4TYQA

Crystal structure of an adenylate kinase mutant--akm2
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
215
structure length
215
Chain Sequence
MNIVLMGLPGAGKGTQAERIVAKYGIPHISTGDMFRAAMKEETPLGLEAKSYIDKGELVPDEVTIGIVRERLSKSDCERGFLLDGFPRTVAQAEALEEILEEMGRKLEYVIHIEVRQEELMERLTGRRICSVCGTTYHLVFNPPKTPGICDKDGGELYQRADDNEETVAKRLEVNMKQMAPLLAFYDSKEVLVNVNGQQDMEKVFKDLREILQGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
publication title Crystal structures of thermally stable adenylate kinase mutants designed by local structural entropy optimization and structure-guided mutagenesis
doi rcsb
source organism Bacillus subtilis 168
molecule tags Transferase
total genus 78
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tyqA00
4IDHA 4YDHB 1WCV1 1II8B 1IHUA 2IYXA 1J90A 3Q9LA 5TY0A 5EP4A 4G5QA 4A8JA 1CRQA 1FUKA 1XTQA 1IN6A 3NH6A 2YOGA 4G3XA 3RNLA 5J4YA 3U6KA 1ZC4A 1XTSA 2OM2A 3ADKA 2CLDX 4IFEA 4US0R 4EQ6B 4M9XA 1IY0A 4EPTA 4PAQA 4GOXA 2XOKA 1W0JD 4M1TA 3BFXA 4I1UA 3B13B 1UEJA 4Q7KA 3T35A 4TTQA 2BIFA 3EA0A 2F6RA 1N6OA 4YMVA 5HCIA 2PMKA 3CKLA 4KBGA 4W5HA 2X19A 1JECA 1N6RA 3GLHA 2ZI9A 3A4MA 3AGQA 4AI6A 2CCGA 1GTVA 1GG2A 3KUDA 1MOZA 4ACBA 2DB3A 2FEMA 4Z51A 2VP5A 2JATA 4CGZA 3KXIA 1ESNA 3WMEA 2BCJQ 3GFOA 4DLTA 2LWIA 1YR6A 3QXHA 1FX0B 1KOFA 4N1AA 4OHWA 3FVQA 3X1ZA 4BZPA 1GFIA 1A4RA 2QUZA 1DARA 3RS2A 4M53A 2XZOA 3QF4A 1D8TA 5FFMA 1KMQA 3QJYA 1P62B 1M1YE 4HAZA 3D7MA 4D25A 4DHEA 1F6BA 1DBSA 1OE0A 5EE9A 4MKFA 1T5IA 2WJHA 5DNYB 4C2TA 2ZU0C 1QHNA 4G5OA 4QXAA 4PHHA 2F1IA 2IS4A 2W6JA 4PSVA 4ASUA 5GVSA 1TQ4A 1S0UA 4RFSA 4AURA 2C78A 2FH5B 3VMFA 1UDXA 2O0JA 1JALA 2FU5C 1M74A 2VSXA 2FV8A 1D9XA 2GCOB 3HPQA 4BLPA 2P67A 4DIEA 4U5XA 4PQFA 1PLJA 3AEZA 4MYTA 2ZU6A 2DWQA 3P1JA 4JL5A 2RB4A 2XB4A 1P2VA 1Z0AA 4DLUA 1EX6A 3K0CC 4DCSA 2FE4A 4URUR 3TVTA 1E9BA 1Y3AA 2IWRA 1QVRA 3LWNA 5LD2B 3EIQA 3NKVA 2RGAA 3IUYA 3MAAC 1IOZA 1ZC3A 5FOXA 2VF7A 2ZRCA 3L2OB 2G88A 1G7SA 3KL4A 1QG4A 4TYQA 1DAHA 3T61A 2Q3MA 1G3UA 2VPPA 2OBLA 2NOAA 3AVPA 1EXMA 5HKKA 4XOIA 3I61A 2AN9A 5FL7D 1N6NA 2A2ZA 2ATXA 2YOHA 4BFYA 1X6VA 4DBLC 2IYZA 1NRJB 2F3TA 4WOPA 3SFZA 5JEDA 1EK0A 2QMHA 1US8A 4HDQB 3THYA 2J41A 4TL9A 3B1ZA 8OHMA 4EDHA 1TNDA 2ZRPA 3WYGA 4B48A 3PUVA 2WJJA 4G5GA 3LV8A 2QENA 1E98A 4TLAA 2JLZA 2P5TB 3QE0A 1TU3A 2BBWA 1JXOA 4KYUA 4Q4HB 4CYMA 3K0FA 2QTVB 1HE1C 2GETA 3PENA 4TZ6A 1WP9A 2IF2A 1NN5A 3EARA 1E9DA 3RRYA 3MSXA 4AY2A 4JYCA 2WIAA 4CW7A 3KQHA 3BE4A 5C1BA 4KLZA 4JT4A 1Z0IA 4OYHA 4AKEA 1II0A 4TSFA 4K81B 1Y63A 2P5SA 2GHIA 1E0SA 1DAKA 4HYYA 2O8CB 3VQTA 1TMKA 2CXXA 2PL3A 3DDCA 4TTPA 3LH5A 3NHBA 2JDID 1XEXA 3ND9A 3O8RA 2C99A 4BE7B 3VNVA 4EKDA 1EG7A 4WW0A 1ZD9A 1IJEA 2IBMA 1U9IC 2P6UA 3KZ1E 1RFLA 4RVCA 4IJMA 2HT1A 3ND8A 1G8FA 4BASA 3KJHA 2G77B 1A2KC 1T8TA 4PAOA 3N5CA 3QEOA 2I1VB 4KFRA 2ZRMA 3I62A 1T4GA 1XEWY 2AWOA 1CULC 1MKYA 4Q7LA 2IEZA 3WHLA 1UAAA 3AVYA 3BB3A 4HSEA 3QPUA 3A4LA 3LW8A 3EZ6A 2MMCA 1VTKA 2YWHA 3I4LA 1S9HA 2GBLC 3SYKA 2ZE7A 4GL2A 4NZYA 1BS1A 1X8LA 1N6LA 1OIVA 2ORIA 3U3JA 3GLFB 2H8KA 4GZMA 3C15C 2QAGB 4IOMA 4JVSB 2OFXA 1W5TA 1E2HA 3TAHA 4KHZA 1G3RA 4TQAA 5EUMA 4GBMA 1IONA 1PVOA 1I2DA 4NHOA 1KIMA 1CJUC 1BMFD 4FMDB 1COWD 1N0UA 4S35A 2ZJ5A 1KAOA 4PX9A 1R0YA 1IY1A 1GUAA 4HDCA 1XD2A 1AQYA 1FNNA 3U44B 221PA 2ZITA 1O87A 2ZXUA 2A5FA 4D0NA 1S1CA 4D82A 5L3VA 2A3RA 4QGFA 1VMAA 2CJWA 2VLIA 1N6KA 4IDNA 2OESA 5HZHA 1S8FA 1XU4A 1N5LA 3RVBA 3RANA 4HLDA 2IYQA 2F3RA 1XPOA 2GXAA 2GAAA 1GL7A 2YC2C 4Q02A 3UATA 2V54A 2XNDA 4WAUA 2ATVA 3MG9A 3IIJA 3NEJA 4B43A 5AK0A 2EFHB 1YZLA 2GK7A 4Y0AA 3NEYA 2BCGY 4B3GA 1WQ1R 5F2EA 2ZR7A 1XWIA 4JKYA 4M1KA 4HLUC 4MRSA 4PO1A 3K9LA 2PEZA 3IQXA 5DHAA 3LX8A 3W3ZB 1XFAA 4WZ6A 2KWIA 5LB4A 2GA8A 4HAXA 4LY6A 4NCNA 1OYYA 3TQFA 5L8VA 3BD9A 3WMGA 5P21A 4IHQA 2JLUA 3AF0A 2FJUA 5KTYA 5E4FA 4UNNA 3QXCA 1Z2CA 2BKUA 1XB2A 1T5LA 1W47A 1OKKA 2GRJA 2WSSD 3AM1A 4Q9KA 1WA5A 3A6PC 1P6XA 1VG0B 1L4YA 4A82A 1YVDA 3B5JA 5CYOA 2XNSA 2ZI7A 1FNMA 3U6BA 2C96A 4TMZA 1SGWA 2ZYWX 4U00A 4XTCS 3AVVA 3AVUA 2WWGA 1SXJC 3OE7A 4ZI2A 3KKQA 1X8KA 3IGFA 1DAMA 2ZRAA 3H0KA 3VR6A 1KI4A 1ZM4A 1D9ZA 1IXRC 2VQSA 2W0MA 3QKRB 1NY5A 3SC3A 1JJ7A 5JEEA 3U3OA 4LYJA 2QMOA 3OFND 4DLYA 1SQ5A 3DMNA 3VR5A 5DHFA 2ZRBA 2ZVQX 2XB2A 1IM2A 4A8JC 4D0LB 3DEFA 1II8A 3CRMA 1ZUNB 2D2EA 3WY9A 4B35A 3U3RA 1LF0A 1N6PA 3KKPA 5TDHA 2AX4A 1II9A 3QSYA 2W6ID 1PLLA 2BBSA 3TMKA 5JJIA 1F5NA 4BZQA 2ONKA 1AS3A 4EQ6A 2XTZA 1P5ZB 3ECCA 1OXUA 1G16A 3DZDA 4WVFA 3BBPA 1KI3A 4TWZA 3AB3A 3OIVA 1Q21A 2VRWA 1NBME 4TMVA 4XWKA 4GOJA 4NCIA 4DLVA 2GTPA 1XNJA 5EXSA 1P2SA 1K5DA 2R2AA 4PZZA 1FX0A 1GL6A 5DYIA 2GF9A 3JZAA 4AC9A 3G0HA 1P3JA 1U0LA 4AWXA 4QBFA 3R8FA 2Z4SA 4XVRA 3OHMA 1XD9A 3I73A 1WBDA 2GZDA 4RZUA 3PCRB 2YC4C 1E2JA 4FIDA 4JL6A 4BLTA 1Z22A 2BMFA 2P0EA 3B1VA 3HYRA 4LV6A 4P4TA 3WRYC 4OQMA 2J3EA 1VCMA 2R65A 1N5IA 5DI9A 1P4SA 3ZIAD 5KO2A 3NG1A 4PC7A 1NIJA 4XVQA 4B2PA 5AJWA 2PBRA 2IK8A 1VG9B 4JT2A 3VR3A 4TLDA 4CEIB 4AYWA 4L9SA 2RHMA 3EC2A 4L16A 2IUUA 4BLRA 1E2LA 1QRAA 1YU9A 3KQUA 1E1RD 2GCOA 1KI7A 3FHOA 1ZIOA 2WKQA 1UBEA 3BJIC 1W4RA 1DAFA 4IFBA 4A2PA 5JCZA 2W0SA 3CZPA 2J0VA 