1G5TA

The three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo-atp form
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
157
structure length
157
Chain Sequence
ERGIIIVFTGNGKGKTTAAFGTAARAVGHGKNVGVVQFIKGTWPNGERNLLEPHGVEFQVMATGFTWETQNREADTAACMAVWQHGKRMLADPLLDMVVLDELTYMVAYDYLPLEEVISALNARPGHQTVIITGRGCHRDILDLADTVSELRPVKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of ATP:corrinoid adenosyltransferase from Salmonella typhimurium in its free state, complexed with MgATP, or complexed with hydroxycobalamin and MgATP.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
molecule keywords COB(I)ALAMIN ADENOSYLTRANSFERASE
total genus 53
structure length 157
sequence length 157
ec nomenclature ec 2.5.1.17: Corrinoid adenosyltransferase.
pdb deposition date 2000-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02572 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g5tA00
1U8YA 4LJ5A 2IS6A 2QAGC 3NBFA 2F3TA 4F91B 2PCLA 1BYUA 2AWNA 3EZFA 4NCJA 1P61B 3DOEA 4OQXA 1WBBA 2JJ2D 3UWOA 1NP6A 1KY3A 1Y3AA 4F4JA 5AUOB 3QG1A 4DLTA 4B3CA 2JLVA 4DBLC 3OZXA 1E9RA 3TMKA 5JCPA 1FNNA 2OV2A 2IYZA 4QKQA 2IEZA 2RGDA 2WZQA 4Z8YA 5JHGB 1XMSA 3K0AA 3NKVA 4NBSA 3NHBA 3SNHA 2VP0A 3VR1A 2BM0A 4EJSC 2BHRA 4K46A 1N6RA 1KI3A 2A30A 1N3BA 1BYIA 4NU0A 4OK6A 2NZJA 1WQ1R 4US0R 3L0OA 1E9CA 4BFUA 4B6EA 3OF5A 3ZH9B 4B3XA 1XTIA 2WSMA 1X8LA 2D7DA 4Q9JA 1U0LA 2HF8A 3UPUA 2GETA 4HAYA 4KJZA 4TYNA 3QEJA 1Z8FA 3J81k 4A92A 3HP1A 5HCIA 3FKSA 2XZPA 1TEXA 4WBSA 4LBZA 1WBDA 2GZHA 2OO7A 3HDTA 5B58C 2OLKA 3UK6A 4BWYA 1F5NA 4LYFA 3RRMA 1KJZA 2ZEJA 2QT0A 3EASA 3HR7A 4HZUB 3DVLA 3BFXA 4DSTA 4PQFA 1J2JA 1S8FA 2GAAA 1Z2AA 2WWIA 1IN7A 4ABYA 1TNDA 4E22A 1LS1A 3FB4A 2YKGA 2VP5A 1W4AA 2V7QD 4HLCA 2VH5R 2XITA 3AP3A 3C5CA 1K5DA 5KHOC 2QNRA 5CITA 1XJ0A 4N1AA 4TMXA 3I92A 4JT4A 5HTKA 1GIAA 3C15C 1P9WA 4M4SA 5E4FA 4ILEA 3X1ZA 4TL9A 4BZXA 4FWTA 3H2YA 4TL8A 1OIVA 2BBWA 1CJVC 2J9RA 4O3MA 1M7HA 3BJIC 4QGGA 2HYDA 2ONKA 1XX6A 1FW6A 2JA1A 1XEWY 4Q4HA 2TMKA 2YWEA 3T61A 5BWMA 4XTRA 4B43A 4US1R 3H1TA 1SGWA 2ZE6A 3ZD6A 4L9WA 5CYOA 1QHYA 4WZ6A 1Q12A 3AB3A 3K0CA 2OG2A 2AD1A 1E2MA 2C2HA 2NIPA 5CK4A 5GJBA 2WM9B 2DFNA 5HKKD 1W36B 5SZJA 2QM7A 3QOFA 4IEIA 4Q1AA 2LKDA 2F43A 2MMGA 4H1UA 3WYGA 2YOFA 1D9XA 2F1IA 3C16C 4Z51A 4EPYA 1DO2A 3AVUA 1Y63A 4Q4HB 1GWNA 3ECCA 4KHZA 4YXWD 4H9GA 1UEIA 3ZQJA 4KO8A 2CLSA 2OFWA 2NOAA 3PFIA 5JJKA 1ZM9A 1T91A 2VEDA 2GF0A 4MKGA 4OQFA 4AYWA 4DKXA 2RMKA 1HA3A 5DSZA 3HU2A 2FMXA 1YR8A 3LXRA 3K0EA 1IAQA 4IKEA 3CPHA 4WZBE 5E7IA 5AUPB 1OW3B 3GQBA 4Q19A 1Q0UA 1ZU5A 3FE2A 3P26A 2EWWA 3HU1A 2F1RA 5LD2B 3AKDA 1KDOA 4C2TA 3VR6A 5H68A 2FSGA 1XEXA 1R4AA 1FQKA 2FPKA 2YHSA 4XWOA 1D2MA 4U7DA 2OT3B 3L2OB 4LC1A 4KFSA 4PQRA 3TIFA 2OCPA 3Q7QA 2JCSA 1TQDA 4A6XA 1ZBDA 1CR4A 1LW7A 1ZM3A 2V1XA 1AQYA 5FOVA 3FYHA 4TMKA 5KOYA 3NH9A 5P21A 1OFTA 1RJ9A 5CLQA 1P3JA 4C0BA 1Q3HA 4JL6A 4EKDA 3CH5A 5DHFA 3GJ4A 1KIMA 2WJIA 4DEYA 3EPJA 1TMKA 2ZR9A 3EA5A 3SI7A 1G1MA 4A0FA 1VCMA 3TJZA 1JI0A 3V4FA 4DDWA 2RGBA 2K5UA 4CYMA 2GVDC 4RCZA 3UKDA 2KJQA 3BH7A 2FDCA 4AYTA 2ZRDA 4G01B 1Z6TA 3UG6A 3HWSA 4RD2A 3TVTA 1OSNA 4NMMA 1OJLA 2VHQA 2JAQA 1G8FA 1Z6GA 1NLZA 4DSNA 4DDUA 1KNXA 2IEYA 1RJ9B 2VHJA 2QPAA 4X8LA 1ODFA 5JMTA 4JYBA 4JS0A 5AJYA 3FHOA 2RB4A 3VU9B 3NTUA 4TSFA 1FX0A 1NSTA 3FMPB 4CT5A 1ZCBA 1OV4A 2GEVA 4IEEA 3U3JA 1R6BX 2F9MA 5BQ5A 1DPFA 4LJ6A 1MH1A 2FEMA 5AK0A 5K8LA 4YQFA 3PV0A 4QBIA 1O87A 2PLFA 1OYWA 3ZDQA 3BK7A 2QAGB 1CU1A 1W44A 3SYKA 3BC1A 3IO5A 4Q1FA 4DHEA 1L4UA 1Q22A 1W4CA 2AXNA 4A8JB 4N3NA 4S35A 1GTVA 4V0OA 3TVDA 3LO5A 3SU8A 4DRZA 2P6RA 2O8EA 2FPMA 4JVSB 3LQQA 4RZ2A 2VTKA 4LDJA 3B1WA 4G5OA 4YMTA 1O3YA 4M9ZA 2VP4A 4HDOB 5KSOA 4Q9IA 2J5XA 4MKFA 2LKCA 1TF7A 1VCIA 1XJCA 1XMVA 1Z2CA 2PX0A 1ZRHA 1D2EA 3PQCA 3UIEA 3C8UA 4ZIRA 4B71A 1IJFA 4DLYA 1XZQA 2C99A 1P2TA 2FE4A 5FR1A 3W6OA 3FFBA 1OPXA 4PZLA 3BE4A 1Z0AA 1G4UR 1II9A 3FMIA 3TK1A 2JLZA 1KI4A 4A8JA 3CM0A 1OH7A 5HZHA 1NMXA 2KSQA 5EP4A 5IT5A 1OH5A 4IOLA 5KO2A 2ZS8A 1XNJA 4US2R 4QHYA 3AM1A 1DELA 1KMQA 3EIEA 2X77A 2ZRBA 4LBVA 4LX0A 4LSGA 1Z0DA 1H8EA 1EWQA 1P9NA 4C0SA 2VBCA 2BCJQ 2P65A 3NXSA 5DGXA 4R7ZA 1S3SA 1GP2A 2YNMA 3B5JA 4NYMR 4MH0R 3OIUA 3PUXA 1PUIA 1YZNA 4ESHA 1XEXB 1KO8A 3H4MA 1ZD8A 2RAPA 1WMSA 2D2EA 4BFXA 1F60A 2W58A 2FH5B 4KBFA 2GZAA 2PZEA 5TXGA 2GK6A 1N6KA 2ZSAA 3M1IA 4F93B 4LJ8A 2RHMA 1VG9B 1X86B 3BERA 2ZUBA 1W2GA 3RS3A 1XBTA 3KQUA 5F9HA 3I4LA 1G64A 1U8AA 1Z47A 2CL6X 2WBLC 1NJFA 2C8VA 2ZIAA 3GJ7A 2DFKB 1UKZA 2P5TB 3W5IA 2IYUA 3AF1A 2ZRKA 2ZRJA 3MWYW 1T4GA 3CX6A 3VAAA 1N5LA 2FSFA 2VA8A 1E0JA 2FZ4A 3NHAA 1VCNA 2NZ8A 1E0KA 1NBMA 1EFHA 3Q3JB 2FNAA 5FFMA 3ZJYA 2GNOA 2GTPA 4FCTA 4G1UC 4YMWA 4BASA 5FOWA 3JVVA 1SZPA 1IN4A 2PCJA 1M7BA 2A5DA 2BBTA 1XFAA 1DE0A 4M0LA 4URYR 5JBQA 4QL3A 2OESA 1HH4A 4TZ0A 1VYUA 2GKSA 4M1SA 4Q4JA 5JRZA 2PJRA 1KMHB 2AN9A 1E79A 4CDGA 1OKKA 1W4BA 4QJ5A 1EGAA 1W0JA 3QF7A 2QQ0A 2W6JD 4AI6A 4OI2A 1U2RA 2QUZA 2REBA 1CR1A 2FFHA 3OFND 2GJ8A 4BLTA 2KWIA 3H86A 3K09C 1QRAA 1GNRA 2X2EA 1JR6A 2VHCA 1PZNA 3A4NA 1KI1A 2YWHA 5L8VA 3T1TA 1HE8B 4CF7A 1P62B 3L0PA 1KJYA 1ZC3A 4HLUA 4BECA 4A1FA 4QBGB 1N5KA 