1G5TA

The three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo-atp form
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
157
structure length
157
Chain Sequence
ERGIIIVFTGNGKGKTTAAFGTAARAVGHGKNVGVVQFIKGTWPNGERNLLEPHGVEFQVMATGFTWETQNREADTAACMAVWQHGKRMLADPLLDMVVLDELTYMVAYDYLPLEEVISALNARPGHQTVIITGRGCHRDILDLADTVSELRPVKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of ATP:corrinoid adenosyltransferase from Salmonella typhimurium in its free state, complexed with MgATP, or complexed with hydroxycobalamin and MgATP.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
molecule keywords COB(I)ALAMIN ADENOSYLTRANSFERASE
total genus 53
structure length 157
sequence length 157
ec nomenclature ec 2.5.1.17: Corrinoid adenosyltransferase.
pdb deposition date 2000-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02572 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g5tA00
2C9CA 5KHOC 2BEJA 1A82A 3KX2A 1JAIA 4W5JA 4B74A 2J0UA 1NSTA 3SN6A 1CR1A 1F48A 2FZLA 3NEJA 5ANRB 4KBFA 1KDTA 3WBJA 3AGPA 3ZGXA 5L8VA 3IBGA 3U44A 2H7VA 1GDDA 4LRWA 4BPBA 4Q18A 1UEJA 2BM1A 3WMEA 4F38A 2QMEA 2P5TB 4L9SA 3W90A 1ZIOA 2CCGA 2ZRBA 1W4AA 2ZAMA 3BXZA 5DSZA 3WNBA 3ADBA 1CXZA 4DWJA 2CMKA 4BUJA 1WP9A 4NZYA 3AF3A 5FTNA 4A2QA 3SHWA 2AXNA 3ND9A 4Q4LA 5E7IA 3GLHE 2QP3A 3K70C 1D8TA 2JIZD 2JASA 1PUJA 2OAQ1 1NLFA 1KY2A 3Q85A 2ZSDA 5KDLA 3AP1A 3VTKA 4C9BA 4TQUS 4WZ6A 4H1VA 2DWQA 2OT3B 2PLFA 1EFUA 3ZLJA 2R8RA 521PA 4YLGA 1UBFA 1YU9A 2JLXA 2CLSA 1XPUA 4A2WA 3IILA 5FL3A 4DCSA 2I1QA 1Q3TA 3LV8A 4I99A 4ZIRB 1E96A 1XCMA 4Q01A 3OIYA 4QRHA 3NC1C 1N5LA 1BH2A 1VYUA 4JYBA 2A78A 3CPEA 1S2MA 3DEFA 1TAGA 4PQYA 2FSGA 4PO8A 1VCIA 1NP6A 4F91B 1IAQA 4NH0A 2OLJA 4OHXA 1XTQA 1TL7C 2WAYA 4WOPA 2W0SA 3S1AB 4ASUA 2J0VA 4Z8XA 2VQSA 2DPXA 4LHZA 2ECKA 2WPDD 1S4QA 4NBSA 5GVRA 4GP6A 4PHFA 2CNWA 3BH7A 3I4LA 2YC2C 1NVUQ 3WP0A 5JHHB 2C77A 2WTUA 2GCOB 3ETLA 3OF5A 2FX3A 1Q22A 4ABYA 1FL9A 4AY2A 1SXJE 3B60A 1KO8A 1KJYA 3DM5A 4AKGA 3ICEA 4EPVA 2QRZA 2AKAB 1E4YA 3DO6A 3MLEA 4H1UA 3THXA 3Q5EA 2DWOA 3H86A 4TLEA 4KVGA 5E7MA 3T1VA 1KSFX 4AKEA 2CCJA 2ZRGA 6Q21A 4LYAA 4LDJA 3LAWA 4FIDA 3GPLA 1X1RA 2D74A 1S3GA 1JNYA 1VDZA 2W0MA 1FQJA 3BJIC 1M1YE 4I81A 3JZMA 3SE0A 4B47A 4OL0A 2F1RA 4DVGA 3Q7QA 2ZPTX 4CIDA 3AVQA 4HYYA 4FWTA 4YONB 5DO9A 3THOA 3R9WA 2IX3A 3A36A 4GZLA 1E9BA 1MABB 421PA 2HYDA 5FOTA 3O8CA 1YRAA 2GJ9A 1CR2A 3IHLA 1HY3A 1R7RA 4FMCF 2YVUA 4A4DA 2XTNA 4LBYA 2WIBA 2D2FA 3V9PA 2KJQA 4M1WA 1DS6A 2H5EA 2RKOA 2AXPA 3GLGA 4IDHA 1WB9A 3O47A 2QPTA 4KU4A 1N25A 1WF3A 3QEOA 5IF9A 2PX3A 2PJZA 4JKYA 3R9XA 1UF9A 4M1MA 2GZHA 3GLFB 1E2PA 3CWZA 2VHJA 2GVZC 1KGDA 1G8GA 5AWFC 4II7A 3FMIA 4JBYA 4Q02A 4RSGA 4D81A 5BYKA 4TYYA 3Q7PA 4DIDA 721PA 1OFIA 2QEQA 4Q7JB 3DDCA 2ZJ2A 1HTWA 4D4JA 1E1RD 3HR8A 4LK2A 2ANBA 4QKQA 1CIPA 2BV3A 1ZU5A 5HE9A 2IYVA 3O8BA 3N70A 4A0GA 4U02A 1E1RA 3K9HA 4O2LA 4UNQA 1XMSA 5AJXA 4UKDA 1O87A 3AUXA 4RD1A 2ZS8A 2FPLA 1JR3A 3HYRA 5HR5A 2C78A 3UPUA 4FINA 1NG9A 5FUXA 4QM7A 2DYKA 4UNRA 3ZS9A 4G1UC 1QHHB 1R0ZA 4US1R 2FE4A 4M0LA 5HE8A 1CRPA 1OT3A 5AR1A 4EJSB 4C7OA 1CP2A 4IDPA 4EFMA 1YR9A 3CH4B 4MRVA 4G5GA 4MUAA 3EA0A 5J4VA 4D0GA 4AI6A 3K0SA 3R7WA 1V43A 2D4HA 3A6PC 1CKEA 2IYXA 1IJEA 5FPSA 1UKEA 3CF6R 2IF2A 4Q1BA 1VPLA 2IA5A 4B3BA 4CF7A 1G8HA 3MWJA 1VKJA 3FTQA 3PUVA 1DO2A 3K9NA 1C1YA 5JMTA 5TMPA 1VCNA 4P31A 3B8HA 3RVBA 2V4ZA 1R10A 4LPKA 2GNOA 1E9AA 4ITRC 3SU8A 1QHXA 4B75A 5FPHA 1OH8A 1QHNA 3GJXC 3NTUA 4DSUA 2XSZA 4BFWA 1SVIA 2H16A 4C0LA 1E4VA 1ZC3A 3MWYW 2OG2A 4QXAA 2QSYA 3FMOB 2IS4A 4XIGS 5CYOA 3B7GA 3WYAA 2ZRMA 3BIFA 4PXAA 1F2UA 3FGNA 3W3ZB 4A36A 5SZJA 1IN6A 2ZRIA 2WPDA 1R0XA 2QAGB 5M04A 1Z6TA 3K53A 3RS7A 1KDPA 1P7CA 1BO6A 3VR3A 4NL4H 5DHFA 1FMJA 4LHVA 5KDDA 3GEIA 5DISB 3AKDA 2BWJA 2YOHA 3TLXA 3TAUA 2H57A 1LFDB 2V3CC 1Z22A 3KXIA 2ATXA 1Z0KA 4C2UA 1ZU4A 3GCGA 4PSAA 4Q4JB 4TL7A 3THWB 1SGWA 1AM4D 3C7KA 3E70C 2D7DA 3TQFA 4XWAA 4R7ZA 5E7JA 2GZAA 3K0FA 1Z08A 3QKSA 1E99A 2JCSA 3PUXA 3WRXC 2V1UA 5KSYA 4PO9A 2GHIA 4PSKA 4Q9HA 4K81B 1KI1A 1H8ED 2O8FA 3KUCA 2IHYA 2B21A 1UPTA 3FMFA 1UDWA 1JQLB 2QZ4A 5C4GB 4GSYA 4NYMQ 2GK7A 1T91A 4DEXA 1GL6A 4AURA 2BEKA 3IIJA 1ZD9A 4MGZR 1TF5A 4MRRA 4HATA 4A0HA 3U6BA 1L4UA 4MDEA 2BBWA 1KOFA 5CJ2A 1AZSC 2A3RA 1GNPA 4A9AA 5DYGA 5J4LA 4KYIB 2EFGA 3GJ7A 3AM1A 1P3JA 4BASA 2IS6A 3GEHA 1FUKA 4EAQA 1G1MA 2IL1A 3LVQE 4Q7LA 4OK5A 821PA 1T5LA 3IPYA 4Z8YA 1TMKA 2CL0X 2XZOA 3CO5A 3W6PA 1SKYB 2ODNA 1NMZA 1G20E 1YZLA 4KCGA 1SXJA 3M6AA 3B1YA 4RZUA 3TSWA 1ETUA 1VG1A 1E2IA 3T1OA 5TDHA 2FWRA 2GWHA 3GLHA 5C18A 3EASA 1F2TA 4WVFA 2XXAB 3KQHA 4TL6A 2BKEA 1GITA 3EC1A 2WWIA 3SDZA 2EFHB 1YHNA 3LLUA 2I1VB 2KB0A 3EWSA 4QGHA 2Z43A 1N5KA 1N6IA 2AX4A 4GFDA 4HAZA 1TUIA 2HT6A 4U00A 2YC4C 3H0KA 1G5TA 1MV5A 1XWIA 4JLVA 4A0RA 1H8HA 4X8MA 2ODWA 2DWPA 1K5DA 1XTJA 1B0UA 2QGNA 1NKTA 3CNOA 2ATVA 3L0SA 3WHKA 2Q9AA 4R98A 4CEIA 1FUUA 3KKPA 2V6IA 4KAXA 4X8HA 3OIUA 3T12A 3AGQA 4NPHA 2XGJA 121PA 2PT7A 4RD2A 3TKLA 2BVNA 2ZE8A 1XXHE 1JECA 3CX6A 1VIYA 5KSZA 4Q47A 1Q3HA 4KITB 2VO1A 2CK3D 4NYIQ 4ZDKA 2KBEA 3VAAA 3K0AB 1XNJA 1N5JA 4JL8A 1FPMA 4Q4AB 4BLOA 3U4QA 2ZIAA 2IXFA 