4KFSA 2JJ1A 3CNLA 2CLSA 3QNUA 4GZLA 5LDDC 3M1IA 2PLRA 1A82A 3P26A 1Z3IX 1E2MA 2X2FA 1UBCA 2VSFA 1YZTA 3FFBA 3OIWA 3PUXA 3ETLA 1ELOA 3QF7A 1KGDA 1HTWA 3DMDA 1G21E 1M34E 4HB2A 3K53A 4LK2A 2A5YB 4A0FA 3A36A 1W49A 3CWQA 2R6AA 4YQFA 5EUQB 2ODWA 4HB3A 5AJZA 2PT5A 2ZRHA 4DSUA 4US2R 1FMJA 1ZBDA 1F60A 4PTLA 3FKSA 2VL7A 1E9SA 5GJWC 3U7EB 3K0SA 1YR9A 5IDVA 4NYIQ 2BMEA 4RY2A 5FBQB 5FL7A 3TNFA 1NBMA 2GXSA 4WXRA 1Q0UA 1ZU4A 5JZVA 3BK7A 2VHUA 5CJPA 3LA6A 4JYBA 3CNNA 1G6OA 2D7CA 4JIMA 3LLUA 4ACAA 3KQNA 1UF9A 5FUXA 1GSIA 1DOAA 4KSCA 1S96A 2ZSDA 1XXHB 4PANA 3EPJA 4DC9A 2QROA 4MKHA 2OSBA 1GKIA 2G9NA 1RIFA 5G53C 3SJZA 1YR8A 4X8OA 1P73A 1S2MA 2RGNA 2WPDA 1OFIA 2AKAB 3R7WB 3AV0B 4B71A 3BH0A 3NXSA 2EW1A 2YV5A 1E2IA 2MSCB 3IIKA 3IPYA 3P4YA 4NYJR 1AKEA 1W4CA 4OQFA 4D6PA 2A30A 2O8CA 5KU1A 3FE2A 3GCGA 1KK3A 1E9FA 4AG5A 1O3YA 2KI5A 3GEIA 4N3NA 1UBGA 4BFUA 4FMBB 4EPXA 1S3GA 1Z6TA 3ZVRA 3NVAA 4PZYA 5CIQA 2VP0A 2FX3A 5FPTA 5H70A 1OB2A 3QXXA 4IDQA 1W44A 1Q1QA 1NVXQ 4K8OA 1E9RA 5A0FA 3UG7A 1QG2A 2WWFA 1KHTA 3T1VA 4B2LA 3I32A 1NL3A 3TUZC 1AGRA 4L4UA 5HE8A 2AR7A 2J5XA 1R0ZA 3UG6A 4E09A 5DE3A 5EP3A 4C4PA 3FTQA 3SJCA 3AVXA 2G3YA 3KUCA 4LHYA 4PFSA 3HR7A 1M7BA 4PPNA 4DCNA 2J1LA 3ADCA 1NN0A 2GJSA 2ZE6A 4S2EA 3DO6A 3U3KA 3IEVA 2ERYA 3WNBA 4A0RA 1R10A 3K0AA 4QJ5A 3DL0A 2ZE8A 2PLFA 4V0OA 2QA5A 3EWSA 4WZBE 2OXRA 4JLJA 3KKMA 5L3SA 2OFWA 4PHFA 3HPRA 2NO1A 3SBDA 2N42A 2QE7D 2QP3A 1N0WA 5FBVB 5KNCA 3MRSA 1ZNXA 4C2UA 4A9AA 1ZMXA 4UJ5A 2N1BA 2G0NA 1XMIA 2JLXA 3OAAD 3TAUA 1XCPA 4WXPA 2Z5FA 5TARA 3ZYCA 5JMTA 3UPUA 1NSFA 5EE5B 4OHXA 1DVRA 1WRBA 5CJ2A 3TSZA 4M1SA 1XJCA 3MMPA 4QJ4A 1VCNA 1XEFA 2R44A 1A2BA 2GEVA 4FI3C 4GT1A 3WRXC 4A0GA 4C0HA 2IS6A 1G5RA 3NTUA 3P20A 4KV9A 1P9NA 4RZXA 2ZJAA 4PSKA 2PX3A 4Q9HA 5E7IA 1QHHB 1ZVQA 4K46A 1ZINA 4DLZA 2FFHA 1Z6YA 3GMTA 3MLEA 4LYHA 5KNBA 5JJLA 1AM4D 2WTUA 2TMKA 3SZRA 2ZSBA 1GZSA 4CEJB 721PA 2OAP1 4MDEA 1CR4A 3PUYA 4LV5B 4TMKA 1T9HA 4FW9A 3CBQA 1U2RA 2GXUA 5JRZA 5KHOC 1DG3A 2W2TA 2IA5A 3SE0A 3QKSA 4JLBA 1R8QA 5TXGA 1GM5A 1NMYA 4ZIRB 3IILA 3HU2A 4Q01A 1AJEA 2YWFA 2IS1A 4DWJA 121PA 3AP2A 1TF5A 1FQKA 3B9QA 3MFYA 1F3OA 3GJ8A 4E5UA 4LHZA 2FSHA 1G8PA 1QBKC 1XX6A 5JHHB 2QPTA 2O8DB 3L0IB 1P9RA 1G9XA 2AD5A 2V7QA 3BS4A 5IK2D 3I8XA 2FNAA 2D4HA 2GVDC 1CR1A 2AXNA 3AKDA 4HLUA 1UBFA 3W8RA 5TMPA 4AKIA 4ZI3A 1TF7A 3G5UA 3OF5A 5EZ6B 3O8CA 1FP7A 4KXFB 1SKYE 4JLOA 5GJVC 1JI0A 3AP3A 4QHSA 5TVKA 2YOFA 1NN3A 1Z06A 3CR8A 3QKRA 1FQJA 2AK2A 1W48A 3PXGA 4MYHA 4B32A 4RD0A 4B33A 1BIFA 1R4AA 1WDTA 2J0SA 4M1OA 4RKFA 2ZSFA 2O8EB 2ZJ2A 4OJQA 2EFGA 4EJSB 4DVGA 5FOWA 2Q9BA 1U8YA 2ZAOA 1GL9B 1YZKA 2CNWD 3FMOB 4HZIA 4PPGA 3EPLA 2P6NA 2R6CA 5EXXA 1Q1ZA 4BWYA 1VYTA 1FTNA 5EP2A 4D81A 2IYLD 3RS5A 3A1UA 2AKYA 2O8BA 2F55A 4RKEA 2OV2A 1VIYA 1H8EA 2ZRLA 1OXVA 1KJWA 4BFTA 3HWSA 2DR3A 3UIEA 1CXZA 2FSGA 3R9WA 3CF6R 2DPXA 1TEXA 2Q3FA 2OLKA 3CPHA 4ZDIA 5KSZA 1OYWA 5AUNB 2CE2X 4XH9B 2H92A 2RGEA 1EGAA 1BO6A 4CT4B 2WZQA 2BOVA 3CO5A 1U8AA 3SEAA 3GD7A 4LV8B 1KZGB 1XXHE 1CRPA 1NKTA 1SVMA 2P3SA 4L5BA 4MGYR 4EPVA 1N6IA 4TLCA 2V1XA 1GWNA 1E2KA 1DAEA 4OKSA 3OEHD 4NONA 5IRCD 1W36D 2BBOA 4NYJQ 4TL8A 2CVFA 5JSZB 4I1SA 2H1LA 4Q4JB 4PSAA 3TQCA 4URWR 2O8FA 1TADA 2DFKB 4B6FA 5DO9A 3B2EA 2BVNA 1NKSA 2V4ZA 1W36B 4Q4LA 4MGKR 4DT1B 3Q3JB 4CZ2A 2OCYC 3X1DA 5AJYA 2GNOA 4OI1A 3K09A 3Q5DA 4AYTA 1E9AA 1N6HA 2QPOA 3PV0A 1B23P 1SVIA 3R9IA 4H1UA 2CEAA 3BERA 1NJFA 2XJ4A 2W2XA 4OK6A 4P4SB 3WP1B 2K5UA 4NDZA 4TT3A 1KI9A 1T3HA 2A5DA 3H2YA 4LBWA 2ZSEA 5FBRB 4GI7A 5HE9A 2ZEJA 3RC8A 2Q9AA 1KSGA 1JPNA 1XZPA 3A58B 3FB4A 3M0EA 4FCTA 3I72A 3WYAA 4RSGA 1LV7A 3L43A 2WKPA 4GFDA 4HI0E 3LW7A 3DKVA 4YXWD 1DAIA 2XJ9A 4JLAA 2DYKA 3REGA 3TK1A 3O8BA 1IN5A 1H8HA 3ICEA 4LHVA 2O0HA 2HDNB 4QKQA 2H7VA 4DB4A 2E87A 1UKZA 1DAGA 1CJKC 2OXCA 4P32A 4MKGA 1TX4B 2GXQA 4MRRA 2J9RA 3M6AA 3BWDD 1UKYA 4Z8XA 4BRUA 1P72A 1KKLA 1G291 2LCFA 3A8TA 3DVLA 4FMCF 4JBYA 3U61B 2A5JA 1HY3A 2QGNA 2GEDA 1TTTA 2JIZA 3I92A 3C4JA 1WXQA 2OT3B 3TKLA 5ELXA 2VP4A 2YKGA 3QPVA 4EFLA 3A1WA 1BKDR 2UZ3A 1RJ9B 2WHXA 2Z0MA 2HCBA 4F7WA 3GJ7A 4MH0R 2F7SA 2JLYA 2IW3A 2Q0HA 3R9XA 4C3ZA 4DDTA 3THWB 3VU9B 1JQLB 4NPHA 4OI4A 1XXHA 4LOAA 3A37A 5FUYA 1YRBA 4NYMR 2HEIA 1KYIA 1G8YA 4KITB 1AIPA 1G17A 4W7SA 5BW8A 2RGNC 2RGDA 1E2PA 2AK3A 4JL8A 5KSOA 5KSPA 1GIAA 2IYUA 1T3LA 2J0UA 3Q7QA 1JR3D 1RRGA 1VHTA 1AQUA 4CF7A 3PUWA 5HPYB 4Z1MA 3EZ9A 4AYXA 5DLQC 5AJXA 1P2TA 3MUFA 1W2GA 5DI3B 2AWNA 3GPLA 4M9SA 1MO5A 1KNQA 2EFCB 4Q48A 2VHQA 3CR7A 4TLEA 2FFBA 3SYNA 2KBEA 2OFOA 2FGJA 3EZ2A 3QENA 3LXRA 2AFHE 2B21A 3CX8A 3ZD6A 1IN4A 4Q4AA 4X8LA 3LBIA 3QKTA 3UMRA 1YKSA 3E70C 4EAQA 2RGXA 5AR1A 3BH7A 1CP2A 2RMKA 4DJTA 4I99A 4F4IA 2ZYUX 1TUEA 1NN1A 2QAGC 2NQ2C 2ZE5A 1AKYA 2GILA 4LHWA 4UJ3A 1OIWA 4OHZA 2F43A 2NO6A 4DZZA 3DHWC 3D31A 4C0LA 2BMDA 2BM1A 1T6NA 3AUXA 4Q1DA 4ABYA 5B58C 3QG1A 4ZDWA 1U8ZA 2WJGA 4LI0A 4TYPA 4IKEA 3W90A 2J0QA 2ZR9A 2QTHA 2PEYA 2YVUA 2F9LA 2WSMA 3EASA 3GJ3A 3T1OA 5B30A 2HYIC 5DH9A 4DLRA 2JLRA 3ZZUA 5BXQC 2ZI5A 5KOYA 4NBSA 4LJ8A 4KI0A 1AGPA 3FMIA 4NE2A 1NLZA 4URYR 5JWOA 2ZYVX 2XX3A 1U99A 1NY6A 4P33A 1NNEA 2G0TA 4Q03A 1OF1A 4KLNA 