1G5TA

The three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo-atp form
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
157
structure length
157
Chain Sequence
ERGIIIVFTGNGKGKTTAAFGTAARAVGHGKNVGVVQFIKGTWPNGERNLLEPHGVEFQVMATGFTWETQNREADTAACMAVWQHGKRMLADPLLDMVVLDELTYMVAYDYLPLEEVISALNARPGHQTVIITGRGCHRDILDLADTVSELRPVKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COB(I)ALAMIN ADENOSYLTRANSFERASE
publication title Three-dimensional structure of ATP:corrinoid adenosyltransferase from Salmonella typhimurium in its free state, complexed with MgATP, or complexed with hydroxycobalamin and MgATP.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 53
structure length 157
sequence length 157
ec nomenclature ec 2.5.1.17: Corrinoid adenosyltransferase.
pdb deposition date 2000-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02572 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g5tA00
3GLFA 2YYZA 1F2TA 3BK7A 4YDHB 1XEXB 1T3HA 2AL7A 3LV8A 5SZHB 3Q7PA 1E94E 1J2JA 2FN4A 2GEUA 3DL0A 2ZRAA 1CXZA 1P9NA 4QGGA 5BXQC 2DR3A 4GOJA 4LHWA 1NL3A 2XTMA 4JLNA 2O8DB 5JRZA 1SKQA 2FGJA 4JKIA 4CEHA 3GLGE 4TT3A 4W5JA 5H8WA 1OHHD 3W6OA 4OK6A 1P72A 3F0TA 3CRW1 4QBIA 4NONA 2QMHA 2P6RA 4Q18A 2HCBA 4QG7A 1P9RA 1W44A 2YWHA 4N0DA 2B21A 1VCIA 1E3MA 4TZ0A 3R7WA 3NC0C 3F8TA 2ODBA 2OFOA 1HQYE 2PZEA 1N5IA 2JJ2A 1Q22A 3RAPR 1QHHB 5LD2B 2IYRA 3OIUA 4NZYA 1E2DA 3CUEF 2CNWD 2IA5A 3DOFA 1I2DA 3OZXA 3I5YA 4LI0A 4LV8B 2AR7A 1R2QA 3AH8A 3WYAA 3GD7A 4HEJA 4B74A 2JJ1D 4OJQA 4MGKR 3SFVA 3I3SR 4KFUA 4QOSA 3ZVMA 2OXRA 2OBMA 4M21A 3W3ZB 5A4JA 3C16C 1E2MA 4Z51A 1W4AA 1N6RA 3CWZA 4B2PA 2JLXA 3LW8A 2Q9BA 4TLAA 3GJ8A 1S8FA 2EW1A 2W00A 3CONA 3JZAA 3P32A 1N6KA 1DS6A 2GAAA 2VTKA 2ZYTX 3AUXA 4MA4A 1OH6A 2XTZA 2ZM5A 3X1WA 3UWOA 4DLZA 4DC9A 2QTHA 2QI9C 3WP0A 1T0JB 1NVUQ 4L9SA 4GP7A 5EE1A 2O0HA 3U61B 1OPXA 1ZW6A 4D26A 5BN3A 3IPXA 3EPKA 2OO7A 2R62A 3W9YA 3X1DA 2HUPA 4GPTA 3B2EA 5FL7D 3G5UA 2NO1A 3WYGA 2BJVA 1F3OA 4CRWB 4A4DA 4UNSA 1NY5A 3WRXC 1JPJA 3CPJB 1LY1A 2QTFA 1SZPA 3RS0A 2D62A 2YV5A 2GA8A 2AN9A 5E4FA 5HCIA 3QF4A 1DO2A 3BS4A 4EJSB 4OHYA 2G9NA 2IK8A 3R9IA 1WRBA 5JHGB 1TF7A 3AQ4A 1XXHA 3B85A 3FHOA 3DEFA 4HYYA 5J4LA 1VIAA 4RFSA 3QG1A 4B3XA 4IVPA 3OFNA 1F2UA 5CLLA 2VSFA 1W49A 2FGKA 4QNRA 1Q21A 3C14C 4FMDF 1W0KD 2QRNA 3SOPA 4QJ3A 5UKDA 4TZ6A 2GJ9A 1NMZA 1PLLA 2QP9X 1P75A 1TNDA 2QM7A 2C03A 3LA6A 3MFYA 2HF9A 4ASUD 2IYLD 3ONWA 3A8TA 3QKTA 2O52A 1NLZA 1XJQA 4ARZA 3NG1A 4CT4B 4DLSA 4CEJA 1D6JA 3THXB 4KITB 3U5ZB 3DVLA 1VYUA 4D4MA 2EFHB 5C18A 2CLSA 2F9MA 3B1ZA 4KYUA 1Z6YA 3THWA 5JJIA 5L3SA 3DM5A 1CJMA 1DG3A 2RGGA 1IXRC 4Q4AB 1Z2CA 4RD3A 3RS3A 1AGRA 2P5SA 4WBSA 5KSYA 1E0AA 2QBYB 1CTQA 5AJXA 2I1VB 1XEWX 3HR8A 1JBKA 4C0SA 5K8TA 1VMAA 2I3BA 3RSLA 1EGAA 1XMIA 2EWVA 1F60A 1FQJA 4ZCLA 3GLIE 4Q5IA 2BM0A 1NN5A 1NSFA 5FTJA 2R9VA 1E9EA 1JALA 1S96A 4IFEA 1OXVA 2A2ZA 3CW2A 1IHUA 4C9BA 8OHMA 2DHRA 4PO8A 4LV5B 1W4RA 1IXZA 4Q4JB 1P2TA 1M1YE 1JPNA 5DN6A 4YONB 2C95A 4RZUA 2YOGA 1I4TD 3O8BA 2WMOB 1Q1QA 3U7EB 2LKCA 3VTKA 4CW7A 2C99A 2TMKA 1GAJA 2IL1A 3GJ5A 4G1UC 5DGXA 2O8BA 1IN6A 2QPTA 3GJ7A 1KIMA 3K9LA 4FW9A 4JMPA 5A5GA 3EIQA 4UKDA 5G40A 5CDFA 1E0JA 1KO7A 1VG8A 2ZITA 2DFNA 3PQCA 4KBFA 1CP2A 2OSBA 4LJ5A 1G8GA 2G0TA 4XOIA 1W46A 2ZR0A 3GJXC 5FUVA 2X2EA 1GUAA 3DKVA 4I81A 3QKRB 4PANA 3T06B 2YWFA 1KK1A 2P65A 4DVGA 1YKSA 3P4XA 5DH9A 3VAAA 3K70D 2XXAB 2ODNA 2I1QA 1K8RA 1E6CA 2CE7A 2ZJOA 5KYKA 1N3BA 1PJRA 1KI3A 2BWJA 2V7QD 3BGWA 3EAQA 5P21A 4R9UC 3FHCB 1YJ5A 1A7JA 4EFLA 2GEVA 2XB4A 2QZ4A 3QOFA 3U4QA 2XNDD 4NKRA 2NG1A 1XWIA 2N1BA 1ZNWA 3A1VA 1XF9A 3GLGB 1KI2A 2FFQA 5EJEA 1OFUX 3ASYA 1KO4A 1BH2A 4V0KA 2ANBA 4TL8A 2BCJQ 1ZD9A 1SHKA 4YQFA 4II7A 1X3SA 4TL6A 3PITA 1MH1A 3LWNA 1N0UA 5FPHA 3FMFA 3ZZ0A 1GDDA 2A78A 3D3QA 3ND9A 3NKVA 4M9XA 2Q3FA 4QRHA 2ZTSA 1RYHA 2CLCX 2J1LA 4LPKA 3EWAA 3KTAA 5FOVA 1COWD 5E3HA 3L8ZA 4GOXA 5CK4A 2O8EA 1E2IA 2XOKD 2ZETA 3VX3A 4LX0A 1JJVA 5GJBA 4Q7LA 4WAUA 4LSGA 4NH0A 4A2WA 5JS7A 1KMHA 1PZNA 4V02A 2G88A 2IT1A 421PA 3ZVLA 1TAGA 1KI9A 2HXYA 4M22A 1IY2A 4BGDA 5IK2D 1P61B 4CEIB 3LVQE 1P5ZB 1XCGB 4TSFD 3RWMB 2FV8A 3THYA 3KJIA 3A4MA 3K8YA 2BEKA 4DSOA 1LFDB 1RJ9A 3Q5DA 4UNRA 2ZUDA 2WMNB 5F98A 3K70B 4Q1DA 4Q4HB 3RVBA 4GDFA 2OCBA 3PEVA 2WVJA 3AUYA 4BFVA 2QMOA 2QU8A 1KKMA 1UKEA 2HLDD 1GZSA 3DZDA 3HU1A 2F6RA 4EQ6A 1UEIA 2CE2X 3B60A 3I8SA 2N46A 3IIJA 3A4NA 4M2LA 1NVVR 1QBKC 1G18A 4A8JB 3GQBA 1E79A 5DIFA 2C5LA 4NDZA 3TLXA 2IEZA 1NMYA 2JJ8A 4KLNA 5FBWB 4BFSA 1RC8A 1ZRHA 1N6PA 3VKWA 3HP1A 4I1UA 1XJCA 1CJKC 2Q0HA 2W58A 4YMTA 1NF3A 821PA 2OAP1 4BLTA 3UPUA 2BV3A 5JWRA 1DAMA 1Z22A 3NBXX 2R44A 3B1WA 2AKAB 3CB4A 1M8PA 4S35A 2ZREA 1GVNB 2FZLA 1TPZA 2A3RA 4PSAA 1D9ZA 2VYFA 4HATA 5FBQB 3MSXA 1H8ED 1XMJA 3K1JA 2OFXA 4B35A 4YDSA 4PO1A 3BXZA 5DYIA 4MRRA 2G1JA 5E7MA 2ECKA 5D3MA 1N6LA 1WBDA 3DKPA 4TL9A 3BFVA 1R10A 1F5NA 1UADA 3M0EA 5LBIA 1DTSA 3SS8A 1NMXA 4A9AA 2AD1A 4MYHA 3J81k 2IHBA 1QHIA 1SXJA 2WIBA 2QAGC 1E1RD 2WZQA 4TMZA 4LBZA 2VEDA 4QM6A 2CBZA 4FN5A 1E69A 5L3RA 3IUYA 3TH5A 3SN6A 3NC1C 1ZC3A 2ZE8A 2PJZA 1QZXA 2ZJ5A 4OK3A 2QRZA 5FOWA 3GJ0A 5HZHA 1PUIA 