3TK1A 5B2ZA 2OESA 1DELA 4EJSA 5FBRB 4QM6A 4P4SB 1E9RA 4Q1DA 2WMNB 3W8RA 1E94E 5EP1A 3I3SR 2QQEA 4G0NA 2R6DA 2WSMA 4BEBA 2YWHA 1ESMA 2VP9A 4PSVA 4XWOA 1K5GA 3BE4A 3ZIAD 2GJSA 3BWDD 4TL9A 4BLTA 4LCBA 2OLKA 2OBLA 1OIWA 2QPOA 4WZAE 3VHXA 4CEHA 1HEIA 4MUBA 1OPXA 2DR3A 3RYTC 1G7CA 1W0JA 1OLOA 4BLRA 3L43A 1YR7A 1CS4C 3SOPA 4DCNA 2OFXA 4Q1CA 2VRWA 2A2ZA 4WXPA 2ZJAA 4QJ5A 3QKTA 3EIEA 4D82A 1KKLA 1RJ9A 3C8UA 2HEIA 5JLJA 3TH5A 1G291 5AJVB 5B57C 2GKSA 4C3ZA 3FKQA 1NL3A 4Q5IA 3TAHA 3U2QA 1P60A 1GZSA 3NDBB 3VKHA 1XFAA 4A1FA 2H8KA 4ARZB 4BLSA 1W48A 2CJWA 2XOKD 4ZDJA 4IDNA 5BN4A 3REGA 3KQKA 5EXSA 1JXOA 4LBZA 3A4MA 3RS4A 3NBYC 3U3OA 1EXMA 2QBYA 1M34E 3AP2A 1RZ3A 2FPKA 2MSCB 1N0UA 3REFA 4Q4JA 1PJRA 2KBFA 2HYIC 2R62A 3C15C 1G5PA 1E9SA 3WNDA 3WP1B 5HKKA 1NG1A 4A82A 2H1LA 1MKYA 2NO1A 3B13B 4YXWA 2F1IA 4DB4A 3U7HB 2J87A 2VHCA 2F55A 1E1QA 2GK6A 2WWHA 1QBKC 4KV9A 2G3YA 3PEVA 1II0A 1QZXA 3EAQA 3OFNA 3P26A 4JVNA 4BRWA 5KUTA 2FSIA 3AKCA 4W7SA 1P62B 4TTPA 3KKOA 1QHSA 1Z2AA 3I8SA 4F4IA 1JR6A 3GLIA 3VFDA 4DT1B 5KTYA 1XEWY 4WBSA 1UKZA 4LC0A 2CL7X 4LBVA 3W8NA 1P75A 2R6GA 4V0ME 4B73A 3LDAA 3VR4A 3GJ4A 1KDOA 1FNNA 4NHOA 2FFAA 2QMHA 2QORA 5DLQC 4MYCA 4L9WA 4TWZA 2P6RA 3D8BA 1ZW6A 3B85A 1COWA 4ESVA 1KKMA 1YQTA 2IC5A 4LJ8A 1GKUB 4DRZA 1NNEA 1G17A 5H1YA 2SHKA 2BMDA 1OHHD 5L3QA 2O8EA 1N6NA 3NBZC 4NCNA 3C5CA 3ZQJA 4P3YA 3AF4A 2HLDA 1XEXB 5LB4A 2YINC 1KI9A 2VIIA 3IQXA 1J8YF 2W6IA 3SEAA 2MSDB 3WMGA 5JFGA 4DC9A 3TVDA 3Q3JB 1A1VA 1FX0B 1GTVA 5F9HA 2ZE6A 4PX9A 4NCJA 2VP2A 4TT3A 3RSLA 3BBPA 3QENA 3NDPA 3BGWA 4LJ5A 4LX0A 5TXGA 3VR2A 3B2EA 3LX8A 2VBCA 4PZZA 4YC7A 3W5IA 2YWGA 3ZJYA 1XTIA 1ODFA 4QC2A 4B2PA 3AVVA 5HPYB 1XXHA 3GJ6A 1GKYA 2FN4A 2Z5FA 3EIHA 4I4LA 1KZGB 2W6JA 4NDZA 3VNUA 1WCV1 2BMJA 4UQOA 3QOFA 1OFHA 1OV4A 1MH1A 4B3CA 1VYTA 3KXLA 1E0SA 4M9XA 3QY0A 5G40A 3EXAA 4NU0A 4KYUA 4YXWD 4XJXA 5GADl 2ODEA 1U0LA 2GF0A 2ZI5A 1N6LA 1E32A 2FJUA 2REOA 4QBHA 4TN1A 3M4YA 1N6PA 4IHQA 3CRRA 3I32A 1U0JA 3LW8A 4TYNA 1NN0A 4HB4A 1GG2A 2OEPA 3RSOA 4CEJB 2DFLA 2YNMA 3P20A 3ICQB 1XD2A 1FZQA 3B9QA 3B1XA 2CVFA 2FF7A 4IVQA 4YMUA 3DMDA 4Q4HB 4IOLA 1EX6A 1C9KA 2ASEA 1IHUA 1FP7A 3C14C 1G8FA 3A1TA 2BBOA 1LB1B 3BB3A 4M9QA 2O0KA 4M22A 1TUEA 3B1WA 1VG9B 4U7DA 1GFIA 1OXTA 2ZQ5A 3GEEA 3EIQA 3GFOA 3RC8A 1X8LA 4JZKA 3L0OA 1AJEA 1NMXA 4DKXA 4Q9LA 4MRNA 1W36B 5DGXA 2WZQA 4BZQA 1WXQA 3C16C 1E2MA 3LVRE 1XD9A 5SZHB 1HYQA 5AJYA 4DEYA 2ZU0C 2ZEJA 2G9NA 1W4RA 5JWOA 2ZJZA 2FMXA 3D3QA 3W6NA 2RGNA 2QPAA 3MWKA 2O8CB 1S96A 5EZ6B 3U3RA 5A0FA 4FCTA 4OQMA 3BRWD 4C2TA 3ZVMA 1HE1C 2NPIA 3HDTA 4EFNA 1Q0UA 2CEAA 4Q48A 3EZ7A 2XAUA 3SFZA 2VSXA 1QG2A 2AK2A 4AD8A 4B3GA 1G9XA 2O8BA 4DLRA 5JCZA 2A5GA 3UMRA 1P2VA 5D3MB 5FPKA 1Z63A 2HLDD 3UWKA 2QBYB 1XJQA 2XZPA 3VKGA 2ZSAA 3NH9A 4DLYA 4YMVA 1OJLA 5A4JA 3ASZA 1DBSA 1Z2CA 1N5IA 2C8VA 2Y8EA 2XX3A 3PUWA 3QE0A 1A4RA 1YZKA 4IFBA 3QI2A 4UJ3A 1CU1A 3NKVA 5EQTA 5AK0A 3CF0A 2AHOA 2AL7A 3THYB 3I62A 1TADA 2F3TA 1LNZA 1KI3A 4F4JA 5HZHA 5BW8A 4DCTA 1SHKA 1UJ2A 1ZUIA 3OESA 3P27A 1T0HB 1Z0DA 5F9FA 4AKHA 2HT1A 3DOEA 1E69A 3LA6A 1BOFA 4KLNA 1HH4A 2WHXA 2REXB 4XOIA 2RCNA 3T61A 3G0HA 4LUCA 4URZR 1UBEA 1U90A 3RLFA 4DUGA 4XSGA 4YMWA 3SJCA 1KMQA 1DTSA 1CEEA 2Q9CA 2ZRJA 1NIPA 1TF2A 1GIAA 2JDIA 2WKPA 4MKHA 2ZXUA 3ECCA 3JVUA 1GNQA 2EFCB 3V4RA 4CGZA 2YZ2A 3AF2A 4PPQA 1ZCBA 4PZYA 1RFLA 3HR7A 2P6NA 4OI1A 1OHHA 4JSTA 2VP4A 4O2RA 1P9NA 4PAMA 4F4CA 4NONA 1O3YA 2ANCA 5KO2A 1SKYE 1E2LA 1DADA 4M1TA 2W2XA 2E1RA 4QGGA 1X1SA 1R0YA 4DLXA 1N0WA 4D4MA 1Z6GA 1EFRA 1G5RA 1W4CA 4G5OA 4B3DA 4URXR 4LV6A 1II8A 3BK7A 5EE1A 1FP6A 2HF8A 4JVMA 2PLRA 3K70B 1U9IA 1DAKA 1QVRA 1U8AA 2IT1A 1XJCA 3BFKA 2W58A 5CM9C 1DAEA 1XTRA 4LGMA 2IEZA 1GKIA 2QSZA 5JSZB 1XXHB 2QMOA 1OXVA 1XZPA 4HAVA 1D2NA 4QHYA 1W46A 2XJ4A 1OW3B 3K0CC 2J0SA 1KO4A 1KJZA 1DOAA 2X8AA 3ZDQA 1EESA 3SQWA 2GXUA 5F2EA 5G53C 1CJUC 3TR5A 4CEHB 1U0HC 2P0EA 2LWIA 4QJ3A 5DH9A 2ZSBA 1ZMXA 4JLPA 4GPTA 4GMXA 2D3WA 4L4UA 1JR3D 4QBFA 1R5OA 4RFSA 3A4LA 1R2QA 1JR3E 2OCYC 1KK1A 4JLMA 2OCPA 5HZKA 1E2KA 5CK4A 5EE0A 4JBXA 3U3MA 3EZ6A 3JZAA 5J4YA 1TU4A 4ON9A 3UIEA 3OFND 2F9LA 1NN3A 4PHTA 2F9MA 2DY1A 1L7VC 5LBIA 4I1UA 2NO9A 4X8LA 3EC2A 4HUQB 4Z51A 2HJGA 4ZV4A 2O8DA 2GJ8A 3CPHA 1G8YA 1P5ZB 4J0QA 1Z0IA 2JLVA 2W2TA 3HWSA 3LRPA 4ZDIA 4A8JC 5JBQA 1KO5A 4QJ4A 1W44A 3HP1A 3PUYA 5J4KA 4JLAA 4MRPA 4BFSA 2FU5C 4TSFA 2WWXA 2IYUA 3GJ0A 5JWHA 2J0UB 2RAPA 3C5HA 4RD3A 4LYJA 3X1YA 2WMOB 3LH5A 1A7JA 1XZQA 2WSSD 1W36C 3FHCB 4BE7B 2V9PA 4OKSA 2OFWA 3GLGE 1OIXA 4UNSA 4DZZA 2F1HA 5FH9A 4JIMA 2GAOA 1KI2A 2IYWA 3KDSE 2ZRHA 2PEYA 1OYYA 3TUIC 1IBRA 1V5WA 2ZYVX 2ZRFA 4B44A 1U98A 4HLUC 3T1QA 4AWXA 3OE7D 4Q7MB 3K09A 1QHIA 4BEJA 1U81A 5FI0B 4OHZA 2BKUA 5H68A 5TY0A 3B78A 1RW4A 2REBA 1YKSA 1I2DA 4YDHB 2CK3A 1ZAKA 3OE7A 5FUWA 3NHAA 2O8BB 3QXHA 1T8TA 5JZVA 2BBTA 2EU8A 4MKFA 3HPRA 2WKQA 1EG7A 1EFCA 2WJIA 4D0NA 4FMDF 2WJVA 1R8QA 1DO0A 1UDXA 2GCNA 2GBLC 1OXUA 4WAUA 2KI5A 2OUKA 4OHVA 1M6NA 1NVXQ 1JB1A 3X1ZA 5JJKA 1RKBA 1YJ5A 2GVDC 5LD2C 3A8TA 4B32A 4CT5A 1JQJC 4TTRA 5E3HA 1D9XA 3BC1A 4C30A 3KZ1E 4X8OA 1ZM2A 1ESNA 1GILA 5EJEA 2QTFA 1XBTA 1E2NA 3SBDA 3IO3A 1X3SA 4MYHA 5G3ZA 