1G5TA

The three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo-atp form
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
157
structure length
157
Chain Sequence
b'ERGIIIVFTGNGKGKTTAAFGTAARAVGHGKNVGVVQFIKGTWPNGERNLLEPHGVEFQVMATGFTWETQNREADTAACMAVWQHGKRMLADPLLDMVVLDELTYMVAYDYLPLEEVISALNARPGHQTVIITGRGCHRDILDLADTVSELRPVKHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COB(I)ALAMIN ADENOSYLTRANSFERASE
molecule tags Transferase
source organism Salmonella typhimurium
publication title Three-dimensional structure of ATP:corrinoid adenosyltransferase from Salmonella typhimurium in its free state, complexed with MgATP, or complexed with hydroxycobalamin and MgATP.
pubmed doi rcsb
total genus 53
structure length 157
sequence length 157
ec nomenclature ec 2.5.1.17: Corrinoid adenosyltransferase.
pdb deposition date 2000-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02572 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g5tA00
1P2TA 1ZAKA 2W83A 4NCNA 4NPHA 1FUUA 2IXGA 3U3KA 3BORA 4Z8YA 4DT1A 1HQYE 3QKTA 2EYUA 4CEIB 1MH1A 5JECA 1TUEA 2XEXA 2QAGA 2PJRA 1FNNA 4LJ6A 1TTTA 3LRPA 3CW2A 1CR1A 3RNLA 3IUYA 4AURA 4BLRA 3BH6A 2O8BB 4A8JB 3A4NA 4QJ5A 1E2MA 1U8YA 3K09C 4V03A 4IVRA 1WQ1R 1UBGA 1IAQA 2GILA 1KI2A 3LBHA 2FMXA 5KNDA 1G17A 4Q4AB 4W5JA 4KFTA 2JASA 3PQCA 4LC1A 1CEEA 2IXEA 5JHHB 3RHFA 3B1WA 3CRMA 3E70C 1KO4A 4WW0A 3MWYW 1E2QA 2BBTA 3KZ1E 2NIPA 1JJVA 4LK2A 4PHHA 5JHGB 3KUDA 4BEJA 2PLFA 1NMXA 2RKOA 4O25A 5AJXA 3QKSA 2CL7X 4F4JA 1VG1A 4B43A 5BXQC 3O8CA 3EPLA 4TLAA 1WA5A 1FMLA 2H16A 4L9WA 2ZE8A 4OHVA 5JEDA 4TYYA 3GJ6A 2QY9A 3R7WA 3I8SA 4UXHA 3PITA 1RZ3A 4BFYA 1FUKA 4EPYA 1Z8FA 2P5SA 4NYJQ 3NDBB 3EC2A 3HR7A 1DAMA 3ICEA 1QHYA 4WXRA 4LSGA 1Z0AA 5CB8A 4Q01A 4AG6A 1LW7A 1GP2A 1OHHA 3L0OA 4B6EA 3VKGA 1TQDA 3U3MA 2XXAB 2FF7A 5EXXA 4PPQA 1KHTA 4TWZA 4QHSA 1CLUA 1GTVA 4IOMA 2IS4A 3KQHA 2IHBA 3AVOA 4LV6A 5CM8B 2RGXA 3LFUA 4MUBA 1RPZA 1X8LA 4QGFA 1E2KA 2Z6VA 1G5PA 2R6FA 2ZS7A 3K9HA 5FI1B 4BUJA 1YRBA 2UZ3A 2J59A 2C04A 4TL6A 3NBXX 2C95A 1KI4A 2ECKA 2V8OA 1E9EA 1OFIA 5C4MA 4FINA 2FFAA 2FH5B 5TARA 5CITA 3VNUA 2QTVB 2XSZD 4KO8A 4L16A 4NYMQ 4DLUA 1N6PA 4DDUA 3E1SA 4AD8A 2YC2C 3NVAA 5SZKB 1GDDA 2ODBA 5TMPA 3OAAD 1J70A 3LLUA 4KV9A 4Q1DA 2IYQA 3TIFA 2WWFA 4GOJA 2LKCA 3U7FB 2P65A 3X1DA 2BBWA 2BCGY 3HDTA 4Z8XA 2JA1A 1G1MA 1II0A 1UDXA 1YRAA 3AF2A 3CR8A 1G3RA 3B13B 2PT7A 4I81A 2G9NA 1S0UA 3IQXA 2X2EA 2ZEJA 5DSZA 4UJ5A 1D6JA 1GL6A 3T1OA 4GDFA 4A36A 2L0XA 1E1RD 4BEBA 4C4PA 2V4ZA 3ZGXA 3KXIA 5KU1A 2OLKA 2QAGB 3M0EA 1N6RA 2SHKA 4PPGA 3FGNA 2QTHA 3I1FA 3KJGA 3NC0C 4LPKA 1DOAA 2V55B 4C0AC 4A8JA 2ZRGA 1W1WA 2XTZA 4R9UC 4TTPA 5EXSA 2DWQA 2IYZA 4PQYA 1A1VA 4DLXA 3GP8A 4DBLC 2ZI6A 3CUEF 2DR3A 2VP2A 2ZE5A 1SKYB 3DM9B 3P1JA 3CRRA 5JMTA 2ZETA 4A2PA 3K70D 5JJKA 1E9FA 4LY6A 1E0SA 2EYQA 1KI8A 3A1TA 4PZYA 1IY1A 3TSZA 4ZI3A 3B9QA 4JLBA 3RWOA 2FU5C 3H0KA 1W46A 3K9LA 4QXAA 3TVTA 3KB2A 1MO5A 1W7AA 2YJTD 4HI0E 2PT5A 3AQ4A 1QDEA 3FFAA 4LJ8A 4M9SA 1NI3A 3K9GA 1X1SA 3QXXA 2ZVQX 4BFXA 1RYFA 1KMQA 4QGGA 2NO7A 1FP7A 2C9CA 2XZPA 4WZAE 721PA 1ZD9A 3K0SA 4JL6A 1HE1C 3EIEA 4LI0A 1RYHA 2VRWA 1L7VC 3CNNA 2BMDA 1KKMA 2RGEA 2ZSEA 2ORWA 3PUZA 4IFEA 4LGMA 3BB4A 1XD8A 4MYUA 1GG2A 1R5BA 4PZZA 1PV4A 1US8B 1OXTA 3C8UA 3IO3A 5FOUA 2FA9A 1XEXB 4DIDA 4G3XA 2QBYB 4IDHA 2C8VA 3T06B 1NL3A 4JBYA 4G0NA 1Q57A 4IKEA 4DLWA 2BDTA 2REOA 5HZKA 4ZIRA 3NEJA 3SU8A 4V0LA 2N1BA 3QEOA 1EK0A 4LX0A 5GJWC 1GUAA 2VSXA 2FZLA 4TSFD 3TE6A 4TMWA 3R9IA 2ONKA 3B7GA 3WMEA 5FTKA 1M2OB 2RGAA 2C99A 4DEYA 4PHTA 2AD1A 3IBYA 5L3VA 2DY1A 3M4YA 1T9HA 2VP0A 4MRSA 1AGRA 4TQAA 2VO1A 2BHRA 1LV7A 1YZUA 4OQFA 2ZRCA 5J4KA 5KYKA 1XB2A 4OJKA 2FGJA 1F6BA 3W9YA 1OF1A 2F1IA 2JLUA 1NSTA 5CDFA 1XBTA 5EZ6B 2OT3B 4Q4HA 5B2ZA 3QE0A 5DHFA 1SHKA 3LV8A 2YOGA 2V1XA 2QQ0A 1UPTA 1G7RA 2W2VA 5KSOA 3N5CA 4IOKA 3U7EB 3NBFA 4MDEA 3K70C 3FE2A 1P2SA 1US8A 2NZJA 1CJUC 5CJ2A 3RAPR 4F92B 1YJ5A 2CHVA 2IF2A 4QBGB 2IUSA 3DDCA 3TBKA 3OAAA 3T61A 4A6XA 1LS6A 4P4SA 2VL7A 5JFGA 5G41A 3BRWD 3K1JA 2P67A 2RGNA 4JT2A 1EGAA 2NO1A 5AJZA 2FSFA 1RJ9A 2PZFA 2GVZC 5LDDC 4YMUA 2J0QA 5HKKA 3REFA 4TL9A 4Q4JA 4CZ2A 2J7KA 4Q1EA 1W4CA 4FCVA 1NY5A 1H8EA 3A8TA 4LWZA 2EFDB 3OHMA 4LJ5A 1FTSA 1N6HA 3ICQB 3DM5A 3AF0A 1Q21A 3DVLA 1G3QA 5IRCD 2JIZD 1KAGA 5HKKD 4XJXA 2AN9A 3I8XA 5AJVB 4HYYA 2HYIC 3IKJA 621PA 4NONA 4TYWA 4MYCA 5DI3B 3H1TA 4JKIA 4AC9A 3U44B 3WNDA 3A58B 3D6TB 1OXXK 4IJMA 3LQQA 4AK9A 3IQWA 3W5IA 2QNRA 2A5JA 1KNQA 1ZYUA 1P9NA 4MH0R 3GLIB 3P26A 1S1MA 2O52A 1J8YF 4IEIA 1R7RA 2O8DA 3W3ZB 4PPNA 3X1WA 2JJ2D 2AR7A 2P2LA 1OH6A 3TQCA 3TUIC 3QIAA 3UG7A 4N3NA 2VSOA 1VHLA 2YKGA 4LJ9A 3PR1A 3K53A 3ZVLA 4XVRA 5FPHA 3AB3A 1RRCA 2VP9A 3G82C 1JQJC 4TQ9A 4XWAA 2V6IA 2ATVA 1NKSA 2WKQA 3RRNA 3K8YA 1KI1A 2OILA 3GEEA 3I4LA 5TB5A 4DLZA 1Q44A 3TNFA 1Q1ZA 2JAQA 4OK6A 4DLYA 2G6BA 1AS2A 2QSYA 1Z22A 2ANBA 1VG9B 2A78A 1OIWA 2Z4RA 2JLWA 3Q5EA 5M04A 3RC8A 3M6AA 4B3BA 4AYTA 3CNOA 1P2VA 1S3GA 2HXSA 1TMKA 3PG5A 2NOAA 3SYNA 1YR7A 2ZRIA 1IY2A 1E69A 3AV0B 3B82A 4Q1CA 4Q9LA 4EJSC 1Y63A 1WCV1 2N42A 2NTYC 3AGQA 4KYUA 4PC7A 3GLGB 2H7VA 3RS2A 2GJ8A 1T8TA 1LF5A 3GJ4A 