4TYQA

Crystal structure of an adenylate kinase mutant--akm2
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
215
structure length
215
Chain Sequence
MNIVLMGLPGAGKGTQAERIVAKYGIPHISTGDMFRAAMKEETPLGLEAKSYIDKGELVPDEVTIGIVRERLSKSDCERGFLLDGFPRTVAQAEALEEILEEMGRKLEYVIHIEVRQEELMERLTGRRICSVCGTTYHLVFNPPKTPGICDKDGGELYQRADDNEETVAKRLEVNMKQMAPLLAFYDSKEVLVNVNGQQDMEKVFKDLREILQGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of thermally stable adenylate kinase mutants designed by local structural entropy optimization and structure-guided mutagenesis
doi rcsb
source organism Bacillus subtilis 168
molecule tags Transferase
molecule keywords Adenylate kinase
total genus 78
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tyqA00
2OAP1 3WNDA 5BN5A 2B8WA 1UAAA 3QXXA 4DCTA 1ZJ6A 1NVXQ 2GZDA 5HE8A 4NDZA 2OE2A 3KDSE 1GM5A 1O87A 2C9OA 5BQ5A 1Q21A 1ZM2A 3AM1A 1E9AA 1C4OA 1L8QA 2BBOA 1P61B 2P2LA 3AKYA 3FHCB 5AJYA 2VO1A 4Q1CA 2V1XA 3OIUA 5KSYA 4CF7A 3HDTA 5H8WA 1OV4A 5GJVC 3R7WB 2XJ9A 4TQ9A 3T1VA 2ZTSA 1AQUA 2OCYC 2ZRKA 3QSYA 3WBKA 2J87A 2RGXA 3I73A 2WMNB 3U3KA 1X8LA 1BH2A 1XRJA 1JQLB 2QAGB 1YRAA 4ESHA 3B1XA 4O2LA 1Z0DA 3GJ3A 4FN5A 2W2XA 4MA4A 1KDTA 2FFHA 2ZANA 1DO2A 2ZIAA 2J0VA 5D3QA 4MGIR 4XD7D 3IEVA 3KQNA 3FDIA 3AUXA 1YZNA 4OQMA 1QVRA 3TSWA 5EXXA 2C8VA 5CITA 1KJYA 3CLVA 5AWFC 2ZI7A 2G83A 4MKGA 2ZE5A 3V4FA 4B32A 2J0SA 3SS8A 2F9LA 3IPXA 2ANCA 4WOPA 5G41A 2WJIA 4QM7A 1TF7A 1Q1ZA 1ZNXA 2CCGA 5FUVA 3AKEA 1OLOA 1P3JA 4URYR 4M21A 1E79A 1OSNA 1NL3A 2IYLD 1E2QA 4Z1MA 5AJZA 4PR0A 3R8CA 2KSQA 3SFZA 4OHYA 3LRPA 4EPXA 5CIQA 1NF3A 4P4SB 2OO7A 2AHOA 1QHXA 3X2SA 2ZEJA 2V9PA 4TTPA 1W5TA 3BBPA 4M0LA 1P9WA 3QKRA 2XXAB 3HPRA 1FUUA 1K5GA 1ZM7A 4QGAA 2Z0MA 4PXAA 4B3XA 1VECA 2OUKA 2ZRJA 4QFMA 1EK0A 4BQSA 3QUSA 2G3YA 4A36A 1E4VA 3RNLA 2YOHA 1T3SA 3FFBA 5A4JA 3IKJA 4JLAA 4I4LA 2OSBA 1EFCA 1DEKA 5FUWA 4YDHB 3FFAA 4OJKA 1A7JA 1W47A 3Q5EA 3SNHA 3KFVA 1D9XA 5EP2A 4JLMA 4EFMA 2JJ1D 2F6RA 5F9HA 3S1AB 3OAAD 1W4CA 4I1SA 4URWR 2FZ4A 3REGA 4AC9A 1OB5A 1JB1A 2BJWA 1WE2A 5KNBA 4C4PA 3EA0A 5CDFE 4MRVA 4OHZA 4UNPA 2IXFA 2KB0A 1MRNA 4IVPA 4BECA 2OT3B 4IDHA 2YWFA 2W6JD 4X8HA 2B7CA 4TMVA 4RD6A 3GLIE 4O0MA 5JS7A 2NO6A 1GIAA 2O8DA 2C77A 1JJ7A 4M2LA 1YZKA 4Q1AA 5GJCA 2I1VB 3TSZA 2IUSA 3T61A 1KAOA 1Z2CA 3CWQA 3PG5A 4BRUA 1X8KA 5KSOA 1TAGA 