4TYQA

Crystal structure of an adenylate kinase mutant--akm2
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
215
structure length
215
Chain Sequence
MNIVLMGLPGAGKGTQAERIVAKYGIPHISTGDMFRAAMKEETPLGLEAKSYIDKGELVPDEVTIGIVRERLSKSDCERGFLLDGFPRTVAQAEALEEILEEMGRKLEYVIHIEVRQEELMERLTGRRICSVCGTTYHLVFNPPKTPGICDKDGGELYQRADDNEETVAKRLEVNMKQMAPLLAFYDSKEVLVNVNGQQDMEKVFKDLREILQGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
publication title Crystal structures of thermally stable adenylate kinase mutants designed by local structural entropy optimization and structure-guided mutagenesis
doi rcsb
source organism Bacillus subtilis 168
molecule tags Transferase
total genus 78
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tyqA00
6Q21A 2BVNA 1KJZA 1AS3A 3CWQA 1OIVA 2W00A 3K0CA 1R5NA 1XMJA 2Z83A 4C0BA 5JRJA 1LV7A 4JSTA 3T1OA 1AGRA 2GCPA 1QRAA 2AD5A 2QP3A 4KVGA 5EP1A 4IEIA 4EQ6B 2BM1A 4HAZA 4ZCMA 3EA5A 2IYVA 1Q1EA 3K09A 3KXLA 3ZH9B 3TW4A 3TE6A 4LHXA 2W6ID 1PLLA 1XWIA 1G64A 2ERXA 1QF9A 3Q8XB 1KY3A 5KSPA 1XX6A 4AD8A 4OJQA 4XVRA 4LHVA 4YDSA 4NYJR 5BN3A 1QHGA 4BFVA 5GJBA 2H57A 2JCSA 3LVQE 5FTMA 1VG1A 3AVQA 2NZ8A 3A1WA 2HXYA 4BQSA 2BCJQ 4V0LA 4TLDA 1YZUA 3WBJA 3RS3A 4BLOA 1NLYA 4DUGD 3NHBA 5KDDA 1TPZA 1KOFA 2X8AA 4KSBA 3U6BA 1QG4A 2ZRAA 5D3QA 3SBEA 3U3KA 4DEXA 3V9PA 3GLFB 3K70C 2CJWB 4Z1MA 2JDID 1X6VA 1NSFA 4AYWA 4QKQA 3DEFA 2EWVA 2IYTA 3HDTA 1B0UA 1K5GA 3C7KA 4PHGA 3PUWA 4M1YA 5CK5A 2OE2A 5BW8A 4K81B 3GMTA 4P32A 2BJWA 4OI4A 2DCUA 4MRNA 2F9LA 4EKDA 3K0CC 1D2EA 4HZIA 1MO6A 1U9IA 4Q4LA 1ZD1A 3K0FB 2D62A 3PJRA 3FWYA 3WY9A 3ZYCA 2IXEA 4V03A 4YXWA 2WMOB 3EARA 5IK2A 2QMHA 3ZIAA 4WVFA 2O5VA 2J0VA 1NN3A 2X2EA 4IOJA 3K09C 3QY0A 4LSGA 5H70A 1D9ZA 4NYMQ 2I1QA 1SXJE 4MKFA 5DE3A 4GL2A 4PAOA 1CS4C 4TTRA 5IRCD 2KI5A 3H0KA 1NKTA 5KSYA 3TK1A 3PXGA 1BOFA 1J7KA 3I8SA 3W9YA 2DFLA 5DNYB 2ODEA 4HB3A 1DBSA 4PPQA 4LYAA 5SZKB 4NU0A 4YMVA 1N5KA 4OJKA 2UZ3A 1DAMA 2Q0HA 2IA5A 3HPRA 4C2UA 4R98A 5J4YA 1Q22A 4FCWA 1UBEA 1ZAKA 2B8TA 2KJQA 3BD9A 4AY2A 1JNYA 2FEOA 1W46A 3AUXA 1OH8A 4FWTA 3EC2A 5DLQC 5FBWB 3LRPA 2G9NA 3BB4A 2ZYTX 2NOAA 4QNMA 3NIBA 2YOFA 4IVRA 4RFSA 2J59A 2VHQA 2A3RA 2JJ2D 4L9WA 1UF9A 2XSZD 3I61A 2FU5C 2W2VA 3ND8A 3V00A 3WYGA 3EC1A 2JLUA 3KB1A 1ZM7A 5HCIA 4QHTA 1OH5A 3K70D 3AUYA 2RCNA 3C41J 1GOTA 1T3HA 3VR5A 4LX0A 4DLTA 3LQRA 5DSZA 3TW8B 2V9PA 4GDFA 4PC1A 4IOKA 1EX7A 1MKYA 4PHHA 3TUJC 5IF9A 1KO4A 3SQXA 3TSOA 4OK3A 5JEDA 2GA8A 5DISB 4P4SB 3GPLA 1CR0A 1P4SA 4RY2A 4MGKR 5KHOC 2ZUCA 1JALA 3MWJA 1BYUA 2CK3A 4ZDWA 4C0SA 3TAHA 3A4NA 2HYIC 3SYLA 1LNZA 1XXHB 4NPHA 4U00A 5EE1A 1JI0A 4DHEA 3FMPB 4DB4A 2YVUA 3NKVA 4CIDA 3BB1A 5FPSA 3TUZC 1NF3A 1S9HA 1Y63A 5KNBA 2F55A 2FJUA 4AKIA 4JL5A 4OBEA 1IQPA 4IOLA 5FUYA 5M04A 3SJCA 4TYPA 4Q19A 1BO6A 2XOKA 1QZXA 5FTKA 4BECA 1L4YA 1NY5A 2PMKA 3AVPA 4A0GA 4XWKA 1BH2A 2GK6A 2OILA 2OZEA 4MDFA 1E1QA 2ZRCA 4LJYA 5EJEA 1BS1A 1G5RA 3K0AA 3C15C 3PUVA 5JI3E 2ZUDA 5CM8B 4HAWA 1XCMA 1R0YA 1VCMA 3BFVA 2OAP1 3C14C 3THWA 5HE8A 5EP2A 4OHZA 4MKGA 4Z1MD 4B6EA 4HDQB 4JZKA 2GTPA 1II8A 2FGJA 1NJFA 3LQQA 4P4TA 4Q9HA 5JMTA 1AS0A 1HYQA 3GLGA 1UFQA 4DXAA 4YMTA 1X3SA 1X1SA 2KB0A 2O8EA 3P4YA 4ZKDA 3VX3A 1G7SA 4BEJA 1MO5A 2D7DA 4ZI3A 5TXGA 1CIPA 2C03A 2RGGA 1II0A 1KI1A 4IVPA 3THXA 1G4UR 3QXJA 1RJ9A 2R6DA 4YXWD 2WWIA 2O8FA 3ZIAD 2C96A 1R7RA 2YC4C 3ECCA 1IN4A 2GZDA 4CYMA 3P32A 3UMFA 3AKCA 3QKRB 2JATA 2EFGA 3A36A 4LV5B 5ELXA 2DB3A 4MGYR 1G3UA 4TMXA 1GNQA 2V6JA 2RKOA 1T8UA 2YOGA 2OSBA 4DKXA 1W36B 1KAGA 3ONWA 3IHWA 1DAKA 2XXAB 3IDQA 2QBYB 3IBYA 3GEEA 2GILA 3RNLA 2FN4A 2C5LA 5JS7A 5FPKA 4KLNA 5JHHB 2OCYC 5JRZA 1ZNZA 1EFHA 1GKYA 5KNCA 1A82A 4CEIA 3QSYA 5HZHA 2JLSA 1P9RA 4DLYA 2W2TA 5F2EA 2ZRIA 4PSVA 4RJLA 2ORIA 2R65A 3SU8A 1AQYA 2RGAA 5FBLB 5L3RA 2CLDX 3K1JA 2BIFA 4DRZA 1N6IA 3TVTA 4MKIA 5EP4A 5JSZB 5GJWC 4D4KA 1PJRA 3AF1A 1G5TA 4PSKA 3TR5A 5J4KA 4QBFA 4JJZA 1OV4A 4N0DA 4ESVA 2IUSA 3IILA 1YR7A 4HB0A 2O8CA 2R6AA 3KTAA 3H84A 1E9BA 3TIFA 3AKEA 1JAHA 2CK3D 4Q1AA 4E07A 3TR0A 4LYJA 1Z6XA 4QBHA 2R62A 2WWFA 2DWOA 4B44A 4EIWA 2CLCX 4TL8A 3GJ3A 2J9RA 4OI1A 1KSGA 2W58A 1J99A 2EYQA 1TNDA 3CRRA 5KSZA 2Q9BA 3WHLA 1NY6A 2CCJA 2J45A 2EU8A 4IRUB 2Q3HA 1ZM9A 4TL6A 2GNOA 5B64A 5JFGA 1EGAA 1S96A 1LVGA 2F43B 1KNQA 2QG6A 2XOKD 2P6RA 1W4BA 4OK6A 1X1RA 2FFQA 1QBKC 2Q21A 3K9GA 4WZAE 4C0KA 5F9FA 3DDCA 3AQ4A 1MRSA 1YVDA 1TUIA 1KK1A 1E1QD 1OB5A 3N70A 4JKYA 4G5SA 2GWHA 5FOTA 2KSQA 4XWOA 2V3CC 2Q9CA 3Q5DA 3KQKA 1N6OA 1PUJA 1KK2A 4JLKA 4UNPA 2P5TB 3CNOA 4UNSA 1GRRA 3SJBA 1Y3AA 1CU1A 4QNRA 2XB2A 2GCOB 3MWLA 1RFLA 1MH1A 4HB4A 5JEEA 3FTQA 5BQ5A 2OFWA 2G6BA 421PA 2ERYA 3WXMA 2SHKA 2H5EA 3GJ4A 2D3WA 4G5RA 1JJ7A 3G0HA 4A8JA 3QF4A 2EQBA 3BRWD 1SXJA 3KJIA 2CL7X 5TMPA 1KDOA 2QI9C 3QUSA 4KV9A 4GT1A 1Q12A 3L0OA 4UKDA 4HDCA 2WAXA 1G3MA 2ODWA 1T5LA 2HXSA 2B7CA 4W5WA 1F2UB 1XF9A 1VG9B 1VCOA 3WP1B 1ANKA 3HPQA 1G41A 1F6BA 4BPBA 2C8VA 1D5CA 2C78A 3TUIC 4CVNA 1AN0A 3AV0B 3KQLA 3IIMA 1E0JA 4DDWA 2TMKA 2IHBA 4URZR 5ANRB 3R20A 2O8BA 3ZS9A 1H65A 1HE8B 1R8QA 1X8KA 1KI3A 3VR6A 1XU4A 1G8GA 2VH5R 4IDQA 2XTZA 1JPJA 1WMSA 2A5JA 3E5HA 1TF7A 4RZUA 