2ODNA 1KZGB 3LWNA 4BRWA 4AWXA 1OFUX 3RYTC 2CE7A 4MKHA 3VFDA 3NBZC 2QGNA 4V0MA 4TWZA 5JWRA 4P0TA 1M7GA 1X3SA 1KY2A 1BO6A 1KK1A 2F9LA 1IJEA 4G5SA 5BN4A 2XNDD 1IBRA 5DI3A 3I8SA 4IOJA 2X1VA 2PLRA 4IDOA 2NQ2C 5EZ5A 3TW8B 4QGHA 5FPYA 1DAKA 2BKEA 2J41A 3GJ8A 5KNCA 5J4YA 3TR0A 2O0JA 4D4MA 3I3SR 4OL0A 4BFTA 2J7PA 1ZC4A 3QKRB 1QHXA 2O8BA 2O8CA 3PIRA 2RCNA 5FOXA 1Q20A 1QBKC 1ZP6A 1EXMA 2ODEA 4R2IA 4RSGA 1ZINA 3Q5EA 3GP8A 1C4OA 4BQSA 3MAAC 2QMEA 1R0YA 1BS1A 4Q00A 3THXA 1OFHA 4RD6A 4TL7A 3GLGE 3T1VA 3KQHA 3BS4A 5EJEA 3KKPA 4O2LA 4XVQA 1Z22A 1II0A 4P32A 2P6UA 4PC3A 2DHRA 1E2QA 1M1YE 1ZVQA 2PX3A 1G7RA 3GD7A 4RKEA 1G7TA 3FDIA 5L3QB 4CEIA 3I5XA 5FI0B 4RD3A 1NRJB 1W4RA 1OYYA 1LTQA 4C4PA 1G5RA 4Q9LA 3BB1A 5FL3A 5FTJA 4B74A 1Q1ZA 2V55B 3AGPA 3L82B 2XTMA 3U3KA 2CHVA 1N6PA 1N6HA 5HE8A 3THXB 5M04A 2DYKA 4AK9A 2ZYTX 5LB4A 3QEOA 5HE9A 4XD7A 4EFLA 3NG1A 3ADCA 2VL7A 3RS2A 2EFCB 1WA5A 1US8A 1G21E 3FFAA 4TYPA 2XXAA 2A5GA 1G291 1QVRA 2J1LA 2IS4A 4IFEA 2J45A 1U8ZA 4HLQB 3ASZA 1P2UA 3GLHA 3WXMA 4XH9B 4OK5A 1KOFA 2GJSA 3G82C 4WXPA 2CE2X 3AUXA 3OEHA 1U0HC 3GJ0A 1J8YF 5G40A 4NYIQ 4GSYA 1W48A 2F3RA 3CPEA 1UM8A 2XGJA 1OXVA 1VYTA 4BFYA 5J40A 4JLBA 4WW0A 4HSEA 4C3ZA 1OLOA 1T3SA 4L5BA 4W5HA 5GJWC 5JCZA 4MUAA 4AKHA 3DOFA 4DSUA 3NEYA 1TU3A 3W9YA 4FD2A 4DSOA 3C4JA 3SBEA 4MYCA 3NC0C 2HV8A 1DEKA 5JS7A 3BAFA 1TQ2A 1LY1A 3CRMA 5KU1A 3I1FA 1Q3TA 1ZU4A 3U6KA 2C9YA 1UFQA 4M1OA 1TF2A 5ANRB 2XJ9A 3X1WA 1E94E 2OCBA 3E5HA 4GBMA 5H70A 4EAQA 1AA9A 4QHSA 2CEAA 4YXWA 1PJRA 4URXR 3K09A 1ZNWA 1KYIA 4MITA 4V02A 3CNNA 1Z5ZA 5FBWB 4TQUS 3A58B 1R7RA 4LHYA 4QNRA 1UBGA 2HUPA 4Q18A 2A5JA 3KZ1E 2WIBA 2XZOA 2ZJYA 2DBYA 1VCOA 3OEHD 1FFHA 2QMHA 1N6LA 3CKLA 4KVGA 1KK0A 2P3SA 4M8NE 2JASA 3E2IA 3QXSA 3MRSA 3AVWA 3DEFA 2QROA 3RNLA 5KDOA 2B6HA 1T9HA 1S96A 1SVOA 3D6TB 3LXXA 2CNWD 4LC0A 2JLWA 3SHWA 5AJVB 4Q7LA 4YDSA 3WBKA 1YZLA 1KDTA 4B44A 5TMPA 4M2LA 3ZVRA 1CF4A 2AR7A 3PEVA 1XMIA 4OI0A 4QG7A 3M0EA 2YC2C 1D6JA 3K9LA 2V6JA 3W8RA 1NJGA 1RKBA 4C30A 5AR1A 1EX7A 2ZJ5A 1UDWA 1DVRA 1Z0KA 3WNBA 1XD2B 3WRXC 1XPRA 4QXAA 5JJIA 3TR5A 3KJIA 4W5WA 5K8IA 4LBWA 1MO4A 4IVRA 1NIJA 3Q8XB 4UNNA 2IWHA 3A1UA 3ASYA 3ZQ6A 1NF3A 5DE3A 3GCGA 3ZVMA 1CR0A 4WXRA 2F1HA 2QY9A 1R0ZA 4I81A 4CEJA 3UMRA 2IXGA 4GZMA 4AG5A 4PO9A 3CLVA 1T3LA 2P5SA 4QJ3A 5LBIA 4LHZA 2G6BA 1KK2A 4JSTA 1E2KA 2N46A 4HI0E 2DB3A 2J7PD 4MA4A 1XTKA 4KCGA 1SXJE 2ZRAA 3NDPA 3TNFA 2G0TA 5KPDA 4MGYR 3TE6A 1ZM7A 4IJMA 2GF9A 4FN5A 2IBMA 1KO1A 4EFNA 4ACAA 3K9NA 5B30A 5K8UA 4PTLA 4HDCA 4X8MA 1E99A 1ZM4A 1KI8A 2HF9A 3DM9B 4FCVA 4EQ6A 2NTYC 2OCAA 3AH8A 5AJZA 5DHAA 1PV4A 2YINC 1US8B 4FXPA 2IYTA 4ZKEA 5C18A 3RWOA 1FL9A 4B76A 2ZRMA 1CEEA 4M22A 5KUTA 2CHQA 1GITA 4AYXA 1VDZA 4DIEA 2EQBA 2QTHA 3UATA 1VYVA 2REXB 3FKSD 2Q3MA 1JBKA 1OFIA 2ZU6A 4MGKR 2UZ3A 4V03A 3IPXA 2QBYB 1XWIA 4R9UC 1MABB 3C41J 5DYIA 3LLMA 3AVXA 4FWIB 2F43B 4ZDJA 1J90A 2QPTA 3THYB 1K8RA 4BEJA 3CNOA 2MSCB 1BKDR 1VG0B 4G3XA 3ND8A 1OXSC 4ASUA 5JSZB 2ZYUX 2RGEA 2J0SA 2IYWA 1N0WA 4LV5B 4Z1MD 2OFOA 1P6XA 2QP4A 1E69A 4D4JA 1CIPA 3VR2A 3X2SA 1JJ7A 2HLDD 3CB4A 2LCFA 2EW1A 4A2PA 3BIFA 4LJAA 3LLUA 3O8DA 1SHZA 2GVZC 1RE0A 2VQSA 2PEYA 1N5IA 2XZLA 3RRZA 1UAAA 2DWOA 2XOKA 3DMNA 5SZKB 1IM2A 1E9SA 5A0FA 3ZS8A 3BFKA 4HB2A 4D26A 3ONWA 4C0KA 2Y8EA 1U99A 1XEWX 2QQEA 3EG5A 1P2SA 3LFUA 2ZRLA 1GVNB 3EW9A 1E96A 1E9EA 1CJKC 3KUCA 3B2EA 4FMBB 5L3SA 3RAPR 4BLQA 1FPMA 2GCOA 4M1WA 2WTUA 1U9IC 4GP6A 3QUSA 2ORIA 3RS5A 4QGFA 5UKDA 1NBME 2Q3FA 3THWB 1U94A 4PZYA 3TUZC 4OQNA 1ZAKA 2D62A 1KZ7B 3CZQA 2ZI7A 3BBPA 1A7JA 1AGRA 1PLKA 1IXRC 1WXQA 821PA 2FA9A 2MSEB 3HPQA 2ZQ5A 1JB1A 4JLMA 1QHGA 4NP6A 4ZO4A 4LV6A 4LV8B 1DADA 1QZXA 2VLIA 2X8AA 2QSYA 2H7VA 2DWQA 5F3WB 2FPLA 2BJVA 4LYJA 2Z43A 4PC1A 3WRYC 4HAVA 1Q1BA 2VIIA 3WMEA 4ZV4A 3BWDD 1W5SA 4GP7A 4F38A 2QN6A 2IHBA 3D31A 721PA 2ANBA 1SKYB 4HATA 1ZIPA 4PC7A 1ZMXA 3PITA 2YC4C 1FOEB 4TTPA 1RFLA 2FZLA 1XU4A 3KQNA 1IN6A 2QT1A 3CWZA 4KFTA 4RFSB 3T06B 4ERNA 2A7QA 5DI3B 1XXHA 4TQAA 5FBQB 2J0UA 5DH9A 3IBYA 4G5RA 1JR3E 1XCPA 1N0UA 5CJPA 5FI1B 4D4LA 1W49A 3ADDA 3GLHE 1R0XA 1Z3IX 1KI2A 2QG6A 2QTFA 3NBXX 1B0UA 3W6NA 2BJWA 2PJZA 1ETUA 4DLUA 3FHTA 1LF0A 1SVKA 2RGNA 4QBFA 1U0JA 2B7BA 2NGRA 3BGWA 5CM8B 4D0LB 1XXHE 1OB5A 3RSLA 3SJAA 3U61B 4PO1A 4EQ6B 1FMJA 3SDZA 2ZI5A 1R8SA 4X8OA 5FUVA 5J47A 3TW4A 3ZGXA 4QM7A 4B47A 2W0MA 2ODWA 2A9KA 1XPUA 2EVWX 2ZS7A 3RVBA 1GILA 1EWRA 2A5YB 5EXXA 1JALA 1E2NA 1WP9A 1N6NA 3UANA 4B3DA 2XTNA 1J70A 3ZIAA 4XSGA 1YR7A 4NPHA 3IILA 1NN5A 1QVAA 1YU9A 4HB0A 2QA5A 2W2XA 2ZRFA 5CB8A 2XNSA 4PAMA 1OE0A 1KAOA 4I1VA 4XOIA 3CPJB 3GEIA 4D80A 3QIAA 1G9XA 5FH9A 3BB3A 2BBOA 2ERYA 5EP2A 4R71A 4JLDA 2BV3A 2WJGA 3P1JA 4Q1DA 4Q9KA 2ZI4A 2ZR7A 5JSZA 1RVDA 4Q4JB 2O0HA 4U00A 1IN8A 2IHYA 2ZETA 4BLOA 5EUMA 1MR3F 2ZREA 1OIWA 3L8YA 4FIDA 3H0KA 4NCHA 4KSBA 1J8MF 4IVPA 4JLNA 5JI2E 4MGIR 2RGCA 2NO0A 1X8JA 1Z08A 3T5GA 4A2WA 1SHKA 2PH1A 4UXJA 4TLDA 5A5GA 5JECA 2AD5A 2D3WA 4B75A 1Z29A 5C2JB 1HQCA 2GXQA 1FUUA 1KO5A 2WIAA 3B82A 1CTQA 1GL7A 3P4XA 1JAIA 1OF1A 1G6OA 1W1WA 2C9CA 1RPZA 5L3SB 3PVSA 1UADA 4Z8XA 3U60B 1CS4C 3CF6R 2GCOB 3P27A 4PSAA 1BMFD 4OHXA 1Q21A 4DB4A 1HEIA 3EIQA 