1G5TA

The three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo-atp form
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
157
structure length
157
Chain Sequence
ERGIIIVFTGNGKGKTTAAFGTAARAVGHGKNVGVVQFIKGTWPNGERNLLEPHGVEFQVMATGFTWETQNREADTAACMAVWQHGKRMLADPLLDMVVLDELTYMVAYDYLPLEEVISALNARPGHQTVIITGRGCHRDILDLADTVSELRPVKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of ATP:corrinoid adenosyltransferase from Salmonella typhimurium in its free state, complexed with MgATP, or complexed with hydroxycobalamin and MgATP.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
molecule keywords COB(I)ALAMIN ADENOSYLTRANSFERASE
total genus 53
structure length 157
sequence length 157
ec nomenclature ec 2.5.1.17: Corrinoid adenosyltransferase.
pdb deposition date 2000-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02572 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g5tA00
4D6PA 3D8BA 4PXAA 3B60A 5UKDA 3IEVA 4JL5A 3VTKA 1RYFA 2ZI3A 2QG6A 1MV5A 2AR7A 3C15C 4NPHA 3X1WA 3EA0A 1T8TA 4QC2A 3C8UA 4F4CA 4TMXA 1E2LA 1ZIOA 2Q0HA 4LY6A 3ZZUA 4OQNA 1A2BA 3K70C 4OQXA 1NVVQ 2BIFA 3PXGA 3QXCA 1U0JA 3L82B 1SVMA 4PHTA 1H8EA 1RPZA 4LHYA 4ZI2A 1DE0A 2R65A 4NL4H 1EFUA 3MGCA 1EFRD 2VIIA 1HTWA 5KNCA 1XTKA 4TYQA 4V0ME 3ZIAA 1Z07A 4XWKA 2WKRA 1U0LA 2CE7A 1WA5A 4PQFA 2J0UB 3QVVA 4NP6A 4XVUA 1JBKA 5AWFC 4IDPA 5HCNA 1L7VC 3RVBA 1G6OA 4D82A 4L4UA 5GJCA 1T0JB 4PHHA 1DAEA 2KI5A 2ZVQX 4JLMA 4U00A 1CU1A 121PA 1COWD 1JXMA 3K09A 3LBHA 3OF5A 4HB3A 5JWRA 1Z6YA 4MGYR 3OFNA 4AK9A 3SQWA 1E2JA 5IT5A 1TADA 3B82A 1YHNA 4ABYA 5J4LA 1QHXA 4TYYA 3HU3A 3DL0A 2GJ9A 4I1VA 2VHJA 5BW8A 1GUAA 5ELXA 3DM5A 4IVRA 2AX4A 2VL7A 2DFLA 3A4MA 1G17A 1KI9A 5EUMA 1KI2A 2PBRA 3PUZA 4UJ5A 3DVLA 2JLXA 2XGJA 4IDOA 5E4FA 2YC4C 2ZSAA 2EFCB 3B1ZA 4LI0A 5CDFE 2GEVA 2YWGA 2YHSA 1Z08A 1P2UA 2DB3A 1KZGB 2ZRLA 1N6HA 1NBME 4Q9KA 4LX0A 4PTLA 5FBWB 2J0VA 1UEJA 3AGPA 2F43B 2I4IA 4B44A 1LV7A 1K6MA 1TPZA 2C98A 3AV0B 1SXJD 3F5FA 1HURA 1WXQA 4M1MA 2BBOA 4HI0E 3CNLA 4MUAA 3I72A 2VSOA 2JLUA 3AVQA 4QM7A 3NH6A 1S2MA 1GSIA 2A3RA 1M7BA 3A1SA 5EZ6B 4C0KA 2HLDA 1O3YA 2KE5A 3HJNA 1OXTA 2ODBA 4II7A 4OHXA 5KSZA 2IYWA 2YOFA 4CGZA 4B3XA 4DCNA 1GZSA 2VPPA 4AC9A 2YYZA 1F2TB 1F2UB 4LHZA 3SFVA 4W5JA 4D0LB 1DAIA 4GDFA 4C30A 3VR5A 1FMLA 1VCNA 4AIIA 4JLBA 4KFSA 4ASUA 5AJWA 2YVUA 1E2NA 1LVGA 1W0JA 5GJWC 2YINC 3DOFA 4DT1A 4ZDIA 4ESHA 2JJ8A 5JS8A 2QT1A 1G3UA 5K8LA 3WMFA 2JGNA 1JR6A 4KJZA 2NZJA 2W00A 1JR3A 2FGKA 2GCNA 4BLTA 2MMGA 2WZQA 3CKLA 1E9AA 1XTIA 3B1VA 5C4GB 5BN3A 3DMDA 3U7FB 5AJXA 5KPDA 4D81A 2VHQA 1BO6A 4HAVA 2ZRAA 2W83A 1GKYA 4M1SA 4YXWA 4TYNA 3TKLA 4YC7A 1VYUA 4GOXA 2OE2A 4AD8A 2J7PD 1Z63A 1OSNA 2ANCA 4ERNA 1AQUA 4QBHA 2CLCX 2PT5A 1NLZA 3FKSD 1ETUA 3PR1A 4BLQA 3KTAB 2ERYA 2XNDA 4PC7A 1LNZA 3THOA 1M34E 4P4SA 3AVOA 2WJIA 3K9GA 3LX5A 4FW9A 1OXSC 1SVKA 1VIYA 2ZJBA 5TARA 1R0XA 3P26A 4JVSB 1US8B 1UF9A 3BD9A 4HB4A 2CHQA 4YQFA 2EU8A 3IPXA 1KDOA 1S1CA 5KHOC 2ZI4A 4XSHA 2IA5A 4KSBA 3THYA 4V0LA 1V5WA 4N0EA 3KXIA 1OIVA 3TVTA 2AKYA 3AVXA 2AD1A 1KSHA 3SS8A 4PAMA 3AVYA 1CEEA 4HLQB 4LK2A 2Z0MA 4OYHA 1GILA 1MH1A 1CF4A 4YDHB 2OLKA 2ZEJA 2X1VA 2O8CB 3ND9A 4L15A 3AP1A 1XX6A 3QKTA 2RGNA 4RFSA 1LTQA 1XCMA 4B75A 3WP0A 1W0KD 2RH5A 4BE7B 4DKXA 1G291 1C1YA 4JT2A 2FZLA 2GRJA 2OZEA 3EZ2A 2FSHA 3QKSB 3TR5A 3EPHA 1A82A 4KBFA 3ZIAD 3UPUA 1DAFA 2ZYTX 2RHMA 5EE1A 1G64A 3H1TA 1IM2A 4Q1CA 4JBWA 4BFXA 2PEZA 1G1MA 1KDTA 1XCGB 1Z6GA 2JASA 2FA9A 2NIPA 1S9DA 4Q9HA 2DCUA 3LXRA 1NSTA 8OHMA 1NBMD 4BEJA 4O2RA 4D26A 1PV4A 3QUSA 3JVUA 5DYGA 1DG1G 3SJBA 4TL6A 4UQOA 5EJEA 1KZ7B 5ANRB 3QOFA 2HJGA 1II8B 2K5UA 3K0CC 4JVLA 1AQYA 3GEEA 3F3YA 3L0SA 2O8FB 4FMCB 1ZRHA 3FKQA 1N6LA 4AI6A 2BVNA 2WIAA 3KQHA 3AM1A 1W7AA 4URZR 3W8RA 3EWAA 3LH5A 2OAP1 1NSFA 1RVDA 2I1VB 1GG2A 1E9BA 1VMAA 3O8DA 1OH6A 1E98A 1F48A 1KI6B 2EVWX 2AL7A 2Q21A 1EK0A 4GOKA 4Q1EA 4BFSA 2Z43A 2QT0A 4PFSA 3LVQE 5JI3E 3GLIB 2O0KA 2ONKA 3T06B 1W48A 4QJ5A 5F9HA 1A7JA 1SXJB 2REOA 3LV8A 4LDJA 4HLDA 3CPJB 1FUKA 1E2DA 4BLRA 1P4SA 3TAUA 4CEJB 1TAGA 2DFNA 3CRVA 5TB5A 1JJVA 2E87A 3EAQA 1NN0A 4EKDA 3IHWA 3FHCB 4EFMA 1ANKA 1QF9A 5JJLA 3H2YA 4Q4LA 2ZS9A 2RGDA 4IKEA 2JLYA 3MD0A 3I5YA 3TE6A 5F3WB 4HAWA 1KAOA 1OYWA 1WF3A 2FJUA 1N6IA 5BYJA 1LB1B 1YZTA 4ZCLA 2ZRKA 2J59A 1XJQA 4MITA 3E70C 3A4LA 3S1AB 2IBMA 1XU4A 3QG5A 1ZC4A 5E95A 2IYUA 1W1WA 1CS4C 2XOKD 3V4FA 4U02A 4A1FA 3DHWC 5G41A 3ADDA 4LHWA 4F4IA 2CL0X 1MO6A 1X8LA 3I8SA 1VYTA 2VP5A 2RGAA 2VYFA 3FOZA 2JIZA 4BRUA 5KU1A 2CCGA 1C4OA 1GIAA 2YOGA 3BFXA 1Z8FA 1G3IA 4FWIB 4TSFA 1XD9A 5EUQB 1J90A 1US8A 1U8ZA 1IOZA 3KJEA 4B2IA 2FFQA 3BS4A 4YMWA 3UKDA 2ZR0A 3RNLA 1I4TD 1EWQA 4KAXA 3H86A 1HV8A 3PQCA 2B6HA 3OIYA 3NH9A 4NU0A 5FBRB 2XITA 4WW0A 2BDTA 4KVGA 4DEYA 3C5CA 1SVLA 1GOTA 1X8JA 1NJFA 3MWJA 4B3DA 5A4JA 4FWTA 1G8GA 1KMHA 1OFUX 4Q4JB 2ZJZA 3A4NA 5IK2D 3LAWA 3B13B 3AVPA 2ZRBA 4A8JA 3EZFA 3F8TA 1XB2A 3GLHB 4RSGA 4Z54A 3QKRA 4RZXA 3QE0A 1L8QA 1ZM3A 4GZMA 2QAJA 1EGAA 2D7DA 4QNMA 2WPDD 4WZAE 4TQ9A 1NIJA 1GAJA 2Q6TA 3P4YA 3UMSA 2VBCA 1E2GA 4L16A 1FUUA 4JZKA 4NYMR 4PX9A 1S3SA 4TMKA 3S1AA 3U3OA 5GADl 4OHYA 2XNDD 3L2OB 2A5DA 3X2SA 