3S1AA 1NJGA 4TMTA 4WZ6A 1W49A 4MYHA 1QHHA 5FBVB 1WBDA 2OT3B 2IYSA 4R7ZA 1VIAA 2OFOA 2JLQA 2ZU0C 1VCIA 1N0UA 1VYTA 1W2HA 2J87A 1US8B 2CVHA 4DCTA 2QZ4A 1SKYB 2IYRA 2ZIAA 2G3YA 2ZETA 3CM0A 1G291 4FMDF 1KI4A 4F4IA 3H86A 3KX2A 5AJVB 4M8NE 4S35A 4IFBA 2BCGY 3KKQA 4P3YA 1M2OB 3LH5A 2ZREA 3CW2A 4POAA 1KKMA 3LNCA 2BC9A 4HI0E 4M9XA 4W5HA 4EPTA 3W3ZB 2GEDA 2H16A 1SXJC 2AWOA 1AM4D 3JZMA 3CF6R 3W6NA 4LCBA 2P65A 5CDFA 4D82A 3T1VA 1F60A 3EZ9A 3Q72A 1EFRA 4IJMA 3PG5A 3ZJYA 2FFBA 1UKVY 5IT5A 4E09A 3VR4A 1L8QA 4TQAA 4ON9A 3ZVMA 1TQDA 1XPOA 2W0SA 2ZRNA 4QOSA 2C77A 1WB9A 2G0NA 2ZE6A 1U8AA 2I4IA 3K53A 2QA5A 3KJGA 1XXHE 4JLDA 2KBFA 4EFNA 1KSJA 3P27A 4Z8XA 5C4GB 2JJ1A 1R5BA 2QGZA 2XTNA 3M4YA 1KMQA 2VP2A 3MMPA 3NHAA 1IY0A 2O52A 2FOLA 1W5TA 2VLIA 5D3MB 3SE0A 2XGJA 1Z22A 2EFHB 4IXNA 1G5PA 2AHOA 3ADBA 4FCVA 4PX9A 3ZZTA 2O8DB 2ZI3A 3CBQA 3QQ5A 2IT1A 4PC7A 4BRUA 2QL6A 4G01B 3KKOA 5DI3B 1FP7A 4C9BA 3X1DA 2G83A 3EWAA 1E32A 1U0JA 2EW1A 3SYNA 5BN5A 1NMXA 1O87A 5JWOA 5FI0B 5L3QB 4N0EA 4J0QA 3VQTA 4LI0A 3LW7A 3WMFA 4FMBB 3DO6A 4ABYA 1IXRC 2A78A 5TV2A 3QG1A 4Q47A 2ASEA 2IWRA 2R44A 3MWYW 4LJ8A 2MSEB 3T5DA 2WTUA 3D6TB 4IXMA 1RKBA 5JJKA 2IBMA 1E9RA 2GF9A 1M1YE 3GLIB 3C5CA 1E4YA 1F2TA 2AN9A 2FEMA 2IUTA 3EIQA 2IS4A 1QHNA 2P67A 2VP9A 2FSGA 4ASUA 4B3CA 4BWYA 2ZS8A 3QKSB 1T8TA 1UDXA 5P21A 3HR8A 3ADDA 1XB2A 4HUTA 2AK3A 1SXJD 2R6GA 3BOSA 3WNBA 5DHAA 4HAVA 1P6XA 3FYHA 3TQFA 1E2DA 2GXSA 1DEKA 4NL4H 2J7PA 5LB2A 2XAUA 1OPXA 2C2HA 5J40A 3EAQA 2H92A 4ZO4A 1XTKA 1CKEA 4LPKA 1JAIA 2R6FA 4JT2A 1XTQA 3GQBA 1D6JA 1GDDA 5K8LA 4ZV4A 1JEEA 1ZVQA 3BS4A 5B57C 3CPJB 5FR2A 4B2LA 2LWIA 2P5SA 3UWKA 3U7GA 4P0TA 4Q01A 2WPDA 3HU1A 5J4VA 5KPDA 3EW9A 3RVBA 3B9QA 1UAAA 4RCZA 1R10A 1SVKA 4M53A 4URYR 4URXR 4E22A 3THYA 4Q7KA 4FMCB 3K9LA 1UPTA 4F38A 4O3MA 1E9CA 2NO6A 3EIEA 1W0JD 2HJVA 3BE4A 4EFMA 1KZ7B 3ZDQA 1KO7A 1E2NA 1CJVC 3I62A 2XB4A 3RRZA 2ANBA 1UBFA 2Q9AA 3NBYC 5AWFC 5SZJA 1FP6A 1SVWA 1XEXA 3BBPA 521PA 4PO8A 3KQHA 4ZIRB 3IKJA 2ZVQX 4XJXA 2J0QA 1U0LA 1EX6A 2WJHA 3Q9LA 4KBGA 4DCNA 4DJTA 1ODFA 1HV8A 1IXZA 2WVJA 2HV8A 3GLHA 2C9YA 4RKFA 4TT3A 1EFRD 3LXXA 2PL3A 3TH5A 4PC6A 1COWA 4EQ6A 3I5YA 3U4QB 4R2IA 4C4PA 1F3OA 1HT2E 1LS1A 2BKUA 2VEDA 5AUOB 4RD3A 2WJGA 1ZD8A 4AG5A 5CM9C 2O0KA 1HA3A 3EZFA 3U44A 4H1VA 4TLBA 3GD7A 3RSLA 5CYPA 3KDSE 2ZTSA 4BLRA 2DFNA 3CUEF 3D3QA 5EXSA 4MQBA 1A5TA 3I32A 1NI3A 3X2SA 1T4GA 3PFIA 1K8RA 2PZEA 4ARZA 2FGKA 3ZQJA 3K0SA 5CJ2A 1E2EA 2CHGA 4KODA 4LOAA 5L3VA 5KOYA 2Z4SA 1P2VA 2GXQA 4GSYA 4QBGB 2YINC 4M9QA 4D4LA 2CE7A 2IYQA 1GUAA 4LRWA 1XMVA 1PUIA 3RABA 1M7BA 3FOZA 1EG7A 1KO8A 2VHJA 4L8GA 1CLUA 2GVZC 1LFDB 2ZRGA 4A6XA 3K8YA 4EJSA 4CGZA 3LFUA 3LX8A 2GETA 2YJTD 2BBOA 3FMFA 1DG3A 4QM6A 4HAXA 3B5JA 3BC1A 3KKNA 1Q1BA 3A58B 3WBKA 3FFBA 4MRVA 4I99A 1VDZA 5KTYA 1AGPA 2ZR9A 4HZUB 2ZRFA 2PLFA 4MH0R 2GF0A 4GFDA 2MMGA 2GZAA 1KMHA 1ZM4A 4M4SA 4B73A 5A5GA 1DVRA 4ASUD 2VHCA 4YQFA 3A1VA 4RD4A 4B3FX 4M1WA 1X8LA 2JLWA 1P61B 1Z0FA 4A6PA 1KYIA 2A2ZA 1A2BA 3N5CA 1TADA 4XVQA 1UADA 3ZVNA 1DOAA 4KYUA 4W9MC 4B34A 1E3MA 1M7HA 1I4LD 2J7PD 3RC8A 3RYTC 2GXUA 4L5BA 1NSTA 1KK0A 2OV2A 1SZPA 4A0FA 4UXJA 3CRQA 4BLSA 2PJZA 3IGFA 4DDUA 1AS2A 1W1WA 1XZPA 5JZVA 5F3WB 3IEVA 3CX6A 2Z6VA 2NMVA 3UK6A 3UIEA 1P2UA 4KSCA 3X1ZA 2V8OA 2EVWX 3RRNA 5KUTA 1W2GA 3U2QA 2WPDD 4F4CA 2V6IA 4US2R 4JL8A 1FNMA 2R2AA 4FN5A 3AM1A 1H8EA 4NTZA 3I5XA 4AIIA 2EFDB 1WE2A 1P75A 4CEHA 1S4QA 3LV8A 4MITA 4PZYA 4NMMA 3K0EA 3AP3A 4CEJB 3Q85A 4GOXA 2CE2X 1J90A 1EWQA 3LDAA 2BBTA 4IDHA 5LDDC 1G4AE 3CO5A 5HE9A 1G6OA 1XTIA 2I1VB 3C16C 1KTVA 5LD2C 3B85A 1GKUB 4KI0A 2LCFA 2V7QA 4EPVA 5G3YA 4V0NA 4IDPA 4DSOA 2F1RA 3K70B 2IF2A 3MJRA 1DADA 3THOA 4EPWA 4C7OA 5AUQA 1S1CA 4G3XA 2IEYA 5JJIA 2RHMA 5TY0A 3TVDA 1SGWA 2C98A 1G9XA 1KKLA 4I1VA 4K8OA 5KU1A 2ZQ5A 1X86B 5H8WA 4RD0A 2WMNB 2DBYA 4OHWA 2ZSFA 4TT3D 1COWD 3VHXA 3EG5A 5JWHA 1XXHA 2PT5A 3E70C 2HEIA 5TDHA 2N46A 1TEVA 4Q21A 3FDIA 5FBRB 1ZC3A 1L2TA 2QMEA 3P4XA 2GHIA 3DM5A 4YMSA 3IIKA 5LBIA 5GADl 5E95A 1RRCA 1QG2A 2W6JA 1KO5A 5CLQA 5BYJA 1NVUQ 1HTWA 3RLFA 5KPJA 2P2LA 3SN6A 3LBIA 2NO1A 4LJ5A 1NBME 1XD2A 4G0NA 3IPXA 1ZC4A 4HB2A 4Q7LA 3K9NA 4LZZA 1XDBA 3U3RA 3PITA 1Q3TA 1Z0JA 3LY5A 2O0JA 2QAGA 3OIUA 1G21E 3EZ7A 1YZLA 2AKAB 3M0EA 3VKGA 2BMEA 2WJJA 3Q7PA 3TJZA 4GRAA 2ZITA 4TQUS 3OHMA 1CJTC 4ZKEA 3EXAA 2DWQA 3ZVLA 5A4JA 2GZHA 4TZ0A 2PEYA 4EAQA 4B47A 1U9IC 1UM8A 4FIDA 3TQCA 3SFZA 1UKYA 4L16A 3VX4A 3X1WA 1G17A 4TMWA 4WOPA 2B6HA 2QMOA 5TARA 3KL4A 1Z2CA 3MUFA 1E2PA 1MR3F 2ZE8A 5EE5B 5FI1B 3JVUA 3O8DA 1LB1B 5HPYB 4JVSB 4RZXA 4B2PA 3L8ZA 1RZ3A 3GLIE 4XTCS 3AKYA 4JJKA 4KLZA 2VF7A 1IHUA 2ZUBA 4II7A 2FX3A 8OHMA 4H1UA 4Q4AA 2ZRJA 1RIFA 3VR2A 3GJ6A 4LHWA 1T9HA 2QSYA 4LBZA 2PH1A 4I4LA 4DLUA 1KI6B 2GDJA 4KFUA 1J8MF 3LWNA 1OXSC 1YR9A 3QPUA 3HWSA 1TAGA 2QRZA 3VNUA 1FZQA 1R6BX 3DKVA 4KBFA 5AK0A 4LJ7A 2VP6A 2B8WA 4BASA 1SULA 2BMDA 3FKSA 1RVDA 5EXPA 2XXAA 2QAGC 5CIWA 2DFTA 1NN5A 3V4RA 1N6PA 2CCKA 5FUWA 4HUQA 1JXMA 4JLMA 2JEOA 2N42A 5SZHB 4DT1B 5CB6A 2IK8A 1GWNA 1ZU4A 1E2IA 4D81A 2BEKA 2CBZA 5CB8A 4ACBA 4DSTA 3MJHA 2REBA 3QEJA 4OI0A 1YE8A 3F0TA 1GILA 4DLRA 2RB4A 1YHNA 