1CJUC 1HA3A 1OXTA 2YZ2A 1G20E 1CS4C 3DDCA 2ZRNA 2OLKA 4KHZA 2O5VA 4U5XA 4BEJA 2OAQ1 3ETLA 1G1MA 4X8HA 2IYZA 2CJWB 3K0FB 3WY9A 4HUTA 4F92B 3MMPA 5CM9C 2VHTA 1GSIA 2BMJA 4CVNA 4LJYA 4MH0R 3GLIB 4TTPA 2V1UA 4P4SB 2YNMA 3LD9A 5JZVA 1G17A 4LGMA 1NG9A 1SVLA 4A8JC 4WXRA 3V4RA 3OF5A 4MDFA 4LYAA 2C04A 2HT6A 4TQAA 2J3EA 4D4JA 2J7PD 1XFAA 4RZ3A 1LTQA 2ZU6A 4DWJA 4BFYA 1HURA 3ZIAA 3DMDA 1NVVQ 2Z6VA 1TEVA 4M1SA 5JI2E 1Z0KA 4HUQB 5EP2A 5G3ZA 3A6PC 4A6XA 4PHFA 3IBYA 4CDGA 4CIDA 3SFZA 3PVSA 1DAEA 4GBMA 2O8CA 4FMCF 3REGA 1Z28A 4JJZA 3HYTA 4KO8A 1MO4A 2B8TA 3AGQA 4ZIRB 1W4BA 1MABB 2CL0X 2FEMA 2ZRIA 5EXXA 3RLFA 2J5XA 4ITRC 1PLJA 2ZYVX 4RKFA 3KL4A 1WP9A 2NMVA 3G0HA 3R9WA 1X86B 2OT3B 4IRUB 2RGXA 1GOTA 4PFSA 3U60B 2ZRPA 3CX6A 2XSZD 3OAAD 2A5JA 3QF7A 4URXR 2J0UA 1JR3E 4DLWA 2CHQA 1UDXA 5ANRB 3L0OA 1E2GA 1KOFA 3AEZA 1XNJA 3I32A 2PCLA 4FINA 4K81B 2AXPA 1GKUB 1CR0A 1CJTC 1YU9A 2F3RA 2RGCA 2NPFA 1W2HA 2P6NA 4LHXA 1P9WA 3L0IB 4E07A 3UANA 1S9DA 2E1RA 4HB2A 1AQUA 2RAPA 5SZKB 2GAOA 2QT0A 4P31A 1RYFA 3QQ5A 4M4SA 1HE1C 2VL7A 5GVSA 4PC7A 2IS6A 4EDHA 1OIWA 2FJUA 2R2AA 2F3TA 3EIEA 2AHOA 1E9SA 2Z5FA 1YR8A 3SEAA 2CL6X 1UPTA 3VR3A 3ZS8A 1K5GA 3QPWA 3TBKA 4US0R 5BW8A 4RCYA 3EZ7A 2ZJAA 2JASA 4G5GA 4FI3C 2RB4A 3RS4A 3CH5A 4HDCA 3P1JA 1VECA 4QFMA 4POAA 3GEEA 1UBGA 3M1IA 2OBNA 4M53A 2GK6A 4LBWA 5FI0B 3ICEA 4L8GA 1TX4B 3DOEA 5DISB 3TQCA 3I61A 3OE7A 1E1QA 3MCAA 3NEYA 4YMSA 3OEHD 2GESA 3SU8A 5JJLA 3IIKA 3AP2A 1US8A 4JYCA 4URYR 1SVWA 4YXWD 2DWOA 4PAMA 1OSNA 2IBMA 5KNDA 5FUXA 1IAQA 1Y63A 4K46A 3SC3A 1Z29A 3GJ3A 3SQWA 1WBBA 2XZOA 2LCFA 4KVAA 3GLFE 1Z0FA 2ZAMA 3NDBB 3PEYA 4JLKA 1QHGA 2W2TA 2WM9B 4NCIA 2DPXA 4LHVA 2GBLC 1GFIA 2QROA 4MITA 3NH6A 3X1ZA 3UMRA 2YWGA 4ACBA 1NBMA 1IN7A 1Q57A 3U6KA 1OE0A 2VH5R 1U8YA 1CEEA 5F9HA 4RD4A 3VHLB 1F48A 4BFWA 4NP6A 1JAHA 3REFA 3LBIA 4OHZA 3BERA 3EZ2A 4A0RA 3RC8A 3VKGA 4XVRA 3W5IA 2KBFA 1II8B 1TQ2A 2JDIA 3AF4A 1D9XA 1DADA 4TMXA 2ZEJA 2GETA 2CXXA 1RW4A 3O8RA 1IM2A 4US2R 2ORWA 4C30A 1TU3A 1PUJA 4P32A 3A58B 5DNYB 4JT2A 4GZMA 2ERYA 2JA1A 1UM8A 1U9IA 4LOAA 2QEQA 2YOHA 1ZM3A 5EP4A 1G291 3AKDA 5H70A 3T1VA 3U7GA 1VKJA 4QXAA 4XWAA 5EZ6B 4XD7A 3SYKA 1G7CA 1I4DD 5F2EA 5IF9A 1Z6AA 4OQLA 4QC2A 2BBWA 3UMSA 1VDZA 3EG5A 4OHVA 1DAFA 1XTQA 1ZNXA 1OJLA 4JLPA 2DWPA 1F6BA 1XBTA 4TYPA 4C7OB 4DCSA 2D2EA 1NVWQ 3AP1A 3QEJA 1M34E 4HB3A 2OM2A 1HT1E 4BLRA 1QRAA 4R2IA 3T35A 1XDBA 5AUNB 2HF8A 4HZUA 4BLSA 5LPNA 5C1BA 1JR3D 3U3JA 4HZIA 2ZJ8A 3MD0A 4MRSA 3T5GA 1W4CA 2IWRA 1E2JA 1YZKA 3B9PA 3H0KA 5KUTA 3EA5A 1IXSB 1VCOA 1G8HA 2ZI6A 3B9QA 4RJLA 3KKOA 4E5UA 3EX7C 1HE8B 1H65A 1HV8A 2CLDX 1FQKA 2VP5A 2O8FA 1LB1B 1BMFA 2ZYUX 3KUCA 2IYVA 4JS0A 2H8KA 4Q00A 5DI3A 1KI1A 4M9QA 5IDVA 5JI3E 5L3QB 1LF0A 3TUIC 4HAXA 3WNBA 1WB9A 4D80A 2P0EA 5BN5A 1X1RA 3CBQA 4LYHA 1KI4A 1FUKA 2R6AA 5BN4A 1E2HA 1DARA 1R5OA 4PC1A 1NKSA 1D2EA 1OV4A 2O8DA 2ZI5A 1NIJA 2A9KA 1M74A 1JNYA 4B47A 4Q9JA 4OQMA 3EPHA 2EWWA 3NEJA 2R6GA 4JLMA 3AF2A 1YZQA 3WMGA 3TGPA 3QI2A 2YWEA 4WZBE 4NYIR 1SVSA 4OHXA 3GMTA 5TDHA 2I4IA 1DE0A 4Q1BA 1RE0A 3LLUA 3ZVRA 3TW4A 2UKDA 4XSHA 1VG0B 1NNEA 1AZTA 3I73A 1Q1EA 2JLVA 2HCJB 2QT1A 4DDVA 1QHHA 4B2LA 4DDUA 2F43A 4MUBA 4GFDA 2A30A 3MLEA 3U3KA 4YLGA 3SR0A 3WMEA 2A5GA 1KZGB 4G5RA 2DFLA 4DUGD 4I99A 3T1OA 3A36A 5FPKA 1XTIA 1WQ1R 4C0BA 2WV9A 4KODA 5AUOB 1IY0A 1EG7A 3F5FA 1R4AA 3W3AA 1TQDA 4TMVA 3FYHA 1ZU4A 1TEXA 4V0LA 3MWJA 4JZKA 3CNNA 1OLOA 2W6JD 3CIOA 3ZQJA 2N42A 5EP3A 1SVOA 3BORA 1GITA 1P62B 2KWIA 4QBGB 3KJEA 2NO9A 4HAUA 1LS1A 3C8UA 1AGPA 3CRMA 2FWRA 1Z47A 2PLRA 1UFQA 4AG5A 2WICA 3CO5A 3I4LA 4MKHA 1S2MA 3HYRA 1KKLA 2UVQA 2KJQA 2ODEA 4BRUA 1AS0A 1G3QA 3LVRE 2AWOA 4QM7A 4V0MA 4UJ3A 4MQBA 2O0KA 1E2EA 1T4GA 4IDNA 3AVTA 4DB2A 4HB0A 2GCOA 4JBYA 2DFKB 2G83A 2IEYA 4GSYA 2YKGA 4G01B 2XX3A 1QDEA 1AQYA 1GNPA 2QPAA 4R98A 5CDFE 2PJRA 2GTPA 4CGZA 4EJSA 4JBWA 3I5XA 4TL7A 4A0GA 4BRWA 4KBGA 1SVIA 2ZRDA 3VU9B 4IOMA 1GL6A 2ZE5A 2RHMA 1ZINA 2FU5C 2GVDC 4TTRA 2JLSA 2PT5A 3GLFB 5DSZA 5DHFA 3VNVA 1F2TB 1T3SA 1RRCA 1J99A 4KXFB 1KSHA 2C96A 3B7GA 4Q47A 4XVUA 3NVAA 2NIPA 4BLQA 2J0VA 2RCNA 3T1QA 1L7VC 5KTYA 4HLUA 2VPPA 5HPYB 4AKIA 2RGNA 4JLBA 2ZE7A 2WIAA 4YMUA 2XTNA 3IPYA 2G6BA 721PA 1KI7A 1W0JD 4IKEA 1EXMA 1OFHA 1M2OB 3TR0A 2FA9A 4LK2A 4ACAA 4CEHB 1Q1BA 4MUAA 3AB3A 5CYPA 1TUIA 4NYIQ 3OEED 1KAOA 2QSYA 4D25A 2ZRCA 1J8MF 4KFRA 2ANCA 3VR2A 3UKDA 1XPOA 2Z4SA 1PVOA 2AFHE 3LX5A 3GEIA 4IXNA 4TTQA 1AK2A 1E2NA 1D2MA 2ZROA 3R7WB 2D4HA 2QL6A 3TR5A 5J4YA 1TF5A 2Z83A 1MRNA 4AYWA 2G1KA 2P5TB 4KSCA 1KSFX 4B33A 3PIRA 4C0JA 4M1KA 1G4UR 2VQSA 4Q4AA 2DWQA 3MJRA 4QHSA 1OXSC 3SJBA 3RC3A 4D81A 4DSUA 1YHNA 5KPDA 1FP7A 1E2LA 1U98A 2VO1A 5FUWA 2CCGA 2IYSA 3UG6A 1B23P 2KBEA 3PG5A 4F38A 1JI0A 2WWWA 3NH9A 2QGNA 3OFND 1OW3B 2QA5A 4WIAA 1UBCA 2NOAA 1QHYA 5KSOA 1Z63A 4BFXA 1E9BA 2UZ3A 1NRJB 5EUQB 1NKTA 4OK5A 4LJ7A 1KMQA 3B82A 5KSZA 2BOVA 1KSJA 5ELXA 1FNMA 5KHOC 2YOFA 3K0CA 1ZAKA 2FFBA 4NL4H 5KDLA 4P3YA 1VHTA 2VHUA 1IN4A 1KDOA 3B1VA 2F7SA 4EPYA 3TSWA 1W0KA 3AKCA 4LDJA 4L9WA 2CK3D 2NGRA 4S2EA 3SDZA 1XTKA 1V43A 2AXNA 1NN0A 4MKIA 2EFCB 3FGNA 3ND8A 1NJGA 3WBJA 3UMFA 4B3DA 4Z1MD 5FOSA 4Q48A 2QN6A 4DCTA 4DEYA 