4X8LA 4EPTA 4DSTA 5HKKD 3B60A 2HXYA 1WMSA 2VP2A 5DH9A 3THWB 2VP4A 3CNOA 1DAEA 1QRAA 3EIHA 4A0HA 3CWZA 1NLFA 3SI7A 1CRPA 1YU9A 4U5XA 2BC9A 4KITB 1OW3B 4I99A 4JLVA 1E0JA 1GOTA 1J7KA 3TW4A 3K0EA 4GMDA 4JSYA 1IN6A 1W48A 1M6NA 1TL7C 1ZRHA 3EIQA 2IL1A 3ICQB 3RS0A 1D8TA 5JJIA 3MAAC 4BFVA 4BFYA 2ZJ5A 1H8EA 121PA 4C0QC 3CZQA 2VPPA 2FSHA 3LDAA 1TF5A 1RJ9A 4C2TA 1HE8B 4DXAA 4XWOA 4LJYA 2O8FB 3A58B 2CXXA 1SQ5A 5J4KA 1N6PA 3Q3JB 3P26A 2ODNA 3LO5A 2ZRNA 3IHLA 1RYHA 3MGCA 1SVOA 5TV2A 1JPJA 3G82C 3QY0A 3ZDQA 1ANKA 2EFGA 1XPUA 1NJFA 3M1IA 1ESMA 3R20A 2N46A 4QM6A 3OZXA 3GLIA 3Q85A 3U7EB 1RRPA 1FMLA 1OFUX 4WZBE 3IPYA 4NH0A 4WVFA 2A5JA 1XD9A 1KSGA 2ZRMA 1K8RA 3EZ9A 3NKVA 1NKTA 4PPGA 4DSUA 1SXJB 5J4VA 3H4MA 5KYKA 2J5XA 4LCBA 4II7A 2OXCA 3FTQA 5TXGA 1VPLA 3TGPA 5JJKA 1JEEA 4XJXA 1P2TA 4AK9A 4Q1BA 1R8QA 1W49A 3KX2A 4AKGA 4Z8YA 1XEWX 2CNWD 4BLOA 2GEVA 2HEIA 2VP5A 4C30A 4NPHA 2C99A 3BJIC 4LZZA 3ADCA 1RRGA 1DAHA 3BGWA 4G5OA 3SHWA 2SHKA 1T91A 3K70C 3W8NA 3KUDA 2GBLA 1PLKA 1YRBA 4Q1DA 3GLFE 1KZGB 1KSFX 3QVUA 2VLIA 5KUTA 3QQ5A 5FTNA 1Q1QA 1IONA 1XU4A 1JALA 4LHVA 2JASA 2F1JA 2XTMA 3LD9A 4B73A 2O8FA 2JLXA 4WZAE 1ZNZA 1FOEB 2VHCA 3SBDA 2IF0A 1DARA 4Q7JB 2ZRFA 1Q1EA 4GBMA 3OESA 1NNEA 4P31A 1ZP6A 3QVVA 1HT2E 1Y63A 1P4SA 1VCMA 4MRSA 4TTRA 4D4MA 4URVR 2ZE6A 3F0TA 4B75A 2ZRLA 3H0KA 3QF7A 2I3BA 1TQ6A 2YZ2A 2W6JA 1EESA 2PMKA 2ZVQX 2ZJ8A 4HZUB 1NIPA 3THOA 1KI6B 2OBLA 4PC3A 1CR0A 4V03A 2FPKA 2DY1A 4HDCA 1QF9A 4DCVA 2KWIA 3NHAA 4ZV4A 4TN1A 2CEAA 2F43B 2QMEA 1G3QA 2W0SA 2YJTD 2IWRA 3AF2A 1NBME 2XOKD 2ZQ5A 3TNFA 2BMEA 5FPKA 1H8ED 3LXRA 3CNNA 4JBYA 4OYHA 2ZRPA 1TU3A 3IIMA 1Q12A 4A92A 4TYYA 2JIZD 3GEHA 1KOFA 2ZI3A 3IUYA 2ZSFA 1G3UA 1G4UR 2P67A 1DVRA 1ZC3A 5F2EA 2OFWA 3THYB 5KTYA 4GOKA 1TQ2A 4MQBA 1SVIA 3H1TA 4KCGA 3TH5A 1DTSA 4GRAA 5IT5A 2EFHB 1GSIA 2VSFA 1CR4A 3ADKA 1M8PA 5B64A 5L3QB 3BD9A 3EPKA 1EFRD 3Q5DA 1G17A 3CX6A 4F4CA 2H8KA 2Z5FA 3WHKA 3Q9LA 1LS1A 2QENA 4B71A 2VSOA 4CRWB 1G8PA 5EXPA 2FEOA 1N0WA 2FOLA 2JATA 2MMGA 3NBZC 3ND9A 3WBJA 2OV2A 3LBIA 3HR7A 4PFSA 1KNQA 4Y0VA 5IRCD 2V6IA 3DM5A 1XBTA 1K5DA 1VIYA 2Q3MA 3SEAA 4B43A 1KDRA 1S0UA 4PO8A 4B48A 4GP7A 3U4QB 1VKJA 3AF0A 4HLUA 3ONWA 3WXMA 1M7BA 4XD7A 1ESNA 3VNUA 4NYJR 1QHGA 5JJLA 4DLSA 4MH0R 3PXGA 1KI9A 1H65A 4HYYA 2ONJA 2FU5C 2ODEA 2YV5A 2YHSA 2FX3A 3DZ8A 2O52A 1KY2A 