4PHTA 3SEAA 1II9A 4LDJA 3UMSA 1PLKA 3DL0A 5EE3A 4RFSB 1B23P 3P1JA 4M22A 2QTFA 3AVXA 2YYZA 3M6AA 5CITA 1ONBA 4GP6A 2IYXA 5GVSA 4B48A 5L3SB 1D9XA 2V7QD 3CKLA 4DDVA 4ACAA 5IK2D 1QHXA 1OE0A 4JLJA 2FFAA 3VKHA 1VIYA 1Z6YA 3X1YA 3X1XA 2VP0A 2J1LA 5G3ZA 2ATVA 4ITRC 3KUCA 4MA4A 2HUPA 1WBBA 2WJYA 1SQ5A 3CF0A 1KDPA 1YKSA 1YZNA 4JS0A 4TL9A 4Y0VA 5H1YA 2HT6A 4WA7A 3AGQA 5HZKA 1QHIA 2H1LA 4BFSA 1WP9A 3KJHA 4PQFA 1KHTA 1RRFA 2F9MA 1T0JB 3DZ8A 3PUZA 3F8TA 5DGXA 3QKUA 3CX8A 4B76A 4ESHA 4V0ME 4NH0A 1JBKA 2NO0A 2V1XA 4LBVA 2ZRLA 4AK9A 4TYYA 2W6JD 4L4UA 2CEAA 4B71A 2JLYA 1XEWX 2YOHA 5TVKA 2CVFA 3V4FA 3CRW1 5BWMA 3CX7A 4LHZA 1E79A 1TTTA 1IM2A 3U3MA 2YC2C 3AVTA 2FPKA 3QENA 4YLGA 2HDNB 2KWIA 4BUJA 4A2QA 4C2TA 3U60B 4B75A 4KCGA 4M1KA 4U5XA 1EWRA 4US0R 2YKGA 2WBLC 3DM9B 4JLNA 4BLQA 2YWGA 2AFHE 2RHDA 1U81A 3CPHA 3CNNA 3K0AB 2ZI6A 3U3OA 1X8JA 1G7TA 4RVCA 4U02A 3WHKA 4RD6A 2ZRBA 1Q1QA 2JGNA 1DO0A 1ZRHA 1Z06A 2FPLA 3BH7A 1ZNYA 4O0MA 5EP3A 2G88A 1OH7A 1VHLA 4OQMA 5K8TA 5FBQB 1ZYUA 2YHSA 1JQJC 3FVQA 1II8B 3HJNA 4UXIA 5FUXA 4JBXA 1AQUA 1ZINA 4BFTA 1OXTA 1V5WA 3LBNA 2ZR0A 3GLGB 1E0SA 1E4VA 2BBWA 2VTKA 4C0HA 2O8EB 1XPRA 3QJYA 1Q57A 1Q1ZA 1T6NA 3VU9B 3FFAA 4OHVA 4K46A 3GJ0A 4ZI2A 2J0UA 2ZRMA 4QHYA 3THXB 1OF1A 1HQCA 4X8LA 3B1YA 5CIQA 3IUYA 2VSXA 2O8FB 5J5CA 3IHLA 1YQTA 4OQNA 4QXAA 4F4JA 1LTQA 1HUQA 1ZU5A 3W6PA 1N6LA 4IFEA 5FOWA 1CF4A 5F98A 1CTQA 2FG5A 1YU9A 2PZGA 2OCAA 4Q7JB 2PX3A 4NYIR 4ZCIA 1IJEA 1RPZA 3FKSD 4UNQA 4WBSA 1VCNA 1A4RA 4JYBA 1D2MA 5FL3A 2RGCA 2FPMA 3SFVA 4NCJA 4NZYA 2WWWA 3BAFA 1DAFA 4AKEA 5FPTA 2IXFA 1IN6A 3BK7A 4B3XA 1G3RA 2ZE7A 1D8TA 2BKEA 4KU4A 3K9HA 2GBLA 3GLFE 2IW3A 4V0KA 1S3SA 4C0JA 1W4CA 2ZXUA 2RGNA 3TAUA 4MGIR 1Q44A 2QTHA 4UQOA 2NQ2C 1IOZA 3I1FA 4ZPXA 5AJXA 2FZLA 1CP2A 2REOA 2XZPA 2W83A 1N6KA 4A92A 1FL9A 3N2IA 2YV5A 2KBEA 3IO3A 1YRBA 4S2EA 1AA9A 1LS6A 2X2FA 3VHLB 3R9XA 4L9SA 2ZJ8A 2FWRA 4IDOA 1A2KC 4MUAA 3TBKA 4RZ2A 3MCAA 4E5UA 3CH5A 3QBTA 4TLEA 2ZSDA 3E2IA 4DCUA 4A15A 4B35A 2O8CB 2F1JA 3GEHA 1GZSA 1H8HA 3KTAB 3CONA 2ECKA 2Z4RA 2NGRA 1EFCA 3OAAA 1PLJA 2GEVA 2UVQA 4WIAA 1P73A 2WZQA 1HURA 3KJEA 4WXRA 3U3JA 3B8HA 3AP1A 3RRYA 3ICQB 3EIHA 1ZUHA 3F5FA 1XMIA 4JKIA 3UXMA 1NBMA 2QSZA 1Z29A 5D3MA 2IUUA 3A6PC 1FPMA 3B1ZA 3NBXX 3DZDA 2H8KA 5EUMA 5JWRA 2WOOA 1ZIPA 3C4JA 2VO1A 4OL0A 5K8UA 4DZZA 2HJGA 3UWOA 4KJZA 2IYLD 1SVOA 1E79D 2DFKB 1NMYA 4PR0A 5KDOA 3BFXA 5A0FA 1Z6GA 2O0HA 3SC3A 3UATA 4B3DA 3AVYA 2ZM5A 1QVAA 1JPNA 4Q4JA 3QVUA 1S8FA 3GFTA 1F48A 4RD1A 2W0MA 2EFCB 4QGGA 3KKPA 4XD7A 5DHFA 3OEHA 3EPLA 5FOSA 4Z8YA 1TUEA 4NONA 3RS5A 1Z0IA 3AVUA 1XJCA 2F1HA 1XEFA 1XD8A 1KIMA 1P2TA 2QQEA 5DH9A 3RHFA 1XEWY 4A8JC 3T1QA 2PT7A 1M74A 2VYFA 3R7WA 3ZGXA 1W47A 4RZ3A 3EZ6A 2ODNA 1S0UA 2NZJA 1AK2A 1QVRA 2BEJA 2F3TA 4Q5IA 4D26A 2QE7A 3CWZA 2FE4A 4FMCF 1GIAA 4OQLA 3LXRA 2GXAA 3QKSA 5EXTA 3OZXA 4LYHA 4LK2A 1XJ0A 2XTMA 3B2EA 1E98A 1V43A 4OQFA 3NXSA 4GOKA 1RRPA 2AWNA 4A8JB 3QF4B 1Z63A 1SXJB 3KFVA 2RGXA 3A8TA 3WYAA 1YR8A 2JAQA 2DR3A 5EXXA 4C3ZA 4BFWA 2RMKA 1JR6A 2WSMA 3TRFA 1IY1A 2MSCB 5C1BA 3PENA 2G77B 3FMOB 1TX4B 3PCRB 5EE9A 2AD1A 1CR1A 1NVVR 4QFMA 2ZI5A 1Q3HA 1MOZA 4W5JA 4Q1EA 2GJAA 3H4MA 2YNMA 1MO3A 2QENA 3E1SA 5EUQB 2O8BB 4DC9A 4NCKA 1P2SA 3QEOA 1R8SA 3EZ2A 4PAQA 3OFNA 4TTQA 3RDPA 1ZBDA 1M7GA 4F7WA 1OXVA 2IEZA 1KO1A 1Z0DA 2JJ8A 1XBTA 4JLAA 1CR4A 4TYQA 3S1AB 4B2IA 1W48A 2CMKA 1XTSA 1QHHB 1XP8A 2AXPA 2QRNA 2X1VA 3ADCA 5HTKA 1P9NA 1YZGA 4A2WA 4LPSA 3PQCA 1MV5A 3U7FB 2ZI7A 3HR7A 3LVRE 3J81k 1E6CA 1EESA 3BFKA 2QM8A 3ZVRA 4OYHA 4ZIRA 1U94A 1XRJA 2FV8A 2PMDA 1U8YA 1VG0B 2UZIR 4PANA 3VFDA 5FH9A 2FSIA 1A1VA 2Q6TA 3SR0A 3OEEA 1TF2A 2J3EA 2OLKA 1DPFA 2ODBA 2QROA 4AURA 3WRYC 1NIPA 4AKGA 1T3SA 4PQYA 3BXZA 1H8HD 1CJMA 2OCBA 3L0IB 3PIRA 4FINA 1EFTA 2J5XA 2VF8A 3L43A 4BLPA 3IPYA 3OAAD 3CZQA 3LW8A 5UKDA 3CPEA 1E0KA 4JT4A 3DMNA 1E2LA 1I2MA 3AEZA 4Q02A 4AYXA 4HEJA 4FWIB 5B30A 2CCGA 3CRMA 1SHZA 2RH5A 1DO2A 4DLSA 2F7SA 4IW3B 4NP6A 1NBMD 1HEIA 4LV8B 3WMGA 2GVDC 2X77A 1OIXA 1YJ5A 1FTSA 5FTLA 1UDWA 4BFZA 4BZPA 1E9SA 1DS6A 1XJQA 2FA9A 1P62B 2JA1A 5FOUA 2A30A 5DIFA 1LW7A 4QJ4A 3FGNA 1XCPA 2ZJ5A 4LUCA 3SQWA 1CJKC 2X19A 4TTPA 1NKSA 1J70A 2QP9X 4A9AA 3NC0C 1U2RA 2V54A 1ZW6A 2AL7A 3FE2A 3HYRA 4R71A 4TN1A 3LO5A 4F92B 1FX0B 1SVLA 4MDEA 3DHWC 4XD7D 1SVIA 4XSHA 3OEHD 3WRXC 2E87A 2XITA 2VHTA 4HLUA 4Q1FA 1AZTA 3MSXA 4Q1DA 2ZE5A 3B1XA 5HKKA 1GFIA 1TQ4A 4B3GA 3NH6A 2WWYA 1GAJA 3OIWA 2E9SA 2AK2A 3VAAA 3ZD6A 3L0PA 4NE2A 4B3BA 3A4LA 2ZRPA 4LHYA 2Z43A 1XPUA 5L8VA 2D74A 2QE7D 621PA 4CW7A 1F2TB 4NKRA 3LX5A 1EFUA 3WYFA 1N5JA 3GLGE 4PC2A 1G3QA 1DAGA 1N6RA 1T3LA 1P5ZB 2VPPA 1VYVA 2KE5A 3U5ZB 2WM9B 1TEXA 4O2RA 4GPTA 2GRJA 2QU8A 3IIJA 1VECA 3IQWA 2GKSA 2JJ1D 121PA 3ZZUA 1AIPA 2BWJA 3VNVA 4ERNA 1E96A 3I4LA 3VR1A 4AI6A 1GVNB 5E4FA 1P72A 4G5GA 3FKQA 3GFPA 2ZSEA 4LBWA 2YWEA 2DHRA 1LF5A 4PHFA 5E7JA 3R9IA 1GTVA 2EFEB 1XD9A 4IKEA 4BFXA 1JECA 4HDOB 3ASZA 4DVGA 4Q1BA 2ZI4A 1FOEB 4Z51A 1OH6A 1TMKA 3W34A 1UKZA 1OFTA 4JMPA 2BV3A 3I73A 4QJ3A 3LA6A 5KYKA 3BB3A 1R4AA 2CJWA 2ORWA 2BBSA 3GLFA 3CNLA 1J8YF 1ZNWA 4I81A 3OFND 4TLCA 1JR3E 2CLSA 3LLMA 1GSIA 