2WAXA 1UBCA 1ZNZA 1YKSA 3QNUA 4PXAA 1G5PA 2DCUA 4A15A 2P2LA 1SVWA 1BIFA 1N25A 3LA6A 4UJ3A 1LF5A 1OT3A 5IK2A 4JL5A 3JZMA 3IIKA 1JR3A 3S1AA 3PEYA 2OZEA 4QJ4A 3NBYC 3SJBA 2HT6A 4FINA 2C77A 5C4GB 4GFDA 4AKEA 1NVXQ 3GJ3A 1GOTA 3KXKA 5TDHA 1IQPA 4JSYA 2ZRPA 1FX0B 2G77B 1SXJD 5DN6A 1NNEA 3ICQB 3CX8A 1U81A 4MQBA 4PO8A 4OQMA 1G7SA 2AXPA 3PEWA 2WOJA 3BRWD 1HUQA 5HR5A 5JWOA 2KBEA 2CL0X 2WPDA 3QENA 2ZRIA 3I72A 4B33A 5JZVA 4MRSA 4GI7A 1GFIA 2QENA 1NVVR 3K8YA 4AG6A 5BN5A 2WSSA 3BH0A 5E7JA 1VMAA 3S1AB 2BCGY 4EDHA 2W6IA 3FPAA 2WJHA 3W3AA 3LX5A 1E2LA 4PX9A 4QGAA 1RRGA 2NPFA 3T35A 2R65A 3NH6A 4CT4B 2Z6VA 2EYUA 2IS2A 1NKSA 4Q03A 2NO7A 3AGQA 1A4RA 2GAOA 2VP2A 3A37A 2DY1A 1E2GA 3SYLA 3WHKA 3LBHA 1G16A 2OAP1 2IF0A 2ZI6A 4B3BA 4GZLA 3L0SA 4NCIA 3OAAA 4U5XA 1EG7A 1KDPA 4B34A 1QG4A 2ZITA 1ZD9A 1XRJA 4OHYA 3X1DA 1CRQA 1Z6XA 1AM4D 1SQ5A 3DM5A 1D2NA 3WBJA 1F48A 3AV0B 3KUDA 2FJUA 3HJNA 4A36A 3GJ6A 3DKPA 4EUNA 2IUTA 4I4LA 4DT1B 4W9MC 3SN6A 5CYPA 1F2TB 2VPPA 4GMXA 5KSPA 5LD2C 1AGPA 5DLQC 1G8PA 5H8WA 2O8FA 1HURA 1G41A 2FX3A 4KFRA 3OHMA 5FBLB 2Z5FA 4C0LA 1UBEA 3VX4A 4FCWA 3MLEA 1EFRD 1I2MA 1U9IA 3D8BA 3R9WA 1UF9A 3HPRA 3KDSE 4ARZB 2VF7A 5C1BA 4QNMA 1MRSA 1AS2A 4Q21A 4TMWA 2VP6A 4I1OA 1Q1EA 2R6GA 4M53A 5J4HA 4EPRA 3ETLA 1S3GA 1G18A 2CBZA 4G5QA 3W6PA 3ZZTA 3A4MA 1PUJA 1E1QA 3ZS9A 3WY9A 2ZJOA 4PC6A 2XEXA 2YZ2A 4NKRA 1ZCAA 3EA0A 1G3UA 3W90A 1YZUA 2BMFA 2E9SA 2C5LA 2V7QA 2OM2A 1MRNA 4I1SA 2EU8A 3LQRA 4Z54A 2ATXA 4DT1A 1AN0A 1GKYA 5D3QA 2ZAMA 4GOJA 5BYJA 4AIIA 4QHTA 3K0SA 1G3RA 3FVQA 2IT1A 5JFGA 1OHHD 1C1YA 2PT5A 5BN3A 1KI9A 1DAHA 2RH5A 3CO5A 3CRRA 4L16A 3SOPA 2WWHA 1H8HD 2QE7D 3UG7A 3T1OA 3OEEA 4A2QA 1DBSA 2P6NA 2OUKA 1MT0A 2GHIA 4LJ9A 4TT3D 4DLSA 2CL7X 1E1RA 4LPSA 5EQTA 2UKDA 3RS4A 4KI0A 4O2RA 3QXHA 3NWJA 2CVFA 1AKEA 4BFSA 2CLCX 5AWFC 2ZE7A 1RC8A 2CHGA 2YYZA 1VIYA 2VHUA 3I73A 1W5TA 1LNZA 4NCKA 4PPNA 2JLXA 2FU5C 2ZJBA 4KXFB 4PHGA 1DG3A 2Q9BA 2WMOB 5CJ2A 2IL1A 3DZ8A 2CK3A 3I62A 3BFVA 2P67A 3IGFA 4XTCS 4BLPA 2D4HA 2IWRA 121PA 4KSCA 4BRUA 5CK5A 4WA7A 4TZ6A 4HLUC 4IHQA 4TYWA 4CIDA 2WWWA 4XJXA 2ZROA 2OAQ1 3K0FB 4HUTA 5KSZA 2VO1A 3LY5A 2HJVA 2NG1A 4C7OA 2GCNA 2IYQA 1KNQA 3RC8A 2NPIA 2GWHA 3B9QA 2EFEB 3HYTA 1DS6A 2NMVA 1CJUC 1UPTA 4X8HA 3F8TA 4B32A 3VKWA 4BUJA 2WKRA 4NTZA 3U44B 2CDNA 4AURA 3GFTA 1JEDA 2J3EA 2OSBA 4BFZA 5JEDA 4JKIA 4PANA 3BOSA 1KGDA 5IRCD 1AS3A 1W0JD 4PFSA 1A5TA 2H1LA 4NHOA 4TLCA 5FBVB 4DCTA 2QORA 5G3ZA 3VR3A 3AVPA 2O8BB 2RKOA 1OXXK 3EC1A 5IK2D 1A2BA 1AZTA 4M9SA 2FGKA 1W7AA 1P73A 2CJWB 1W0KD 4JT2A 2CCJA 1G8YA 2DPXA 3IQXA 3SJCA 3PENA 4DUGA 4YMVA 2AKYA 1YHNA 2YVUA 3VU9A 3T5DA 3ZZ0A 1JQLB 2QP9X 3FGNA 2DWPA 3WMFA 4DLZA 1W2HA 2GESA 3RS7A 2F55A 2FFQA 2H16A 2ONJA 3TQFA 1K6MA 4L8GA 2R44A 3B1XA 3R7WB 4RD1A 1CBUA 1DAIA 4BLRA 6Q21A 2C98A 5FTLA 4W5JA 2UZIR 3TLXA 1L7VC 2J0VA 2G1KA 3CIOA 2GBLC 2JLYA 4CEIB 1G4AE 1QG2A 5CB6A 1XXHB 3TSOA 4TTQA 1CKEA 1HYQA 1Z06A 1G8HA 4MRPA 4JBWA 2ZTSA 3FMFA 3I8XA 4M1TA 3UMFA 1JJVA 2B92A 2WWYA 2IS1A 4LPKA 3RANA 2OXCA 1E79D 5JJLA 2V6IA 4WIAA 3R9IA 3GLFB 4EIWA 1F2UB 1TUIA 2ORVA 2R9VA 4F4IA 421PA 1XTJA 3OE7A 4HUQB 2WWXA 5J4LA 2EFHB 2YWFA 4FI3C 1SVLA 4P3YA 1HY3A 4FMCF 4PSKA 5JLJA 4MYTA 1XD2A 3G0HA 2WKPA 3GLIE 3LV8A 3RRYA 3TKLA 4DDVA 2WJJA 1RW4A 2C03A 2QRNA 3GFPA 4J0QA 1KSHA 4Z1MA 4D0GA 4D81A 2J7KA 1M74A 2CVHA 4DLWA 2YOHA 1XB2A 2KBFA 4GL2A 2XSZA 2WKQA 3QBVA 4ESVA 3REGA 2J0QA 1RIFA 5EXSA 3A1SA 3AVYA 4A0HA 1TPZA 1P4SA 3AVQA 5DN6D 2ERXA 3DMDA 3PUZA 1FQJA 1BOFA 2RGNC 1FTNA 1UKVY 1KJWA 2OBLA 4D0NA 2ZU0C 4JIMA 5CDFE 3K53A 4K81B 4ZDKA 3FWYA 2H18A 3DZDA 4D25A 1OKKD 2V4ZA 2C95A 2ZR0A 4M1KA 2B8TA 4Q5IA 1MOZA 1VECA 4V0KA 5EE1A 1OIXA 2RHDA 3B1YA 2Q6TA 3DKVA 3DO6A 3PJRA 4LCBA 1RYHA 2KE5A 2O8DA 2Z0MA 4BFWA 2AK2A 1CR2A 1KK3A 1EK0A 3QKTA 5KDLA 1KSFX 3PUWA 3IO3A 3ADKA 2G83A 4ZDWA 4A82A 3ZYCA 1Z6YA 2VF8A 4MRVA 2AHOA 2MSDB 2JJ1D 4M1YA 1HE1C 1T8UA 3RLFA 1S2MA 4LJYA 5C46F 4E5UA 2FN4A 4I1UA 3QVUA 4G5GA 1CRPA 4MKIA 1SXJB 1GM5A 621PA 2WAYA 1ZUNB 3K70C 3R8FA 2QPOA 5K8TA 2OLJA 1S9HA 2HT1A 1B23P 3EPHA 1NI3A 1VG1A 4JZKA 3PUYA 1NLYA 4YC7A 4TYQA 5EUQB 3LBNA 4URWR 5KSYA 4GRAA 3RS0A 4CRWB 1E2HA 2QAGA 2G88A 3W5JA 3EAQA 4P33A 1YJ5A 5AJWA 4GMDA 5KYKA 3QPWA 4DCSA 1IY1A 1IOZA 1NKTA 4DCVA 4RKFA 1FUKA 3P4YA 3MMPA 4UXHA 2HYIC 2BMDA 1GZSA 1Z6AA 1XP8A 3LAWA 4KAXA 5FOTA 3U7HB 1ELOA 1AS0A 3VKGA 3VKHA 3CF0A 1Q57A 1T6NA 2GEUA 1IXZA 4D6PA 4D82A 5FPTA 5TARA 5DI9A 3IEVA 1KHTA 1FZQA 3CF2A 2PEZA 3QG5A 3EC2A 3EZ9A 3SQXA 4JLPA 5FOUA 2AL7A 2L0XA 2OILA 2O5VA 2XAUA 4B2IA 2X2FA 1L4YA 1YR9A 1Z28A 3IQWA 3LW7A 3HU3A 4Q02A 2GILA 4BEBA 4DLRA 1KSGA 3WP0A 4CEJB 3QPUA 4P4UA 1DG1G 1G3IA 3EZ7A 3MD0A 4E09A 3OIWA 1NG9A 4IVQA 3A1TA 5F9FA 5EP1A 4TQ9A 1VKJA 2HLDA 3MJHA 1TL7C 1SULA 3SS8A 3KJGA 3GLFA 4ZI2A 2O8CB 3AF3A 3LH5A 3Q5DA 4HB3A 4HUQA 4JVLA 4KLNA 4M21A 4RJLA 1S1CA 1S4QA 4EPVA 1XCMA 3TAUA 2V3CC 1FP7A 1JQJC 4DXAA 3I5YA 1JNYA 2AFHE 3UXMA 4DWJA 4KBGA 4RD0A 4A0GA 3CNLA 1ZNYA 1Z0FA 2IC5A 3K1JA 3A4LA 4Y0AA 1G6HA 1E2EA 1SXJC 4F92B 1GKIA 5AUNB 1CP2A 2QTVB 3AP2A 5FPHA 5EE5B 2ZPTX 3PG5A 3F5FA 4XWKA 2JJ1A 4ZPXA 3UWKA 5JHHB 4WVFA 3TQCA 1ESNA 3RRNA 1WB9A 2D2FA 2IXFA 