3LX8A 2JCSA 1E4YA 4WXPA 2IUSA 2J45A 5KPJA 1JECA 3TSOA 4Q1EA 1T5LA 3EXAA 3KJHA 1KK3A 1HUQA 3MAAC 4QJ4A 4D82A 1NVXQ 5DLQC 1GTVA 4Q1AA 1TMKA 1R0ZA 1G6OA 4TQ9A 3ZLJA 3QUSA 3X1YA 3GLGA 5JSZB 1X8JA 2WKQA 3IO5A 1VYTA 4AC9A 5BQ5A 2ZJBA 5DN6D 2XITA 4LZZA 1F2UB 5TV2A 1GL7A 1GNRA 4R71A 1W36D 1J7KA 3S1AA 1W5SA 2GILA 1J90A 2XGJA 3W6NA 1R0XA 4RD2A 1FX0B 3ZQ6A 4PPFA 2REXB 2GWHA 1T8TA 2QP4A 2WWXA 4M1WA 1DVRA 2J0SA 4YC7A 4D6PA 1Z0AA 4YMWA 2QG6A 2ZVPX 1SXJE 2GXQA 4FMCB 4TLDA 1A1VA 3ZVNA 3T34A 4NCKA 4CEJB 2BVNA 2RKOA 1WMSA 4F4CA 4DLXA 2HYDA 2V6IA 2WJYA 1YZTA 3ZH9B 2MSCB 3L43A 1QG2A 2IUTA 1CJVC 5L3SB 3ZD7A 2VF7A 4PZYA 2FSGA 4HAZA 5GJCA 5FTNA 3EA0A 2QENA 3VHXA 4DJTA 1RPZA 2JLRA 4ZCMA 3HDTA 3BB4A 4Q4HA 3CNLA 2HXSA 3GEHA 4ZI2A 5E7JA 5KDOA 4Q7KA 1QHSA 4MYCA 4BECA 3DM9B 3K53A 3CRRA 1L2TA 3PV0A 3QNUA 3L8YA 1XEWY 5LDDC 4NTZA 3P4YA 4YMVA 3CZPA 4LUCA 1IN8A 2V1XA 1RRGA 3W5JA 1U90A 4Q9KA 4HLUC 3KQHA 2QAGB 1BKDR 1G8PA 2ONJA 1XMVA 3U3RA 3LBNA 1M7GA 1HYQA 2AK3A 2BC9A 3HWSA 2W0SA 1G6HA 1WE2A 2GKSA 4ZDJA 2AD5A 4DLUA 1XZQA 3BFKA 2JLZA 1W36B 4JIMA 3AF3A 1GL9B 2O8BB 4NCJA 2WJHA 1CLUA 1H8HA 3FWYA 4F4JA 1AM4D 1U94A 2OCAA 4DLTA 1COWA 1FOEB 4MGIR 4ZV4A 4NMMA 3LAWA 3A1SA 2ZI9A 1NLYA 4U02A 1YE8A 4DHEA 2FFAA 2H5EA 3N5CA 1LNZA 3C41J 2Q9AA 2XOKA 4D0GA 3CKLA 1EX7A 3TJZA 621PA 2GXAA 1VG1A 4EPWA 1W7AA 1XD8A 5GJWC 4URZR 6Q21A 2GDJA 3MG9A 2FSHA 4A0FA 3THYB 1EWRA 3VR4A 4PPNA 4PR0A 1S1CA 4DBLC 3QJYA 4IEIA 5IK2A 2QY9A 4DXAA 4Q1CA 3CRVA 5FTMA 3KQKA 2D74A 4TSFA 1FMJA 4WVFA 1V5WA 1E96A 1XD2A 5E7IA 3SZRA 4GT1A 2IS2A 1WDTA 3UIEA 4Q01A 2WKPA 1S3GA 1ESNA 3KKMA 2ERXA 2ZQ5A 3UK6A 1KK2A 4NPHA 1N25A 1XTSA 2Q3MA 1S9HA 1VCMA 3K0AB 4L15A 4XTRA 1L4YA 2HLDA 1NN1A 1G3UA 4IDHA 3VNUA 5CB6A 1P2UA 2MSEB 2EU8A 3OIWA 1O87A 1ZM7A 3E1SA 5CLQA 2J9RA 2Z43A 3KTAB 4GZLA 4OQNA 3I72A 1JAIA 1Q1ZA 2HYIC 3QBVA 3DO6A 3OHMA 3BH7A 5JEEA 3CR7A 3KKNA 1JB1A 1KJYA 1EFCA 3VMFA 2CJWA 1OB5A 4NYMR 3NTUA 1KMHB 2BBTA 2WPDA 1JXOA 2R6DA 4N0EA 4JL5A 4FIDA 5B30A 3GLIA 4RCZA 1CULC 2CHGA 4LPSA 1R5BA 4X8LA 4ZO4A 4AWXA 2OBLA 4JVMA 4KV9A 1GG2A 1TQ4A 2B8WA 2GEDA 2QQ0A 1ESMA 1RJ9B 3B78A 1H8EA 1T9HA 2V8OA 5FBVB 2H7VA 3KXKA 1RZ3A 1SXJD 4I1OA 1OKKD 3A37A 4B48A 3CX8A 2CVFA 2FPLA 3T1TA 4ESVA 3N2IA 5HKKD 4EQ6B 1W36C 2B92A 2O0JA 4G0NA 1A82A 2G3YA 4JT4A 1FUUA 4XJXA 3FMOB 5AUPB 2H92A 3BH6A 1E1RA 2JGNA 1MO5A 4HAWA 3T15A 3QXCA 4F7WA 1TUEA 1NN3A 3ADCA 1XU4A 2REOA 3SYNA 4ZDIA 4ZIRA 1CR4A 3DMNA 2OILA 2ZR7A 2JATA 4ON9A 3X1XA 2FPKA 3AF1A 2ZRHA 2ZSBA 3SJAA 3KJGA 4JYBA 5K8LA 4L4UA 2EQBA 1HH4A 3L0PA 1Z5ZA 2EFDB 1W5TA 4JLJA 1N0WA 4A15A 1CF4A 1L4UA 1X8LA 1QHNA 2VHCA 3WXMA 5FBRB 2ZANA 3VKHA 1S0UA 2F1IA 3FE2A 1P7CA 3B13B 1II9A 3BE4A 3QEOA 4L16A 3Q8XB 1S1MA 4LC1A 2ZJ2A 5AR1A 2ATVA 3BB1A 5D3MB 1Q3TA 5HCNA 1HQCA 3RRNA 1NIPA 1SVKA 3I62A 4QKQA 1N2CE 2VRWA 1N6OA 1ZM4A 4UJ5A 4WZAE 1D8TA 1IBRA 2VIIA 4BZQA 4TYQA 5AJYA 2JEOA 4IXMA 4HB4A 2BDTA 1KJWA 1UBFA 1W48A 2QP3A 1SXJB 2FF7A 3U6BA 2CEAA 2J7PA 3QKUA 5GJVC 1HEIA 2FOLA 3B1XA 4IOLA 1Z8FA 3GP8A 2P2LA 3GLHA 3QXJA 1ZIOA 3ICQB 4DIEA 4QGHA 4RFVA 3ZS9A 4M9SA 2CHVA 1UJ2A 1N6NA 3VFDA 2ZRBA 2RGEA 2EFGA 2NQ2C 2MSDB 3QENA 1ZUIA 4WZ6A 2AKYA 5FOUA 1FW6A 1N6HA 1EFTA 2FFHA 4K8OA 2IXEA 4DT1B 3OIVA 3QKSA 1DOAA 4NYMQ 4FCWA 4PC6A 4PZZA 5FPTA 4ZKEA 5EP1A 5FR2A 3LRPA 5FPSA 4OQFA 2B7BA 2H18A 4AG6A 1ZUHA 2GXUA 4GRAA 2EVWX 2DFTA 3Q72A 1XCMA 4RD6A 2IYTA 4QGAA 1GILA 1SQ5A 1ZD8A 3L82B 4A0HA 5L3VA 4M1MA 2IX3A 2J59A 3AV0B 4KJZA 2XSZA 3OAAA 1G8FA 2ZRFA 3R8CA 4DSTA 3PUXA 1AZSC 4P0TA 2PZFA 1BOFA 1Q44A 5EXPA 2QMEA 2W6ID 4A1FA 5FBLB 2ZS8A 4D4KA 4G5OA 4W7SA 1RFLA 1FP6A 3QIAA 2J0QA 3GCGA 1YZLA 2WWYA 4PHGA 1C4OA 2C8VA 3PEUA 4Q66C 3ADBA 2GJAA 4MGZR 2VLIA 5J4HA 3ZD6A 5J4KA 4DDWA 3D7MA 3RRYA 3TW8B 1XP8A 5CM8B 1AKYA 3GFPA 2GHIA 3WMFA 1B0UA 3QXHA 3P27A 3K0SA 5JJKA 5DYGA 5HR5A 2EFEB 3NIBA 4MRVA 2WOOA 2ZXUA 1E1QD 1KYIA 2BHRA 3U7HB 3B6EA 2O8CB 5JFGA 1KY3A 4KU4A 2WHXA 1TADA 1Z6TA 4UNNA 5JCZA 3GJ6A 2HV8A 2BKEA 3K9HA 1J70A 4LRWA 3PR1A 4KLZA 4QNMA 3C15C 2JIZD 2BMEA 2FH5B 4RZ2A 3IEVA 1YQTA 2IWHA 3AVOA 1VTKA 4FMBB 2VA8A 3AVYA 1XX6A 3KDSE 1U0HC 4JVLA 4OQXA 4V03A 3F3YA 3AVWA 1UF9A 3A4LA 3QVVA 1P60A 1Z06A 2FX3A 5HTKA 3W6PA 2WTUA 1N5LA 1FPMA 1JJ7A 1SXJC 2WJJA 1U81A 3KB1A 4O2LA 5EE0A 4YXWA 3SJZA 4PC2A 1QG4A 1BYIA 2C9OA 3U44A 3IEUA 3M4YA 4JVSB 4QL3A 1HY3A 5IT5A 1MO6A 3FMIA 1NY6A 4EUNA 1GKIA 3T5DA 1G5TA 1FTSA 4OI2A 4B3BA 3DPUA 1PV4A 1XZPA 3FKSA 1KO8A 4X8OA 4TLEA 2GJSA 3K09A 2FG5A 4ABYA 3B1YA 5EE3A 3UXMA 1EFRD 2H57A 3LNCA 4IDQA 4PO9A 3VQTA 2CCJA 1KK0A 2GXSA 2PX0A 2V55B 4V0ME 5JMTA 3LO5A 2VBCA 2F1RA 5EXSA 2GF0A 2C2HA 3NHAA 2W2VA 5L3QA 2AK2A 4OKSA 1ZNZA 4RVCA 3FHTA 3CF2A 1RVDA 4HSEA 1P6XA 1AN0A 4RD0A 2JLQA 4XD7D 3CF6R 3WNDA 2H17A 4GP6A 1T6NA 4PPGA 5FOXA 1UKYA 3BWDD 2ZJZA 2GRJA 1US8B 3R8FA 3CWQA 2OESA 4Q9IA 1IY1A 5K8UA 3EWSA 3GFOA 5HZKA 1FL9A 2BBSA 2NTYC 3IKJA 1KI6A 2P3SA 3LFUA 1G16A 2X77A 1OH5A 1R0WA 2BBOA 4FXPA 4M1OA 4TMTA 2ZIAA 3C7KA 2XAUA 4PTLA 3QPVA 2K5UA 2GZHA 3U7FB 4W5HA 3CPEA 5JHHB 1SHZA 2FSFA 4B3GA 1E0KA 2QQEA 2ZYWX 4HDQB 2ATXA 4JSTA 5FL3A 1XEXA 2KI5A 1W2GA 2VSOA 1JR3A 3FPAA 1WXQA 1ETUA 3EZ6A 3FDIA 4NCHA 5FOTA 5K8IA 1KZ7B 