1F5NA 3EASA 4O2LA 3BORA 4GMXA 3THYB 3FMIA 1OJLA 3RWMB 5AUNB 3UPUA 4UJ3A 2GK7A 3C8UA 4PTLA 2NG1A 3K0FA 2JIZA 3ICEA 1VYUA 4RCYA 3I8XA 5DYGA 5IHPA 5G53C 5C2JB 3SZRA 1R0XA 3NC1C 1KI8A 2WV9A 2ZJOA 1XEXB 4IHQA 1HT1E 1MABB 1E2QA 4MRRA 1NNEA 3BGWA 2GJKA 4BEBA 3UANA 4M1OA 4GOJA 4D0LB 2ZEJA 1BIFA 2LKDA 1VMAA 2BOVA 3OEED 1U98A 1NG9A 4FI3C 3VKWA 5JI2E 1KJYA 1R2QA 2PCLA 3GLHB 1R0ZA 2PLRA 3EPHA 2C95A 1EXMA 1OFHA 3VR3A 4C0LA 1Z0KA 3MAAC 1P9WA 1Q0UA 3DPUA 3B82A 2YWFA 4Q4HB 4V0OA 3U44B 3PEVA 1R5OA 4YDHB 3AVWA 2V4ZA 4F91B 1E0AA 4P4UA 4UNRA 2IWHA 2BM0A 2AFIE 2ZPTX 3U6KA 221PA 2OFXA 1G8PA 4LWZA 2WSSA 2JLVA 1G3IA 4EJSC 4PO1A 4ZDIA 4LV6A 2N1BA 4Q9LA 3LAWA 1TU4A 5TB5A 3R8CA 4HLQB 4ARZB 4AKHA 4JSYA 1FFHA 3QXHA 4TSFA 4JBWA 1VHTA 1GNRA 3CH4B 3KB2A 1SKYE 1TF5A 1DG1G 2VL7A 4QG7A 2D4HA 1ESNA 3QXXA 3FHTA 5C4MA 1UEIA 1S3GA 1KZGB 1JEDA 1ETUA 3AKDA 3T34A 5FTNA 1GRQA 4JVMA 4PZZA 5HKKD 2J41A 4EJSB 1NRJB 2PZFA 4TWZA 4X8MA 5E7MA 5FPHA 2W2XA 3UG6A 1NLFA 1TQ2A 2FMXA 4P4SA 2P0EA 4QGAA 4DCVA 2A5GA 1G7RA 4OQXA 3SYKA 2PCJA 2DYKA 2ZROA 4Q7MB 5FOVA 2XZLA 1Z08A 1HQYE 5AR1A 3WNCA 1KGDA 1XTJA 5LD2B 4JL6A 1O3YA 1NVXQ 2WOJA 2OBMA 2QNRA 2QT1A 1KMHB 5CJPA 3W6OA 3W5IA 1KNXA 1SKQA 4RKEA 2ONJA 4DLXA 3NWJA 1KAOA 4PQRA 2OESA 1QDEA 2OO7A 5KO2A 1CBUA 1MRNA 3GEIA 2OHFA 3B13B 3QXSA 4JLPA 2BJVA 3MGCA 5EZ5A 4B33A 3AVVA 4QHSA 1KI6A 3WP0A 4B32A 3BH6A 4NYIQ 2G1JA 3O8CA 4JVNA 3TSWA 1YZQA 2WKQA 2VIIA 1GM5A 2OG2A 4MKHA 3QBVA 3AB3A 5CK4A 4D4JA 1XCGB 1CRQA 2CDNA 4BFYA 4DT1A 3O8BA 2FSFA 1WXQA 1Z2AA 3P20A 3AF2A 4Q1CA 3GJ7A 1VG8A 1IONA 4Q9IA 4EDHA 5DYIA 1PZNA 1W7AA 1FW6A 1W4RA 2ZRDA 5JCPA 821PA 1ZMXA 2K5UA 3NTUA 4CEHB 3BERA 5GJCA 1FQKA 1I4TD 2FSHA 4YMWA 2NPIA 2XNSA 5CYOA 1E2KA 1AJEA 1KJWA 2A5FA 2JIZD 2BDTA 3T12A 4LC1A 1YZKA 1UJ2A 4M9SA 2IYZA 4ZDKA 3A37A 5L3SA 1IN8A 3REGA 1OYWA 1HE1C 1HH4A 2ZANA 4WZBE 3QE0A 3A1SA 3IBGA 5FOXA 4URUR 1YZTA 1DE0A 4C7OB 5CLLA 3QKRA 2ZS9A 2VA8A 2ZSBA 2LKCA 1IBRA 1QHSA 2XEXA 5EZ6B 4EUNA 1G8YA 3I72A 1RE0A 2F1IA 2ZYUX 4D0NA 2XNDA 4IDNA 2WWXA 3IO5A 5CDFE 5K8IA 1ELOA 4U7DA 4KYIB 4N3NA 4R9UC 1U0HC 4F93B 2DPXA 2FH5B 1JB1A 4KO8A 2QBYA 4DSNA 1N5IA 4AYTA 5AJWA 4QM7A 2OBLA 4URVR 1Z07A 5SZIA 2BHRA 2IS6A 1N6NA 4NCNA 2C04A 3ASYA 2ZJAA 1S1MA 1KY2A 3ND9A 3L2OB 4LBYA 2ZJ2A 3KXKA 4YC7A 1S2MA 3W5JA 2E1RA 3ZD7A 1XD2B 1H8ED 2WSSD 2R6CA 3C5HA 2VRWA 2CHVA 3HU2A 3ETLA 1BYIA 2QAGB 5BYKA 2PBRA 3G82C 3AVOA 4HATA 4TSFD 2OM2A 3F3YA 5C18A 1GITA 4HSEA 5JSZA 1W5SA 2UKDA 1XMSA 4XH9B 4M21A 4B43A 2Y8EA 3NDPA 2ZJZA 3OF5A 4JBYA 4DCSA 3FHCB 1XNJA 4B74A 2IC5A 3EWSA 2BMFA 3GFOA 3SJZA 5DN6A 3GJ5A 3CR8A 2ATXA 2BMJA 2F6RA 2FF7A 3N2EA 2JLXA 5LB4A 1C9KA 4GP7A 3R8FA 4Z54A 4LC0A 1DAHA 2HYDA 2WKRA 5FL7A 1GKIA 3VU9A 3PEWA 3SDZA 1N25A 1W36C 3ZQ6A 4H9GA 4R2HA 4QC2A 3REFA 1BKDR 1TQ6A 3QIAA 1VPLA 2IX3A 1Z6AA 3TLXA 4KHZA 1SVSA 1OYYA 3KXIA 4Q66C 4Q4AB 4Q18A 4CZ2A 1G18A 1G20E 1ZUIA 1NVVQ 3L8YA 3LD9A 1EK0A 4D25A 2NO9A 1KI7A 4KAXA 3MG9A 2ZR7A 1E9FA 2F43A 4Q48A 5FR1A 1OFIA 2EWWA 1IXSB 3DOEA 3T06B 1DTSA 2HF9A 2G0TA 3OESA 4AG6A 1NL3A 3M1IA 4QL3A 4LJ9A 1SHKA 4D0GA 2XJ9A 3CIOA 3FPAA 1P7CA 2FZ4A 4A0HA 2QUZA 4DLVA 2AXNA 1RC8A 2C9OA 2OBNA 5AUPB 1RRGA 2OUKA 2WICA 1JR3A 2AKYA 3TNFA 2FFHA 1AZSC 4HUQB 4RFVA 2ZRHA 5EE0A 1XFAA 4JLVA 1D2NA 2B92A 3THWB 5LPNA 3HU3A 1G6HA 4MRPA 2GCOA 2H17A 2G1KA 5FFMA 1U8ZA 2GJ8A 2XX3A 1SVMA 5JECA 5KNDA 1M34E 2QPAA 2MSDB 5EQTA 4OI2A 2C9CA 4Q9KA 4QGFA 4MYTA 4MUBA 3DOFA 4FCTA 3T61A 3IEUA 3QPWA 1G1MA 2ORVA 1N5LA 1WRBA 3UG7A 2HT1A 3GJ8A 1S9DA 4M1TA 1RJ9B 3RS4A 1WQ1R 1NG1A 4OK5A 3OE7A 2GJSA 4N1AA 4DSUA 1IY2A 1F2UA 1ZNXA 2WJIA 1XZQA 1Z0AA 2QT0A 4HAYA 1E9EA 2C99A 3GP8A 2WIAA 3D8BA 4I1SA 4AWXA 3SI7A 3U7HB 1Z83A 3H1TA 4KFTA 3B9PA 3PV0A 2XNDD 1GG2A 3G5UA 1UBCA 2ZSAA 3GLHE 4G1UC 4TMVA 4NYMR 4WXPA 5DO9A 1W36D 4MGZR 1E2MA 3SNHA 1DAIA 2WJVA 4MRSA 1W0KA 3T15A 2ZJYA 3JVVA 2OXCA 3W8RA 3KFXA 4BZXA 3TSZA 2ZAMA 3AF4A 2QAJA 4EPXA 1M6NA 5F9HA 1FUKA 1GL6A 1E9DA 4A1FA 3A1TA 1VTKA 4W7SA 4DLZA 3LBHA 1J2JA 5J4LA 1NN1A 1Z5ZA 1US8A 4MYCA 1T5IA 3B1VA 4ZDJA 5JJLA 4RSGA 4PFSA 4CEIB 1E2GA 4DIEA 1OIWA 1IJFA 1RW4A 3RRMA 2A9KA 5AJYA 1Z6TA 2GAOA 3AF0A 3QI2A 4GBMA 3QXCA 3TMKA 4CF7A 3MFYA 4I1OA 1PVOA 1ZUNB 3CF2A 4BRWA 2L0XA 4FXPA 1Q21A 4WAUA 1NMZA 1OLOA 4DB2A 4Q9JA 2WAYA 4IEEA 1CR2A 4X8OA 1DARA 3L0SA 4AC9A 2ONKA 1NLZA 2ZU6A 4DWJA 3ZLJA 3H2YA 2P6UA 4KFSA 1E99A 3RS2A 1U99A 5DN6D 2IYYA 4KITB 3T35A 2JLZA 1YR6A 3Q3JB 1E94E 2XZOA 1P60A 3PVSA 4C30A 1OKKA 2GJ9A 1E69A 2IXGA 4OHXA 4OHYA 1FMLA 5E3HA 2VP4A 4GZLA 5FL7D 5J4HA 2QORA 3B78A 4D2IA 2J7KA 3KZ1E 5FTJA 1E9AA 1R0WA 4I1UA 4FW9A 4GI7A 4IOMA 3O8RA 3R9WA 2B21A 3U7EB 2HLDA 4EPYA 2J0UB 1E2HA 4LY6A 2RAPA 2VSOA 4IVQA 4JIMA 4C0QC 1XTRA 2FDCA 3BIFA 3DMDA 3UMRA 5B2ZA 2O8DA 5GVRA 3WNDA 1FUUA 4C0AC 4BE7B 1WCV1 1IN5A 1ZJ6A 3NG1A 5DI3A 2CNWA 4TMZA 4NBSA 1UBGA 3UKDA 4A36A 2GBLC 1GP2A 3QNUA 2PJRA 5KDLA 4UNNA 3W8NA 4TYWA 2RGNC 3EPJA 1WF3A 2ZRKA 2GEUA 2IYWA 4E03A 2OAQ1 2CL6X 4LJ6A 5L3QA 2OCPA 2IS1A 2CL0X 1JR3D 3PUXA 1N6HA 4BZQA 1UEJA 2QN6A 4ILEA 2DY1A 3QOFA 2QQ0A 3EPKA 4CRWB 1M8PA 5BXQC 1NVWQ 1W0JA 3EX7C 3GLIA 4DEYA 5HR5A 1C1YA 4JLOA 4TYNA 2J0SA 4BLTA 