2F3RA 4ZV4A 2QAGA 4GMDA 2GXSA 2CJWA 3U3JA 4TN1A 1HYQA 4JKIA 3TW4A 2GVZC 4C0HA 1ZM9A 1WQ1R 1KOFA 2VSXA 1XRJA 3QG1A 1JNYA 1Z0FA 1NY5A 3QXJA 3GFPA 1DO0A 3ONWA 1G8PA 4P33A 3ZDQA 1RE0A 4A4DA 4WA7A 4EPWA 4HUQA 5H68A 4JLJA 4EPXA 4NYIR 3CH4B 3VNUA 3WMGA 2ZI7A 4L8GA 1T5IA 3AVVA 2BV3A 1P2SA 4DDWA 2MSDB 3WNBA 5TV2A 1T6NA 4XWOA 4IOKA 4KLZA 1DAKA 2GAOA 2RGNC 2YV5A 3ZZ0A 4O0MA 1ZC3A 4Q7JB 3EXAA 5HE8A 4DDUA 1KMHB 3Q5DA 3N5CA 4A15A 3ZVRA 2EYUA 1KMQA 1KSJA 1T3LA 4JLDA 1AZSC 1CIPA 4IOLA 5DISB 5CYOA 4BWYA 5KSOA 3QJYA 2HXYA 2V6JA 2QE7A 4PAOA 1GRNA 2HYIC 4LJ8A 4MKFA 2C78A 3GLGB 1KSFX 5G3YA 4B35A 1A2KC 3FGNA 2IUSA 4GP6A 1EX7A 1I2MA 1XDBA 3VFDA 4DIEA 4FCTA 4KO8A 2JJ2D 4Q4AA 2OV2A 1T8UA 4FMDB 3PVSA 2V1UA 4PC2A 3SOPA 4DCSA 2CK3A 4EPVA 4OI1A 1KK0A 2OFOA 4IOJA 4RD6A 3NBZC 4DLRA 4C0JA 2QQ0A 4QL3A 4B3CA 1UKEA 1YZLA 4C7OB 1HQCA 2R6FA 1TQ6A 3DZDA 4C2UA 2D06A 4D80A 2W2VA 3TRFA 2NO7A 2B92A 3U2QA 2D3WA 3FFBA 1FPMA 1UDWA 2IYQA 4JJZA 2RGXA 1PVOA 4BFUA 5CM9C 3A1UA 1E4YA 4BUJA 2CLDX 4B43A 3IGFA 1QHSA 1LFDB 3NDBB 2FEOA 3AQ4A 3KQKA 1D5CA 3UMFA 3ZH9B 3TUZC 3GJ4A 4RKEA 5TVKA 1DG3A 2EYQA 4X8OA 4A36A 4ZIRB 2ZIAA 3TBKA 1CP2A 4I1SA 4LBWA 3REFA 4DLTA 4OK6A 1U8AA 1KK3A 4ZDKA 4RD0A 1ZCAA 3VX3A 5AJYA 4ARZA 4LUCA 2ZREA 4EPTA 4D25A 2H92A 2HUPA 1KGDA 1KKLA 1CR0A 3R8FA 1IONA 4A0HA 1BYUA 1AKEA 2AWOA 5SZJA 3ZLJA 2ZRFA 2W0MA 3E1SA 1GNPA 2AFIE 2FPMA 2J0UA 5EXPA 1S4QA 3NWJA 1KJWA 3OIVA 1KI6A 3UATA 2Z4RA 2A2ZA 2Z83A 3E5HA 1OJLA 4LYAA 2NTYC 1KI7A 1YZQA 4AY2A 4V0MA 4TLAA 5GVRA 2J46A 4JKYA 3B78A 5HZKA 4WVFA 4GSYA 1D2EA 4L5BA 1N6RA 3LWNA 4TSFD 5DO9A 3SI7A 3W5IA 3RS5A 4P31A 5TDHA 1D2NA 1M7HA 2P2LA 1OW3B 2ZU6A 4C0LA 4EDHA 3X1XA 5E7JA 2VQSA 4LWZA 1GFIA 1OH5A 4EAQA 4MGKR 3BB4A 4IFEA 1VHTA 4NCIA 3IDQA 3A1VA 2FH5B 1BYIA 2DWQA 4Q7MB 3SNHA 3RANA 2OCPA 4LYHA 2JLRA 5CLLA 3BE4A 1X3SA 2ZR7A 2GXQA 3DOEA 4DWJA 2WJJA 2JDID 2BMJA 3PEVA 1CRQA 2AD5A 1GKUB 3TQFA 4QM6A 5P21A 2CNWA 4AYXA 3ZJYA 1OIWA 4Q4HA 1G9XA 5IRCD 1VG0B 1AGPA 2BCGY 3KUCA 1BOFA 3PEUA 1YRAA 2VO1A 4OKSA 1E9SA 4XIGS 4GRAA 2WOOA 2VP0A 3CB4A 3L0PA 2CCKA 2AKAB 3TR0A 3BB1A 5JCPA 1KJZA 4Q19A 2GJKA 5FUVA 4B6EA 3R9WA 2XJ4A 3NIBA 2QMOA 5L3SA 4TQAA 4ASUD 2Q9BA 1Z28A 1W0JD 2GXAA 4F4JA 1SQ5A 1UEIA 4C0QC 4MKHA 4CRWB 1MT0A 4KFTA 3OZXA 4DHEA 1E3MA 4A92A 1GL7A 4YMTA 1ZNZA 5GJBA 1FNNA 1NY6A 5E3HA 2IWHA 4R2IA 4HDQB 4Y0VA 4Z1MA 3GCGA 1Y3AA 2QM8A 3CR8A 1JPJA 4IRUB 5BN5A 3QF4A 3TSWA 3EC2A 2OCAA 4E22A 1KK2A 4N0DA 3MWLA 2F55A 3LW7A 4MKIA 4QBIA 5G3ZA 1G21E 1OKKA 221PA 2J9RA 3OESA 4Q01A 2YNMA 2XOKA 2AHOA 4R2HA 4X8HA 3FFAA 5AK0A 2F6RA 1AKYA 2J0SA 4QBFA 3EPKA 2J1LA 3N70A 3TW8B 1OFTA 2C95A 4MYUA 5F2EA 2ZITA 1W5SA 2VRWA 5GJVC 5KNBA 1IN7A 2H1LA 1NVWQ 2IHYA 4BZXA 5HTKA 3LFUA 3CBQA 4DVGA 1BH2A 2LKDA 2PCJA 2D62A 5FUWA 4A2WA 2FV8A 4M22A 1E9EA 5FPKA 2RB4A 1G18A 1RKBA 3HR8A 3X1ZA 2ZUBA 2P6RA 1B23P 1JALA 3FB4A 3LLMA 4WZBE 5C4MA 1ZP6A 4JSYA 2D4HA 1E2FA 4DSUA 1ZJ6A 1GTVA 3VHXA 1J8YF 3KKOA 4M1WA 4Q7LA 4MYCA 1KI1A 5BQ5A 1MO4A 1GRQA 1L4UA 3RABA 1LY1A 1XJ0A 1FL9A 4DXAA 1XPOA 3R7WA 1U81A 1ESNA 3EARA 2ZE8A 5CB6A 1GVNB 3O47A 3THXB 4DDTA 4WXPA 2X2FA 4LJ6A 4XOIA 1KDPA 2QP4A 3R7WB 1RZ3A 3QXHA 1Q20A 2V8OA 2ZRJA 1JAIA 3L0OA 4EFNA 3V9PA 1OV4A 2ZRPA 4KSCA 2OG2A 4BFTA 3SEAA 4V02A 3IPYA 4MGIR 3QI2A 1E0SA 1E99A 3WXMA 1IY1A 1YU9A 5DYIA 4ZKEA 2ANBA 3WYGA 2CJWB 4Z51A 3PUVA 1KK1A 4NCKA 3SYLA 5GVSA 5CB8A 3P20A 2QL6A 2XTMA 4QGGA 1TQDA 2GWHA 3V4RA 1J70A 2QU8A 1CLUA 1Q3HA 2VHUA 3AF2A 1FP7A 3DKPA 4LBVA 1DOAA 2AN9A 1T0HB 1W4AA 5EXSA 2XSZD 3QXSA 4JYBA 2X2EA 3ZQJA 1OH7A 1DS6A 1XF9A 4RY2A 4U5XA 1CKEA 1M6NA 4PO1A 1E69A 1NN3A 1GNRA 4OJKA 4TZ6A 4TL9A 2OT3B 2LWIA 1RIFA 3AUYA 1BMFA 4M21A 5HZHA 1X6VA 2CBZA 2GAAA 2ZSDA 4NHOA 1YRBA 4Q00A 4ESVA 2IXGA 1F6BA 5KDLA 5CJPA 2DR3A 3NHBA 3CM0A 4MGZR 2EW1A 1JR3E 4OQLA 1HT1E 1P5ZB 2ZJOA 4EUNA 1KI8A 5FOWA 1AS0A 2O0HA 2QSYA 3SC3A 3N2EA 1JJ7A 4M1YA 2HJVA 1E1QA 4LBZA 1ZD1A 1OIXA 1W4RA 3CWZA 3DKVA 3SYNA 2EFDB 5L3SB 1R5OA 2GDJA 3GJ5A 2V7QA 4H1VA 1FTNA 2MSCB 4PZLA 5F9FA 4B2PA 4MRRA 2FU5C 4KI0A 3IIKA 1XD8A 2EQBA 2AWNA 2JLWA 1K5DA 2ECKA 2BCJQ 3CF6R 3I92A 3LW8A 4QGHA 4TMWA 1R4AA 4URUR 4YDSA 2GZAA 3NTUA 1G5PA 2QE7D 2NPFA 3A6PC 3PIRA 1KHTA 3K9LA 521PA 2WIBA 3KKMA 2XB2A 2WKQA 2WJHA 3C7KA 3SJAA 1G3QA 4IDQA 4PQRA 3ZVLA 3J81k 4LJAA 2EFHB 4Q4HB 2WTUA 2ODEA 4PC1A 3B5JA 4K46A 4AKEA 1UBGA 621PA 4UNSA 4GZLA 1W36B 3MFYA 3ZYCA 5CIWA 1X1SA 2GZHA 2ZRCA 1IN5A 3FMPB 3MSXA 5EXTA 4DEXA 1P2VA 4Q02A 2F3TA 4Q1BA 3VR1A 1PLLA 4JT4A 4LV5B 1Z0KA 4TMVA 3DM9B 3OAAA 3SYKA 3UK6A 1YZGA 1J2JA 2ZYWX 3EIHA 1IN8A 1Q3TA 1YJ5A 5FOXA 3U3RA 1G19A 1S9HA 4W5HA 2IYSA 3AUXA 4AWXA 2YWHA 2O8BB 4TTPA 4P0TA 3PEYA 3CRRA 5FTMA 2GCPA 1FX0A 1VKJA 4OI2A 4CEHA 2W2XA 1NLYA 1KSGA 4UKDA 3G0HA 2VP9A 2O8EA 3BIFA 2FSGA 2OSBA 4LJ4A 3WMEA 3MLEA 1KKMA 3TUJC 1OYYA 2A78A 2ZRGA 2VLIA 3EA5A 4XTCS 4ZIRA 5K8TA 1QG2A 2NGRA 1KY3A 2GHIA 2NZ8A 2EWVA 3A1TA 4CYMA 5J47A 5JEEA 1QHHB 2IXFA 1NMYA 1UKVY 5DIFA 3CW2A 4B3FX 4JYCA 2BM1A 5B57C 2IUUA 3H4MA 3CR7A 1N5IA 4BEBA 2JATA 1DVRA 4QNRA 2ZUDA 5FL3A 1BIFA 2KBFA 4JLKA 3FYHA 4P3YA 5JMTA 1KAGA 2D2FA 2CVHA 2JLVA 3DO6A 1CBUA 4UNNA 3VAAA 4OK3A 4ZO4A 2ZPTX 2G3YA 4IHQA 