3EG5A 3BRWD 3ZJYA 3VHXA 1R5OA 2AD1A 2QE7A 5KDLA 3RS7A 4DLWA 5AJVB 2GJ8A 3VX3A 3RAPR 1ZM9A 2PZFA 3H84A 2H57A 3WNCA 3OEED 2HLDD 4EPWA 3VKWA 1BYIA 4OI2A 2Y8EA 3U4QB 1KO8A 2VEDA 3GJ4A 3I1FA 1G41A 1QHGA 4OL0A 4PQYA 2NO0A 4Q9LA 1E4YA 4G5RA 4HUQA 5C2JB 2HF9A 4XSGA 1QHHA 2IYYA 3HP1A 2W00A 3W6NA 4AIIA 2XXAB 4I4LA 1J7KA 2GZHA 2IF0A 2CK3A 2ZR0A 5D3MB 4DKXA 2PX0A 3QVVA 5JECA 1KK0A 4A36A 5L3QA 2LKDA 2V9PA 3W5IA 1E1QA 1FUUA 4CEHA 4D0GA 4D2IA 2IYTA 3BXZA 2HF8A 3N2IA 4Q47A 3VAAA 2CBZA 3PIRA 2ZRGA 1OHHA 1N0VC 3MWJA 4KAXA 1OH7A 2PZEA 1GNRA 3DM5A 4MUBA 4WZAE 5E3HA 4HZUA 5KDOA 3U7FB 4XD7A 1F2UB 1ZNWA 3WHKA 1Q44A 1XP8A 1G3MA 1WE2A 4M9QA 1QF9A 1N5JA 2OBMA 1CLUA 3BOSA 4QHTA 1ZW6A 2O0KA 3SBEA 2IUSA 2WWIA 3X2SA 5CITA 4W9MC 4A15A 4MRVA 1GRNA 2O8DA 1W4BA 2PCLA 4BEBA 3IPXA 3B1XA 1EFRD 5EQTA 2V6JA 4LJ7A 4UNPA 4QJ3A 1VG1A 2NIPA 2REBA 4RCYA 1G4UR 2ZJBA 3U2QA 1KAGA 3AKYA 1MT0A 4RD6A 5AUOB 3JZMA 4LUCA 1Z28A 3TR5A 1KI6B 1DPFA 3RLFA 2HCJB 4D80A 2WV9A 1RYFA 1IY2A 1G64A 2FPKA 4B34A 5SZIA 4ZDJA 1Z0KA 1E0KA 1MABB 3WMFA 2JLVA 1HURA 2QT0A 2XAUA 2GZAA 2O8EA 3IDQA 3AP1A 2QMUA 3L82B 1K8RA 2EYUA 3ZGXA 1LF5A 1RRPA 4BECA 2BWJA 1E0AA 2ZS8A 1OPXA 3B9PA 4AK9A 3DZ8A 1WB9A 2Q6TA 4JBWA 4GP7A 2GJAA 1NMXA 1KTVA 1NI3A 1R5NA 4HLCA 1HE8B 2FOLA 5FUWA 1JQJC 1VHLA 1KSFX 3TW4A 1XRJA 3SHWA 3HU3A 2ORWA 4WBSA 1G4AE 5FL3A 1ZP6A 1CEEA 1OH5A 3CLVA 3V00A 5JLJA 2BC9A 3BB4A 4DSNA 4LWZA 5FH9A 4NYMQ 4DLSA 2XEXA 3S1AB 4Q1BA 4JLVA 1T8UA 621PA 2PJRA 2GF0A 4G5SA 3SR0A 3GLGB 4ESVA 4B75A 2D62A 2H16A 3CPJB 4MITA 2EWVA 3UKDA 1HT1E 2QTFA 4QFMA 2V3CC 2RGCA 1CR2A 4NP6A 3TR0A 4DUGD 2H5EA 4LC0A 2ZTSA 1E2QA 3KFXA 5JSZA 1RRFA 3AKCA 1SXJD 1G7CA 2ORVA 3IBGA 1I4DD 2GK6A 4Q1EA 1OFUX 4LYAA 4XVUA 4FWIB 1ZUHA 4HAUA 2B6HA 1MRSA 1W0JA 1TF2A 4C0JA 4ZCIA 3VNUA 3C8UA 2CHGA 5FTMA 2ZQ5A 4R98A 1SXJB 3DM9B 3K09C 4PC1A 1TQ6A 2QNRA 4TZ0A 1JR3E 3C5HA 1IJFA 2QGZA 4ON9A 4BPBA 5CLQA 5JWHA 3H4MA 4IOKA 1G7RA 1KSHA 3P4XA 2G6BA 1E79D 2DWOA 2DBYA 1MO6A 2I4IA 2DFNA 4A8JB 2XOKD 2R62A 2WWWA 3B7GA 3MCAA 2HXSA 2AFIE 4L9WA 5FTLA 2R9VA 3SYLA 3PQCA 3GQBA 1MR3F 3NDBB 4M9ZA 2B92A 2JASA 4P3YA 2C8VA 1E2EA 3TSOA 1Z0DA 4CVNA 3LLMA 4NKRA 4LBYA 3IO3A 2KBFA 2EFEB 2YHSA 4A92A 4B3FX 1G6HA 2AL7A 2IHBA 4JLMA 2VO1A 2ZETA 4OBEA 1FTSA 2ZSAA 3A4NA 3AF1A 5C4MA 1UADA 2D74A 2ZVPX 2NGRA 2FSFA 4BFWA 4C7OB 1DO0A 4ZKEA 3TGPA 2FDCA 1W0KD 5EXTA 5GJCA 3GLFE 2OZEA 3RS0A 2NZJA 4PR0A 1E4VA 2WJYA 2X1VA 1NVVR 2ZI4A 5EE0A 3T12A 1U98A 4AG6A 2QZ4A 4LDJA 1FPMA 1KDOA 3QF4B 3LY5A 4TMTA 3PG5A 4BLQA 1QVAA 2GESA 4AKHA 2W6JD 4ASUD 4DSOA 3HDTA 2CCKA 1S9DA 2YNMA 2G1JA 4O2RA 3RABA 1LY1A 2CE7A 3T1TA 5EP1A 2XZPA 3UXMA 3F3YA 1KI8A 1W4AA 3O8DA 1I4TD 1VYVA 4DCUA 3IHLA 5M04A 3TBKA 2WIBA 4QRHA 4GSYA 4I81A 4LPKA 4KFUA 1Z2AA 4RFSB 4IVRA 5FUVA 2W58A 3KB2A 1RKBA 3W5JA 4V0ME 1U0JA 2HJGA 3O47A 1Z83A 5FOUA 3DKPA 3OESA 1RC8A 1QDEA 3GJ0A 1YZGA 2VH5R 1CU1A 4QGAA 3R8CA 4A0HA 1EWQA 4Q4HA 2MMGA 2ZJYA 1EWRA 1A5TA 4FMDF 1S3SA 4BGDA 3SI7A 3CF0A 4TQ9A 1FZQA 4LGMA 2A9KA 2BBTA 5AWFC 1OB5A 1UPTA 1ZM7A 4GP6A 4ZPXA 2LKCA 1D2EA 5FBWB 2ODEA 1L4UA 4DCVA 2GWHA 5HKKD 3U60B 2JEOA 2N46A 3C14C 3TW8B 2NMVA 1IQPA 1E2FA 5JS7A 1R6BX 1VIAA 2FF7A 3LD9A 4LCBA 5B2ZA 2I1QA 5KPDA 3L0PA 1J8YF 3BC1A 5H1YA 4AKGA 2C03A 1CJTC 1AK2A 3LRPA 1KO1A 1DG1G 4R2IA 5J4KA 1SVWA 1NVWQ 1DO2A 1E96A 3LNCA 3EWAA 4HUTA 3QBTA 1F2TB 3F0TA 3LDAA 1SHZA 1OV4A 2JDIA 1US8B 2R6GA 3RWMB 2BDTA 4I1OA 2JJ2D 3NWJA 2BHRA 1LW7A 2F1JA 4LJ6A 1PLKA 3X1WA 3THXB 4MQBA 3EPHA 2VHCA 1QHYA 2ANCA 3GLFA 4HAWA 2VP6A 1CJVC 1YJ5A 2QAGA 4TMXA 1CS4C 4TSFD 4PC2A 3SN6A 1U94A 1KK2A 2GVZC 3NIBA 2JA1A 3Q72A 4ZO4A 2XZLA 3NBYC 3B8HA 4JVLA 1SZPA 2VYFA 4QL3A 2ZRIA 1GILA 2ZREA 5FTJA 4B44A 4BQSA 1K5GA 1KY2A 1YHNA 4LHXA 2L0XA 2PCJA 3FMFA 1NF3A 4FMCB 5K8LA 2ERXA 1JB1A 3FYHA 3AQ4A 3JVUA 3PR1A 3IKJA 3U44A 2XXAA 3EIHA 5G3ZA 3CF2A 1UKEA 1BMFA 4A4DA 1XJ0A 1COWA 3KDSE 3W3AA 1Z08A 2ODNA 4V0MA 1KKMA 2OLJA 1VYUA 1OSNA 3FKQA 4Q19A 1CJMA 5LBIA 2IXGA 2JAQA 1G19A 1G7TA 6Q21A 5HTKA 3D8BA 2RGGA 5BN5A 4I1VA 2IYSA 4F93B 1F2UA 1L2TA 1T91A 2CHQA 3T1QA 4KFTA 5K8IA 5G3YA 4MKIA 4X8MA 1ANKA 3MD0A 4HDOB 4IEEA 3EX7C 1TQ2A 2QP4A 2GAOA 2EFDB 1NJGA 2Z6VA 1IXZA 2A7QA 3FPAA 2OILA 2OCBA 3AVTA 3QY0A 1SVSA 5BYKA 3T06B 1EFRA 1UM8A 2IT1A 2JCSA 2QBYB 3JVVA 3UWOA 3V4FA 3J81k 2FPMA 3LX5A 2XNDD 2CJWB 4LZZA 5GJBA 2KE5A 1JEEA 1FL9A 2PT7A 3BGWA 1G1MA 2F1RA 3LO5A 4GOKA 2CL0X 4TYNA 2WSSA 2ZRFA 2D2FA 2FPLA 2ZI3A 4R2HA 4C0SA 2C2HA 3ZZ0A 2QSYA 3U7HB 2EVWX 2C9OA 1YZNA 4QBIA 3KQKA 1ZYUA 2CL7X 4HB0A 3X1YA 4QOSA 1W7AA 1Q1BA 2X8AA 5FI1B 3B82A 2Q3HA 1NVVQ 3NHAA 4GRAA 4II7A 3LXXA 1JAHA 3MJHA 1UFQA 2OCAA 4O3MA 3GEEA 3W6PA 2VIIA 1RVDA 4MYCA 5DN6D 5G41A 3TUIC 3OFNA 5HZKA 1XD8A 4Q5IA 4A2QA 4B2IA 2ZRKA 4EPYA 4YMSA 4V03A 3TSWA 2DY1A 5KNDA 1SVOA 5EZ5A 1RPZA 1VDZA 4JKIA 4JLDA 1XCGB 4M21A 1MRNA 3IQWA 5CYPA 4LSGA 1PJRA 2OEPA 2W6IA 4HAVA 3H1TA 4URXR 1F48A 3BFVA 3SJAA 4J0QA 1DE0A 3TLXA 3NC1C 2J59A 3WYFA 3AKEA 3T5GA 3KJEA 3L8ZA 1I2MA 4UQOA 4A6XA 4GMXA 521PA 4V02A 5FOTA 3U3MA 1W36C 1GITA 1YRAA 3NBXX 4RZ2A 3RC3A 2J46A 4P31A 5K8TA 2C04A 1ETUA 1RZ3A 3FHCB 1U90A 1Z29A 4QNMA 2WAYA 2WAXA 3K70D 