 5F9FA 3W3AA 4F38A 3TAHA 4A2PA 1FTSA 1P75A 1E2QA 1NJFA 2HT1A 1EX7A 4BPBA 2XB4A 4MGIR 1DVRA 2XEXA 1SQ5A 1SKYB 2P6UA 1OYYA 3QKRB 2YOFA 3DMNA 2BHRA 2WMNB 4QXAA 2TMKA 4RFSB 1VECA 5FUWA 1CKEA 3UK6A 4DCUA 2W6ID 3U6KA 3GLFE 1VHLA 1NY5A 1ZD8A 1NIPA 1T5LA 2XJ4A 1COWD 2R6FA 2P5SA 3IBYA 3IKJA 3NTUA 4JL8A 4LYJA 1M7HA 2D74A 4PAQA 5FI0B 1KI7A 2AR7A 3SI7A 2ZYTX 1PZNA 3TH5A 3SNHA 1E9FA 3RLFA 4WZBE 2PZGA 4HB0A 4EPVA 1F48A 5LDDC 1YZNA 1WMSA 2ORWA 3KFXA 3TUIC 1MV5A 3QJYA 4MDFA 2F6RA 5B64A 4XJXA 1E99A 3QXCA 4FMCF 4JVSB 4QG7A 1XMSA 3BFKA 3CZPA 4X8OA 4HEJA 2CCGA 1HUQA 3OIUA 4UNNA 3U7HB 3B1VA 3Q3JB 2FU5C 2ZSBA 3NIBA 4IVRA 4EIWA 5CK4A 2VP5A 4NCHA 3B9QA 4HUTA 1GRQA 4RSGA 4M4SA 3SOPA 3BH7A 1ZCBA 2FZLA 1TNDA 2XSZA 1CRPA 2V3CC 5AJVB 4LJ6A 2VHTA 4DJTA 1YU9A 4Q7KA 1UDXA 721PA 3O8RA 1SZPA 3AM1A 3KTAA 2C03A 2CMKA 4DSNA 4Q18A 1D8TA 3SC3A 5L3VA 4OHXA 1KY3A 5KDLA 3QXHA 4V0OA 5E4FA 1E69A 3I92A 3OF5A 1KHTA 3K0AA 4BRUA 5H8WA 4DUGD 3K0FB 3VKHA 5KPJA 4JLDA 4QJ5A 4CVNA 2ZRPA 2ZXUA 1UBGA 4LC1A 2C8VA 3HYRA 4KBGA 4HB4A 3ZZ0A 4A2QA 4HUQB 1WB9A 1XTQA 4BFVA 3CF0A 3LO5A 4KV9A 4CZ2A 3P32A 3OEED 1S3GA 1KKLA 1VCIA 4DLWA 2KJQA 3IPXA 2CHGA 2GJ8A 1DOAA 2GA8A 3FHCB 3OZXA 2H8KA 1TQDA 3AGQA 2BVNA 1JXOA 2BBSA 2DFKB 2F43A 1P3JA 1I4LD 1ZNWA 4LHXA 1RW4A 1QHIA 2K5UA 1KDPA 2QPTA 3B1XA 2XTNA 3PG5A 2ZVPX 1A1VA 4A36A 3GLGE 2WSMA 4L5BA 2DWQA 2Q0HA 1BO6A 4GOJA 3IEVA 3LX8A 3HU3A 5C4MA 1AJEA 4TL9A 1VG1A 1WA5A 4H1VA 3SS8A 4IDQA 2ZANA 4NTZA 2ERXA 2DFLA 1OH5A 3E5HA 4UJ3A 4MQBA 5KNBA 3SJCA 1FQKA 1E9DA 1IN6A 1DE0A 4KFRA 1F5NA 3GJ3A 1XBTA 3B1ZA 1FNNA 1UBEA 4JLOA 221PA 4WW0A 3WHLA 3DKPA 3C4JA 4DLZA 1FUKA 3OIYA 3FB4A 4CEHA 3RS7A 3T5DA 1KOFA 3QXSA 2FF7A 2L0XA 3TNFA 1IN4A 3GLIE 3CF2A 4KXFB 3EIHA 3PV0A 3CRW1 2ZE5A 3OEHA 4PO1A 3UXMA 3LDAA 4MUAA 2H1LA 3QXXA 2IHBA 2RGAA 1A4RA 1IBRA 3A1VA 4BEBA 4G3XA 2QAGA 1KSHA 3K09C 4Z8YA 4I1UA 4B2LA 2NG1A 4A4DA 2BMJA 4TYQA 1HT2E 1P61B 1X8LA 2GESA 1E0JA 1SHZA 3NBFA 3K0EA 2QG6A 4P4SA 1F2UB 1MKYA 1T5IA 2FA9A 4AIIA 1SXJD 4L9SA 5D3MA 1A7JA 4CDGA 1JNYA 2X1VA 3KQUA 3BFXA 3X2SA 2JLUA 2WKQA 3GP8A 5IDVA 3NC0C 3PEUA 3ADCA 2EU8A 2ZTSA 1HH4A 4QNRA 1OKKA 1Q1EA 2G6BA 3ND8A 3VU9A 2FX3A 3UMRA 2SHKA 4M21A 2OG2A 1BMFD 2Z83A 121PA 3C8UA 4Y0VA 1E98A 1VKJA 4YONB 4YXWA 3R7WA 3SYKA 4CT5A 1IXZA 3T1OA 3D6TB 5IF9A 2ZI5A 1E9EA 4LK2A 1E2LA 5KU1A 3TUJC 4URVR 1NVVQ 2BMDA 2ZREA 2J5XA 1ZC3A 3T15A 1GOTA 4KYIB 1EX6A 2IW3A 2J41A 4HZIA 3Q8XB 2CVHA 1K6MA 1QG2A 3HPRA 1T6NA 4AKEA 1M1YE 3VQTA 2QNRA 3NEJA 2QGZA 5FBVB 3TR0A 3Q5EA 1E2NA 2YZ2A 4U5XA 5LD2B 5JCZA 2O8DB 4GSYA 4NCNA 1PV4A 1K5GA 2P67A 3BS4A 4A1FA 3BXZA 1G6OA 1W5SA 1XU4A 4DCNA 3IEUA 1M7BA 5GJBA 1KO8A 4KLZA 4BLRA 4FW9A 2ZSDA 2R6DA 4URUR 3QG5A 1YZQA 2PEZA 1AS3A 1ZC4A 4HLUC 3RABA 4BFXA 1P62B 1F2TA 2IUUA 3W90A 1XEWX 5JRJA 2IA5A 4KFSA 5EP4A 