1P6XA 3P20A 3IQXA 2GVZC 3P4YA 4H1UA 3AGPA 1XMSA 3W3AA 3A1VA 5H70A 5HE9A 4TYPA 4HEJA 4MUBA 1LFDB 3B5JA 4Q4HA 3MG9A 3GJ7A 2JLZA 1YZGA 1Z6YA 1A5TA 4NP6A 3A6PC 1P75A 4EPYA 3HYRA 1J99A 5CB6A 2ZI4A 3I8XA 3CRVA 2WSMA 3TR5A 4QBGB 3OFNA 4FMBB 5E3HA 3KXIA 4POAA 5TARA 3TW8B 1UM8A 4IDPA 4D2IA 2IYXA 1EFUA 1E32A 2OESA 3ADDA 4TL6A 4DCSA 2AKAB 2ZSAA 4BASA 1U94A 2O5VA 4IXMA 1E1RD 2Z83A 4CT5A 3BFVA 1AIPA 1GAJA 2W58A 1CTQA 4US0R 4XWAA 4KO8A 4LJ7A 5HCNA 3R7WA 3VR3A 4JZKA 3TK1A 1E2IA 1XDBA 4KI0A 1Z22A 2GCNA 3KB2A 3LWNA 3LVQE 3ZZTA 1ZUNB 5FOVA 2F7SA 2G88A 3QE0A 4G5RA 4OI0A 1OYYA 1IJFA 1RW4A 1EWRA 4BLRA 2XNDD 1DADA 1MOZA 5G3YA 2P6NA 4NMMA 1R2QA 4AG6A 1ONBA 1XXHE 2JLQA 2XNDA 1TEVA 3AF3A 3ASZA 4C0LA 4DC9A 3HU2A 4CEJA 4DB2A 2ZRBA 3A36A 2D3WA 2IF2A 3DO6A 5FL3A 2ASEA 4HLDA 2DPXA 1WBDA 1NY5A 1AGRA 5B58C 1N5JA 1R7RA 1AS3A 1R0ZA 3PENA 4IDOA 4JVSB 3RWOA 4LC0A 2V3CC 3AVOA 1FFHA 4G5QA 3K8YA 4C0KA 1G18A 3C8UA 2VP6A 4BFUA 2WWHA 4BLPA 3AKDA 2Q9BA 2GCOB 2ZSBA 2CMKA 2ATVA 4F93B 4J0QA 2WV9A 1YVDA 3O8RA 1DS6A 3GLFB 2Z4RA 3BRWD 3VU9A 1G4AE 2A78A 2GESA 2ZJYA 2XB4A 1KK2A 4JMPA 421PA 2RAPA 1RE0A 4HAWA 4QHYA 4UJ3A 2WJVA 4JT4A 5GJWC 2WKRA 2YNMA 4NU0A 5FTLA 4DLUA 1OXXK 1W44A 4Q02A 1EXMA 2GXAA 1XF9A 3QPUA 3U7HB 2GZHA 1HQYE 2VA8A 4Q9IA 2AWNA 3F8TA 4LV6A 1BO6A 5EE9A 4JVNA 2ZUBA 3GFOA 4P32A 5JZVA 5ELXA 1G5TA 2TMKA 1GL9B 4QRHA 4C0AC 4E22A 3RWMB 4Q4AB 1ZYUA 3GLGA 3CH4B 5GJBA 2EFDB 5JMTA 3ZJYA 2QBYB 1JI0A 1ZIPA 2R65A 1G7TA 4DEXA 3FHOA 1LF5A 1OF1A 2IBMA 4HLCA 4P0TA 2FPMA 2ZJZA 1KAGA 4OQLA 5DHAA 3ZQ6A 1R8SA 2R6GA 3TMKA 1HV8A 4US2R 5DGXA 2GAAA 5FBLB 4MYUA 2CK3A 3W6PA 4JLBA 4JYCA 1Z0IA 3AH8A 1QHHB 1UDWA 3PUWA 4GI7A 3VQTA 621PA 2O8EA 4DWJA 3AVUA 1PUJA 3UWOA 5K8TA 2NQ2C 4QGHA 4R7ZA 4V0MA 4OBEA 4M9ZA 2O8CA 2IYUA 2WOOA 4D4LA 4ZDJA 1N6RA 1P62B 2ZR7A 3B78A 3GJ0A 4L5BA 3CF6R 4PO9A 4PAQA 4TSFA 1LNZA 1DE0A 2QT0A 4QJ5A 1L4UA 2JJ2A 1G5RA 1G9XA 4V02A 2RGAA 2BOVA 4HLUC 1GWNA 3Q8XB 4P3YA 3GJ4A 5ANRB 4DRZA 1IN4A 3L2OB 4PHFA 4PSVA 2EWWA 3GLGE 2CJWA 2QTVB 4LV5B 2QE7D 3QF4B 5EP4A 2QRNA 3C7KA 1AM4D 4LPSA 4DCNA 2Q9AA 1OPXA 3O47A 4UJ5A 1HT1E 3U61B 1KO1A 3DKVA 1KI6A 1XXHA 4LYHA 4E5UA 2ONKA 1ZCAA 5BYKA 5K8UA 1SVLA 3NEJA 1P5ZB 1CS4C 2XZLA 3GP8A 5G3ZA 3FMOB 4GZLA 2FSIA 4YDSA 3I32A 2AXNA 1KI1A 2C95A 1HUQA 1Q20A 4ILEA 3GJ8A 2WICA 2YKGA 5JCZA 1L2TA 2RH5A 4F4IA 4G3XA 