1NF3A 5JRZA 2PCLA 1G3IA 3KFXA 1HUQA 2GEUA 1NJFA 2P65A 1G6HA 4IOMA 4UNPA 4E09A 4LV8B 1P72A 1XU4A 1T3HA 4RZXA 1LS1A 2EFEB 3GJ5A 1A2BA 1KMHA 2JEOA 5KPJA 3VHLB 4HB3A 1G3MA 1Q21A 2QL6A 3SR0A 2NOAA 4LHYA 2FG5A 4M1OA 2XZLA 3ONWA 2ZI7A 2CE7A 4FW9A 1ZVQA 3SJAA 1GAJA 2CHQA 2CXXA 5F3WB 4IW3B 1VCMA 1ZNYA 1AN0A 3SBEA 5CIWA 3W9YA 2RGDA 2O5VA 3LBIA 3HU3A 3WNCA 3I72A 2JA1A 4LYFA 3P32A 1OH6A 2YV5A 3CM0A 3B82A 1XPRA 1QRAA 2QG6A 1FQKA 3A37A 4JLKA 2PMDA 1YVDA 2VYFA 4P0TA 4AIIA 4H9GA 3IIKA 3FHTA 5FOVA 2AFIE 3ZZUA 4NYMR 2C03A 4RVCA 3RWOA 1KJWA 1XTKA 2B7CA 2P6UA 4PPFA 3ZD6A 4Z1MD 3ADDA 2RGBA 2FA9A 2O0HA 1WRBA 5CB8A 4IOJA 3S1AA 1L2TA 1W0JD 1F2UB 1FW6A 1Q12A 3R20A 2NO0A 4PC1A 3T06B 4M4SA 5FTJA 4V0LA 1J70A 3UG6A 1OB5A 1MO3A 4N0EA 3NC0C 1T0JB 3ASYA 1MABA 3U7GA 3WRYC 2ZJOA 4V0MA 1NKSA 2CHGA 3RNLA 5EXTA 3CLVA 4LC1A 2A5FA 4RFSB 4OBEA 4OI2A 3ZVRA 1NLYA 5C2JB 3AKYA 4M1YA 3GLFE 2XTZA 4S35A 5L3VA 2WJYA 1XEWX 1JEEA 2O52A 2I4IA 4LI0A 4HZUB 4TMVA 3K70D 2D06A 2VLIA 4I1VA 3CZPA 3AVOA 3W6OA 2BOVA 4XTRA 4JMPA 1W7AA 2O8DB 1Z6YA 2FEMA 2GETA 2OAP1 4R71A 3DZ8A 2R65A 3UATA 4UXIA 4BQSA 1UBCA 2ZI6A 3AF0A 4IEIA 1TQ4A 4KFTA 1BMFA 4W5HA 4ESHA 4KSBA 2C5LA 4IRUB 4NCKA 2ZJYA 4TMZA 4V03A 1XCPA 3WMFA 2BC9A 4LWZA 2Z83A 3IUYA 2QN6A 4IEEA 2GESA 3KJGA 5JWRA 4DSNA 1HURA 4ZI2A 1VTKA 3LQQA 2G6BA 1D2MA 1MT0A 1EK0A 2IYQA 1BYIA 2A5DA 1WBBA 2WJJA 3GQBA 3IPXA 1P9RA 4JLNA 3IHWA 2VP6A 3TUZC 5K8IA 4EKDA 1XB2A 2OE2A 3LY5A 4FMCB 3VKWA 2Z0MA 4KODA 4ACAA 1DAHA 2XSZD 2IK8A 1R8SA 5GJWC 1CTQA 3SYLA 1YZGA 3MAAC 3SYKA 1DAMA 4AK9A 2JLUA 4OHWA 5KSPA 5KU1A 4CT4B 2W83A 3GLHB 2XXAA 5UKDA 3CRW1 5J4HA 2NMVA 1UKVY 5ELXA 3QNUA 1YZQA 3NBFA 4ZPXA 1QHGA 2JIZA 4E5UA 3PCRB 4Y0AA 3H84A 1W1WA 4C0BA 4FWIB 4JJKA 4JBWA 5FTMA 1F60A 1JAHA 5CIQA 3GJ3A 3L82B 2CE2X 4C0AC 2QNRA 1UM8A 4ZDWA 5KYKA 1AS2A 2FPMA 3KKNA 1IOZA 2K5UA 4Q00A 1Q1ZA 4HEJA 4XH9B 3SHFA 4DIEA 1E2JA 3RRNA 1E0AA 5JI3E 3VU9B 1X8KA 2ZR7A 2NZ8A 2J59A 1RYFA 3LFUA 1VECA 1VG0B 3WXMA 3AVXA 3UG7A 3SJZA 2Q3MA 4IDOA 5CDFA 5KNBA 3I92A 3R7WB 1GVNB 4Q1FA 3N2IA 3H2YA 3FDIA 1A5TA 2ZAOA 3CX7A 4MRSA 2CL6X 3OIWA 1GL9B 5FBLB 2JJ1D 2ZRDA 2ZYWX 2J5XA 2QU8A 4IFEA 3EPHA 1H8HD 3GJ8A 4PQRA 2R2AA 1CULC 4GBMA 2X77A 2NGRA 3IO5A 3MGCA 2G83A 3WY9A 1AKYA 4XTCS 2V8OA 1Z0FA 4WIAA 4A0FA 5IRCD 3KTAA 1XF9A 3BH0A 1N3BA 2A30A 2KSQA 3OEED 3VMFA 2QRNA 5GVSA 3QSYA 5H8WA 2HJVA 4M21A 3QF4B 3K0FB 3NH6A 5FBQB 3CZQA 1F5NA 2QQ0A 1IXSB 2GEDA 4B2LA 3FWYA 4PC2A 4HLDA 1K6MA 2GXQA 2VL7A 3I5XA 3L0IB 3DVLA 2P67A 2H18A 4G3XA 3QPVA 3BD9A 1G4AE 3CWQA 3QPWA 4GOXA 4KLZA 2BHRA 5K8TA 2HXYA 2DCUA 2FSFA 4TTQA 3IQWA 5FUVA 1DAFA 4PC7A 4DCUA 4WXRA 4BRUA 4GMDA 4DSTA 1AQUA 1Q1QA 2AD5A 2GA8A 2VP5A 4Q1EA 2GRJA 2WBLC 3PXGA 1G8PA 4JLOA 4N1AA 2VTKA 3ZS8A 2GJAA 2ZU6A 1KSHA 1TQDA 4B3FX 3IDQA 4XD7D 2J41A 4N3NA 2V7QA 3QKSB 2XB2A 2AN9A 1J8MF 4AYXA 1LVGA 2HUPA 1DVRA 2ZE7A 1AGPA 3CBQA 4LV5B 4KFRA 2F6RA 2X1VA 4AKIA 2ZJ8A 4EPTA 2O8FB 2IUUA 4DB2A 2BBSA 2IUTA 5EE3A 2OM2A 3TSOA 2C9YA 2HF9A 4RD0A 4YQFA 4BFUA 3KB1A 1OFTA 2G0TA 2Q0HA 4QHSA 1UAAA 3VR1A 2FFQA 1E2EA 2QAGC 3BAFA 1Z0AA 1I4DD 3ZH9B 1ZC4A 4B43A 1KI7A 4M9SA 4ZI3A 2G88A 2Z4RA 3QJYA 3VR5A 3H1TA 1NBMD 1LS6A 2J9RA 2KWIA 4HI0E 1Q57A 2VHQA 3KQUA 2PL3A 2WICA 2DFNA 4AG5A 2VPPA 3FKSA 5JEEA 3RRYA 2G77B 2JGNA 5FL7A 1Z83A 4OQFA 4D80A 3IGFA 3TUJC 1G3QA 4MDFA 3U6KA 4FXPA 4HLQB 1ZCAA 1VHTA 3QQ5A 2F3RA 3KJEA 1II9A 4R2HA 1YRBA 4HUTA 2N46A 1R6BX 1NN5A 1IJFA 3IKJA 3KKMA 1F2TB 4IOKA 4L5BA 2HCJB 3AH8A 2JAQA 4V02A 1GL7A 2QE7A 1FTSA 3ND8A 5CK5A 3PJRA 4MGIR 1NY6A 2R44A 2PX0A 5SZIA 3TJZA 3TRFA 1FX0A 1KTVA 3AUYA 4Q03A 4ZCIA 3CRMA 1NRJB 2E87A 3U61B 1E9CA 1KZ7B 2GILA 1YZNA 4GT1A 2BMEA 1TX4B 2GXSA 5K8LA 5KNCA 2B8TA 4A92A 1SXJD 1OH5A 2R6CA 3F3YA 4KHZA 5LDDC 1DG1G 1DE0A 1KO7A 2ZI4A 1EFRD 2ZJ5A 3BFXA 1G4UR 1RE0A 4UXJA 4EPRA 4EPYA 4CDGA 2OHFA 1NSFA 1WDTA 1ZJ6A 3QEJA 4TLDA 5FI1B 1X6VA 4BGDA 4IDQA 2JLZA 1E2GA 5EXXA 1WA5A 1S9DA 2XNDA 1W49A 4ASUD 4O3MA 4P4SA 5FL7D 3CIOA 4XWKA 3EPJA 3DKPA 2ZTSA 1Z5ZA 3FB4A 4KFUA 2L0XA 2YWFA 2WWGA 4P33A 2JLSA 1KAOA 1US8A 4EQ6B 4ERNA 3IEVA 1SZPA 2V6JA 3H4MA 2AWNA 1DPFA 3X1WA 2J46A 2ZITA 2HCBA 1TNDA 3CKLA 3OIVA 1KNXA 2QT0A 3A58B 2NIPA 4PHGA 1HQYE 5L3SB 2J3EA 3VX3A 5DNYB 2BCGY 2HXSA 4POAA 2ZRLA 4RFVA 4YMSA 3CNLA 1QF9A 4Q66C 2OILA 1RJ9B 4UNNA 2N1BA 2R9VA 5CJPA 5DHAA 2PMKA 4QNMA 2KE5A 2GJKA 1FTNA 1KI6A 1N2CE 4GNKA 4LSGA 1UEIA 2ZRNA 1JBKA 2CVHA 2WWWA 3TSZA 3GLIB 2CJWB 1BKDR 1W0KA 4BZXA 3UKDA 1PUIA 1B23P 2UKDA 1PV4A 2ZROA 5GJBA 1JJ7A 2JJ8A 4IXNA 3HYTA 4ILEA 1WE2A 5FR1A 5AUNB 4M9ZA 1P4SA 1ZD1A 2WJGA 3A1SA 5JCPA 4EFLA 1GP2A 2WIAA 3ZIAA 5LPNA 1DARA 2A9KA 4BLQA 5B30A 3FPAA 3WYGA 5CLLA 1IN7A 2RHMA 4GOKA 1T5IA 2YHSA 2CHVA 2MMGA 1KY3A 1HQCA 1AS0A 5BYJA 2IF0A 2O8EB 5J47A 4HAYA 4M1SA 4URUR 2P2LA 2RGGA 2DFKB 2PH1A 2VF7A 2QTVB 3QIAA 4Q9JA 1J2JA 3LD9A 3QF7A 4RCYA 3U44B 3CRVA 1SVMA 2AWOA 2ZYUX 3HJNA 2B6HA 2VA8A 4GRAA 4LJ4A 5DIFA 1P61B 2B7BA 5FFMA 5AUQA 1NBMA 4PANA 1TU3A 2VSOA 3AV0B 4B2IA 3THYA 1H65A 1SVLA 1TEXA 4NKRA 4W5WA 3ZD7A 2IUSA 3OHMA 1CJKC 1L4YA 4B35A 5CDFE 1GSIA 4DUGD 2Q21A 1Z8FA 4KI0A 4Z54A 1E0JA 4JVSB 2NZJA 5L3QB 3BERA 4I1SA 1E2DA 2BJVA 2ZREA 2C2HA 