3H84A 4UXJA 3ZVNA 5DI3A 1SVWA 4F7WA 1QDEA 1FQJA 4QFMA 4JVNA 3QSYA 1PUIA 2IC5A 2QMEA 4DBLC 2R62A 3RS3A 3B1XA 1T5LA 1P75A 5FOSA 4MDEA 1E9DA 4HAUA 1R8SA 4P32A 1JQJC 3RLFA 5KSPA 2D74A 4URXR 3ND8A 4OJQA 3PCRB 3BK7A 4JLVA 1KNQA 4PC3A 4WIAA 2REXB 5KNDA 3KQLA 1WP9A 2CL7X 4V0KA 3HWSA 2XXAA 5JJIA 5FR1A 4OQFA 5SZHB 1RJ9A 3K70D 3WY9A 1VCOA 1P72A 2C8VA 2ZJYA 2MMCA 1GKIA 5JWHA 2IF0A 2PLRA 1II0A 1JECA 3GJ8A 4PR0A 2Q3MA 1N5JA 3EIEA 4PZZA 1QG4A 2OILA 1XNJA 2RHDA 4B47A 3PEWA 3QPWA 2J5XA 3RC3A 2WOJA 2ZE6A 4KYUA 1QHGA 3G5UA 1TL7C 4M0LA 4NYJQ 4DSTA 3RS4A 2F1RA 1ZU4A 4GT1A 2CXXA 2EFEB 4EIWA 2F43A 4M9XA 1MKYA 2O0JA 3IO3A 3RSOA 1YKSA 2CE2X 4FMCF 2QMUA 3W6PA 4D0GA 4AYTA 2ZU0C 2BJVA 3NVAA 5EP4A 1G5RA 1T9HA 4YMSA 5DE3A 1U8YA 3W34A 2WAXA 3B9PA 3T61A 3VU9B 2BOVA 2WJVA 1FZQA 1GL9B 3NEYA 3QKSA 3LXXA 4ACAA 2GEUA 4CEIB 4KYIB 2P6NA 2ZRMA 3C4JA 4IEIA 2Q3FA 2DWPA 3AF1A 3LNCA 1J8MF 2AXNA 2GJSA 3CRMA 4WOPA 3T1TA 1Z3IX 1QHYA 1SZPA 1Z83A 4ZI3A 2AXPA 3VMFA 5J4KA 1AS2A 2W6ID 3VKHA 5L3RA 1D6JA 3I1FA 4ZDWA 3WRYC 2QBYA 2G1KA 3AEZA 2FEMA 2GF0A 1U0HC 4CZ2A 3T12A 1GM5A 1G4UR 1CJKC 1NL3A 1YR6A 4A2PA 4RKFA 1TTTA 3TQCA 2WJYA 1ODFA 3HU1A 4FD2A 2IYXA 3ZQ6A 2BWJA 4PPQA 3NBXX 3U7GA 4C4PA 2X19A 5DHFA 4OI0A 4LPKA 1MRNA 1Z2CA 2BM0A 1DBSA 2O52A 1UDXA 3BH6A 3B8HA 4QJ4A 3T35A 2N1BA 3Q7QA 4HLUC 4G5OA 5KPJA 5JWOA 3VX4A 2VHTA 2QMHA 3FTQA 2Z4SA 1LW7A 1Z5ZA 4TLEA 4LC1A 4NH0A 1NRJB 2E9SA 1CR1A 2ORIA 1EX6A 2H57A 3ADKA 1W36C 2XB4A 1OFHA 2YJTD 3HR7A 4IFBA 1CRPA 4O25A 2VSFA 4GI7A 4DLSA 2G88A 2NO6A 3HPRA 3IILA 4HLCA 1WB9A 3I8XA 3ETLA 4E09A 5SZIA 4WBSA 4N1AA 4BLSA 1GITA 2P5SA 5K8IA 3EW9A 5HCIA 2GNOA 2KJQA 4IDNA 2FOLA 2V7QD 1FP6A 4AURA 5CK4A 1TUEA 4QG7A 4B2LA 1CR2A 2P65A 1XZQA 2G1JA 3KL4A 4WAUA 1GL6A 1U9IA 2FWRA 1DELA 2R2AA 2DFKB 3GEIA 1P62B 1DTSA 4EPYA 1UBEA 2LKCA 2ZYVX 1ZUNB 3B1YA 3L43A 4CT5A 1N0UA 2C99A 3CZPA 3GEHA 4DCTA 1HUQA 3HP1A 4HDOB 4GPTA 1ZNXA 3KUDA 5IK2A 1DPFA 2R6CA 3MRSA 3QQ5A 4NYMQ 4LRWA 1KYIA 2WSSA 5CITA 1M2OB 1U9IC 2C04A 3AF4A 3THXA 3AVTA 1XTRA 3MWYW 3BH0A 3BBPA 3GLIA 4PZYA 1XMJA 1Y63A 1WCV1 2JIZD 4R71A 1VTKA 3TH5A 2AK2A 2NO0A 3L8ZA 3CX8A 5FUXA 2JJ2A 4B32A 4LSGA 5FPSA 1OXVA 4Q47A 4DLWA 2NO9A 1SVIA 2V1XA 4GP7A 2WHXA 4Q4JA 1AA9A 4GL2A 2YWFA 2J7KA 2FSFA 3LO5A 2QRZA 4CF7A 5JEDA 3CPHA 3RS7A 5AJZA 5DN6A 3KJHA 1RRFA 3D6TB 1XXHB 4TMZA 1NVUQ 3BERA 3K53A 5KTYA 4DLVA 3NBYC 4PO9A 1OF1A 2IHBA 1IN4A 2ODWA 1E2QA 3AP2A 4LHVA 1OPXA 4D4KA 5EE9A 1BS1A 1PUJA 2OCBA 3FMOB 3KKNA 4MQBA 4US1R 4US0R 4NMMA 2JAQA 1YZKA 2HLDD 4PSKA 3T1OA 3PITA 3C16C 2TMKA 4BZQA 2W2TA 4IEEA 4BECA 1R2QA 1E32A 1NKTA 3QVUA 4HAXA 2L0XA 2PMKA 5A5GA 3RSLA 4CEJA 1IAQA 4BFZA 3GJ6A 4D2IA 4B48A 1KDRA 1U2RA 2JLQA 2BKEA 1VHLA 2NG1A 2CEAA 2H18A 4QOSA 5C18A 3NC0C 2F9MA 4P4TA 2HEIA 4QJ3A 1GWNA 5AR1A 3KJGA 1XTSA 4QXAA 4XTRA 5FPYA 4WXRA 2ZVPX 4RD3A 3K9NA 2QA5A 1PLJA 4R9UC 4KFRA 5LDDC 2QNRA 1XPUA 5AUQA 2C96A 5BN4A 2XXAB 4CEHB 5FI0B 4NCHA 5FBVB 3WRXC 4EFLA 4MYHA 3WHLA 2B8WA 4NTZA 3U61B 4NBSA 1QZXA 1R0YA 3B2EA 2IEZA 4A0GA 5FI1B 4BLPA 2H17A 2G0NA 1NN1A 3UXMA 4JIMA 4NYIQ 5FOTA 4DIDA 1UM8A 5EP2A 2PT7A 4D4JA 3CF0A 3I62A 3IKJA 1R0ZA 3G82C 2CHGA 3KB1A 2O5VA 3RC8A 5FBLB 2QI9C 4LYJA 3K0FA 1F5NA 4LJYA 2REBA 3RRNA 1N25A 4TLDA 1Q1QA 1SHKA 3UWOA 1IXSB 1G7TA 3MAAC 2IYRA 3LX8A 1X1RA 1OLOA 3W5JA 2OFWA 2WSMA 2IYYA 3GD7A 4H1UA 4BQSA 4BFWA 1HY3A 5JJKA 4DC9A 1GRRA 2XZOA 1TQ4A 2OXCA 4KXFB 2QPOA 3VR4A 4I4LA 4C9BA 1CJTC 1M1YE 4JLAA 2BBTA 4TTRA 3I3SR 1SXJC 1ZAKA 2XAUA 4HYYA 3Q85A 5J4HA 3QBTA 2Y8EA 2P3SA 1ZM2A 3BJIC 1AJEA 3SJCA 3EASA 1CXZA 3BOSA 2ZS8A 2NPIA 4A0FA 5JS7A 1W46A 2UZ3A 1CJVC 4KBGA 3VU9A 2BC9A 3KFVA 3KJIA 4POAA 1X86B 1SGWA 1GP2A 4JBYA 4RCZA 3EX7C 1T3SA 2GCOB 2KWIA 3U44B 2DFTA 1PJRA 1ZCBA 2WICA 3GJ0A 2OO7A 2FE4A 3GFOA 3CX6A 3FE2A 2WWXA 2QAGB 3IBGA 5J4VA 1YR9A 2FNAA 3LA6A 1VG1A 2G0TA 4FI3C 5KO2A 3WNCA 4TLCA 1CULC 3K0EA 2W0SA 3GFTA 4LC0A 1E0JA 2CL6X 3LBIA 4M1TA 1R8QA 4R7ZA 3O8CA 4HAZA 5BWMA 2H16A 5IDVA 5JHHB 1RFLA 4GNKA 4GBMA 2QGZA 2A5JA 2GJ8A 1E2PA 2GBLA 3FMFA 3DMNA 5JBQA 2QSZA 4RD1A 1TF2A 4QRHA 3WHKA 4HUTA 4ZDJA 5G53C 3LLUA 3K8YA 3U4QA 3CONA 1ESMA 1UKZA 5B30A 4MYTA 2RCNA 2GBLC 3DZ8A 1G6HA 1SKYB 3GLHE 3OHMA 2QY9A 4IVPA 4OHVA 5H1YA 1HE8B 2OFXA 1NVXQ 3U3KA 2ZANA 4DSNA 3AKEA 4PQYA 3ZD6A 3CUEF 2NQ2C 1K5GA 3OAAD 4FMBB 3OIWA 3H0KA 3PJRA 5JRZA 1U98A 5H70A 2CVFA 3TSOA 2WMOB 4JJKA 5HR5A 2R6DA 1NG9A 1R5BA 3FKSA 1N6NA 1E6CA 2J45A 1ELOA 2GZDA 1RRCA 3BC1A 1E4VA 2FDCA 4AKHA 1OKKD 3ADBA 4XH9B 2DY1A 2QP9X 3CRW1 1JXOA 3SHFA 1F60A 3GP8A 4Q1AA 5LPNA 1Z6XA 1ZW6A 2GETA 2VF7A 4M2LA 2GVDC 1ZMXA 3Q5EA 5DGXA 2FF7A 4ARZB 5JFGA 4KCGA 3A1WA 3JVVA 4TMTA 3TUIC 4ON9A 3X1YA 5TXGA 1XEXA 3W90A 5A0FA 1P2TA 3AP3A 2RMKA 3PG5A 3ZVMA 1NBMA 2ZI6A 2IS6A 2ZRHA 1VG8A 4DB2A 3OEEA 2VP2A 3A36A 3EG5A 1TEXA 1H65A 3K0FB 4M53A 3RYTC 2XNSA 1XXHE 1D9XA 5K8UA 4IVQA 3K0CA 1S3GA 1FX0B 3L0IB 2PZEA 2FSIA 1GNQA 4LV6A 2DPXA 5HE9A 2H5EA 1NMZA 3MCAA 4DZZA 1OB2A 3B7GA 4AG5A 1Z22A 1VIAA 2WV9A 3SR0A 2XEXA 5D3MB 4EPRA 1XMSA 1KI4A 1XWIA 2A5FA 3AVWA 1E1RD 4L9SA 2VEDA 3KQUA 4C2TA 3VKWA 4UJ3A 3ADCA 2PCLA 2EWWA 3E2IA 2ZYUX 3N2IA 1P9RA 4TT3D 2QBYB 2GA8A 5KOYA 5HPYB 3AB3A 1U90A 