1TTTA 4TSFD 3A1UA 4PSKA 3HU3A 3V00A 2PL3A 3EZ6A 1W36D 3CB4A 4QNRA 3VHLB 3TLXA 3PUYA 2ZM5A 3T15A 5CJPA 3A1TA 4A2PA 3LBNA 2CE7A 4YMSA 1X3SA 3MJRA 1HEIA 2ZREA 3HPQA 4D0NA 4AG5A 5KDLA 2QPAA 2BKEA 5TVKA 2ZRCA 1SKYE 2B92A 1ZUIA 2XX3A 4M9XA 2H7VA 1J90A 4UNRA 1TX4B 5KPDA 1AKEA 3NVAA 5DYGA 5CLQA 2CE2X 4Q4JA 5FPTA 3KKOA 3QF4A 5BYJA 1XMJA 2XGJA 1CXZA 4KLZA 2IYVA 4I1OA 4GPTA 2EVWX 2AD1A 1YZLA 3SQWA 3LW7A 4RD0A 3R9IA 1AKYA 1WQ1R 2ZYTX 2RGGA 3CPJB 3GMTA 2XZPA 4PPFA 1BMFD 1UKEA 4F38A 4RJLA 2G1JA 4JLDA 2AXPA 3RS7A 1JBKA 2QQ0A 3W8RA 4DIEA 2RKOA 2DBYA 1VIAA 2GDJA 2QAJA 2QROA 2O8DB 1E2GA 4F92B 4Q47A 1W4BA 4RZ2A 4URUR 2FE4A 3UIEA 1EX7A 2XTZA 3QOFA 3ZLJA 2QT1A 4OHWA 5DHFA 2IT1A 1ZVQA 5JLJA 2PX0A 4RKFA 2AFHE 3OEED 1QHNA 3FE2A 2V1UA 2YOGA 4Z8XA 2RGDA 1W0KA 2ZVPX 3I4LA 2R2AA 3W5JA 2PCJA 3ZD7A 1AN0A 3GLHA 1A2KC 1OXVA 3T1OA 1XB2A 4RFVA 3AVVA 2GZAA 1GZSA 1ZNYA 2VRWA 3CONA 2XAUA 5E7IA 1S96A 1W5SA 4IEEA 4WA7A 1SKQA 4HZIA 3WMEA 3LW8A 4LHWA 4X8OA 4ARZA 1JECA 4RVCA 3SHFA 2ERXA 3K0SA 2RMKA 3PEWA 4B74A 4IVRA 2V4ZA 3MLEA 4LHYA 1QZXA 4LDJA 4JBWA 1PUIA 4U00A 3TAHA 2H57A 2YC2C 5FH9A 2F3TA 3ZZ0A 1MO4A 4F91B 2N42A 4Q18A 5JHGB 5JS8A 3R9WA 1XEWY 4XVRA 3C5CA 2MSEB 2GJSA 5M04A 2J7PA 1HQCA 2C2HA 3WMFA 2V54A 2V6JA 3GLFA 1W46A 4DT1B 4TL8A 4MRRA 3ZS8A 3K9NA 3CF0A 1NN3A 4HAZA 3ASYA 3U3JA 4LY6A 1YR7A 4TMXA 1BOFA 2GBLC 3T5DA 5DN6D 3KQHA 1U9IA 1G19A 4UQOA 1NI3A 1TUIA 3O8BA 1OH7A 3B82A 2IX3A 3EASA 4NYIQ 4A15A 5EP1A 4BZQA 1GKIA 3U44A 1TNDA 1GFIA 4FMDB 4TMKA 3T1TA 1M1YE 1ODFA 1J70A 2G77B 3UMRA 2VHTA 2CHGA 1IHUA 3L0PA 4IXNA 4JLNA 4B47A 2N1BA 2WSSA 1SKYB 3LQQA 3UPUA 4IKEA 4ZCLA 5DIFA 5EXSA 1N6KA 4BE7B 1BIFA 1EFRA 5AJWA 4OL0A 2AKYA 2IEZA 3TUJC 2HUPA 2QNRA 3KQLA 4KLNA 4EAQA 1RKBA 1R6BX 4F4JA 4DSNA 2C04A 1WBBA 4BFTA 2CL7X 3OIVA 1F48A 2GRJA 2GK6A 3Q7PA 4GMXA 5AUNB 1N6HA 4KVAA 4D4KA 1OKKD 1X8JA 3U60B 1XMIA 5FTMA 4PQFA 2VHQA 2NO0A 2DWQA 1I4LD 4C0JA 3TQFA 3JZAA 3T35A 2V7QA 1QVAA 1SVKA 2RGBA 3BB1A 5E4FA 1PJRA 2JLVA 2P3SA 2F55A 1AA9A 3PV0A 1F2TB 3DVLA 4P4SA 2AN9A 1KHTA 2BM0A 2P6UA 3VKGA 2PEZA 4NE2A 1FQKA 2Q3HA 4TMWA 3PUZA 2JJ1A 2PZEA 3U5ZB 2JLWA 2RHDA 1IJEA 2J46A 4V0OA 4H9GA 4IDNA 2E87A 1NVVR 2BBTA 2GHIA 4ZKDA 4G5SA 4EQ6B 2DB3A 1X1SA 5F3WB 3HR8A 5BW8A 2FDCA 3B6EA 4HUQB 4UNNA 4YMUA 1FPMA 1KDOA 1ZU4A 3L0IB 1BYUA 3VKWA 1II8B 4GT1A 4JJZA 4BLTA 3KJHA 