1S9HA 2RGEA 5H70A 4B48A 5EP4A 4C0SA 1ZP6A 3P4YA 1M7BA 1XEXA 4PC6A 5J5CA 5EUQB 2Z6VA 2VSFA 2ZR9A 5EUMA 2Q6TA 2GBLA 1OE0A 2ZI9A 2ZRPA 5FOSA 1J90A 2MSEB 1GOTA 2EFDB 5EP2A 1ZRHA 4PPGA 4JJZA 5B58C 3RRZA 4D4LA 4ZIRA 1AS3A 1TTTA 1N6OA 3OEHD 3RABA 1PZNA 2RB4A 5DYIA 4PQFA 2IWHA 1W47A 1XD2B 2G1KA 5DN6D 5FOUA 1N6RA 3NXSA 4LJ6A 3B1VA 3Q72A 1KSGA 4TQ9A 4DLWA 5CITA 1SKQA 2CBZA 2WJHA 3HU2A 4DLVA 2WAXA 4HLUA 4QNRA 3THXB 3EARA 2DBYA 4D4KA 4TYQA 3FE2A 2R6FA 2I3BA 2XEXA 1HT2E 4IJMA 1JPJA 1U2RA 3UXMA 1F6BA 4LYHA 2JJ1A 1G18A 4NTZA 3CNNA 4DCVA 3IEUA 4QFMA 1CLUA 3AF1A 3PQCA 1DAIA 1XDBA 3MMPA 1EGAA 4OK6A 5JHGB 1RYHA 1U8YA 1T3SA 4KJZA 2D2EA 3SJBA 1XRJA 1GUAA 5EE5B 3AVUA 2AKYA 1OXSC 1KI4A 1W4BA 2IHBA 3UMSA 1XP8A 3PVSA 3PEYA 2CLDX 1LV7A 3R8CA 1PVOA 4K8OA 1IN8A 1AK2A 1R5NA 2QI9C 3QG5A 3WYFA 4QGFA 1GRRA 2E9SA 3K9GA 5FPYA 4A8JA 621PA 4K46A 3U60B 3T1TA 3V4FA 1IY0A 3CX8A 3FVQA 3RWMB 4Z1MA 3LW7A 4KO8A 4WW0A 3WHLA 2QAJA 4OQLA 3KQNA 4DHEA 3GLFA 1AKEA 4BZPA 1VHLA 2FFHA 3LQRA 3OEHA 2MMCA 3RANA 3GD7A 2BM0A 1OXXK 3FKSD 3K1JA 2PZGA 1OH7A 4BECA 2ODBA 5HKKD 3PITA 4QG7A 2GTPA 3X2SA 4PO1A 4NMMA 2UZ3A 3SNHA 2JLRA 1TF7A 3ADKA 1DG3A 2IYRA 3K0CA 1J7KA 1N6HA 3P4XA 1CRQA 2IXEA 2IYYA 4MKIA 2ZUCA 5TVKA 4PAOA 4W9MC 5JEDA 5BN5A 4G5RA 4EIWA 3ADCA 2CLCX 3CUEF 4N0DA 3DMNA 1E98A 4OQNA 1BYUA 2A7QA 2QE7D 3QKUA 1GNRA 3CR8A 5D3MA 1Z3IX 3EW9A 4FD2A 5L3RA 1OSNA 1XD8A 2V54A 2F7SA 3MSXA 3QXJA 1E0KA 5EE9A 1OKKA 2PJRA 2H92A 1T4GA 2QUZA 2XB4A 2Q3HA 1AZTA 3U7EB 4TT3D 1M8PA 4A6XA 4KSCA 2XNSA 2W2VA 3I5YA 3EPLA 4MH0R 3BORA 5DE3A 3LX5A 1KSJA 3AQ4A 4TMTA 1K8RA 1TPZA 2IWRA 1Z47A 1OYWA 3PFIA 3U5ZB 3QVVA 2ZETA 2UZIR 1SQ5A 5CLQA 1XEFA 3CB4A 4G5QA 4Y0VA 4DLZA 4Q9IA 3AP3A 4QOSA 4EUNA 3A1UA 1QHHA 1U8ZA 2C9OA 1FMLA 3EZ2A 4FN5A 1ZUHA 2VH5R 2HV8A 4HDOB 1RVDA 3I1FA 3PIRA 4IVPA 1XMJA 4P4UA 2VEDA 4JS0A 5P21A 2QAGA 4JL5A 3SQXA 3OEEA 4L16A 5IDVA 5FTKA 3SZRA 3QBVA 1IN4A 1KMHB 5C4MA 1IQPA 1JPNA 1KDRA 3FYHA 3D6TB 1W36D 2H17A 2NG1A 2TMKA 2J7PA 4EPWA 5TV2A 2RGCA 2CNWD 3CR7A 4OHYA 3THWA 1Z06A 2PEZA 2ZI3A 3TIFA 1MO4A 3JVVA 1CJVC 4TLCA 1XMIA 4ZO4A 1OF1A 3TVTA 3TR0A 3AVTA 3LBHA 4HLCA 1S0UA 2WWFA 3RAPR 5JSZA 3PG5A 3DKVA 4UXHA 1LF5A 2GEVA 3SI7A 4TYWA 2C95A 3AEZA 3WBKA 5E4FA 1AGRA 3KB2A 1W5SA 4QGAA 4GI7A 3OAAA 4L15A 1ZBDA 3Q9LA 1LTQA 5A5GA 3RRMA 1AA9A 4LY6A 1VCOA 3FMPB 1G3UA 4LJ7A 1XPOA 3F5FA 221PA 4US0R 2EYQA 4URWR 3GLIE 2JLQA 2ONKA 4B6FA 2QP4A 2IS1A 2C98A 4LBWA 1NI3A 4ZCLA 5FOXA 1ZINA 3E1SA 1NY5A 4AYWA 3EX7C 1ELOA 2ORWA 3A4NA 4RKFA 1CR0A 3V00A 3L8ZA 2IYSA 4LZZA 1S3SA 4OYHA 4XVUA 2J0QA 1E2HA 1D6JA 2EWWA 4O25A 2OBMA 1E9EA 1Y63A 2W6JD 1ZYUA 2WKRA 3A1VA 3KJIA 4OJQA 3E5HA 2P5SA 2ZR0A 4BWYA 1VG8A 1M7HA 3ZZTA 4BFZA 1FOEB 5JJIA 4F93B 4PPNA 1P2UA 1JJVA 1SXJB 2X19A 3BB4A 2C96A 2GF9A 4URYR 4NYJQ 3MFYA 4RZ2A 3A1WA 2WOJA 2RH5A 4B6EA 4RD6A 1E2FA 2CCKA 1QVAA 2N42A 4KXFB 4MGKR 1ZD8A 4P32A 5HCIA 1COWD 2VF8A 1E79A 1I4LD 4JKIA 3RDPA 1PLLA 1YR6A 2FZ4A 2FH5B 4LJAA 3W34A 1HE8B 1IONA 4JLDA 1G6OA 1E79D 2ZRAA 5EXPA 1IXZA 4B76A 5BXQC 3KQLA 3MD0A 2BMFA 1JXMA 3I73A 5F98A 2AK3A 1IY1A 4LOAA 1ANKA 2QENA 3QPUA 4BFTA 2GDJA 4C7OB 2CDNA 3KJHA 1X8JA 3KUDA 4TYPA 2PZEA 5FTLA 3FFAA 3B5JA 2NQ2C 3O8RA 2JDID 3CPJB 2BDTA 1G21E 2RGAA 2XJ9A 1TEVA 2ZS9A 2WSSA 3ZZ0A 1DAGA 3PUZA 3QKRB 2WVJA 4Q4AA 2FEOA 1EX7A 1BS1A 3BB1A 1IXRC 3RC3A 2D62A 4R9UC 5FBWB 1XMVA 3B9PA 1HV8A 3GP8A 2C99A 3NWJA 4RY2A 1PLJA 2NO7A 1Q44A 5AUOB 2FSHA 1P9WA 2IS2A 1OKKD 1VMAA 3HU1A 4DSOA 1W5TA 3EZ9A 3CH5A 1CBUA 3Q8XB 1ZNXA 2IEYA 4QBGB 4PC3A 5CM8B 2YJTD 3VX4A 4CEIB 4JLBA 3T35A 5AJWA 3TGPA 3CONA 1KK0A 2ORVA 4FMDB 3MJHA 4XVRA 3ZQ6A 1R0WA 2LCFA 2JLYA 2B92A 4KFSA 4C0HA 3X1XA 5FUYA 3AVYA 2EVWX 3M0EA 1NN1A 4C0KA 4JVLA 3R9IA 3TW4A 4WZBE 5AJZA 2XTMA 1G7SA 3PENA 5HCNA 3U4QB 2D7CA 2IW3A 2EWVA 1EFHA 1SVSA 3UWOA 2R6AA 4PZLA 2EQBA 2RMKA 4JLJA 3UMFA 3D31A 3PEWA 5KOYA 3T15A 3D7MA 2GAAA 3K0EA 4HAUA 3RS0A 5C46F 4FCVA 2VHTA 5FOWA 1CF4A 3BH6A 4B34A 1GM5A 2V7QD 2ZE5A 1W0KD 2QM8A 1KYIA 3EZFA 3PV0A 4ARZA 4F92B 1KNQA 2IYLD 4Q19A 1G19A 1S1CA 4V0KA 3CF2A 5JS8A 3EPKA 1EFTA 1UFQA 2HDNB 3LNCA 4CZ2A 4P4TA 2XNDD 4AYTA 2ZSEA 3ZVLA 5FPTA 2X2EA 4WA7A 4A6PA 4HZIA 1L8QA 1XCGB 1NBME 4LHXA 3TNFA 4MA4A 4PR0A 2OO7A 2GCPA 4HB0A 1UBGA 3SC3A 3RHFA 4C4PA 2WWYA 3LO5A 3DPUA 1PLKA 2FV8A 2ZUDA 1G64A 4LHWA 3MCAA 3QBTA 1FNMA 3KL4A 4MYTA 1M74A 2DB3A 3EWAA 3UK6A 3CW2A 3EG5A 5CYPA 4OQXA 4JL6A 3KXKA 5DI3A 4D26A 2WOOA 3FHOA 3N2EA 5SZKB 3OAAD 2YYZA 4M8NE 1E1QD 3RS5A 4GP7A 3LXXA 4RCZA 2JJ2A 4RKEA 4URVR 2A5JA 3NVAA 4DJTA 2J7KA 1AQYA 4Q7KA 4TMWA 3MJRA 4TLAA 4MGYR 2ZM5A 4V0OA 1WBDA 2GZDA 1OFUX 1ZM3A 2J7PD 3NIBA 2ZANA 2C04A 3I8XA 1LW7A 2ZVPX 3K9LA 4LPSA 1IY2A 4GL2A 2ERXA 4HZUA 1JALA 3NBXX 2XOKA 4GDFA 4JT4A 1XJ0A 4IXMA 3SS8A 1QG4A 2NTYC 3Q5DA 4M2LA 4AC9A 4DT1A 2ZSFA 1UKYA 5DI9A 2QTHA 2WM9B 4EJSC 1XTSA 4HB2A 1P2SA 1GRNA 2OCAA 2VP0A 3QXXA 4FCWA 4FMBB 3LXRA 5JJLA 3QXCA 1C4OA 3NHBA 2JLWA 2DFTA 4DXAA 4V0NA 4ZKDA 4US2R 2FDCA 3RS2A 1T9HA 3T5GA 4Q21A 4XSHA 1SHZA 1ZUNB 4KVAA 4OJKA 4TQAA 1D9ZA 3L0PA 1X86B 1RIFA 2FGJA 5BWMA 1VYVA 3GMTA 1OIVA 3MWLA 4MKGA 3TQCA 5JRJA 1XX6A 2XITA 3K0AA 5DN6A 3LWNA 5G3YA 1U94A 3VU9A 1SVWA 4XD7A 