1CXZA 1GL7A 3QG5A 3KQUA 3U61B 2OEPA 4XIGS 4NHOA 1RYHA 4A0RA 1OW3B 5BN4A 5JLJA 2IS2A 4HLDA 3RS0A 4BGDA 2HCJB 4YONB 3NDBB 4M0LA 5FUVA 2XJ4A 4XWAA 2JLRA 1G19A 1CRPA 2R8RA 3HP1A 4Q03A 4NDZA 1T91A 1ZP6A 4A4DA 4BFUA 2VBCA 1DELA 3BH0A 2R9VA 1L7VC 3P26A 3O47A 4LGMA 1Z8FA 2IHYA 2Z0MA 4LJ4A 3OE7D 4UJ5A 2D2FA 3ZS8A 3FB4A 2F3RA 4NCIA 3BWDD 4DIDA 1KK3A 1K6MA 4JVLA 1KI2A 5KSOA 2QM7A 1WDTA 1I4DD 1FTNA 3ZZ0A 1OSNA 3B1WA 1PV4A 4QJ5A 2WIBA 3RWOA 1W4AA 1A7JA 3PUYA 3OIYA 1W0KD 4Y0AA 2WWHA 3NVAA 4TQ9A 1E1RA 4NYJQ 3MLEA 5JS8A 4M1SA 4QGHA 2ZJBA 2YWHA 1OB2A 1OXUA 2IL1A 3SHFA 1OHHA 3CR7A 3MD0A 3OIVA 3PEYA 1CJUC 1G8FA 3W90A 4XTRA 4PPGA 2QEQA 1BMFA 4LYFA 2FNAA 2AX4A 2HCBA 4OKSA 2GESA 3CZPA 3I3SR 4FD2A 2I3BA 2QP4A 1FQJA 2RGBA 4WW0A 2D2EA 1FX0A 1KDTA 1CULC 2GCNA 1KSHA 1U90A 1OXXK 4L15A 4Q4JB 4DLWA 4EPRA 1C4OA 3LLUA 5GJVC 4PSAA 3B60A 4A2PA 4D80A 3RS7A 3RC3A 4URWR 1WA5A 3AF3A 1KDRA 1ZM2A 3RSOA 3SBDA 3QKTA 2EYUA 3VMFA 2P6NA 2HF8A 1N0VC 4KFRA 4TZ6A 3R7WB 4PPFA 1NN0A 3L82B 3U4QA 3SS8A 3KUDA 4P33A 2ZI9A 2Z5FA 1QHYA 4PAMA 4V02A 1OKKD 3NBFA 4RD2A 3DKPA 3HYTA 1ZCBA 4V0MA 3GCGA 5AJZA 1ZCAA 1VKJA 4XOIA 2ZYWX 2W6IA 2WWGA 5JCZA 1GRNA 1G7CA 2HLDD 2VSFA 1I2DA 1Z47A 1RYFA 3I92A 4Q00A 1N0WA 3MRSA 1N2CE 4QRHA 1L4UA 4EFLA 1IN7A 3CRVA 4HLCA 5JBQA 1G8HA 2PEZA 3A1UA 2D06A 3D7MA 2V1UA 1MT0A 4FMDB 1UKEA 4PO9A 1JJVA 2CNWD 2QPOA 4HYYA 2QMUA 2ZAOA 5HCNA 4O25A 4PC3A 1NIJA 3A4MA 4CT4B 1CEEA 1TL7C 4DUGA 2VP5A 3TGPA 5JHGB 2QGNA 3NEJA 3B6EA 3VTKA 4JLBA 2WHXA 3SHWA 4G5OA 3QVVA 1NP6A 4PPNA 4X8HA 2V55B 3NBZC 2Q3FA 4P31A 3MWKA 1E2FA 4LJAA 5G40A 2JDIA 2RGEA 3D31A 4M1MA 2A5YB 2AR7A 3RAPR 1Z3IX 4KVAA 4QBIA 3CB4A 1IAQA 3CLVA 3QF7A 5IDVA 1MO4A 4JYCA 4UXHA 3KQNA 5B58C 1FNNA 4ZCLA 4YMUA 4HZUA 3T5GA 3T1TA 2JASA 3IQXA 721PA 2VQSA 3FHOA 3RANA 2NIPA 4CT5A 4D4MA 2OXRA 1OFUX 1MABA 2A7QA 2B7BA 1YRAA 4D6PA 3DVLA 3TKLA 1ESMA 3Q7QA 1ZM3A 3QPVA 1K5DA 3SOPA 2IF0A 1OT3A 4TLAA 2QPTA 3KKMA 3WMEA 1JXOA 2H18A 2GAAA 1ZIOA 2DWPA 4A82A 4CDGA 2A5DA 4MYUA 4TL7A 2NPFA 3JZAA 3W3AA 2J46A 4PZLA 2RGDA 3GJXC 3Q5EA 3ADKA 3AGPA 3BJIC 1TU3A 1LY1A 4Q4HA 5G41A 1KI9A 2ZS7A 1FMJA 1W44A 4HAUA 4TMKA 3EA0A 2D7CA 2NO7A 1E1RD 4XVUA 1AKEA 4B6FA 1P3JA 2QTVB 1JQLB 4HLUC 1OHHD 2ZVPX 1Q20A 4M2LA 5C46F 4GMDA 2Q3MA 1T0HB 3B7GA 2YZ2A 5J47A 5E7IA 1ZD9A 4DBLC 3SJAA 3PR1A 4CEJA 4GNKA 2IYUA 1DAEA 2WKPA 1BMFD 5DI9A 2JJ2A 2QY9A 1N3BA 5H68A 4GZMA 2XSZA 1Z28A 2CXXA 2VHUA 2NTYC 1GL9B 2ANCA 2PX0A 1KSFX 4US1R 1AKYA 3NEYA 2P3SA 1HY3A 1LF0A 3AH8A 3AP2A 4G5QA 4NCHA 1G16A 4KXFB 4XSGA 2H7VA 4PXAA 3PEUA 3NH9A 1E2JA 2ZYVX 2CHQA 5FPYA 2REXB 4M9ZA 2MMCA 2OLJA 4DDTA 1GNPA
chains in the Genus database with same CATH superfamily
4C29A 3I45A 2BVNA 5K99A 1WBDA 4H4DA 1AS3A 5JNVA 3MTAA 4IXDA 1SCQA 1XMJA 2Z83A 1P2FA 3BTUA 3DMFA 3HCFA 3ZXIA 4EMBA 1AGRA 2GCPA 2QMQA 4H0FA 4UUPA 3D3KA 2EZ8A 3H42B 1U4SA 3UMMA 4BC1A 1ML3A 2HA2A 2QRMA 2IYVA 1Q1EA 2M6SA 1CX9B 3LUPA 2V7UA 4CQMD 2PANA 4XKJA 2ZCVA 4E5VA 3QW4B 3TW4A 1OUMA 3TE6A 4D96A 1INLA 2AE2A 2RH4A 2WLSA 4LHXA 5C52B 2PZKA 4I4NA 1FTYA 1G64A 3F98A 2IGBA 1E1KA 2IH2A 2PXXA 4WACA 4TRJA 1XX6A 5J2UB 2XY4A 5JH7B 4IS3A 2Z57A 1BHO1 4LHVA 1VLJA 1AGNA 3Q87B 1YBFA 3OMXA 4NYJR 1X80B 1YL6A 4P54A 4QXMA 4KPUA 3T3HA 4YP1A 3REOA 3AINA 4ZPJA 1T0IA 5DNVA 5FTMA 3J7AC 4M0DA 4KXLA 2P9GA 3MTBA 4I4IA 3U31A 1X15A 1ZSYA 2H1SA 1GA4A 1XDWA 2PA3A 3A1WA 4GWLA 5A6VA 2G80A 3WBJA 4PLVA 2PRYA 3AX6A 2EC5A 4IO0A 2YH2A 4TT8A 2P62A 1VLHA 4XWTA 3WJ7A 4CPDA 4S1VA 1KOFA 2CV0A 4UAUA 4E88A 1MVLA 2XW6A 3U6BA 4DEXA 3N7AA 4E51A 3T3MB 4CF3A 2BFBA 2JIMA 1NSFA 4I6JA 5G0TA 3DEFA 4LWOA 4W1SA 4CM3A 1L5OA 4YECA 4QKQA 1OR8A 3HDTA 3C7KA 3HRIA 5IFLA 3Q3IA 3GMDA 4FFBB 2OE2A 2A9VA 3GMTA 4OI4A 2XRFA 3GOQA 2GPYA 1BKSB 4LZOA 3HS3A 3AOEC 5M34A 1ULHA 3QU2A 2XNCA 2PZJA 2QSUA 2BZ1A 3JQ9A 5D5QA 2VNJA 4V03A 2WY2D 3OZTA 4HGYA 2KLBA 2Q07A 1JNXX 3L07A 3DMTC 4L85A 4WVFA 4DWOA 2A0FA 5COAA 2O5VA 3EFHA 1NN3A 5MN4A 1DRKA 1C4XA 2CXOA 2D1YA 2I1QA 2CSUA 4MKFA 4RHYA 5IAJA 2I3DA 1S02A 4PAOA 6AT1A 5JZBA 1CS4C 4TTRA 2KI5A 3IJEB 3R0QA 5KSYA 1MX5A 2BFEB 2GTHA 4MZDA 2H0AA 3UB4A 2XWPA 3R75A 4B3TB 1LJLA 3O8QB 5JCXA 4B3RB 5JYBA 5GZ6A 1Y7PA 2ODEA 3CT6A 4JQYA 4ZCPA 4A5OA 1B26A 4NU0A 1N5KA 3EVNA 3FFWA 3FDZB 2PUWA 4LJKA 5T4EA 4LNAA 1CDDA 5E6SA 4V39A 1A9QA 2IDJA 4QOGA 5HIJA 3HL4A 3KEQA 1Q22A 3LUGA 4FCWA 1HR0B 4LE2A 3ZWBA 1KEZA 1LLCA 1GPLA 1S2IA 1SQFA 3PFCA 4MHOA 4Z3KA 4NH4A 4Z4HA 1ZESA 2X0RA 1PN3A 1Q77A 4OXIA 4P5PA 4QUKA 4AY2A 1W46A 4I9UA 3T95A 1UZMA 3EC2A 4F06A 1PKXA 3SZLA 2PA0A 4X71A 5KCZA 4TS1A 3Q3GE 2G9NA 3BB4A 3WKAA 4RFSA 2VHQA 2YL2A 3JQEA 2AJBA 3ME5A 2JJ2D 1DJQA 1F06A 1I7NA 1UF9A 4L9WA 5KYVA 2AI3A 1S3FA 3UXEA 2W2VA 4F0JA 3QU5A 2B7LA 1AKNA 3ND8A 2VPWA 1T8SA 3GIWA 5ALZA 5JFOA 1IZ8A 5HCIA 3VHRA 1OH5A 4RF3A 2AG8A 4FGLA 1GAEO 1KYYA 1N7IA 4JC5A 4XGQA 4EHFA 2Z8YM 1K8YB 3RGGA 1QAMA 5DSZA 3TW8B 2C8JA 3I9OA 4U7HA 4GDFA 3WGZA 4PHHA 5ECYA 3ZY3A 3CUTA 1JHZA 1OU4A 4OK3A 3SE7A 4DYDA 4OB8A 3HXKA 5DISB 5A4FS 4P4SB 3KYDB 2D1QA 5AHXA 3WE7A 3VZCA 2AQKA 1XQYA 1E3WB 2BLNA 3TTYA 2E4YA 1LX6A 3C7CB 3HVKA 3HB1A 4ZVUA 1RQNA 2HYIC 4JX8A 5DTQA 2V6BA 3SYLA 4DHEA 2YJ4A 