2A30A 1EFHA 2ZROA 4KVAA 1U99A 2ATVA 1QHNA 3TNFA 4URWR 1EWRA 3QBVA 2BEKA 2PEYA 4S2EA 1Z2AA 5EXXA 1R10A 1K8RA 5FTKA 4PAQA 1S96A 2AFHE 5CIQA 2ORWA 1XMIA 2ZRNA 1NNEA 2FGJA 2OUKA 3KXLA 4DT1B 1MRSA 4XD7A 2QPTA 1V43A 4S35A 2QAGC 3QEOA 1KO4A 3K0SA 1A5TA 2J3EA 1RJ9B 2Q3HA 3WYFA 2KBEA 1WDTA 4LJ5A 3NEJA 1L4YA 2HCBA 3CX7A 4LOAA 5TY0A 5C1BA 3W3AA 2IS4A 1Q12A 1KTVA 4HATA 1OFIA 2ZJAA 1FQKA 3MG9A 3P4XA 3W8NA 4LZZA 3LVRE 1IHUA 1CJUC 2F1IA 3RRMA 1MR3F 1W5TA 2XTNA 5CM8B 5FOUA 1JEDA 5BYKA 1Q1EA 2IXEA 2XTZA 1RC8A 1E79A 1Q21A 2PLFA 721PA 1Q1BA 4W5WA 3WBJA 4X8MA 3RDPA 4JL8A 3ZD7A 1CTQA 2VH5R 1G5TA 1Q1ZA 2ZI5A 3CF2A 3PENA 1G8HA 3QPVA 3CPEA 4I99A 4P4UA 2QENA 1L2TA 4KHZA 3X1DA 2QPAA 4V0OA 3GLFB 3LRPA 4G5QA 3FMIA 4NCJA 4G5RA 4FXPA 1TU3A 4Q48A 3BWDD 2UZIR 3BGWA 2ZTSA 1KO1A 3THYB 2ZI9A 3EZ9A 4EJSC 2YKGA 3QPUA 2W6IA 5EP3A 2B8TA 2BBSA 4IW3B 4H9GA 4RFSB 2F1HA 3ZZTA 4B33A 3B6EA 3AGQA 2F7SA 2ZAOA 3P27A 4AG6A 4DCUA 5IF9A 2YC2C 2B21A 1P6XA 2ZJ8A 2V3CC 1H8HD 4M9ZA 1VG9B 1OXXK 1J99A 3AF3A 1IXZA 4M1KA 2PMDA 4RJLA 4DLXA 1YVDA 5G40A 5FPTA 1D2MA 1IQPA 1SKYE 4XWAA 1JQLB 5CLQA 4U7DA 3DPUA 4FCVA 1RRGA 4Q4AB 3OFND 4HZUB 1FMJA 4CDGA 4AYWA 3GMTA 3SDZA 5FL7D 3OE7A 5DSZA 3O8RA 5E7MA 2Z5FA 1HH4A 1TEVA 4ACBA 1TX4B 1T3HA 2HF9A 4ITRC 1Z0IA 3GLGA 3NDPA 3DDCA 2ASEA 4GFDA 1S0UA 1TF7A 2FFBA 1W4CA 1G41A 2QTFA 3LY5A 3M0EA 4LJ7A 2ZSBA 3PUWA 2OM2A 4Z1MD 1VECA 2P67A 4E03A 4G3XA 1FW6A 2JLSA 4FIDA 1Q0UA 3CNOA 1ZIPA 1XEFA 2ZJ2A 4CIDA 4E5UA 4DSOA 4C0BA 1JR3D 1X8KA 3W3ZB 2O8EB 1JAHA 1TNDA 3U5ZB 2GTPA 2BEJA 3U60B 3SJZA 3ICEA 2EFGA 3BB3A 5JRJA 2JCSA 4MRPA 5EQTA 1SVOA 1MO3A 1E9FA 2H7VA 3CIOA 3I4LA 4PSVA 5C2JB 1EFCA 2PJZA 2N42A 2GKSA 1RYHA 1VDZA 3AKCA 4CW7A 4OQMA 3MMPA 2O8CA 3QY0A 3UG7A 3DEFA 2OESA 5KDDA 2D2EA 4LCBA 2O8DA 3T5DA 1IN6A 3QXXA 1SXJE 4JMPA 421PA 2VA8A 1J7KA 2IS2A 3FPAA 2QEQA 3P1JA 3T1QA 1IJFA 1CJMA 4AKGA 4ZCIA 4C3ZA 5FPHA 1II8A 1QVAA 5KYKA 1XTQA 2IEYA 2IW3A 2ZQ5A 3K09C 1ZM4A 4RVCA 1KNXA 1WRBA 3SFZA 2H8KA 1I4LD 3ECCA 2YWEA 2DHRA 2X8AA 4WZ6A 2ATXA 1LS6A 4BLOA 3UWKA 3IO5A 1E1RA 4HZIA 3QNUA 2WWGA 2QP3A 5JSZA 3REGA 2VHCA 5FR2A 3EPJA 5HKKD 3M1IA 2B7BA 4L9WA 4EQ6A 3BH7A 2GEDA 2YOHA 3KDSE 3SN6A 5JLJA 3I61A 1DAHA 4TL7A 3RAPR 4IXNA 4RFVA 1PZNA 2C77A 3BORA 3GLHA 1NJGA 3A37A 3IIJA 3LQQA 1Q57A 4G01B 4UNPA 821PA 1VCIA 1W0KA 2FMXA 2FPLA 3QEJA 3HYRA 4LJ9A 5B58C 1XFAA 4Z8XA 4KLNA 3TJZA 4QGAA 1XD2A 2NOAA 2W6JA 5FFMA 4M9SA 2WWIA 4Q66C 3VQTA 2A5YB 1YZUA 4ILEA 1DAMA 1NF3A 1U94A 4Z8YA 4URVR 3AVUA 3GJXC 3R9XA 2XJ9A 4KFUA 1XJCA 4A9AA 1E79D 3SZRA 1LF5A 1JI0A 2Q9AA 2IUTA 3QIAA 3SE0A 1G8FA 1M7GA 2GXUA 4JLPA 4B3BA 1LS1A 1F2TA 1F2UA 4LV8B 4PHGA 2HF8A 4PSAA 4Q5IA 4EJSA 1AM4D 4HDCA 2XZLA 4RZ3A 4QHTA 1G7SA 2IYLD 1P60A 4LHXA 4A6PA 4RD4A 1WBDA 2VP6A 6Q21A 4V03A 2ZS7A 1E94E 3SBDA 2FX3A 2V55B 4PC6A 1IY2A 4B74A 1E2IA 2I3BA 5DH9A 2PX3A 1XP8A 1MABA 4V0NA 3GPLA 2OAQ1 3NXSA 4XVQA 3OEHA 4YXWD 1E2MA 3MJHA 5FTLA 1P9NA 1E1QD 1TQ2A 4TT3A 1JPNA 4M9QA 2V6IA 2JA1A 5AUNB 3UG6A 2QQEA 4M1OA 4KV9A 3Q72A 4D4MA 1A1VA 4DJTA 2VTKA 3KZ1E 4B73A 4UXHA 4N3NA 3B85A 2P6UA 4BFVA 1YQTA 1COWA 1IY0A 1MO5A 4XSGA 2HDNB 4XD7D 3SBEA 4B71A 4GOJA 1KO8A 2FFAA 5FTNA 3U3MA 4G1UC 2BMDA 4OHWA 1UBCA 3WYAA 2ODNA 1MOZA 4UNQA 4PHFA 1N0WA 1H8HA 2BHRA 4DUGA 2QGNA 3PV0A 1EFTA 5TMPA 3M6AA 4IXMA 1ZU5A 1KJYA 2DYKA 3BFKA 5H8WA 4A0RA 5J4YA 4MH0R 5DI3B 3T5GA 1QBKC 1SHZA 4HZUA 5IHPA 3D7MA 2XZPA 2V9PA 4CVNA 4NZYA 1P7CA 1TF5A 5JCZA 5L3QB 3GLFA 4QBGB 5J5CA 3MUFA 4C0AC 4ZKDA 1P73A 3FHOA 3ICQB 3KX2A 3K1JA 2ZRDA 4K81B 1XEWY 3T1VA 3HU2A 2HT1A 2XSZA 2FPKA 4HB2A 3QF4B 2CK3D 4F38A 2C2HA 1HQYE 3CRQA 3OIUA 4UNRA 2IYVA 4JLNA 1N3BA 3KQNA 2WM9B 4Q1DA 1JEEA 3OE7D 2WJGA 5B2ZA 1NG1A 2PX0A 3UIEA 3CH5A 1KO5A 4TTQA 1NLFA 4W9MC 3A8TA 3CO5A 3CZQA 3RHFA 2GCOA 2A7QA 2OBLA 2PL3A 5AUPB 3U44A 3JZMA 3UMRA 1QRAA 3IIMA 5L3QA 5D3QA 3LQRA 3C5HA 3RRYA 4FINA 1Z6AA 1N6OA 3P32A 3TVDA 2ERXA 4IOMA 2OXRA 1VCMA 4HLUA 1AZTA 5FL7A 5DNYB 3NC1C 4NDZA 4DLYA 1C9KA 1KIMA 3TK1A 1DARA 5EP1A 4M8NE 5KSYA 4HB0A 4LPSA 1XZPA 4NCNA 1W2HA 1CR4A 1TUIA 4PPFA 2ONJA 2UVQA 3VR3A 3K70B 4A8JC 5L8VA 1G16A 3B9QA 3CWQA 3FVQA 1W47A 1QVRA 1PLKA 3EC1A 1D8TA 1ZYUA 1G20E 3HYTA 2PZGA 1E0KA 3TMKA 4MUBA 5FH9A 5HKKA 2YZ2A 5EE3A 4BZPA 4TYWA 1XBTA 3EWSA 1KY2A 4XVRA 1W4BA 1RRPA 3U6KA 5EZ5A 3IEUA 2C5LA 5FOVA 2GESA 1E2HA 4RZUA 4I1OA 1YZNA 4A8JB 3TGPA 2NMVA 1HT2E 4UXIA 4EQ6B 3EPLA 1AN0A 1BKDR 3LD9A 4QHSA 2PZFA 3T34A 3IQXA 4MDFA 1Q44A 2ZAMA 3F0TA 4JL6A 1TMKA 1FOEB 2OCYC 2X77A 2P0EA 2G9NA 4HUQB 3KTAA 1ZM7A 3KXKA 2QORA 3O8BA 4TL8A 5M04A 1G8YA 4NYJR 3QKUA 4FN5A 3BRWD 2FG5A 2BBWA 1KI3A 3R20A 3M4YA 3SQXA 2R9VA 3D31A 2WSSD 2GJAA 4DDVA 5KDOA 2JLZA 2WVJA 2QN6A 4GMXA 5DN6D 2OBMA 3IQWA 2RAPA 4DRZA 2JDIA 1B0UA 1UKYA 1E2KA 2V54A 3KKQA 4JBXA 1E2EA 5FBQB 4DCVA 2ZSFA 1UPTA 3D3QA 4FCWA 1IXRC 1OT3A 3CNNA 4RD2A 2OHFA 4HEJA 3VHLB 1VYVA 2ZXUA 1M74A 5FTJA 2HV8A 4MRSA 4LYFA 4MRNA 1SVSA 5DLQC 1QHHA 2ZETA 3ASZA 4Q03A 5AJVB 3BAFA 3ASYA 4A6XA 1RW4A 5DI9A 2WWYA 4NONA 4KITB 1WBBA 2W58A 3TIFA 4G5SA 3W6OA 3I5XA 2JEOA 4Q1FA 3MWKA 2IL1A 4D4LA 3GLIE 3NBFA 3FHTA 1VPLA 2IF2A 2JJ1A 1N5LA 2ZR9A 1Z47A 4TLBA 3PUXA 2GILA 1DADA 2IS1A 2RGBA 3OEHD 