1NVVR 2GA8A 3RS7A 1XD2B 4PC6A 4C0KA 2OEPA 1P9RA 4LBYA 3T35A 4BASA 1E1QD 1VHTA 5TDHA 4C0SA 3REGA 2BV3A 2PCJA 2HJVA 4G5RA 2Z43A 1PUJA 3AVXA 1ZW6A 3FMOB 1WRBA 1QHGA 5FPSA 4MRPA 1QG2A 2A3RA 4AY2A 4KJZA 3EIHA 3TSOA 1JR3D 1OFUX 2QMHA 1R5NA 4HDCA 1NVXQ 4PQRA 1OXSC 2QG6A 4I1VA 1J2JA 4URUR 4DLSA 2QAJA 2D4HA 2O5VA 4E5UA 4BLTA 3MJRA 3PEUA 5GADl 2IYVA 1P9WA 1Q3HA 4OK5A 1L4UA 4TZ6A 4A9AA 2Z0MA 1MV5A 2DFTA 2ZR9A 4OI1A 5AUOB 1BMFA 2BMEA 4FXPA 2AD5A 1UBCA 2G0NA 1G4UR 1PZNA 4HAWA 1E9DA 1A82A 1E0KA 3KQNA 1M6NA 1H8HA 4G5QA 1N5IA 4NYIQ 3L0IB 1XEWX 4GT1A 3QF4A 4A6PA 2XNDD 3B5JA 4HDQB 4B47A 4L5BA 4EAQA 4KSCA 2FOLA 3CO5A 5F9FA 1ZUNB 1ZM9A 4TYPA 3ZZUA 4UNRA 2JATA 5H70A 1AS0A 3G0HA 4BZQA 1JNYA 4Q00A 2RMKA 3IPXA 2X1VA 3Q72A 3UWKA 1R4AA 2BMJA 3ZVNA 1YZLA 3IGFA 2REXB 1EFCA 4KU4A 1M1YE 4EJSA 2MSCB 3MWJA 2V1UA 1S4QA 2PJZA 1Z0JA 2NO6A 2ZUDA 3QOFA 1XPOA 4EDHA 4ACAA 2XZLA 1YR6A 2I3BA 2P6NA 1X8JA 3TRFA 1ZC3A 5JS8A 2AFHE 3LXRA 4YDHB 5D3QA 1NKTA 3MUFA 2QRNA 1KJZA 2ZI7A 4M53A 3MRSA 2IYLD 1QHSA 5CK5A 1LF0A 2HF9A 1XTJA 2B6HA 3B8HA 3I72A 5HE9A 2W2TA 2IYRA 3D31A 1MABB 4BFVA 3H4MA 1SULA 4AI6A 1II8B 4HUTA 1IJFA 5FOVA 1D5CA 2FGKA 5A5GA 5L3RA 4BZXA 4R2IA 2GJ9A 3BIFA 4MGYR 1XX6A 4MGZR 3WBKA 1NN1A 2BBSA 2QP9X 1G64A 4YMVA 3FMFA 3HU2A 4OBEA 1XCMA 5GJVC 2VP6A 3AUYA 3VR5A 3WRXC 1GNQA 3NXSA 1UF9A 3LX5A 1E9CA 1XWIA 3ZH9B 4LYJA 2PZEA 2Q9CA 2B92A 3GJXC 1D9XA 1E99A 1TNDA 4Q9JA 3IHLA 1XDBA 2VHQA 1IY0A 1AZSC 1YKSA 2BM1A 3KUCA 2W6JA 5CLQA 5DI9A 5DE3A 2HXYA 4MKIA 3SHFA 3GLIE 3FMIA 4H1UA 2WMOB 4F38A 3RRMA 2PZGA 1TF5A 2WWXA 2ERYA 1R0YA 1DARA 1HEIA 1EG7A 1GL9B 3LY5A 2FZ4A 2J7PA 4M8NE 4URYR 1XPUA 3BB1A 2V7QD 3KKPA 4MITA 2J87A 3RWMB 4W9MC 1Q1EA 1QBKC 4MYTA 5FTLA 2GVDC 1Q3TA 3UMRA 1IOZA 3KFXA 4JKYA 4LJ4A 3EASA 1BYUA 3MAAC 4TMZA 1MOZA 4YDSA 3OEED 2IYUA 1NF3A 1XXHB 5FL7A 5H68A 2VHCA 1YQTA 3AP3A 1ZNZA 4I1SA 4F93B 1VCNA 1S96A 2Q0HA 2OSBA 2JCSA 3GLHE 5E7MA 1OYWA 2ZRPA 3V00A 4C0BA 4HATA 2ZUCA 1DAGA 4QL3A 1G6HA 1FOEB 2OUKA 4XWOA 5FUVA 1MRNA 3SEAA 3SYKA 1Z2AA 4JVNA 3SJZA 3HJNA 4RD6A 4NCKA 4NCIA 1TF7A 2GDJA 4Q4LA 1LB1B 2YHSA 3CR7A 1ZM4A 3OZXA 4GOKA 3RVBA 2ZITA 1E94E 4P3YA 2ZXUA 5J47A 1AKYA 1CBUA 5LB2A 1T0JB 1S9HA 1E1RA 2HDNB 3R9WA 2NGRA 1NN5A 2J9RA 3P4YA 2ZQ5A 3EG5A 2RGGA 4V02A 3F3YA 3L0SA 4CEJA 1FZQA 4LRWA 1ANKA 3K70B 3NTUA 2KI5A 2QI9C 1E6CA 4LV5B 3DMDA 3H86A 4PHFA 3U3RA 2OBNA 2IWRA 1BOFA 2CCKA 3DKVA 4HAUA 1PUIA 4DT1B 2PCLA 2VPPA 1WMSA 5IDVA 5L3SA 1EFHA 3CX7A 3BFKA 3UKDA 5FTMA 4LJAA 2WPDA 4ASUA 3K0CC 5J4HA 5IK2A 1HTWA 1MO4A 2J41A 4Q47A 2DFLA 1XMJA 1J7KA 4DDWA 3TSWA 1QHHA 4KBGA 1KSHA 4CVNA 3R9XA 2IS2A 1YE8A 3SZRA 4AKHA 2QORA 4HB2A 3V9PA 2BIFA 1JBKA 2ZRBA 2ZTSA 3MCAA 1NMZA 1XNJA 3UMSA 2VLIA 3VFDA 3WY9A 4OKSA 4PSKA 3PEYA 3Q9LA 3QKRB 4GFDA 5K8IA 3QENA 1IXZA 3FOZA 4II7A 3L8ZA 2YINC 3GEHA 1E1QA 3BFXA 1VG8A 3JZAA 4PFSA 1K5GA 4DDVA 4CF7A 4JSYA 4NYJR 1EWRA 4JL5A 4NDZA 2YWGA 1VIYA 1G18A 4Q9HA 2JLRA 2OCPA 4PAOA 1OFHA 2IK8A 2WBLC 1T0HB 2JEOA 3ZS9A 4LUCA 3C41J 1RFLA 1KK0A 3K09A 4OI0A 4Z1MA 1UBFA 2GXAA 2QM7A 4DLVA 5AJWA 4H9GA 4M1KA 2EU8A 4RZXA 5C18A 2FE4A 3FKSA 1UFQA 2FDCA 4DUGA 2EWWA 2ZANA 4MA4A 4PPFA 3T1TA 2F7SA 3JVUA 5E95A 3GLFB 5G40A 4JJKA 4JLVA 2H1LA 3T34A 4GMXA 2V9PA 2VYFA 1N6LA 1QHHB 1XTSA 4A1FA 3PJRA 1JR3E 1XPRA 3SI7A 4BFTA 1AGPA 4RD1A 4RFSA 3WYGA 1OIVA 3B60A 1KMHB 5FUYA 3FFBA 4BWYA 4V0NA 4JZKA 2WTUA 1I2MA 2C78A 4G01B 2GEVA 2YV5A 4WA7A 1UEJA 4NKRA 2P6RA 2WAYA 5BN3A 4K81B 1R10A 3EWAA 2CLCX 2PX0A 3ZLJA 2QMEA 4LYFA 1GWNA 2G83A 3RDPA 5AR1A 2G77B 4HAXA 1DE0A 1W0JD 1JQLB 1R5OA 3VMFA 1OJLA 5BQ5A 1EFRD 2F3TA 2R6GA 1HURA 3CZPA 1ZIOA 4Q02A 2BEJA 2ERXA 4ZKEA 1RJ9B 4ZKDA 2AL7A 1ETUA 4ZCLA 3IBGA 4QM7A 4URZR 2DWPA 1U9IC 3TAUA 4YXWD 4WZBE 1M7HA 2A5GA 4O0MA 2VIIA 2LWIA 3Q5DA 1ZP6A 1COWD 2IW3A 2IHYA 2RGNC 2RCNA 1CR2A 1F2TB 4A2QA 1FFHA 2WSSD 3AM1A 2H8KA 4I99A 2GK6A 3AH8A 4US1R 5CK4A 4CRWB 3TAHA 1VIAA 3CH5A 4D0NA 5AJYA 3SDZA 1T5IA 2JLQA 2F43B 3GEIA 3KKOA 3W34A 2OFOA 2BKUA 4LOAA 1JB1A 3CF0A 2EFCB 3A1SA 5FR2A 4M2LA 1X6VA 4MRVA 3J81k 1D2NA 2IEZA 4M21A 3Q8XB 4QHYA 4RD0A 3U61B 4TL8A 5A4JA 5EE5B 5JCPA 5KTYA 2IL1A 1VCMA 4EQ6A 4I1UA 1KJWA 5FBRB 2WIBA 1KO1A 4MQBA 4Q03A 2XTNA 2ZVPX 1OYYA 1U99A 4XSGA 4D81A 2ORVA 3AVUA 2GF9A 1BO6A 2A9KA 5GJCA 1QVAA 2O8FB 1NG9A 3CZQA 4WAUA 2D62A 3AP1A 1E2HA 4TMVA 3ADKA 1E2GA 1OB5A 2HLDA 1TF2A 3AVTA 3B1ZA 4A0HA 4DLTA 1FNMA 3KXLA 3U4QB 3MJHA 3AVYA 1V5WA 4Q7KA 1R6BX 1E2FA 1N6KA 2OCAA 5FL7D 4XD7A 4LPSA 4ZDIA 4UKDA 1BH2A 4Q9KA 4C0HA 1AK2A 4YMWA 1OE0A 1NIJA 2H92A 4Q1AA 1NBMA 3LX8A 1F3OA 2IT1A 3C5CA 2NG1A 4OHWA 1NVUQ 3GLHB 1TPZA 2ODWA 5EE1A 5FBWB 4JIMA 2J3EA 1A2BA 2E87A 2ZUBA 4P4UA 4DUGD 2FSHA 1G7TA 2Z5FA 3K0FB 4R2HA 5F2EA 3EZ7A 4DKXA 1N6OA 1HY3A 3EA0A 1P5ZB 1RW4A 1E0JA 1G41A 3GCGA 4KI0A 4P4TA 1ZD8A 4D6PA 4US2R 3O8RA 1W44A 3IDQA 4NYMR 5EJEA 1RKBA 2FPLA 2QPTA 1QZXA 3T1QA 1LY1A 2VHTA 4KITB 3RSOA 4D4MA 3HPQA 1W0JA 3N2IA 4UNSA 4B73A 1XCPA 2D2EA 1N0VC 2OBLA 3IPYA 3QUSA 1JR6A 1P61B 4EFNA 1FX0A 3CPJB 2VF7A 3IEUA 1XZQA 5IK2D 4FMDB 1KYIA 5CB6A 3I5XA 2HT1A 1Z3IX 1L2TA 2F9MA 2A7QA 3C15C 2MMGA 2JIZA 3E5HA 3ASZA 2ZI3A 1A7JA 1QG4A 3SJAA 1F2TA 1CU1A 1R2QA 1FMJA 1Z28A 3CBQA 3UK6A 