4U00A 3T3NA 2X9NA 3UUFA 1B41A 4MR9A 2ZBQA 3M4NA 2QZJA 2C5FA 2UYQA 1W9MA 1BHJA 3U62A 1N2CA 5J43A 1S9HA 1L3BA 4BP8A 2VRNA 2WM3A 4KPGA 4IWNA 1QSGA 5K3FB 4AKIA 4P5DA 5CX4A 2FRXA 5FUYA 3S7TA 4HH1A 5K0FA 5M04A 3TZ6A 1HZZA 1K89A 1XDUA 4IZOA 2XOKA 4IS2A 4NZPA 3DFKA 5FBHA 4BECA 4CM9A 1IVSA 3FJ1A 4MVJP 3RYHB 3TOSA 1QFXA 5ELLA 4XWKA 1BH2A 1X9HA 1XYYA 5JMOA 3ZCQA 4DQKA 2ZRCA 2FN3A 1QIKA 2BPOA 5ALJA 5FRDA 3LNTA 3CINA 3FAZA 4MUHA 1SBTA 3CEJA 3ERCA 3C15C 3P0IA 1CE8B 3KB8A 5CRIA 2ZUDA 1LD3A 4FNOA 4M99A 5LOVF 1UK6A 3THWA 2BI8A 3C14C 1YMVA 1EDEA 1MMFB 1PJZA 5EP2A 13PKA 1N2BA 4I5DA 3IKMB 4E5PA 3G5LA 4PZUA 4CCYA 2GTPA 3LHKA 3EVDA 4C88A 4BLVA 1II8A 3IVGA 1PW5A 1K88A 4RVDA 1RS0A 2QLFA 2ES4A 5JE8A 3ORQA 3UAYA 1PG5A 1E6EA 1ZRSA 3KCQA 1B73A 1UFQA 2BFNA 4NV0A 3EPRA 3S1LA 2KB0A 2BFPA 2ZBDA 3LP5A 5HIIA 2L69A 3QA9A 4E5DA 3A06A 5HYVA 2D7DA 4MV3A 4WZZA 1V6SA 5A9SB 2C03A 1JF8A 1PT6A 2FP4B 4YAGA 3THXA 4E5KA 2XE8A 1AO3A 3AR5A 1KFCB 3EZXA 3LQFA 3PYMA 4G25A 3SNKA 4D92A 2ABWA 3O3CA 3WQQA 5FLKA 1R7RA 1CV2A 4E2YA 2BGLA 3VYTB 5TS2A 1J2RA 2GZDA 2V7WA 3HBFA 3AKCA 3PR3A 1XCOA 2O5CA 3U9TA 5A7FA 4JJIA 1Q0PA 4QO8A 4OGFA 3VZQA 4MGYR 1NU8A 2V7VA 2X76A 4TMXA 2H06A 3GMIA 1K6EA 2WU1A 1T8UA 1GADO 1UXHA 1W36B 2XYVA 1H05A 2GI4A 5M29A 1GFWA 1KAGA 2O07A 4UPDA 3NAZA 4R3NA 5EPOA 1AUOA 1NUUA 3TTWA 2YWCA 3WICA 1B42A 3V8BA 1J24A 4F5WA 1PJAA 3BZBA 3CQ9A 5KJ6A 1RWPA 1BX1A 4QWMA 4BCCA 5JADA 2FN4A 2A9JA 2C5LA 2JFVA 5JHHB 1X1EA 3WK8A 4M37A 4G4JA 1MJHA 1ZNZA 5KQRA 3A1NA 1GKYA 1X77A 4IYJA 4XQ0A 1SXQA 1K8QA 1E77A 3S27A 4A6EA 1EGMB 2WZBA 1WZ2A 1P9RA 2X8LA 2IP4A 2W2TA 1J8FA 3OJFA 2ZRIA 4RJLA 3K0BA 1Y3FE 2JCGA 4WLFA 4ZT6A 2ORIA 2VXOA 2QWXA 2OLEA 3FKJA 4JEHA 3OF3A 3K1JA 4DRZA 1GUDA 1HLGA 1D2CA 1CQJA 4DCOA 1PJRA 2H0QA 4YJDA 3DVQX 3FUUA 3KD2A 5DXAA 2FX2A 1LXCA 3SSOA 2DOKA 4BWFB 2I2DA 2JGIA 1NYLA 1PS9A 2Q5IA 4O6VA 3TR5A 4CKBA 4QQFA 5J4KA 4CETA 1XZGA 4WEOA 5KB3A 2HLHA 2E3JA 1R4NA 2COKA 3FNEA 3TXXA 4AP5A 5JUWA 1IWBB 1X1QA 4JIGA 3PGMA 1CY4A 2I4TA 3PQDA 3WSVA 4AJNA 4D3ZA 4OQPA 2D1TA 3QKIA 3TIFA 1FDWA 1HRKA 2R66A 5CFMA 2WJ3A 4KIGA 4RZSA 1ZQ1A 1V8OA 1XZNA 1NHGA 1EB8A 3DMYA 2VZLA 4ZMBA 3EXG2 1Z6XA 3DFIA 1THTA 4X85A 3HBAA 4B44A 2PY6A 4EIWA 2K7FA 3QJ5A 1KSGA 1AA6A 3KOUA 1V11B 3NTRA 3ITKA 2Q9BA 2PG3A 5FI3A 3WHLA 4I9GA 2DT8A 1YUNA 2CCJA 1NXTA 2J45A 2R1VA 2VN8A 3LCMA 3G2LA 4IILA 4M46A 4MS4B 1A76A 3B6KA 1LDMA 5B64A 2O2EA 1NQUA 4MW1A 2F43B 2JIRA 2QG6A 2XOKD 5BMVB 1GXSB 3FOAA 4CM9D 1XHFA 3V7NA 1X1RA 2FFQA 3PTLA 4MDYA 2H51A 2VJLA 3DDCA 3O1IC 4MICA 8AT1A 5CCBA 1MRSA 1YVDA 1TUIA 2PYIA 3VA7A 1OB5A 4YRLA 2WYWA 1Z4IA 2OHIA 2ZB4A 4KTVE 4G5SA 4X0EA 2IPNA 3SK0A 2FP3A 16PKA 4EA6A 5C8ZA 1M2EA 3J81A 3AWDA 3F9CA 3MVEA 3Q3HA 4E5SA 1XO1A 3Q5DA 4BMDA 4DXHA 4JLKA 1PUJA 3PQ8A 1A9RA 2F48A 2P5TB 3CNOA 4UNSA 1Y3AA 4PE5B 2XB2A 2EJWA 2GCOB 3IRUA 1P44A 3ITNA 1E60A 1GAQA 2JD0A 2VBGA 3DBIA 3AEUB 3CC8A 3GAZA 3PPWA 3OO0A 4O4JB 4JASB 4O4IB 3FTQA 4R9RA 3A9VA 4QOFA 1UP6A 2M2IA 3PNVA 4QFBA 2O2IA 3PFFA 3ZD8A 2SHKA 4EKEA 3ZCUA 1OX5A 4G5RA 3T54A 3DTVB 4Y9DA 3F2VA 3X0DA 5IC4A 3G0HA 2X8JA 3UMYA 2EQBA 4FGJA 1Z37A 3KJIA 1SXJA 5DCLA 5DKFA 3RYFB 3WK5A 3WTCA 2QI9C 2H4XA 3ELUA 3GN1A 3QUSA 2HHLA 4ZHQF 1Q12A 3L7YA 3DUFB 1XLTA 1VE5A 2HXSA 1EYZA 1TCAA 1CJCA 4G4IA 3R6TA 1YULA 5AVYA 1VCOA 2ZB2A 3RTBA 4X9XA 4NBKA 3FF4A 3L7LA 4GD3Q 2C8VA 1VBNA 1KQOA 5GAJA 1WDKA 3TUIC 1F8FA 1AN0A 1RAHA 1WUKS 2BTQA 3DE1X 2IY8A 4GXRA 4DNFA 1R15A 4R05A 4OAPA 3N8HA 2XPCA 4K7JA 4EB8A 2DR2A 4URZR 2PT9A 2O8BA 1HE8B 1M2VA 3KVNA 1X8KA 3ETNA 3VR6A 4IDBA 2I2AA 4C87A 1RLJA 2XTZA 2NX2A 1WMSA 1ULBA 3K5PA 2JZCA 3G9ZA 4XXHA 1EXWA 3ACCA 1T2EA 2AQIA 4E13A 1AGXA 4WZ6A 1E3LA 4B3MB 2BUBA 2H6EA 2VNIA 4J0HA 2OT3B 4R7ZA 1KEEB 1N0UA 1VCIA 1QDUA 1XK6A 2J87A 4WY5A 2R96A 1LTHR 4G37A 3S1SA 1ODCA 5BR4A 2FPPA 2ZIAA 3HB5X 5CA0F 1KI4A 1CS0B 4HWGA 5T3UA 1RYMA 1R3DA 3GV0A 1DXOA 4P3YA 2VDRB 3DAHA 3H5AA 2DKOA 3LNCA 1MORA 2HL6A 4FEEA 4W5HA 4EPTA 4XDHA 4Z9BA 1H5UA 1WAMA 2GEDA 5KTPA 4G89A 1LQTA 1SD5A 1A71A 1AUXA 2AWOA 1CK4A 4K6GA 2W4MA 4ZYZA 5CDFA 3ZV5A 5HDQA 3T1VA 1F60A 4IJMA 3FPGA 3O1HB 4TWJA 3INGA 3ZJYA 4A8PA 3P0FA 4LQLA 2XGMA 1UKVY 3UJ3X 3R74A 4QTYA 1I94B 1L8QA 4ON9A 3ZVMA 1TQDA 3VZPA 2W0SA 2ZRNA 3EQ8A 5HIMA 1FIUA 1FJHA 2C77A 2WJ4A 1HOTA 3CTPA 4KH0A 5JXIA 4KMOA 1ATIA 3KJGA 3KSZO 3MELA 3RE1A 1IZ0A 1TVMA 3C0KA 5EC8A 1JSCA 3AUFA 3FGZA 2LDBA 4AJOA 2C31A 1KSJA 1K8ZB 2QGZA 3MMPA 1TLFA 3F7OA 3A26A 1C1HA 1SKUA 2ARKA 3I2JA 2QD5A 2WF8A 4LY3A 4EUEA 2G67A 2PX4A 1RHKA 5GGYA 3TOZA 2RD2A 3ADBA 3PNOA 4DA4A 4PX9A 3IAS6 4UE3S 4JGBA 2IT1A 2NU8A 3N6VA 4PC7A 4UVGA 5DI3B 4U3JB 3X1DA 5JNUA 1BX0A 2NUAA 3ZTTA 2J0QA 2DMRA 2XMSA 3LDFA 7AT1A 4V0SA 2EW1A 5JASA 2CZGA 4YPFA 1YJQA 2FUG6 1FLDA 1IHYA 5I7AA 1O87A 3EIUA 2QTMA 4YRCA 2DULA 2RE8A 4HT3B 2YMQA 2BFWA 3N5KA 2VT7A 3ZWAA 4BKPA 1BDHA 1IXRC 2A78A 1ONPA 3DWIA 3KQWA 3KSRA 5CR9A 5TV2A 5LP6B 3T7AA 5DCYA 1NF8A 1LSOA 5JXGA 4Q47A 2GRUA 1O97D 4P82A 5LLSA 2IWRA 3NHKA 4LJ8A 1PSZA 2Y4NA 4N3BA 2AV6A 3PNYA 4RHXA 3T5DA 4Q3AA 5JJKA 5C51B 5BSMA 2WABA 3TOVA 3DZGA 1P8AA 3ZE1B 4NU5A 2AN9A 2FEMA 3CH6A 4MW7A 5CPFA 1QHNA 2P67A 1NZFA 1OD6A 2JIPA 