3FFBA 3WBKA 5EUMA 1J8YF 1R0YA 3U3MA 3VX4A 3MUFA 2CVHA 2ZSFA 1E9AA 1II0A 1UKVY 4P33A 4KFTA 4P4TA 2ZR9A 2D06A 1E9RA 1X8KA 2B7CA 1KDRA 4E22A 1Z0IA 1CRPA 3P26A 3PUZA 5BWMA 1EWQA 4IOJA 4C0QC 3K0EA 1HTWA 1XXHE 5B58C 1KTVA 2ZSDA 5DI9A 3JVVA 2WSSA 2X1VA 2GF9A 1XMSA 5AWFC 4UXIA 1XJ0A 5F3WB 2OXCA 1MV5A 1E32A 1G9XA 2FEOA 4IFBA 3FMPB 2IF0A 2IUUA 3C5HA 4GNKA 1KJZA 3EC2A 2Q21A 4A36A 4AKHA 1G5RA 1NLFA 2WKRA 2DCUA 2DY1A 2ZJYA 4URWR 221PA 4DKXA 4W9MC 1Q3HA 4AYXA 2QE7A 4HZUB 3ZGXA 5JWOA 5F9FA 1E0SA 1FFHA 4GI7A 2OUKA 2YINC 1P4SA 5IRCD 1U8ZA 2ZSAA 121PA 2ZS9A 2H1LA 4O25A 1OB2A 4EFNA 1R5NA 1SVMA 1Z3IX 4TQUS 2QGZA 2OHFA 2C77A 4TT3D 1MKYA 2ZPTX 2O8FB 4DUGA 3QY0A 1X6VA 5J4VA 1E2KA 5JRJA 1RRFA 2W0MA 5DI3B 3T61A 2A5DA 4B6EA 2HJVA 3SBDA 2XJ4A 5J47A 3R9XA 1AS2A 1Z0DA 1QVAA 2XB2A 2JJ2D 3VR1A 4XVQA 1VIYA 1JR6A 3ZJYA 1OHHA 2NO6A 2W6JA 4M1YA 4DRZA 4Z54A 1TF2A 4NYJR 1OYWA 2AFIE 1E9CA 4C4PA 5TY0A 4D0LB 3EPLA 2OV2A 4I1VA 4PC3A 5E95A 1E2FA 2Z0MA 2Z4RA 3KB2A 1SGWA 3ADDA 1KGDA 4XH9B 4N3NA 4ZPXA 4BEBA 2ZRKA 1M7HA 1EX6A 1XD9A 4OI4A 4C0HA 2QSZA 3P20A 3D31A 4KSBA 2RGBA 2ODWA 1ZM2A 2CNWA 2F43B 3K09C 2QPOA 4BZXA 1Q20A 4XIGS 1W47A 4PZLA 4QJ5A 2IS4A 1JEDA 3Q3JB 2JJ1A 2IXGA 1U9IC 4AIIA 5FUYA 4IHQA 2GJKA 4A2PA 2QMUA 1M6NA 1ZD1A 1T8UA 4HAVA 4DIDA 2VHQA 1ZUNB 2WAXA 2PX3A 2OCYC 1X1SA 4X8MA 3CX7A 3KQLA 1KO1A 1XTJA 3EPJA 2SHKA 5HE9A 3SQXA 5CYOA 1CR2A 2C9CA 1RKBA 2P67A 1IJEA 2CL7X 3THXA 2KE5A 4QBFA 3CF0A 4QHYA 2NZ8A 5D3QA 3PEWA 4BFZA 2IC5A 1NSTA 1O3YA 3RS7A 1DEKA 4URUR 3SHWA 3CNOA 5EZ5A 4H1UA 4OHWA 3LDAA 4DDTA 4CYMA 4CT5A 5J5CA 5B57C 2AWNA 1W0JA 2VF8A 5KSPA 2DBYA 1XPRA 1T3LA 5FL7A 4GL2A 3OEEA 1ZU5A 3BIFA 2QBYA 4ZDWA 1I4LD 4OYHA 3WP1B 4ZCIA 2F1JA 3DZ8A 2GCOB 3PUYA 2RH5A 5TVKA 4DLRA 3KKPA 4MDEA 2GCNA 1PLKA 1G7SA 2Q3HA 4F93B 3TUJC 1G64A 5BYKA 2C78A 3RANA 2QTVB 1DELA 1U0JA 5SZIA 1AJEA 2WJGA 2J7KA 4ILEA 4H9GA 3TUZC 4LV6A 1XB2A 4B73A 1DAGA 1OIXA 4BQSA 1GP2A 4Q4JA 5JSZA 1T5IA 4V0NA 3SHFA 3AGPA 3TKLA 1XPUA 1LVGA 1R7RA 1UAAA 3AVUA 4F4IA 2XZPA 4Q19A 2ZI3A 3T12A 2FPMA 3W90A 3IQXA 4QBHA 1K5DA 2OEPA 4LWZA 1ODFA 1OH8A 4JVNA 2BIFA 4C2TA 3BBPA 3PJRA 1FX0A 3PXGA 521PA 1ZBDA 2PZGA 4NYJQ 2J87A 5B2ZA 4ASUA 4B2IA 1N5KA 1P3JA 3QKRA 3TE6A 2GNOA 1LF5A 2FSIA 4IJMA 5LD2C 3SJCA 2XXAA 1KY2A 4Y0VA 4A92A 2BEJA 4TYYA 3Q9LA 4IOKA 4DSNA 3HPRA 3KUDA 3QXXA 1CU1A 2V4ZA 3W8RA 3QVUA 4LC0A 3AVXA 1IQPA 4E09A 1MOZA 1UKZA 2CK3A 3HPQA 3IHLA 1ZMXA 3E70C 1D2NA 3FFAA 3TRFA 3QF4B 5C2JB 1DAKA 1RIFA 2OZEA 3NWJA 1AKEA 1K6MA 2ZU0C 1FZQA 2CCKA 3M6AA 2ONKA 4Z1MA 1XXHB 5M04A 1XRJA 4IDPA 4BFTA 3MRSA 4RFSB 2RMKA 5KOYA 1TQ6A 2WBLC 4QHTA 5HE8A 4F91B 4AK9A 3AF0A 3EARA 3MJHA 4KFSA 4LJ4A 4Q9LA 3LQRA 2VHJA 4Q03A 4M1TA 5G53C 2WWIA 4UXJA 3PCRB 3QBTA 3MWYW 4OI0A 5FTLA 3IHWA 4MKFA 3PFIA 1NI3A 4UXHA 1A4RA 4EKDA 2QAGA 3E5HA 3VR6A 1E2QA 2YJTD 1E99A 3AVQA 3CRQA 4ARZB 3JZMA 5LB4A 3AVPA 3IIMA 5G41A 4C3ZA 4BZPA 5TMPA 3SE0A 3BD9A 3EIHA 4A6PA 5FH9A 2HT1A 4ESHA 4CEIA 4C0AC 2V9PA 5KO2A 3NXSA 1ZIPA 3THWB 1FTNA 1Q12A 1S4QA 3B8HA 2IYYA 1ANKA 4JLAA 4WA7A 2ZUCA 3AP3A 3HU2A 4NE2A 4OI1A 3I8XA 4XSGA 4EJSC 5FFMA 3TK1A 3V4FA 5KDDA 1I2MA 4P4UA 1G3MA 2V7QA 1YR7A 4IVQA 2IW3A 5CIWA 4B32A 3BB3A 3FB4A 4IVRA 2V6JA 1WA5A 2XNDA 4A8JA 2D7DA 4XWKA 3RRZA 1OYYA 1QVRA 2D3WA 4B75A 2RGNC 5CB8A 5C4MA 5DE3A 2Y8EA 2VP9A 3RYTC 5KU1A 3W34A 4DCVA 5JEDA 2WJVA 3C4JA 3K9GA 1Z0JA 1N6IA 1EFUA 1ZYUA 3BC1A 3K0AA 2ZRMA 4BWYA 2YC2C 3A1UA 2PEYA 2PMDA 3TNFA 1GNQA 5JS8A 3TSZA 3BJIC 1TTTA 1E2PA 4NU0A 2A5FA 5A0FA 3S1AB 1H8HD 4Q21A 4MYTA 1G7RA 3V00A 3ASZA 4LJ6A 3E2IA 3FVQA 3LH5A 4BFUA 4DLYA 2FE4A 4FWTA 4TLCA 5L8VA 4OJKA 4UNPA 4DCNA 4TYWA 2W2XA 4N1AA 2YVUA 4LHZA 1BO6A 5LB2A 4JLDA 1YRAA 1G3RA 5JECA 1N0VC 3KXLA 3OIYA 4PQYA 3GFTA 2REBA 3RABA 4TMKA 1R8SA 1LS6A 2HEIA 4C0KA 4MRNA 1R6BX 2G0NA 3GLHE 2D7CA 2ORVA 2FNAA 3HU3A 1IN5A 2ZSEA 4KYIB 3U4QB 5GVRA 5SZJA 4DLVA 3OESA 3B5JA 4TLBA 3RDPA 1GRQA 1N5JA 4EPVA 2BM1A 1E79D 1E9FA 1HT2E 3BFXA 3G82C 3H2YA 5EE9A 1TU4A 1ZNYA 2BJWA 5JWHA 4B34A 2NO0A 4O3MA 4HLDA 2IYWA 2QNRA 2R65A 1GM5A 2YC4C 3K0CC 1WCV1 2PH1A 3CPHA 3SI7A 4B76A 4DCUA 4ZDKA 4JJKA 1OIVA 2DYKA 4JL6A 2LKDA 2BCGY 3D8BA 4RZXA 2O8EB 1U2RA 1DPFA 2PEZA 4LJAA 3TMKA 1FNNA 4BASA 1ELOA 4FWIB 4Q4LA 3FOZA 3H4MA 3K0FA 1TL7C 1GKYA 1T91A 3O8DA 2WPDD 4LY6A 1DG1G 4M0LA 4JLOA 4B3FX 4EFMA 4P4SA 2ZRJA 4JSYA 2JLYA 2R6FA 3N70A 3QSYA 1MRSA 1Z08A 2NO7A 5CK5A 3IGFA 1G19A 3A1TA 4BE7B 4B44A 4EPTA 3MWKA 2XNSA 1AS3A 3WHKA 2IHYA 4L5BA 2CMKA 2VP0A 3TAHA 4NBSA 4O0MA 4U00A 4GMDA 1XEFA 3MWLA 2G77B 1KO5A 3WRYC 5H68A 1JEEA 1XD2B 4J0QA 3KXIA 2BKUA 2QAJA 4HUQA 1SKYE 2PT7A 4JL8A 4D0NA 2VSXA 2QM8A 2GBLA 4AKEA 2CDNA 4EAQA 5GADl 1KNXA 2ZRLA 3FKQA 3W8NA 3HR7A 1OKKA 2PBRA 3MGCA 4M9ZA 2GK7A 3A1WA 1NBME 4BLOA 1Z83A 2AX4A 4MGYR 1MABA 1DAHA 2RHDA 5HKKA 1BS1A 4PX9A 1YRBA 2F55A 2Q6TA 3KFVA 5KNCA 2OG2A 2ORIA 1OF1A 1D5CA 3ZDQA 3PENA 3TIFA 3AVVA 4E03A 3TAUA 3EZ9A 2ZI7A 3ECCA 4ZI3A 1ZC4A 4DT1A 2FZ4A 2IF2A 2IS1A 1DO0A 3L0SA 1FMLA 4PSKA 1R8QA 3TVDA 3EASA 3NHBA 4ZKDA 2XEXA 4I4LA 2BMFA 2F1HA 2PLFA 1A2BA 4OBEA 4W5WA 3K70C 4PHHA 3TVTA 3SYLA 3ZIAD 3KKQA 1JXMA 2IXFA 3CLVA 1NJFA 2WAYA 4LJ8A 4IEEA 4FCVA 4HLCA 1KSGA 