1MO6A 2AFIE 4JVMA 4WBSA 4PANA 4Q4AA 3TH5A 4GPTA 4KAXA 1P2UA 5D3MB 5KNBA 3I61A 3AP2A 1DPFA 2QROA 8OHMA 6Q21A 3CB4A 4JYBA 3CF2A 1KO7A 3GMTA 4TTRA 5FBQB 5B58C 5K8LA 2A5YB 4F7WA 1HYQA 2G1JA 2BC9A 2F9LA 1VPLA 2OESA 3B1YA 1SVSA 4C7OB 4EIWA 3GJ3A 3RRYA 2OXRA 2F6RA 4R7ZA 1E2PA 4GNKA 3SOPA 4Q1BA 2CVFA 1ZNWA 1S3SA 3R7WB 2ZYVX 3MG9A 3VR2A 5EP4A 2IYSA 3FKSD 1G21E 5KSPA 5JSZA 1W4BA 3L8YA 5JLJA 5KSYA 2E9SA 2FFHA 3VX3A 4JS0A 2KJQA 4M9QA 4LBVA 3VNVA 1WF3A 1Q1QA 5KOYA 1ZMXA 3BH7A 1KY3A 3GPLA 1HA3A 5FR1A 1QHXA 5BN5A 1PJRA 2ZRHA 3ND8A 1N0WA 2O8DB 2D2FA 2JGNA 4S2EA 521PA 4DZZA 4Q19A 1IQPA 3I3SR 2RHDA 4L15A 2NZ8A 3K0AA 1C4OA 1TADA 4CT4B 5JWRA 3A4LA 1Z5ZA 2N46A 1EFRA 4MKGA 1UKEA 4HEJA 4RCYA 5L3QB 3T5DA 3ZVMA 2Q3HA 1NVWQ 1IN8A 4OHZA 4DB4A 1Z63A 1KSFX 3BAFA 4RJLA 1R8SA 2EW1A 1RRGA 4B76A 4WXPA 1P60A 1AQUA 2IBMA 4TLCA 3ZIAD 1E4YA 4NCHA 3THXA 2GKSA 1XTIA 2P3SA 4YMTA 1XTQA 1DG3A 1P62B 4ITRC 4TLBA 4AG5A 1ZU5A 2JJ2A 1KI9A 3GJ8A 3RABA 3UIEA 3KL4A 3WMFA 1HUQA 3C14C 3GLHA 3I5YA 3B9PA 1AZTA 1M8PA 2W0MA 3C7KA 4QM6A 2AXPA 1OFTA 2AXNA 3LD9A 3U60B 5EE3A 1IJEA 3GLGA 1MRSA 1YHNA 4V0MA 1XXHA 4OI2A 3LO5A 3AF3A 3BFVA 2WICA 2Q21A 1K8RA 4V0OA 2CL0X 4FMCB 1HQCA 3CPHA 4M4SA 4QHTA 4QJ4A 5KPDA 3CX6A 4LC0A 3FKQA 5C4GB 5L3QA 4Q18A 1KI6B 4X8OA 4D4LA 4GZMA 1A5TA 1ZU4A 1G8GA 2ZYTX 4ERNA 3ZD6A 2YC4C 5FTJA 5JWOA 1FX0B 1LS1A 1UADA 5GVRA 3AF4A 4JT4A 3RS4A 2BCJQ 2RGDA 2FSIA 2W00A 2Q3MA 2FSGA 4LDJA 5EUMA 3ZD7A 4IVQA 1HH4A 3B85A 4EPVA 3QVVA 2X8AA 4TN1A 1E2DA 3EARA 1CS4C 2CCGA 4Q7LA 1ZCAA 2H57A 1IXSB 3QQ5A 3C5HA 2C77A 4NHOA 4U00A 1DG1G 4CDGA 1JECA 2JLSA 2FV8A 3I92A 4N0DA 2UVQA 2JLZA 2CMKA 4MGKR 2QQEA 3NHBA 2IYTA 1G8PA 2O8CA 5HTKA 1XCGB 3BXZA 3WRYC 2CE2X 3NHAA 2ZYUX 2Z83A 2Q9AA 1XZPA 4TSFA 3VHLB 4LHWA 1VYUA 3SE0A 1A2KC 3KFVA 5AUNB 1Z0FA 4PC2A 1UJ2A 1OKKD 4OQMA 4Y0AA 3RYTC 1N5JA 4GP7A 3FDIA 3KQLA 3DZDA 3AVWA 4BZPA 4DJTA 4RKEA 1XEXA 1SQ5A 1NY6A 3QKRA 3X1XA 5B64A 2C5LA 4NTZA 1JEEA 4IW3B 4HUQB 2CJWA 5CDFE 3WP0A 4ABYA 4P31A 1WDTA 1WXQA 4XVQA 2HUPA 1SVKA 5JS7A 3DOEA 5EXPA 5E7JA 5C1BA 4A2WA 2R6DA 5B30A 3GLFE 2XNSA 2AKYA 4IDOA 4ESHA 3ADCA 2RGBA 1TL7C 4RZUA 4BECA 5FFMA 2UKDA 1ZUIA 2ZJ5A 3QF7A 1XU4A 1U8ZA 3S1AB 4ARZB 4YLGA 1ONBA 3PVSA 5JZVA 4HAYA 1KK3A 2GEDA 1II8A 1SVOA 4M22A 2ZSFA 4UNNA 1LNZA 4JSTA 2O8BA 2JJ1A 5EXTA 1UBEA 2V7QA 3OFNA 2XITA 5FOSA 2WJJA 3KQKA 5UKDA 3QVUA 3LW8A 3TUJC 4B2LA 2QMUA 3W3AA 1F48A 4YQFA 5G53C 1P6XA 5HPYB 5CM9C 4B3DA 1XP8A 1E9AA 2QPAA 4KVAA 5BWMA 4IEEA 3GLIA 2AK2A 1Q22A 2CHGA 4Q66C 4WVFA 1PLLA 2F55A 4O3MA 1MO3A 1RVDA 3EIQA 4C2TA 1N3BA 4PO8A 3K0CA 1M74A 5K8UA 1T3SA 2C96A 2DFNA 2FJUA 4D80A 4AKGA 3SJCA 1T6NA 2IC5A 1I2DA 4U5XA 1DAEA 2FFBA 4YMSA 5FUWA 3TJZA 4IVPA 3DL0A 5DYGA 1E9SA 2QMOA 2RB4A 1K6MA 1IONA 4JLJA 4D25A 4TL7A 3DZ8A 2ZJOA 3IIJA 1OW3B 2OXCA 2QPOA 2OAP1 3LVQE 4FCTA 4GMDA 2FPKA 2QE7D 1E32A 2J1LA 3THOA 4C9BA 4ZDKA 2ZSDA 3EZ2A 4OQLA 1CRQA 4XTCS 2KBEA 4EUNA 1GZSA 5DN6A 4X8MA 1PVOA 5JCZA 3ND9A 4PAMA 1U90A 4Q1FA 3EX7C 5BW8A 1SXJD 1UKZA 2XSZA 2ZS9A 2W6JD 2XXAA 3KXKA 2NO0A 3ADDA 1DS6A 4ZCMA 1G3MA 2XJ9A 4B33A 3ZYCA 3O47A 3NG1A 2RHMA 2B7BA 3A6PC 2HCJB 4WOPA 2AK3A 4M1WA 1W0KD 3QXJA 1S9DA 4LHZA 3BS4A 2VBCA 2BMFA 4A15A 3TLXA 4CW7A 1ZNXA 4JMPA 4PTLA 4A82A 4BLSA 1NN0A 1P73A 2B7CA 1HE8B 2AHOA 2OFWA 2BWJA 4JYCA 4IOLA 2AKAB 1GSIA 2AWNA 2QT0A 1LTQA 4ILEA 2D3WA 1TUIA 3EXAA 3AVVA 2CK3D 3KJHA 4MGIR 1U0LA 3MWKA 2ZI5A 1U8AA 2AX4A 3KQUA 4ESVA 3VR6A 4Z51A 3VR3A 4TQUS 5FBLB 3I73A 4EFLA 1DBSA 3LVRE 1G3UA 2CNWD 4IRUB 2NPIA 2W6ID 3DOFA 3OE7A 2ASEA 1IM2A 2ANCA 2ZRKA 1KSGA 4A92A 4NMMA 1OPXA 3NEYA 2KB0A 3ZQ6A 2OBMA 1G20E 4HDOB 3HP1A 1ZVQA 3CRW1 2VSFA 4XOIA 2FEMA 4YONB 3T1VA 4B48A 3NIBA 3SBEA 4W5HA 3BB3A 3A1UA 1F2UB 4B2IA 1KK1A 2XTMA 4OQXA 5EE9A 3EPKA 2W6IA 4JLDA 5DNYB 3CNLA 1JXOA 3DMNA 5KHOC 3CPEA 3KDSE 5FUXA 5L3SB 1DAFA 3AEZA 2YOHA 1NN3A 2ZRFA 4Z54A 1CULC 5B57C 3ADBA 2KE5A 1ZM3A 2VH5R 2JLXA 2ORIA 3EPHA 1GKUB 4JVSB 4X8HA 4B32A 1KZ7B 1SHZA 2ZJBA 3GJ5A 3G5UA 1FL9A 1BMFD 1W2GA 1UEIA 4C0QC 1YZQA 2GJKA 1SXJC 1WP9A 4Q21A 4D4JA 4CEHA 2J0SA 2VF8A 4BFSA 3X1ZA 1Z07A 4U7DA 4J0QA 3L43A 3RRZA 4MDFA 1AM4D 3Q85A 2BEKA 2ZR7A 3K9NA 2NQ2C 3LA6A 2QBYA 1EXMA 1O87A 2ZYWX 1IN7A 1OXVA 2VHJA 4HB3A 3HR8A 2ZROA 1DELA 3HYRA 4OI4A 3CIOA 5HR5A 2C9OA 1XMVA 2WIAA 1XRJA 2ZJAA 4KFSA 1S1CA 3O8BA 1CTQA 4DIEA 2A2ZA 4LV8B 1CF4A 2FN4A 1XXHE 2ZRLA 4RFSB 5EP1A 1Z6GA 1VTKA 4FIDA 4DWJA 1BS1A 2IF0A 1KI7A 4ACBA 2CE7A 3QF4B 4CEIA 4P33A 2GCOA 2QN6A 5FOTA 5DHAA 4IOJA 2I1VB 1NRJB 2HT6A 3IIMA 1JXMA 3TK1A 3CWZA 2QE7A 2OCBA 1VDZA 4W5WA 2WSMA 3BERA 1X3SA 5E7IA 1QVRA 4JJZA 3MWLA 1MT0A 2ZI9A 4A0FA 3TR5A 5FPKA 4CEHB 2XB2A 3VKHA 1E2IA 4FMDF 2F1JA 3PFIA 2D74A 3QG5A 1W5TA 4NE2A 1WBDA 2WJYA 1KMHA 5BYJA 4DCTA 2H5EA 5E3HA 1VECA 2H18A 2VTKA 2JJ8A 2YNMA 1N2CE 2EFGA 1K5DA 3DKPA 3MGCA 2IXFA 5J4YA 2O8EB 3MMPA 1KDTA 4PZLA 5JI2E 2V6JA 3Q7QA 4Q4JB 5SZIA 4Q4HB 3GFOA 4OQNA 2EVWX 3OFND 3QPUA 4HLUC 4DSNA 1CJTC 3AKCA 1QRAA 1Z2CA 1YVDA 3IILA 4XH9B 2KBFA 4YC7A 4TZ0A 4HB0A 3PUWA 1OXUA 4FCWA 2R44A 4HAVA 1XF9A 4EPRA 1TU4A 2CK3A 2W2XA 4PO1A 3TR0A 3NDPA 4K8OA 1U9IA 2ZR0A 1NMYA 3W8RA 3KKNA 2WJVA 4POAA 1ZCBA 4HZUB 4C3ZA 4E09A 4HLQB 