3FPAA 2C99A 4LX0A 4I1OA 3CNLA 4DHEA 3U4QB 1X86B 4M1KA 1W0JA 4B32A 3TJZA 4I99A 4P0TA 1MO6A 1CF4A 2BBWA 1OXSC 2I1VB 3A58B 1Z2CA 4RJLA 4US2R 5D3QA 3IHWA 2IYRA 4JSYA 3DOFA 1G3UA 3M4YA 3PIRA 4KVAA 2ZE6A 1FQJA 4HDCA 2FGJA 1DG1G 3GD7A 4TTRA 1G7SA 1IHUA 4FCTA 4N0DA 1VMAA 2I4IA 2OEPA 4M1MA 1XTKA 4Q1FA 5JRZA 1NN5A 4FI3C 4WBSA 5KTYA 2QP4A 1HURA 1SVMA 4Q9HA 3RVBA 1ZM7A 2W00A 2KE5A 3L8YA 1XD8A 2QTHA 2Z4RA 3C14C 3NXSA 1TUEA 2NZ8A 3T1VA 4BLOA 5KNDA 821PA 4C7OB 2XOKD 5IK2D 2ZETA 2ZRJA 4B47A 3N70A 2AWNA 4JT4A 1EFRD 2Q3HA 4BQSA 2X19A 4DLVA 1Z0IA 1OYWA 2OBNA 3KB2A 3EZ7A 3PUZA 4IXNA 2QQ0A 1DBSA 1U94A 2D2EA 1ONBA 1NKSA 1DAFA 1II0A 1LNZA 2PJZA 3TW8B 2W2TA 1DS6A 4NE2A 4ON9A 2ZS9A 5DE3A 1QF9A 2CL7X 4W5JA 5KNCA 3FMFA 5ELXA 1MRSA 1VDZA 2B92A 4DDTA 2QENA 1BIFA 4QOSA 3CPJB 2KSQA 4NMMA 3OE7D 3ZH9B 3QSYA 4A6XA 3ZJYA 5L3SB 3QF4A 5JS7A 4EFMA 5J4VA 5FPKA 2CL0X 1ZM2A 1UKZA 3AVQA 3LRPA 1H8HD 1YRAA 2REOA 3REFA 2AX4A 2WJVA 1TUIA 3CPEA 3LBHA 5DISB 2C9YA 5B57C 2ZRAA 2WSSD 4RFVA 1ZJ6A 2HCJB 5JWOA 1JAIA 2EFGA 3PUWA 4R98A 1I2MA 3LV8A 4BASA 2VH5R 2XXAA 3CWQA 4D2IA 1G9XA 4Q7JB 1NVVR 3W5JA 2HYDA 5FTNA 4LPSA 5HE9A 1XEWY 1CP2A 1JQJC 3HWSA 4MYTA 2B8TA 4Q4HA 1ODFA 3LW8A 5GJVC 3SEAA 5HR5A 5EP3A 1CJTC 4G5QA 4KAXA 4ZDWA 1NNEA 4TTQA 2RKOA 3DEFA 3R9WA 4E09A 2VP9A 4RD2A 1KZGB 2AK2A 1P2UA 4HZUA 3EAQA 5K8UA 1DAMA 1KIMA 2QI9C 3QBVA 2R8RA 1WRBA 1GFIA 1YZKA 3B78A 4L8GA 4CEIB 3GLHA 4KU4A 1ESMA 4QM7A 5DN6D 5B2ZA 1FOEB 2ZI3A 3LX5A 4DLUA 1LF0A 4ZKDA 3C16C 1DG3A 3NBXX 4YDHB 3QXJA 4KYUA 4PQFA 4BEJA 2CNWA 1J90A 1CJVC 3KL4A 1MO5A 5EP1A 3LD9A 4B3DA 2D62A 3L0OA 2MMGA 4Q00A 3TIFA 3UANA 4KBFA 3EASA 1W49A 2FEOA 3A1UA 3VKWA 4DCTA 2PCLA 3RAPR 4A92A 4AI6A 1U2RA 2VF7A 1FZQA 2VRWA 4LJ5A 2W0MA 5CDFE 2I1QA 1AGRA 1OXXK 2IYLD 4OQMA 1GUAA 2Z6VA
chains in the Genus database with same CATH superfamily
1XCGB 3GFQA 4XVQA 5LQSA 4CM7A 1QG4A 4MCJA 3QUQA 1P7PA 3RYHB 4I55A 1GKYA 1Z08A 2BFFA 3GEEA 3NDPA 2RK3A 3ORHA 3FCAA 4OQXA 3PFFA 4TLCA 4LV8B 1GCUA 3H5NA 3D3NA 2JAUA 4F91B 1NBOA 4K9PA 4FNAA 3HZRA 2E37A 4D8YA 2WJIA 1FF9A 4XOIA 5EZ6B 4F6RB 1UKVY 4TGLA 4CLXA 3QW2A 1HYQA 1V3TA 1VC2A 2Q1YA 3K0AB 1EP3B 2VHYA 1E1QA 3BXHA 1ZW1A 4WZAE 2GZHA 4O25A 1A0OA 4OBEA 5DSTA 4N7JA 3IJRA 1R37A 1G20A 1OMOA 3B6ZA 2RAFA 4YRRA 5H59A 1N6IA 5SICE 2C7BA 3IOCA 2YXEA 1U0GA 2OWEA 4AJOA 3U7EB 3O74A 2ZBEA 1S2LA 2UVPA 2D59A 2HAEA 1ZCFA 2O2YA 2PRIA 5I8ZA 2H52A 1CQJB 2FJ0A 4LBYA 2I7TA 3AKZA 4R3WA 3EGIA 3JQRA 2R85A 5TMDA 5TF4A 4N76A 3KHUA 2DX7A 1JG2A 1TAGA 1RWNA 3EIWA 2JCGA 4I2NA 3QF7A 1L8AA 3CUEF 2R87A 1ISHA 4A91A 4KOAA 3HO1A 1JHUA 1Y0BA 1XCBA 4NEGA 4HWKA 3RRFA 5CPBA 2G06A 4YT8A 3M1AA 3IC5A 4RS3A 3NEYA 1SB9A 2X9QA 4FEEA 4XGRA 1ZDMA 3B7WA 1KQFA 2BE9A 4ZXPA 1C7RA 2A1UA 3A4YA 3VOTA 3LDFA 1NI4B 1D2EA 1U8CB 1GG8A 3NM4A 2PWZA 5KQSA 2IX3A 1G64A 