1MFPA 2QQFA 3H8WA 3OSUA 4MVJH 3D6FA 4UM9D 4QUJA 5D00A 4B7CA 5FLYA 5BN4B 4E2WA 3OQOA 2UXBB 1TTQB 3HR8A 3RV3A 3WYCA 5E6UB 1G20A 1VPTA 5AM5A 4KNYA 1SXJD 2R6GA 3VU3A 4EH1A 2CXQA 1P1CA 4U2CA 3A0UA 1OBFO 6YASA 1EM8B 4RXTA 3FYHA 4HTAA 4PYLA 4GPAA 2GAJA 4HQNA 3D2AA 3V9AA 5BVHA 4R0NA 2FQXA 1DEKA 2YXPX 2FR0A 3CZAA 3ROGA 1OPXA 2WHEA 1V3UA 1NAIA 1YVEI 4ZALA 1Q0ZA 2I7VA 4M86A 4O4LA 4BKRA 4ZO4A 4YRJA 3S7ZA 3W1WA 3ESQA 2FW8A 2ZIFA 3DEIA 5K0NA 3GT7A 4L8YA 3DAOA 3QFFA 4M8KA 1F14A 1I10A 3RCBA 4F86A 5LP1A 3ER8A 1R4MA 3CURA 3HN6A 2ZWPA 4L0MA 2ILTA 3GGDA 3R76A 1T9ZA 4CMHA 5MGNA 2QGFA 2PRJA 3VR6D 1MEEA 3ZWPA 2V03A 2WPDA 5J4VA 1ZX1A 2JHCA 4FYKA 1UAAA 4E14A 4S1NA 3NDIA 1WPXA 1MG0A 2ZULA 2O2JA 5TRTA 4FOPA 4BX8A 4FMCB 5LXTF 2CUZA 2GZRA 4DUZB 4C4TA 2AGVA 4ZRDA 1DJPA 1E9CA 4KQJA 1T36A 2NO6A 5LBTA 3SLKA 4TKUB 2XEDA 3PDIA 3COSA 3SF0A 3SPXA 5I3ZA 3BE4A 3W8EA 4I0WB 2OZPA 3WRWA 1OFGA 5JO0A 1GPNA 1I9GA 1CJVC 4MRMA 2JZNA 5DLDA 1G0NA 1P5RA 2PTHA 2Q9AA 4U6SA 3ASVA 5SZJA 3JQ6A 4AKSA 1EJBA 3BBPA 1GQQA 4MS3B 3RFVA 5JSUA 4PO8A 3ZU5A 2J3MA 2VDOB 2RK4A 1VIVA 3HZRA 1HDYA 3BXHA 2EARA 4MWCA 1U0LA 1NR7A 1DXHA 2IUFA 1L5HB 3Q9LA 4FVTA 3TZQA 5BSVA 4CQLA 3RR2A 3O03A 3PNKA 4REOA 2AJLI 3ROQA 2ORYA 2WVJA 3GLHA 2HLPA 5A3JA 3FI9A 1O1YA 4HNHA 5ICGA 4TT3A 4OUKX 1COWA 5EEGA 2Q1UA 4TTIA 4YCNA 3O4GA 2WU0A 3QFHA 2XMPA 3EIWA 5H9WA 4IL5A 2E2WA 1LS1A 2BKUA 2GASA 2J9ZB 2PYZA 2QVLA 3L4BC 1A95A 5FTWA 3RSSA 4YR7A 2QVGA 2NV6A 1HNWB 1HA3A 2VDWB 2H7CA 3FI0A 3NM5A 4MP8A 4DADA 1YCFA 3I2GA 3K32A 1YI8A 3MBIA 4XWYA 5CYPA 1PP4A 1Z26A 3RSLA 3UXYA 3TSYA 1ONSA 2DFNA 3UV7A 3RRXA 2X13A 5SYNA 1C14A 3BMOB 1KYTA 5HGXA 1A5TA 5A4DA 4LQCA 3VH4A 5HOEA 4X00A 2AR9A 2V98A 4M60A 5ALWA 1J0BA 2OKGA 1N2HA 2VJDA 4H7EA 2ZT5A 4U6QA 2YV1A 3TLZA 3CMCO 3K0SA 5CJ2A 1E2EA 2IRWA 3ZZNA 4Y2TA 2GXQA 5K0SA 3JWJA 3WGMA 2GTIA 3TWOA 2YINC 3HHEA 5AVRA 2YWRA 1XN4A 1XMVA 1PUIA 3BDIA 4LRWA 4G23A 4WQMA 3RABA 4EHNA 1V41E 1TCVA 5HM8A 1ISJA 3N1UA 2AW5A 3MTJA 4OKNA 3FOZA 1KO8A 2H3HA 4GR9A 1CLUA 1GGNA 2ZRGA 3OQ6A 1SBQA 4A6XA 4CGZA 3LX8A 4GGMX 2OQIA 5F1OA 3HBMA 2UVDA 3AR4A 2XYGA 1CZLA 3VU1A 1DG3A 3GLVA 4KNWA 4HNQA 4QSHA 1J9ZA 1I1OA 3PQEA 5HEKA 3S68A 3WBKA 1TO1E 3WYBA 1MAWA 3SIPA 1NNSA 5JAQA 3IBTA 1EE9A 4RW0A 1TYAE 2QTGA 2C1EA 4WH0A 2ZRFA 4EVSA 3DF7A 4LF7B 2PLFA 2R7KA 1EUCB 3QYJA 4IIDA 4AWAA 3AUJB 5K45A 1ZM4A 3D81A 3NRCA 4CCAA 4LFCB 5B55A 1AU9A 2W90A 4UHJA 3A1VA 3RSGA 1LPNA 4AO7A 2RI1A 3N59A 4JVOA 5AM1A 2IJGX 1XL1A 1X8LA 4D8YA 4A6PA 4WK4B 2H85A 2G36A 2WKWA 3OWXA 5CGQB 3EVAA 1JI3A 4KGDA 2PK3A 3RKUA 2VAPA 4DVGA 3W77A 1DOAA 1SNYA 1Z5UA 1CQIB 4B34A 3DB1A 3GFQA 3AEQA 1M7HA 1XDDA 1BQ3A 4NZ9A 4UAJA 5ESRA 3TXAA 3RYTC 4WBNF 2HA7A 4EYEA 1P0CA 3RC8A 2PLNA 4GX1A 1A8UA 1HDIA 4MP6A 3VYRB 2B1JA 5F2KA 2VBFA 1C1XB 3CRQA 1NDHA 3D0OA 4JU9A 1FXWA 4BHTA 4X84A 1AS2A 3O1JC 1XZPA 3AHHA 1TRKA 1YFZA 3DNPA 3PIIA 1R6VA 4IUDS 3TKAA 4ZJUA 2C5HA 3IEIA 1Y4SA 1KC1A 3IAS1 4KSCA 4ZCSA 2O7NA 2XT9A 1EBBA 1JFTA 2EVWX 2A14A 4ZZ0A 3CVJA 4UCQA 3RRNA 1Y89A 1MTOA 4F4CA 1J8DA 2WPDD 4US2R 4JL8A 1SR8A 1UT8A 2EQAA 2R2AA 5C8VA 1F3LA 1BHSA 4PLWA 4RIFA 3AM1A 4NTZA 5KREA 4AIIA 3HO1A 1D4OA 2FUG1 1QYXA 2HNAA 1WE2A 1P75A 3GA0A 1TRHA 3MMSA 4OSPA 4UHEA 3WBFA 5KTMA 3K0EA 3HDHA 2M6RA 2O2ZA 4K0KB 4CEJB 3QPBA 2CE2X 4QXQA 3AERA 3SYMA 4IDHA 4M49A 5LDDC 1YH3A 3QMMA 5HE9A 5BRNA 4JI2B 3KPJA 3MK31 1XZBA 2BAGA 5LD2C 3OLQA 1GKUB 4KI0A 3B1FA 3G0GA 3PDJA 2PQMA 1YE5A 4OMFG 4LRXA 4V0NA 5G3YA 3K70B 3MJRA 2HHCA 1DADA 1KKUA 5CFPA 3PGKA 4HDAA 4Q6WA 1ORDA 3K15A 4OB7A 4RA9A 5TPWB 3JAMA 1S1CA 1L8AA 3EQ6A 4FNGA 1GNPA 2IEYA 1ZMOA 3D8RA 5JJIA 3OLCX 2C98A 4PGMA 1G9XA 5LLTA 4NPCA 2NYUA 4Q3LA 2PBLA 2MYPA 2WMNB 2WJAA 3NWOA 4TT3D 4UATA 4UVIA 4MEJA 1COWD 2K4MA 4OLHA 5EMHA 5AW2A 3EG5A 3GEGA 5MDHA 1X14A 1RKQA 2GQ0A 4QA9A 3SR3A 1YR3A 3FDIA 4KR2A 2A0XA 2QMEA 4EO4A 3UMVA 1ADGA 5BXYA 4YMSA 8ABPA 1LGYA 3RTAA 1GCGA 1RPTA 3IIKA 5LBIA 3V2HA 5GONF 3HLKA 3PZRA 1F51E 1QG2A 3RK1A 2H3EA 4JB8A 1KO5A 2G7ZA 1DDGA 2J5BA 1NVUQ 1HTWA 1SH7A 2OY0A 3H18A 4WFQA 3SN6A 3HUFA 1NM5C 4LJ5A 1FSPA 2H4JA 2C5AA 4YT2A 1MDBA 1GRCA 3BT7A 4LTDA 5COBA 1U0EA 4C3OB 1ECFA 1Q3TA 2H1OA 2QAGA 2R8XA 3OIUA 4E5MA 5BN3B 4L6AA 1JJAA 2Q6OA 4HF7A 5JS1A 1X1DA 2XMCA 3UHPA 2WJJA 4M3NA 3UFBA 2X6RA 3Q7PA 4TQUS 3OHMA 1CJTC 3PDCA 3EXAA 1FDSA 2DWQA 2BY4A 2GZHA 4MQLA 2B3DA 4QQRA 4U9HS 3WDKA 3ZVLA 1IY8A 1NXSA 4II3A 3ZW8A 3WSTA 4EAQA 3LX6A 1Q6ZA 2NXEA 1KRWA 2CWDA 2CMHA 1ZITA 4KXWA 3VX4A 3PPVA 3D8SA 2FUCA 1GLGA 4UBMA 2ONZA 1T5DX 1UODA 3RUCA 2O1SA 3W2EA 1RBYA 4DA7A 2GYWA 1IZZA 2XV1A 1XQ6A 1XELA 1Z2CA 3FZNA 1DQZA 1MR3F 5EE5B 4DMHA 5FI1B 3PDWA 1ENZA 2B30A 1DB3A 3L7NA 1MX9A 5HPYB 4B8WA 1QYIA 2FPGB 3CO0S 2XHZA 3E2MA 4B2PA 4XTCS 1CB7A 4KXUA 1ORWA 4LHSA 1ODTC 3WWYA 3QGMA 3WLLA 4BJHB 2ZUBA 1RQLA 2Q4OA 4PEVA 2CB9A 3WL3A 2VJKA 1XTZA 2V9ZA 5EJ6A 1VZ3A 2H1WA 3BJEA 1RIFA 4HSGA 2V7BA 5DHPA 2FW1A 4YRBA 5AVWA 4OA5A 4LBZA 2J08A 2OBYA 3B3JA 2DVMA 2PH1A 3DP9A 4I4LA 2G5GX 1RXUA 4DBVO 5SYMA 5SY9A 4X3OA 3F8WA 4KFUA 4QOEA 1SAYA 3WB9A 3ZXXA 1VHJA 1YR9A 3HWSA 1TAGA 5CUQA 1N9GB 4ETMA 3AI7A 4KBFA 3MSCA 1L8XA 1Y34E 5AK0A 3R4VA 5IW8A 1UBRS 2VP6A 