1GILA 2QGNA 1TQ6A 5TV2A 2B8TA 1NBME 2GNOA 1ZD1A 2GBLA 3PIRA 2QGZA 4B74A 2IEYA 3AKDA 1N25A 2ZE7A 4OJQA 5FPTA 1NJGA 3F8TA 2DB3A 3SFVA 1EFUA 3SJBA 1KDOA 2ATXA 4OL0A 1P72A 4LJ7A 3HU1A 1DO2A 2XAUA 1W47A 5DGXA 1W4RA 4XTRA 4B3FX 3PEWA 1KDRA 2Q6TA 121PA 2GESA 1XFAA 3CF6R 3ZQJA 5E4FA 5JWHA 2ONJA 1WBBA 3AF1A 1CJMA 1YZGA 1SXJA 2A30A 3SHWA 4PXAA 4URXR 2R2AA 3IO5A 4B3CA 1T91A 1J99A 4TLEA 4KSBA 5H1YA 1Q12A 2J46A 3KTAA 5DYIA 4KVGA 3GFPA 4BRWA 2G0TA 1YU9A 2MMCA 4PAQA 4JLKA 3VAAA 4C2UA 4AIIA 1D8TA 4BE7B 4OYHA 2HV8A 3OEHD 1ZBDA 5F3WB 1E79D 2GJSA 4N1AA 4FW9A 3U4QA 1JALA 4AYWA 2WMNB 4IHQA 3U5ZB 4QNRA 5DISB 4D82A 4IXMA 5SZJA 2WKPA 5LBIA 3AVQA 1G6OA 1GIAA 5FOWA 5LD2B 2VP5A 3W6NA 4DCNA 1W36C 1WB9A 3GJ0A 1E2EA 1M7BA 1LFDB 1OH7A 2IYYA 3BD9A 4W7SA 1QHNA 1GNRA 1TEVA 2ZSBA 1AS3A 4JLAA 1UKYA 1E2NA 1KI3A 3TKLA 2MSEB 3QKUA 4M9XA 1HT2E 2J7PD 2QZ4A 5DO9A 5TY0A 2FEOA 4TT3D 2QUZA 1GKYA 2GEUA 2DCUA 3R20A 2Q3FA 3SFZA 1B23P 2RGCA 2GJAA 5H8WA 1NG1A 1W49A 2P5TB 4GI7A 3SQWA 4KODA 2DHRA 4PR0A 5JJLA 4CGZA 2WHXA 4RD3A 1KZGB 2GXQA 3U6BA 1GM5A 5CJPA 5EZ5A 2XOKA 4BRUA 2HYDA 3ZJYA 4X8LA 2JLYA 2REBA 3EZ6A 4JLNA 1D2EA 5G3YA 4Z1MD 5C2JB 2EQBA 2ZS8A 3HYTA 3A1WA 3FB4A 4JL8A 2OO7A 1H8HD 1S8FA 2QL6A 221PA 3QI2A 4UNQA 2OG2A 3QSYA 1TX4B 5HCIA 4OHYA 2WJIA 3B1VA 2IYWA 3VU9A 1G19A 2WOJA 4PSAA 2G1KA 5EP3A 1ELOA 2XZOA 4GL2A 3L2OB 4E07A 4LHXA 4BFWA 3N70A 4M9ZA 2IA5A 5AUPB 4ZCIA 1XJQA 3BC1A 1T3HA 4PC3A 5A0FA 1SVWA 2BJVA 3EZ9A 4I1OA 1VYTA 2EFEB 1AA9A 2CVHA 1P3JA 3QPWA 5HE8A 4RD4A 3B6EA 2WWWA 2GXSA 4FN5A 2R62A 2F1HA 3ZIAA 4GRAA 5KDOA 2CHQA 2HEIA 2IYXA 4FI3C 3GJ7A 3EW9A 1JPNA 3FMPB 3EPJA 2OE2A 1OV4A 4QG7A 2C2HA 1SXJE 2PX3A 1R8QA 3DPUA 4RY2A 4AKEA 5JRZA 1J90A 2O0JA 1EWQA 1CR0A 3SC3A 1GFIA 3Q7PA 1Z83A 1CJVC 1SXJB 3U6KA 1NIPA 5JSZB 1LVGA 1Q1BA 1VKJA 1X86B 1T4GA 2ZU0C 4CT5A 3RC3A 1XMIA 2GBLC 4M0LA 1O3YA 1OLOA 1AKEA 1E2JA 1JPJA 2JLVA 3QKSB 3EZFA 4HAZA 5AWFC 4D0GA 2X19A 4BGDA 3OIYA 1PLJA 3L0PA 3UWOA 1CXZA 1Q0UA 1GRRA 3QY0A 4P4SB 4QFMA 2ZAOA 3W6OA 2G88A 3NBYC 1OB2A 1Z6YA 2D06A 1AJEA 4GP6A 2YWEA 1HT1E 2VA8A 1N5LA 5IHPA 4QOSA 1JJ7A 2BJWA 1TU3A 2QP3A 4DC9A 5TVKA 2OHFA 3A36A 5P21A 1XEFA 1ZNYA 4AWXA 4E03A 5JRJA 1Z29A 2IWHA 1G9XA 4L8GA 5EE0A 3ZZTA 1SKYE 4A8JC 4RVCA 1E79A 4MKFA 5EP2A 2WWIA 3O8DA 1Z47A 4LJYA 1GKIA 3U3OA 2KWIA 1SVMA 4Y0VA 2OV2A 2TMKA 4NP6A 5J5CA 1H8ED 3LQRA 1UDWA 5DI3A 3SS8A 3JZMA 3V4FA 4D4KA 3IEVA 3FTQA 5C46F 1JEDA 2GTPA 4DSUA 4E22A 5KNCA 4HLCA 4DEXA 1TAGA 4QRHA 421PA 3HU3A 2JJ1D 1DEKA 5DIFA 2NMVA 1CRPA 4AKIA 2GK7A 4KFUA 2W0SA 4HSEA 4PQFA 3LLMA 4PC1A 4ZI2A 2FWRA 5EUQB 2ZJ2A 3AKYA 4O2RA 3BE4A 3QNUA 2PH1A 3BWDD 1U98A 1A4RA 2XOKD 1SZPA 2R65A 1BKDR 1E2LA 3QJYA 1Z08A 4NH0A 4A0GA 2O8FA 3BBPA 4G5OA 3W6PA 3PENA 1ODFA 3GFTA 5KDDA 3THWA 4KHZA 2GF0A 1DAIA 4K46A 5GJBA 5LD2C 1ZINA 2A5DA 2V54A 2D7DA 1UAAA 2OCYC 5G3ZA 4CEJB 3P27A 4FMCF 1Z6XA 5HCNA 4WIAA 4LBWA 1VCIA 3V4RA 1NBMD 1E9BA 2YVUA 5LPNA 3LW7A 3P4XA 821PA 4RKFA 1GAJA 1Z0IA 1R0ZA 5CLLA 5FH9A 4D26A 1U0HC 1XEWY 1F5NA 2BOVA 4CYMA 5J40A 3WP1B 2WWHA 2ZIAA 3MD0A 1YZTA 3KKMA 1SVLA 1GOTA 5KSZA 2GXUA 4HUQA 3TW8B 2KSQA 1E3MA 4LHYA 4PSVA 1EESA 2PEZA 1T3LA 1FQJA 3P32A 3UMFA 1RRPA 3THYB 3D8BA 1TQ4A 1GRQA 1SVIA 4TMKA 1MKYA 4NU0A 5D3MA 2HLDD 4DRZA 2X2FA 3VR1A 4UXJA 3FYHA 3UG6A 4XSHA 2GCPA 2GZHA 2VHUA 5FTNA 4DB2A 2ZM5A 4JLOA 1NP6A 2OFXA 3BH0A 4ZPXA 5SZHB 3SR0A 5FBVB 1G8FA 4RCZA 3WXMA 3QXSA 2OZEA 4B34A 3U2QA 2QM8A 5FL3A 1PLKA 4RD2A 4B75A 2QEQA 4UNPA 2K5UA 4PO9A 1D2MA 3AGPA 2AWOA 4KFRA 1G5RA 3C4JA 4DXAA 1Z06A 1OH5A 1XD9A 1JR3A 2OM2A 2GETA 3SQXA 1E0AA 3QBTA 2DFKB 4HB4A 1G8HA 2IS6A 5DN6D 4XD7D 3WHLA 3F0TA 3NBZC 3OIWA 4QBIA 2WWGA 3GLFA 1NJFA 2IUTA 2WWYA 2ZRAA 3A37A 1KDPA 2DPXA 4A4DA 1OH8A 4DCSA 1NLZA 4V0ME 2HCBA 3LDAA 4MUAA 3A1VA 3WNBA 2J45A 4RSGA 1G5TA 1Q20A 2WAXA 3AUXA 3GLGE 3DEFA 4HLUA 2QENA 2YZ2A 4KBFA 1NLFA 2ZI4A 3D3QA 1S2MA 3LNCA 4URWR 3VX4A 1KKLA 1KO8A 2R6CA 3LAWA 4G5GA 4EJSB 5KUTA 1RRFA 3ZZ0A 2XX3A 1E4VA 1ZIPA 2ZRDA 1GITA 2NO9A 4EPWA 1E96A 4FMBB 2WM9B 3PUYA 1P75A 4DSTA 1N0UA 3THXB 4L9SA 3FPAA 2ZREA 3B2EA 5L8VA 4EKDA 3ZS8A 1SGWA 1AQYA 3D7MA 2I4IA 3SYLA 3ECCA 5JEEA 4LHVA 1R0WA 5ANRB 2C98A 4D2IA 3LBNA 4B35A 1CKEA 1FPMA 3Q3JB 1FQKA 1BIFA 3PV0A 3T5GA 3K0AB 1KY2A 5KDLA 2JDID 5JJIA 3ASYA 4DSOA 1NNEA 1ZM2A 4HZIA 2WV9A 1FW6A 1GNPA 1FTNA 1W36D 2J0UB 4OK3A 3QXCA 2QT1A 3WBJA 3RLFA 5KO2A 1N6IA 1KI6A 1Z6TA 2I1QA 2PBRA 3ZVRA 3CONA 4JLMA 4YXWA 3UATA 2ZJ8A 2BM0A 4FWIB 2FX3A 5F9HA 3CH4B 4PHGA 3F5FA 5IF9A 2GRJA 2WSSA 2IUUA 4FD2A 2YWFA 1IN4A 3PCRB 4QBFA 1YR9A 1GVNB 4F4CA 1B0UA 1VCOA 3KJEA 5BN4A 3MSXA 5JBQA 2B8WA 1ESNA 4BLPA 3QPVA 1D9ZA 5AK0A 1YR8A 4DVGA 1G3IA 1U2RA 2ZJZA 3SNHA 3RS0A 4M1MA 1QF9A 1YZKA 2FNAA 2ZRNA 4I4LA 5EQTA 2CLDX 1EFTA 4IDNA 4B3XA 5CIQA 3OEHA 3NH6A 2B21A 4M1TA 4BFUA 1ZM7A 2P0EA 2YWHA 1G7CA 3CM0A 3NH9A 3IHWA 4LYHA 1DO0A 3U44A 5CIWA 4DCVA 2QRZA 2CXXA 1ZRHA 5FPYA 2RH5A 2CNWA 3I62A 1I4LD 1IN5A 1U81A 2H17A 4F91B 2G3YA 1E98A 2GCNA 3X1YA 4Q7MB 1SKQA 1L4YA 2QP4A 1MR3F 3H2YA 2QSZA 3FHTA 3OE7D 4TMTA 4GSYA 4NL4H 4DCUA 2PMDA 4GBMA 3KB1A 3JVVA 1C9KA 3EAQA 2ODNA 4IDPA 4JLPA 3RS3A 4S35A 1DADA 1GRNA 3LXXA 2R8RA 4JBXA 4M1OA 1R0XA 2PLRA 