4EFMA 3T34A 5L3QA 2JATA 3D3QA 2O8FB 3QKSA 2QBYA 1QHIA 4Q1BA 5FPSA 1C9KA 3O8RA 4OKSA 4CGZA 1E0AA 3EIHA 4FMDF 1N6OA 5FTNA 3WYAA 2W6ID 3H84A 1OB2A 4UNPA 5H1YA 2WHXA 2ZI9A 3QBTA 1XDBA 4B73A 4ON9A 3CRW1 1NN1A 3QJYA 1NN0A 4P4SA 2WV9A 3VNVA 1KMHA 3IIMA 4PPFA 1SKYE 3GLGA 2LWIA 5JS8A 2YV5A 1E0SA 2H17A 4BFVA 4PAOA 4TLBA 1Z83A 3AKCA 4B3GA 1XTSA 1YZTA 1IONA 2JDIA 1TU4A 1YZGA 2XXAB 2VSFA 5EXTA 2CXXA 2IYSA 3M6AA 5EZ6B 4A6PA 2ZRGA 4LUCA 3EZ2A 1GL6A 5KTYA 2E1RA 4EPXA 3GLHB 1GKUB 3W3ZB 2I4IA 4YMSA 4Q48A 1TQ4A 2C04A 4OJQA 3VHXA 3GJ5A 2A3RA 4GPTA 4XVRA 3ZZUA 1KDRA 1GUAA 4M1MA 5J5CA 2WSSD 4URZR 3PXGA 1AJEA 2QMUA 2A78A 3LNCA 1RRPA 4KV9A 4P4TA 221PA 2ZS9A 4JLKA 4ASUD 3PCRB 2ZSFA 1TQ6A 2PBRA 1D5CA 3MGCA 1X8KA 4Q7MB 4Q1CA 4DCUA 2W2TA 3CBQA 5LB2A 2F6RA 4IXMA 4HLDA 3PEUA 2ZXUA 5IHPA 4MRRA 5KDDA 4F4CA 1R10A 2Q9CA 4G0NA 4JLAA 3EPLA 1EFCA 2V8OA 1YZQA 4JBXA 1VPLA 1N2CE 4CW7A 1II8A 3OIYA 3NIBA 3U3OA 3IKJA 1GRNA 1ZIOA 3AUYA 1TADA 1CLUA 1S0UA 2ZUDA 1ZM2A 3MG9A 3U3RA 1RRCA 2W2VA 1FTSA 3B8HA 4IW3B 4QFMA 1LVGA 2JIZD 3B60A 2EWVA 3I32A 2KB0A 1H8ED 3AVTA 1AIPA 1W47A 1YR6A 5A4JA 1TEVA 2CLDX 3DL0A 4PZZA 4ZCMA 3L43A 1GAJA 1HT2E 1YRAA 2W00A 1EFTA 1WDTA 1JXOA 3EXAA 1T5LA 1E2PA 1G8GA 1R8QA 4Q7JB 3MWJA 2N42A 3REFA 3EPKA 2BM1A 4CVNA 2JEOA 3O8BA 2ODBA 1BMFA 4HZUA 4UNQA 1MV5A 2HEIA 2BMEA 1VTKA 4A9AA 4BE7B 3KQLA 2DR3A 4ARZA 3IHLA 1OH6A 3QQ5A 4BLSA 3WMGA 3HYRA 1G3MA 3KKOA 1T0JB 4OK3A 3AKEA 4D2IA 4LJ7A 4P31A 1UKEA 3O47A 2WICA 1X1RA 2ZSBA 3Q9LA 1E9BA 1ZNXA 3IPYA 2I3BA 4KODA 5E3HA 3A1VA 4JYCA 3VMFA 4DVGA 4DZZA 3KXLA 4HAXA 3KTAB 4MDEA 4NZYA 2ZSDA 2QMOA 3B9PA 1KI6A 2AFIE 3CWQA 3R7WA 3CONA 3GLFE 5DO9A 4QM6A 4L15A 4OBEA 4Q01A 1NN3A 2IYVA 3KJEA 3DDCA 1H8HA 2JIZA 3VX3A 1XD9A 2ZYVX 2R6FA 2Z4RA 4JJKA 2IUUA 5J4KA 3ADBA 2OHFA 4FW9A 5D3MB 3QKSB 1GRRA 1GG2A 2FOLA 2ZI3A 3MJRA 3ZVLA 2A2ZA 3RSOA 1P7CA 2CNWA 1P75A 1DAGA 4LI0A 3OFNA 1E6CA 4TT3A 2KI5A 5GJVC 5ELXA 2XTZA 1G19A 4JLJA 3U7EB 3QY0A 5FOSA 2GBLA 4A0RA 3KTAA 3NC1C 4A8JC 3C5HA 1MO5A 3QSYA 3CZPA 5CM9C 1KI6B 4JMPA 5HCNA 1G17A 4HZIA 1XTRA 1E4YA 1R0WA 2GJAA 5CIWA 5B64A 4NCNA 3TGPA 1WCV1 2OFXA 4LGMA 4NYMQ 3SZRA 2XNDA 2HCJB 1Q1QA 1M34E 3ZIAD 2CMKA 1NBMD 3VR5A 1NMYA 4D4KA 4DCNA 1QHSA 3KJHA 2RGXA 2IYXA 4N0DA 1DO0A 2EYQA 5EE3A 4LWZA 8OHMA 3RDPA 4C7OB 4DB2A 2IX3A 1MABA 2DFLA 2H8KA 5FL7D 3B6EA 1GL9B 1JXMA 3THOA 2J87A 5BXQC 2QEQA 5SZIA 1XTQA 1P72A 1I4LD 4POAA 3VTKA 3NVAA 3U44A 3ZLJA 3MWLA 3A1WA 4ZDIA 3SFVA 3AF0A 5G53C 3O8CA 4W7SA 4ZCIA 1JEEA 1HTWA 3VQTA 2WJVA 3SJZA 1S1MA 4BZPA 4GNKA 4BGDA 1M2OB 1Z07A 1NIPA 1NMZA 1G20E 4HEJA 3JZAA 5FUWA 1HV8A 1CJMA 2R62A 3Q7PA 4PC2A 1F3OA 2G1JA 2J46A 3ND9A 2CJWA 1KO4A 1Z0IA 5FBRB 2XOKD 3AF2A 1SVSA 1SXJA 4NONA 4WAUA 5EP3A 1I4TD 2ZJAA 2IXEA 3E1SA 5GJCA 3KQKA 3VNUA 2IUSA 2Q21A 4LHWA 2F7SA 4JLVA 3A8TA 1QHHA 3SR0A 2QGZA 1E3MA 3B78A 1R2QA 3I61A 4RZUA 3B1VA 1N0VC 1VHLA 1NVWQ 1Z0JA 4IDHA 4TTRA 4XSHA 1E9AA 3ZD7A 2E87A 2JLQA 3T15A 4U02A 2OBNA 4R98A 1P2VA 2FSIA 1FMLA 3CH4B 4ITRC 3N2EA 4M9XA 4MYHA 4OI4A 5JEEA 2IYRA 4LZZA 3K0FA 2JDID 1K5GA 3FMOB 3MFYA 4B2PA 4PHHA 5AJXA 3EZ6A 4UXIA 2REOA 3D7MA 3IEUA 4PSVA 1JR3D 4C2UA 4LYHA 2HJGA 2JLSA 2F1JA 2GJKA 3AQ4A 1E98A 1RYFA 2FEOA 2ECKA 3U2QA 4DUGD 2RGGA 3NEJA 2IYYA 1YRBA 3GEEA 2QZ4A 4Q9HA 4ZCLA 3RHFA 4QBHA 4Q7KA 4OI1A 1TAGA 1F2TA 4OYHA 4TYYA 2R2AA 1OH8A 4PHFA 4QOSA 2AKAB 1JECA 2GA8A 2VHTA 1KKLA 2NO6A 1IHUA 1G7CA 1UKYA 2SHKA 3SFZA 521PA 1E4VA 1W46A 4IDQA 3SHFA 3U7GA 2IF2A 4IDPA 2H57A 1D8TA 1XJQA 1MO3A 1QHNA 4RZXA 5FR2A 1F6BA 4Q66C 1RRFA 5KPJA 4R2HA 1IY2A 1E9DA 3TH5A 1I2DA 2G0NA 1AKYA 2ZRNA 3LD9A 1P60A 1U98A 5EXPA 4IOKA 4O0MA 2NO9A 3U4QA 2ANCA 3TSWA 1XCGB 2VP9A 3TBKA 2ORWA 1BH2A 5EE0A 1KAGA 5DNYB 2QM8A 2D74A 2PZGA 3MUFA 1TTTA 3QXCA 2Z4SA 1LB1B 1U90A 2BOVA 2QE7A 2QL6A 3P20A 1R5OA 3GMTA 4TLAA 3TUJC 3ZVNA 5TV2A 1E1RD 2PT7A 1NVUQ 4FMCB 2BEJA 5CIQA 2RGAA 3KX2A 4PAQA 4HDQB 3L0IB 2R6CA 1NVVQ 3SQWA 3IUYA 2H5EA 1M6NA 3LVRE 4HAWA 3R8CA 4DC9A 4E07A 4NYIR 2UVQA 1M8PA 2VSXA 2BKUA 1UBFA 3TSZA 1XZPA 4LHVA 3THWA 1E2IA 1VG8A 2ZJ2A 2WVJA 2G3YA 4EPTA 1UJ2A 2EFGA 4EJSB 3F0TA 4V0NA 3A6PC 2WJYA 2G9NA 3VR4A 3VHLB 3K70B 4TMVA 4E03A 3LW8A 4Q4AB 1XF9A 4HAUA 1FNMA 3QPVA 4EPWA 1T3HA 1ZYUA 2C96A 5GADl 1DAFA 1GRQA 1NLFA 1NY6A 4HAZA 4DIDA 3GLIB 4L4UA 2PZFA 1JAHA 3BB4A 3CR8A 3JVUA 4LOAA 3IIJA 3EX7C 1SKQA 2XB2A 5TB5A 4MUBA 2FSHA 2JGNA 2R6DA 3K0CC 3K9GA 1UDXA 1TF5A 4TLEA 1ONBA 2GK7A 4B6FA 3M4YA 1EX6A 3CW2A 4OHVA 3TAHA 5BW8A 4EJSA 2D06A 3KB2A 3CR7A 4TMTA 4URVR 3BH6A 5LDDC 4M9QA 1PLLA 2W83A 3P32A 4C0JA 1X1SA 2AWOA 2A5FA 3OAAD 5HKKA 1LS6A 3WP1B 4XWAA 3RABA 1DARA 2BMJA 4OQLA 3IBGA 1PVOA 5DYGA 4LK2A 5HZKA 2XJ4A 1Q44A 3R9XA 2PMDA 4LJ4A 1W36C 5DISB 1HQYE 1LV7A 2ZVQX 4KLZA 3L8ZA 1L8QA 3QXJA 3C7KA 5E95A 2C78A 4ZI3A 3OIVA 1PLJA 2WPDD 1EFRA 3BXZA 1DAMA 4A4DA 1UEJA 4KYUA 2CCKA 5IDVA 2V1UA 4Q1EA 4B35A 4V0ME 1KSJA 4LRWA 4S2EA 4HYYA 5L3VA 3KFVA 3T1QA 1IXSB 1XPOA 4DLXA 1Z63A 5F2EA 2ZSEA 4DLVA 4URUR 2ASEA 3N5CA 4DEXA 1HT1E 3QKRA 5KNBA 4Q4LA 3F3YA 2P0EA 2JJ8A 1AZSC 3AP1A 4H1VA 2ZANA 4RVCA 4GOKA 1IY0A 1XMJA 1JPNA 5JRJA 4RCYA 3QKUA 2FFBA 3B85A 2DFTA 2I1QA 1ZW6A 3SYNA 2VYFA 3EWAA 3V9PA 4AC9A 3A36A 