3HCCA 4LJ7A 1SULA 1YB5A 5BQFA 3M6FA 1GAWA 2DFTA 1NN5A 4Y6SA 1J7JA 4UMVA 3RUPA 3QYPA 1AB5A 2GO1A 3G2PA 3GR6A 3ZR4B 2A59A 2FN7A 1BG6A 1ZU4A 4IIXA 1EFKA 2FR8A 1G5FA 2Q2QA 4PN7A 2F8MA 2GKGA 2YXEA 3R3JA 4W1RA 4HGZA 2BEKA 4B9EA 1ND6A 4OI0A 3ELYA 3MJHA 2HMWA 7REQB 5M5BA 3F0TA 5ICCA 3N53A 1A4IA 5MFPA 1JSRA 1YHNA 3HLTA 2EKPA 4GKJB 3EVGA 4E70A 4PPYA 4BQNA 2QQGA 2KYRA 3IALA 3JPYA 5D87A 4KGXA 3VV2A 4QPNA 4BBAA 1QWOA 1NW9B 5EE3A 1TW2A 3ZDAA 4M22A 3N0TA 1AKVA 2YYZA 3AVXA 4JU8A 4JYAB 2QUKA 4TWAA 1F6DA 1DBWA 2I4NA 1GTJ1 3O31A 3EODA 2O06A 5ALHA 3W6ZA 3LSYA 5GVSA 2HQRA 1SQ6A 5DHSA 4DDVA 2LXNA 1A0OA 1QHXA 3MOIA 2NV0A 3D02A 3VKHA 4CV1A 3UJ9A 2QTZA 2E5FA 3Q7RA 4EJFA 3ADPA 3X1XA 2VP0A 4CJXA 1H0RA 1OGIA 1P0FA 2WM8A 1G59A 2ATVA 2QN8A 2IHUA 3E1KA 4YALA 1RXWA 1TZMA 5GIOE 3KUCA 3IP1A 4BTLA 1Y3CE 3O90A 4GOLD 3T41A 3W4KA 2P41A 2HV9A 4DANA 4GBED 3CF0A 1KDPA 2XMGA 4UE2A 3FPFA 3BDVA 2FZCA 3FJYA 2UAGA 1U7PA 4JC0A 4CMIA 2HT6A 1Z34A 2RDMA 3AM4A 2FF5A 3JQRA 4Q3DA 4IV5A 5EMMA 4EGCB 2H1LA 4BFSA 4I55A 2X0NA 1BWQA 1ML4A 1WP9A 4FLFA 4QOHA 3FMVA 1RRFA 2F9MA 4Y7CA 2H2HA 1JBEA 1T0JB 3F49S 3IT2A 2WAMA 5DGXA 2VQDA 3T7IA 4KQKA 4ESHA 1IHOA 2DC1A 3KLNA 2XDWA 5FX2A 1CYDA 3BQ9A 1ULAA 1VPEA 5THQA 5DMHA 4PS1A 2ZRLA 5AW4A 1ZHFA 4EF4A 4TYYA 2CEAA 9ABPA 1RE1A 2W9XA 3FZGA 2RSLA 5K6AA 2HFKA 1IBCA 3CRW1 2YCBA 4TXMA 3CX7A 4LHZA 1TTTA 3IV9A 2WF9A 1KARA 2REQB 4ODIA 3AVTA 3QENA 3KWLA 4NK5A 3RSFA 4DIUA 4LRSB 3G17A 1E6WA 1SCBA 2F67A 3O91A 3OUTA 5JR3A 3WYNA 4O02B 2UUPA 3SVZA 4KCGA 1O95C 5JAMA 1IPHA 5A71A 4RAQA 1MLDA 3AXTA 1U81A 3GZJA 3CPHA 2ZI6A 4H0CA 1QFYA 2B36A 2WIFA 4RD6A 2YXLA 1G42A 3KFLA 4TSRA 1FSZA 2HWUA 3F6PA 4NHEA 1Z06A 2FPLA 5ALVA 4ND8B 1V7PC 1O0SA 1OY1A 2B0CA 3CCFA 4ITUA 4KUEA 5JVDB 2G88A 5K4AA 2EV9A 3BIJA 1QIFA 3D54D 2BHTA 3FMGA 3G2QA 3KOXA 1U1GA 1OH7A 4OL9A 1VHLA 5K8TA 3OQPA 1D2HA 2H4WA 5EJMA 3WFJA 1QH9A 9LDBA 5JZMA 3G2OA 4DL9A 1JYSA 4RK6A 5EQDA 1ZINA 3MJVA 3DYIA 4II2A 4ARVA 2CN1A 1W52X 2GB4A 2HZ7A 2NUTB 5I7UA 4RTOA 2XRZA 3GLGB 3PBKA 3TKYA 3H9JA 1WSBA 2BBWA 5C7YA 2O8EB 3PC6A 1XPRA 2FMTA 3I4FA 4YRSA 4AQDA 1Q57A 3BWEA 5AK4A 5H80A 1M83A 1Q1ZA 3OA0A 3E9MA 2GF2A 3FD8A 3ILYA 4IIVA 5AOBA 2PN1A 3WADA 1GUFA 5I7SA 3B12A 4FZRA 4YMGA 5KHLB 1E7QA 2J0UA 4X7BA 5FOQA 5JXWA 1QH0A 3MEQA 5KNDH 3IUYA 2OCDA 1K3UB 2VSXA 1V3VA 4X20B 4Z0TA 2O8FB 1B74A 3TMAA 4A03A 4H60A 4TTSA 4YFVA 4JQZA 4AFNA 1PJ3A 1WBJB 3SSAA 4YP0A 3S6JA 1VE7A 2A8YA 5JAIA 1TM4E 2DEUA 2R86A 4QELA 5REQB 1P29A 1JDBC 4Q7JB 2PX3A 2X0FA 3MBOA 5EJ5A 1IJEA 1FXUA 5LLDA 1UK8A 4LC9A 1P33A 3QVTA 2FPMA 2FEKA 3SFVA 1TTPB 4NZYA 2WWWA 4CIVA 5IKEA 4UM7A 3UJPA 3OTOB 1Z4PX 3OZCA 1IXYA 2IXFA 1IN6A 2J07A 1CUFA 1G3RA 4PX3A 1D8TA 3OEYA 4PQEA 1JHOA 2KX7A 4U2GA 1PHRA 1Q1GA 2GBLA 1S3SA 1XYGA 2YDXA 2ZXUA 3B52X 1L7NA 1XKTA 2DY0A 1QGUA 3B36A 1SFRA 3LUCA 1Q44A 3MPUA 4J0JA 4R16A 4RTLA 4YHHB 3OPYA 3SCZA 1IOZA 2WYHA 3I1FA 4GGOA 4FT2A 4E2XA 3K0HA 4BEVA 1RR6A 1CP2A 3UW1A 2XOXA 3GGCA 4D79A 4ZU6X 1JFFB 3N2IA 5D7BA 1ADCA 1DC4A 3HJBA 1VMIA 2BHNA 1QH1A 3IO3A 4S2EA 2XE6A 1XJWA 2EGHA 5FO1A 1U7OA 4CDNA 5L95A 4LGVA 3MGAA 1V8PA 2O3SA 3R9XA 5FPQA 3D7NA 1A2KC 3OZEA 1BN7A 4RZ2A 1CQZA 3MCAA 1GQRA 1CUGA 4EYSA 3QBTA 5KMGA 2Q62A 5TVGA 1N4DA 4D43A 2WHQA 1Z82A 2BGIA 5DP2A 1HNXB 1UZAA 4L5JA 4WFIA 2O8CB 3EUEA 1H8HA 4PYJA 1K7EB 1SUEA 5BNWA 4QAQA 2YN4A 3NORA 4JJEA 2O54A 1Q92A 3G2HA 4W4TA 3WBBA 2GEVA 3B6JA 4BQFA 1PE0A 2UVQA 4B3SB 1SVNA 2WKSA 2WZQA 4JOSA 4WIAA 1HURA 2J8ZA 4OJYA 3OZ7A 3B8HA 4RA6B 3R0VA 4RV4A 4XB6B 4ZZ2A 4L6IA 5ECWA 2QSZA 5IM5A 4C6HA 5ADVA 4IJKA 5BSWA 1E66A 2H8KA 4INJA 4NI5A 3O2SB 2PH7A 3C4JA 2F64A 4QJBA 4F72A 2NUPB 4OL0A 4BKQA 2VDVE 1E5VA 3UWOA 3WNQA 4KJZA 3K8ZA 3SC2A 2NP6A 1MXHA 3PJEA 1UJCA 3E84A 1GZ4A 5A0FA 4B3DA 1OLXB 2VJOA 2DFVA 1BS2A 4MROA 5K20A 5KI6A 2HIMA 4Q4JA 3GFTA 1GSAA 3DDHA 3N2GB 2I6SA 3EPLA 4Z8YA 4YRRA 3RS5A 4DS3A 2ZAIA 4OKIA 1P2TA 5ABPA 2D8AA 4J1SA 5F4BA 4BFLA 1XEWY 1BW9A 2EWMA 1V4VA 1XT6A 5LMZA 1D09A 1RQPA 2PT7A 1W5AA 1Q7RA 3WSWA 5AESA 1I4EB 1M66A 4RZ3A 3EZ6A 3EIFA 1T6ZA 1S0UA 3INRA 4Q05A 3OCYA 4S0ZA 5K1ZA 1LDEA 1AK2A 1SZDA 1WSAA 4RHUA 2F3TA 2QR3A 4IMIB 4XRRA 1V1JA 5EPUA 2QE7A 2WF5A 5HKOA 1T5SA 4L5CA 1TEZA 4IUCS 2H08A 1UJ4A 1MHTA 4AQ7A 2W43A 4H27A 5EXTA 2WIGA 3H2JA 2EBHX 3WZLA 3TPZA 4B8YA 4DAEA 3EN0A 3B2EA 1XVAA 1V43A 2NYVA 4FHFA 3UO8B 4Y18A 1RP7A 2CNNA 2JIOA 1EU1A 5LQKA 4A8JB 4FMPA 1QAQA 1PJTA 2JHGA 4HS4A 3M33A 4M55A 2BZSA 2D6FA 1C30A 1R00A 3HRHA 3NWPA 3EDCA 2JAQA 3GROA 2A58A 3JD2A 4TWIA 3BMCA 4U2DA 3B6MA 5EXXA 4BFWA 2NV2B 3H2ZA 4RTSA 2WSMA 3GO4A 1JR6A 4HKTA 1U7DA 3NHWA 5EWJA 4MP3A 4U9IS 3WC4A 2G77B 1CUSA 1R66A 3R6GA 3PCRB 5ILGA 2AD1A 3RM3A 4TV8A 2UZ1B 1NVVR 3DS8A 3JR7A 5DWVA 1SUBA 3HA3A 3S3TA 2TMYA 3NHYA 2ZI5A 3AHJA 4CI9A 3OT1A 4W5JA 5KWIA 5GV7A 5BT9A 4YP9A 4EI7A 2BR5A 3GFBA 3EISA 4NICA 4NCKA 4B0PA 3DXZA 3OFNA 2HEGA 4TTQA 5LQSA 1ZBDA 5H82A 1M7GA 1R0LA 4MINA 2IEZA 4P9NA 5HTOA 1KO1A 4FZVA 1SBYA 3HB7A 1LC0A 3S1AB 3PIDA 3HLYA 3GCDA 1QHHB 2AXPA 2C9MA 2W7TA 5C8XA 3ADCA 1EA7A 4GUAA 4LPSA 2WUFA 5IHXA 3WRXA 5EIBD 1U2GC 4N6OA 4TX1A 5FWXB 3HMKA 3J81k 4AF7A 4C6TA 1TJ5A 2J31A 3EF1A 4JENA 3ZWMA 4B4OA