2GXAA 3I61A 1CJMA 1T8UA 2FNAA 3SYNA 1R4AA 4TMXA 2OFOA 4NCHA 1QHYA 1Z28A 3AVWA 2QROA 4NE2A 3ZVNA 4TSFD 3TMKA 4DDUA 3DHWC 3QKRA 3AKEA 3T34A 5KDOA 1N6KA 1NMYA 2LKCA 2P3SA 5J40A 1Z07A 4CVNA 3PEUA 3X1DA 2YOFA 4MQBA 1SXJC 3K09C 4A15A 4HAXA 2W00A 2QGZA 3P1JA 4Q4HA 4HSEA 2IYZA 2OBNA 4TZ6A 4OI0A 4E07A 1ZNZA 3KTAB 4ZKEA 2OSBA 4A2PA 2A5YB 3QXSA 4MITA 3UANA 3W3AA 3QF4A 1MOZA 4E03A 4RJLA 2FGKA 1AIPA 2DHRA 5JI2E 5K8UA 4TMKA 4PTLA 1S8FA 4B71A 4JYCA 2AD1A 4F7WA 2F43A 1W2GA 4S2EA 4CEJA 3DM9B 2RHDA 3RS3A 1N0VC 1QDEA 4NP6A 1HA3A 5LB2A 4G01B 2YWEA 1KIMA 2JJ2D 1YE8A 2X2FA 4DLSA 2FFBA 1Q20A 1E9DA 4D2IA 3C41J 4QL3A 2Q3FA 3F8TA 2QP9X 4DDVA 4M1KA 2OXRA 1SULA 1M2OB 4EQ6A 2PZFA 3FFBA 3VNVA 1U99A 3VR6A 4UJ5A 2ERYA 5CB6A 3K8YA 1RRPA 1VIAA 3W5JA 1MR3F 1CJTC 2ZYTX 1YZUA 3MRSA 1UADA 1G16A 5L3SA 1Z6XA 1WMSA 2ONJA 2EYUA 1RPZA 4QBIA 3G82C 3ZYCA 1YZTA 3BOSA 3O8DA 4DDTA 4U5XA 2IXGA 1BIFA 5G41A 4ZCMA 5B64A 2ZUBA 1SVKA 2W6ID 1G3RA 3BFVA 4CW7A 3LBNA 3U3JA 1OB2A 2PCJA 2ZS7A 5KPDA 4JT2A 5GJVC 4LJYA 1M7GA 4O0MA 2UVQA 1MRNA 5EZ5A 1H8EA 1G7TA 2F1JA 5GJCA 2IYTA 5DI3B 5BQ5A 1KI8A 1FFHA 1MO5A 1MRSA 1J99A 1U9IC 3U3KA 2BJWA 5FBVB 3GFTA 1MO6A 1NLZA 4YMTA 1JEDA 4IVRA 4E22A 4EDHA 3BS4A 2B8WA 5KNDA 2OCBA 4OK3A 4TLBA 3EA5A 1F3OA 1KK2A 1NVVR 1Z0JA 4BLPA 2G1JA 4KBGA 1HT1E 1IM2A 2EW1A 4CRWB 1NIJA 2ZRCA 2WV9A 4HDCA 1G7RA 2QA5A 4L8GA 2NO6A 1ONBA 3NEYA 1W2HA 2YOGA 2FOLA 3QUSA 3B6EA 3AB3A 3G5UA 1ZNWA 1GRQA 1E9FA 1Z29A 1E3MA 3HPQA 3N5CA 1CR4A 2IBMA 1G41A 4BFVA 3AVPA 4IKEA 1P2TA 1E2QA 1GWNA 1R5BA 4C0QC 5TB5A 2O0JA 3OZXA 2G0NA 2OXCA 3B1ZA 2RGXA 1S1MA 2QT1A 2ZRKA 3T5DA 1LY1A 1RRFA 4RZ3A 2BCJQ 1ZM9A 1ZM4A 4XVQA 4PFSA 5C1BA 3DZDA 3TW8B 1A2KC 5JECA 1I2MA 5HTKA 4Q9KA 4R2IA 5IT5A 5LD2B 1KO1A 2AR7A 2GCOA 1DEKA 4Q1AA 1RC8A 1I4TD 4HAWA 4FI3C 1RRGA 3J81k 3VQTA 3IBYA 4D0LB 5IHPA 1T6NA 1NVVQ 3R8FA 5KSOA 1D5CA 3DL0A 5D3QA 2V1XA 4NCIA 2ZVQX 1II8B 3MUFA 3M1IA 1D2EA 1ZM7A 4TZ0A 2V55B 4ACBA 4GZMA 5AUPB 1US8B 1KAGA 4RD4A 2QM7A 4HDQB 5JS7A 3FOZA 4GOJA 4HUQA 3U7FB 2VHUA 4AG6A 4DDWA 3NG1A 3QG1A 2ZJBA 2BIFA 1KHTA 4TL8A 1P6XA 3L8YA 4D25A 1BMFD 4EPXA 4CYMA 1SVOA 3DOFA 8OHMA 1Y3AA 2J45A 2QMUA 4D6PA 2RGNC 1RRCA 4BFYA 3KFVA 1WQ1R 2Z4SA 5E95A 3GFPA 1ZIPA 5TARA 2JATA 5IK2D 2O8CA 5FR2A 4I1OA 4C0JA 1NJGA 1KK3A 4B3XA 3TBKA 2J1LA 3C4JA 1Q1EA 4B33A 2Q9BA 3TE6A 4OI4A 1KI6B 3IIMA 4YDSA 5IK2A 3GLGB 1IN5A 2YKGA 2OV2A 3LLMA 1TQ6A 4NYIR 2F43B 4BFXA 4PHHA 1EWQA 4MYUA 4M53A 1NVWQ 4JSYA 3PR1A 2AFHE 2LKDA 3CRQA 1Q1BA 1Z6AA 3F0TA 3L2OB 1E6CA 2NPFA 4DLTA 1TQ2A 3E2IA 3SFVA 4A8JB 1EWRA 1T3LA 5BN3A 4NYJR 2PT5A 2ORIA 5EP3A 1LF0A 4QHTA 1JI0A 1YR8A 4DBLC 4LJ9A 1P73A 2QY9A 4PAQA 3MG9A 2OZEA 2PBRA 3KKQA 3QVUA 4DLUA 4G5SA
chains in the Genus database with same CATH superfamily
2C9CA 4HHEA 1PR1A 2BEJA 1PTJC 1J0DA 2WAMA 1A82A 3FGPA 1IWBB 3LDUA 4Q15A 3UC9A 4B74A 3C0KA 3D2LA 1EK2A 1PN3A 1XZKA 1S6YA 3DW1X 5C34B 1ZG3A 4Z7OB 1ACLA 2CZCA 4OLAA 2LCIA 4YVFA 1QLWA 2GGSA 1QIEA 3K0KA 4K28A 3HB4X 1N8NA 3JWEA 1U1DA 4RWZA 2I6GA 5L9AA 5L8VA 3K5HA 3WKEA 2KQUA 2O14A 4J8PA 4G37A 4F38A 3EFOB 4I0WB 3U09A 3IELA 4MROA 1JG1A 4CM8A 1X7WB 1ZD3A 3Q6MA 5FHRA 2M6LA 2EG9A 1W4AA 2XUDA 3WNBA 1MAVA 1ISPA 1CXZA 3D4PA 3WLOA 4EY6A 3AF6A 4MVJA 4C4AA 4NZYA 2XUAA 5A2QA 5FTNA 2PX5A 4U1RA 3H9UA 2YYSA 4F56A 3EQ8A 3SHWA 3I6BA 1H1DA 1CJCA 3L7MA 4AY3A 4Q4LA 3HB7A 5E7IA 2QP3A 2ODPA 3RFUA 2JASA 2RHTA 5A05A 3IT1A 1YR3A 4I6EA 4Q3KA 4X60A 3MXOA 4RK7A 3O95A 2IZOA 2C7PA 3EIWA 5CTAA 3TE7A 4B44A 1E4OA 1HT0A 3VTKA 4ZYXA 2M6SA 4EEXA 4ETMA 1TO6A 2DMRA 2X0JA 3EGDB 1GUDA 4FBLA 4H1VA 4EHJA 4Z4HA 1IZ8A 4I9FA 2OYRA 3FDFA 1SUFA 4I4NA 2CLSA 4AM8A 2JLXA 1PK8A 1JHMA 1UXHA 3CLHA 2J33A 3H13A 3IMEA 3IILA 3G2MA 5FL3A 4ZIRB 1Q3TA 1GQOA 1Z5WA 3A4VA 3HV0A 3LV8A 4I99A 4YAKA 2R11A 2AR0A 2H06A 4ENPA 3H04A 1U4SA 1F38A 4K26A 4M54A 4CI9A 3U5TA 1JB9A 4JYBA 2HRZA 1W73A 5BSHA 3CPEA 4HBGA 1A27A 4PQYA 5ALWA 1XZDA 2FSGA 3NHLA 4PO8A 4QTTB 3S2ZA 3F5MA 4NH0A 3D54D 2P2ZA 2YN4A 2OLJA 3IVGA 4XJSA 3FCEA 5LBUA 5E6UB 1UXGA 3TIGA 3R6GA 4M86A 3F46A 4MJXA 5GY7A 3OCVA 4CM6A 3B6MA 2HZ7A 3G17A 3JQ7B 3HACA 4G0VA 2XY4A 2D5LA 2J0VA 3CHYA 2VQSA 3IA7A 4CN8A 1DXYA 4LHZA 2ECKA 2QGFA 4GOOD 2WPDD 4NVRA 4OY3A 4CLRA 4EJ2A 2HLNA 4GM1A 1J1UA 4G0YA 4PHFA 5AM1A 3RK0A 4KHPB 2XHZA 3I4LA 3WWEA 2YC2C 4D9MA 1IMOA 1RLJA 4Y6PA 2ZZNA 1DQZA 3G7SA 2WTUA 5AQEA 5KQSA 1Q22A 2WJ4A 3DQPA 4PZCA 3MF4A 1V0JA 4P9NA 4E5NA 4TS4A 1SXJE 3L6RA 5F5LA 3UFXA 1KO8A 3LHIA 1E6MA 3G23A 1T36A 3WWPA 3FHLA 1E4YA 3MLEA 4CHTA 3D5EA 2WTAA 2DQKA 3CVWA 3THXA 3S2EA 1FDRA 1WW2A 4EY7A 2TMDA 2H59A 2DKOA 2P2NA 3TXAA 5CA0B 2VNIA 3MJTA 4TLEA 1HZZC 5E7MA 3T1VA 2DPLA 4ZT6A 3USZA 4CCAA 2ZRGA 3CO0S 1PU2A 3V7YA 1ZMRA 3Q3HA 1V8PA 3LAWA 4JSRA 2QTGA 4LDJA 4LYAA 4UPDA 3VOTA 4EYOA 3OQOA 4FIDA 3W3AD 1A7AA 5LJLA 3PC3A 1JHQA 3Q0TA 2D74A 3GPLA 1WZCA 4DR3B 1M1YE 3TCNA 3TQRA 5JW6A 4OL0A 1DTEA 4CM5A 3GN2A 2ZPTX 1V48A 4CIDA 4K40A 5DO9A 1NUQA 3O6VA 4IXWA 2W6ZA 4GZLA 3ANNA 1E9BA 5HWSA 4IWYA 5F23A 1YRAA 1S2IA 3TW6A 3IHLA 1R7RA 2ZJ6A 1F8YA 2V03A 3BHNA 3ESQA 1R0RE 2RAFA 3TLGB 4A4DA 4KXVA 1WPXA 3CRNA 2PD3A 2CXPA 4M1WA 1SXPA 3L06A 3JQDA 2QPTA 3EFBA 1N25A 4C3UA 3SAJA 4RNDB 