4P4SB 2QSZA 3SE0A 1V43A 3Q72A 5SZHB 2FV8A 2ZM5A 2XX3A 4UQOA 4RZ3A 3U4QB 3N70A 1WF3A 3U7FB 2BC9A 2JLRA 5J4VA 2FFAA 3HR8A 4CEHB 1ZJ6A 2OCYC 5GVSA 4AY2A 2WWGA 3SC3A 3PUVA 1KKMA 4WOPA 3V00A 3OESA 4NH0A 4TMZA 3GPLA 4CZ2A 3KKMA 4PPQA 1SVIA 1VHTA 4Q47A 2Q9AA 1E2JA 3UMSA 2WWFA 2PMKA 5TY0A 3WNDA 4C0HA 1RZ3A 1I4DD 1CULC 1ZUIA 4ZIRB 3LRPA 3THYA 5F98A 1SVMA 3FTQA 1ANKA 2ZE5A 2O8DB 1ZUHA 1G3QA 3GFOA 2GXUA 3ICEA 3CRVA 1N5JA 4AKIA 1L2TA 2IK8A 2VSOA 4TL6A 3TRFA 2HXSA 4RY2A 2ZJZA 1N6IA 1YVDA 1X6VA 4TN1A 1E1QD 4ZKDA 1R5NA 1W0KA 5FTMA 5JWHA 3K70D 4CEHA 4AD8A 3DHWC 4KVAA 1DOAA 1S9DA 1WE2A 3IDQA 4JVMA 2ZAOA 2BDTA 2FG5A 4PR0A 2QRZA 4RD4A 3EWSA 2WOOA 3KL4A 4Q4AA 1IN5A 4YMUA 4TSFD 2FWRA 2ZJ8A 3QF4A 4NE2A 2ZE8A 1ESMA 4WZAE 5HPYB 1EESA 2FGJA 3CUEF 4JLOA 1NG1A 3GLIA 2OXRA 2Q0HA 3WHLA 2ZYWX 3AVVA 1J7KA 2CCGA 3GEHA 4LBYA 4NDZA 2VRWA 3W34A 2OEPA 5C4MA 3GLGB 1YZKA 1KO7A 3AEZA 4JVNA 3W8NA 2V9PA 3N2IA 2V54A 1J99A 2R6AA 1LFDB 1OXUA 2CK3D 4I99A 3QE0A 4NYJQ 2FF7A 2IYLD 3LX8A 1FP6A 4C0QC 4IFBA 4MRNA 2JJ2A 2QAJA 3EARA 2IA5A 4Y0VA 3LVQE 2ZVPX 4PQYA 3QI2A 4PPGA 2ATVA 4GT1A 1G5TA 1W36D 4PHTA 1KTVA 4IOMA 3QF4B 4KYIB 1P9RA 4XIGS 4LY6A 3IHWA 3QVVA 2N1BA 3K0AB 2YWGA 3TUIC 1TX4B 4BPBA 2R8RA 4KITB 1TUEA 5FTKA 2AX4A 1P5ZB 2GEDA 4AKGA 1OHHA 4GOXA 4LHXA 4N0EA 4UKDA 3OEED 1T8TA 4RFSA 3DPUA 2O8EB 2MMCA 2J0UB 1AQUA 2B8WA 2BEKA 4DDTA 4DJTA 2ZUCA 4MYUA 3RC3A 2AK3A 3RWMB 4F7WA 3SBDA 4XVUA 3CX7A 2O0KA 3QXXA 2WMNB 3BORA 4II7A 5CLLA 4JJZA 3U3MA 4OHZA 2XB4A 2PL3A 4HB4A 5G41A 4O25A 5B57C 1MO6A 1E9FA 2YOGA 1GSIA 1II8B 2QP3A 3AF4A 4QRHA 3MWKA 5LPNA 5EE9A 4JBYA 2W6JA 3B7GA 3KB1A 1R5BA 4B48A 4FMDB 3GJXC 2X19A 4C9BA 1QDEA 4ACBA 1E32A 1T0HB 1E2FA 4NYJR 1A1VA 1YE8A 3X1YA 3G5UA 3WYFA 3MSXA 4JL8A 4OJKA 2XSZD 4YDHB 3SEAA 2OE2A 5B2ZA 5JI3E 2OBMA 3NDBB 4BZQA 1NY5A 4MGZR 3FHCB 5GVRA 1XEFA 5L3RA 4B3FX 5CDFA 1YQTA 2BWJA 4JKYA 2C9OA 2NO1A 1CXZA 1EFUA 5FPKA 2GJ9A 1CJTC 1COWD 1XD8A 1GDDA 2HCBA 2GCPA 1H65A 4V0LA 1GNPA 1NSFA 3LDAA 2B21A 5G3YA 1COWA 4YLGA 1V5WA 3PR1A 5FL7A 1KI7A 3OE7D 1DAEA 4UNSA 1E2DA 3AKYA 5TVKA 5IF9A 1ZD1A 2GXAA 3BD9A 2BVNA 3X1XA 4KFUA 2J59A 4QC2A 1F2UA 4MDFA 2QU8A 5BYKA 2HDNB 2I1VB 4IDNA 4K8OA 2ZRHA 3R20A 4NL4H 1A82A 4XD7D 2GDJA 5AUQA 3KKQA 3CRQA 3KKNA 3LBIA 2H92A 3FOZA 3T12A 4GDFA 2ZRCA 4IXNA 2BIFA 2W0SA 3K9HA 5FUXA 3B13B 3E70C 1A2KC 3FKQA 4LYAA 1DTSA 1D9ZA 2GZDA 2BBSA 1JPJA 4C0AC 5D3MA 2Z83A 4B2LA 3KXIA 3MCAA 4UNRA 3V4RA 4KU4A 1GNQA 2D7CA 2QI9C 2YJTD 4UJ5A 2Q3HA 2B7CA 4OHWA 1OXTA 2EFDB 3C14C 1NL3A 4IRUB 3B1ZA 5FUYA 4L9SA 3WNCA 2GXSA 2GRJA 1WRBA 4YONB 1T5IA 2IW3A 3KFXA 3AVOA 1QHHB 2JLUA 1VIAA 1AK2A 2HXYA 3U5ZB 5KNDA 1MKYA 5E7MA 3U6BA 5DIFA 1QF9A 3Q85A 2O52A 4RFVA
chains in the Genus database with same CATH superfamily
5AVRA 4NESA 1TCBA 4FM9A 1GJRA 4NPAA 2IS6A 5EJMA 2QAGC 3NBFA 5DGCA 1ENPA 4QYIB 2HWKA 3EXHB 1P61B 3OPQA 4AJ2A 3DOEA 4M8KA 4LN1A 4OQXA 4I7EA 5IZ4A 1WF6A 1IDOA 2JJ2D 3CINA 1FLNA 1NP6A 3I37X 2GMWA 1KY3A 1VI2A 4NK5A 1J23A 2E7ZA 2NTEA 2R86A 1EDOA 1EM8B 2AZTA 1GPJA 3NANA 3R3UA 4N18A 1H2AS 3OZXA 1ULTA 5CT4A 3TMKA 2VXCA 5JCPA 1F6DA 1AQLA 1FNNA 2OV2A 4UEQA 4TTIA 3LBAA 4QKQA 1YQUA 4Z8YA 1E5LA 3NKVA 1T24A 3VR1A 4QG3A 4XX0A 2ZIXB 2TMGA 3A04A 5AOBA 1YL5A 2VJLA 4ER0A 1N3BA 3ZK9A 4K40A 3PTAA 2PHZA 4TN5A 2HWUA 4N5MA 4A8HA 4MWEA 4B6OA 3PR3A 2P0AA 4B6EA 2VQ3A 2QNBA 1NOIA 5E6SB 3H3XA 1XTIA 2JAHA 2WSMA 4B3XA 4CI9A 1RWPA 4Q9JA 1T2DA 3UPUA 2J07A 2Y0PA 5KJFA 1GRCA 2V96A 5DHTA 3GG2A 2PL5A 1Y3FE 4JI1B 2OK7A 1KAEA 1BTOA 4BKRA 1RKXA 1JFFB 3A3KA 5FNVF 3QFFA 2W70A 5FUMA 1TEXA 5KVVA 1HTBA 4WBSA 1S5PA 2I4LA 2RJOA 5I9BA 1DG9A 2JI4A 3SS7X 3RT9A 3UK6A 2H63A 4IEFB 3RRMA 4C4SA 4QJIA 3AWIA 3C3DA 3HR7A 1NNSA 3VR5H 4PQFA 3DLPX 1S8FA 3VV3A 2P2SA 2QOEA 2WWIA 1PTKA 1TNDA 4JXJA 3A06A 4ABYA 4BB6A 5C3UA 3FB4A 1BDHA 4JSRA 2V7QD 4WN9B 1WDMA 3O0DA 2VH5R 2XITA 3AP3A 4H7JA 4LS3A 2QNRA 5CITA 3KUXA 3O82A 4N1AA 4JH0A 4JT4A 2LZ0A 1FYVA 1GIAA 2A59A 1P9WA 4M4SA 4BZXA 4ILEA 3R9XB 2NVUB 3T9DA 3B6ZA 4HQRA 4CCAA 1P6UA 5JD5A 2LIPA 2Q5HA 4HJXA 1GZ6A 3BJIC 2AJCA 4HDNA 1M1NB 2PMBA 2H06A 4JQOA 3GOQA 4YHBA 1E1NA 4Q4HA 1CFJA 1PDWA 5H0IA 5KS2A 4PNPA 5D5HA 5JH7A 2QW1A 5BWMA 2XXBA 2OMEA 4XTRA 4US1R 4B43A 3SIWA 4B1FA 3H1TA 3IUJA 2PBLA 3DUFB 3Q4GA 4MS1B 2RAFA 3ZD6A 3A1FA 4L9WA 1QOPB 4M7RA 4BKPA 1QHYA 1YMUA 3BE6A 1ZAYA 1QGYA 5FAKA 5B7QA 1BQEA 1QFSA 1YZYA 2C2HA 5CK4A 4AMBA 2DFNA 4NV1A 5HKKD 3RBXA 5FI5A 5SZJA 1JVSA 4CCWA 2LKDA 2H4XA 3QX7A 1FNSA 4MWTA 3ENZA 4OHBA 4WCFB 1IG0A 1O95C 3HSYA 1I80A 1D9XA 2I67A 3C16C 4Z51A 1DO2A 4IIFA 3HWX1 2SNIE 4NBNA 3FTFA 1AUPA 5CX1A 3TRDA 2OVFA 3SXUB 4PU0A 3UN1A 1ODTC 3ZU5A 3ECCA 2ADFA 1K6XA 3U49A 2B94A 2A9PA 3DOIA 3DBLA 3OE5A 3OUUA 5LP6C 2PMCA 2VEDA 4MKGA 4B3TB 1C7EA 3D7RA 3WB0A 3FCSB 5DSZA 3VO9A 4HNTA 3HU2A 4F12A 4PBTA 1Y98A 1DJPA 4LYDA 3G0OA 2BP7A 2XT9A 3PGXA 1M8GA 2PX2A 4BMOB 2PE5A 4Q19A 1E1YA 3R3ZA 3MCUA 3VBEA 2DR2A 2PZLA 2BSQA 1ZWLA 2EWWA 4C2TA 3NWOA 3VR6A 1U04A 4A10A 4LDRA 1QV9A 1TYDE 2FSGA 3SY8A 2FPKA 2XRFA 4YAFA 3VM6A 2Q5CA 4KQCA 1T34A 2BHNA 3I5AA 3WWDA 2JCSA 3G5LA 4DZTA 2O8NA 4A6XA 4F2PA 1U0FA 1ZJ5A 3HN2A 5ECGC 2J9YB 4HLNA 5FOVA 3KR9A 4C3OB 1WHSA 5KOYA 