3N2EA 4JVLA 5HPYB 3QI2A 4MYCA 5CYOA 3NXSA 3BWDD 1Z0KA 4ZO4A 4A6XA 3HWSA 3SJAA 3ADBA 3X1XA 2IS6A 2QM7A 4B2LA 2A30A 2IA5A 4WXRA 1ZU5A 3RRNA 4B35A 2H17A 4QXAA 1OJLA 3KJEA 2QPTA 3AP2A 1UKYA 4MDEA 4FMDF 2J45A 4OI2A 2IUTA 3VX4A 1CLUA 2OFXA 1RFLA 4JLOA 1OFIA 4XIGS 3AEZA 2O0HA 3WMGA 1P9RA 1KZ7B 4LC1A 3U4QA 4JL6A 2D62A 4RFSB 1FNMA 1QG4A 1UEIA 2B21A 1NN5A 1SVSA 1Y3AA 4M1YA 2QTHA 1PLJA 3LX8A 1HY3A 1DPFA 3QIAA 1OIVA 4RZXA 1E9BA 4NYIR 1JAIA 1NKSA 1WF3A 2CL0X 2GILA 1WA5A 2GEUA 2XSZA 1M34E 3AF4A 4GNKA 5TY0A 5C4GB 1S8FA 1EWQA 3RS4A 3NBXX 4G1UC 3D6TB 2ZSEA 5FPHA 1G5PA 4HB2A 4HB3A 2IHYA 2V8OA 1GNRA 3K9HA 4XSHA 3TAUA 2QP4A 3KQUA 2GJAA 1GTVA 3P32A 1KK0A 3QEJA 1MT0A 5BN3A 2J7PD 3EARA 2ZYUX 5L3SA 4GP6A 1UBCA 3IHWA 1SHZA 2OILA 1VHTA 3Q7QA 3D8BA 2R6CA 4Q9KA 2WPDD 4BFZA 5EE0A 1G8GA 2J0QA 1G16A 1KSJA 3TUIC 5SZJA 4NCIA 3OIWA 1OFHA 3IEUA 3GD7A 5DI3A 2GXQA 1D2NA 2R9VA 3KXKA 3AVYA 5KPJA 2IYRA 1NMYA 1HH4A 2PBRA 4JKIA 4KFSA 2WZQA 4EFNA 4OQXA 2BIFA 3FPAA 3KJIA 3BS4A 4JS0A 4NL4H 5DYIA 3K09C 2QGNA 4Q48A 2B7BA 1LV7A 5SZIA 3VR4A 5CLLA 1KJWA 3TVTA 1II8A 4GFDA 2LKDA 5LD2C 3MWKA 1CEEA 5J4HA 4RCYA 4EPWA 1YR9A 2J1LA 1RYFA 5AUOB 4D81A 1OXTA 3EWAA 2CLSA 5EE1A 4PZYA 1YQTA 2IWHA 3W6OA 5KDOA 3OEEA 5CK4A 2FWRA 4FCVA 1CJUC 2HDNB 2VF7A 3B1ZA 3K0AA 4Z51A 3KKMA 2AX4A 3LBHA 4NZYA 3WYFA 4RY2A 3SN6A 3KFXA 4N3NA 5FI1B 1UPTA 1I4DD 2ODBA 3ETLA 4OHXA 1MABA 2JEOA 3BB3A 3KUCA 4EPVA 1LTQA 4M8NE 1KI2A 4U7DA 5GVSA 2G0TA 1S4QA 1CBUA 2O0JA 1N0VC 2B6HA 4MKIA 4P4TA 1U0JA 2ZJBA 3W6NA 3CRMA 1LW7A 1ZCBA 4M4SA 3CO5A 3RSOA 4HSEA 3GLHE 2PEYA 4XVQA 1PV4A 2FV8A 2H1LA 4ZPXA 2DWOA 4CW7A 3NDBB 2ZYVX 1IXRC 2WAXA 2Y8EA 3MWYW 1TMKA 5AK0A 4A9AA 4BZPA 2OXRA 2JLRA 3OAAA 3IBYA 3LAWA 3EPLA 2D74A 4YONB 1XPOA 3GEIA 1T6NA 5LD2B 4LHZA 4KFRA 1XTQA 5IK2D 1US8B 3NH6A 4M9QA 4EFLA 1I2DA 3ZVNA 2XSZD 4B3DA 1E2LA 4QHSA 4PHGA 2R8RA 4RSGA 1XD8A 4PTLA 1N5KA 2R62A 4ZI2A 1QHSA 2KBEA 1NVUQ 2DHRA 1J2JA 2RHMA 2VIIA 1CR1A 2BKUA 2OZEA 5HR5A 1I4TD 3I92A 2HYDA 2WWWA 3AGQA 3NH9A 4ZCMA 3IDQA 5CK5A 4D6PA 4OQNA 2H18A 4JIMA 4MITA 5AJXA 2WTUA 4DLTA 1QG2A 2WM9B 2PMDA 2R44A 5DO9A 4C0SA 4YQFA 5HKKA 5CIWA 1YJ5A 2WWFA 5J5CA 1UADA 3MUFA 1G7SA 3E1SA 1NSTA 1UEJA 2WSSD 3CZPA 3EX7C 4ZIRA 2AK3A 2QMOA 2NO7A 4A8JB 1CR2A 2YWHA 3B9PA 1KO7A 1R5BA 5CYPA 2NGRA 3PQCA 4AKHA 1NSFA 1XCMA 4Q1FA 3UMSA 4OI1A 4ARZB 3SJZA 