3QELB 1KK1A 2FEPA 5GAJA 3G8AA 2Y1GA 1X2EA 1FDRA 1TKBA 2FPWA 2VUHB 1U4SA 2WAYA 1R6XA 3BMQA 3PUXA 4FYPA 1FDSA 1SH7A 4JB2A 1L5MA 4UBJA 2VDMB 4AO7A 3OJCA 3WLMA 1UDBA 2K7ZA 3BTVA 4MGHA 3H9GA 3V4VB 4LVNA 4G1UC 3I23A 3VSCA 5B6JA 3TF5A 5KNLA 1NUTA 5KOIA 3MWEA 1SU8A 4FYVA 3WK7A 4RPCA 3O8BA 3K35A 4CI9A 3JY6A 4MV3A 1V2GA 4ARAA 1JSZA 1USWA 1T4MA 4G63A 4EUEA 3QX3A 4J0IA 1GUBA 2MSNA 1Q0RA 2QGNA 5FI1B 2DPXA 2EX4A 3O8OB 4CIVA 1D0VA 2G36A 2I2CA 2IOFK 2YMMA 4J0GA 3QHAA 4C3OB 4CM8A 4RTRA 4O08A 1C9YA 1IJEA 1M2JA 2IIBA 2J5BA 2X0RA 5TPWB 1KPHA 4DTIA 3SSMA 3BSWA 4X90A 3GCGA 3RU2A 2RGRA 3RV4A 5CGZA 4XD7A 1KMIY 4UDOA 3VYUB 3HUFA 2R4QA 1AA9A 3ZU3A 3QM1A 2FPXA 3PJGA 1HQYE 2WHXA 3MTGA 4HATA 1K97A 4M0PA 3V7FA 1W0KA 5HZKA 4Z99A 2NVWA 2F59A 2WV9A 3NAQA 4MQMA 5BQOA 3R7NA 4DARA 1NVWQ 2VCYA 1M54A 2QAGB 3BK1A 3NIDB 4Q82A 2VEDA 4KQFA 4DC1A 1MZVA 5LYYA 1Q0UA 4BLPA 5REQA 3DOOA 3TZLA 2WC1A 3OEWA 1IPEA 3CG4A 1LDNA 1M2OB 4JJZA 4XIGS 4BX2A 2ZIWB 1XTZA 3D3WA 1Y34E 5JBNA 2Q27A 2VIIA 4AC9A 2ZSAA 1CV2A 3WNVA 3HGMA 4F97A 3T5GA 5IASA 3DMRA 4K9RA 4UVHA 1FDIA 2YVKA 2Z04A 1SQ6A 2QW8A 2A9FA 3G6KA 2DFDA 4P84A 3T0IA 1E5DA 4PYKA 2OV2A 2WBLC 1DDIA 1XD9A 4IH4A 3CZ9A 5FH9A 4QRHA 4OYHA 2AFIE 2OTCA 4HBGA 3KYIB 1E2JA 2PH5A 1XCLA 3UYLA 4QGSA 3LCUA 1GEGA 2VBGA 4LHWA 4RD6A 3T7DA 4HEHA 2I6FA 2WJHA 3FUWA 1Q84A 1JJIA 3B48A 2B7LA 3HEAA 4U00A 2OFOA 3V2UA 5IT9A 3RUAA 4AT1A 3VX3A 3OPYI 3PLRA 4NL4H 4OHPA 3B70A 5DXJA 1BDIA 2NO1A 1SJ9A 5ICFA 3X3HA 4BNIA 2FK7A 3TQIA 1OAOC 1EM8B 1TU4A 3HKDA 3MC1A 3PF8A 1JMKC 3VVLA 1RLUA 3DLIA 5LZ9A 3CRZA 2WSIA 3HLTA 3TQSA 4BGEA 1FVHA 3VM6A 3I42A 1DX9A 1PYGA 3NHRA 5E9QA 1BE6A 1PO7A 3D8RA 4QBGB 1NAIA 4GKVA 4PN7A 1ACMA 4LFBB 2J3JA 3AEYA 4ZV4A 3DDNA 1NBHA 4RPGA 3T4UA 4A2CA 2BR4A 2OAP1 2R1UA 3U7RA 4FWBA 1VSTA 3AV0B 3TTUA 1CHDA 3WZ2A 4D0GA 2B3TA 3HY3A 4MYHA 4NFLA 5T3YA 2GI4A 4K1XA 1TJ5A 4DNPA 2OFWA 5BXQC 1OLUA 5GONA 1WLSA 4FFDA 4MEJA 5E8JA 1MOQA 4PSAA 4NICA 2C2BA 1TKRA 2JLRA 4GEKA 1W46A 4D79A 5K0GA 3N2KB 3BERA 1UXIA 1YWGO 4KMMA 1F14A 1ZGZA 2H9YA 2VP6A 4LOLA 2BP7B 4G81A 3BAZA 1RBZA 1YO6A 1ZBQA 2FRDC 2CHUA 5LSAA 1C8BA 4HRXA 1E0KA 3LHFA 2D0PB 4DLSA 3FPLA 1G7TA 1PJBA 2EJBA 4OXQA 2EAUA 4KDEA 5CLHA 1JVNA 3C6MA 5ARCA 2MYPA 5BWLA 4EVSA 4FFPA 4WY5A 3OEEA 4Q19A 4UTRA 5JARA 2Y1OA 2WWRA 4L5JA 4P3YA 5B2EA 2G77B 4JLMA 1Q1ZA 4K9OA 7REQB 5KX5F 3R6GA 2OHJA 2NQ2C 1GPAA 5IMSA 3BPSA 5EZYA 4GDMA 5JLAA 4OGFA 2WHPA 3IFSA 3MLAA 4Q1CA 3TLXA 3CC8A 1NN1A 2WNSA 3TLGB 2W6NA 4QBTA 3K0CC 3EGWA 5SY4A 2X23A 3IKTA 4JENA 2JF0A 3KDAA 4QYMA 2GN0A 5AHOA 1JHRA 3PHCA 3S55A 4W5QA 4YBRA 4K03A 2NV0A 5KCMA 1UZNA 4QASA 3MB8A 2W43A 4JL5A 1CQIA 4JBWA 2OHXA 1NSFA 1YZHA 2P5UA 5PNTA 4S35A 4CU2A 5L4SA 5KYNA 5GOZA 3AP1A 1E61A 1I4DD 3LYUA 3I62A 1J99A 4UHJA 1QHNA 5F35A 3QKIA 1DTWA 1ZUIA 3BSYA 3SXPA 4MQ4A 