4FNMA 4H6XA 4GUAA 3L79A 1RJ9A 3BICA 5CLQA 4YQZA 1H4SA 2YCLA 1MDBA 3HHEA 4OSEA 1YIAA 1X7HA 1NZJA 4CUJA 4N7JA 4A5SA 5AJHA 4R51A 3QV1A 4DEYA 3T3IA 2HSJA 2Q2QA 3LX4A 7MHTA 1ECGA 3L7KA 3EA5A 3QLUA 5CB4F 3G6WA 3DT9A 3TZLA 1QO0A 2D13A 1LCIA 3TKYA 4B7CA 3V4FA 4DDWA 1XLUA 3UKDA 3ZCSA 2KJQA 1YGPA 2JCXA 4UZFA 2DU8A 5B37A 7ADHA 1V2GA 1FFYA 4HD8A 4FEYA 4W63A 4F3YA 4HDSA 3C3KA 4UTNA 4G01B 4GYKA 4HNAA 3UG6A 4RHUA 4E6EA 1GTZA 4LNUA 1XAGA 3PHBE 4GICA 3FTCA 2XQFA 3ICOA 4MR8A 2X86A 2ZIWB 1C0LA 1NLZA 5CGZA 4DSNA 3T1YB 3EYAA 1AKQA 1XDGA 2C3OA 1AZLA 1A77A 3QQPA 3X2FA 2JI9A 1B42A 5EXDA 5AI4A 1BXZA 2B5VA 1YCGA 1X9GA 5TF4A 3H04A 4MVJI 3QLJA 1Y6FA 4NXNB 3PHLA 4JYBA 4H3HB 1L7DA 3UJ8A 2RB4A 4TPKA 4TSFA 4ESEA 4RSRA 5J5VA 2FRVA 3OIFA 4M6WA 3IDAA 1NSTA 3KSDO 3MTDA 1RHUA 3VUEA 3HB1A 3S6JA 3AR6A 5DDIP 4RLQA 3S5JA 1FQWA 1HKHA 4E2FA 3FMGA 4AJJA 5BPHA 2VCHA 1MH1A 2X6RA 1VIVA 1E7QA 3FCXA 3OQVA 5AK0A 5K8LA 4QDUA 2AMLA 1YTLA 3ZDQA 4M1EA 2G6TA 4NXMB 2AC4A 3I04M 1W44A 4N3CA 4WUTA 1FX1A 3IQHX 3IO5A 3WB9A 2V4MA 3FKJA 1LDGA 2I76A 3ACBA 4CV2A 3WNZA 4ZP1A 3EXEB 3PYXA 4GNRA 2W71A 3SU8A 1P77A 4RV4A 3RODA 4DRZA 1JU9A 4OAQA 1XQYA 2J4FA 9GPBA 2WDZA 3JW8A 4FSXA 5AI9A 4RL4A 2R8PA 4OATA 3NIFB 3NKLA 4X93A 3OTIA 4HDOB 4RKQA 2Y92A 1Y4UA 4Q9IA 1W29A 1PQPA 2J5XA 2VDKB 4MKFA 4CQLB 3BBLA 4MVJP 1Y6ZA 1XJCA 2PX0A 3ONDA 1C3LA 1D2EA 1YRHA 3ENNA 3ND5A 3PQCA 1PJ3A 2ZWOA 4ZIRA 3HXPA 2JLBA 4NBTA 3T0GA 4DLYA 3UZUA 2FE4A 2V7WA 5FR1A 1U7PA 4F06A 4AS3A 4PY2A 4AO7A 3N5KA 1OPXA 4PZLA 2Q5IA 1GA4A 1YIDA 1G4UR 5BO5A 1II9A 4MWDA 4R8KA 4A6DA 3D3EA 3TK1A 4GQIA 1BHJA 1XG5A 1GAQA 3VPGA 3FROA 3HKEA 4M7PA 3JXEA 1G2QA 3PC3A 3UAWA 1T35A 2C7GA 2F3QA 2WAAA 3H2SA 4BYMA 5KO2A 1UZMA 3DCYA 3KEGA 3OTGA 4QHYA 3AM1A 3EIEA 4KO2S 3O21A 3FVVA 4J7XA 4BQNA 2QXTA 4U7HA 4B46A 4DV5B 5LKAA 4BKUA 2BCJQ 1DAOA 2HFKA 1R3DA 3BN3A 2C4WA 4Q3DA 4MH0R 1G21B 2PPLA 1LDNA 4HOYA 2D2VA 3M3HA 2FZEA 1N5MA 3LYAA 5EI5A 3EXG2 1F14A 3GR6A 3MWDB 4QTZA 2V6BA 5KWIA 3WGUA 4QULA 3N74A 1ULAA 3EMKA 2GH1A 3H4MA 2FZKA 1WMSA 3VC7A 2D2EA 3GDWA 2G17A 4R1OA 3S28A 2P2YA 1K08A 4W9RA 4FNOA 4G2NA 4X9XA 3UJBA 5ICMA 4MR9A 4F93B 1J0CA 3M6VA 3ZE6A 5G02A 2HCTA 1MAAA 1A95A 2DT5A 3HYSA 3BERA 3QK7A 5KQLA 1XNRB 5F9HA 3GH1A 1U8AA 1THZA 2ZIAA 3I4LA 3ZIDA 4IUYA 4E1VA 1MF7A 3O9VA 1NF9A 5H4GA 2H52A 2X5XA 3C1UA 3W5IA 3AF1A 3AR7A 2Y6UA 2I34A 2ZRKA 3HI4A 5IAAA 5IT4A 2PUVA 2ZTVA 2CV2A 1XMPA 2QW0X 4AJPA 1ND6A 1QGUB 2FZ4A 3ZJYA 1VCNA 2NZ8A 4PEVA 4X7RA 3Q3JB 5AW5A 4BVFA 4FCTA 5DM2A 4G1UC 4E4RA 5K0ZA 8MHTA 3FUTA 2PYIA 2X9GA 5FOWA 2P30A 4YACA 1SZPA 4B6QA 1XF1A 1J33A 1NOJA 2PCJA 1V0JA 2BBTA 5ECDA 3TCKA 4TZ0A 4PFKA 2OESA 2RARA 2ZDHA 5B3JA 1KQPA 3NBAA 4M1SA 4IGAA 4IIYA 5JRZA 2YNMC 3N53A 1I3MA 1YJCA 4P08A 4KC0A 1HZZA 3K9BA 4JZYA 2A7XA 4RPJA 5DIZA 5DXFA 2FRDA 4I14A 3KU1A 2F2TA 1EGAA 3QF7A 4IDBA 4WNCA 5BUQA 2W6JD 5JNWA 3GFVA 2ZVDA 3BWYA 4AI6A 4OI2A 2QUZA 4MPDA 3OM0A 3WZ2A 1M8FA 4CMIA 1LNQA 1MCZA 1QRAA 5EXEA 1WOMA 2X7XA 4LXTA 1GNRA 2OK8A 2R47A 3A4NA 2O2XA 2YIDA 4ZEVA 5B4VA 5L8VA 1ZR2A 3EN0A 1Y37A 1ZMRA 4U4AA 5AW7A 2GA9A 4B82A 1ZC3A 3NMUF 4Y1FA 1IYZA 1ZGHA 1P18A 3IERA 1IOVA 5K45A 4QBGB 3FCEA 4HEA6 3U9TA 5ALSA 2APJA 3SZ3A 3RYTC 1VSVA 2CE7A 2F59A 2FUKA 2PV0A 3JS5A 4V0MA 4BPRA 4TWZA 1C9EA 1VLMA 2O2SA 4R9RA 3JD0A 1CJCA 1X3SA 3AU9A 1T1RA 4B4DA 2JFPA 1RBQA 5LN1A 1KEUA 4BMCA 2Q6OA 1CVRA 3EULA 3WLMA 2YHIA 4QELA 2JD2A 3E18A 3RC9A 1AK9A 4KIFA 3DP7A 1YHZA 4ZD6A 1GGHA 4QGHA 1VFPA 3HB9A 3UAGA 2CFOA 3E1KA 3IQFA 5AW6A 2FPWA 2XBLA 4DARA 1PZEA 1V9LA 4EH1A 5A62A 4XDYA 4D4MA 3I3SR 4BFTA 4EG6A 2X1LA 4JYPA 3JSAA 3SF8A 1EWTA 4P81A 4D9HA 5HRCA 2RCNA 4J1TA 3K6RA 4HDMA 1Q20A 4RXTA 4G4IA 5CAEB 1G60A 1BVUA 1ZA2A 4RF2A 3T3MB 1UAYA 2C7BA 2V45A 1VC2A 1J9ZA 2ODEA 1TJNA 3TMAA 1SWVA 4IKPA 2IZ7A 5E4JA 5EOVA 1YDMA 4BQSA 3I05A 3ROQA 3O2NA 3EUWA 1U0TA 4MUKA 4BIIA 3PGLA 1OFHA 4RD6A 3KCNA 1GGFA 4TL7A 5LMCA 2XUGA 1DIAA 3DAFA 4RADA 2RJ3A 1HTTA 3HKEB 3T1VA 3WL5A 1NQUA 1GD1O 3NGXA 3FUXA 2W6CX 3DUWA 4P32A 5GONF 3PDUA 1UMCB 5BSTA 1IRXA 1OZFA 2WFAA 5KZMB 4RACA 1ZVQA 2QVGA 2PX3A 4YASA 3S8MA 1LBIA 3I5XA 1NWCA 2F4NA 3PPXA 4RD3A 4MS1A 2GZ3A 2VNKA 1KYWA 3FIJA 1G5RA 3H5VA 3LQ1A 1D1PA 5L6LB 3BB1A 3WDSA 3TW0A 1JSLA 3BXXA 4M49A 3UJ9A 2CF6A 4Y6SA 5C7OO 2V55B 4QODA 3QVTA 4IJ5A 1N6PA 5DM1A 4DPKA 5CB4A 2PRKA 1GYQA 2IQ5A 5HE8A 2PH5A 3ZCRA 1U5AA 2GNAA 2TECE 2XVAA 5JRDS 1G8AA 3SHQA 2FMIA 2NV2B 4KPFC 4AK9A 1P6QA 4MEJA 3R75A 5I7EA 4FS8A 1HDEA 3FX2A 3RS2A 2I3ZA 4W5NA 1MRZA 2EFCB 1US8A 2I33A 2XXAA 3MC1A 4K3UA 1QVRA 4WZAA 4J4BA 2PYZA 2VHYA 4ID3A 1A9TA 1M75A 2J6IA 1U8ZA 3DZCA 4OJYA 1VIMA 4O2AF 4TX1A 4XH9B 1RKQA 2W8BA 2IPLA 4KGVA 4OK5A 4B3IA 3UA3A 1KOFA 3RTCA 2CE2X 1U3DA 3V7YA 1WW2A 1KMNA 1NXPA 3LF1A 2IZ5A 3GJ0A 3OEHA 3CC8A 1LJ8A 5G40A 3WQRA 2EXXA 1JHYA 1NUQA 2B8EA 1VHDA 1UM8A 5AI0A 1UBUS 1X39A 3ZDRA 3NFRA 4WW0A 1NMQA 3ZWCA 4NHEA 1T3SA 3DONA 4FMPA 3ETCA 5GJWC 5JCZA 4XEHA 4YJFB 4HYTA 5HJEA 4QEDA 1R6XA 1VMEA 2IELA 4DSUA 1Y80A 3W9YA 3WGTA 3LPLA 4FD2A 4R8VA 3R4VA 4UVEA 4DSOA 5JFTA 3NC0C 2E4UA 2JEZA 3ESQA 3PLNA 2HV8A 4RPLA 1DEKA 2BMAA 2DPMA 2FSVC 2ZGVA 4EDFA 2PD3A 1Y4SA 3CRMA 1K8XB 4B87A 5KU1A 1FYDA 3WRYA 3I23A 