2BJVA 1F2UA 3SYNA 1E99A 2QTFA 4A8JA 2BMFA 2J3EA 3V4RA 2BCGY 2NG1A 3KQKA 1KIMA 4E07A 2P5SA 1NY6A 2RGNA 4Q21A 1RC8A 3CF2A 3ZVMA 2FH5B 1ZD9A 3GLHB 1EFHA 5CM9C 4LUCA 2X77A 4Q1EA 4QJ4A 2BBWA 4O3MA 4KV9A 5CB8A 2GJ8A 3NIBA 4B33A 4TYWA 4LJ5A 3EZ2A 3CX8A 3E70C 2ZROA 4LJ8A 1U8ZA 5FUXA 4RD3A 4R2IA 4JBXA 1NBMA 1E2NA 4YMTA 4IHQA 4UXJA 4DCUA 1G8FA 2NO9A 5HZKA 4CEIB 4S35A 2IYSA 1P7CA 2P5TB 3U3OA 4XSGA 3W5IA 521PA 4CT4B 2UKDA 1XTIA 1H8HA 3H86A 3G0HA 4MYHA 2ZR0A 3DMNA 1VYVA 2Q21A 3OEHD 3P27A 4HAVA 4KBGA 4I1UA 4XTCS 1R5NA 2W6IA 3S1AA 4HUTA 3RSLA 1TUEA 2ZI6A 1HYQA 3BE4A 3FKQA 2Z43A 3AQ4A 3LQRA 4F7WA 1E69A 1E79D 2R6FA 3RRMA 2H92A 2FFBA 4L8GA 4O25A 3RDPA 3KJGA 4HAXA 4KVGA 5C1BA 5FOSA 1UDXA 4MGYR 4LJ9A 4LJ6A 221PA 2ZS8A 3U3MA 1XFAA 2DFKB 2PJZA 2IUUA 3F5FA 4ACAA 1Q22A 3KXLA 5KU1A 2IHBA 3PEUA 2G9NA 1G6OA 1GKYA 1YZQA 1BYIA 1KNXA 4A82A 2IYQA 2HXSA 1DBSA 5FPSA 2WJHA 4LWZA 3BH6A 2OFOA 1FX0A 1T3LA 4UNSA 5DNYB 3HP1A 2QRZA 2FMXA 4PC6A 2WMOB 3W34A 1ZM3A 4Z54A 3BORA 3LFUA 3U6BA 1VG1A 1AS2A 2QY9A 3B13B 3K0FA 3N70A 2H5EA 5GVRA 3SYKA 3JZMA 4JL5A 1FP7A 1DAIA 2F1RA 1ZBDA 1Z0FA 5B57C 2UVQA 3VX3A 4QBFA 1W36B 3PEVA 1IAQA 3B2EA 2WAYA 4BLSA 5G53C 4D0LB 2YVUA 2J59A 3GFPA 1U8YA 1N5LA 1OKKA 2OBNA 3D7MA 2R6DA 2Q0HA 2ZYWX 3EC2A 4BUJA 2Q6TA 3OFND 5EXTA 4JVMA 1U9IC 2ZJOA 4LX0A 4QG7A 3ZIAD 1FP6A 3CX7A 1W36C 1YE8A 1SVMA 5EUMA 1ZAKA 2CLDX 3IGFA 1E96A 1IBRA 4NKRA 4XTRA 3IO3A 1XEXB 4M1KA 1D2MA 4RKEA 4AIIA 3AP1A 2FSFA 4O2RA 4QJ3A 2C98A 2HLDD 3W9YA 2GAOA 2X2EA 3KTAA 4Q66C 2JDIA 5L3RA 2QMUA 4Q4AA 1XJQA 2IYZA 2YWGA 5BWMA 2FN4A 1SVWA 2VP9A 4TMZA 1ZM4A 1JXOA 2FF7A 1PVOA 4LRWA 4YXWD 3C15C 2RB4A 4GSYA 3VFDA 1AQYA 1XPRA 4IRUB 4PC1A 4WIAA 5DN6A 2IXGA 4RFSA 1GILA 4LBZA 4W9MC 3U2QA 2BBSA 5J47A 3IIJA 2R6AA 1OH8A 2WOJA 3DDCA 2XJ4A 1S3SA 4Q7LA 4JJKA 2HJVA 4C7OA 1E98A 2QQEA 3RRZA 5C18A 2FFQA 1K6MA 2W00A 3CRRA 4P33A 4UNQA 2A7QA 1JNYA 2V55B 4KFUA 1ETUA 1DG1G 2PJRA 4FW9A 4Q5IA 2EW1A 3SU8A 1Q1BA 1XP8A 3SBEA 3V9PA 2ZU6A 2FG5A 3MWLA 5IDVA 4K8OA 1YZUA 4C9BA 1OB2A 5H1YA 1Q3HA 2CLCX 3SC3A 3THXB 4C7OB 1W7AA 3QNUA 3PEYA 3X1YA 1R4AA 5FBVB 3J81k 1KI8A 1Z0AA 5FUYA 5L3SB 1NRJB 1W0JD 3C14C 3BFKA 4BEJA 2BMDA 3I62A 2RCNA 4BRWA 5K8IA 1VTKA 4TLBA 5UKDA 1GDDA 2C5LA 3HJNA 4A1FA 4BWYA 4CZ2A 4OK6A 1G41A 4ERNA 1F2TA 3HYTA 4M1WA 3FKSA 3KKNA 4YC7A 3EZ7A 1S9DA 3QKSA 4OK3A 1M2OB 