1Q57A 4F91B 1OFTA 1XMVA 4QGGA 2Q21A 3THOA 4IRUB 4CDGA 4NCKA 4HEJA 4UKDA 1GKUB 1X1SA 5KYKA 4LRWA 1NLFA 1ZIPA 2XSZD 3VTKA 3CRRA 3K70B 2ASEA 2GCNA 3AF4A 4US1R 4OHVA 4O25A 3K9HA 3LBHA 2QI9C 4JLKA 1J2JA 1G5TA 2IL1A 2B8WA 2F1HA 4PXAA 5DGXA 5JJKA 1SULA 1E79A 1U0HC 4JJKA 2V55B 5DIFA 3K1JA 4B73A 1HEIA 3IIMA 4E03A 4CEIA 1FOEB 1EFHA 5HCNA 4D4LA 1E9EA 2P65A 1X86B 4R9UC 3UMSA 5AUPB 5H8WA 3E5HA 3UANA 3ZIAA 5F3WB 1D2NA 2MSDB 3FWYA 5CM9C 3GLIB 2RKOA 3CRVA 3NBZC 1GNPA 3QOFA 4L15A 4MRNA 2UVQA 2DHRA 5IF9A 3Q85A 1UKVY 1XTKA 1R8SA 1JAIA 2QM8A 4C7OA 5J40A 2WWYA 2VSOA 3VR2A 1R5BA 1E1RA 4OQNA 4TTRA 2WMNB 5LD2C 1L7VC 3DPUA 3VFDA 3T34A 2NG1A 1FP6A 3AH8A 2DWPA 2UKDA 1MO4A 3FGNA 3KJGA 4LX0A 1MH1A 2IC5A 3QQ5A 2J7PD 2QT1A 3I5YA 2JLSA 1W0KA 2ZUDA 3OIUA 3ZQJA 1XTIA 1R2QA 5SZKB 4RJLA 4V0KA 5JS8A 4TLBA 4BLOA 1E9CA 1PUJA 1M7GA 4D4JA 4MGZR 1TL7C 4V0LA 4EIWA 2QRZA 1V43A 1OH8A 4B74A 1DS6A 1N3BA 3WNDA 2OAQ1 3GEHA 5H68A 4W5WA 2QORA 1T0JB 3ZVNA 3HR8A 1NIPA 2NO7A 3KTAB 4M4SA 3SFVA 5BN3A 2JJ1D 2GJKA 1XJQA 1AS2A 1RW4A 2VHJA 3KXLA 3KB1A 2V1UA 3EZFA 1GVNB 4YDSA 3Q7PA 5FPSA 3GJ6A 4MA4A 4KBFA 1UEIA 1IBRA 1E69A 2FGKA 2X2EA 1BYUA 3QBVA 1HA3A 2IXEA 4DLXA 3EIEA 2CHVA 2IXFA 2NZ8A 1Q12A 1R0XA 4PQRA 4JMPA 3VR1A 3VKGA 1MV5A 4KYIB 1S4QA 4G1UC 1G18A 2O52A 3R20A 3LQRA 2OBNA 4H1VA 2VP2A 4UNRA 1NVUQ 3CH4B 3CZQA 2JLQA 3R7WA 4QNRA 4EFMA 4W5JA 1IN8A 1J8MF 4Q1CA 1QHSA 2GDJA 2ZIAA 5D3QA 5J4LA 5DISB 2QU8A 4QBHA 4Q7JB 3FKSD 2C9CA 3UWKA 3L0OA 4Z8YA 1HQYE 2J45A 1P9WA 3RRMA 2D06A 1E3MA 1NBMD 4N0DA 3NBFA 4EFNA 2QL6A 4Q18A 1G3QA 3GP8A 2WJIA 4JLPA 4OJKA 1HT2E 3EA5A 4URVR 2GEUA 1F2TA 4M1WA 3RDPA 1M8PA 2PZGA 4B3BA 5KSYA 4DCTA 1KDRA 3QPWA 1G20E 5A5GA 4YMWA 1RYHA 3W34A 4BFSA 1E2GA 5E7MA 3THXA 1KI1A 1E99A 2ZPTX 1GKYA 3L0SA 5CM8B 3F8TA 3OIYA 4ZCMA 1YQTA 4YC7A 2YJTD 4NCHA 4QBGB 2WPDD 4D4MA 2JJ2A 2IS2A 4IW3B 1VCOA 4KVAA 1XDBA 4TL7A 2IYVA 3RRNA 3WBKA 2BM0A 1KMHB 5LPNA 1KDTA 1P75A 4ZKDA 2HJVA 3K0EA 4RD2A 1HH4A 4ARZB 1KO5A 4DXAA 2WWXA 3C41J 1T3SA 2BKEA 3VKHA 5CK4A 2R6DA 1TU4A 1GAJA 4B3DA 2QRNA 4M22A 4NTZA 4C0QC 1GOTA 2EQBA 1ZAKA 4GMDA 1KZ7B 1Z8FA 3NDPA 4B47A 4B6EA 1GNQA 1EFCA 2H18A 2W83A 3EAQA 2C98A 2ODBA 3ASZA 5HR5A 3DOFA 1TQDA 1CTQA 3FDIA 2AHOA 5FPKA 2ZUCA 1G3IA 3B85A 2EU8A 1UJ2A 1IN7A 3IHWA 1HQCA 3KX2A 2DFTA 2OUKA 3OAAA 4D26A 3B1WA 1CKEA 1EFUA 3MJRA 4FCVA 5JWRA 3ZDQA 3AF3A 3QI2A 2F9MA 2NO9A 4FN5A 3IEUA 1Q1EA 4KO8A 5C4GB 1TAGA 2WOOA 4XTRA 3FMPB 5B57C 3EC1A 4DDVA 4M8NE 4URZR 2OO7A 2QSZA 2Z43A 3CRQA 3WXMA 4R71A 2OE2A 4RCZA 3K8YA 3U5ZB 4JSYA 4XJXA 1ODFA 3SS8A 4CEJA 1CR0A 3K0AB 4OHYA 2ZS7A 3C7KA 3SHFA 4DEYA 5IHPA 2A5GA 3CIOA 3Q8XB 3HYTA 1Z6XA 4ZV4A 5L3SB 1LS6A 4JSTA 4ZIRA 1AZSC 2ZI6A 3KKOA 1K6MA 1QHXA 2SHKA 5JFGA 2QBYA 1XMJA 4RD3A 5DSZA 4MGIR 4ILEA 3ICQB 3D6TB 5KDDA 3QIAA 2ZAMA 3VHLB 4BZXA 1M6NA 3AVOA 2WICA 1OXXK 4LJAA 2ONJA 4NYIR 5C46F 4AD8A 4FD2A 1ZNZA 4C30A 3OZXA 1EESA 4IVQA 3L8YA 3GLIE 5CIWA 2FFQA 3A1VA 1LFDB 1AA9A 3D3QA 1DADA 4Q66C 3LVQE 4LJ9A 4OK3A 5IK2A 2HUPA 2D7DA 1XBTA 4YMTA 1FMLA 4NU0A 3BORA 5J5CA 4KU4A 1GRQA 4IXNA 2BEKA 3KFVA 2JJ8A 1XPRA 3ZH9B 4TQUS 2E9SA 5CK5A 1EFTA 4Q9JA 3LAWA 3KKNA 3ZVLA 1NG1A 5F98A 3RSLA 3RHFA 4D4KA 3EXAA 3CX6A 4EJSA 3G82C 1EX7A 2KSQA 2CLCX 5FR1A 3RRZA 5IT5A 2ZJ8A 4UNSA 4FWTA 4B3CA 4LC1A 2Q9CA 1LVGA 5E7JA 3K9NA 3QKSB 3BAFA 3CW2A 2V7QD 1RE0A 2CL6X 1OT3A 1PV4A 1GDDA 2I3BA 4DIDA 4JZKA 2H17A 2CNWA 4G0NA 5DN6A 2X77A 3I5XA 5TB5A 3GFPA 4A2WA 2WVJA 1W2HA 2MSEB 3CUEF 3C5CA 3A1SA 1E2NA 5FI0B 3CWZA 3MWLA 2YYZA 3ZVMA 4M0LA 1N25A 2QY9A 4POAA 4M1MA 2CVHA 1DEKA 1XTRA 2YWEA 4ZDKA 4BRWA 3W8NA 4M2LA 5EXPA 3SNHA 3C16C 5KPJA 2VHTA 4IXMA 4ZCLA 5CB8A 1FW6A 1Z6AA 3I3SR 1X3SA 2HT6A 5FOVA 2ZUBA 1OJLA 1LB1B 1OLOA 1A1VA 5CDFE 2FA9A 4Q4JA 1W1WA 5JHGB 2VBCA 2IX3A 4JVMA 4NMMA 3SDZA 2OHFA 1TUIA 4KJZA 5FBLB 4KVGA 4YLGA 4MUAA 2QAJA 3OEHA 4DDUA 1SHKA 2CCJA 1ZU5A 1H8ED 3ASYA 4CT5A 4HB4A 4DT1A 2WOJA 2XSZA 3ZS9A 3RYTC 1KNXA 2FSIA 2RGBA 1B0UA 4QG7A 5SZJA 3EW9A 4BFZA 3ADBA 2P2LA 4C0AC 1X8JA 1W5SA 2RHDA 2O8BB 1YZQA 2IUTA 5FOSA 3PUZA 3GLIA 1Z47A 4BUJA 1CIPA 2QEQA 3B1YA 3TRFA 4P4SA 2DFLA 5L3RA 2C9YA 4PPFA 2VA8A 1AZTA 4QM6A 1U81A 3CNOA 3LBNA 2IHYA 3MWYW 3T15A 3VR4A 1OIXA 3Q5EA 4CRWB 3U7GA 3SQWA 1P61B 4UXJA 4NCJA 4A6PA 1V5WA 1KO7A 4UXIA 2GCPA 3PJRA 2O5VA 1E0JA 4BFVA 4PO8A 3ZZTA 5BN4A 3AVQA 3EPKA 4Q00A 1TEVA 2KB0A 1M2OB 1E32A 4ITRC 5GADl 1H65A 1Q3TA 4YXWA 1VPLA 2HV8A 2ZANA 5EE1A 4XWAA 3SU8A 2O8FB 4C9BA 2J7PA 3GLHB 2FEOA 4Q1FA 821PA 1Q3HA 4R7ZA 2ZRDA 1OXTA 3CPEA 1WF3A 4C0BA 3VX4A 4HLQB 4GPTA 4TT3D 2XTMA 3KTAA 1RJ9A 4C0KA 1D6JA 4H9GA 2NPIA 2G83A 5FTKA 4FINA 5EE3A 4PAMA 2QP9X 5G40A 2UZIR 1Z0FA 2ZRJA 1OW3B 3THWA 3VU9A 3ADDA 3GJ5A 4GNKA 1J70A 1SKYB 4L8GA 5GVRA 2GJ9A 1H8HD 4Q21A 3QG5A 3FFAA 3SOPA 1QZXA 1GRRA 1OFHA 2OG2A 4DSTA 3PEYA 2QM7A 3IO5A 3ZLJA 5CLLA 1UDWA 2QQ0A 1D5CA 3W9YA 5CDFA 4IDOA 5EJEA 5SZHB 3ZS8A 3H86A 4B76A 3E1SA 3X1XA 1W46A 2CDNA 4BEJA 5J47A 2QG6A 4LJYA 2JLWA 2JIZD 1SVKA 5E95A 5KUTA 4E22A 2QQEA 1N5KA 2REXB 5DI3A 1D2MA 2PH1A 1WBBA 2RAPA 5BYJA 4U02A 4PZLA 1JR3A 1XCMA 2ANBA 4JLNA 1ZRHA 3BIFA 1ZD8A 2BJWA 1SVLA 3BH6A 3QVUA 5C18A 2KJQA 3K0CA 1Z6GA 