4GZ5A 3OP4A 1FP2A 4TUYB 4S24A 4JKYA 4V24A 3NAMA 3PRHA 1PRYA 4WI1A 1XI2A 5FPPA 4PLCA 4QUAA 4AJOA 5KYYA 1WV0A 4UNIA 1SNYA 2VHJA 2BTQA 4QU9A 1DKNA 1TIBA 2E48A 1Z5UA 1EKXA 1U3WA 4YJHB 4RSGA 3HH8A 1FQWA 3MTDA 4Q02A 3K6SB 2XUOA 1BE1A 2B1JA 4DIDA 1V8FA 3O1HB 2CNLA 1HNZB 3MWDB 3FI9A 2FMUA 1KXJA 4YAOA 4G1EB 1E1RD 4LK2A 1FBNA 5EZYF 3AESA 3H2BA 1XV5A 5J5AA 4M6WA 4YUVA 4D8XA 3EDQA 4DW8A 3W5SA 2ZZKA 2FWPA 3CKMA 3MGKA 5AW4A 1OLUA 2IYVA 1HLGA 4MTCA 1TXGA 3N70A 3GRPA 3PYXA 2JKVA 3OJLA 3PNKA 4WVLA 5AJXA 4UKDA 1EVEA 5AI0A 4D0SA 1O87A 1XU9A 4R3NA 2JCVA 2A0KA 1JR3A 2QTTA 3HYRA 5E6SB 4JB0A 3O31A 2W2OA 5JCJD 3RVRA 4UVIA 3NUQA 4KIJA 3UPUA 2G1AA 4RU1A 5FUXA 5FUBA 4QM7A 2DYKA 4V0SA 3TKAA 2EJUA 2OPHA 3UT6A 3GMSA 1GRVA 3CVYA 4US1R 1M6WA 1CRPA 1M76A 1PJAA 4EJSB 1CUFA 1CP2A 3QX3A 4EI2A 4MRVA 1AT1A 3K1YA 5FI5A 3B6IA 2LVBA 1R00A 2XBUA 3PDWA 2FP4A 3L8CA 1GPH1 1VPDA 1C8BA 4TV9F 5GONB 3L0YA 4JYAB 1L5OA 2WJAA 4BZWA 1DSSG 1JHPA 3WGHA 3FCCA 3CW8X 1BXGA 4XCXA 4ENQA 2PNFA 1ZDMA 2BR3A 4Q1BA 4HFNA 4L1KA 4B3BA 4CF7A 4OXXA 5DBEX 1QR2A 3MWFA 3VHXB 5TX7A 4CI0B 1DO2A 5JMTA 3FIJA 1P18A 3AEUB 2QYHA 3B8HA 1VPWA 2V4ZA 3GXBA 1KRWA 1AG9A 1E9AA 2GNOA 3ETCA 1QHXA 3G2QA 4ITRC 4P22A 2Q9UA 4WBXC 1QHNA 3AI3A 4AAYA 1OH8A 4N48A 3NTUA 2QQ5A 4PCLA 3O94A 1PR5A 5AKHA 4BFWA 3CZRA 1XDUA 4D44A 4DUYB 4OB6A 5BN1A 2B4RO 3QZUA 1AGXA 4KQ9A 3GT3A 4PINA 4BUZA 2OG2A 4JJIA 4QXAA 2B1QA 2CD9A 4LNAA 4D3XA 5DMXA 2EKLA 5B1SA 2IS4A 4EG3A 3C3DA 5CYOA 2JBAA 4Q4DA 4P54A 4LZLA 3MQFA 2ZRMA 5BVGA 4MYRA 4J07A 4U7PB 3LF2A 2QAGB 4BP3A 3C70A 3RS7A 2A5LA 3RTAA 2K4MA 1UKAA 1Z38A 2GKGA 4HS4A 4AO6A 4NL4H 5DHFA 3L1VA 3WO1A 3O4JA 2WU8A 1HYBA 1N3YA 1RS0A 3L93A 5K3FA 5KDDA 2BWJA 1EK5A 1ID1A 5KX5B 2H57A 1S2GA 1WX1A 5J58A 1DIRA 3T95A 2V3CC 3WQHA 3T3OA 4I55A 1QH9A 2CXSA 2AEMA 4MS1A 1QVWA 2OCGA 4CMAA 5EC8A 4EHBA 4YAEA 3GCGA 2FPIB 4Q4JB 5CP8A 2HSDA 3THWB 1Z4PX 2C5GA 2IY8A 3C7KA 3E70C 3F78A 4PYMA 4X92A 5ADUS 5FQOA 2F8TA 3TQFA 3NHJA 4YAJA 4B7XA 5KAMA 5E7JA 4IEFB 4U2BA 1XAJA 2XZTA 1F0YA 2VJMB 3T94A 3IE1A 3HKBA 2JCSA 1B3RA 3PUXA 3WRXC 2VDLB 2V1UA 1O6ZA 1ZRSA 2RDMA 3DOJA 2YJZA 4X97A 1B1CA 1GUFA 3KUCA 2E5WA 3HVJA 3NTVA 1OLSA 3B7PA 2WYIA 4G0QA 4GSYA 5K4GA 5LL6P 2OCXA 1TVEA 3N2GB 1CZHA 3T9FA 5BXYA 3DSRA 4JP5A 4DV1B 4ENVA 4GMFA 1NDQA 1YV9A 4C7VA 4IRMA 1DJMA 2BEKA 5CA1F 2B3DA 1TF5A 3H1FA 5B37A 3AWDA 1CQJA 1EJ6A 1L4UA 1OPRA 1F12A 3P2KA 3D8HA 4HATA 4A0HA 4ZYWA 1L7NA 3JAKA 1C0LA 2JFNA 4BTEA 4OUDB 1RM0A 2A3RA 1AMNA 3PKIA 3ROXA 1R9MA 5HBGA 2EFGA 1PL7A 4CKZA 4IWNA 4C78A 1VBKA 3VDQA 3VJKA 4ALNA 1PDVA 3MJSA 1ZOLA 3GEHA 4EAQA 1FFCA 1BQ3A 2CL5A 4RTKA 3B20A 3F4BA 2QDXA 4OK5A 1U1EA 3E81A 4P08A 2IH4A 2XQJA 1ULZA 1KL7A 3BN3A 3H9JA 4JBLA 4Y6OA 1A4IA 1CZNA 4QXMA 2WIJA 3IPYA 2JK1A 2ZSKA 1P77A 1TMKA 4R51A 1QE0A 3WFJA 2C7RA 5BVHB 1XXLA 2Q2VA 2ODNA 1NMZA 4PM4A 1RYYA 3L3BA 3M6AA 3B1YA 3GAFA 3O92A 1DIBA 1ETUA 1OZFA 2I80A 5EPEA 3RJTA 4JB8A 1TJYA 1USWA 2FWRA 2HNAA 3GLHA 3EASA 4WVFA 5EVCA 2XXAB 4G4GA 1NE7A 4TL6A 1GITA 3M2TA 3JQAB 2YVAA 3SDZA 1NI4B 4LWQA 2EFHB 1YHNA 2P1ZA 2G9VA 5AKJA 2X0DA 1N5MA 3FNRA 3AR4A 2E4AA 3K4QA 3FSRA 2AX4A 2R4UA 3TLJA 4HL6A 1BHJA 2HT6A 1QYCA 1V2HE 2VYVD 4U00A 4Y2JA 3TEMA 1MQAA 3QXGA 5EKUA 4X8MA 4ARCA 2XDQA 3CNOA 2ATVA 3L0SA 4OEHA 1L9XA 3PGA1 4EMUA 3RIXA 1L8LA 3W7AA 5KHLB 2V6IA 2L18A 3JZIA 4X8HA 3T12A 4NPHA 4L6CA 1UT6A 3KTDA 2RKWA 2PT7A 5KTOA 1BGVA 1WUIS 2ZB8A 3DE0X 2MSLA 2AMYA 2VQDA 4G36A 1ZCFA 3GELA 4DJAA 3ISJA 2FUNB 2DSTA 2RHGB 2KBEA 4JY7A 3DYVA 1WPQA 1N5JA 4JL8A 1MFZA 4YALA 4DQDA 4C3OB 5JZMA 1Q0TA 1D03A 4PN3A 3WMRA 3A4YA 2IXFA 3TK1A 4GM0A 1DELA 1MENA 1WF6A 1SUIA 2RGWA 2YRWA 3AR8A 5EJ8A 2VF2A 2O6LA 4Q1DA 2WMNB 4N01A 3G2JA 3W8RA 4DMHA 4JX8A 4KAJA 5SY9A 4G0NA 3LE8A 2EOAA 1E5LA 5JTTA 1ISJA 3H99A 1NJ6A 3AYZB 4OA8A 4MPPA 1ESMA 4M8SA 3ROFA 4K6GA 2OFPA 3HL0A 4M99A 3BE4A 4FYXA 3ZIAD 1JFRA 1QCZA 2OBLA 2NVWA 4EGJA 4MEJA 4CEHA 3DEHA 1I6KA 1OPXA 3M6LA 5T6BA 1G7CA 1W0JA 4BLRA 3IEXA 5E4TA 1Z26A 2B8EA 3L43A 4KNYA 3N07A 1LLQA 3BWMA 4KQCA 4G23A 4DCNA 5JFTA 4M55A 4DBZA 4HQFA 2GB4A 2HF2A 3QKTA 3EIEA 1C0EA 1QMGA 2PLAA 4QJ5A 1YB1A 4D82A 3WLJA 1J8QA 3HE3A 4ENWA 3IKTA 1MZPA 3E0XA 1SCAA 2HEIA 4O63O 1VKOA 1U0OC 3ZHCA 5JLJA 3ZCXA 1UBLS 1I5OA 1ND6A 4BQEA 3GV0A 3PCTA 3AUKA 4HGRA 1Z39A 4IIUA 5B57C 3FKQA 4ZCQA 2XVXA 5IJ0B 3WE7A 4PGFA 4QPZA 4MVJF 4ARZB 3MJDA 3IUSA 4NZNA 4ZV7A 2XOKD 2DSNA 4JJ8A 4ZDJA 4BXOB 3FCSB 1HF3A 2ZYDA 1U28A 3FZNA 3DE3X 1SQFA 5BR8B 5IP5A 4BN4A 4PIMA 2QBYA 4MDHA 4RK0A 4DG9A 1RZ3A 4DLKA 5J3JA 3FNBA 1KTIA 3KJQA 2KBFA 4YJFB 2R62A 5ULLA 4A03A 1G5PA 3WNDA 2D3TA 4N0MA 2D1SA 2ZXFA 2HA4A 2H1LA 3BJEA 4ZOAA 2F1OA 4YXWA 1DKRA 2F1IA 3KKEA 3U7HB 2VHCA 3GFRA 4EI9A 1E1YA 1B00A 1OC2A 2OK8A 2GK6A 4KV9A 1QBKC 3QU4A 3P26A 4MZXA 3UF0A 4BRWA 1GU7A 3AOEA 3AKCA 3KZCA 4IIXA 2GD0A 1DP4A 1WV1A 3E9YA 1JR6A 4F4IA 4XYMA 4AWBA 1T9KA 4BNJA 3DYIA 3VFDA 2RBKA 4GMGA 1DHTA 2IPLA 3BQMB 3I2JA 4R54A 5LQRA 3WLFA 1UKZA 4CL3A 3QE9Y 4U2KA 3W8NA 4LOHA 3VR4A 1RI3A 3GJ4A 4NHOA 5K3OA 2POCA 3EDYA 1C7FA 2DFVA 2V0GA 3DTVD 1RHKA 2YBDA 3QYJA 2IW1A 2JZOA 2XTJA 4BNVA 2QORA 4EA8A 3PPXA 5GWXA 3DWFA 1I13A 2XCTB 3MQ2A 3IJPA 1KKMA 3C4QA 4R7TA 4BOYA 