2R6AA 1EESA 1M8PA 2BMFA 3Q7PA 4B3GA 1ZNYA 3VR6A 4PO8A 2WWFA 4MKGA 2ZE7A 2IK8A 3VNVA 1R5NA 1R0WA 3K0AA 2RGCA 3WP1B 1G3RA 1WMSA 3L8YA 4Y0AA 4YMUA 3WNDA 4KODA 5BXQC 4B6FA 2WWHA 3QENA 2DBYA 2Z6VA 2KB0A 1QHIA 1AIPA 1R7RA 2CLSA 4DUGD 4Q9JA 2D7CA 2OLJA 1XEXB 4D0NA 1S1MA 2NO1A 3ZS8A 4G0NA 2ORVA 1AK2A 4XJXA 2WKPA 1SKQA 3QF7A 5KUTA 4YONB 1OB5A 4O3MA 2ZRIA 5LB2A 3Q8XB 2R6GA 1P61B 3K9HA 1NI3A 2ZJ5A 1ZNWA 3ZGXA 3W9YA 4OI4A 1TU4A 1Z0AA 4LBYA 1YR7A 2Q9CA 1R6BX 5LB4A 4BPBA 4AKIA 4JVMA 3A58B 2QROA 2IX3A 5JSZB 2ZE5A 1H8ED 3FWYA 1UAAA 3KFXA 1HA3A 3B1WA 4FMDF 3AKYA 2BJWA 1NIPA 1Z0JA 1BMFD 2IT1A 2HXSA 4US2R 5JHGB 4DB4A 3THWA 2HYDA 1NMXA 2QZ4A 3C41J 3I32A 4EJSB 4OHZA 3FDIA 2OBNA 3Q3JB 1FNMA 1JB1A 1UFQA 2O8DB 1P9WA 1ZINA 4DLUA 4A2QA 1W36D 2ZM5A 1WE2A 4CT4B 1N6KA 1XTJA 3IHLA 4Q21A 2O8BA 2RGEA 1ZUHA 2DWOA 1YE8A 2FFHA 1OHHD 1Z6TA 3KB2A 4Q9LA 3EZ7A 1ZD8A 3EIQA 4C0SA 3RRZA 3RWMB 1EFRA 2J87A 2V4ZA 4URYR 5E7IA 4CEIA 4HAYA 2W6JD 1EG7A 3HPQA 5EE5B 3I73A 2XX3A 3U7HB 5J40A 1F3OA 3LDAA 3THWB 4OBEA 5CK5A 3VKGA 2CDNA 4DLZA 4Q18A 3GJ7A 1OXUA 3AF0A 1G4AE 3U7EB 4X8LA 1DAGA 3VR2A 4B34A 2ZSEA 4PPGA 1XCPA 3TLXA 2R44A 3LBNA 1EXMA 4NKRA 4ZPXA 2VP4A 2HT6A 2RKOA 3GJ3A 1XXHA 2CNWD 1E9RA 3TAHA 1KO7A 1G3MA 4IDHA 1XPRA 1ZBDA 1N5KA 4A82A 3QKRB 3NHAA 4B76A 1W44A 3BXZA 3R9IA 1DEKA 1FFHA 2GK7A 3HDTA 3MJRA 4QHYA 1I4DD 5SZKB 2N46A 5JI2E 2GF9A 4TZ0A 4ZCMA 5LD2C 3RS2A 3EZ6A 4MRVA 1NP6A 4F93B 4LGMA 5JECA 2J0QA 3WBKA 2J41A 2UKDA 3AKDA 5LBIA 1T91A 2CCJA 3K0AB 4M4SA 1AS3A 3KKPA 4YMVA 2BMEA 3GLFE 5DHAA 1ZVQA 5CDFA 1YR8A 2C03A 4JLOA 4TWZA 2ZUCA 2J7PA 1E96A 2WBLC 2G6BA 4E07A 1XMVA 2MSEB 2WAYA 2QUZA 2PH1A 4KU4A 5EE0A 5AUOB 5FUYA 4JS0A 4BFYA 2LCFA 3U4QB 2WPDA 1XEWX 4I81A 5CYPA 1GDDA 2BKUA 1Z29A 1NN5A 3W6NA 3JZAA 1UBFA 3RS0A 1UJ2A 1ZD9A 1IBRA 2IYTA 2SHKA 4QGFA 1NKSA 2FN4A 3GLGE 5F98A 2CMKA 1N6PA 4OK5A 1Z06A 5L3VA 1I2DA 2KSQA 3UANA 5LD2B 1A4RA 4PPNA 1HEIA 2F1JA 1FTSA 1G7RA 2HCJB 1W49A 3C14C 1Z0DA 3Q9LA 3R8CA 4Q9IA 3IBYA 2IYZA 4YLGA 2QRNA 1O87A 3U6BA 1MABB 2GK6A 1II9A 1N2CE 1LF0A 3BFVA 4HSEA 4IJMA 3T15A 4F91B 4G5GA 2PJRA 1HE1C 3OEED 1SULA 1W2GA 4RCYA 1P3JA 5CJ2A 2A5GA 2O8FA 1G7CA 4PANA 2VF8A 4BGDA 1ZUIA 2C9OA 4I1UA 4C7OA 3SU8A 2F9LA 2R8RA 3NKVA 4J0QA 2CHVA 3CLVA 4F92B 2QTVB 1OE0A 3RWOA 2WWWA 5JZVA 2AK3A 3GQBA 3TSZA 1OH8A 4K8OA 1S8FA 2G77B 3ZS9A 2A9KA 2E1RA 2JJ1D 3V00A 4W7SA 1SXJA 1OHHA 3PFIA 4OL0A 4NE2A 4RZ2A 2C9YA 4BRWA 2C9CA 1E0AA 2RGGA 2WMNB 2B7CA 2I1QA 2FZ4A 4QKQA 2IWRA 3IUYA 4O2LA 4Q7KA 4P4SB 1N0VC 4JSTA 1Q22A 2P5TB 2QTHA 4TYPA 1IJEA 3SHWA 2OEPA 1AGRA 2QM7A 1UADA 5C46F 3AH8A 3PUYA 1XD2B 2G83A 5B64A 4MA4A 1T4GA 4BASA 4R98A 1ONBA 1DO2A 3NG1A 1E9CA 1D9ZA 4TQUS 1NVVR 5D3MA
chains in the Genus database with same CATH superfamily
4PXAA 4GRDA 5UKDA 1PR2A 2ACKA 1DCFA 3PIIA 1MV5A 3PNLA 4NPHA 3IYLW 1T8TA 3FPJA 2GARA 1KQPA 2Q45A 1L5QA 2V0CA 3FIJA 1FXWA 4TMXA 4WHMA 1ZMBA 3NLLA 4LY6A 4ER3A 5KKCA 1TYZA 5TQJA 3AFOA 5K03A 3T4XA 2BIFA 4F97A 4N5MA 4MRMB 5EQDA 2R1VA 1VHDA 2QR5A 3B5IA 3B3QA 3OQVA 2R65A 4LQLA 3BJEA 3DDUA 3MQFA 3H75A 2VIIA 4Y8VA 4YMGA 1PGJA 3AZPA 4F4DA 3BMQA 3ZIAA 1YB7A 1ZVKA 4HVCA 4PYJA 4XWKA 2CE7A 3ZJ5A 5T8KC 1DKOA 4LNHA 3EBPA 4RLSA 4RADA 4LF6B 3HJGA 3BDIA 4GZ5A 3ZCQA 4PZCA 2DKOA 3U39A 4AJ1A 2JFHA 2NZVG 3AKZA 3KYCB 1YMUA 2QV7A 3I76A 4PSUA 3BA1A 4IDPA 4J0EA 5AWFC 4MUYA 2OV1A 4R7GA 1ZJJA 5EMNA 5GJCA 5BNIA 1T0JB 1P29A 4PHHA 5BT8A 1PG2A 4U7JA 2AFHA 4FWBA 2ZVQX 4KWEA 1CU1A 2DERA 121PA 1JXMA 2EG5A 2J0EA 2LTAA 3IDAA 3KQPA 2FZGA 3LBHA 2R6ZA 4R05A 2XGSA 3L9WA 5KTPA 5JWRA 3N0TA 5HS6A 4N6GA 7MHTA 1H9BA 1E2JA 1PFWA 3Q7EA 1QONA 1YHNA 3B82A 1HFJA 1QHXA 4R01A 2PRSA 3T5BA 4ABYA 3PHLA 1KERA 3NVMB 1MH9A 4NJOA 3IBTA 3ISJA 4KPYA 2GJ9A 4XR9A 5CT4A 1OI7A 3QE3A 4NFHA 1VMEA 5AW9A 2W6CX 3DM5A 4BAUA 1SA0A 5IAJA 1EK6A 5GONA 3T4PA 3A4MA 4CM6A 1K7SN 4UUQA 3JR7A 5EUMA 1GPWB 3TB4A 3PBKA 2Y71A 1AKUA 4DLPA 3H17A 3FR8A 3PUZA 1H5NA 2JLXA 3P9CA 4AY5A 5E4FA 2YC4C 2CLEB 1QR6A 5CB4A 3MXOA 2EFCB 1NVFA 2PH3A 3DP7A 5BR7A 4ND5A 2Y1CA 2OXTA 4FNOA 5AOCA 1P6QA 4B79A 4OKNA 3WO1A 2YFKA 1T2NA 3G2KA 2VBFA 2G9VA 3IOMA 4N8DA 2DB3A 2RIRA 2EKBA 3TXYA 1ID8A 1U3DA 1NX9A 1C50A 3WGUA 4PTLA 2VQEB 3M34A 1JIIA 2OGUA 4W5RA 4QUKA 4GBJA 4V2UA 1JFFB 3R09A 4WQMA 4B44A 1AMUA 3HXPA 1YTUA 1KZ9A 2PQ2A 1J9GA 3HVKA 1TPZA 4CUKA 4GLOA 3F6RA 3LQ4A 1QIMA 1WXQA 1BDJA 1F8UA 2BBOA 2ZCVA 1NM5C 1ISIA 1VGRA 4KQMA 2B1QA 3I72A 3RC1A 1ISPA 1U5BA 2VSOA 3OZUA 4IIVA 4CHTA 4KO1S 4NH4A 4RENA 3N7TA 3ZU4A 4JUDX 1M7BA 3HB5X 4BTEA 1V2HE 2C4WA 1NZDA 1OXTA 2ODBA 2OECA 4II7A 3LPDA 3V1YA 5FO1A 3GFQA 2B1IA 1P5HA 4U9IS 1WMAA 1ISGA 2VPPA 1WZEA 4IXWA 3QWIA 4ZT3A 1OGJA 1F2TB 1F2UB 2L69A 3D3NA 2VNHA 3P96A 5GIOE 1G2OA 4DMUB 5ITZA 3BREA 4C30A 3UUWA 5MN4A 3VR5A 4LVNA 4JLBA 2ZWVA 3SSNA 1LVGA 1KU6A 1W0JA 5T41A 4BX0A 3DOFA 4ZDIA 3AL3A 3CN9A 4ESHA 3CUUA 3ESQA 4MUHA 1ULSA 2VYVD 3WYNA 3WC4A 1OX4B 3LC1O 3DMYA 4TWRA 3HKDA 5KYTA 4OQDA 4KJZA 2W00A 4R2MA 1VLHA 3RRXA 1SCNE 4D92A 2MMGA 1E9AA 3B1VA 2MSWA 3WS7A 3GUUA 5KPDA 4JX9A 4D81A 4WNCA 2B8JA 1G98A 4JUAA 3AMVA 2I2BA 5C8YA 4AJIA 2XUIA 2K4MA 2VHXA 4M1SA 4QPJC 2GERA 1OWLA 2HBYA 3B8EA 1FDOA 3M9LA 4GOXA 2OE2A 