2FN4A 3DOEA 1HYQA 4PC3A 3A1TA 2ZM5A 3SQXA 3W6OA 2B8TA 1KO4A 3ONWA 4F4JA 4NH0A 2BJVA 3RWOA 1N2CE 4TL6A 3P32A 3N2EA 4QGHA 2FFAA 2C77A 4IOLA 1J99A 2WWHA 5JI2E 4YONB 1Q20A 3FOZA 4Z1MD 4UNQA 1C4OA 5FTNA 1KJYA 1ONBA 1T0HB 2PMDA 3TUJC 4A1FA 1KMHA 1ZCAA 3THYB 2WKRA 4KODA 4FXPA 2CMKA 1JR6A 2Z4RA 2WMOB 3TH5A 2W2VA 2J0UB 2REOA 1LNZA 1DELA 4Q7MB 4ARZA 2VP9A 3AF2A 3RSOA 1NSTA 3CH5A 1XPUA 1SKQA 4F38A 4M1YA 1XTJA 3CX7A 2WJVA 1KK1A 3K0FB 5LB2A 3GFTA 3B60A 2WM9B 3K9GA 3PEWA 2BEJA 1KI2A 1WMSA 2YINC 1JNYA 5BWMA 4LPSA 4Q4AB 3N70A 4TYWA 2IWHA 1VG8A 4IEIA 2VTKA 4BFXA 1JJVA 3HU1A 2EYQA 4LBVA 3V9PA 4HAYA 3U4QA 2JGNA 1G8HA 1P7CA 1KSJA 2AXPA 2C95A 4LJ4A 5ANRB 2G1KA 3TJZA 4RFVA 4XSHA 1E94E 1XEXB 1CBUA 3FHTA 2V8OA 1IAQA 2EWWA 2IYRA 3OEEA 5D3MA 2F43B 2HLDA 3SJBA 2OCPA 1AN0A 4EPRA 3QXSA 4TYYA 1DTSA 3QUSA 3GLGE 3PFIA 4Q9IA 1ZM3A 5UKDA 4MRPA 4RZ3A 1U9IA 1R7RA 4PO9A 1HV8A 4LBZA 2YZ2A 4WA7A 5FPHA 1HUQA 3AVWA 3E2IA 5F9FA 4Z54A 4JVNA 4U7DA 1MO3A 2FZLA 4BLSA 3KXKA 1E2DA 4IOJA 4ESHA 3TIFA 3PEVA 4O2LA 1ZUIA 2IEYA 2VF8A 4JBXA 4Y0VA 1FFHA 2FG5A 1XZQA 5B64A 4V0NA 4Q1AA 2GBLA 3RS4A 1RRCA 3KJIA 2DCUA 1NP6A 5A4JA 4JS0A 3I8SA 4LYFA 1SXJE 3ZD7A 3HJNA 1ZD1A 2C5LA 4RD1A 4YMUA 1VECA 4DDWA 4QM7A 3MWKA 4RD4A 1IXSB 1Z0JA 1XMSA 3BFKA 3QXJA 2CK3D 2YWGA 1KI6A 5J4VA 4DRZA 3WBJA 4B3XA 4F4CA 4FCWA 2RH5A 2WBLC 4P0TA 2GKSA 1E1QD 2R8RA 4HUQB 2ZJZA 5BQ5A 4OQLA 3QKUA 2B7BA 1XF9A 1XD2B 1OH6A 2HYDA 1LS1A 1E6CA 1Z07A 1KJZA 2FWRA 1CF4A 3AUYA 1MABA 1YZUA 1OHHD 2FMXA 3REFA 4EJSC 1C9KA 1QHIA 4PHGA 5F9HA 5L3QB 5FR2A 2R6FA 4N0EA 1TPZA 4CEHB 4MDFA 4X8HA 2IYWA 1AS0A 1I4LD 1NG9A 2QMEA 4XD7D 4HATA 2RCNA 4WIAA 1YR7A 5J4HA 4PC6A 3LFUA 1ZJ6A 4TN1A 1NLYA 3KQLA 421PA 2XITA 1C1YA 3WP0A 5JBQA 5JI3E 2BV3A 4HZUB 2P6RA 2ZROA 3RS3A 1YE8A 3B78A 5JCPA 4LJ5A 3PITA 2ZYTX 1PUIA 4PPQA 3GLHE 1ZNYA 3PVSA 2ZS9A 3NH9A 4IVPA 2XGJA 3M4YA 1S1MA 4UXHA 2D3WA 1BH2A 4QHYA 3UK6A 1VCIA 5DYGA 1X1RA 3EZ7A 5FPYA 1JPJA 1ZM2A 1G5PA 1GP2A 1XEWX 2J87A 4NL4H 4XIGS 5AUQA 3UMFA 5JRJA 4O0MA 3IBYA 1R0WA 3P27A 1P2UA 2E1RA 3V4RA 1JEDA 3S1AA 1OKKD 1ESMA 4OI0A 2HXYA 2FZ4A 3B6EA 3CB4A 4OQXA 4QC2A 1BOFA 3LVRE 1Z5ZA 1G8GA 3GLGA 5TV2A 5CB6A 2B7CA 2ZRNA 1JXMA 4GDFA 4KCGA 1LTQA 4P4UA 3OE7D 3GJXC 3K70C 4MYUA 4G01B 3TE6A 4E07A 3QEJA 1KY3A 4EUNA 2PJZA 1Z63A 3CONA 2ECKA 4OK5A 4F92B 2ZJOA 3ZQ6A 1P60A 4XWOA 2BMJA 1KDPA 1Q22A 3NC0C 3PEUA 2QPAA 1M7HA 1NMZA 2V6IA 3AGPA 1ZCBA 3CRW1 3TVDA 1JBKA 1L8QA 2XTNA 3LQQA 4DUGA 4TMWA 4ERNA 3CM0A 1SXJA 4PHTA 1PZNA 3T5DA 4IDPA 1VKJA 2A78A 2NTYC 4DB2A 1A7JA 3MGCA 4KSBA 2NPFA 5K8UA 1OXSC 2J7KA 2Z83A 3BB1A 4CIDA 4DEXA 2QN6A 4JJZA 3F5FA
chains in the Genus database with same CATH superfamily
3Q8MA 2ILVA 1J33A 2ZP1A 5HJEA 1LTHR 1AMOA 4M98A 4OGKA 5TY0A 2E5FA 2DFDA 3CTPA 3EGVA 1ZH2A 3FFWA 3F98A 1CRQA 2QJRA 3AOEC 1BQ4A 4IGKA 3AT1A 1UJCA 1XTQA 2F3QA 3COZA 3AR3A 4NBLA 5ELMA 5J4YA 5C2JB 1SC4A 3R0JA 3BSWA 5JISA 1HYHA 3EEOA 4AJ1A 1JVSA 4TV9B 3WK9A 4EQ6B 2YBEA 2HSJA 5JV5A 2QTBA 2A4MA 1FDWA 3WGKA 4BNDB 3AY3A 1TZKA 1B7GO 3E9DA 1UEJA 2BISA 5AHWA 1D04A 2MYNA 4PLPA 5JFTA 1FZTA 1LWNA 3M6FA 3WDMA 4G9EA 5BNFA 3GLVA 1LPNA 1D0VA 1TI7A 3PUHA 4I5EA 4W5HA 4C43A 3UAVA 3AGQA 1FJGB 3RFCA 2UV8A 2CCGA 5JYBA 3KUDA 1GG2A 3U80A 3E61A 2FEMA 1E66A 2VP5A 4L6IA 3OJWA 2YZNA 2C57A 5IDYA 1RCUA 2JATA 1M0SA 2GYWA 4Y2SA 2IZ1A 1KAMA 3GFOA 4QARA 3WFJA 4BKPA 1FX0B 2I7CA 1A96A 2CXPA 4WCFB 1QC5B 4MEBA 1DARA 2WFMA 1OREA 4M53A 3ZUPA 3OMLA 4RJTA 4GECA 3AI1A 4KO4S 4K6GA 3QJYA 1N7JA 1J20A 3ZLTA 1TUGA 2EZTA 5CG2A 1F6BA 4IGEA 4M8SA 4MKFA 4L5AA 1U0NA 4CQJA 3KPVA 3NGMA 4V2IA 2C2KA 2EERA 1AVTA 1RHQA 4QXAA 3WRYA 5IVKA 4WOBA 2W6JA 2NP7A 3GGSA 4AQDA 1EK6A 1PAUA 3WWZA 2FRVA 4HNGA 3W5HA 2P2YA 2VYQA 1EWTA 1USVA 4XIIA 4EB0A 2C78A 4CV1A 3ED1A 1UDXA 1RM4A 2O0JA 1JALA 3EW7A 3PPVA 1SAYA 4GZ6A 4RMIA 3H6GA 3INGA 2CYCA 3W4KA 3HPQA 4UU0A 2QYSA 2P67A 4V3CA 2G9RA 1M5RA 5JAPA 2ZU6A 4FN4A 2PD6A 3F3SA 3CUKA 4RYDA 4MNTA 4CTOA 3ZU5A 1QGZA 3JVEA 1IMOA 1RXYA 1IOVA 3JAMA 3GB9A 3WGUA 5DM1A 3ZD8A 4DV1B 1JYEA 3UXYA 1NNSA 2UUOA 1L7EA 5T6MA 2FE4A 2OM6A 1R74A 4URUR 4KHPB 1E9BA 4PGHA 3L7AA 4RMHA 5A03A 3LWNA 3HCRA 4QDJA 4ZOLF 3TW8A 3WGTA 4MTCA 3DEHA 4ZI7B 1IOZA 2QHXA 1C2YA 3BCHA 1G7SA 3CZCA 4E5PA 4DLAA 4IMRA 3QEAZ 1N8NA 2Q3MA 3DAHA 5B1HA 3KJNA 4KQIA 1VE1A 3CYFA 1ZGZA 4MULA 2AN9A 4FWBA 1ZKDA 4L0QA 2A2ZA 2ATXA 3C7TA 4QPDA 4BGUA 1KTIA 4UREA 1QRUA 2VKQA 3ZV5A 4CM6A 4MS4B 4G36A 3R7LA 2Z09A 5AKHA 2XAAA 2RJOA 2CVOA 4AY4A 2HLPA 5I9BA 1US8A 3EC7A 1DKMA 4EYSA 3KWFA 4JDPA 3M2PA 1I7SB 4BO3A 8OHMA 4C6SA 3O9MA 1GGVA 2VNHA 3QFRA 2R7MA 3PUVA 5E4JA 3MFQA 1RBYA 1T4CB 2QENA 3LV8A 5DCLA 4OV6B 5KINB 4DQLA 1JSRA 1YU6A 1U8EA 2CLKB 3QE0A 4K1LA 2BBWA 2VJYA 2JKZA 1EUYA 1QS0B 3AEQB 4Q4HB 3PGA1 1O8CA 1XLUA 2UYQA 4LZJA 1E3DA 1PSDA 3GAZA 3PENA 2IIBA 4LOHA 1WP9A 2PX4A 1EB9A 1I0LA 1NN5A 3HADA 3JQPA 3ZCUA 1N1DA 1NBIA 2W6CX 3OJ0A 4QREA 4JJAA 1NGSA 4AY2A 2QL9A 3ROQA 3KQHA 5DHRA 4JT4A 3R5SA 4OYHA 1I5OA 4F5EA 3KYJB 1JNXX 5JAMA 3GAAA 3WYDA 3JYPA 1B1AA 2JIBA 1D5WA 3GDWA 1CFJA 3G2HA 2B99A 4OHRA 5SICE 1C14A 4G8BA 3RM3A 1FYXA 5T57A 1AUQA 5KI6A 1GZ5A 2O8CB 2IOFA 1NVGA 2Y1LA 4EG3A 