3WV5A 3ZQUA 1HNXB 3I1FA 1HDIA 3L18A 1PS8A 2P6MA 3TNJA 1WVIA 1IZYA 1CUAA 1NJ8A 1UFQA 5DNVA 5ANRB 3TZQA 2AMYA 1E94E 1RJEA 2E6UX 4HWTA 2OCBA 4GBMA 2VJBA 3OA0A 4QHSA 2ESRA 3DYVA 3NORA 1N4AA 3K09A 3BFPA 1NUPA 3F47A 1ZNWA 3NM6B 1R6UA 2FDXA 2WLTA 3HS3A 4V02A 4X1OA 4KE7A 3U4DA 3T5AA 2XQIA 2GBIA 2B2CA 1A5SB 2Q1UA 4TQUS 1KE2A 2WE8A 2XYQA 2JZOA 3M7IA 1M2EA 4JJEA 1R7RA 4LHYA 2C4HA 2HUPA 4Q18A 4FCCA 2A5JA 2BFOA 4MQMA 3W78A 1L7RA 2ZJYA 5EWMA 3MCZA 3E7DA 1IRIA 3CKLA 3EEYA 3NYIA 3V8BA 3R44A 4NJEA 4QU0A 4AMYA 1QBGA 5KCMA 4YWHA 4I50A 3DEFA 3RREA 1OA1A 2B6HA 2RD2A 1T9HA 2VS1A 5BV1A 1DFGA 2CNWD 1X1QA 2XTJA 4I55B 4IO0A 3SHWA 1FJHA 3PZRA 4I1PA 3FWHA 4Q7LA 5DWQA 1PJ8A 1J0BA 3WBKA 2F8MA 1QH0A 4M2LA 2VVTA 4TXMA 3DWFA 5JYDA 2ETVA 1MA3A 3K3PA 4M0KA 5E38A 5ELMA 4C30A 3D1JA 1E6WA 3QYAA 2Z9CA 4YA6A 1QC5A 2NP6A 5PNTA 2PUTA 2QVLA 3BSYA 2QJTA 2HBZA 5I7RA 1MO4A 1G5IA 1CVIA 5BV0A 4IVRA 4RMHA 4HX9A 4UNNA 1LZLA 2IWHA 3W5AA 2G07A 3GFBA 4JV5B 5CX1B 1CY0A 1NF3A 2Q2NA 3GCGA 1MB3A 5JC8A 1A8SA 2HA3A 4ZI7F 3UT0A 2PRZA 2QTNA 2HDOA 2QY9A 4PQGA 2DY0A 4KQ9A 1RAAA 5LQNA 2XKAA 4YJ2F 4AG5A 1T3LA 2G5CA 2VPQA 2GQ0A 4IH9A 2Q7OE 3MS4A 1YBAA 4GZ3A 4LHZA 5LBIA 1KK2A 2P68A 3X3HA 1PJBA 3ZWVA 2J7PD 4MROA 1XTKA 3W04A 1LZKA 3LCUA 1C0PA 2PVPA 2AOTA 3W8DA 4BO4A 1FDWA 2AFVA 3REQA 4IJMA 1XU9A 4FN5A 1BD4A 3A9VA 3DBRA 3SNKA 2IBMA 1TEZA 2N47A 1YAJA 4ACAA 3K9NA 4G2TA 2Q28A 1OREA 3HNOA 3KHKA 4PTLA 1M2HA 4DQDA 4JENA 1E99A 3FXAA 4Z2AA 2HF9A 3DM9B 4JQSA 2J6HA 4ES6A 1NKVA 3BA6A 2W4IA 4TTSA 3VVLA 3PIIA 1J9EA 1KZ9A 2ZK7A 2OCAA 5AJZA 1UFVA 4P8RA 5DHAA 2RFLA 3VU8A 4YAWA 1US8B 4XGIA 1Z5OA 4HDNB 1U3TA 1R50A 3L06A 3UCEA 2AQHA 2A57A 2B9VA 1K7YA 3WWZA 2FX5A 3WAJA 1EVQA 2Y93A 2PM8A 2W48A 3DCJA 3OT1A 1TCUA 2AF3C 5ALFA 5B55A 3DFKA 3JWPA 3HCAA 4I8DA 4N9WA 5LA6F 4DIEA 1XZAA 1NE2A 2UUAB 1ZSVA 5AO9A 4QU8A 1I9CA 4YALA 5EZYF 1L7OA 2R79A 3FPHA 1OFIA 3K1AB 4MGKR 3RYIA 1WY5A 1DRVA 2JHPA 4FN4A 3AY7A 4V03A 3UXEA 2QBYB 1XWIA 3KJXA 1MABB 3DG9A 1MDFA 2CLKB 2PFSA 3MGKA 3AVXA 2R87A 4KQ2A 2X5NA 1KAMA 1ZH8A 1M10A 4LZAA 1J90A 1E63A 5DBEX 1XT6A 1ILWA 1IPFA 4L2IA 4ZVKA 2I8CA 2MSCB 3G2QA 2H1IA 3P5SA 4HWRA 3B1KA 4Y67A 4K2AA 1TK2A 3C39A 3GD5A 4NBUA 1M66A 1YVPA 1NVEA 4E12A 1K1EA 5JSZB 2J0SA 2BFWA 3RKRA 1N0WA 5LA6A 1JDSA 3I9KA 4L5AA 1TZCA 2OFOA 3JQ7B 3W1VA 1E69A 1FFGA 1A2OA 2BGNA 4FLEA 3L4SO 2HLDD 3CB4A 3LDFA 2LCFA 1C3JA 5E9JA 3X2SA 4A2PA 4CMCA 3A10A 2JB9A 4CFZA 2VQSA 4X3PA 5KQPA 4YTEA 1W6UA 2XZLA 1V1MB 4YX9A 1D3AA 2H31A 1QYCA 1FFWA 3Q41A 1K8QA 4PPYA 1I1NA 1KDYA 3RYHA 3ZS8A 1XVAA 3U39A 5KKNB 2Y8EA 1SVUA 3B3QA 3T9BA 4UM9B 2QQEA 2XUPA 3H1GA 1JUDA 1J5EB 1ZVMA 4OMFG 10MHA 3DLAA 1IQRA 1U8UA 3TW6A 1EK5A 3EG9A 2RHLA 4BUCA 4FEAA 1HQKA 3I9V1 5L3SA 4IDCA 1FPMA 1I0LA 4J0DA 2A0FA 1PD0A 3LQFA 4HGOA 3EK2A 3N1UA 3W2IA 1H1TA 4GP6A 1YQXA 2HK9A 1RMQA 1DOHA 3OOHA 4RK0A 4Z86A 1X0VA 4PZ9A 4ZQCB 5UKDA 1KZ6A 2HRDA 3T3HA 3OJWA 2D62A 3DD1A 3OG9A 3WOVA 5YASA 5I5EA 3E03A 3BBPA 4GGOA 1A9OA 5KYTA 4REQA 1Y5MA 3OPYB 1GT6A 1WXQA 4MW1A 3HPQA 3SR4A 2ZQ5A 3ZJVA 2DP4E 1L5WA 4R41A 1AVTA 1TD9A 4Z3KA 4I5FA 5FUBA 2O59A 4G4SO 2CXQA 1QFJA 3VOBA 3V55A 3MS2A 4W1RA 2WIFA 3ESCA 3G7UA 3BMOB 3HDJA 4HAVA 1F2DA 1Y42X 2WU4A 3LYHA 2XCLA 4X65B 1ZWKA 4ZVVA 1W5SA 2QYOA 1E8DA 2RGYA 4LYGA 3D31A 4OVKA 5ALGA 5BXYA 4LRSB 3R8XA 1ZMXA 4I66A 2FCAA 2G7ZA 5E1MA 4G56A 4TTPA 4ZC1A 4WESB 4Y2VA 2H48A 3CWZA 4KFTA 2IXTA 3T06B 3UCFA 2X9LA 3AEQB 2I6SA 2IV3A 1L7PA 4CF4A 2A92A 2J0UA 3TFOA 4IYRA 4G5RA 2QYHA 2YV2A 1BG6A 1U0GA 1C8VB 1RU3A 1KR2A 2P1RA 5COQA 3NIWA 3THSA 5AVOA 1U1IA 3DP9A 2QUHA 4CQMB 1IE3A 1YVRA 3BGWA 2OCDA 4UULA 5E9QA 2VH2A 3CF4G 2VOEA 3WKAA 4B4VA 3Q0IA 5ENVA 3U61B 1FMJA 2BTOA 2GHRA 1J00A 2Z8YM 5DWVA 2ID4A 2BH2A 5AT1A 1B15A 5FUVA 2QVYX 2RHJA 1DXYA 1PHRA 1XYGA 1Y1TA 3HCDA 2Q2WA 4O4JB 2NUTA 3WLLA 4KX5A 2ODWA 4LAFA 3GZNA 1UODA 2O3QA 3BXGA 4UBLA 1MPXA 2YJ4A 1I4OA 3HDGA 2QD2A 4CN8A 1PRYA 1JALA 1IBKB 5CVEA 4B9EA 2PNJA 4M60A 1U6KA 1CW2B 1X2EA 3H6GA 3JQGB 1LPAB 3UANA 4B3DA 2BY4A 1U0NA 3PC6A 4JU9A 4XSGA 4PLCA 2W98A 2OZPA 5CLJA 3OX4A 1IPEA 3BL5A 4RTRA 1U5CA 5KJ6A 2W2XA 2HQBA 3NYWA 1ZI9A 5CB8A 2XNSA 4TV8A 4V0SA 1OE0A 2IU4A 2B2NA 4RVUA 4P3NA 5WRFA 5LP6F 1QCCA 1UK7A 3PQ7A 3R40A 1KE1A 1IY9A 1BHO1 1J2RA 3L0DA 3L8FA 5AKLA 5EP2A 3HCFA 1IBMB 4Q9KA 4YYEA 4NV3A 1HFJA 4AG3A 2YCBA 1Z3CA 2ABWA 1VMDA 2ZR7A 5E8JA 1V8PA 1RVDA 1K8YB 2C94A 2WP8J 4C4OA 4MP8A 3WGLA 1XL0A 4BLOA 4QXPA 5CDGA 1FFEA 3H0KA 4JLNA 2BZ1A 4CKEA 2WHEA 1HYHA 1YRYE 3T5GA 4HO1X 3C3EA 2VHEA 4QTXA 1L5FA 4UU8A 5A5GA 3T1NA 2OKGA 3ML1A 4X7MA 1OTHA 2D3WA 4IJKA 4MQEB 1Z29A 4WCFC 1T6XA 4UAUA 3QEBZ 3JQPA 4FKBA 2A1TS 2EC5A 3R7AA 3SSAA 5DW0A 4YCMA 2B82A 2BFEB 3NAZA 5IHXA 2GZMA 5LQUA 1TU0A 3MTEA 4BX8A 4MPRA 3OH8A 5FF9A 1RPZA 1QVZA 2JRCA 3GFFA 4Z8XA 1UADA 1W85A 4M0MA 5FV7A 2GCOB 5DB4A 1BMFD 4DB4A 1HEIA 3EIQA 1CQPA 2QMQA 1PR9A 3TFWA 2RIRA 1UBCA 4DOMA 1JB9A 3ISTA 2DQKA 3ANYB 1CHNA 1T9DA 1HFEL 1ZXBA 2A9VA 4EY8A 3AEXA 4PXAA 1DO8A 1K7XB 3C6YA 2QDKA 3EGXA 1FFXA 2P2LA 3R3JA 4JFAA 4JUFA 4XAQA 1UM9A 5HGXA 4IV5A 3JASA 3LA6A 3O6VA 4GWGA 5I47A 3JARA 1XMOB 2IHTA 3NHPA 5IK2A 3ZX5A 3IIKA 4TYMA 3S1AA 4HQLA 1WZNA 4HNVA 3PEYA 4YMLA 