3V8NA 4BVGA 4MGYR 1DIBA 2CD9A 1RHJA 3E9YA 2BC9A 4LJKA 3TIXB 4C04A 1W75A 2GKGA 3ASVA 3NOXA 4TKZA 2OMKA 5G1PA 4CIYA 1QU2A 1X80A 2P3OA 1LLFA 2ZRGA 1GUYA 1ODSA 3KIPA 3QUSA 4KRGA 4U0JA 1U7OA 5TRTA 4BEWA 5L3QA 2RONA 1D1SA 1GG5A 2PRJA 4JC8A 5AJWA 3FWPA 1ZJ5A 1I6WA 1P0MA 5B3JC 1FDTA 1NFQA 4GOLD 5TMPA 1JEAA 3L0YA 4I55F 2M32A 5CXXA 2AN4A 1YR2A 2PZJA 3H11A 4JFAA 5CT8A 4C1NA 3ANNA 1AO0A 2X1MA 2EWWA 3AWDA 3QNMA 2I4MA 2P9EA 2LRHA 4OMDA 2JI4A 1Q92A 3A1NA 3PF9A 1CZRA 1OY1A 2HNAA 3I2JA 4JBYA 4Q9KA 2YQZA 1PL6A 1C29B 5KX5B 4MR9A 4PFSA 3VO8A 4F2DA 3AKCA 5AKHA 1RYEA 5F9HA 3NDRA 3DT6A 3EY9A 3OFJA 2GYYA 4JYPA 2WLTA 3H2YA 4QVKA 2X0KA 4DB4A 2UU9B 4EECA 5E38A 2IQ5A 4QPPA 3V1KA 1Y7IA 3VOSA 1GM5A 2FW7A 1R9GA 2C4HA 1PI3A 1ZI9A 2I7DA 2PTHA 2QN7A 2VNHA 3OZFA 3L46A 1E6LA 3QEJA 4ZCIA 5EE3A 4GP7A 2PRSA 2OKGA 3GRRA 3H5IA 4KVZA 3DDSA 3ZKAA 4U0KA 1TQ2A 2JD2A 4CR8A 1NUHA 2HDNB 4N0EA 2GSWA 1ILWA 4OMFG 1UC5B 2X1LA 3TQFA 4GLBA 2JLCA 4LF6B 3K5WA 3ZD9A 1WMDA 2O20A 3FR7A 1J8VA 2ANCA 2GLXA 4WBXC 2MMCA 5EHZA 1Y7HA 2JJ2D 1HMPA 3V7WA 3EEBA 4EJ0A 3ZZNA 4DRXB 3BBLA 2EC5A 2AFRA 4FLEA 4TTIA 4XUCA 4F56A 3DCNA 2XDYA 2IWHA 1RJFA 2BFCA 3W7BA 1SQSA 3LK7A 3CF6R 3UWKA 2ORED 2RGEA 1VKRA 1NP3A 3VZRA 3IA2A 2NTJA 1RPTA 1XK6A 1IPFA 1F0YA 2ILTA 4HS4A 1YZFA 5CIWA 1HDIA 1G8HA 1O6BA 2XNKA 4I55B 1A8PA 2BFFB 5J5AA 1Z56C 3SGLA 2TYSB 4G4GA 2LV8A 2AF3C 1Z6AA 4PHTA 2VAPA 4CM9D 4B3TB 1IZZA 2YWRA 1ZNQO 3KLOA 1GGJA 3BJRA 4J75A 4RZQA 5COBA 3WK9A 3HGTA 3N0TA 4DQDA 3UAYA 2V98A 4QG3A 1NIJA 1PDOA 1YA8A 3TFQA 1EK6A 3REGA 4B31A 3STTA 5C18A 4W5RA 1DJMA 2KYRA 4R2MA 2VTVA 3SHFA 5JR3A 1B6SA 2DKFA 1TCUA 2HD4A 2C07A 3QYAA 4OQNA 2HLHA 4Y0AA 3U13A 2W2PA 4CEJA 2UVPB 3C3AA 1CNFA 3GA7A 3HB7A 5KTOA 1K3FA 2X8LA 4GF5A 8OHMA 2H4HA 1PR0A 5BRNA 1SEPA 1T2NA 2SICE 4RY8A 3B53X 1U63A 4ZGBA 3Q87B 1KAGA 2X4GA 2P27A 3G7NA 4GI7A 2JB9A 4MR7A 1PLJA 1DELA 2VSOA 2CEKA 4YASA 5BR1A 4QATA 3DD1A 2JFXA 3G2KA 3NOOA 2Z2YA 4MWSA 1SVLA 5ENDA 3V3KA 1L8QA 1RMYA 2WFZA 4MX8A 4PVCA 2C9DA 2ZI4A 2ZFUA 2C5GA 2A1UB 1A4XA 1N6OA 1YZYA 4RD0A 4ZEWA 2AW3A 1XEXA 2Q3JA 3FMIA 3VDQA 4BMXA 5GIPE 5MHTA 2JVIA 3CE6A 1M0TA 1I0LA 2R8YA 4IIVA 2EJCA 5E9JA 2O5EA 1XQWA 4X41A 4HNQA 3L43A 4GBMA 3BMQB 1NXVA 5CIQA 5AK4A 3K8QA 1NPYA 3ICEA 5HZGA 2JGKA 1P7YA 3BORA 3HV2A 3VVMA 3I6MA 3TS1A 4EMSA 1CJKC 4HQFA 3OZ7A 1S2MA 4BYGA 5HFJA 4YAWA 3DJFA 3FJYA 2OK7A 3QVKA 5BNWA 3MWEB 4R2WA 1Q21A 3WNDA 2HEIA 3HJGA 1X1TA 2WHEA 3PJRA 3IELA 1G8AA 1WG8A 1YE8A 2OD7A 4U5QA 1L7DA 1HYGA 4Z7OB 4JLWA 5CA1A 4QVIA 4UBIA 4FBGA 1I2ZA 2F1HA 2P5YA 2ZIFA 3UAVA 3RK1A 3VPDA 3WYDA 1VLHA 1P1FA 3THYA 5KQPA 1KYYA 3AKEA 3I9LA 3QBEA 1AZTA 4G0WA 4AULA 1Z38A 1OIXA 1T6BY 4MNTA 4L51A 4EPYA 4IDEA 2I78A 5I45A 2NU9A 2PE5A 2AJ8A 2EZ4A 2PS0A 2JFPA 1RJ9A 1CQWA 1PQUA 4X8LA 1KJWA 2B2XA 1ZX1A 1MG5A 2OHGA 5EJ8A 1J9EA 