1UF9A 1XEXA 2ZR9A 3H2YA 2XOKA 2QP3A 4MGKR 1E0KA 2VSXA 3QJYA 1E9FA 4NYMR 4Q7MB 2DYKA 4R98A 5D3MA 4FD2A 3QPWA 4L9WA 4LYFA 2WJJA 1NN1A 1IN7A 4FWIB 1IY2A 4B2PA 2VP0A 4CYMA 3RC3A 2VYFA 4PZLA 1FUKA 3IQWA 4L9SA 1F3OA 3DL0A 4GOJA 4XH9B 1D2EA 1GNQA 3FMFA 3RAPR 1ZUHA 2ANBA 3ECCA 4I1VA 4OHVA 2X1VA 1E2MA 4PAMA 3TRFA 4DLWA 2ZS9A 2F1HA 1E94E 1GRNA 5IHPA 1X6VA 3GFTA 2GXSA 2XZOA 2CHVA 2DFLA 2REXB 4LSGA 4TWZA 2PT7A 1B0UA 2QMHA 3DKPA 1B23P 4HATA 3SYLA 4AYTA 2NIPA 4MKHA 4HB0A 5AJVB 4M1OA 3K0FB 1G1MA 4MYTA 1IN8A 4RD1A 4KXFB 3EAQA 4EUNA 2L0XA 4BLQA 2WWIA 1VCOA 2AL7A 4NTZA 1YZTA 2WJGA 4AURA 1NN0A 3UMFA 4QL3A 1G6HA 1Z06A 2JAQA 4AYXA 1XNJA 1XZQA 3T1QA 2KJQA 4Q4LA 4TQUS 1SZPA 3SFVA 4DT1A 2AWOA 4M22A 4QGFA 2CNWA 2HT1A 4IFBA 2FGKA 2CDNA 2ZU0C 5JFGA 2NPIA 2D06A 4C0HA 1F6BA 3EPHA 3PJRA 4M1TA 2Q3FA 2PLRA 4OI4A 1MO6A 2YYZA 1AZTA 2JLUA 3PCRB 4KHZA 5JWHA 1NG1A 2VL7A 4OQFA 4KODA 2P0EA 1NBMD 1T8UA 1T0HB 1VMAA 1ZC4A 4EIWA 1LY1A 1S1MA 2CCKA 2W2TA 2JJ2D 3DHWC 1KI3A 4XVUA 2LCFA 2Q9CA 4V0NA 3X1ZA 1E9DA 2ZRIA 1OXSC 3IIKA 4YMWA 2O8BA 2C9YA 3C16C 4D4JA 4BPBA 2HYIC 3QXSA 2C03A 3U3RA 4CEHA 5FOXA 3BXZA 3CR8A 4TLAA 2DWPA 1P2SA 1T0JB 3PUVA 4LBWA 4DLVA 1VG0B 2A5YB 2CK3D 1JPNA 3RC8A 1EX6A 4FCTA 1J8YF 4PANA 1UBEA 1GRQA 1U8AA 5JI2E 4PC2A 4A0RA 3THYA 5TMPA 3THXA 4NONA 1DAGA 2F9MA 1L7VC 1KMHA 1KTVA 2QSZA 4LBVA 4B44A 1FZQA 2AD5A 2RGCA 3FHTA 3T34A 1CF4A 1DAMA 1NIJA 1E1RA 4RD4A 5EE5B 2IS1A 1Z6XA 3NEYA 5CDFA 3NC0C 1P9NA 2OCAA 3QEOA 1CJTC 2ZITA 4C3ZA 3AVXA 2ZUCA 1QDEA 3AV0B 4TL9A 5SZKB 3EXAA 3X1DA 1GUAA 2GTPA 2F43A 2IEYA 5L3VA 4FXPA 4V0ME 3D31A 2ZE7A 4Q4JB 4LJ4A 1OE0A 5JWOA 1ZD1A 4PAOA 2J7KA 4HZUA 4A2QA 2IC5A 4ZKEA 2KE5A 4EJSC 4ZI3A 5GADl 1IN5A 3A4NA 3KZ1E 1SXJD 4D0GA 4ZIRB 2OHFA 2EYQA 2BEJA 2XITA 2ZI5A 3KTAB 4ASUA 1SGWA 3CW2A 4C0BA 4CGZA 4N0EA 2O0KA 5KNCA 1G7CA 3SE0A 4LOAA 2J41A 4D80A 2ZS7A 5P21A 721PA 1QHIA 4ITRC 4M53A 1GG2A 2E9SA 5FR2A 4BFXA 3MJHA 4CIDA 4E09A 1MKYA 4Q00A 2XNSA 4K81B 2NMVA 3KL4A 4LBYA 1XMVA 5FL7A 1C9KA 3ZS9A 2GJ9A 3AF1A 4V0LA 2QGZA 2IW3A 3GQBA 4EJSA 1Q57A 5HCIA 2GEDA 2X19A 3CH5A 3X1WA 1NJGA 4LYJA 2P6RA 4A2WA 2Z6VA 3QXCA 1UBGA 1E9CA 4DDVA 4DJTA 5C2JB 1N6NA 1US8A 2DFNA 2F3RA 4MGZR 2CBZA 1KYIA 1II0A 1Z2AA 3AUYA 2Z4SA 5G40A 1XD2A 1M7GA 3MSXA 2NO1A 2O8CB 1KJZA 1RZ3A 4QOSA 1G20E 5FI0B 5FBRB 3PR1A 3AKCA 2W2VA 4Z1MD 1VG8A 4OK5A 