1U28A 1ULUA 3LH5A 4FC7A 4I5DA 1OT5A 3LXUX 4LJRA 4RF3A 4DMCA 4M0CA 4J0KA 3TB6A 2ERCA 1S5PA 1DT5A 3H9QA 1U7HA 1GGFA 2IBMA 3F7NA 4P82A 5LOVB 1PL8A 1RFLA 1M66A 1I32A 4IJMA 4QELA 3HGQA 3JU3A 3COVA 3KCQA 5CFPA 4OU5A 5D84A 7MHTA 1A2KC 1T8TA 2A88A 4MWOA 4ZGBA 5E6UB 5AW3A 3RHSA 1XEWY 3W77A 3WHLA 1DWUA 2Q7XA 3A3KA 3AVYA 4PCLA 4KXVA 3BB3A 4C06A 3A4LA 3HJGA 2MMCA 1FEZA 2G28A 2YWHA 3OT1A 3ZXSA 4EG6A 3GDHA 1U7WA 4ZZIA 2GBLC 3CVVA 1CETA 3SYKA 2IDKA 3AXSA 2ZE7A 3WAKA 3L4BA 1Y80A 4X84A 1OIVA 4NFLA 3NHUA 5TPZA 3MQ2A 3GLFB 4UPEA 2Z2YA 4BV2A 2UZAA 4OAOA 3EFOB 1U8CB 4IOMA 4JVSB 2DVMA 3IV6A 2FEAA 1W5TA 4LI3X 4BGIA 3TAHA 5JDIA 3OLYA 2GN0A 2V9CA 3JX9A 1G3RA 1J1IA 4YRJA 1G21B 1M34B 1AA6A 4GBMA 1P1RA 3BQMB 5L9AA 4B3SB 1MPTA 3IUNA 1KIMA 1YS2X 3EZNA 3OSZA 2R6R1 5JC8A 4E5DA 3G85A 3ZDDA 4H3SA 1N0UA 1Z6PA 2H1IA 2ZJ5A 4IMPA 3HN6A 4OH1A 4EHJA 5BMVF 1WV0A 4AZWA 4PX9A 2H9AA 1GCUA 4LYDA 1VGQA 2RJ3A 1XD2A 4IRXA 4RWZA 1AQYA 1YRLA 1CDZA 4R9VA 1UBKS 4G9BA 1PJTA 4PFQA 3T3MB 4KFCA 4D0NA 1S1CA 3F1KA 4HWPA 4KQXA 5A4DA 2P4UA 3LDUA 4Q9NA 2BFFA 4AAYA 3U7QA 1N6KA 1KMIY 1M2VA 2AF4C 4JDUA 1S8FA 5IYZB 1N5LA 1WUYA 1G2PA 3QITA 4G0QA 4UBIA 3RVBA 1ONPA 4Z5XA 4X0EA 3O94A 3G02A 1XTZA 3WJ2A 4O33A 2F3RA 2XCRB 1XPOA 2GAAA 4HAOA 4Q02A 1K1EA 2ZRQA 2XNDA 3HRKA 4WAUA 3UATA 4DLVA 5KNBD 5J1SB 5BN5B 3HSSA 3ROEA 1EQUA 3C6BA 2XLCA 2OAEA 4NZ9A 3NEJA 1GXSB 1TE2A 3VHQA 4R0MA 1JFTA 4TKZA 1QDUA 1ZWLA 3PQEA 4GX2A 3DCNA 4HDRB 2BCGY 2G40A 1WQ1R 3KQYA 3F7OA 3QA3E 4AF8A 1ZI8A 3KV1A 2ZR7A 2HU8A 3K4HA 1AC5A 4MVCA 2O3RA 3MT7A 1EH5A 3IAAA 2PEZA 4YP0A 1WZEA 2PWAA 5DHAA 3LX8A 4WLOA 3L7DA 1YDGA 4EBFA 1GEGA 4FX5A 3WA7A 5IZCC 1JIQA 3L8GA 3MT0A 1Z8NA 3I01M 1OYYA 4NCNA 5BP7A 3WMGA 5L8VA 3CZRA 4OJMX 2K87A 3IQEA 2FYTA 2NZWA 4WLUA 2B4QA 2YFYA 3SC2B 4IHQA 1AQIA 3P94A 3TJMA 4RKWA 2JLUA 3RADC 3PNQA 2VDWA 3GIWA 3SHTA 4EKIA 1ZA2A 3ZIDA 5KTYA 2F3UA 2R25B 3CGWA 5EXDA 3JD0A 4HGOA 1XB2A 3E9ZA 4B80A 4HX9A 4YUWA 5I47A 3ABIA 1D4AA 5LP6A 4WACA 3AM1A 4MV3A 3UVEA 1PSZA 1ZD3A 1P6XA 1EVLA 1VG0B 1VM6A 5EMKA 3RT7A 3UBTA 4TRMA 1YVDA 4BC1A 3T3DA 2XNSA 4NY1A 1WWKA 1FFAA 2HQ1A 4Q82A 5EG5A 3WQBA 3U6BA 2VPTA 4BGEA 2Z9CA 3SHOA 1WEKA 1FMCA 3AX6A 2XNJA 3OE7A 4MEJA 3KKQA 4JI3B 5HFAA 4GMGA 2ZRAA 3H0KA 1KI4A 2RBEA 4GGOA 7REQB 2W0MA 2YASA 3QKRB 4IDCA 3UGKA 3SC3A 4FLFA 4EZIA 1JJ7A 1FBTA 4RY8A 5DTEA 4JGBA 4Z2YA 5C8XA 1MAAA 5T64A 1I6LA 2VRCA 3OFND 3K1AB 4NFHA 5JNSA 4WZBB 5CFZA 1P6UA 2ZVQX 1R6TA 2XB2A 3K6JA 1UOOA 5JD6A 1RJDA 2D2EA 1EYZA 2AZDA 4M1ZA 4WNYA 2FUG6 2DF8A 4MVJA 2MJLA 4R2WA 5L51A 2AX4A 3QSYA 2OWEA 5DGTA 3AWDA 1PLLA 1F1JA 2HHJA 3TMKA 5JJIA 3A1EA 1RHKA 3OM0A 2QUKA 1Q7BA 4RHEA 3ZWYA 1O77A 1H0KA 2GPWA 3SHVA 2JW5A 3IAUA 4EQ6A 4ESOA 5L7WA 2XTZA 1RIIA 1BWSA 3ECCA 2QX7A 4BQNA 5CFNA 4U7HA 1O4VA 2WZDA 1IBSA 3DZDA 5JS6A 3BBPA 4BIIA 2XUJA 3RF6A 4CHGA 4EA9A 1Q21A 4DWOA 3AU8A 4TMVA 2BGJA 2VBIA 3AQIA 4N3BA 3ZDEA 4BNVA 4IZOA 2VPXA 4NCIA 3ZTTA 1BVYF 1MIHA 2GTPA 2WA2A 2WE8A 4MV1A 1NRIA 1XNJA 2B1RA 3FWPA 3L5KA 2AMYA 5AW1A 2IEAA 5EXSA 2IHTA 1TGVA 3VA7A 5J43A 2R2AA 2ZJ0A 3L6BA 3ZQ4A 4CMKA 1YS4A 4B4OA 1FX0A 7ADHA 3ETJA 3JALB 3DE5X 5CDTA 3EXEA 1SVNA 2EL9A 2GM5A 4ICIA 3G0HA 2PQ2A 3LQ1A 4AWXA 4QBFA 2DZDA 3QBJA 3JWHA 1SUEA 1NV8A 2YXDA 1XD9A 2Z4SA 3I73A 1CG6A 3NYWA 3OHMA 3PWKA 4XVRA 5DHSA 3DO8A 1HX7A 2VHVA 1NP7A 5ALKA 4YV7A 5KQRA 2YC4C 3LVFO 2A9OA 3A31A 4CIXA 1ARZA 1DQRA 4I50F 5B6IA 1RD4A 4LV6A 5A3RA 2ORYA 4P4TA 3WRYC 3ZOKA 4OQMA 4KKVA 5C4IA 4IXTA 4YRRA 1EGVB 4GWKA 1X15A 5G02A 1U6JA 4MPRA 5KO2A 4E46A 1T8PA 3GA7A 2V59A 4JT2A 3LVBA 3DT9A 2DKNA 3QEMB 4KWTA 3UJ8A 4MWZA 1PZGA 3A6HA 3A70A 3NBAA 2C42A 1H2BA 3GEGA 5I9TA 1M33A 5JYEA 1KHHA 3KQUA 4TSKA 3G7UA 4FB4A 1NRWA 3TLCA 2FZCA 1UBEA 2JFVA 2ZT8A 1W4RA 1DAFA 3ACBA 3D3KA 4IFBA 5EUBA 1WVMA 5DW3A 1JHPA 3RTBA 4A2PA 3MGBA 4QU8A 4CPDA 1GARA 2B4RO 1MZPA 4NU5A 2A0XA 4FP9A 1O5TA 3QLVA 1WZIA 4GZLA 4IUCS 1UMCB 1V95A 2KQUA 4JJ4A 3U5TA 2JAPA 2HJRA 5FIUA 4D4LA 1UXGA 2BGMA 3PNSA 3P26A 3TFQA 4HNAB 1YZTA 3PUXA 1HTWA 1QHFA 3DMDA 3DE4X 2A5YB 2P6MA 4A0FA 2R6AA 1FK8A 3BL6A 4B6PA 4DANA 5B7GA 4X44A 3PQ8A 1WV1A 3NJ4A 3U4CA 3PC6A 1RWKA 2QN9A 4KNVA 2PT5A 3OQIA 4S04A 2P9TA 2WK1A 3KG2A 5B3LA 1VMKA 1WXFA 1ZBDA 5ES3A 1Q91A 1PR9A 1F60A 3O2SB 3QPBA 4UQPA 5IJ9B 5C7OO 3EEIA 3LOPA 3U7EB 1PGNA 1SXIA 3HLTA 1YR9A 4DY6A 1SK9A 4NYIQ 3FKJA 3LX4A 4R16A 3S8MA 3UT5B 1OBCA 1MIOB 4Q3DA 3BTUA 4NMWA 2PUAA 4RTJA 5DBFA 1S2OA 3K0KA 5ALSA 1CPYA 1X3LA 5BVGB 3CN9A 3CNNA 1G6OA 3L41A 1FFBA 2COUA 3FCCA 3VPSA 4F6RB 3STUA 1RBQA 2VNIA 4RFLA 1OWLA 1QS0A 1EE1A 3AEQA 5FUXA 3RVQA 3VC1A 4UNIA 5LP6F 2FVYA 2QMQA 4DC9A 1BVHA 4MKHA 1OI4A 2D2XA 3IFSA 1GKIA 1Z18A 5FADA 3QV2A 3JPYA 4JB0A 5G53C 2X41A 1P4RA 3DLAA 1RI5A 1WPQA 2HSGA 1NJ8A 1HBJA 4M38A 4CTNA 2WPDA 2XECA 3P2KA 3AV0B 2ZJ7A 2G7MC 1G55A 1EDBA 1RI3A 2YV5A 3IIKA 5FX2A 3GV0A 1AKEA 2J5BA 3WYEA 4RV9A 1KJ8A 3P4UA 2O8CA 2AMVA 4BX9A 3LQ2A 1DOHA 1S8AA 3GCGA 1HGXA 4GMFA 4BO9A 7ABPA 2JBWA 4DG5A 2O57A 1NMEA 3ODGA 4JUIA 1V47A 4QYMA 4WWHA 4RULA 1Y89A 2AW5A 3C6MA 3JPWA 2I7DA 4PZYA 4BWVA 2FX3A 5FPTA 4D9JA 1PJ4A 2VRBA 4JP2A 1UP6A 5JALA 4B3MB 2OGUA 4L27A 3S70A 2O2YA 5JMWA 3QJ5A 1E9RA 