4LDRA 1YBAA 3GLSA 5HQ3A 1T9GS 1LD3A 2VZ0A 2GMWA 5REQB 4J8PA 4HAIA 5KQRA 4NBUA 2HNBA 4BKPA 1BWPA 3MILA 1QRUA 1F0KA 3D3WB 3HHPA 4PEVA 1V47A 3HYLA 4TMYA 1ZH8A 3U44A 1JDUA 4DR4B 1U28A 4X1OA 5FOUA 3LQQA 2BM9A 5LZ7A 2AQ8A 3OKFA 2J46A 3PXGA 1G8YA 2RCNA 3PSAA 1E18A 4ZAZA 2HK6A 1DTEA 1QJ4A 2X0NA 3E7DA 1NLYA 3TZKA 1K1EA 1N9KA 3IUYA 3LAWA 3CINA 4CWAA 3NNNA 1VIVA 2VN8A 3SYRA 1QK3A 1FXSA 1HFWA 4MRMA 1VI6A 3GAZA 5EZYF 3AB8A 4L6IA 3ACDA 4D9FA 4JI8B 1Z35A 4N3NA 3UC9A 3QIAA 5LPNA 2FR8A 4PZDA 1T0IA 5CVTA 1ZIOA 1G9TA 1ZK3A 5HMMA 5BXYA 2PS3A 4W8GA 2HLPA 5CT5A 3RVKA 1T2EA 2O7QA 3HKDB 3ZWDA 3OPNA 2YVQA 1BU8A 1F3OA 1JR4A 3C0KA 3OT1A 3SFZA 2H48A 2HU7A 2P9TA 2LDBA 1YJCA 2XVXA 8AT1A 4L74A 2B61A 5H80A 2D8MA 3GFGA 1L5HA 1ZGAA 1QO9A 1X1AA 5CDTA 4Y6RA 1A8HA 4O4LA 1C80A 1LI7A 4A0HA 3Q6IA 4JB3A 4IMIB 2XWSA 3PGMA 3FPGA 3PK0A 4LV5B 1G17A 1TJ3A 3HJTA 3BDIA 4P5EA 3SHOA 3R2JA 4BAZA 1A5TA 4UVEA 3CW2A 1RWPA 3TQCA 1VB3A 3A1WA 1OLUB 3G2QA 5GONB 3TJMA 1GUDA 4UNIA 4EZBA 4B75A 1ORDA 4NATA 3S1AA 4OQQA 5EIAA 3TBHA 4PNEA 4GKBA 1TEVA 3D3KA 2Q9CA 3OE1A 3RWMB 1XNGA 2B4TO 3SFVA 4CHGA 4EYQA 4TROA 3TGWA 4KXXA 1J8FA 4KAAA 2I7CA 4WOJA 3TVYA 2WWHA 1W1IA 2DCUA 2O7NA 5JMOA 5KSYA 1Z4JA 3PEWA 1LVGA 2QN1A 2W83A 3F90A 4G26A 4TTJA 5KREA 4N8SA 3DF9A 4B46A 1EDDA 2V4ZA 3BRWD 3DFIA 3AJRA 1I13A 5DCUA 1CEQA 1HORA 1N1GA 2X3YA 2H8GA 3ENZA 4NESA 7YASA 1DIGA 1U9YA 4LDAA 4HYEA 5CX4A 2H4WA 2CUZA 1LBQA 1QYDA 2BOVA 2WUVA 5EZYB 4QECA 2AI3A 2WHPB 4HXGA 4MV1A 2DWPA 3FB1A 1V11A 3BDAA 4L5AA 1X70A 1LDYA 3JZIA 4UXIA 4WA7A 5IC4A 2YVLA 1A8IA 1NVTA 1G0NA 1YQUA 2GD6A 4N47A 4TXNA 5E7MA 3UCXA 4ZI7A 5F2OA 3A6JA 4RCZA 3VKFA 1HOTA 1VKOA 2ZEJA 2GAJA 1L7OA 3UM9A 3O8DA 5KYVA 2QLLA 1CTQA 3IHKA 1EFTA 3MB5A 5DF1A 3LRTA 3KZKA 4GBED 4RY2A 4WK0B 2N3ZA 3W6NA 3WLHA 4CYMA 4K3VA 2R6R1 1QH0A 1Z47A 1ZW6A 5FL7A 5G41A 3GQBA 1WV1A 4FDTA 2FRXA 3KQVA 1E2IA 1DQNA 3Q0EA 4HDRA 1LI4A 3QYJA 4AM8A 2WWWA 1CNMA 3ZCTA 4PYJA 2NZVG 2D5AA 2RHHA 1FIUA 1DTWB 1YGPA 1T0UA 2DAPA 2J7PA 3ESXA 3K9QO 3K92A 3N2EA 1CZNA 1ZNXA 1C9NA 4EKYA 4LXQA 1KVRA 5ICSA 1W73A 1X80B 1Y3DE 1GZ6A 3ILVA 4ALLA 2ECPA 5JHGB 3RSLA 2C20A 2YUTA 5L3QB 1DLJA 1P5JA 3PB3A 1WTAA 2E82A 1JSXA 2FSUA 2AHOA 2ISCA 3LFUA 2YIVX 3QPUA 2VNSA 5EJFA 3URMA 4AF8A 4JI5B 1YUMA 4JWTA 4HV4A 4JITA 3NM5A 1IN8A 2JATA 2WB4A 5KSPA 3KZMA 3AZOA 2HM7A 4NHEA 4PC2A 2FFQA 3H11B 4X84A 2JFNA 4UFOA 3JR3A 2QAIA 2QVXX 4PWYA 3AIOA 4K6HA 1U8EA 4TN1A 2RKWA 4FC6A 1K5HA 2EHJA 5A5EA 2YZMA 2JFZA 1JQ5A 1KSGA 4J1QA 2ZJYA 3GJZA 2E87A 2CXTA 2JGNA 2NSHA 1EEXB 2VKQA 3GROA 4Y0NA 1F9EA 3HWX1 3L6DA 4O2LA 2ZRLA 3RNLA 4KH1A 3FF1A 4MR9B 1RWQA 4J0HA 3OFKA 5EESA 1NI5A 3TMKA 1E1CA 2G9VA 4YO8A 3HA3A 3JTEA 1U7PA 2JVJA 1MQSA 2QXYA 3AFOA 1UF9A 3EGXA 2I87A 4LYYA 3ZGVA 1XTJA 1NX9A 2ODWA 3QKRA 1XRNA 1FTNA 3P94A 4W5HA 1JALA 1W2HA 