2CZGA 2KW5A 2HT6A 3H6KA 3LCRA 4E5SA 4JASB 2MSNA 2GKGA 4JI3B 1SOWA 5T64A 5TDHA 4L4ZA 4AO8A 1XAJA 1IQPA 5C3MA 4FWBA 4TWAA 3CE6A 2A9JA 3TZHA 3TX2A 3GEMA 3AHGA 4GBGA 1UT6A 1KFJB 3AINA 3SOZA 3HB4X 4HUJA 4GMHA 3T7AA 3CX8A 5JQWA 3OQOA 1NNEA 4HMPA 3ICQB 5E6UA 1NVTA 1V8BA 2AN1A 2ZYGA 1JU3A 2AXPA 4Q39A 2WOJA 1NW8A 1HUQA 1NBOA 5HR5A 3P9CA 4UHDA 5D01A 3QEMA 1DBRA 4EVRA 3K20A 4XIFA 2WPDA 4HZGA 3WZLA 5AIBA 4B33A 4PFQA 4FP9A 1CP3A 3IYLW 1SELA 3UUFA 5JZVA 2QENA 3JR7A 4PO3X 1NVVR 2BUAA 1U9CA 2CLHB 3K2BA 4G9GA 4N54A 3HADA 1D1SA 3BJEA 1OZAA 3T54A 4EM6A 5HRAA 4IMPA 2WSSA 1CY2A 4MB6A 1VMAA 5E7JA 3S1AB 1RBYA 4GKKB 5EKDA 5K6AC 3E9EA 1HDXA 3TYXA 4RABA 5JXIA 4MXDA 2DPLA 2Y9PB 3LX5A 4PX9A 4QGAA 1RRGA 2C57A 3A6HA 4QO8A 2HAEA 3LDHA 4QAJA 5EQDA 1XDSA 1XJ5A 3TFQA 1OGJA 5GGXA 3OLXA 4R5MA 1Z5WA 3FHJA 3SX4A 1L7NA 1QPBA 1QZZA 4UPDA 2DY1A 2L69A 5ALYA 3LBHA 4J16A 3L5OA 2OAP1 1RAGA 3MTBA 5DMHA 4B3BA 2R8BA 1UZUA 4X60A 1VFNA 2O2HA 4G1FA 4ZJPA 2VYCA 2FETA 4NCIA 3RK4A 3TWOA 1QG4A 4L72A 1FXUA 4HXFB 4FB5A 1UBHS 3NNSA 4TROA 3X1DA 4CMGA 1UXJA 3HV0A 5JMWA 4GW3A 3AV0B 1T10A 5D85A 3GAAA 3HJNA 2JH8A 1EVZA 4GAEA 4UC0A 3RIHA 4RF3A 4W9MC 2ARKA 5CYPA 1YHYA 3G0GA 4IG9A 4IHKA 3SN6A 2VEOA 5KSPA 4YEDA 4EZIA 1YVEI 2ES4A 2QRQA 4MWOA 4NS1A 5IM4A 4C29A 4M54A 4MQFA 1G41A 2FX3A 3TGWA 2O8FA 1T0IA 1YB1A 2RCYA 2Z5FA 3C43A 1UBEA 3AXTA 3KSZO 2YQ5A 3MLEA 1EFRD 3D8BA 2C97A 2M98A 3DGEC 3UAXA 5AFSA 4JBGA 1UF9A 4XDGA 4ARZB 4YDQA 4GZ5A 4RPKA 5GIOE 1XRRA 3FYUA 1UP6A 1Q7RA 2E4WA 4C7VA 1V1RA 2VP6A 3BSWA 2R6GA 3R7SA 2Z4TA 3OSZA 1P8JA 3E4CA 3MWEA 2YJNA 4AZ3B 1V5EA 4PZPA 3A4MA 3PZBA 3QUQA 4EA9A 1NR5A 1QIDA 3IUNA 5AM5A 2ZJOA 2XEXA 4N41A 1ZCAA 3X1KA 2Q0XA 3W90A 2BMFA 2ZB7A 1H1LB 5B7PA 1Y3CE 1MRNA 2WF8A 4I1SA 4PZAA 1TZ2A 2EU8A 1J06A 1UQTA 2FPPB 5L9AA 5KYYA 5TLSA 1O95D 2CDCA 5D3QA 2H59A 3BDIA 4GOJA 4M8SA 1J8FA 1T6BY 2CDBA 2PVSA 4QHTA 1PDVA 3FVQA 4CTOA 2IT1A 2OGWA 1LSOA 2PT5A 2WR8A 4Y6LA 1DAHA 3IPAA 1GPYA 1GY8A 2Q6LA 3CO5A 4YAUA 3DR3A 4N8SA 3G2OA 2WWHA 4R2WA 1JHDA 4HYQA 5AXAA 2ZYSA 4MUJA 3ZDZB 3DDZX 4DAOA 2CL7X 3H7IA 1E1RA 4LPSA 3HVIA 4DLSA 3RS4A 2Z5LA 1RIIA 4KI0A 4O2RA 3QXHA 4JHXA 4BFSA 5ESRA 1YA8A 2YV4A 1AGYA 5IUJC 4CWAA 3ZUGA 2CHGA 2YYZA 3C8ZA 4H2DA 1VIYA 4DBLE 1LNZA 4NCKA 4TZTA 1YZHA 3IIIA 2ZJBA 4KXFB 4TRNA 4BVGA 1DG3A 2JLXA 4XVCA 2XGMA 4RA6A 1I51A 4G0ZA 3DOUA 1O9BA 2I54A 4XYEA 3RFVA 3VZQA 3ICWA 4CDMA 4E51A 3EUFA 2P67A 5BMOA 1KQFA 3I62A 1RZRA 4PVDA 2IEAA 4TZ6A 5CK5A 4HLUC 1Y1PA 5KI6A 4CIDA 3NV7A 1V5GA 3LO8A 5M29A 4G0OA 2R6JA 2WWWA 2VRNA 1O94A 1TZBA 5D84A 3T7EA 4L3WA 1U0RA 3T9CA 3V1TC 2YV3A 4C7OA 1KNQA 3WDMA 1C0KA 2GWHA 1EBFA 4RYDA 1P1KA 2VWGA 1HGXA 2ZYRA 3JYQA 2GN6A 1TJ3A 2FQXA 1UPTA 3PHHA 4G4GA 1B16A 3B12A 2ZB8A 4E5NA 2OCLA 4NTZA 3U44B 1E89A 5D6NA 3V4OA 2ZJ7A 2VDPB 3KDPA 4M7WA 3ELWA 5GAJA 2OCIA 5IAGA 3WHPA 2EHJA 3GFTA 2DJIA 2I4OA 2J3EA 2OSBA 5JZMA 3AM4A 1YASA 2OWDA 2JI7A 3ZCPA 3SJUA 2YZ7A 1ACLA 2QG9A 1A5TA 4R1TA 2M6LA 3E15A 4JWKA 4F96A 3F8SA 4NHOA 3L4JA 5HZMA 2M6RA 3P94A 3HCNA 1CZOA 3UMVA 1APBA 1QG6A 2O8BB 4J03A 4RGQA 2JAUA 1IZ8A 1OXXK 2G80A 1RRVA 5GTDA 3ZPXA 1QUFA 3QM1A 4TXNA 5HUHA 3WBFA 1W7AA 1H5UA 2CLLB 5EIAA 1LBQA 2B30A 3HZRA 4JT2A 4PM4A 2WSYB 1NJ5A 1FS5A 2CCJA 2DPXA 1DZIA 1NPTO 3BL6A 4UTZA 3SJCA 4DUGA 3EJWA 2AKYA 4ERXA 4U7TB 5IABA 4Z53A 3T5DA 3ZZ0A 1SOVA 1JQLB 3DBHA 4DLZA 5CLGA 1THMA 1QPZA 2QX9A 3FPLA 4MWBA 4WCFA 1K6MA 3ZR4B 4NEQA 4XRGA 2ZYHA 3OOWA 1Q50A 2H9AA 1Z37A 1X77A 1J0DA 1DV2A 2B3TA 2XIQA 2PGAA 4BGVA 4BLRA 5LYJB 1M54A 2HMVA 1QVVA 4QPNA 3SYRA 1JR2A 4Z3OA 3HDYA 4ETWA 5J2UF 3H2HA 2AQKA 3L8GA 1OX4A 2R6HA 4I0WB 4QRIA 4YJHA 1M1UA 3NBKA 1G4AE 5CB6A 5EJ5A 1TQHA 3BRSA 3TSOA 3TLKA 1KA9H 4PLYA 3GGGA 5FHRA 4LOHA 2ZTSA 3FMFA 4M1TA 5B3KA 1TKBA 1JJVA 5E3IA 4OLBA 4NX2A 1EBUA 1K89A 4LPKA 3RANA 1CQWA 2GHTA 1OASA 1VMKA 1I24A 3RROA 3ZE0B 3GLFB 5JJLA 5F78A 2ORVA 4UVDA 4KNYA 1XTJA 3OE7A 4DRXA 5J4LA 4FI3C 1X7XA 4MX8A 1ODIA 4PICA 2QUKA 5JYCA 2AZDA 2BEUA 2YHBA 1ZH2A 2FMHA 2WKPA 3I4CA 3GLRA 5KHAA 3LV8A 2P8SA 3RUEA 4DDVA 2XEDA 2OO5A 1RYBA 2WJJA 2C03A 2QRNA 4CMKA 1ST3A 4J07A 1RPJA 5EJFA 1N5RA 4B4UA 3BREA 3EDQA 4IS3A 3SIRA 4CG2A 1CZKA 4GL2A 1I3LA 1JWLA 3PRYA 4JCOA 5K0EA 1UJMA 2CDAA 1JEOA 2EL9A 1TPZA 1T6YA 3AVQA 3OMWA 3VSAA 3PUZA 1FFAA 3VYWA 2W42A 1Q0TA 4MV5A 3CU5A 1QIFA 3TDKA 1OMOA 2OBLA 3IQIX 4ROSA 2OECA 4PIPA 1MW9X 5KVQA 3E05A 3L7NA 3JAWA 1YT5A 3DZDA 3FOFC 3TIGA 3QKIA 4M1KA 3UWSA 2BR5A 1UBNA 3S40A 3U37A 1VRVA 1NBHA 2RHDA 3DKVA 4M99A 4JBHA 1P5HA 4XJSA 3M9XA 1L5VA 5KQSA 1C8BA 1GPNA 2C61A 2KE5A 1QORA 3KCQA 2JIBA 1PJZA 1CR2A 1Y8AA 1T3ZA 1EK0A 1QHEA 3QKTA 1KSFX 2J9FA 1C1HA 3IO3A 1ZZEA 5HIAA 3ADKA 4ZMSA 4KYVA 4BLWA 3BIJA 4ZYUA 1VGVA 5AVJA 5JY1A 4PRZA 5JMOA 2QXYA 2VTEA 3E3LA 4QVKA 1NW5A 3E3AA 1JW9B 1PYOA 2MSDB 4ODIA 4FUTA 4YCJA 1USVA 5TT1A 5FB3A 2VBIA 5C46F 1CT9A 3D6MA 4DA6A 3QVUA 4DMFA 4C2BA 3KC2A 1EK2A 1KEVA 4MKIA 2ZWPA 4UARA 2BW0A 1ZUNB 2DULA 3IB6A 2QPOA 4RX1A 2BMVA 3W8EA 2Q4TA 4KXNA 1WZCA 2FOIA 2Q99A 3RB8A 5ESWA 2VK8A 3DDWA 4JJ7A 3ROXA 2RGUA 2CSXA 2R7LA 3N76A 4I4TB 3IEKA 1VG1A 2Q5OA 1MVLA 4FYJA 1K5PA 4YXFA 4OLJA 1NLYA 3KD2A 4TYQA 3O9ZA 1BXRA 2OD2A 1EB8A 4FQ8A 3E6AA 4GRAA