3PUVA 4JBWA 4RZ3A 2XB4A 3C16C 4AYXA 1FP6A 3K0FA 3KX2A 2WKRA 4TT3A 1IHUA 2D7CA 2WJHA 3VKWA 4QGHA 4QGAA 4GZLA 4D0LB 1DAHA 1UKVY 3A4MA 1DTSA 2O8CB 4DDTA 4UQOA 5FI0B 4LZZA 4G5SA 5HZHA 3KKQA 4B3GA 5ELXA 2QAGC 2EWVA 4TMXA 3SN6A 5J4VA 3QXHA 4NZYA 3TVDA 2CL6X 4US0R 1I4TD 1I4DD 1XTRA 3ONWA 2ODEA 4MKHA 1KSJA 4KLNA 5DLQC 1WE2A 2GHIA 2FPMA 2PEYA 3RS5A 2O0HA 5BYKA 3R8CA 3PXGA 1EX6A 1AIPA 2DWOA 3VU9B 2R6AA 1CIPA 1ZJ6A 4NCJA 1KAOA 4IFBA 3TQFA 2RAPA 1XTKA 2OLJA 3AVPA 2PMKA 4ZIRB 2WPDD 1AN0A 2OAQ1 2VEDA 1DVRA 1Y3AA 3LH5A 2BBOA 3TUZC 3B1XA 2WZQA 1W5SA 4EPXA 2GWHA 1E9RA 3CRQA 4NBSA 3W90A 3HWSA 3QG1A 4ON9A 2J0UA 1G4AE 4BQSA 3S1AA 4ARZA 2MSDB 4C0LA 1KOFA 2GZAA 1IN6A 3ZDQA 1COWA 1M34E 3W8NA 2LKDA 2NPFA 3NC1C 3QEJA 4QBHA 3PUXA 2FFQA 3HPRA 3VQTA 1IBRA 4CIDA 3VHXA 4LBZA 2CBZA 5DH9A 2ZRJA 4FWTA 4H1VA 4G1UC 1OT3A 2X77A 3K0EA 2O8EA 1OKKA 1H65A 1RE0A 4Q5IA 3L82B 3PEVA 2WVJA 4DLRA 2BVNA 1ZUHA 1X8KA 1L8QA 1T8UA 3BJIC 3WMGA 2GAAA 1KK2A 4B6FA 2WJGA 3U7HB 4V0KA 1QHIA 2HJGA 4DHEA 3LBIA 4HLDA 2DBYA 2XJ4A 1W36B 4P0TA 1EX7A 4KCGA 4ZDWA 4RFVA 1U0JA 4TTQA 3OIVA 3T15A 1F60A 3BK7A 3CX8A 4BPBA 1RC8A 2PL3A 4NYIR 4L4UA 4C7OA 4QNMA 3QBVA 5AUQA 4KXFB 4C0JA 2J0VA 3FHOA 3RANA 2CDNA 4HZUA 4BFZA 1N5KA 4B2PA 4O2LA 4WZ6A 3MLEA 3MFYA 3X2SA 4EFMA 1XJ0A 5FOXA 1Z0KA 4ZDJA 2HF8A 1G7SA 1OIXA 3DO6A 2J5XA 3M1IA 3FVQA 2Z4SA 2ZU6A 3EC1A 3OESA 4UJ3A 3SBDA 2Q9BA 1KJYA 1TQ2A 4KLZA 2IS1A 1Z6AA 4C30A 4JVLA 4XWKA 4F4IA 4QKQA 3NKVA 2IX3A 1W48A 2XGJA 1VG0B 3FHCB 4BLQA 4URVR 3IIKA 1DAKA 3I32A 3CRVA 3H84A 3W5JA 4LCBA 2F43A 4XVUA 2A5FA 5K8TA 2QTFA 1NLYA 3AKEA 4M1YA 1N6NA 1KGDA 1MABA 2ZE6A 3KTAB 1UM8A 2JDIA 1P7CA 1YZNA 2CLSA 4MRNA 5F98A 2VQSA 2R9VA 4B71A 4QC2A 3R8FA 3U3JA 3P20A 1ESMA 1VYVA 1OHHD 1OSNA 3FWYA 3TMKA 2QA5A 4PX9A 4GOXA 2F3RA 4RZ2A 3CWQA 4BLOA 1CP2A 1TEXA 4ZV4A 1NSFA 3E2IA 4MRRA 3OEEA 3B78A 2P6UA 1XJCA 4LYAA 1M7GA 2O0KA 4IXNA 1JAHA 1IXRC 3THWB 2ZPTX 1G291 1KTVA 5CYOA 3WHKA 2GZDA 3NWJA 4P32A 3DHWC 3EA5A 2GAOA 4ZO4A 3GD7A 2C9YA 2V3CC 1W4AA 1II9A 2C03A 1JI0A 3BOSA 3UXMA 1C1YA 3VR4A 5GVSA 2XNDA 1Z0DA 4R71A 3N2EA 4Q7JB 3GQBA 1XMSA 1G8YA 2CCJA 1F2UA 4Q48A 3EWSA 3LWNA 2FG5A 2CEAA 2Y8EA 3ETLA 2ZJYA 2DYKA 3TGPA 2F1RA 2EFHB 1CR4A 1W0KA 1ZC4A 1NVVQ 1XD2A 3KJIA 4B44A 4EQ6B 1KIMA 3RSLA 2GCOB 4IDQA 2VP4A 4TLDA 4Q9IA 2W58A 5J4LA 3WNCA 4QJ3A 1KNXA 3OIUA 4R98A 3TW4A 3WYFA 4XIGS 2E1RA 4A0RA 2QU8A 1VMAA 1JAIA 5TXGA 1X1RA 5LB4A 1BYIA 1W2HA 3THYA 4KYIB 1P4SA 3U7GA 5KPJA 2YYZA 3WYAA 1HV8A 4ASUD 3CKLA 3CLVA 3BGWA 4OHXA 3OF5A 4EPTA 1CJKC 5CYPA 1KO5A 3UPUA 2LCFA 2ZAMA 4M1SA 2YOFA 1RIFA 2CJWB 4N0EA 3UANA 2UZIR 3VTKA 1V43A 1GL7A 4U02A 3T12A 1J8MF 5IT5A 1G16A 1U94A 2ZRMA 4UXIA 5JI3E 4TYNA 2BKEA 4MYHA 4TYQA 2WOOA 1T5LA 2ZSAA
chains in the Genus database with same CATH superfamily
4PM4A 4NCNA 1I14A 2G4LA 2IXGA 3BORA 4DT1A 1P1JA 1BQEA 3O1HB 3DFFA 2Z1NA 2XEXA 4DVJA 4XXHA 1E62A 2PKXA 2QD5A 1FNNA 1TTTA 1HYEA 1S4MA 2QLJA 3LRPA 3IAM1 3FF4A 2OAEA 3RNLA 4P9NA 4MAMA 3HCBA 3BH6A 2V4UA 4ER3A 4R81A 5ESRA 2A1IA 1U8YA 1YB6A 3FAKA 4OEHA 3A1CA 2RJOA 4V03A 1WB4A 4HY3A 4GC5A 3HFJA 5HQ3A 1R64A 4HUJA 1T3ZA 2BR4A 2GILA 2PH7A 4K2HA 2FMXA 1G17A 3G9TA 2WTEA 1DWQA 4Q4AB 4KFTA 2D5AA 2JASA 2QGFA 3FDFA 4B3RB 1C0LA 1CZOA 3AUTA 4KZPA 5JHHB 4MVJD 4LAFA 5HKLA 3ZI0A 2GPAA 2ZVJA 1E2QA 1UIMA 3KZ1E 1DMSA 3LKBA 4Z4EA 3AL3A 2VKQA 2ZWAA 3N2GB 1G20B 3KUDA 4BGVA 2RKOA 4QELA 1VPTA 4QXRA 4A6DA 3EGEA 2CL7X 4HRYA 1VG1A 3LOPA 4HK4A 1BFUA 3V1TC 3EPLA 2NWQA 2W2MA 3IL2A 2H16A 4TYYA 2ZE8A 4ZAZA 3UNXA 2AE2A 2QY9A 3DFIA 2P9HA 3P0FA 5AK5A 5AM4A 5IJ9A 1Y1SA 4AS2A 2HRCA 4WJLA 1AG9A 4IQ8A 4GUDA 3O26A 3PITA 1BG6A 2HQRA 4BFYA 1FUKA 5JEDA 2ZIFA 5KJFA 2P35A 2O3SA 2DGDA 2WHRA 1DAMA 3AI3A 4FDMA 4WXRA 5FWAA 1WULS 3LX6A 2JBAA 4WLUA 1P9OA 4XR9A 1W76A 2H1HA 3L0OA 5I9SA 3VKGA 3G9QA 2XXAB 3FKJA 2O07A 5EFOA 3VAYA 1FS4A 5MN6A 1KHTA 4GU5A 2H1VA 4QASA 4NV1A 5C52B 2MDTA 2IS4A 1QUEA 4G8BA 2YL2A 1HOTA 3KQHA 3AVOA 3HB9A 4UE2A 4BNGA 4XKJA 1OWPA 2V7UA 3EFBA 3CEHA 3FVWA 1X8LA 2ZAGA 1NPTO 3AUAA 3UT0A 4ZYWA 3S7ZA 2J3KA 5TQ0A 4HH3C 1TA9A 1GGJA 1LU9A 2JLCA 3B52X 3ILYA 3LRTA 3OO0A 3UAWA 1YRBA 2QS9A 2UZ3A 4IIVA 4ARAA 4BUJA 1GCUA 3KP1A 1KI4A 1POWA 1Z5VA 1E9EA 2ECKA 2FMIA 2HHHB 2VJNA 4CMKA 2FFAA 2HB6A 2CD9A 3PQ4A 1CQPA 1LRLA 4ND2A 3V1LA 4CN8A 5CITA 4H7DA 4MB2A 3VNUA 2QTVB 1O95C 2RI6A 1SOUA 4B9AA 4YRBA 2KMLA 1CNEA 3LQKA 4GQBA 4J76A 1E1LA 2WR8A 1ZK1A 4DDUA 4AD8A 5SZKB 3A2NA 2ZUWA 4L22A 1ZJYA 3TZQA 5JAUA 5TMPA 3OAAD 4JP5A 4CM4B 1XKTA 3I12A 1GFWA 4KV9A 3ENVA 2CF5A 5KQGA 3TIFA 3QVJA 1A3CA 1W4LA 1WXHA 4GOJA 2C0QA 2VDMB 3IAS1 4JT8A 4OHOA 3S2YA 3TW0A 3GJZA 1I94B 2QAIA 3HDTA 3VZRA 2DKOA 4CJXA 3E3MA 2FMHA 1HDGO 1QWSA 2J0EA 5F7ZA 1UDXA 2UUOA 3BRCA 1ZCFA 1BQ4A 1XRLA 2H59A 3IQXA 2PUAA 4XVHA 3PGLA 1WB6A 1JG2A 1SC4A 3DA8A 1LPNA 4NQZA 5DSZA 2E5FA 3OZAA 4UJ5A 2JK0A 2Y1XA 3D0KA 1QQ6A 4JQYA 4X1IB 4BO0A 4A36A 1XZJA 4C4PA 1AQNA 2F59A 1U7HA 5MFZA 3ITEA 3M0EA 4YCMA 4JXKA 4WK4B 5IAJA 3KYIB 1T5SA 2SHKA 3I1FA 3KJGA 3ISTA 1MIOB 1Q0QA 4ID3A 3PHLA 4WESA 3EXEA 5JAZA 4C0AC 4BNVA 5K51A 2IP1A 2XTZA 2X4LA 1WMDA 5KAPA 4Y30A 3VDMA 1MH9A 1PJQA 4KPUB 4PQYA 5JR3A 3GP8A 1MA3A 3EVEA 1JDJA 3CUEF 