1ZRSA 4IP0A 5JDCC 1FPQA 1Z12A 2Q8NA 1H2XA 2DGDA 4DW8A 1G8GA 5JNRA 1ZM9A 1XF9A 3VPCA 2HIMA 3QOXA 4HPXB 1VG0B 5DEOA 2XGMA 4CDRA 3ZJ4A 2ZM6B 2P3LA 3M82A 3MS2A 4U7PB 2VWPA 3OAAA 2UZAA 4YMGA 3DZJA 4N6GA 5KC8A 1T5DX 4Q3NA 3RADC 1KI3A 4NCJA 5F1PA 1LQUA 3G5UA 3R3HA 2B4AA 3K70D 4Q4JA 2ENUA 3N59A 4PPYA 1XPOA 2XUGA 4LF9B 3L7YA 2Q1SA 2BFCB 4C3ZA 1XKTA 2J4DA 4J1TA 4PCUA 1BCRA 3NBYC 2PGAA 2WDZA 3SICE 3M4NA 2V8BA 2HW8A 3T9AA 3HXOA 1NGSA 3GZTB 3PYLA 1GA4A 3UA4A 3SSAA 4HAOA 3BAFA 4RM3A 4K5QA 4Q05A 2H5EA 1OD6A 2JH9A 4LJ7A 2GBFA 3HRHA 2WF7A 4AJPA 2W2NA 3ANXA 1I5RA 3DXXA 3DLAA 1GQRA 1YRYE 1HWYA 1Q6ZA 1XP8A 1NUPA 1C4KA 3F46A 3J7TA 3L7AA 2YVAA 1Z74A 3FNQA 1XDGA 4HH1A 1KFBB 2JANA 1DWUA 1IAVA 3IUEA 3MWFA 2XTJA 4PX2A 5BO5A 4DKXA 4ER6A 2GBIA 3N76A 1IB0A 1E6WA 2H7VA 3IBSA 3NYRA 4LSMA 4FMDF 1CUZA 1MB4A 1VCMA 1NDHA 3KBOA 4QFCA 5K8CA 1RI2A 5G3ZA 1DAKA 4WLEA 5IHPA 1JDZA 2A33A 1NU8A 2WM8A 2Q1TA 4KFTA 3NUGA 1H8EA 5TMEA 3LVQE 4RDIA 1GKLA 4F6CA 1BE8A 4CEJB 1E3EA 4ZVVA 5CCBA 3O9ZA 3FCXA 3L8EA 5CK5A 1KXZA 3TQRA 3HBJA 2E4ZA 4RANA 4BWFB 3K0KA 3GUCA 3LYHA 1KDVA 2WA2A 3ZDCA 2ZZMA 1Y8RA 4BO3A 3UB2A 1A9ZA 3IKLA 5TARA 4EUSA 2OCXA 4B2IA 1JE1A 1P4JA 1S4QA 1W0JD 3Q1LA 4JP8A 1T6ZA 2H59A 4I9UA 3RIYA 2XODA 4MR7B 4JI0B 1SULA 1E58A 1KK2A 3TQHA 1P1BA 1ULHA 1AB6A 2JJ1D 4LYHA 3I9V1 4NU5A 3KOXA 2BKEA 3VTFA 2FQXA 3QVVA 3W3ZB 3EPJA 2WWGA 4W1RA 3FSGA 3HM9A 4HGYA 4CF3A 3DTTA 3N2GA 1S8OA 1SY7A 2C3YA 3AU8A 2G1PA 4HNSA 1T8RA 4IJVA 4BO4A 4EVIA 4XDZA 1G41A 1BS2A 5CVUA 2O1WA 5H9VA 3W5IA 1QGAA 3NS7A 3W0LB 4XR9A 1CUWA 1LC0A 3GYGA 1VA4A 721PA 2YXLA 2XCIA 5BY2A 3V1UA 4OLBA 3DYVA 3UAWA 5IFKA 2FY8A 2ZE8A 4K40A 4P3NA 2E1PA 2GSDA 2YZKA 5FLKA 4Q7MB 5FWYA 2COKA 3L8FA 2NNLD 4RTOA 4C4RA 2R68A 4EG3A 4JLKA 5CA1B 4ZA2A 1NUUA 3VPHA 4PSCA 5DKFA 3NP9A 4YJGA 3ZU2A 1II8A 1OV4A 4XIFA 2W2LD 1FS4A 1HTTA 4QGHA 1W59A 1CEXA 3WWYA 4AS1A 1CLEA 4HAXA 2B1GA 4OK5A 4O4LF 3O84A 4RL4A 4B1FA 5K0JA 3THYB 2R65A 4FMDB 3EY4A 3KZXA 4D4GA 3HN2A 3OLXA 1PUXA 4F3NA 3GVHA 1ODCA 2CMHA 3E3OA 2NU9B 1MIOA 3WLQA 3VO2A 1PJ2A 3PPYA 3HVRA 1RJ9B 3OM9A 1X9GA 1M6NA 3BVPA 5G4KA 5AW1A 3L8CA 5HQJA 2X77A 4F93B 3QI2A 2VDLB 1LA2A 4OU4A 4MMYB 5ALMA 5HQ3B 4KQWA 4JHLA 3FGNA 3VR1A 3ROQA 5KB3A 1MVOA 1JDVA 4PXSA 5DV9A 1YULA 5AOCA 2H4FA 2Q5FA 3T41A 3PUVA 2OORA 4EY3A 2K7FA 4D25A 3DTNA 4ZAGA 2ZJZA 2O3RA 1F8YA 3U44B 2QNBA 1ZLXA 1VLMA 2PKQP 1WKCA 4JVLA 5C32A 2FR1A 3K8ZA 4B6GA 1BKDR 2W4MA 3PXEA 4FOLA 1S8FA 2HV9A 1M2HA 3GA0A 4Y9TA 4DDUA 1TIPA 5G4LA 2MSCB 4NAUA 3X1XA 1VRVA 2GEFA 2QX9A 3R7WB 2EATA 4PIVA 5BW4A 3LUJA 3R20A 2YJZA 3DWFA 5F23A 2PVPA 5FT9A 4DWJA 5KAPA 4MJXA 2DBVO 3A31A 4LNHA 1DFGA 2RHMA 4QWWA 3PLNA 1I5OA 4G4SP 1E60A 1GTZA 4I14A 4MRMB 5A3QA 1BVUA 3ZNQA 1PL0A 1XLWA 2NVBA 3BB3A 3GDHA 3S2GA 3R41A 4WLVA 3C3KA 1I9GA 1G6KA 1SAYA 4PIMA 3HDHA 3L0PA 