4KXVA 1QRRA 2J7PD 2ANCA 2P5YA 3OUTA 4I8XA 3TRKA 3GNLA 1AQUA 5JS2A 1XTVA 2A0UA 4QBHA 2PT5A 4JITA 2CLFB 3FKSD 4EYKA 1ETUA 3PR1A 4AJ4A 2XUQA 1I5RA 4C5AA 3C6XA 2ATEA 3PNQA 4YAOA 1A0OA 2VNIA 3E3NA 3KVNA 2E5WA 4MMYB 5AKXA 3ZVKA 5DOVA 1EQ2A 1E3WB 3GGPA 1EK1A 2O3JA 2I8AA 5MN6A 3RU2A 3QUAA 1GAEO 1THMA 3P26A 1HZJA 4B6RA 5AI9A 4K05A 1SCKA 1CUDA 1TPYA 4B4KA 1GV1A 3QU5A 4V39A 4YQFA 2J9FB 3IPXA 1T4CB 3WKEA 1S2NA 3LQFA 2ZI4A 3JSAA 2O7SA 3RVDA 1GGEA 3ZHYA 4C88A 5KHOC 5DNAA 3UXEA 1E5VA 4ZXFA 4CM3A 3V4OA 5T8KA 1OFGA 3FUWA 5GM1A 4ARCA 2HBRA 2HGSA 3L04A 1U7PA 4KXMA 5E38A 1MHPA 3L6EA 4I2VA 4HLQB 3AVYA 1CEEA 4HWTA 4KR9A 2HJ9A 1W93A 2Z0MA 1U1GA 2YY6A 4GYJA 4OYHA 4XCXA 1BVHA 2QRKA 4S1VA 1EWKA 4MWBA 7AT1A 2A1TR 3S2UA 4OIMA 5ALKA 2ZB2A 3FRJA 3QKTA 3E2PA 5IUKC 2RGNA 1U2GC 3GVHA 1IOLA 1MAWA 1XCMA 3NM5A 1W0KD 2RH5A 3DMFA 3NX4A 3WIEA 4E70A 4PRZA 4BE7B 1J0CA 1JKJA 5TE9A 3HK2A 3KZCA 4IJKA 3TF5A 3RADC 4KX5A 2FZLA 4M99A 2C1XA 4JHLA 3DF9A 3TR5A 3EPHA 5KYWB 1NAIA 2ZTHA 4KBFA 1VPEA 1DAFA 1Z2PX 2HCRA 2X1MA 2X7JA 3ICPA 2H31A 1X9HA 1G64A 3C3XA 4NBWA 4Q1CA 5FEUA 3EWIA 3BTSA 3O8QA 5C5CA 1YQQA 4JBWA 4I19A 1SPBS 2AVDA 1XHFA 2PEZA 1G1MA 1NMSA 1KDTA 2JASA 2QD5A 2FA9A 1T3GA 3GNTA 3NTVA 4UPDA 3QU2A 5JNWA 2FP4B 3WJ2A 4AF7A 1NSTA 3QM1A 4OLFA 3C1AA 2NSHA 3B6ZA 4J3JA 2R8EA 5CNMA 3V8MA 3FSRA 1YVUA 2PUFA 4D26A 1PV4A 4C14A 3JVUA 4MW1A 3F5DA 5KX5B 4YJFA 5EUBA 1Z4QA 4HWRA 5JCJA 4A26A 3QOFA 2WTXA 1X13A 2A9OA 3GP5A 3S5UA 3SIWA 4JLUA 1RKQA 3LBAA 4WBNA 3U9LA 3GARA 4YQEA 4MICA 4TTIA 4AI6A 1NVBA 3FOEC 2OHOA 3HVUA 5FWYA 2OAP1 1NSFA 2IPNA 2I1VB 1GG2A 5ESDA 4GKKB 5KOJA 1Z18A 1E98A 1LPBB 2Y4OA 1BE6A 3I58A 2Q21A 2YWBA 3G2NA 1CUWA 2AQKA 3EGWA 4NBUA 1ZJZA 2FETA 3LVQE 4O4LF 1OTXA 3AIMA 2PGXA 3KEQA 4IYRA 3TIVA 4GSLA 3ZDXB 4R9NA 3TINA 1A7JA 1J0XO 1XT6A 3DYVA 3H16A 3I2FA 2D1SA 4HXYA 4HLDA 4TWBA 1NQUA 3IAM1 3EXFB 3CPJB 3AXTA 5A7GA 4MULA 1Y8RA 1E2DA 3PUKA 4JQCA 5JSUA 1P4SA 3TAUA 1TAGA 2DFNA 2GPYA 1RAEA 2IDJA 3A6LA 3KOOA 3QTLA 3A2NA 1CETA 3EAQA 4EKDA 3H5LA 5A4DA 1I80A 2I80A 1Z8DA 3IHWA 4HYTA 3UENA 4EFMA 1QF9A 2WF7A 1QQAA 2QMYA 1FP4B 4Q4LA 2JH3A 4X0EA 2FPXA 1B7GO 2IU6A 2BR5A 1G8AA 1MIOA 1L5YA 1H2XA 1L4MA 2CUZA 3E1GA 5DGHA 3I5YA 1WNTA 5JNLA 5F3WB 3EVDA 4LXXA 4D9MA 1KORA 1IU9A 1WF3A 2FJUA 2WYOA 4JEHA 3FR7A 5BYJA 4BLUA 2C7PA 4ZCLA 1IIRA 3SKVA 4CLOA 3JD3A 1NNSA 2JFFA 4FIZA 3ZV5A 4AAYA 5DM1A 3ED5A 1M73E 1F14A 1QV7A 1W1WA 4LMAA 4U02A 2Q41A 4PCVA 4ZFNA 1IIBA 3E3LA 4H1HA 5G41A 3LX6A 1T1EA 3UFXA 3F9CA 2IW1A 3K4PA 2SBTA 2C07A 2CL0X 4F4IA 1IZ7A 1N2SA 3P0EA 1U0EA 4E5DA 2H11A 1DIGA 3UKOA 2HNBA 2RGAA 2VYFA 3UW3A 4QTUB 1Y9EA 2OAGA 1HE4A 1C4OA 2YOGA 1YS9A 1Z8FA 3AWDA 5LQRA 3CC8A 3WLMA 1TCAA 2R11A 4CKEB 5KJCA 2PR7A 2ZIWB 1IOZA 3UUFA 1RMYA 2GDZA 5HKOA 5AXBA 2W2LA 2ZR0A 3WB2A 1GSOA 1W88B 3KQVA 4H4DA 2EG9A 4IIDA 4RESA 4YCJA 3NIDB 3H86A 5H59A 4XB1A 4P0QB 4Q4DA 3LPCA 3TIIA 2PRZA 4DUZB 3NH9A 4NU0A 2PE5A 5GOZA 3TLEA 4ZHQF 4KQHA 3HEBA 3QLEA 1PEYA 1UPBA 2N75A 3PB3A 2VDMB 1OBHA 5LP1A 1K4MA 1SHLA 1SVLA 2WTEA 4G4SP 2VVTA 1OAOA 1T1SA 5A4JA 4YIHA 2CXPA 4GW3A 4KVFA 3RNOA 4NNPA 3D3KA 4BO1A 5AICA 2N1MA 1R27A 3D1VA 5IK2D 3PCXA 2ZRBA 1S8NA 1KEZA 2FWIA 3F8TA 2EEZA 3NYQA 4C6TA 3B51X 1JDNA 2IODA 3VHXB 5AW7A 5EJ9A 2VH1A 1CJCA 4AY4A 4UUOA 3SXUB 3SVLA 5D2CA 1AB6A 3QE0A 1ZM3A 2YW2A 2HU5A 2ZP1A 4RKWA 4E7OA 2D7DA 4JODA 2MTBA 4PIPA 5KCZA 3BXHA 9LDTA 2CFCA 2HZBA 3R7BA 1U5BB 1L8OA 3HXKA 3L84A 2B4RO 1NIJA 1JSXA 4H77A 2Q6TA 1JEYA 1H94A 5KOHA 2WWRA 2F2TA 3F4BA 1B73A 2P9JA 1E2GA 4MCIA 1FUUA 2MIIA 4NYMR 3CNBA 1S3SA 4TMKA 4MVXA 4X9XA 3S1AA 1NXSA 5GADl 1PHPA 2XNDD 5J63A 3WOHA 2YJGA 3L2OB 4YJDA 2BGNA 1ZIDA 3ONVA 1BCSB 3G0OA 3X2SA 4ZV4A 4GMDA 2CJWA 3U3JA 3Q6MA 4BKMA 2Y9MB 1PR1A 3ZE2B 2XA9A 4CKBB 4XCVA 1HYQA 1AMOA 4DN6A 2IHTA 4Z3KA 5DCYA 5EPUA 1GKKA 1H2ZA 1WQ1R 4KOEC 2VSXA 4C0HA 4DV3B 3N2NA 3GPCA 5HMMA 3NUZA 1XRJA 1JNYA 1Z0FA 3KAPA 1DO0A 5CX4A 1G8PA 3ABQB 3H8WA 1BNCA 1RE0A 4YCAA 4WA7A 4MVJA 3WADA 4A4DA 2C7QA 3RYFB 1IZ9A 1PJQA 1PKXA 4PLFA 3UK0A 4RWEA 3KVRA 1RMQA 1KMMA 1M5UA 3CVJA 5CVUA 3WK6A 2MYNA 4X1IA 5A9TA 3WMGA 5LP6F 4EYOA 1F8GA 2ZI7A 4HN2A 3R3ZA 3GL9A 4LW8A 1HL7A 4L8GA 5E4JA 5SYAA 1GO2A 1ADBA 1UDRA 2GRUA 3D6HA 5AI0A 4E5YA 4G0WA 3AVVA 4DM4A 2YXBA 4MVJI 2NO4A 2BV3A 1MQAA 1M0WA 4IZOA 1NNLA 1L5FA 2EZ9A 4JQOA 4R1QA 5TV2A 3SG0A 3GFVA 1DAKA 2GAOA 3HN6A 2K2QB 1GPUA 4G36A 4GBGA 4IJ5A 4J43A 4EB6B 5BWBA 1ZGZA 4TKUA 4COKA 4DNPA 1HBJA 3FNBA 5L6MB 2PGJA 3M6VA 3KBBA 4MWDA 5KCMA 1L7OA 3N5CA 4A15A 2VKQA 3O3CA 3L05A 2BE7A 4FYPA 2FYTA 1AZSC 5EIBC 2PA3A 2R6HA 1SUSA 5DISB 3GBSA 4BWYA 3QJYA 2BGKA 1GSHA 3NV9A 5ITVA 3A9SA 1E1CB 3FG9A 3E53A 4RHUA 2F64A 1D2HA 1GRNA 3DPSA 2H9IA 1SKAA 3VPSA 1DHTA 3ZHSA 1GRVA 2GBFA 4UM5A 1OX4A 1BD3A 1K8XB 1R16A 6NULA 3TX2A 1HORA 3IESA 1ZBQA 1S2LA 2DH6A 2O7NA 5G3YA 3C3YA 1VSUA 3H13A 1R3UA 2KX7A 4R2LA 4ZVTA 3FGNA 1ZLXA 4L5AA 1JLLB 4MV4A 5G0VA 3GOHA 3BE6A 2TMGA 3V2GA 3EIOA 2P4UA 5LXTA 2V0GA 3WO0A 1PQPA 3DV2A 3FKJA 1I2MA 4HG2A 4N03A 4OSEA 2HSEA 4JUCA 1TYDE 1XZCA 1UWLA 2AYZA 2OV2A 1T8UA 1QPGA 3NKFA 3PVSA 4FMDB 4Q4AA 1T1RA 2NU9B 1O08A 4CPDA 3LL4A 3SOPA 4L8LA 4MWZA 4YCCA 4OI1A 3CZ9A 3LK6A 4EVSA 4RD6A 