2DR3A 4IZIA 3IT1A 3MIZA 5AOVA 4KR2A 4HWPA 5JMTA 5JS1A 2ZETA 3VDXA 2GNAA 1F1JA 3KV3O 3HSYA 1WMAA 1KI8A 2GS9A 3A1TA 2ZZKA 1E3SA 1IY1A 4U8HA 5AVOA 1WX1A 3H9EO 4F5EA 3P9CA 1RI3A 2A9RA 3OLYA 4QXAA 2I7XA 1W7AA 4TXNA 1Y81A 1Z5PA 1XMXA 2PT5A 1QDEA 2WVHA 1EJ2A 1C7JA 4UHKA 8ABPA 3QXXA 1X1SA 5T6BA 1O6CA 3IIEA 1YRHA 2XBMA 4XWTA 3GR6A 1RYFA 3C43A 5AJHA 2O5CA 1KMQA 1QMGA 721PA 4LHSA 3DHVA 4WZAE 1ZD9A 5T67A 4I8IA 4P7JA 1N32B 4Y2RA 1T2DA 3D3WA 3O0DA 2VRWA 1ZGJA 2ZBEA 4NR0A 1U7PA 3FNEA 4MUEA 4LG1A 2ORWA 2V9CA 3PUZA 4ZQEA 2ALJA 4Y6RA 3TXAA 3T95A 1R5BA 5IVDA 3TB6A 4NJMA 4PZZA 2QDKA 3VVLA 4DREA 4AJJA 1PV4A 2B37A 3RVLA 3IO3A 3X43A 2FA9A 2OZPA 3DE3X 3F90A 3OE1A 4MW7A 1O4WA 5KYXA 4G3XA 4LF8B 3ONNA 1E92A 3DLCA 3ECAA 4LE1A 4C1BA 3WO1A 5CUQA 4F8EA 1N2CB 4IKEA 1MQAA 4O8ZA 4RCVA 4DLWA 5HZKA 2PXAA 4H60A 1XP5A 1EK0A 1GUAA 2HNBA 3VDQA 3N8GA 1WNTA 1U0FA 2VSXA 2ZWIA 5B7GA 2FZLA 4JROA 1V4VA 4U6SA 2N47A 2ONKA 3D7NA 1EVJA 2VWPA 1JLLB 5FTKA 3K6SB 5G0TA 2O59A 3HZHA 5TQ2B 4DEYA 4OMUA 4ENVA 3PNOA 4MRSA 2R6JA 1AGRA 3CHYA 2XRFA 2VATA 3ZZNA 4TQAA 2VO1A 4M8KA 1W581 3ESXA 4ENRA 2ICAA 1D0SA 4L5YA 5J4KA 4D0RA 1VI2A 3ICOA 3LT0A 3QE3A 1NSTA 3W7VA 1U8EA 3KQMA 3NOQA 4K9RA 1UC8A 3WA6A 5JAPA 1YJBA 2OT3B 1MX9A 4WBNB 5K0FA 4IJUA 1CDOA 2DU8A 4L8LA 2XCTB 4ME6A 1EB9A 2WHQA 1DLIA 1PTKA 1ZCJA 2GM9A 2R6HA 3N5CA 2A9FA 4IOKA 4ND6A 1NVMB 3RVMA 5C1OA 5ISMA 4WZAA 1P2SA 2FZGA 4YAWA 1FP2A 3O2SB 4TV9A 4F92B 2BEWA 1YJ5A 2PYDA 3K92A 3R0VA 2IUSA 3CSDA 4QBGB 3MPOA 2IEGA 2PBZA 3HCDA 1H0KA 4LNUB 2I6UA 4P4SA 2VL7A 5AM5A 2DX7A 5E8RA 1FFYA 2CFOA 2HWXA 1Y89A 3PWTA 2XGMA 3Q6IA 5DGDA 3WLSA 4HKTA 4FN4A 5IEJA 1H42A 4Z53A 2IHZA 4J6EA 4YMUA 4TWBA 3VUFA 4IAOA 3G59A 4XPZA 2V97A 1MHPA 1YTLA 4OBXA 3CE6A 1XIVA 3LPCA 3HVKA 4Q4JA 1PT6A 1W4CA 1PR1A 4FBMA 4FCVA 1B43A 2RK3A 4IH1A 5DOZA 3BSFA 4QQKA 4ZT4A 1RPNA 3ZN2A 3EXHA 4DJJA 4MUHA 5HOQA 2WQ7A 5IFKA 2EFDB 2IP4A 1EDZA 1RM5A 3FROA 4C6HA 4FJ0A 1XZEA 1Q7CA 3DVLA 1V16B 4C08A 1JDBC 5D5QA 5A02A 4CUZA 3KJQA 4FHZA 2DTEA 1KARA 4NONA 1ZOPA 4MYCA 4UMEA 3G7NA 3S99A 2YRWA 2OORA 3L4JA 1VP9A 2G40A 4MO2A 1OXXK 1JE0A 5BPHA 4HHEA 3WL5A 1YZVA 4CKYA 2QNRA 2VPQA 1U2GA 2ZTLA 3WGNA 1EUQA 2UXBB 1KNQA 1FZTA 3ZWMA 1X9GA 1C4XA 3J80A 4KXNA 1C8BA 5J1SB 4XX0A 4CM5A 3Q8LA 3GYBA 1J8YF 3DDZX 4IEIA 2O8DA 1B16A 1T9KA 3CLUC 2VZ9A 2R8XA 5A7GA 4MV6A 5DFAA 4N4AA 2OZLB 4F4UA 3KVOA 4DMFA 3QIAA 4MQLA 2GPNA 3V4LA 4N3NA 3KSZO 4I3FA 2JJQA 4XCXA 1BCRA 2YKGA 3K53A 3G8BA 1VL8A 2DPHA 2VP9A 4ETIA 3IYLW 3OFSA 3G82C 4PNHA 1EEXB 1JQJC 3HCWA 2Q27A 3OA0A 1SU4A 2I4MA 2WKQA 2OILA 1T26A 3SEQA 4FSHA 4PE5B 2NUTA 3K71B 3KOYA 4NS4A 1JTVA 2G6BA 2RGYA 3O8OA 2CMDA 1KVQA 2ANBA 2CXUA 4YHHB 4V38A 3V8RA 2FWIA 2IKQA 3IT0A 4Z9YA 3CVUA 1C1XA 5K0BA 1XHLA 3LCMA 1NF9A 2JIBA 3EW7A 3PGMA 4RK4A 2ZXFA 3RJMA 1TMKA 3SSAA 1SCQA 4C0WA 4F8YA 3MS7A 3K32A 1V11B 2FN9A 3ER6A 4JD5A 4Q1CA 3RH0A 1K5HA 1Q7BA 3A9CA 4EJSC 1C8KA 1JLLA 1G8MA 2N42A 2Q4TA 3GLGB 1UMBB 1KJ8A 1SD1A 1X92A 4EJ0A 2GJ8A 3FUVA 4RA6B 1YUMA 1BROA 2Z08A 3RS7A 3S2EA 1XD2B 4PC6A 2LIPA 4ZYLA 5CG1A 1K4KA 3F97A 4RANA 3IAXA 1JFLA 3R44A 4LBYA 4WXYB 4O4IA 1VHTA 1UDAA 1SXQA 3REGA 4EUSA 5IJZA 2PYIA 3DE0X 4OB6A 3AVXA 2V03A 2Q8NA 1N2XA 2Z43A 3FMOB 4JDPA 3ROKA 5FPSA 1Z4LA 4MRPA 4YV2A 1QG2A 3KPYA 4NE7A 4IDEA 3VR6H 4G0PA 4RULA 1UK6A 2C5FA 4UW9A 5EZYF 5P8WA 1MTOA 3MM4A 3TSOA 2B6NA 2NYVA 4UD6A 4PGGA 5SV2A 1R5NA 1SCIA 4HDCA 4XB6B 4PQRA 1L7RA 2PWPA 1L4EA 4I1VA 1J2JA 4IUDS 2AMFA 4DLSA 1M2NA 2D4HA 1IJBA 1ZFNA 4O59O 1LGYA 4L3VA 1ZUD1 1P7PA 2FKAA 16PKA 1P9WA 2QX4A 3UMYA 1HRDA 1GAXA 2WJ6A 4XWWA 4TZ6A 4QUGA 3ANTA 4MGHA 1RI5A 3QE2A 3WYNA 4A9AA 2DFTA 4OI1A 2O7VA 2QUBA 2F17A 3I0ZA 2FPGA 4XYMA 4AN0A 3BE5A 3HJFA 1H2XA 1E6KA 2J9GA 3QSGA 4QYIB 5LWQA 3ENZA 3H1GA 1GYRA 5LNK1 4P4GA 4G5QA 1PR2A 3U7QA 4BFLA 3L0IB 2GMWA 2WE8A 3IBCA 4GT1A 2DAPA 2XNDD 4YYZA 3B5JA 5CDTA 2ZTUA 3JWHA 4B47A 4PRZA 4L5BA 4Y7DA 1M34A 3CO5A 3WJ7A 4WDRA 3C8ZA 1EXVA 3KZCA 4TYPA 4XX1A 3ZKAA 2OO5A 1E58A 3ZZUA 4GM4A 1YHZA 2Q5QA 4LKRA 5FYQA 1AS0A 1MUUA 3VC2A 4O2BA 3VNSA 5DM2A 1NQWA 3BTOA 4QLOA 1OTHA 1BX0A 4Q00A 3UWKA 3KKEA 4RVGA 3ZQ4A 4Z7QB 5HXAA 3ZVNA 4RMJA 2F1KA 3Q6MA 5KTSA 1EFCA 5JQWA 4DLLA 3W5DA 1SQFA 2X7JA 1NJ2A 2BI4A 3VPBA 1KEEA 2V1UA 2JH3A 3SZ3A 1WHSA 4Q37A 4PSDA 4AX4A 1U7XA 3H4IA 4CLOA 4XX0B 3OQOA 4X94A 4JJ6A 2YHUA 2BEVB 1X0VA 2MYNA 2GPWA 2CNBA 2ILTA 1PQWA 2OQ2A 4IDFA 3TRFA 4ACAA 4J0JA 5JS8A 1YOVA 2AFHE 4M76B 3LXRA 2A1UA 4NZ9A 3NOOA 3M5PA 5FWXA 3MUFA 3HADA 3W6ZA 1KJZA 2ZI7A 1YK1A 1JIVA 2ZAYA 3MRSA 5SY9A 2ZXEA 4GMKA 3M70A 1XNGA 1Z5GA 2BN4A 2TECE 3D9QX 2HF9A 4I8XA 1Z9BA 2JI4A 4OQZA 1F0KA 1SKMA 2B6HA 3CKKA 1NE7A 2Q4BA 3IBSA 1J4AA 3BMXA 2DR2A 1MB3A 3BMOB 4BFVA 3DB2A 1U04A 3TOCA 1CY0A 1MB0A 1CUXA 1SQ0A 1IJFA 5FOVA 5L95A 3KLMX 5DTMA 4BZXA 2B61A 3P5BA 1WXWA 3BIFA 4MUMA 2CMGA 4ZEXA 3URMA 3DTYA 4ZGGA 5GPBA 1ADBA 1PFWA 1RVV1 2QP9X 1VJ5A 3FMFA 3HU2A 1Q0SA 3RRJA 4QE3A 3ZDXB 3GI1A 4KO1S 3LX5A 3CH7A 2Q9CA 3GGDA 3NRJA 5AKZA 4C1NA 2WB2A 1HMPA 1Z35A 2DTXA 2H1FA 1XDBA 2BKAA 1YKSA 3T7EA 4QT0A 2ADOA 1OROA 4HDKA 2A94A 4Y1RB 5DI9A 5TX7A 4BRZA 4D97A 3DMFA 1YRWA 4TQGA 1AHHA 2II6A 2Q5EA 4C01A 4F38A 1Y9DA 3EF1A 4P38A 3RRMA 2PZGA 3FR7A 