4DV2B 5LZ4A 1HEIA 3C1UA 2DFPA 4AMUA 4E14A 3OVMA 3ZHVA 3LVBA 1FFYA 3NWBA 4ZI7F 3FWHA 4PRLA 1JECA 4H0NA 3FYUA 1ZN7A 3IAEA 1D4FA 1JDBB 1EFDN 3BOSA 3UW1A 3OT1B 2ZSHA 2YBEA 2I71A 2XECA 4M53A 1U8AA 1X19A 2ONJA 3DZHA 4RULA 4H2DA 2P0EA 3IEIA 2GLUA 1L5HB 3DCYA 4Q3AA 4XPIA 4BYMA 4UBMA 4DBVO 2IODA 4O4LB 1PLLA 4Y6GB 4OQLA 4D9EA 2UUAB 1F0PA 1JKXA 1IB6A 3C3JA 3CVOA 3RT7A 1R6AA 4LI3X 5A4FS 3QITA 1NQWA 1O0CA 4RY0A 2VT6A 2ZYSA 2F4NA 1G19A 1X8JA 4TMTA 3QLVC 2NQTA 2EFEB 1V95A 1P31A 4G9EA 1S1MA 4UVGA 4YN3A 2ZI9A 3EXAA 2WNIA 1IZ9A 3E8XA 3PX2A 3S1AB 2EW2A 5FA6A 5IAEA 4RJJA 1JHAA 4DMUB 1AX9A 1B8OA 4RK5A 2P2NA 1HLGA 2RBEA 5THQA 4C2BA 1WZNA 2OV8A 4RAOA 1OE0A 3R0JA 4RORA 4WAUA 3T1QA 1FRFS 5HUQA 2JG3A 1WUTA 1G8SA 4MPRA 1S2IA 4D9CA 4EHDA 2MWMA 5IM5A 5HKKA 1WMEA 3E35A 3HB4X 1WPQA 3ABIA 3LUBA 1D1PA 2J9RA 3ONDA 3DCJA 5H82A 2PUVA 1JFTA 2QIOA 4C0SA 3B8HA 3HBFA 4K1LA 2DPGA 1NVMB 1XLTA 2OHFA 1NG9A 5AJUA 1QHGA 3ANTA 2HBQA 2WUGA 3D64A 5AKIA 3GF4A 1D3AA 1RE0A 4IXMA 3ML1A 3L40A 2J5RA 3PGLA 3TAXA 2ZWAA 3H16A 4MVJE 4RH0A 2X6QA 3F4KA 1V11B 4ZOBA 2YWGA 4URWR 5EQDA 2XNHA 2Q07A 3E70C 3NH6A 1BAPA 2QRLA 3L07A 4Z86A 1YVDA 3EH2A 4HQNA 3VGJA 5HJ5A 3PX3A 2IQIA 4B40A 1R18A 2XJ9A 3C3DA 3O2JA 3WBJA 4ZI7B 2MU1A 1KJQA 2C95A 4V0NA 3HNRA 4A8JC 1DJNA 1ZL2A 3OZCA 3BB4A 3KNZA 3QIVA 3HQ4O 2OXIA 1N1DA 4RHTA 3TW6A 1P72A 4FJ2A 2IUEA 2IE8A 1GZ4A 3IJ5A 3TSOA 5BW8A 3TBKA 1XG5A 3GQBB 3E22A 3KRTA 4O59O 4AUKA 4EYGA 3K9FC 2QYTA 3D6JA 4U39A 4HDRB 1BS9A 2X8BA 4QUEA 2QAGC 4C29A 3EEOA 1CR2A 2HSWA 4TV8A 3FTDA 1ZOIA 1T9HA 4NK4A 1GZ7A 4R68A 3Q7QA 4GUDA 1D09A 3MFQA 3WOHA 3SF8B 3CSSA 1ZA2A 3WY9A 1YKGA 2JC3A 1XDDA 3B3GA 3SLKA 2ZUVA 3MTEA 3Q7EA 4BO7A 1NURA 4J7CA 4YV0A 4YV2A 4Z4QA 3IVMA 2PX0A 3AINA 3PD7A 1R9JA 2YXNA 1JQLB 1V7PC 3L6UA 4MEAA 3LX4A 3C3EA 4C88A 4IQ8A 10MHA 4CE6A 4DDHA 3F71A 1O77A 4BATA 3R4CA 4LJ9A 1EP2B 4C5AA 1NU6A 1NT2A 4F04A 1XAGA 1PJSA 3H5WA 3JX9A 1PZXA 4QJIA 5E95A 3ZW8A 1E2KA 2JFVA 4RZ3A 2BAGA 4NLLA 2DJIA 2FW6A 2RHDA 1C1XB 1BFDA 1JG3A 3I4LA 3ZIUA 3BQNB 3WLOA 2R6ZA 3DXYA 4OI2A 3KQTA 1QIFA 1VBMA 1UBKS 2DECA 2OLJA 1CY0A 1WU7A 1XDWA 4KSBA 1Z5VA 3EARA 4J4BA 5BW5A 5HM8A 1Q14A 1CDZA 2VK2A 5E2IA 2F7SA 1RZ3A 3DGEC 3JD3A 3WFJA 1FJHA 4NYIQ 1DPGA 3H7AA 1E1CB 3NTOA 5BSGA 3DMTC 4MS3A 1C1HA 5EZQA 1U04A 3WLLA 5JZ9A 4DIOA 3EGXB 4XZ3A 4YJ3A 1KMMA 4WDRA 5CNJA 3WC4A 3BXOA 4TV9A 4AURA 3OBBA 3G2OA 1M1UA 4HPJB 1KY4A 1EK2A 4JS0A 3VDNB 1YK1A 1AS0A 1XVLA 2HJWA 1NWHA 5FOXA 1DARA 4QXRA 2CNBA 1H93A 4YEDA 2OO7A 4ARUA 3ICQB 1JN0A 1G4UR 2XTZA 1I4EB 1PR2A 1DU4A 1E4VA 1KVTA 2VT2A 2UZ1A 1PGQA 2UZIR 5IZ4A 2KMLA 1QHEA 4BNZA 1GRNA 2JASA 4YIHA 4R9UC 4UREA 4ARZA 4ZD6A 3EOAI 3KPVA 3OWOA 5JBQA 1SBCA 4HS9A 5JSQA 4XJTA 2P77A 2YV4A 2WEKA 3KJXA 2HF9A 5CB8A 4Q4JB 2IEAA 4Z2AA 1D0SA 5JMWA 1VFNA 5CYOA 1YS4A 5AW5A 1UXKA 