3NBZC 3NGLA 4AP6A 5IU6A 2NM0A 4FLFA 1UKEA 2P4QA 1E60A 3K6KA 4IMRA 2DF8A 2JKVA 1SD2A 1Z6PA 1BX1A 2VCHA 4ZHSA 3DZDA 4R5HA 1JJAA 3E15A 4C2UA 2W2VA 1ZFNA 4L8FA 1ODLA 1X80B 1PAUA 2QRLA 3HKBB 3VBEA 1OR8A 2NO7A 2PLAA 3KHSA 1C1DB 4FLEA 3PC7A 4XOUA 4CL2A 3MWGA 3FFBA 4WBNF 1UDWA 5IM4A 1DX9A 4L9RA 4R2JA 3EC7A 1N2ZA 1Z0ZA 2XAAA 4IWXA 1M67A 3NMUF 1XWWA 1N7JA 1M5RA 4GS5A 1XALA 2ZBDA 2C2BA 4HSGA 3NDBB 5FA8A 1D5CA 3UZUA 3ZH9B 5BSWA 4QICA 4RKEA 1Y3BE 3R6WA 4EG1A 4ENQA 5K0CA 1DG3A 4RNDB 3WICA 1RC1A 3A6JA 4UMEA 4X8OA 4A36A 4BMYA 5JAUA 1DUSA 3REFA 1U8AA 4ALLA 1RT9A 3ZCTA 1JNXX 1QE3A 1MA3A 4RDHA 3VX3A 5I01A 5JCJD 1C0EA 3CEJA 5TQ2A 4ARZA 2IHNA 2OMKA 2ZREA 4UHCA 4AL4A 6REQB 3Q8WA 2H92A 2HUPA 2P2GA 4WY2A 4AWAA 5THXA 5I9BA 1IONA 1TMGE 2RAUA 4RF3A 1JIXA 3VI3B 5JISA 5KWSA 1THGA 2AWOA 1NHWA 3JWHA 2W8BA 4WL0A 3ZI0A 3ZLJA 3QLVA 1Y82A 1UJBA 4ZMSA 2M6RA 3LC0A 2AFIE 2J0UA 1ADJA 5LMZA 5IBRA 3U56A 1JA9A 1KJWA 4ARIA 4M1EA 3VDXA 3H6GA 1TLLA 1VMIA 3KYDB 4S05A 3UJNA 4LYAA 4XYMA 4CV0A 1KI7A 1EB8A 4BQFA 1U6KA 1LWOA 2B20A 2BKXA 3WGLA 1FS4A 1N6RA 3BVPA 4RK6A 1LZLA 1Q14A 2WNIA 3FH0A 1T26A 5DO9A 1GAWA 2PTGA 3QVKA 4P92A 1YA4A 3RR2A 2X7HA 1A4XA 2R8PA 3A04A 1D2NA 3X44A 3ZLBA 1N5MA 1C3XA 5E7JA 1OYVA 4Q34A 3GB9A 4BOYA 2P8JA 2XNCA 4RQBA 5JW6A 3R1IA 3QX3A 4MGKR 3GDFA 1YOBA 4IFEA 2DQZA 1ZW1A 4NCIA 3IDQA 3JARB 3VC2A 1XTZA 1WPGA 1UDAA 2YIMA 4WUVA 5KTKA 4YBRA 3H4VA 1Q0QA 5CLLA 4X7MA 2EZ4A 2C2OA 3DOEA 3MWDA 4UAUA 1M2GA 3OEWA 1INLA 1JHAA 5FWNA 1IJBA 3Q7RA 4RH0A 1FS5A 3TQFA 5EIOA 2CNWA 1XZGA 4KQ2A 1OIWA 1ZUD1 2XMGA 2M6SA 5IRCD 1PT7A 1ORVA 3VR4D 4RTRA 3G5AA 1VG0B 2CLMB 3HKEA 4ZMRA 1FF9A 1R9NA 2BCGY 4TOIA 1BOFA 1QPBA 3W79A 3CLKA 3I05A 4MWEA 5JT1A 2QTAA 2I7XA 1NI4A 2EBHX 1EJ2A 2OV3A 3GHHA 5A3JA 2WOOA 1XLWA 1QQBA 4AJ9A 3CB4A 1SU4A 5A3VA 3P2JA 4F5EA 1XYYA 2JGDA 4ZZ2A 3TR0A 3BCUA 2QLBA 2VATA 1KJZA 4Q19A 4S1PA 3O82A 5FUVA 4B6EA 4DTIA 2GBCA 4IY1A 1P0QA 3NIBA 5FYDA 2X0NA 2HSDA 3PKZA 3S28A 1W0JD 3UJAA 1SQ5A 3OPMA 2ZIZA 1FMTA 3MRXA 3PSHA 4C0QC 5HVNA 2LDBA 1GNVA 4YMTA 4FE7A 3GVCA 4K2AA 2I7DA 5C7LO 1XF1A 1IAVA 1M10A 2QD1A 4DV7B 4HDQB 4LJLA 4JP3A 4Y0VA 2G0AA 1X1EA 3GQVA 4FKMA 3GCDA 5JROA 4IRUB 4N40A 5DRTA 5F64A 3CVUA 3WLSA 4FYIA 4JB2A 5TMBA 3ROFA 5L51A 4HRYA 3ZCSA 3UFXB 3TOVA 2ZVJA 4DMKA 2FWJA 3K5IA 3OM1A 1WUIS 4XASA 2F55A 3LW7A 3T3IA 3DE0X 3OTWA 2CVQA 4XUEA 3GROA 1UWKA 1OKKA 221PA 2WZBA 4KQCA 4II3A 1ZOLA 3OESA 4MV8A 2OD9A 4X8HA 4DSZA 2D1QA 5AK0A 2XODA 2HAEA 2HTFA 4XAQA 5JDIC 4QBFA 1U0NA 1SUBA 2A35A 4HFNA 2PWYA 1E7QA 1NYRA 1SIUA 3PHJA 4MYUA 2ZQZA 4HTAA 2ZITA 3GRKA 4I3FA 4B09A 1YA6A 2H1LA 1NVWQ 2IHYA 3VVCA 4BZXA 5HTKA 3LFUA 1V1JA 4MQMA 5F7JA 1I8TA 1H6AA 1SUDA 2OGZA 4IDCA 3D59A 4EG7A 3NVKI 2B2XA 1E9EA 1EWYA 5C81A 5J5VA 5IUNC 1G18A 1UZAA 2QQGA 3FRIA 4HRVA 3ECAA 3F8SA 2GA9A 2QG9A 2Z30A 3AFIA 3LT5A 4CE6A 4EO9A 5L95A 2H29A 1B23P 4BQRA 3VAZA 1T8RA 4ND6A 1O57A 3LLMA 5C4MA 1ZP6A 3VU0A 4ZA2A 3A6DA 2Y1GA 2BGGA 3JQCA 3OM8A 3V1KA 1W5FA 4QARA 3VHXA 4Q7QA 3OZDA 3V2IA 4TV9F 4J4HA 4BMDA 1ESZA 2OXEA 3DV0A 4E13A 1KI1A 5BQ5A 3UJ9A 2YXNA 3UJ8A 1L4UA 2VSYA 1KTIA 1YR3A 4G67A 4JYZA 3OZGA 1YOVA 1QGOA 2H1FA 3E5RA 1GAQA 4P6VF 1YQ9A 4DCOA 1N0IA 2HWYA 2R3SA 4J90A 4DDTA 1PJ4A 2EJCA 1T35A 4XOIA 3GO4A 4E46A 2QN2A 4H16A 3SY8A 1SUEA 1Q20A 3QXHA 2ZRJA 3E35A 3TL6A 4DNXA 3GVIA 1OV4A 3A6PC 4LZOA 3C6KA 4HNVA 3MOIA 4XXHA 1ND6A 4K9LA 4RTLA 4N41A 4CXMA 1M2NA 4A3SA 1I7QB 4YP7A 3WXMA 1JEOA 2O59A 1IY1A 1VPWA 4RPIA 3WYGA 3EZNA 5C52B 3OTGA 2WYUA 4GI2A 3SYLA 3CT4A 1TIPA 4FDUA 4OM7A 3T95A 5GVSA 2Q5QA 5CFNA 1TQDA 2H3EA 3HJBA 4YP1A 1J70A 3SHVA 1CLUA 3VPCA 1S2OA 3FOCA 4BMCA 2O9JA 5CA1B 1Z17A 1X7XA 1PJBA 1RM0A 4MI9A 4IHJB 1T0HB 1OH7A 1ONPA 3QXSA 4JYBA 4G9GA 4OG2A 4EEZA 1JN0A 4JCOA 4U5XA 1CKEA 1Z12A 4PO1A 4B83A 3D43A 4WH0A 2BFBB 1LCIA 4M0EA 4P3KA 5A5DA 1NN3A 1QM5A 1TA9A 1T29A 2LWIA 4HEA6 1RIFA 3AUYA 3NFRA 4BCCA 4M21A 5HZHA 2ZSDA 1D7OA 3WNZA 3PVZA 4ZC8A 5ELLA 1LPMA 3NHBA 4MGZR 2EW1A 1JR3E 1KS2A 3IQEA 3LQ2A 2ID9A 1KI8A 5IARA 1NNI1 3G2HA 1C14A 3L02A 4BVBA 1KAMA 2P1RA 3M70A 3ZIUA 3N2EA 4M0DA 3OD5A 2HJVA 1IHOA 3DMTC 3B36A 5LNK6 2RBKA 5CVVA 2ZBUA 5CP8A 1R5OA 2GDJA 5TSDA 3WRVA 4M9UA 2PZLA 5HCUA 1IMJA 1RHJA 5G1NA 1PWHA 4FQ5A 4F1KA 2VSQA 3I9OA 2JK0A 4DR2B 1DHRA 2DFDA 3VDNB 2EQBA 2BP7A 3R77A 4MP3A 4J3FA 2UYYA 1VE1A 1UZUA 1K6XA 1M66A 1K5DA 4IP0A 4N5LA 1UFOA 3CF6R 1ARZA 2X0FA 4K6HA 5LZ2A 2HL6A 4TMWA 3TNDA 2B30A 3EEYA 4MAFA 1S2GA 3M5DA 3UOWA 3IA7A 4E3ZA 2Y1OA 4G2NA 3S2FA 3K9LA 4KOAA 3TW6A 4RPGA 2WIBA 3OCXA 3UEOA 1R6DA 2WKQA 2XB2A 2HX1A 1G3QA 2ZKLA 2ODEA 1U8UA 1Y7IA 2W6OA 2BFMA 2IX9A 1NJSA 1SUCA 2AC4A 4N82A 4A0QA 5L4LA 1HDZA 4R41A 3PF9A 1L3IA 3K9BA 2XMQA 2EL7A 4AMVA 3E58A 1X1SA 4QNNA 2GZHA 3MSXA 3O75A 5AFSA 3K6RA 2F3TA 9ATCA 3TAXA 4O0LA 4GOND 4Q1BA 4Z4GA 3KVYA 1FSZA 1T2VA 1NKVA 1RAGA 1TE2A 3IR7A 4TMVA 3OAAA 1B6GA 1YZGA 1J2JA 5DM4A 1I0LA 4RLQA 4Z99A 5J9FA 3ETHA 3HC7A 2ZYWX 5DM60 1GG8A 1IN8A 1Q3TA 1AQLA 2G6TA 2XKJE 2Z2ZA 1S9HA 3DOHA 4L73A 4W5HA 4QYIB 4AWXA 2WQ6A 1WBBA 3MLBA 2YWHA 2O8BB 2X9GA 4JX8A 4YC7A 2Q5FA 2GCPA 3KZMA 1FX0A 4OI2A 4LSWA 4CEHA 1Z2OX 3BYZA 1KSGA 4F3YA 2VP9A 2UXBB 3BIFA 2C7RA 4GR9A 2O8EA 2VXYA 