3RRMA 2OE2A 1U8AA 2OCPA 1G3IA 4LJ9A 4LYJA 1VHLA 4LBYA 3UG7A 4LYFA 1BIFA 1OFTA 4RD1A 1P2VA 4Z8XA 3VR5A 4EPXA 3WYFA 4HI0E 4B71A 2DB3A 2A5YB 3H84A 5AJWA 2VP2A 1XTRA 5AJZA 3Q85A 2ZE6A 5CJPA 2PMKA 3ZZTA 4KAXA 1ZCAA 4US1R 4DB4A 1UEJA 1KDTA 4GOKA 2FMXA 2NZJA 1LV7A 2OFWA 1G5PA 3SBEA 4AD8A 1A2KC 2WWFA 1W1WA 4Q02A 5BYJA 3IDQA 1C9KA 3QE0A 4IW3B 4NCNA 4IDOA 3NBZC 2WJIA 4O2RA 1AA9A 1CR1A 3NDPA 4R7ZA 2GCPA 3CH4B 3QG5A 3IBGA 2FDCA 3LQQA 1EFHA 5G3YA 5FTKA 2ASEA 1IOZA 4RKEA 3U2QA 4FD2A 3EC1A 1KI8A 3BOSA 4B3CA 1OFIA 5TARA 1CRQA 1E98A 5FPYA 4EPRA 4A2QA 1UBEA 4G5SA 1SULA 4PAOA 4C0LA 4BUJA 2RGDA 4CZ2A 1YVDA 1ZVQA 4G5QA 1CKEA 3TQFA 3WNCA 5JCPA 1VYVA 2W83A 4BPBA 2YHSA 4CF7A 3CR8A 5TB5A 4PAQA 1KAGA 1YR6A 3I1FA 5JLJA 1YZUA 3NBFA 3UWKA 3RS5A 1GWNA 2MMCA 3I92A 2GVZC 1XCPA 4PQRA 2XJ9A 1A5TA 2GJ8A 2ZI4A 4RSGA 3LW7A 1II8A 1UDWA 2W6IA 2ZVQX 3OE7D 3BAFA 5C4GB 3ZZUA 1QF9A 4AYTA 4GMXA 5DHAA 1G4AE 1GRRA 5C46F 1MT0A 1KNQA 3H1TA 4HAYA 3GLHB 3RSOA 3Q5EA 2JLUA 4TYNA 5EE5B 4XTCS 4WOPA 2HJGA 1IJFA 4HDOB 1YZNA 1WF3A 2B6HA 3R20A 3AKEA 2X19A 4EIWA 2JLWA 5AJVB 2C9YA 2J0UB 3WHLA 4Z8YA 3OEHA 3QKSB 1Q0UA 4G3XA 2QUZA 3KZ1E 3Q7QA 4LCBA 1U99A 5B64A 1NBMD 2R8RA 3NBYC 1M7BA 3IO3A 4M8NE 5CJ2A 4C7OA 1P2SA 4R2HA 2JIZA 4JBXA 3O8CA 1G21E 3LY5A 1ZP6A 4JKYA 4Q9HA 2J46A 4DZZA 1C1YA 2HDNB 4ERNA 2WWGA 2LWIA 2KSQA 3UATA 2XZLA 2JDID 2VP4A 1Y3AA 3L2OB 4TMWA 3FKSD 4UQOA 1MO3A 1MR3F 4AURA 1VPLA 1QHXA 2OLJA 1YR9A 2GZAA 5IHPA 2P6UA 2QORA 2Q9CA 5AUQA 5KNBA 4Q1FA 4MKGA 1VG9B 2EYQA 3CZQA 3FTQA 4HLQB 4PPQA 2NPIA 4MRPA 3KQNA 1DAIA 4URVR 2ZUBA 3LBHA 3GJ4A 1U0LA 3LXXA 1LW7A 3RS2A 5H1YA 4PXAA 2V54A 2ZAOA 4TWZA 3BH0A 4UNQA 1EFRA 1ONBA 2C98A 3IQWA 1NP6A 4B43A 3LLMA 1E9DA 3X2SA 3D6TB 4NHOA 4Y0AA 5AK0A 1ZM9A 4KCGA 1SKYB 4PSVA 4Q7MB 2UZIR 1S3SA 1G41A 4D2IA 4LHYA 5CITA 1E4VA 2IYQA 1NG1A 2ZRGA 4WW0A 4BLPA 5FR1A 3AM1A 1EESA 4RY2A 1T0HB 2IYUA 5CIQA 5FI1B 4JLVA 4FMDB 1AIPA 1Z07A 1Z6GA 3EZFA 1DBSA 3HJNA 2ZS7A 5EQTA 3RHFA 3V9PA 1GIAA 3KX2A 5J40A 3JVUA 2D2FA 2A7QA 4MYUA 2E9SA 2GZDA 3U44B 3IILA 1Z2AA 1BMFD 1ZCBA 3EW9A 2F9LA 5JBQA 4I1SA 1OXUA 1JQLB 3PUVA 5EXTA 4LBVA 1IONA 2JAQA 3SNHA 3K9NA 1CBUA 3H86A 3DHWC 3ZYCA 1OT3A 1VCNA 3KFXA 4FCTA 1YZGA 2PL3A 2BMDA 3LXRA 3PUWA 3ADKA 2PCJA 3QXSA 5TXGA 1ZJ6A 1RRPA 2WWHA 3C5CA 1EK0A 4KI0A 5DO9A 3N2EA 3BRWD 3QPUA 4OL0A 3KQUA 2RGAA 4TN1A 2WSSD 2X8AA 1BYUA 4AKGA 1KDPA 3O47A 4U7DA 4AY2A 4AI6A 2R6CA 4V0OA 4B6FA 1Z6XA 2EYUA 1JQJC 4A82A 1L8QA 3U3OA 4PHTA 4DEXA 3AKYA 1GRNA 3CM0A 1G8YA 1KHTA 1P73A 2X2FA 2VP6A 4KVGA 4D4LA 2WOJA 4PQFA 2V3CC 1KI6B 4QGFA 4XWOA 4C2UA 1OXXK 2KB0A 1G7TA 2QE7D 3THOA 3RNLA 3RWOA 2IYXA 2MMGA 4H1VA 4Q7JB 1OH7A 3GPLA 3VU9A 1CIPA 2L0XA 2H16A 2J41A 2E87A 2WSMA
chains in the Genus database with same CATH superfamily
3AUUA 4ZO9A 1BA3A 1TZKA 3LV8A 4N0PA 4YDHB 4MI3A 1E94E 3O0TA 4DQLA 1J2JA 2FN4A 3VO9A 1CXZA 3EDCA 4EG6A 4KVFA 3PC4A 4CNQA 3QHQA 1C0EA 1UR5A 4GOJA 4B3SB 4LHWA 3QFRA 1UBRS 3C3PA 1PFGA 2RK4A 3UC5A 5C8VA 2EFYA 5SICE 3S70A 3T5PA 2O8DB 1C7JA 1A4IA 1JWAB 2XWSA 2CEKA 4ZWNA 5H8WA 2VPIA 4W5JA 1OHHD 1U9ZA 4E3ZA 2BEVB 3BTUA 4AJ9A 1P72A 5FV4A 1LBHA 1M2EA 2VRCA 1C30A 4QBIA 2P6RA 5JSUA 2D5IA 4RJ2A 4AJOA 3LTEA 3RREA 2HCBA 3WSVA 2OZVA 4OV6B 5DF1A 2XGGA 1P9RA 3IDOA 1VCIA 1G8SA 4NJEB 1RM3A 5E1MA 3DW1X 2OFOA 3F5QA 3MMZA 3CZAA 1HQYE 3LPMA 3WIUA 3DHNA 4M0DA 1V6CA 2Q2NA 3U1TA 1ZRNA 1ORRA 2JJ2A 4LYGA 4YRJA 4ZZ3A 2JRCA 3DR5A 1HX7A 3OIUA 4YAEA 3A32A 1MQAA 3OPMA 3JALA 2HBRA 2I3DA 1RABA 4MARA 4BL5A 4P7BA 1V26A 1U3TA 2HL6A 4S1TA 5MN4A 4D42A 1HPLA 1NBIA 4ZU3A 4BQIA 1ZIDA 3LLVA 3AH8A 3WYAA 5GIOE 2JJ1D 1VBNA 2CT8A 4M1QA 3I3SR 2DHDA 4XM1A 4M0PA 5G0TA 4QPCA 4NJMB 1NUHA 2AJ8A 5L6LB 2MSNA 1MRZA 5A4JA 2QLBA 3C16C 1V45E 5L45A 2EEZA 1F0NA 3EZGA 1N6RA 1K7CA 2JLXA 2IOYA 2Q9BA 1O8BA 3CUYA 3JZAA 3CONA 4LXUA 3P32A 2HH9A 5CA1B 4OVKA 4Z4EA 1N6KA 1O97D 4WTOA 2AOUB 5HRCA 2H1VA 1T6ZA 2WSBA 1V5FA 2Y99A 2VJKA 4MQ5A 2PFGA 3HVKA 3I9V6 2FEXA 3X1WA 3VRHA 4C22A 3I23A 2QTHA 2QI9C 1T0JB 2XCUA 1NW3A 3FFXA 3V2IA 5LM3A 1L8AA 2O0HA 4RHTA 3LPDA 1OPXA 4CU2A 3W5DA 3PX2A 1HYHA 1P44A 4KSYA 5IABA 1SCUB 5ALQA 1TAQA 2QVXX 3PDUA 3OO1A 3HA5A 3GJRA 4KTVE 1QYXA 3B2EA 4QNNA 2J3IA 3WJ7A 1QGUA 5FL7D 4D8UA 3SBXA 1XZDA 3AF5A 3G13A 3GR6A 1NSYA 2GRAA 1SCIA 1XZEA 3D3KA 2HTFA 3E9MA 5IVHA 2QN8A 4UNSA 2W2QA 1NY5A 4CLOB 2PN1A 3WRXC 4A6DA 1ONPA 1KQPA 4LXIA 4RGYA 4EL0A 4R6WA 4FKZA 1LDBA 3EVNA 1CT9A 2D62A 3DEIA 1QF6A 1L5WA 1W52X 4YRDA 2AN9A 5E8JA 1JDNA 1KEWA 1T8WA 4AJIA 2JAXA 1JMKC 3OM0A 2HWXA 4EJSB 2UVDA 3GK3A 1OBCA 4X94A 3R9IA 4BHTA 4HN2A 1DRUA 3L01A 2I91A 3ZDEA 3AHDA 3AQ4A 3IUEA 3B85A 3BF7A 4GSLA 5JHGB 1SBZA 2R1UA 4WZBA 5JUWA 1VIAA 1A5SB 4V39A 4RFSA 3QG1A 4PIPA 2AF3C 1H6DA 3H5TA 4IVPA 4Z0PA 4BO9A 4L5JA 5CLLA 4ZC8A 1OX6A 5U4QA 4K2HA 2H85A 1I2BA 5DXFA 2FGKA 4QNRA 5ITWA 3C14C 2R1TB 3ASUA 1QQ5A 2QRNA 1P8AA 4QJ3A 5JAMA 2Z6UA 1CFJA 2QP9X 1PLLA 2XRYA 1WUIS 2O7VA 1P75A 1TNDA 1USKA 2P4UA 1X92A 2QRQA 2ZPUA 2ZTVA 4CQMD 4Z5XA 4D6XA 5F52A 2IYLD 2I87A 5BRAA 4OF4A 1NLZA 7REQA 1H0HA 3KK0A 1Z8NA 2NSDA 3NBAA 3OU2A 3UJNA 3K6SB 1HGXA 4FYKA 3U5ZB 2NZYA 2AUMA 4D4MA 1H4VB 1AQNA 2F9MA 1C50A 3IEMA 5KB3A 3NM5A 3THWA 1NV9A 