3K31A 2AE1A 4DOMA 2AMJA 1OHHD 1GV0A 1FUEA 2SCUA 3MT9A 3TBHA 5L3QA 3AU8A 2EEPA 4LNUB 4FGUA 4MW2A 3QLUA 3I9KA 1IXYA 4HO1X 1Y7TA 3EFEA 4KXMA 4MV5A 1VLHA 5ERGB 5KKNB 2HLDA 2GZSA 5C80A 4CNBA 1KI9A 4YA6A 3HN2A 3E9ZA 5JQWA 1O95C 1FYFA 2PZKA 2D1QA 5JFGA 3HMQA 4C4RA 2AG6A 3NVDA 3LWDA 5F2NA 3PXDA 4OL9A 2XVZA 3TZLA 3VZCA 5A4AA 7MDHA 6REQB 3N39C 4U0KA 4EG8A 4AG3A 4LMBA 3HCRA 3QENA 4M46A 4LJ5A 1QOQB 3IEIA 1EGVB 4R81A 2YWGA 1B6RA 2OP0A 1L5QA 1IWPB 4QC2A 3MTQA 4B2PA 3UNXA 1OVMA 4UFPA 5L7YA 3AIOA 3LBFA 1UT8A 3PLNA 3F73A 1UBJS 1JQ3A 3PL5A 2PM8A 4JCCA 4LGYA 3RJMA 1YJAA 5FWDA 2W6JA 5B55A 3ICVA 5K6AA 4IJKA 2PZJA 2INGX 2NVOA 3DD1A 2HK9A 3GT7A 4AN1A 4JUIA 2BMJA 3ELUA 4F71A 2A9OA 2V58A 4UFOA 5HKAA 3Q5GA 3TPFA 4B3CA 1VYTA 2BGWA 1ZJJA 2PWPA 1AXEA 1L4MA 2H7YA 3U7QB 1BNCA 1UT5A 4HRAA 5I47A 4NU0A 4EHIA 3GRCA 4LOLA 2OQ2A 1W8DA 4J3JA 4YXWD 2QE6A 3KR1A 3DV9A 5EMJA 2CNOA 2CXOA 5AVYA 3FETA 4YJ2A 3KV3O 3T5MA 3VU3A 4DYVA 3UB2A 4E2WA 4XGKA 1L1RA 2C8LA 3IQDB 1M1NB 2JAWA 3M4YA 3DFMA 4H7PA 3BXEA 3DFKA 2BM9A 2V0CA 4TYNA 1JHUA 2Z9CA 3C1UA 4HB4A 1KJNA 3WMWA 4CEJB 1A4UA 3GFVA 1JDPA 2W8BB 1REQB 2DFLA 3SXUB 3ICQB 1P1IA 4RF2A 1MT3A 4XUDA 1V5EA 2ECPA 3HKEA 3HVIA 3JQ9C 3P9QA 1G4HA 4AQDA 1FVFA 2YH2A 3AHIA 1GGVA 5T67A 1EBBA 3DMDA 4OYYA 3RI3A 1C9KA 4YY3B 1FP7A 2VHVA 2WTEA 3C14C 3K16A 4RUKA 3WJ2A 4ZZ0A 3U3XA 4E2ZA 4DADA 1SCUB 4D8VA 2WMDA 3DBLA 1P1BA 1TUEA 1VJ1A 3B1WA 3BXXA 2FCAA 1DI0A 2HLHA 3LYHA 1YE3A 1OQAA 4V2UA 1Q77A 1QGOA 2XD4A 1RWWA 1OLXB 3GFOA 5HEKA 3RARA 4AI6A 1IJBA 1W36B 4MRNA 4EY4A 3BGVA 3DV0A 3U4AA 3C16C 5EWJB 3MT8A 1XD9A 2FKNA 1HYQA 4ARBA 5BNFA 4DEYA 3KPYA 3LT4A 3RPEA 4BU0A 4Q4CA 1PV2A 4ZYTA 1E63A 3OZRA 5D5HA 5HHTA 5DHQA 1DBVO 3EOZA 3RUFA 3KOMA 4CL8A 4QQFA 2HXGA 3RRFA 2FEKA 2QYOA 1T4CA 2J5KA 2W2LD 2BONA 1IBLB 1S96A 2W98A 3H4IA 4KO3S 2A14A 4G81A 2ES4A 4EB0A 5E1MA 1U8TA 4BN0A 3AQIA 3SNKA 3ACCA 5DV9A 5HZHA 2NPIA 2P8JA 1X7XB 2R4QA 1DZ3A 3HDTA 1J0AA 2CEAA 2QNBA 3EZ7A 4NBNA 1L4NA 2VSXA 1KMIY 4ZAVA 1LUAA 1NM5A 1DQNA 1G8KA 5DBFA 2VYND 2JFBA 3SHOA 1Q2UA 3OQHA 1K8QA 2NT3A 5FPKA 5IN4A 4GHWA 3LYLA 1Z63A 5FNVB 4QUDA 1R37A 3IP8A 4KV7A 2HMUA 4XSVA 5ALVA 1XJQA 2ID8A 4GVPA 2VK1A 3RHZA 3D0RA 3WYBA 5C8DA 2B34A 1FMFA 4DLYA 1AHPA 4WCFC 3CINA 4BVHA 1Y3DE 1X77A 4XCQA 1KQFA 2XKKA 1A4RA 1R4NB 3UK7A 3PGXA 5TLSA 2D5AA 4N5MA 5AK0A 2O07A 5H81A 1N7IA 1RAEA 1U5BA 2J5BA 2QNIA 3FG9A 3P0IA 3UWMA 3KU4A 5JISA 4KFCA 3FTNA 4F8EA 4DCTA 1E58A 1UJ2A 1ZUIA 3P27A 3FJYA 5JLAA 3TOXA 1T0HB 1IRXA 1Z0DA 4G5HA 4FZ3A 3UTDA 3PPWA 3DOEA 1E69A 1J9GA 1BOFA 2BDUA 3FOCA 4H3SA 4J49A 4Y6LA 2FXIA 5A6VA 5I01A 2REXB 3ABIA 3GGOA 4GM4A 2RCNA 5FQNA 5TJHA 3G0HA 3E9NA 3FVVA 4W1RA 2ISQA 4LUCA 1U90A 2DH5A 3A6GA 2FWIA 3KVVA 1E7SA 2FSSA 2PZAA 3AFIA 4XSGA 4GX5A 1D3AA 3SJCA 1KEEA 5JCXA 1Q3KA 3LCRA 1Z74A 1ZH0A 2Q9CA 3FMGA 4MI6A 4ZK2A 2XH8A 3I9OA 1VL2A 4NU5A 4B6QA 1O0BA 1YGPA 1JH9A 2ZK7A 3AF2A 4NV0A 4DUPA 3U62A 1RFLA 5BP7A 3GPIA 5AVKA 1O96B 4BWGA 3QU5A 5M29A 2I3AA 3TLKA 2IEIA 3BKXA 2VJOA 2P9HA 1RQPA 1E2LA 1DADA 2EZ4A 3ESYA 4ZT5A 3SIRA 4M1TA 4XGNA 3UT0A 1X1SA 5AW3A 1UBKS 3CLKA 3O7MA 2I78A 4URXR 1NQAO 4G5OA 4B3DA 4AKSA 5FIUA 4LV6A 1II8A 3BK7A 4QQ8A 5EE1A 5AXBA 2DQSA 3EZXA 1VSUA 2TS1A 4JWKA 4YAFA 3S8MA 1QVRA 3A0UA 1RYDA 2CT8A 4ZXFA 1SU6A 5CM9C 1MIOB 4LGMA 4RE5A 5TQ0B 3K5WA 1EA5A 2XKBA 2IZZA 2EV9A 4UOQA 1NE2A 4U4AA 4QOGA 5JSZB 3NJRA 4M8KA 3I0ZA 4HAVA 1Q7GA 3OCCA 5HJEA 3Q8MA 1GPNA 4IDDA 3RJ5A 4PYIA 3WK5A 1DOAA 2X8AA 4HH0A 4N18A 3ZDQA 1BS9A 2VJDA 3MA0A 2GXUA 5CDSA 3SQWA 3T3NA 3FDZB 4IHJA 2PVCA 3IXMA 3ZTYA 1BA2A 2VPTA 4G0PA 2LWIA 2P0EA 5DH9A 1FFYA 5IM4F 1PG5A 3ORFA 4L4UA 1NR5A 2DOKA 4QBFA 1XZIA 2H4FA 5MN6A 1R2QA 2O3QA 1VKZA 4HJXA 3S3TA 4Z7JA 1NPTO 3UBMA 5FFNA 2FWBA 4ROSA 1JT2A 1KIAA 5IS2A 1X1BA 4DRXB 4EVQA 1POWA 2VPWA 3UIEA 2XYRA 3OFND 4PG6A 1VE3A 1EX1A 1LH0A 4GLOA 5ALZA 2PKCA 2A1UA 2CLOB 2OWEA 3LPLA 4X8LA 5K0JA 3Q3EA 1PHRA 3SC2A 3WKBA 4C14A 2H11A 2XMGA 3CPHA 2A4MA 3KYDA 5BV0A 4BE9A 3WJAA 1Z36A 3EVEA 2GYVA 2IVFA 4A8JC 3I2KA 2BE7A 3IR5A 4V1CB 5J4KA 1X7DA 2J9YB 1QV7A 3WYEA 3ZG6A 2E21A 2ZPAA 3SYRA 4BFSA 2FU5C 5LMUB 3KUKA 2UUOA 4R1PA 2X3FA 3WB9A 1RAAA 2J0UB 2RAPA 2EW8A 3IX7A 4YO7A 4WCVA 4LYJA 3X1YA 4KSYA 1F9AA 2PZ8A 4M0UA 3X1KA 3M6IA 1JDNA 3FHCB 4LC9A 3WOHA 1WZNA 1JKIA 4OKSA 4J76A 4AB1A 3BCUA 4DWOA 1KETA 2AJCA 4I8IA 3GLGE 2F1HA 5FH9A 1LBIA 1MX1A 1R0KA 3D5TA 3LGSA 4GH5A 3H5WA 4GL4A 4X1YA 2E49A 4HQKA 1M2NA 1XJWA 1PW7A 3WS7A 3RSZA 1TKBA 2ZRHA 3W9UA 1X42A 1DLIA 1YVUA 1XDWA 2R5NA 1NPYA 2E1PA 3BE5A 3T1QA 4FNOA 4AWXA 5MGBA 3L4BA 4BEJA 2GT1A 5H68A 3HRIA 3TF5A 3B78A 1OAAA 4RESA 5FUWA 1ZAKA 4FQ8A 4JUDX 3S55A 3HYLA 1RMTA 2WE7A 4EP1A 2Z6QA 2I62A 1KDZA 3R76A 5EPUA 4MKFA 4J4TA 4TYMA 2WKQA 5IANA 4D0NA 1EFCA 1FA9A 1TJ4A 2J4FA 3SSMA 5KMGA 3CG0A 1C2YA 1ESDA 3INNA 4FMDF 3K2IA 2DUUA 4ZMRA 2XA9A 3AFHA 2OORC 1KBZA 1O54A 4UQLA 2O1XA 1SZJG 1T8RA 1WD7A 1OXUA 2GCNA 4WAUA 2OUKA 3C1AA 4OP3A 3MJEA 1SG9A 1YUMA 2E37A 3AU9A 4IBOA 4LN1A 3V7UA 5JJKA 3EJ6A 4B32A 4CT5A 3K72B 1Q0PA 1HG1A 3BC1A 4X8OA 2HFJA 5FLYA 1ESNA 5F9MA 4F6RA 3IRVA 5PGMA 3IO3A 1X3SA 4DJFC 4HQ6A 5JANA 3C8MA 1L5WA 4MI9A 3KFXA 3KLNA 2H2IA 1K68A 1HUQA 2QY6A 5CNIA 