3TECE 3LYUA 3TYXA 3ZU6A 1MOPA 4ZOAA 1JZQA 3TUJC 3LCRA 4B17A 2A78A 3EA5A 3JZFA 5JZBA 2PUEA 2WHPB 1DKPA 1QG2A 1X7ZB 4DR5B 1KY3A 1ZH8A 2EWVA 4AU1A 1OUMA 1YQWA 1I0IA 4P58A 3L7IA 1VMDA 1BVRA 2VJPA 4Y1GA 1UKVY 1N34B 4PW0A 5DIFA 1NAHA 1GG5A 5J23A 1PL6A 4LJRA 3CBGA 2WYWA 4OXYA 4J8PA 2IUUA 4X7RA 4DLKA 5EWMA 3CR7A 1EQAA 1F3LA 4RVDA 4MS1B 4YRRA 4ZJPA 1XZEA 3ZZMA 1B8VA 3EZYA 3FYHA 4FDMA 1JP7A 3HKEB 4E5MA 2CVHA 2GN1A 4O4IB 1ZK0A 4DAEA 1CBUA 4UNNA 1GAXA 1C3OB 3N76A 5I7AA 4MPDA 1K2VN 1ISFA 3ETJA 1U4NA 3D0QA 4IHQA 1NJ6A 3K94A 3VOTA 3I4FA 1RM5A 3MSCA 4AX4A 5DI3A 5BN3B 4F7WA 1P1RA 1QDEA 4NCNA 3LZCA 3DUFA 4JVNA 3PNVA 5LJIA 1MV8A 1PUIA 1NR7A 3IOBA 4PY2A 4DBLC 3GCWA 4CV2A 2R62A 3NBKA 3IP5A 3L7BA 1UOEA 1U04A 1S8OA 2NSDA 4I1YA 4JDPA 4JJEA 3ST7A 1W5BA 1JQJC 2A6PA 3RLFA 4DR4B 3KLNA 1JHQA 3EBLA 2OL4A 4UTNA 4F60A 5A0VA 4JLVA 2DR2A 2F1KA 1B14A 4WIAA 1JHPA 2DTEA 1MIOB 1DB3A 3WL8A 3EEOA 3W0LB 1TGVA 2C57A 1OROA 4X61A 4MTLA 5KNDA 3KQLA 4E09A 3BTOA 4GI3A 3H83A 5GM2A 4E5SA 2XXAA 2Q0QA 4GX0A 2WJAA 5B3JC 4L78A 4RTMA 1G63A 2JI7A 3K70D 1VCOA 3FTDA 4JP8A 5FNZA 3VYWA 2HU7A 3SZLA 1TKAA 1PZMA 2MMCA 4NG4A 3H9GA 5JWHA 1LLFA 1RRVA 2JIPA 3M6WA 3DAHA 3G0IA 4AJPA 4HX9A 3GJ8A 2VXBA 4DUPA 1QB7A 3EIEA 1DT5A 3VGPA 4PZZA 2FW7A 3JZIA 3PX3A 2RHDA 3OG9A 3A9VA 3QPWA 3S4YA 4CM8B 1K7CA 2WOJA 1PIWA 2ZE6A 4NMXB 4A8HA 1OLXA 1Y5RA 1I10A 3WSTA 2GZMA 1P2DA 1K08A 2QE6A 4N48A 1M2FA 5EN4A 4AXXA 1F9AA 3W5DA 3RS4A 1ZU4A 2HADA 1I01A 3QLJA 1WQ3A 3DKKA 4FMCF 2WDZA 3WAJA 2ZBVA 2ZU0C 2O20A 1J8QA 3H1FA 1CVRA 1G5RA 3G85A 1WVGA 2WAXA 1XOIA 1N75A 2BOVA 2QR3A 1FZQA 2Z9CA 5K3EA 1GL9B 2ZIXA 4L4ZA 1TJPB 3QKSA 1MW9X 2CKDA 3LXXA 3Q0EA 4EW6A 3LTNC 1FFSA 3THSA 4NHEA 1SM4A 1ZJ4A 3IALA 2P6NA 3HGTA 1H2FA 1RADA 2PBFA 2QTWB 3C4JA 3DE3X 1ZKDA 1ZIYA 1JPVA 2OO5A 2QJTA 3VC1A 5K45A 1NR5A 2GJSA 2Q5IA 1NF9A 1USVA 1QFYA 4MAAA 1RZVA 4OHMA 1YB1A 4C4OA 5A4KA 3E03A 3IEPA 1QHYA 1XVVA 2FEKA 1JIKA 2YVAA 5L3RA 4L07A 1UWVA 3ZCUA 1NW4A 2FEMA 3H11A 4PCLA 1U0HC 1GM5A 3S6JA 5EFZA 2O6LA 4A2PA 3TQCA 1ODFA 3HU1A 4KN9S 4Z53A 4PPQA 3NBXX 4O02B 5BUSA 5L7WA 4LOKA 3STUA 3PJEA 3N6XA 2X19A 4GF5A 5YASA 3NIFB 2XR1A 1NI4B 3M1AA 1Z2CA 2BM0A 2O07A 1GADO 1U2QA 3H2JA 1UDXA 1OJ7A 4FFNA 1RFGE 2ZTUA 2OC4A 5DM0A 2Y1KA 4AZSA 4QJ4A 5FUMA 5KYNA 4XFJA 1BSVA 2EWMA 3T35A 2UYCA 4Y2RA 1JG3A 1QNFA 3Q7QA 3QVTA 5HGXA 1QDLB 1RXEA 5IJZA 5JWOA 3P9QA 1T2DA 3AEQB 1OTHA 5ILGA 5BPHA 4OHBA 6PFKA 4NMHA 3GUYA 4EHFA 1PL7A 1A9ZA 1SEVA 1U1DA 1WZ2A 2E9SA 3EK2A 1QOQB 3AOEC 4XD2A 4RU1A 1EX6A 2H57A 3ADKA 3U7RA 1JHUA 1OFHA 4BKUA 1CRPA 4QELA 3K35A 2O5CA 1FRFS 4ALIA 2G88A 3HPRA 2I33A 3NNSA 4LXGA 3UMJA 2DE0X 5E6SA 5KBYA 4DIFA 4TN5A 3ETLA 3DEIA 4LN1A 4GR4A 2ZKIA 4WBSA 1ISMA 3O91A 2Y92A 3STHA 3LHKA 3DMGA 3NXKA 5H83A 2RAFA 2KJQA 2FOLA 3CUSA 5JY6A 3BKXA 4I3GA 2LZ0A 4CL8A 2PXCA 2O2JA 3GH1A 4TUYB 5CT6A 4B2LA 1MOSA 2JW5A 4YPFA 3BG5A 5F51A 2G9QA 1U9IA 5K05A 3C6BA 1ECLA 3DNMA 2JFGA 4H7FA 3PJDA 1P62B 1JKFA 5I7SA 4KIJA 3BZWA 5CCXA 3F74A 4IIFA 2LKCA 1QIFA 1RM4A 3PHCA 4EK9A 2VDWB 1GLNA 3L43A 1EGMB 1WTCA 3Q9UA 1BFUA 2D7JA 2X0IA 1EKXA 2O1WA 1ES9A 1B6TA 3IAS1 4DCTA 3HP1A 1K8QA 4G2TA 4MHSA 4UCXA 1QB8A 1V16B 2GFHA 4NYMQ 5CITA 4LRWA 5EIAA 5I7FA 1KOJA 1JEYB 3I2HA 1TB4A 3I9JA 5E2AA 5AW2A 2PYDA 5FPQA 5BORA 1A50B 3D6JA 2K87A 2DKFA 1YKFA 3MWYW 4UHBA 3HJFA 1Y63A 4CHGA 1KDVA 3OX4A 4FBMA 1V0JA 2ORED 4R71A 5BRNA 1Q1GA 3RSQA 2P90A 5EWJA 1E0DA 3KDAA 1UKBA 2HHJA 2WMDA 2QL7A 3CX8A 4B3SB 2VA9A 3MYRA 2JJ2A 3RBZA 4B32A 5AVSA 4JQSA 3SM9A 3EH1A 3H1EA 2PFSA 4GP7A 4X91A 1ZJYA 2ILTA 4IZ6A 4K40A 4Q4JA 3CHYA 4C5CA 3GC6A 4GL2A 2FSFA 2YV2A 4MRAA 1JSZA 1TD9A 2QRZA 4CF7A 1QLWA 1J56A 3P9SA 3CPHA 5C0OE 2I6GA 1TM1E 1P77A 1P0PA 3HJTA 4JOSA 4DQDA 1NV8A 2AKEA 3GMSA 1OTYA 3WLIA 5CLIA 3EPRA 2V6GA 3EMBA 3UCXA 3U0VA 5L40A 5HUQA 5BMVF 3JYQA 2W2OA 4YLEA 2W6MA 4IS2A 3NDJA 1N33B 1JG7A 3AP2A 4LHVA 4MUGA 1PUJA 1I6MA 3FLAA 2PUTA 3SE7A 4EYSA 1T8SA 3TSYA 2JAQA 1UQUA 1I2AA 4HDSB 3O4VA 4IIXA 1I24A 3PITA 5DT2A 5TT1A 1SBHA 3F71A 2R4UA 2YH2A 4IEEA 5HNKA 5JQGB 4QOHA 3QVUA 2CXHA 4RGBA 2RB5A 4TVKA 3UO8B 1PD0A 3PNYA 1O95A 5HIIA 1CDOA 2PMKA 5C3MA 3TKYA 1QANA 1IAQA 4PGAA 3GJ6A 3MWEA 5K3CA 1U2RA 4B48A 1V7PC 5DWQA 2C54A 5GV8A 1T36A 1ZUNA 3BXPA 2CEAA 3D8NA 1O96B 4I14A 1AX9A 1L5ZA 3E9DA 4GWKA 4J7AA 5LZ8A 4QJ3A 4GUDA 4LF8B 1JQ5A 1GWNA 4FK8A 1RZRD 5I7OA 3KJGA 4J0KA 2XF8A 1XTSA 3KJQA 4QXAA 2I62A 3LLVA 4EG4A 4HVTA 1BW9A 2ZVPX 4FCCA 4QDTA 3K9NA 1RXCA 4ZTUB 2XCIA 3VC3A 1QUFA 5AUQA 2C96A 4EATA 3AR2A 2LUOA 5FI3A 4I66A 3QUQA 4AJNA 1EVYA 2Q2QA 3AR8A 1V9LA 2FZWA 1PP4A 4AFNA 3WRXC 3MJTA 3FROA 5ILQA 5BSMA 2V45A 4R8RA 4E15A 4A0GA 3A14A 3C8ZA 3KALA 4BVHA 5FI1B 2CFSA 3B1KA 1K97A 4CM9D 3L7LA 3TDMA 1ZL0A 2JFQA 5DEIA 2GN9A 1A5AB 1V45E 4GOMD 5K3BA 2HRRA 3B6MA 3PK0A 5B37A 1SU8A 1B2RA 3CF0A 4D4JA 3WWCA 2CHGA 3KB1A 3RC8A 4MGEA 3K16A 5EZYB 2O8FA 3QITA 3RRNA 5FULA 1CE8B 1QO0D 2TMYA 4L6AA 1Y34E 4K5QA 1M0EA 3WLRA 1Z2EA 1UZNA 1XIVA 1MJFA 1OC2A 3TPCA 4B45A 1CHNA 1QYIA 3MS2A 3ZHRA 1R37A 2IYRA 1B42A 4HGYA 4FFBB 1L7AA 3FTPA 3GA7A 1OLOA 3CUTA 3F98A 5DMXA 4FZRA 5ICEA 3JQFA 3PDUA 4MP6A 4Y2UA 3GD7A 1OXKB 1N1GA 1MZVA 3AIOA 3ENKA 4BQSA 1T4CA 5DKFA 1HY3A