5DGCA 1FVOA 1TF5A 2ERYA 5KTKA 4QATA 5B37A 1RQPA 1YB4A 3LDUA 3LY5A 3MLBA 3M1LA 4M8NE 4U7GA 1BD3A 3NM6B 3KJZA 3ROZA 3KDPA 2J87A 3V4VB 4D9JA 4MOWA 4W9MC 3GFGA 3BSYA 1PUXA 3GQBB 3I6BA 3QELB 3SCZA 3EQ2A 1FDTA 4MYTA 5A3QA 3ZV5A 4HFRA 5AK6A 3A0RB 5FTLA 2ZSKA 3UMRA 3KFXA 4I4TF 1FYFA 3OEED 1XZGA 1XXHB 1T25A 2WY2D 2VHCA 3CZ4A 3W79A 2BL4A 3KAKA 4PX3A 1RQ7A 3GLHE 2FP3A 5KYWA 5JYDA 1I10A 7GPBA 4HATA 3T6KA 2XCRB 1E1CA 4R31A 2JFPA 3P9YA 4QL3A 1SXIA 2R5FA 1G6HA 1FOEB 4N8EA 1TVCA 3NRCA 2IU6A 5AKKA 4QPJC 1ABFA 5EZYB 3KEOA 3R5XA 1A50B 4Q4LA 5IDYA 1MEOA 4H0CA 5LMCA 2BI7A 1KAMA 3STYA 2FPGB 3QYAA 1F8XA 1SR8A 4G4JA 3JSAA 3WYBA 1B3RA 4LY3A 2XUQA 4R6WA 5J47A 1CBUA 2NO4A 2IBTA 2HLNA 3A7DA 1CE8A 1KBOA 2WJAA 2VAMA 1JVBA 2O3TA 3RHZA 2BUCA 5HA5A 2Q2VA 4FZRA 3KQTA 2YH2A 4CEJA 4V02A 3L0SA 1N8TA 1FZQA 1M75A 2QJRA 3PFCA 3NTUA 2F2TA 2EV9A 2PJDA 2QI9C 3LTNC 1M6VB 1KBQA 4OYYA 4PVCA 4PIMA 1RHKA 3H86A 4ID9A 2OBNA 4BMPB 2OP1A 1BOFA 2H85A 3B51X 2AQ8A 1PUIA 3D3JA 3DJFA 4FFNA 2PCLA 1QCYA 1XHEA 3UHJA 4CXMA 2HMVA 2PL1A 4P54A 3UKDA 4DTIA 4TS3A 2Q2QA 2WU8A 2WPDA 5ALNA 4NZNA 3CUVA 2CLMB 3IDOA 4TKUA 2MSNA 1RWKA 3OU7A 2IE8A 2J41A 4OXRA 4EY7A 5IH7A 1WSWA 1XMJA 4FBGA 1EGVB 2ZJ6A 3QTBA 1QHHA 3R9XA 5G1PA 2IS2A 3I2IA 1QGED 4OAOA 1A9SA 2J07A 4HB2A 1EGMB 2BIFA 1D4FA 2ZTSA 1W87A 3H19A 5E1DA 4JFAA 3KO8A 1Y82A 3LLVA 3RADC 3WI7A 3I5UA 2Z57A 5CBPA 5AKXA 3OX2A 5IKMA 4OVKA 1N4AA 2XGSA 4GFDA 1I24A 3JWJA 2PFSA 4M88A 3YASA 1IXZA 2V7WA 1KBZA 3SZMA 5HM8A 1NUSA 1G59A 1XTUA 4NEGA 5JZVA 4P2GA 1VG8A 1JEYB 4DDVA 2VHZA 4IG9A 4BO9A 1PE0A 4KE7A 5DHPA 4JL5A 4E7OA 3L0ZA 1VIYA 4Q9HA 3CRNA 3LM8A 1RZRD 3HKBB 3WKDA 3NNNA 4ZYXA 3C1UA 2WBLC 4WTOA 3UHFA 1TIKA 2GD6A 1T0HB 1XA0A 2JEOA 1K7EB 3C41J 3Q98A 4RDIA 3K94A 1RFLA 3ZIDA 3F5SA 3QEMB 2J5KA 5I7FA 4OI0A 4JNKA 5LLDA 2VK4A 3LUGA 4RJJA 2C4VA 4IQGA 2E3JA 3IELA 4Z49A 3AHFA 3N9IA 1O6BA 3TCNA 3N2KB 4DUGA 2XB6A 1RHJA 1PP4A 3OLQA 4FE4A 3ZKWB 5CA0B 2EWWA 2ZANA 5ALQA 2HHJA 5DLEA 1W85A 3EN0A 4MQUA 1DEXA 5KHLB 3TMYA 4JJKA 1CZRA 2H1LA 2VCHA 1YS2X 3DEHA 3WLQA 2VYFA 1N5RA 1VSTA 2QRJA 3H87A 3PJRA 2ISSD 3B12A 4ZVKA 1XPRA 3QJ5A 4N03A 4Z4QA 1KAQA 1MAVA 1ISMA 2IGBA 5CR9A 1GXSA 3WYGA 1LBQA 3G0CA 2WTUA 1KU0A 1PKXA 1WXEA 4G01B 3MSCA 2YV5A 3QELA 3I34X 1M2VB 1Q7TA 4B6OA 1UEJA 3U3DA 1MP0A 5TMDA 2RIRA 3QX8A 2CLCX 2PX0A 4A2CA 3IIIA 3ZLJA 3ZWKA 2GPYA 5ADHA 5FUQA 4Z4GA 1PWHA 1DE0A 3F5QA 5LCXA 4QYMA 3KK0A 1R5OA 3TS1A 4GICA 1ZOIA 2UZ0A 4RH1A 4A26A 5EZSA 2ZUUA 4B09A 2I22A 1HZZA 4FSDA 1E1CB 2PXCA 1HFKA 1R66A 2GOYA 1O9HA 3IBGA 4QM7A 4CMBA 4P1ZA 3U4IA 1M2KA 4YXWD 3PRHA 3KBBA 4WZBE 3S7TA 3V8EA 2RI0A 4ZYUA 1PGNA 4O0MA 2VIIA 4V24A 3BCUA 4HX5A 5DW3A 4CNQA 3Q5DA 3WWZA 5KJ6A 1COWD 3T4PA 1A5AB 3H0EA 1FFHA 3K2QA 1K6IA 4GH5A 3CCFA 8AT1A 1HE2A 2X0JA 5I3CA 4XYEA 1EE1A 1W34A 3MT9A 4NC9A 4RA9B 2NU9A 4NENB 1PZMA 2YV1A 1LDEA 4REMA 4XGIA 3TAHA 3OFJA 5AJYA 5HIIA 3FDJA 5HK8A 1ULTA 3ASUA 1U2TA 2JLQA 1AXRA 2F43B 2HGZA 2P9TA 2YS6A 3W34A 1KFCB 4PS1A 1WPGA 5ERYA 1YCGA 3E84A 4GSKA 3KG2A 3ZWYA 3USZA 5COQA 3NTOA 2XRYA 4FNMA 1O95D 4L27A 3A1SA 2IIVA 2X0IA 1X6VA 2IY9A 4MRVA 2IEZA 4M21A 1CJCA 3JQ9A 2XQIA 4QHYA 4RD0A 2EJBA 3RBZA 3S2IA 1C7EA 3DJYA 4UBMA 2SKDA 3CYFA 3DHYA 3MZ0A 3PUIA 4HR7A 5EE5B 5JCPA 2PUVA 2BFMA 4RTKA 1NFFA 1YQ9A 1VCMA 4HNAA 2X23A 1GZ6A 4M6WB 3R7NA 3OETA 5I6DA 1TEZA 3VU1A 4I1UA 4KDEA 5FD8A 4NG5A 1KO1A 2O23A 3M49A 3TDMA 1TYCA 5ETJA 4XSGA 3BKWA 3DZGA 4D81A 3MRXA 1I0LA 4MR8B 3R9XB 2QXUA 1ONPA 1VRVA 3L7DA 3QEBZ 4D8UA 4X7RA 3CJRA 4WCFB 2O8FB 1NG9A 3Q3VA 1VGQA 4J3JA 3KJXA 2Y67A 1BC5A 3CU5A 1ZD4A 1P7VA 3ILSA 4YO8A 3PPIA 5ERGB 4H59A 2GZ2A 3DR3A 3RFVA 1WMFA 2A1TR 2HLDA 3VOAA 1OB5A 1VLMA 1P6UA 3AVTA 5EC8A 3D4OA 3B1ZA 3RU2A 3CG4A 3K1YA 3LO8A 2XE6A 4YALA 2AZMA 3EVAA 3HVIA 3KB6A 4AQ7A 3EJ6A 3FTFA 5CX1B 5T5QA 3HKBA 3QFCA 1IOLA 3JATA 3IULA 1QJCA 2X58A 5K8VA 4NBLA 1SU8A 1DHTA 2D8MA 3OT1B 3RVJA 2ET6A 1N6KA 1QVVA 4EMSA 3CLRD 1L1RA 4LPSA 2X0RA 2AEFA 3PNKA 3QFRA 4UKDA 2NUPB 3K31A 4KUGA 4QGSA 5HUQA 1P7WA 2ZT5A 1NHWA 4C0HA 1X94A 1AK2A 2EW8A 4I4NA 5AHWA 3WK7A 1NIJA 2VDKB 1HNXB 3R3HA 4FYMA 1NBMA 3QLEA 4ALLA 2VWGA 1VA4A 1GL3A 1SCUA 2MSWA 2XUOA 4OHPA 3RTGA 1RPAA 4F6RB 2IHJA 4EYOA 2A86A 2J31A 4RPLA 3OZGA 5EE1A 1AUQA 1BDMA 2FQQA 1A72A 2I34A 2ARKA 4GECA 4MWCA 1PFUA 5KWIA 4R9RA 4NPCA 1U7OA 4TV8B 1OASA 4LEIA 2OZKA 2WJPA 3LPMA 3QLUC 4ZQFA 4D1YA 2ODTX 4BBPA 4ZXPA 1VKNA 1ZLYA 2GN6A 3EA0A 1HY3A 4LWQA 1Y7TA 4P22A 5HKOA 3ZD6A 1G41A 4NEQA 4ZTUB 1ZD8A 1YAJA 4US2R 4N65A 1FBTA 3IOMA 1XQ6A 3F6EX 2A92A 3OM9A 3GY0A 1YR3A 2I78A 3CKYA 3EQ7A 1LZKA 5T64A 3N6VA 3AY0A 3B6JA 4EGFA 2DPGA 3T1QA 4ENQA 2RH4A 3DZKA 1SBQA 3RSOA 3UV6A 2J6BA 4YLYA 1ZN2A 2VHVA 3N2IA 3OECA 2H48A 1EVKA 2HSWA 3QUSA 1G0NA 3RHSA 4UAVA 3GLUA 5H9VA 2RARA 4C20A 2GK3A 5C1DA 3IEUA 4J2OA 5C4IA 1PEYA 5JO0A 4RKRA 1KYIA 3HVJA 4OPMA 2C57A 3G8CA 3QNMA 1Z3IX 2CDRA 2F9MA 2A7QA 4W1RA 2MMGA 2JIZA 1FYEA 3R7LA 4MJXA 5EA2A 5ABPA 3HKDA 4LQDA 1QG4A 3O4GA 4FOTA 5DCYA 1KRWA 2VC2B 1R2QA 4CQJA 2AFIE 3KVNA 4WBSA 3R7FA 4B85A 4XJVA 5AESA 3VOTA 3RYCB 2F4VB 1ENZA 1AC5A 3DTVB 4PANA 4Q4AA 3TH5A 1DBRA 3ORYA 3SX4A 3ZDCA 1U11A 3RJTA 1RQGA 2EGUA 3CINA 3M89A 3ITKA 4GDMA 2WIKA 