2P65A 2ZJ1A 1LBHA 2VZ0A 4E09A 2O5EA 5K8JB 2BFWA 4DA4A 2Q6OA 1XTPA 4B79A 5B4VA 1LS1A 3K8QA 4Z3KA 1A2BA 1KMHA 2FE1A 1Z6QA 3W77A 4UOZA 4H15A 4UHHA 5DSXA 3UVEA 2GH1A 1Q21A 4WERA 4M1OA 5E9QA 2XZLA 4CQMB 4BFLA 3EGDA 2JGJA 2QUJA 1Y34E 4IZIA 1CPYA 1NUTA 1O5TA 1U0GA 1BGWA 4FYYA 3WK8A 1GAJA 2CHQA 2A0WA 3LECA 4FOOA 1I14A 9LDBA 4IW3B 5IUNC 4FM9A 3CYFA 5LWQA 3LBIA 4KIFA 5EXDA 3VSEA 4A1OA 3TZHA 4KQGA 2JA1A 1ZI9A 2Z57A 3FPHA 1OH6A 3E05A 1UOOA 2BGJA 3BXOA 4YQEA 3PHCA 1FQKA 1Z34A 2H65A 3DKKA 3P52A 2VYFA 4NV3A 2CHUA 1J49A 3IIKA 4NYMR 3O03A 1O58A 3ZE7A 4XI9A 4ZCSA 1KJWA 2C61A 3E3NA 4FEAA 2LRHA 3KWFA 4RC9A 3U40A 3IQEA 1GARA 1IB0A 2EBFX 4RTRA 1RJGA 1ABEA 1ZJYA 2QTNA 2JAOA 1BA3A 1TMGE 2RGBA 4XUGB 1MPXA 3ZJUA 2NP7A 1FZTA 1GGNA 4IH4A 3RO7A 3W06A 4EB6B 3JQ7A 2RD2A 2L17A 1L2TA 3OURA 1W2WB 2QYTA 1OU0A 3DDZX 3RGGA 3M5CA 4JP1A 4KQMA 5HUHA 4YDRA 3UK0A 3ZCUA 1D4AA 2A1TR 4YYZA 1V45E 4RXUA 3NC0C 1T0JB 3PQDA 3T7SA 4MQFB 1YT5A 4Q0MA 5FI3A 4TXLA 2ZJOA 4CFYA 2CHGA 4RV5A 3ROEA 3TJRA 3CLVA 5E9WA 5C81A 5IPFA 1MC5A 4RFSB 3IV7A 2R4TA 2PX2A 5C2JB 3N8HA 1L5LA 3ENVA 2XVYA 4JP2A 4M1YA 3GLFE 5TF0A 3ZZNA 2XTZA 3BCSA 3X44A 4TROA 4GLJA 1KZ9A 1GLVA 3JYHA 1W85B 3PQ5A 3EPPA 1XVTA 4RENA 2P68A 2G80A 1JEEA 3ZWOA 2IYPA 4CIVA 2O52A 4TMFA 4X62B 2IEDA 2V7PA 1UZAA 2P2SA 3DE4X 2O48X 2D06A 5LWHA 1VBFA 2GBCA 1JMKC 3CZPA 1SBYA 3W6OA 3HFRA 4ID3A 4XTRA 4OYRA 5J2TF 3FJOA 1G55A 3OCJA 1Z6YA 2FEMA 2GETA 4FFBA 3BFPA 2Y4NA 4PRKA 2WF9A 3R6DA 5JMPA 3FFTA 1KMMA 2EFYA 3ROMA 3UATA 4BQSA 3GBPA 4C5AA 2ZI6A 5LJIA 4IJVA 4IEIA 3NKFA 4QEKA 1QVVA 2B83A 2ERCA 1QKJA 3GRRA 4W5HA 1QV9A 4KSBA 1TDJA 4ZT4A 2DT5A 1LDNA 2C5LA 2H2AA 2JFXA 2JPDA 1YA4A 1ZLYA 2MDTA 3BJMA 2FR8A 3QE3A 4G26A 4TMZA 4MK4A 2BC9A 2YW9A 3TLGA 2JGAA 2H1CA 3VR0A 3EEYA 2PNJA 3VO1A 1D4ZA 2VJYA 2ZCUA 3L01A 2HRCA 3RYFB 1HURA 3EQ7A 4ZI2A 3L5OA 1FYEA 2G6BA 2QT9A 5TQ2B 1N2CB 3T41A 2YIJA 1NVGA 3BAZA 3HDQA 3DF7A 5A4FS 3DLIA 3DYBA 4W1SA 5ES4B 1K66A 3GQBA 3IPXA 2Z08A 1P9RA 1H2HA 3P9ZA 2RH4A 3M5DA 5K8IA 1LFAA 1Z13A 2ON6A 5IC5A 4TKZA 3G2IA 4FMCB 4I9UA 5KYYB 4FGSA 1GUZA 5CH3A 2WU1A 1PR9A 2HMTA 2IK8A 2ISCA 5GJWC 1CTQA 2NACA 3QYFA 1WJGA 3MAAC 1VL6A 1H6BA 5DHRA 5K0ZA 2O8NA 2B20A 2QUHA 3MFQA 1HO3A 4INJA 4DMUB 5KU1A 3QEBZ 4OJNA 4GR5A 3V1LA 4EYGA 1BDHA 3CRW1 2II6A 4YXFA 2NMVA 4ZTUB 3OC6A 1A76A 1YZQA 3KQYA 2Q28A 4FDLA 4OQYA 2QW0X 2J9GA 4E5UA 3HG7A 5JE8A 4O2BB 3UJPA 2Q7DA 2PUEA 4JJKA 5FTMA 4Y2SA 4FR5A 1QSGA 2BKXA 1JAHA 1XAIA 2P9JA 4K3VA 2CE2X 4E3WA 3HJAA 4C0AC 1IOVA 1Y5RA 2QNRA 5E6SA 5GV7A 1GGMA 5D7NA 5KYKA 4UREA 4U2CA 2ZT5A 4GLLA 1SU7A 2Y0DA 4TV8F 1WNFA 2ADFA 4RSHA 4BNFA 1E0AA 1ISMA 1EXDA 3UG7A 2NSJA 3PHHA 4P82A 2O4CA 4P83A 4QARA 5FBKA 4J0GA 3SJZA 4RXTA 1ECJA 2R00A 4HBZA 1X9IA 4NS1A 1ORRA 2PD6A 3KPJA 1Q83A 4K3UA 3L1JA 2YHBA 4YCAA 4Q1FA 3QIVA 3KJZA 4R8MA 3SG0A 4DAOA 1PJZA 5ERXA 3E8SA 2CMFA 5L51A 4LAFA 4RK5A 2ZRDA 2ZYWX 2Q5HA 1XOIA 1H8HD 2OXEA 1AKQA 2Q7XA 2QF7A 4GRDA 4I1IA 1KARA 1QRSA 2R2AA 1CULC 1RWOA 3MGCA 2XEDA 1A9PA 3WY9A 1AKYA 4XTCS 4KIWA 1Z0FA 4WKBA 3PWTA 3KTAA 1CUGA 1XF9A 3QOWA 3U3ZA 1N3BA 3AETA 4NZOA 2KSQA 1MD9A 2HTEA 3EEBA 3OEED 4L8VA 5GVSA 2B98A 1JG6A 3EH1A 3NBMA 3ROKA 1B6TA 1IZYA 3QF4B 4M21A 5I9TA 3K0FB 5FBQB 5AOCA 3P45A 3TXXA 3G8DA 4CIYA 2JBAB 5ICEA 1XK7A 1E3SA 1XCOA 2IXAA 4B2LA 4BO5A 3U4DA 1M75A 2GXQA 4FN4A 4K2AA 3I5XA 3L0IB 3AEQB 3WX0A 1JHOA 3TRKA 3NNDA 1LC0A 2EF0A 3DVLA 4HNRA 4ZQHA 2FG7C 4MAAA 4CL2A 2R1TA 2VYNA 1MW8X 3AJAA 5ALYA 3ZGOA 4HF7A 3QPWA 1G4AE 3A31A 1GG8A 1RI2A 3QJGA 5CFNA 5K8TA 5K3FB 4DQXA 2HXYA 2C20A 2EARA 2RHRA 3C5EA 1B2RA 5FUVA 3NRCA 4ER0A 5DLPA 1IUOA 2AD5A 4HOYA 2J6IA 2GRJA 3PXGA 5J43A 2ZBUA 3F4KA 4COOA 2VPYA 3OZDA 1BROA 2V7WA 3HBMA 2GJAA 4NK5A 4RETA 4P3KA 2EJTA 1M9NA 1H1LA 3IDQA 1V9LA 2VJMA 1UC4B 5JCJA 3HUEA 2BR5A 3HKBB 1E18A 2XB2A 2YIMA 1XMQB 2BR4A 1YI1A 4O0LA 1UJ6A 1M5UA 1UK9A 1ZD2P 4LV5B 4F46A 2F6RA 4MUXA 3U13A 1ICEA 4MO9A 4U2FA 3DXYA 3HADA 3CH7A 2IUTA 4FSDA 4QYSA 5EE3A 3TSOA 1JFFB 2XCQA 1ZK3A 2IELA 3N2GA 4PYOA 3ZCQA 1NP7A 5AW7A 3GUUA 4YP9A 2ZWMA 3E15A 5DOVA 4QHSA 4DYHA 5KWEA 2J0EA 2DQZA 3EISA 4GC5A 4R4JA 2CFTA 5ADVA 4ESOA 1C3JA 3IS3A 1DFGA 3AM3A 1I4DD 4FNMA 1PJLA 2XNCA 2G88A 2Z4RA 3QJYA 4UEJA 4O8CA 2WTBA 3LQKA 3PS9A 3DDOA 3T0GA 1ZUNA 3O75A 5M5BA 5U4QA 2BH2A 3T0FA 2VHQA 3K4HA 4EUFA 4BDTA 1UH5A 1RKXA 3P71T 2G77B 3O74A 2JGNA 5FL7A 5DNVA 4ZCPA 3OM1A 2CB0A 4KK3A 4EOGA 2GZRA 2AYXA 2Y92A 4JN6B 3AUAA 1B4DA 3NEAA 4F8JA 5NULA 1DRJA 3N75A 5A4IS 2JFHA 4ZRDA 5GAJA 4MDFA 1V37A 3KHTA 3U6KA 1YR2A 4FW8A 1V9CA 1K27A 3I28A 4HX9A 2DCMA 2Q5QA 5PNTA 3UZUA 3GNSA 1J5XA 3NIFB 4DNPA 5BQXA 1XL1A 5H3LA 1O4VA 1YRBA 3DEIA 4HUTA 2N46A 2EKBA 3C7CB 3KKMA 3H1AA 3OWOA 5I5GA 3D3NA 3ONEA 5B4UA 1GL7A 3KQOA 1FTSA 1SXIA 3ND8A 2J9ZB 3FTDA 3JVEA 3GCZA 4G0WA 4ARSA 2Q1YA 1Y5LA 1NQXA 1FX0A 2YBEA 3AUYA 3C8DA 4PQGA 1JGTA 2WWVD 3NIWA 4NX2A 3VU1A 4DWWA 4EO9A 2VRCA 3V4LA 1LPSA 1YNSA 1KZ7B 2CUZA 1YZNA 3UW3A 1O6CA 1YSCA 4B6JA 2BMEA 2CXHA 4MVJH 1ORDA 1X1EA 2GXSA 5K8LA 2B8TA 5KNCA 4INOA 4KZKA 1KJIA 4A8HA 2E2WA 1WETA 3PSHA 5TPWB 3VJRA 3ABZA 3VSBA 1DE0A 2VJNA 1EFRD 1STOA 3P0JA 4GX2A 4UXJA 2VPQA 1HDCA 3H16A 5A3JA 1ULTA 5DT9A 5GTDA 4CDGA 1L5FA