4EA8A 3AHJA 3W1WA 3I32A 1NL3A 3L4BC 3RHZA 2BHLA 3CVYA 1NF8A 3UB4A 3M9WA 2WIKA 2W4IA 3D6MA 3DYVA 3CGGA 3R41A 5DM70 4HVCA 3EG9B 2J31A 3BXOA 4XFKA 2YJNA 3W5SA 3EGIA 3KUCA 4DCNA 2NYVA 2IPNA 2ZB4A 2ZWAA 5IVDA 4AJKA 5JDIC 2AE1A 3ENQA 4C87A 3GOQA 2JGEA 2VQDA 2Q0QA 3IAXA 4I2NA 1PEAA 4EZBA 5JAUA 3OT4A 5MN6A 2ERYA 3WNBA 4CNBA 1V0JA 1M34A 5JROA 1HMYA 3DTVA 4QJ5A 4UHKA 1B2LA 5CFLA 3MS4A 2QA5A 3EULA 4EUFA 1N8SA 2OXRA 1NDUA 1CS0B 1SUDA 5I8PA 1D0IA 2X6QA 4BXOB 2BFMA 4ZCRA 2QE7D 1KP3A 3OKPA 1N0WA 2XWBF 2AOXA 4C2UA 2KX7A 1N75A 4G4SO 1ZMXA 3ENVA 3IOCA 2ZBDA 3KXPA 4ZZ2A 1D1TA 2E82A 1CUYA 4RSHA 1XCPA 4YH1A 2L19A 3JAKB 1BRMA 5KOHA 3CV3A 3ZYCA 3LCRA 4RLSA 4RJJA 2EKQA 4QEZA 1IZ0A 2FWBA 1NQTA 1XPJA 1WRBA 2ODQA 3ETGA 1GY8A 3BMNA 4M1SA 4MUIA 1WPXA 1Y8AA 2ID7A 3IUBA 3MMPA 3CWCA 4QJ4A 5E1DA 4A0GA 4ENWA 2GPAA 4C0HA 4LRTB 5ILGA 3MAJA 4DFDA 3P20A 2XWSA 1Q1NA 2AQKA 2QVXX 3MRVA 1DIHA 1SKBA 2ZJAA 3PIIA 3KJQA 5GV8A 2JCYA 2Z6UA 4MHSA 1QHHB 4K9NA 2IHJA 1ZVQA 4NZMA 5JVDB 2FG7C 1C0LA 4KPEC 3D8RA 4HDRA 5T3UA 1D03A 1HDXA 3H5RA 3HB4X 1JQEA 1JDBC 2Z6AA 3USZA 1EP9A 5KNBA 5AVWA 5A4MS 5K0EA 4DC0A 4MXDA 4RTLA 2ZSBA 5JTTA 1HI9A 1L4KA 4YBZA 5BW4A 1QPZA 1T4MA 1RAEA 1RAHA 3OZSA 4MW6A 2IV7A 4MDEA 2V6FA 3GRPA 4C4OA 4QYSA 1CR4A 3PA8A 4LV5B 3S44A 1Y3CE 4FXOA 3LUCA 1TQ8A 1R4NA 4NE7A 1Y8QB 5G4KA 3SC2A 4EGSA 1IEXA 3QKSA 1R8QA 1GM5A 3CSUA 4U2GA 3FN4A 3L4SO 4ZIRB 4MV8A 2LXNA 4OM7A 1YCFA 1QDLB 2H07A 2AFHB 4FE7A 3JVIA 2DR2A 1E5DA 3MFYA 4Z0PA 5I9MA 2OXEA 2JARA 2FSHA 1G8PA 4P3XA 1QBKC 5EPUA 1USKA 2QPTA 3OX2A 1T1GA 2O8DB 3N2KB 3KEGA 1E2BA 3VO8A 4BN5A 1P9RA 1W6RA 1G2QA 2V6MA 4FM9A 3JVDA 4R69A 4KXXA 2FPXA 2VJKA 4HLUA 1LLCA 1UBFA 2AKEA 3IE2A 2ZIXB 5L40A 4ZWNA 2TSYB 3KWMA 5EZ6B 1HFEL 4XFDA 4CM5A 1M2NA 3IVGA 3AP3A 4R8KA 3AUJB 7REQA 1TCUA 1ZPDA 4FQ5A 3Q7RA 3U19A 3QKRA 3GRUA 5GAJA 1UOEA 3H2BA 3LUDA 1FQJA 1T2FA 2XR1A 2Z08A 3MPUA 4HQFA 2XTAA 4R1SA 3K1AA 4RD0A 4B32A 1ODKA 2C8JA 4BLUA 1ORWA 2DLDA 4WZBA 1XRMA 3UHOA 2HHCA 2ZJ2A 1UBNA 1DQSA 4GKBA 2DUMA 1S7GA 3OF2A 1I36A 1XQ6A 2GX6A 3QTLA 4MMZB 5ELLA 4EJSB 6NULA 3C8ZA 1QWSA 2Q9BA 1U8YA 5DTMA 4C21A 2Q4DA 3I2FA 4A8TA 4B45A 4LMAA 2A84A 4KQ6A 4I6EA 2QRKA 1JGTA 1SKMA 1LW6E 4ZVVA 2FY8A 4ZZ0A 2P6NA 2R6CA 2XUQA 1Q1ZA 4V39A 1MAWA 3VPCA 3ZK7A 3EE6A 4CU5A 2HOQA 3PFKA 4A26A 4G25A 4D81A 4FFMA 2PT6A 2OHJA 3ISVA 5DXJA 5KAPA 3OTGA 2TMDA 1QCZA 4CLOB 2NTJA 1VIYA 3DW1X 4NOJA 1DMSA 3VJLA 5I3ZA 1KJWA 3IX7A 5KU7A 4BFTA 3HWSA 4C89A 5IS2A 3DXYA 3L4JA 1IXYA 3MAGA 4EY6A 3VYTB 1L8AA 2ZZKA 4OQEA 2VR1A 5DB4A 3CF6R 3I1YA 1TEXA 2GN9A 1GG8A 3CPHA 4YNBA 2MHCA 3TD2A 3M7IA 3ODPA 1OYWA 5AUNB 3WSWA 2CE2X 3HBLA 1VE7A 4QFCA 5KC8A 1EXDA 4YQYA 2OMEA 3NVMB 3HBFA 3CO5A 3IUSA 4L5CA 4Z86A 4JHLA 4XR9A 1SVMA 4WCFC 5AO9A 4MQFA 3JALA 2QUHA 5EZYA 2V1XA 3O74A 4GMKA 2PS9A 1NVTA 3K15A 4ZT5A 1UJ6A 3QE4A 1GWNA 5HDQA 2OVFA 1DAEA 3LLVA 4OKSA 4O4HB 3OEHD 1MVLA 3QVTA 3WO1A 4D3DA 3ZW9A 2BBOA 3TMYA 1MU0A 2HA5A 3GJQA 4OBXA 4UW9A 4TL8A 4BO8A 2V96A 4I1SA 2H1LA 2XYHA 3M1AA 1AUOA 1DEAA 5AXAA 3TPFA 1PQPA 3O3MB 1NULA 2GK3A 1C9MA 3CY6A 4URWR 3UC5A 4XIYA 2WWTA 3C6KA 1NKSA 5COQA 4ZAYA 1ISSA 3EMBA 1UC9A 3IEIA 5KTOA 4U3JA 4Q4LA 4MGKR 5ERXA 5JW6A 1L0BA 3IODA 3A1CA 3V6LA 3X1DA 3M49A 4HY3A 2D54A 4EJFA 4CKCB 1V96A 4IIJB 1Y6ZA 3H75A 2LIPA 5DF1A 1E9AA 2IPAB 4RF5A 2K4MA 5JLAA 3VNBA 1LSUA 2WA1A 2K5UA 1ZN9A 2PMCA 3GNTA 3H2YA 1QR6A 2ZSEA 3QLVC 2ESRA 4OQZA 2ZEJA 3MQFA 4FGJA 4YDRA 5GONF 2QRVB 4GYWA 1EG2A 3HH8A 3QVLA 5E1BA 1UMCA 4RSGA 3MTGA 4ANFA 3O4HA 2WJZB 2YQZA 4FOOA 1CUCA 1XJWA 3MBOA 4HHEA 2CBXA 1DAIA 2A9PA 4JLAA 1NW9B 2DYKA 3FB1A 1P7PA 3KTDA 3R7SA 3TK1A 3WDLA 5MGBA 2QN8A 1JEYA 3EXFA 1H8HA 2DSTA 3T4UA 4JWKA 4PYIA 2JHFA 1UKZA 2YRWA 3F9CA 4IICA 3F96A 3GNSA 4HWKA 4EYKA 3KBOA 1DAGA 1WEHA 4WINA 2GK4A 5C1IA 3WMRA 2GXQA 3SAJA 3V8QA 2J9RA 3B70A 3KAJA 3BWDD 3PFWO 2MU1A 1A95A 5K3EA 4CU2A 1P72A 1KKLA 2E4VA 3H2IA 1AK1A 2RHJA 4GKJB 1T4BA 1XRRA 2LCFA 3NUZA 2DHQA 4JBYA 2HCRA 3PUIA 4R2XA 2A5JA 5I8ZA 5IJ9A 1NMSA 2QGNA 3I01A 1LRLA 4MOWA 1TTTA 3HDYA 3GT7A 2QRQA 3JY6A 4F5DA 3TKLA 5ELXA 4KR3A 4DV6B 5IC4A 1GPAA 1ENPA 1TKAA 3A1WA 3A10A 5LDGA 3UT5A 1VMEA 2Z0MA 3DAFA 3TSCA 4F7WA 3GJ7A 4MH0R 1JHYA 3F2VA 5CAEB 4ED9A 3SVLA 1QFJA 2JLYA 2PFSA 2Q0HA 3R9XA 4FNOA 3HNPA 3BGOS 4F6RA 2E21A 3SEFA 2ZXFA 3VU9B 4NPHA 1XU9A 3NI2A 4UD2A 1FVFA 2FN7A 2WAOA 5FUYA 2XVXA 3EMVA 2I5PO 2OCGA 2VHEA 2OHVA 1O6ZA 1SM4A 2RGDA 3H9JA 1KE1A 2AK3A 3SVZA 2O7RA 3R5FA 4AUNA 2B35A 4G86A 3DLIA 3WB1A 1X2EA 2QX6A 3QMMA 1R9JA 7YASA 4MQMA 4EW1A 2O14A 1M83A 4QDOA 4HT3B 2IYUA 3Q7QA 2F59A 5C52B 5K6AA 1AQUA 1QTNA 4CF7A 1U3FA 4H60A 3EZ9A 4TTTS 2I2FA 2BEWA 3KIPA 1K0FA 1EXNA 4F97A 4LFBB 5AJXA 3VYRB 2OD2A 4JU8A 3KOWA 4L4YA 1W2GA 4DA6A 4YLYA 3T7EA 1Z9BA 1FLVA 3TL3A 5ESXA 3FHLA 1AUPA 4M9SA 2W70A 2VHQA 1WDKA 4HCJA 4TLEA 3SYNA 4G0MA 3I30X 3QENA 1FSPA 3TXXA 4YUXA 5C7YA 1U9YA 1QGED 3CX8A 5EPEA 3JQAA 3AZOA 2B98A 4HWRA 5TJ9A 3GNQA 5DOVA 3V7NA 2QYTA 4JD5A 3LBIA 1W4ZA 3O84A 3UMRA 2FMFA 5AHKA 4ZQEA 3MYYA 4KBYA 1C5KA 1PKXA 3UK0A 1M1YA 3BH7A 4OYRA 1J97A 4DJTA 4QULA 4I99A 1NF2A 1YI0A 4MS3B 1O6BA 3EG9A 3MMSA 3B89A 4X24A 4LXQA 4OO3A 1ZVVA 4AY6A 