2QN3A 4OSOA 3CB4A 1C0EA 5JMWA 3WL8A 4IXWA 4GWKA 3ZWDA 1MFZA 2JFQA 1RRMA 1DV2A 4YFVA 1U1GA 4GHWA 2OESA 4WI1A 3PFWO 5DT9A 3U39A 5JDIC 1SVSA 1RM4A 4EZEA 1CS0B 3JY6A 3NGLA 5JISA 4C7OB 3DT8A 3PR3A 1ISRA 2EJTA 3O5AA 1XTPA 3RRYA 1BSVA 2I71A 4GNKA 3AUJB 4FGJA 1HE5A 1S3SA 3MG9A 2XCQA 3O92A 2IYSA 5JSZA 1JEQA 7ABPA 2C82A 1GR1A 1NI4A 4BL5A 3M3DA 4LBVA 3KB8A 3VNVA 1MW9X 1Q1QA 1PR6A 1NJ6A 4FFSA 2HK7A 3DAOA 1NP3A 3G3EA 3K35A 4YJFA 5BWBA 3MJFA 3A6LA 5JXJA 1A9XA 3GPLA 5FR1A 1O94C 2A35A 2WFMA 3IP5A 1NXVA 2AFIB 1TA0A 1M8GA 4YPFA 1L5ZA 3NYWA 1SBTA 2DUNA 2H08A 1FDRA 3E18A 1YO6A 3I3SR 4DZZA 1TPYA 1TAHA 2NPOA 2XVZA 1O0CA 2NP7A 1COZA 3U4DA 1YRYE 4K6GA 3LCCA 2P2GA 4KYTA 4CT4B 1KPIA 3A4LA 3QWFA 1EWTA 3DO5A 4MKGA 3WFJA 3LWDA 1NV9A 1UKEA 3LT1A 4HEJA 3X2EA 4N3AA 3FZYA 5TE9A 1LPBB 3O9VA 2Q3HA 4BLVA 1NVWQ 4OHZA 5C53B 1Z63A 5U4XA 5FPQA 3ZXXA 3SVLA 4FYJA 3H8WA 4BB6A 5H59A 1Z62A 2WNHA 4TWJA 2EW1A 4PN3A 4B76A 3IXMA 1P60A 1A5BB 4MUXA 5TGDA 3ZIAD 1N0HA 1JDNA 4AVYA 1E4YA 2DBVO 4QDUA 3THXA 2DOKA 2D8AA 3MK31 5ELMA 1JIIA 1XTQA 4ICIA 4LZLA 1DG3A 1SY7A 5EWMB 4YMTA 4EMTA 1L7XA 3IS3A 3AHGA 1KI9A 1QMPA 3RABA 3BHMA 3PD0A 4IDDA 1T1GA 3OWXA 3OKAA 5MN5A 1SIOA 3BDAA 2P30A 2YYAA 3B9PA 3HK2A 2Q1UA 1AZTA 4HS9A 2P91A 1YKFA 3EPRA 1KA9H 1OFTA 2AXNA 1ACMA 3JZIA 3MYYA 4AF6A 3D3KA 2PLWA 4MLCA 1Z75A 5EE3A 3DWGA 4EW6A 2DHDA 4IILA 1B8OA 1MRSA 4OI2A 4MWDA 1Q0LA 2R8PA 1DC5A 2WT8A 3FCSB 3HRKA 2NU7A 1LSSA 3BFVA 2PXXA 1A7UA 2Q21A 1K8RA 2HCRA 2CL0X 4FMCB 2G7ZA 1HQCA 1TYDE 3CPHA 4QJ4A 4MRMB 4CTMA 4KV7A 3QE9Y 2WNIA 3DKKA 1SZJG 4GUAA 5GZ3A 4Q18A 4F0JA 1KI6B 3KIPA 1ZU4A 4ERNA 4YNBA 1G2IA 3LUBA 3RWBA 1ZK2A 4NOJA 1A8SA 3TPFA 3ZK8A 5JIBA 1UADA 3L6CA 4H1TA 4UCFA 3RS4A 3ROXA 2HSJA 4MW9A 1MIOA 3V3KA 3X0DA 1K6JA 3ZXIA 3HLYA 1CQZA 2ZQYA 3QVVA 3GN1A 3W5CA 4J1SA 1CVLA 3VR0A 1D4OA 5E4TA 4Q7LA 2DT8A 1NTRA 3Q41A 1YS1X 4O4IF 4OJYA 2C77A 4JI1B 3R76A 2XCIA 1WAMA 1DG1G 2JD1A 4JZYA 4CDGA 5IDWA 3WICA 3GROA 5ALWA 3AC0A 4UBOA 3K2EA 5ESWA 1OX4A 4J16C 2VQFB 4LVCA 1Y7IA 4E13A 1CUAA 1HGXA 5JSYA 1C3JA 1SEPA 3QFSA 4BV9A 2IYTA 1I80A 3RU7A 1G8PA 3ROQA 4CHTA 4JOSA 3ZDAA 4REQA 2ZATA 3DTNA 2X5JO 2ZYUX 3B8EA 3KOMA 2WUEA 5KYVA 5CHYA 4TSFA 3HLKA 4R1LA 4TVOA 3P8ZA 3OM0A 4RY0A 1VYUA 3SE0A 4G0QA 3JW8A 4ZVLA 5LU9A 1JDSA 1V5IA 3DCJA 4XASA 5AVJA 3KYDB 3SR3A 4DR7B 2JIQA 1N5JA 4HYEA 4NRDA 4HX2A 3FDIA 4NMLA 3KQLA 5IMBA 4K8RB 2GZ3A 3RCBA 2VRCA 5TJHA 2FAXA 4ALIA 1SQ5A 2M32A 3QKRA 5B3JA 4NTZA 4B3HA 3HV0A 5IDXA 3FNHA 3AJEA 5JE8A 2PGNA 5TJ9A 3OLWA 3WP0A 1Y3CE 1ZICA 4HDSB 4P31A 1ZIDA 2O1XA 1IOWA 1EK5A 3ILHA 3PTLA 3WJ1A 1J21A 1U7TA 5EXPA 3U0VA 2L17A 2FXVA 5E7JA 1C9DB 3GLFE 1W5EA 4AIRA 3KWMA 5JATA 2AKYA 3ADCA 1GVHA 1DX6A 3MCTA 2RGBA 5FADA 2XE8A 3AI2A 3RTCA 1LSUA 1TL7C 3BD7A 4N8SA 2P79A 2C7RA 5FFMA 2PGJA 3UB4A 5EGSA 3HZZA 4Y6GB 5IC4A 5IX8A 4KXMA 3W8EA 3CZRA 4WRRA 2VG8A 3WQRA 4GS5A 2QR3A 1O57A 1V1RB 4MMZB 3UGKA 4W5OA 4IDGA 2UVPA 2ZSFA 2PL9A 4JSTA 2QUHA 3KHTA 1C8VB 2V7QA 4WBNA 5FOSA 5E9WA 1J24A 1Z7GA 2V6BA 2WJJA 2ONYA 5UKDA 1EUYA 2AS0A 4PLZA 3AXSA 3LW8A 3LUKA 1QP4A 2OHIA 3GRPA 3JYOA 1AUPA 5CA0F 5HPYB 5KWSA 4TV9B 2VBGA 4K9DA 3GVIA 4GKVA 2J4CA 2YUIA 4Q12A 1BTOA 2GPBA 2YCLA 2X5NA 3EGCA 3OZWA 3ECSA 3VH2A 4BO7A 1C30B 5BWMA 2CVZA 4IEEA 2AK2A 3SAJA 3S27A 4BV8A 2J6IA 4Q66C 4LSMA 2F55A 5CTJA 4ZJYA 2ZBVA 3PQ3A 3GO4A 1RVDA 3NANA 4GC9A 3B2QA 1N3BA 4PO8A 5ALMA 1WPRA 2GERA 5AK3A 2C96A 5DK6A 2IHUA 4D98A 4AZ0B 4IX1A 5KSWB 4HXFB 5D85A 2FCAA 3ETDA 2O57A 4U5XA 1PJTA 3JYLA 3TJZA 2FX2A 5JCXA 4DUYB 3H5AA 4QRDA 1E9SA 3UAGA 5CB4A 5JSHA 4TL7A 1V37A 1YE3A 2YQ5A 2ZJOA 5G0VA 1BRTA 4RWEA 2FPKA 1W5BA 1E32A 1Y42X 2QE7D 3A4YA 3THOA 5GV7A 2ZG6A 1KVTA 4ISBA 1GZSA 1MPTA 1YACA 5CAEA 3K30A 3P2IA 4K86A 5JCZA 3V7YA 3ND9A 1WTCA 3L1VA 1U90A 2PBFA 3EX7C 5ES4B 1SXJD 2X3FA 2XSZA 4KVZA 2W6JD 2XXAA 2FEKA 1UMCB 2V65A 3HXTA 1G3MA 1Y8QB 2Q07A 3D5TA 1DFHA 3KELA 5CP8A 2PR7A 3EBLA 5E6RB 3ROPA 1B41A 1DRVA 3NG1A 1A97A 1MOPA 1O94D 2JH8A 1P5FA 1OTXA 2HCJB 5D5PA 5ICGA 1FYXA 3WOVA 3CLTD 3MT8A 1S9DA 2FPPB 4KPYA 4QOIA 3W2GA 1SQGA 4M7OA 4DIBA 2JFUA 2NQTA 2JFZA 2C2XA 5TQ0B 1MAAA 2C4TA 1ZNXA 2QW8A 1LLCA 3NUGA 2XA2A 4N6OA 1E3WA 5TNXA 2G06A 3ACBA 4D9KA 3Q10A 2EAUA 1L5KA 1KZ4A 2AHOA 1UCFA 2EHDA 3ZWVA 4BV2A 4EP1A 4I4IA 4RDXA 3TM4A 4G2NA 4JYCA 4IOLA 2WFZA 1GQQA 1VMDA 2B7LA 2AWNA 2Q5HA 4OX9Y 1LTQA 2YXDA 2GN0A 3A26A 3D0QA 4WEOA 4DS3A 1M5RA 4GKKB 4ZJPA 3AVVA 1Z12A 1LQUA 1TJNA 4DA6A 2CD7A 4JWTA 5LBUA 1VE1A 5PGMA 1U1IA 1TVMA 3Q9SA 2LV8A 2I66A 4IVNA 4J1TA 4C4AA 5LZ9A 3M4JA 5JU6A 1ZKDA 3KQUA 5FO1A 3OLXA 4Z51A 2PMWB 4OGWA 1UWKA 5ALKA 3RSQA 2P9CA 3P0RA 2X15A 3ABRB 3GD5A 3OE7A 1TYBE 3AUKA 1IM2A 3M1AA 2ZRKA 1KSGA 4EKYA 1OPXA 5BUZA 1ZJZA 3VU8A 3LUPA 1AGYA 4HDSA 4HDOB 4YJ2B 2OWDA 3PC2A 1DC4A 2EOAA 1ZVQA 5BWCA 3JR7A 3T1VA 2FEMA 1ADJA 3NIBA 1O2DA 3QVTA 2AB0A 1JZQA 2OC9A 4W5HA 4CFSA 5LP6C 1Y1LA 2VK2A 3MYRA 3D5EA 5D00A 3T54A 3CVVA 2W6IA 5DNYB 3Q8WA 1X77A 2CW5A 4O4HA 1RWWA 3KDSE 3OPYA 5L3SB 3AEZA 2VK1A 3B3JA 3AZPA 4X1OA 3F74A 3U56A 4AM8A 2XDQA 1IZZA 3RBVA 4FQ5A 3FUXA 5B57C 1GKUB 4JVSB 4R8LA 1YNSA 3EXEB 4MWGA 4XQ0A 4BLWA 4BVJA 4BX9A 3KLOA 3NFYA 3ABIA 3ZXSA 1TLTA 4DNXA 3GLQA 4G1MB 1ZO8A 4TZKA