3DULA 5L3SA 3LT5A 3R5HA 3ZCRA 2XYVA 3PYMA 1QIEA 1YB5A 1IXRC 5FNVA 1XGKA 2NUPB 1F4VA 1WJGA 3GJTA 1PFWA 2JJYA 3UW1A 4EYOA 3H9BA 3I39X 1QK3A 4RD3A 4X92A 3N75A 4BV9A 1AGRA 4P4LA 1QTRA 1M83A 1R6AA 2F67A 2P5SA 2G36A 1MFZA 4F4DA 3KWLA 3V4LA 4Q24A 5AHKA 1KOJA 1QM5A 4MR9A 3SDBA 1Z37A 2RBEA 3PXBA 1N5RA 3IPCA 3PKZA 5JAIA 1WUHS 1TUBB 1EGAA 1XMIA 1QLJA 1FQJA 3FWKA 4ZCLA 2J8ZA 4YPVA 5JCJD 2BM0A 1NSFA 3CF4A 3DVSX 2R9VA 3Q4GA 1JALA 4IFEA 1TTPB 5CXSA 5A2QA 2DHRA 4C4RA 2AXQA 5EIBC 4DLLA 1IXZA 3FNFA 2JGDB 3BJMA 3K20A 4IUBS 4WACA 3GJQA 1RHKA 5KOJB 2C95A 4RZUA 2V03A 3O8BA 4LCEA 2WMOB 2D3TA 5K0CA 4C05A 5AVRA 4HMPA 4GKAA 3OIDA 3ZCSA 2TMKA 2RSLA 3GJ5A 3PF9A 1GCAA 4KRXA 4BB5A 4BNDA 1QPZA 1KORA 2F90A 1ZOSA 1I7PA 1WLSA 3G5LA 3T95A 3UWDA 3BIXA 1E1DA 1VG8A 4G5HA 1YB7A 5BVHB 2I8LA 2OSBA 4LJ5A 1G8GA 1I10A 3B8EA 2ZR0A 1YJ8A 2B37A 3GJXC 3K2IA 2X2EA 2C2OA 1GUAA 3PX3A 5FAKA 4W9MC 1WDKA 2DPGA 3G2PA 3AUKA 1E64A 3QKRB 4I81A 2F4NA 1I3NA 5JVDB 3T06B 2QTWB 3A70A 4YDQA 3SF0A 4IJWA 1KEKA 3E22A 3DUFB 3EGOA 2B2NA 1V2GA 5DH9A 3VAAA 4OLFA 1XTUA 4KXQA 1Z36A 2CE7A 3DTVD 4MI9A 5H16A 3JYNA 1C9MA 5KYKA 3EQ8A 5A6SA 3BGWA 4C3VA 5A3RA 5T5QA 1YJ5A 3IQIX 4TKUB 4UE6A 2GEVA 2XB4A 2QZ4A 2WFLA 5DTQA 3U4QA 2AJCA 2NG1A 4CKCA 2JLAA 4KPGA 4UAUA 1HDRA 1JDVA 4EYSA 5DLEA 2FFQA 1ULHA 4UPDA 4L76A 5BWOA 5EJEA 3ASYA 4MK4A 1OR8A 1ABBA 1BH2A 4V0KA 4TL8A 3J81A 3PI7A 2BCJQ 1D03A 1X0XA 1ZD9A 2C5SA 4LE1A 2WE8A 2R8PA 1LEHA 2IEGA 2WAMA 1SOUA 2W2KB 3PITA 2PK3A 4TL6A 4EX6A 2AFHA 1GDDA 3G8DA 3D3QA 3ND9A 3WBFA 1MDFA 2Q3FA 1V7PC 3G68A 3V33A 2OK8A 1RYHA 2HNKA 2HOQA 1MGPA 4LPKA 1C2YA 2EGUA 5FOVA 2MOKA 3TOSA 5L51A 1J7JA 4PBRA 2RGYA 4D4IA 4OB6A 4RTOA 4ZO6A 5KQGA 1HYGA 2ZETA 2GD2A 2V4UA 1FFGA 4PCUA 5K01A 2PIDA 5HIIA 4LX0A 3SSMA 4B4KA 4Q7LA 1JDPA 3P2JA 3WYBA 1UWCA 4GI2A 2Z1MA 1FSGA 2RG7A 4II2A 3MUOA 1QH8A 2GTIA 4V02A 5ES4B 1SKMA 2YFQA 1M2NA 1CUWA 1TAGA 1AZWA 1IY2A 3BSSA 4RA9B 2ZWPA 4BP8A 3QEAZ 1EVJA 5L6MB 1P5ZB 1I80A 1XCGB 2FV8A 3THYA 2FEKA 4RK5A 3FLAA 1YDWA 3L0CA 1LFDB 3CURA 3PC8A 1Y3BE 3Q5DA 1M2FA 5BW4A 1U5AA 2HLHA 1YIDA 3ULKA 3ELDA 3K70B 3DCJA 2OCBA 3EGXB 3AM3A 1STOA 1W5AA 2WVJA 3TQOA 2B35A 4BFVA 3N8IA 2YV3A 3E9EA 4ESEA 4G0QA 2PUCA 2VDLB 3DZDA 3W5UA 1J0EA 4JENA 5C9ZA 4EQ6A 3B60A 3I8SA 4JOBA 2N46A 5DX0A 3A6GA 2JW5A 1GY8A 1QBKC 4M2LA 1CVRA 5TMDA 4A8JB 4X24A 5FUMA 1PYDA 1GEGA 3AR3A 2XQKA 3GQBA 4GRIA 1E79A 4OYRA 1K1EA 3IXLA 4Z7JA 3BCRA 4TUYB 3TLXA 3N9IA 1UZNA 2IEZA 4ZO7A 1OMOA 1YF3A 5B4TA 2HO4A 5FBWB 4R7GA 4WCFC 3HP1A 2C31A 3CT4A 5JASA 3Q9NA 3PKJA 1IBMB 4ZVTA 4JB2A 4UE3S 3SEFA 2PXXA 4BLTA 4E15A 2WU1A 1Z22A 2AVDA 1TA4A 4HG2A 1FYFA 1M1NB 3G3EA 4ZOLF 3FF1A 1XRRA 2AKAB 3WWCA 2MSLA 3O1HB 4OHOA 3MHPA 1P9OA 2J4CA 3T9CA 4N7MA 5IXJA 1TPZA 5AXDA 3I6MA 4K28A 4PSAA 1TI7A 3G6WA 1FMFA 1H8ED 3K1JA 1JH9A 1B6GA 4YDSA 2CV2A 1YB6A 4MYDA 4GG1A 1X74A 2W7TA 2DSTA 4MLDA 3AERA 4CTMA 3MWGA 1K3TA 3L04A 3WZMA 2C2YA 4KTTE 3N6XA 4GLLA 1WBDA 3DKPA 2Y2UA 4OUDB 1OASA 3Q3CA 2J31A 3S6JA 3HCDA 4KGXA 1UADA 4R1UA 4XEUA 3NASA 3KSRA 3NHYA 1ZMBA 4D3SA 4JLUA 4A9AA 1P0PA 2WT9A 3Q0EA 4FKMA 4FT4A 1KRWA 3DWFA 1V8PA 3J81k 4BQRA 1CIJA 4NARA 2QAGC 2WZQA 3DVQX 4TMZA 3FCCA 4LBZA 2A9FA 3NUQA 4NZMA 4QM6A 4NOKA 5G4LA 2O48X 2VNHA 3IUYA 3TH5A 4AAYA 1XVAA 1RXCA 1DB3A 1KU0A 3NC1C 4ITUA 2ZE8A 2PJZA 2ZT7A 3DZHA 1FVOA 1CUFA 1REQA 2QRZA 4FUTA 3OZFA 2VWPA 4K9SA 5HZHA 1AHIA 1CJUC 1AVTA 3AM4A 1QRRA 1AO0A 4G5YA 1KMMA 4E2FA 2ZUWA 4HGNA 1CS4C 4YAUA 1MVOA 2OLKA 3PK0A 2XE6A 4DV4B 4UOEA 2UXCB 1BRTA 5ITSA 1EAYA 5K3FA 5JNRA 1HDXA 4BEJA 2SCUA 2AZ4A 2OAQ1 1G1MA 2YXBA 2IYZA 2CJWB 3B5EA 4Y2HA 4YRIA 3RLIA 1IRIA 4X84A 4F92B 5JZSA 4UVEA 2XNCA 3ABSB 3ZY5A 1NVKA 1ZONA 3HCFA 3OJFA 4UUMA 4CVNA 1C0PA 1QPGA 2DUJA 2MINB 4TTPA 1H2ZA 3H4TA 5JZVA 4O5OA 1G17A 2XMDA 3PPXA 3IIEA 2HREA 1W6UA 3FUTA 4BJ6A 1AQJA 2OCLA 3EULA 5MFPA 4WXRA 5HP4A 3UJHA 1F17A 3L92A 4HUJA 5I8PA 1XFDA 1JXAA 5HUQA 2QTRA 3DS8A 3EFEA 5HEKA 4W8HA 2C04A 2Y71A 1Z13A 4QWMA 2DVMA 2QVBA 2RBKA 3ETNA 1GG9A 2JFUA 1DIHA 2PS0A 1TCCA 3AFHA 4EUFA 1PR3A 4BFYA 1HURA 3BL8A 2IITA 3BMNA 4KDCA 4QRIA 4RDCA 3Q1LA 1O57A 4M1SA 2WW8A 4N6OA 4KQFA 4WASA 2F4VB 2HSWA 1IM8A 3M5CA 4ARCA 1TZCA 2I2XB 3E18A 3IBYA 5ECYA 4CDGA 5BW5A 1WLYA 4OP1A 1RMQA 2FPIB 1SBQA 3I09A 4YFVA 1Q0RA 3PVSA 1DAEA 5F2KA 3ZWWA 2B82A 3BM5A 3TKYA 1QH0A 5HUHA 1JV2B 4P8RA 5LP6B 2B8TA 3RKSA 1RDFA 1UM9B 1W4BA 3AGQA 4ZREA 2ZRIA 3FETA 4BNGA 2YDYA 2C7GA 1K7YA 2QUAA 1BAPA 2DSNA 6LDHA 4EW6A 1I2CA 3O4VA 3VISA 3KL4A 3WQQA 3R9WA 5ENDA 3P7MA 4JBLA 3BXFA 4C89A 4CKWA 2RGXA 4PFSA 1P2BA 4ZAVA 3ROFA 4IKEA 4ZOAA 5ER6A 4I08A 5FO1A 3PXXA 3RSSA 1JR3E 2J0UA 2QD3A 2CHQA 1H4TA 3GUUA 1KOFA 2NT4A 3AEZA 4CWAA 2WP0A 1NLUA 1NHWA 2QN9A 4K81B 1F4LA 3DH0A 5HF8A 5AW9A 2QMZA 1VP3A 2RGCA 3CCFA 2VXOA 2DUWA 3Q1KA 1NX9A 1W2HA 4LHXA 2EARA 2QRMA 5DK6A 2HA4A 1U7WA 3OQOA 1QFYA 1SOWA 5SZKB 2E55A 2JGMA 2JKVA 3G0IA 3GCWA 3PNQA 3GGGA 4JP1A 2HU2A 4P31A 3V97A 4DIBA 2XYHA 2HU7A 4HY3A 3KR9A 4E1BA 2Y0EA 5FWXB 2QGFA 3CU5A 4ND8A 4EUSA 2AHOA 2HK7A 2P6PA 3F6RA 4NABA 2Z5FA 4QTUB 5KTOA 5K3DA 2DLCX 3DL7A 1UPTA 3VR3A 4TKLA 1K5GA 1PZHA 3ZS8A 4US0R 5K3AA 5AVSA 4F97A 5BYAA 2VCHA 3ILVA 3GT0A 3AG6A 2RB4A 