2A1TS 2EIXA 2FE1A 2GILA 1YQDA 2XQGA 3ZYZA 2P9ZA 1AQNA 5I9IA 4JGGA 1OIWA 2VHYA 2NO6A 1IAVA 3DHWC 2IYAA 3NHMA 5B58C 1AMUA 3ZTYA 3R7BA 1QZTA 4EQZA 1KH2A 1U8ZA 3HEAA 4LI0A 4IKEA 1P5RA 1CZHA 2C4VA 3JAWB 3MWFA 2QTHA 3RO7A 2YVUA 1Z2DA 4S05A 2QTTA 3PEEA 1G8SA 2HMYB 4CWAA 4OQ4A 3TZKA 3O1LA 2WSMA 3EASA 1BVUA 3QW4B 4D79A 2HYIC 2Z3WA 1S8NA 2H3EA 2JLRA 4PYOA 2BTOA 5BXQC 1TTPB 3ANLA 5SYNA 1AGPA 2HJSA 1IDOA 2I9PA 4NE2A 1NLZA 4URYR 4EUSA 1MAUA 1ZJ5A 2XX3A 1U99A 1ESDA 1YS7A 3ENKA 1RWXA 5AM3A 1VPVA 4YAFA 5H02A 2HF7A 3V97A 4MX8A 5CLIA 3ZJYA 1CQIA 1R5OA 1V2GA 1XZKA 2AD1A 5FD8A 2QE7A 2R8PA 2X14A 2FXIA 3PD7A 4J91A 5CVDA 3P9NA 3FBWA 4QE3A 5AJVB 5FLKA 1MQ9A 2QU7A 3SZLA 1VI2A 5C35A 5ITZA 3FGOA 3AESB 1K7FB 2P7IA 4HNUA 4KQEA 4BAZA 3OEED 4EPWA 9LDBA 4ZAVA 5JAQA 2O2XA 5AQEA 1ZIXA 1KO8A 3GJ4A 4M6WB 1U31A 1G41A 1QHGA 2BM8A 2DCMA 4P1ZA 4PQYA 3R3WA 1R0SA 4Q9LA 4D4IA 1FIUA 4CE6A 2HF9A 2UYGA 1QHHA 2QB5A 3D4NA 3GG2A 3HP1A 3JTMA 2W00A 4EVIA 3I5UA 5H81A 4I4LA 2IF0A 4J4TA 5IT9A 3FFXA 5D3MB 3HB7A 2PX0A 3QVVA 4UM9D 4I0WB 3VSBA 4DKXA 5JECA 3IALA 2YIMA 3KYBA 2ZB7A 2NYAA 1IATA 2PXHA 4CI9A 3S1SA 1BDJA 2HF8A 1C29B 2BP7B 2XBUA 4Q47A 4DQVA 1GV1A 1T5SA 5AXDA 3VH3A 1OHHA 2ZUEA 1C0EA 5EJ8A 1WSWA 2CDRA 4KAXA 3EJ6A 3DQQA 5TR9A 3DM5A 2ZYRA 1BZYA 5B53A 3WLMA 5A5VA 1OH7A 5A0TA 1HKHA 1U2DA 4Y9RA 2HA6A 1E0DA 3ZHZA 1F2UB 4MVJF 4EOGA 3WHKA 1Q44A 3WIOA 2DT8A 1RMQA 1WW3A 3T9CA 1QF9A 3L8HA 4K86A 1CLUA 2CYBA 3TINA 4D8XA 2GHQA 1ZW6A 2J3KA 2VXYA 2IUSA 4RXUA 3D0QA 4K6KA 3DYIA 4YFVA 4JHXA 1E77A 5EFOA 2O8DA 1E7YA 1W4BA 3B3AA 3N2KA 3NHZA 4TV9F 3ESZA 3DJFA 1PYDA 2REBA 2F64A 1G4UR 2UYOA 3SMVA 1GO2A 4M9UA 1KAGA 4RELA 2CNNA 3MW8A 4RD6A 4YAWA 1NW5A 1BE6A 4LUCA 3TR5A 1KI6B 1CJBA 4FYIA 4V1CI 4I7EA 1WTAA 1QO0A 3ORYA 5IM4F 4CM8A 4OXXA 1RYFA 1G64A 1PFQA 5IANA 2FPKA 2C83A 5TIIA 2C5BA 1V9LA 4U7FA 1ID1A 1W87A 1FFWA 1U0RA 3DSRA 4O2AA 4OHPA 2XDWA 2AYZA 5JH7A 5ADWA 2ZZMA 1L7AA 2IUYA 2XAUA 4H7HA 4PGAA 2GZAA 3GDOA 3H2ZA 3AP1A 3IDQA 4IIXA 4AJ4A 3L82B 4FLMA 1K8RA 2EYUA 4OHMA 3ZGXA 4ALLA 1RRPA 3SYMA 2H08A 2XE6A 3VO1A 5JNTA 1OPXA 4F2PA 1APBA 4RYLA 3UEOA 4AK9A 3G3EA 1JMVA 5EKTA 1U3UA 2VF2A 3AV3A 2Q6TA 4HBGA 2F9FA 3LPAA 4GP7A 4L95C 2SCUB 3AR2A 1NI3A 1UK6A 3R3XA 3EA4A 3QBEA 5FUWA 3ELDA 1ZL0A 1U7PA 1KSFX 1TJ3A 5BV1A 1XRJA 2OHOA 4Q3KA 5F77A 1E4OA 4ER0A 2Q5FA 3ABZA 5PGMA 4UFOA 4CLOA 2P4HX 4WBSA 1G4AE 2YIVX 4MW7A 4E4RA 1ZP6A 1N3YA 3EUWA 5INTA 3PF8A 4RF2A 2Y0PA 3AIKA 1CEEA 4DG9A 3V00A 5JLJA 1DUSA 3HBAA 4LWZA 1RQLA 1INLA 3MCTA 2WFAA 1ZHHA 1OVMA 1QQ6A 5JSKA 3DHNA 3S1AB 3WXBA 1R16A 1BXRB 4Q1BA 3OCZA 3ZU4A 3U3DA 4PZ9A 3CLSD 5I7AA 621PA 3G9QA 2R85A 2FI1A 4Z2AA 1DRUA 3DC2A 3ABOB 2J07A 1XZHA 2PAAA 4ZZ3A 1SQGA 1XAHA 1TW3A 2P3LA 4QU9A 2EWVA 2QDKA 3UMBA 5TMDA 2V7TA 4O4HA 4F84A 4D57A 1B93A 1CJSA 4JP8A 3W9SA 2CD9A 3KFXA 1PL6A 3AKCA 2XF8A 2FPSA 3R3YA 3IBGA 1I4DD 2GK6A 1U5AA 2EBUA 3MELA 4LY3A 1AURA 4OSEA 5F51A 4UEOA 1RHMA 2AUNA 1ZUHA 5AJTA 1BGVA 1PU2A 2PMEA 5GIPE 1SWVA 5L6LB 3VNUA 2NTEA 1P19A 2BFPA 1FTWA 1H85A 2ZQ5A 3HY6A 1EFVB 2HSZA 4BUZA 1MB9A 2P0AA 1KP2A 1ISIA 2JIRA 3V8MA 4PC1A 1TQ6A 2WR8A 2QGFA 1WKBA 1MRZA 4CKCA 4TZ0A 1IJFA 4L8WB 2CNKA 3WHIA 1EX9A 4ON9A 2QRGA 1VLJA 2FAXA 2H1FA 2Q9UA 4IYJA 1K5HA 3H4MA 5FWAA 1G7RA 1KSHA 1UCFA 5GZ6A 1GN9A 1L4BA 2HFKA 1CCWA 5AHOA 1KR5A 5JS1A 4BLRA 1TVCA 3B5IA 1JPUA 1TC2A 2X8JB 5IAEA 4XYLA 1XFDA 3BULA 4POOA 3D2BA 4CL3A 4W5TA 2XOKD 3S2UA 2WWWA 2YUTA 3B7GA 3MCAA 3L0DA 2AFIE 4LWOA 1CB7A 2Q1TA 2F8MA 3HB1A 3PQCA 2CNBA 4RVFA 5EIWA 5REQA 3H4TA 1DBIA 3TSOA 4CVNA 1ZI9A 4NKRA 3GVIA 1J49A 2VLBA 4FDUA 3IO3A 4MEAA 1L5HA 2YHSA 5JMOA 1P0FA 4B3FX 1C30B 1G6HA 4QRIA 3UJBA 2W8BB 2WD9A 4DTCA 2Z1MA 1NAIA 5CCBA 3P0FA 4M7OA 4QICA 3FLEA 2GFHA 5IKXA 2I6FA 3LT0A 2VA9A 1T9KA 2NGRA 3JASA 1ZA1A 3PSHA 2X0RA 3FA2A 1VA4A 2GZSA 1YNOA 4J9UE 1DO0A 3RJMA 2BY4A 4M7WA 3OZUA 1M8GA 3NQ41 4CLXA 3CQ9A 4E70A 1PQ4A 2JFQA 5GJCA 3DVRX 1TJYA 2OZEA 1KEPA 2WU4A 3O3OB 3UA3A 4PR0A 3OKFA 4QLAA 5EE0A 3VI3B 4QUAA 1WD7A 3LX6A 3L0ZA 4R41A 2J32A 3LY5A 3ESXA 3PG5A 2GESA 4QGSA 3R5KA 1Q0QA 3R4CA 4L4ZA 3HDTA 1S9DA 2YNMA 2G1JA 3HZOA 3LL7A 5DNCA 2NZYA 4Y6SA 2CE7A 4UPDA 4ZT7A 1UXIA 2WSBA 2XZPA 3IOBA 1U6KA 3NTQA 1W4AA 2Z8ZA 3L7CA 3G1WA 1VYVA 4ARIA 1KYQA 1LI4A 3F4LA 3M5PA 4UHHA 1Y6RA 4Y9DA 3RKRA 1EJ0A 4X3OA 3TBKA 1T13A 3S29A 5K0JA 5M04A 2H2WA 5K6AC 4LPKA 4RFSB 1OV6A 3K9WA 3E9NA 4HL6A 1FNBA 4QTUB 3RUAA 1E7SA 4COKA 3OLQA 4V0ME 1U0JA 1N8TA 1RXEA 1Z83A 5FOUA 3GRCA 3TZ6A 5KSWB 1PT6A 1QDEA 3T5CA 1B0PA 4C01A 1YZGA 1KVUA 3COSA 5FV7A 2UZ0A 4OAPA 1R1DA 1XN1A 2CMFA 3WQRA 1WDWB 5DNUA 2H3HA 3AIMA 4JQYA 2GOYA 1E6WA 3AEUB 5DM4A 3VR4H 1QKIA 4GF5A 4LGMA 2Q2NA 1P81A 2WYHA 1OB5A 2FXVA 2CXSA 2HMTA 2PX5A 3LGSA 3LGXA 4R1UA 3JQRA 4BBZA 4DCVA 2JEOA 3GUUA 1X7HA 1MMFB 1ZLYA 4I8XA 3V5NA 2GCEA 1NQOA 3B8EA 3JQ7A 5IYZF 5B2EA 3LBFA 2PKYX 4BRSA 1VIAA 1RZRD 2X9QA 3LD9A 1RE1A 1L5KA 3L7OA 5DCYA 1P4GA 4BNZA 1IVSA 4RHXA 1CJTC 1CW2B 3LRPA 2BR5A 4R2IA 5LFAA 1JKMA 1QZ3A 4N41A 1WS6A 3I09A 2C94A 1DJQA 4BMYA 1X9GA 3W5CA 1U0BB 5IEBA 3OFJA 1H2XA 2GGSA 1F2TB 4D9EA 1QKKA 3JAWA 1SHZA 2JDIA 4KQCA 4WTOA 4JVOA 5FWNA 1R3UA 1Z68A 1EWVA 4CIAA 1XVTA