2F3RA 2FP4A 3HG7A 3SZGA 4NBLA 5C3MA 5IBRA 1Z29A 4B09A 4LY6A 1BCRB 1N2JA 1NFFA 4BFSA 3EGEA 3WWCA 1KC3A 4JEMA 4JZYA 3RFVA 1X15A 4JODA 2VS1A 4PYIA 1SVKA 3QFFA 3OLCX 3KJQA 2R8PA 4R6WA 3U7IA 1GZ3A 5BN4A 1U9CA 1JR3A 1RIFA 2A1TR 3PDUA 4MUKA 4Q1BA 5FI5A 2P6NA 1RU3A 4S1PA 1J5XA 1EGMB 1VDMA 3CJRA 3PP8A 3DDCA 2NV2B 2REBA 1W2WB 4KRXA 2B6NA 2XQFA 4WEQA 2FWBA 4FWTA 5C81A 4GNKA 4LF7B 5IYZA 5A3RA 3GH3A 4HG2A 1ZFNA 3WRXC 4A10A 1VYTA 1MC1A 2JD1A 3H8SA 4PIPA 1PL7A 3GMSA 1VG8A 2LD4A 2BF4A 2M6RA 4CNQA 2JCVA 2VNIA 1TU3A 4TLEA 4D9JA 1FUIA 3F2IA 4DYHA 4W7IA 3M6AA 5FR2A 4BNMA 5IH7A 3I1IA 2JZNA 5ES3A 4N3CA 4IIBA 4EGSA 4JQOA 3O2NA 4LJ8A 3FOWA 1TQ6A 2E49A 2J33A 4ZV7A 2G83A 1Y8RB 4L6AA 5BNTA 3VC1A 2QW1A 4U63A 4DABA 1OFTA 1XZFA 4YX9A 3OX1A 5DI9A 2PBFA 1C9DB 5ECDA 4AWXA 5LNK1 1ZICA 5IK2A 1AMNA 4W5NA 2VO1A 3GEHA 3IUJA 4E1VA 2CE7A 3GGSA 4M9QA 1G59A 3HGQA 5MFPA 4KQEA 1SC6A 3T7JA 3V9AA 2XCTB 4YQFA 4J0DA 3N2GB 4MI9A 5HCIA 1DKNA 5K3DA 1L9XA 4H08A 4O2RA 3UXHA 3OIDA 3CLHA 1MIHA 2PKEA 2VC2B 4RQUA 2X8WA 4KGZA 5YASA 2C7OA 2INGX 3FHTA 3RU7A 2FFBA 1P0FA 2C7PA 2E85A 4TT8A 4ESVA 1R5BA 3G85A 4G56A 1XHEA 3G23A 3BCSA 1VPWA 4D7AA 1RRGA 3AM4A 2VHVA 3NV9A 1VSQA 2OSBA 1TJNA 5DTIA 5FWYB 2OAGA 1CZUA 2FE4A 4MCIA 2WU0A 3W8RA 3I6IA 4HTFA 2P9YA 4B87A 5KOYA 1W4RA 3ANMA 1LS1A 3X1ZA 2P3SA 2IDKA 5JEEA 3IRUA 4G24A 4YJGB 2EYQA 1N5LA 1II8B 4NDNE 4LDPA 1OB5A 4DAEA 2ZT5A 3KUCA 4OHUA 2BTEA 1E1MA 1LDEA 1K9SA 2F48A 3B7PA 3PL1A 4P4UA 2GAAA 2C9ZA 3DO8A 4RZIA 3VNAA 4B76A 3PHHA 1BMDA 2BHTA 2H5JA 1YCGA 2CHVA 3DMDA 4XLLA 4RIFA 2GVNA 2PWAA 1TVEA 1WF3A 2Z3WA 2ZAMA 3DZ8A 1MIOB 1KK3A 3PNOA 2PKYX 5U9CA 1Y1PA 2Q4DA 2QI9F 3FZYA 3G5MA 3MRTA 4U2CA 5L3RA 3GT0A 3RFTA 4AWAA 5G4KB 3INTA 2XUQA 3Q9SA 1JQAA 1N3IA 3UT5A 5A2GA 2IBMA 4Q6BA 4KN5A 2ZITA 1KMQA 1C14A 2DEUA 1AH2A 1ZWKA 3D6MA 3V8MA 3KWMA 3C7TA 4FHZA 1NQ5A 1O03A 5T4HA 2W2XA 1PIWA 1RKQA 5JJBA 2FPRA 2P7IA 3KD3A 3INYA 4C7MA 2D3WA 1NW9B 4D3YA 2RIRA 1RXWA 1IEQA 3KU1A 1K8RA 2Y77A 3PA6A 4A27A 3WRYC 1OBVA 3G79A 4MVJD 2YJGA 5FOQA 1W76A 3KJZA 5DW3A 3IL2A 2CKDA 4F0JA 4ZT7A 1BE0A 4R4JA 3MXOA 5ED4A 1N6PA 3FPHA 3JQCA 4NG4A 1PS8A 3TRFA 1CQXA 5FBRB 3GJTA 4KAJA 1KH3A 2VSNA 4HEA1 3H8JA 2ANBA 4F46A 1ZOSA 3AUKA 4BIIA 3O82A 3JV7A 4BMPB 4IW3B 2ZT6A 3MGBA 2XCRB 1WDTA 3B9PA 1TIKA 3BE5A 1H94A 1H2AS 3O4GA 3ZWYA 1VE1A 1OA0A 1ZR2A 3FYUB 3LLUA 4N40A 3HV0A 3R3YA 4O4JA 1OC2A 3OECA 4HNGA 4ZOCA 5KKAA 3N0VA 3RGGA 4C6HA 4D8TA 1KFEB 1L5KA 2IZ1A 3H7IA 4K9LA 2PYZA 3ECSA 1U6JA 2IXFA 4B73A 2RGDA 4XPIB 3QKSA 1TQ4A 3FLEA 4ALJA 4E31A 4TV8F 1TAQA 3QFSA 4RZSA 5BNIA 1AO3A 3HPQA 1G55A 3CX8A 3SBDA 4BLQA 3GMDA 4LVUA 2Q6VA 3UJ7A 5L40A 1UANA 2FGKA 1BZYA 1JEDA 3O3NB 2Q7DA 1ID1A 3H0CA 3JYPA 5GVSA 3ZV3A 4KYVA 1U5BA 2YTZA 3PPVA 1JX6A 2AMFA 4WLUA 3SKYA 5LQMA 1X7YA 2J3KA 1V0JA 4CL8A 1O08A 1ZK2A 3BD6A