2E4UA 4FI3C 3CH5A 3DNFA 4N5NA 5IT4A 3AMVA 5CW2A 1BD4A 1RE1A 1JNXX 4G9GA 2X0KA 2BT4A 4QTZA 4TV8B 3GO4A 3I1JA 2BMWA 4I5FA 5AVKA 1O94A 4R5MA 1NA5A 1YRWA 3T3IA 3ZWMA 4YASA 2WYWA 2YJZA 2CMFA 3K1AB 1BZYA 4R4JA 1E1QA 1KYVA 3NEYA 3UB3A 3AIMA 4DMKA 2OGWA 4GPZA 4QOFA 1YMQA 3OEHD 2GESA 2F2TA 1YJXA 4FFWA 4YCAA 4LXQA 4MKZA 3UM9A 3PR3A 4JYCA 2GZ3A 1SVWA 2D13A 4RF2A 3OPNA 1UXJA 3KVOA 1OBFO 3KEOA 4RLQA 4G09A 3GLKA 3HVHA 2G70A 4PZCA 4HNGA 3SQWA 3EIUA 1FLDA 3VH1A 4IUDS 2IW1A 2F3QA 4M76B 2PRKA 1DIRA 3BA1A 5ALZA 3ZHCA 2GBLC 1GFIA 2Y76A 3VKFA 1H6CA 1GG5A 1I30A 3CE9A 3NH6A 5AJHA 5F73A 3UMRA 3X1ZA 2ST1A 3JARA 1FJHA 2KS6A 3QWBA 1ULAA 2VRBA 4TRRA 1K7FB 2B98A 1WKVA 1P4RA 2LPMA 3WK6A 1RM0A 4KQWA 4RVDA 4R68A 5B4UA 5JDCC 1XHEA 4QELA 4F72A 3KQYA 3OOSA 2AUTA 4PYIA 1OTYA 3HBNA 3IQZA 3DT9A 1JAHA 3R3HA 1NV8A 5CHYA 5E8RA 1L4BA 1C7EA 4JI7B 3EZ2A 4HDSA 3VKGA 4L7VA 3W5IA 3ZLTA 2VOJA 1A9OA 4LK3A 2VAPA 4DE5A 4XIIA 3TSAA 4I66A 4TMXA 3KKKA 2GETA 2HA5A 2NW6A 3BTSA 5AM2A 4AQYB 2VNKA 2WSYB 2LNDA 3FOEC 4ROTA 5ECWA 5F9HA 4FCCA 5JNVA 5T3YA 3DEZA 4I4TB 3AETA 1PR6A 2PLNA 4WZAA 1NYLA 3TKAA 4CMIA 3U7GA 3L7BA 3T1VA 5CVTA 5HZMA 4XB2A 4HEA6 3FLEA 2C20A 5J3JA 3D8HA 5LN1A 1N8SA 2UYYA 3PHBE 4OQLA 4QC2A 2BBWA 1V3TA 3BJZA 3GUHA 3QWIA 4GX0A 3QK7A 3UMSA 1K06A 4OQPA 1Z5UA 1ZHFA 3LHDA 1OJLA 4JLPA 4J90A 1NX6A 4XQEA 4BJ5A 3S55A 1NUUA 3ZDYB 1XZJA 3NX4A 3VPHA 3HDVA 3IC5A 1I8TA 3WGTA 3N8HA 2GN1A 5E2AA 3DBIA 4DQUA 2XUIA 4R2IA 1IB0A 1XDBA 1MX5A 1Y8RA 1PX0A 4Q7EA 1KJ8A 1IHDA 2BF4A 3QWHA 2E82A 2ZJ8A 2BR5A 2YJNA 2DKOA 3DBOB 4LTNA 4YB8A 4ETWA 2WT4A 4J0HA 2IWRA 2ZPAA 4NFLA 2EKZA 4BV3A 1YH3A 1W9MA 1YZKA 1HNZB 3I9JA 4J9UE 2AW5A 4OUKX 3T7RA 1VCOA 4HD8A 3C6MA 2PKXA 5KS2A 5DP1A 1RYEA 3EX7C 1D0SA 1BC5A 3ANSA 1YBAA 1HV8A 1B3RA 1KEVA 3PZBA 3O8NA 2VP5A 1UPUA 5HKLA 4DL9A 1LB1B 4AMVA 4E4TA 4YYZA 1MMFB 5BT8A 1Z6ZA 4LMBA 4MYRA 1GZ3A 4ZV9A 2IYVA 3R6DA 4KAJA 4MQEB 4OGGA 3KWMA 5DI3A 1NQUA 4LZWA 1KI1A 4JUBA 3AL3A 3VR0A 1WB9A 1L4GA 1JPUA 5CH3A 2C5HA 3TUIC 1OZGA 2PUFA 2A0YA 2FDRA 1GGHA 1X1RA 1SOMA 3NKLA 3TQTA 3CBQA 4MWGA 1KI4A 4NXMB 5CXQA 1AC5A 3QW2A 1OAAA 1Y5MA 5LQDA 2LRHA 4EA8A 1D2EA 2WVGA 2FXIA 3A28A 5KYUB 1I5RA 2A9KA 3OCYA 4FFBA 3QELB 1H5UA 1JNYA 1M74A 5HQJA 4N47A 1ZMTA 3JQAB 5HK8A 4ZAYA 4YY3B 4G0YA 1LRJA 2O7SA 3BQMB 4JLMA 4DLBA 1YZQA 1JE1A 1MB9A 1Y81A 3OT1A 5H7XA 3BFPA 3BRWA 2Z5LA 3QI2A 4WZBE 1QZZA 1SVSA 4OHXA 3GMTA 1JQ5A 1V5IA 1HE2A 4I1RA 2DQZA 2G8LA 3AHIA 4RELA 2PO5A 2Z2YA 3X2FA 1OAOA 2EG5A 4RKRA 4CDMA 4YHHB 4XSHA 1BEEA 2NZUG 1T3GA 2VPTA 3FNIA 1H3FA 3MUEA 2O4CA 3LLCA 1PT9A 3ER8A 4J16A 1FJXA 2JLVA 1NJ2A 4IJKA 4GFDA 1L3CA 3A2MA 3MLEA 2P2GA 1ZK1A 4XPZA 2O3QA 4KDFA 5K9ZA 1KZGB 2Z8ZA 4G5RA 1E62A 2VPXA 4I99A 4U2FA 1KIFA 1GGEA 3G9QA 4DLAA 1ISRA 3M9WA 4ID3A 4KG7A 1YTLA 3OICA 4L5CA 13PKA 5AUOB 1IY0A 1EG7A 1ZJJA 3F5FA 1A3CA 1R4AA 1TQDA 3W3AA 4X54A 2X0FA 3KETA 1ENOA 1ZU4A 5CDUA 1S2IA 3HCRA 2ZG6A 4FS3A 3DQZA 1SVNA 3UK2A 1NC3A 1T5BA 4WQMA 1YAHA 4BV2A 1XQVA 1BJRE 5HJEA 1QE3A 1OLOA 2XOEA 4W99A 3WRVA 4HH0A 3K1ZA 3QLTA 1J1UA 2VDWB 3GNTA 1LI5A 3LCRA 4C7XA 1DCMA 2J3KA 2NO9A 3GLTA 5I01A 1LS1A 1P6UA 4PCAA 1AGPA 1QRUA 2R7KA 4D99A 2X0NA 5C0OE 1E8NA 2P5YA 3CO5A 3EGDA 2C82A 2JIQA 3LPLA 3U17A 1CYDA 4MKHA 5FQOA 2CXPA 1G8KA 3DAGA 2EC5A 4O4IA 2JH9A 1H2BA 4OX9Y 2UVQA 4MW6A 1JIXA 2VSQA 4E5DA 1AS0A 3BRCA 3HVRA 2VJQA 3S2GA 1VLMA 2BEUA 2CZGA 5AVJA 1F8UA 4IWNA 4MPJA 4MUJA 3FR8A 4DPLA 4KI7A 1BWSA 1TKAA 4IDNA 2GPTA 3DJYA 1Q0ZA 2QTNA 3KM0A 3VYSB 4JBYA 3GZNB 2FPGA 4BZZA 3SMVA 2OYRA 1DMRA 3WNVA 1CUCA 1M33A 5K4HA 2YQ5A 1ISHA 4C76A 3I34X 4R98A 2QPAA 2VHWA 1R15A 2OQ2A 3R0IA 2H2DA 1UKBA 3I5XA 2HQ1A 3HU5A 4BRWA 3VU9B 2ZCVA 1GL6A 1OZ0A 2X8BA 4C78A 3P2IA 3K5WA 1NW6A 3UJPA 1VJCA 2YWJA 5DSZA 2VBFA 5TEWA 1KSHA 1DLJA 1JA0A 3NVAA 4PONA 3TXAA 5ILGA 2FWMX 2RCNA 1T29A 3GN2A 5DIZA 3T1QA 3G59A 5GZ1A 4HLUA 5HPYB 4AKIA 1T9BA 2D2IA 5KCMA 3RC9A 3IV7A 4DV5B 5TQ0B 3QPBA 2JI6A 2EL7A 1GTZA 1DCFA 1ZVVA 3EVBA 721PA 2HPAA 1W0JD 4O1MA 5D1HA 1OFHA 3VH2A 1UDAA 5T4EA 3IOCA 1XMPA 1UANA 2CWWA 1TT5A 2O2YA 1Z38A 2CY0A 2FG7C 3GFBA 4B4UA 1J8VA 2ZRCA 2YXNA 4NBLA 1J8MF 1ULBA 4H7DA 3LS2A 5HIJA 2OORA 3B3FA 1RKQA 2AFHE 3LX5A 5KVAA 2X9VA 1OWLA 1AK2A 1E2NA 2ZROA 3F1KA 4OLHA 3G5TA 4IMPA 3WB9A 3GW8A 4ZI7F 4AYWA 5E6UB 4EJ2A 5JPDA 1FRVA 3O2SB 4AUKA 3PIRA 4M1KA 4B9EA 2VQSA 4Q4AA 2DWQA 2HF7A 4D81A 3P0RA 3FUCA 4FFSA 4D8YA 4ZGWA 2WHRA 1Q17A 3JALB 4L22A 3RRBA 2Z1DA 2B6NA 1FP7A 2QVYX 2WF6A 3IJ5A 1DLIA 2VO1A 2QQ5A 2IYSA 3H2JA 3DB1A 1ADFA 4DR2B 2KBEA 3H8WA 5T4BA 3C3DA 4F38A 1UBOS 2QD4A 2WWWA 3C98A 1AKUA 3D6JA 2QL5A 5CX1B 4ZRMA 5ERYA 4WBNA 5A2GA 2W43A 5KTKA 4WIAA 1PW7A 5F7OA 3WGIA 1DKOA 1XDUA 2NOAA 3SFTA 3DE6X 3HB1A 2VPQA 4BFXA 5KSOA 4CG3A 4KDEA 2VHYA 4RMHA 5EUQB 1XZBA 4FT2A 2P9HA 3VGPA 3KT0A 3B82A 4XDYA 1FK8A 2JIDA 5KSZA 4B09A 1W5BA 2COKA 1FNMA 3BK2A 2YOFA 1VSVA 1QC5A 4L8WB 5KHOC 4JUDX 1I7QB 2V0GA 1OU4A 2SBTA 5ALUA 2IODA 2ID8A 5BWCA 4BNNA 3CLKA 1KYWA 2OYSA 2P4QA 1KDOA 1CRLA 1AHNA 1JF8A 1B3BA 2F7SA 2H6EA 1RADA 1A4XA 3K4HA 4ZRNA 2BR4A 3TZKA 1RZRA 1O7JA 2NGRA 2VYQA 4S2EA 1USVA 5A5VA 5IS2A 1TGVA 1UQTA 1XTKA 5ALHA 2BMAA 1NN0A 2BP7B 1WTAA 3ISVA 4MQ4A 3EXHC 4DWVA 3HB7A 1PW5A 1K3UB 2EFCB 3ND8A 1RTKA 3I2HA 3VAZA 3CYFA 3ZUPA 1C3EA 1QGUB 4PYLA 3UMFA 5J2UA 1JFTA 2A59A 5FOSA 4DNPA 3AY6A 2O2IA 4Q48A 1KJ9A 3MJSA 2OXTA 3RKRA 4KR3A 4WXPA 2IUSA 2H31A 2J45A 2YH2A 5KPJA 4Q1EA 1R0LA 3FHJA 5CFMA 1JQ3A 2Q4BA 4U2CA 1PQPA 3H5WA 5IAAA 3VR4H 3GT7A 4Q1AA 2VH1A 4HWSA 1U7ZA 1G6OA 4TQ9A 4RY8A 3QUSA 5JAOA 3GLGA 3MHTA 4H1HA 1PJ4A 4JI5B 2EP7A 4K05A 2DOKA 3ROXA 4GGMX 4RV9A 4CLXA 5JSZB 1JTVA 4HO1X 1ZD5A 3QYFA 4BBPA 1P2DA 1XTZA 2Q3BA 5FA6A 4BE4A 1A2OA 2Z1NA 3BA6A 3IE0A 4WZBB 3OZAA 5DN6D 3ESDA 5A5EA 5CCDA 1J7KA 3EGVA 4LRUA 3S1AA 1EFKA 4CMEC 2FSSA 4LQDA 1LCIA 2IYPA 4RD2A 4EVSA 2WHEA 3L8MA 3OP4A 2WWXA 2OLEA 3C3WA 4IILA 3QKIA 1DVRA 3WB2A 1QYVA 3SWWA 4BNHA 4BO7A 7REQB 3OUUA 2QG6A 2GPBA 1VB3A 5FUBA 4GX5A 2RKOA 4ATNA 1WMSA 4I36A 2GCIA 4DLXA 1CRWG 2HYDA 3F6YA 5KMGB 1DHTA 4LN1A 1B1AA 4UAJA 1SEPA 3VU1A 2PSHA 2HMUA 1CJVC 2C4VA 3LDHA 3G2JA 3HJHA 5L3SB 2OO5A 2WTEA 1N9GA 4DR5B 3IA2A 2FQXA 4IDEA 4K3UA 1TVMA 1R0CA 3UKJA 3ZK9A 5GJCA 4K6GA 3VHXA 2Y4OA 1AV7A 1FB5A 1XR3A 3HGTA 4PLCA 2JLRA 1RPZA 2UVPA 1Q0QA 2YV2A 4FNGA 4Q4HA 5BSRA 4NCXA 1SC6A 3GEHA 1GAQA 1QCDA 2DEUA 4RABA 2QVGA 2XKAA 3OQVA 1BOOA 3CRRA 3CEMA 3E61A 4MR9B 3EBLA 4NNJA 5DXAA 3QNUA 3L8YA 4RHUA 3RUDA 3P4YA 1CQZA 1H2WA 1SM4A 2ZZKA 4AP9A 3NGXA 3KLPX 4IDAA 4Z2YA 4RMGA 3QIVA 1ML3A 1GGMA 1PJQA 2RHOA 1Y4ZA 4MV9A 5G0WA 1B15A 4HLUC 1EXVA 5FXMA 4DNQA 4GXTA 2QAGB 3ZWXA 3ZZNA 4BNXA 2NO4A 4DIUA 1DEXA 3E4CA 1KFKB 3U3RA 1C3VA 3D2CA 3IKVA 4EVQA 2PXCA 2H2GA 3PDWA 1HYQA 1TEHA 1G6HA 4JUFA 3L7NA 2CUNA 1Q7TA 2FQQA 3E82A 3T9FA 4FOLA 2JLZA 3QYJA 2QTLA 1ZGCA 4PSCA 5H59A 3GOHA 4BNDB 3LUHA 1ZWLA 1P3Y1 2GTHA 4ZV4A 1GPKA 3LAWA 3A1SA 2ZI9A 1NFQA 1NLYA 2WWRA 3LECA 1NZFA 4U02A 1KZ1A 2H5EA 1NMSA 1K4MA 3PGLA 5K0GA 1TLTA 2ESRA 4D0GA 4WFKA 2GXAA 3HBJA 2AI2A 4WNCA 1Y8QB 3E22B 2UZ0A 4HPJB 4N8DA 4URZR 3IVMA 3FIUA 4DMGA 1QS0A 2CLHB 3QBJA 2HQOA 5BT9A 2PYZA 5A6SB 3NCTA 1S1CA 2CHFA 5DM70 4JGIA 3CRVA 4AF8A 4ZN6A 2D74A 2JCGA 4L07A 1SG0A 4DQDA 4WVFA 3RCBA 1XD2A 1CUJA 3D43A 5E7IA 4MS3A 2O5EA 1QHFA 2WKPA 4I4NA 3ZQKA 1ESNA 4CKCB 2XCRB 1Q0LA 1T8YA 2H4JA 5AKHA 3ZV5A 1WEHA 1S9HA 4WECA 1S7GA 3I9MA 5HOQA 2V6FA 1JRLA 2ACVA 1GV0A 3K0AB 4FJ2A 1DKNA 2X86A 1D8AA 2FZKA 4C4TA 2AFHB 1NN1A 4CE6A 1VP9A 3UQYS 1AKMA 2ONCA 3RC2A 1WS6A 1QRSA 1UMDA 4JGGA 2E5FA 1WV1A 2EU8A 4WV3A 4H4CA 1CUVA 4ISBA 3TTVA 3NBMA 3OBIA 2Z43A 3M9XA 1AX9A 3STUA 5B1IA 3I72A 4Q6WA 3OQ6A 5CHEA 3RFVA 1KYQA 1P80A 1SCJA 4FBLA 1IJBA 3JD4A 2CB9A 2C8KA 4FQ7A 3DO6A 3A7EA 4M0UA 2Z3VA 1SQ6A 2IVZA 4ZEVA 3DPSA 3DAOA 5GV8A 3KKNA 3VMFA 1SQSA 3FSGA 1CVLA 1OT5A 1V8ZA 4PNEA 1FDIA 1CZOA 1LI4A 1QH8B 1HQKA 2JPDA 4ENRA 4H1WA 1JLKA 4N0EA 4UBMA 4FIDA 4H6PA 1P0IA 1IHYA 3PFNA 2QF7A 5E7QA 5TNXA 3GAMA 3HI4A 3KB8A 3FDFA 1WXXA 2IIVA 5LLSA 4KV9A 1ZMOA 2JFYA 4O8CA 3KVRA 4YBZA 4D6YA 4E51A 1TQ4A 2D6FA 2GEDA 4HZGA 2ZUFA 4ZQHA 1YIAA 4FEGA 4AFNA 2IZ7A 3F96A 3ZY2A 1U3UA 2QW1A 3I9V1 4IJ5A 3G9XA 2WLTA 4DFDA 1P8JA 2E7ZA 2JZOA 1Z25A 1R64A 2FPLA 3CEAA 3T1TA 1P4JA 2VXBA 3N2IA 5IYZF 1W36C 3EFHA 4FYWA 4IF4A 3LJKA 2O0JA 4AN4A 4EQ6B 2IY8A 3K30A 2C88A 3U48A 2P1DA 3GQBB 4FHCA 5EY5B 1TECE 3ZGLA 3OCCA 2H92A 4O59O 4RMIA 1H2FA 2FR8C 1QYWA 4NZPA 1DQYA 3TG8A 2XIJA 5LDGA 3N5KA 3A6HA 1YZHA 4HAWA 4Z0TA 5GP1A 3QXCA 4D98A 3ADCA 2REOA 1D09A 3L79A 4ZDIA 2OILA 1ZXLA 2JATA 2ZR7A 3SM3A 3GMSA 2V74B 4HEHA 4EYKA 5K8LA 2ZSBA 2B0CA 3KJGA 4QU5A 2YRXA 2ARKA 4JOQA 3VZSA 3RWBA 3JWGA 2B34A 3T7CA 3MTQA 1Z5ZA 1EVKA 1K08A 4TKZA 3SHQA 1W5TA 4A15A 1U1DA 4WDQA 4RJJA 4ZAZA 5CBKA 1XIVA 1L4UA 4QJIA 2HMAA 3DNMA 2NXEA 5LP1A 4I5IA 1FTWA 3FYUA 3H18A 3ZU6A 4B46A 5M5BA 1IZ0A 1LTHR 1YVEI 3U16A 2I6UA 5A7FA 2SKDA 5JLAA 1U04A 1II9A 3BE4A 2HZ7A 4OATA 1A9SA 4C0HA 2LD4A 1H0SA 2ATVA 1TTQB 1Y89A 1Q3TA 3B53X 4QYTA 1FYDA 4PG6A 4WK4B 2CVZA 3RRNA 4EA9A 1F9AA 5AW3A 4PAGA 3I62A 1JP7A 1ZAYA 4HJXA 1EU1A 4QKQA 3B70A 3LUFA 1F2DA 3DFUA 2GYUA 4WZAE 4BZQA 2GRUA 1TIBA 4KRGA 1XDSA 1OI7A 4IXMA 4CDRA 3K6JA 4BVGA 3U6BA 2CEAA 2J7PA 4U8GA 1AURA 3D7SA 4E11A 2PPLA 3UMBA 4IOLA 3VH3A 4LTDA 4BV8A 1GTRA 5JTTA 4G81A 2FYTA 3HL4A 4D9JA 3FI0A 3QXJA 1XVIA 4Y2TA 2JS7A 1A9PA 5TSDA 5B1DA 1R4MA 3IXQA 3PWKA 4N6NA 2WMDA 3VFDA 5D7NA 1ZUIA 2JVIA 3SHVA 3E9NA 1NW4A 1Y9JA 1IEVA 1N6HA 2GZRA 3V1YA 2Y68A 4J75A 2IXEA 1FYWA 4DT1B 4ZZ1A 5DX1A 5JANA 2Q0QA 3OIVA 1DOAA 3QKSA 3QVSA 5BSMA 4PZZA 2XUHA 3FZGA 5FR2A 5AQ1A 2XVMA 2SCUB 2VPZA 4MVJD 1EWKA 3M7IA 4INJA 4LF8B 4GRAA 3VPAA 4DUZB 4GYJA 4F4UA 1CETA 3IHTA 4HDNA 1K5HA 1V47A 3KT3A 2IYTA 3RK0A 4AJ2A 2CHUA 3FWPA 4DRXB 1QONA 1JHVA 5TS3A 3AV0B 4KJZA 3PX7A 1ESCA 2XSZA 1G8FA 2XOXA 2I66A 3OAAA 3QY9A 5A4MS 3OQHA 3MRXA 1DUSA 1FFEA 1AZSC 2PRZA 1HE4A 3ELBA 3PUXA 4FQ8A 3WDMA 4CIXA 3F4BA 1LPSA 3PRJA 1QIIA 1SCDA 1B8OA 2GLXA 2ONZA 2OR3A 2PNFA 4GPAA 4EM6A 2NTNA 4MB0A 3QIAA 4W7SA 2J0QA 2MR6A 5EPEA 2J9XB 2K6GA 4PHGA 4OA8A 5JRZA 3L4KA 5LNK6 1O96A 4FE7A 2LW7A 4NAUA 2WY2D 4F06A 5H3LA 3BMNB 3ADBA 1NVBA 3EMBA 4ISCA 3EEOA 4Z2AA 4PO3X 3ZD6A 2M1XA 1DFHA 3O2NA 3TW0A 3RRYA 4KWCA 4XR9A 2XB6A 4IR7A 1C0LA 3GGOA 4H2DA 2FN7A 3QHPA 3QA3E 5JJKA 1EGMB 3K0SA 5DYGA 2ZXUA 1KYIA 4G8JA 5IUNC 4IIFA 4ZICA 1H9BA 2XQIA 2WHXA 3CLHA 2AJBA 3HC7A 2C7RA 1WNTA 2X9GA