3ZVRA 3QXJA 5J4YA 2O8EB 3P1JA 1KK3A 2AFIE 2YOFA 2EU8A 3VR1A 3O8CA 4LHXA 5H68A 1R0YA 3WNBA 1ZD8A 2ZE8A 4PO1A 3GJ6A 4ZDKA 1HURA 1KGDA 3PITA 2VTKA 2HJGA 3VAAA 3L43A 1JR3E 2NZJA 2PZFA 2IK8A 3IO5A 3UWKA 3LX5A 1Z6TA 2BVNA 3HU1A 3K70D 2NPFA 1N6OA 3WYAA 4CDGA 2QBYA 5IK2A 1TQ4A 4LJAA 2FSGA 1NP6A 4PHTA 3R8FA 2MSDB 2W83A 1DO0A 1CP2A 3K0AB 1E2KA 4NHOA 2ERYA 3I72A 3GCGA 1BS1A 1DAKA 1XXHB 2FPLA 2ORVA 1G7RA 4OKSA 3WRYC 2GVDC 3CRW1 1X1RA 3SQXA 1T9HA 1WXQA 1FL9A 2GK7A 3GJ5A 4IEIA 3CIOA 4DDTA 2KI5A 1E9SA 1L4YA 4LV8B 2RGEA 3UATA 2BDTA 2OAQ1 3GPLA 2BV3A 2ZAOA 3NBYC 4RD2A 1XTKA 1XWIA 2LKCA 4HB4A 4JL8A 3WHLA 4MKFA 1TPZA 4PQYA 1FW6A 1G8HA 4DB4A 1OFTA 2QEQA 3B1YA 2FGJA 1YHNA 2EFEB 1AS0A 5E95A 2DFTA 5DI3B 3A4LA 4DLYA 3TKLA 3TIFA 4UXIA 2WKQA 4CVNA 6Q21A 5LBIA 4BFSA 1NLYA 3FGNA 3FKSD 2ZJAA 1JAHA 3FB4A 3K0CC 3ICEA 3N2IA 4E03A 1XX6A 1KKLA 4FCWA 1G3RA 4B2IA 2REOA 3UK6A 4TMTA 1C1YA 4CEHB 1HA3A 4EPRA 5EJEA 4W5WA 4HAUA 3MWJA 2FFAA 3B1VA 3QENA 2G1KA 3DOEA 1W0JA 4B34A 4PX9A 5EUQB 4L16A 1S9HA 3CUEF 1U98A 3EZFA 3GLGB 4KAXA 4WBSA 1OXUA 1BMFA 4M9SA 3RVBA 1IQPA 4AKIA 1AGPA 1CJMA 4D26A 1ZIOA 1F2UB 4D82A 2C9CA 2GETA 2BEKA 4QGGA 4ACBA 4MDFA 3CPEA 2H16A 3MMPA 1U81A 4DDWA 4V0KA 5FFMA 5C4MA 5FL7D 2BCJQ 2ZRGA 2YWEA 1IY1A 4H1VA 1EG7A 4DVGA 4KSBA 4R71A 1MH1A 3RS3A 2CVHA 1S2MA 1E2HA 4GDFA 5F98A 3DPUA 4ABYA 2J0UB 5JRJA 4PSAA 1FQJA 2XB2A 4DUGD 4TL7A 3BIFA 3VKHA 2GF0A 4DIDA 2WVJA 2GCOA 4NCKA 3TVDA 1HTWA 5LB2A 4TTQA 3IILA 5KDDA 1KMHB 3BOSA 1WB9A 3AVWA 4ESVA 1T5IA 3I5YA 4FI3C 1E0AA 4YXWA 2JJ8A 5FOUA 1IOZA 4HUQA 3TE6A 4L15A 4P4UA 4PPNA 3AVPA 3I61A 3SDZA 1UKZA 2I1QA 3UG6A 2JDID 5KHOC 2YINC 4Q4HB 3B85A 2PX3A 4IOJA 3CBQA 5KO2A 2HCJB 5EZ5A 5AUPB 3PFIA 4EKDA 5EP3A 3EPJA 3KKPA 2UZ3A 2CCJA 2QUZA 2BM1A 4RZUA 1JR3A 2DR3A 2NZ8A 2ZETA 3DEFA 1GKUB 2PH1A 3K09A 2ORIA 4NCNA 3NWJA 5KSZA 1Z83A 3LVRE 3OF5A 3BB4A 1WCV1 4MRNA 3VR6A 1G3IA 5E7JA 4A0FA 2IXEA 2GJKA 4WXPA 4MUAA 1COWD 3QKTA 5BXQC 1RRFA 1KO4A 4N1AA 3NTUA 1NVWQ 4ON9A 4W5HA 5JRZA 4PPQA 2MMCA 2ZRHA 3A1WA 3LLMA 1J8MF 3AVQA 3RS2A 4YMVA 1GL6A 3A37A 1ZNWA 4JLKA 1MABB 2GXUA 3D3QA 3RS5A 1T8TA 2F1IA 3QKUA 2ZXUA 3C4JA 3K1JA 3VHXA 4G01B 1XTJA 4Y0AA 1S1CA 1SXJC 1F60A 2WPDA 3IBGA 1Z5ZA 1GITA 3ZYCA 3L0SA 5KNDA 1S3GA 5DI9A 5J40A 1CU1A 2V7QD 4BEBA 3E2IA 1D5CA 1EGAA 1O3YA 4D25A 3U44B 1FTSA 3EW9A 1DELA 3KB1A 5B2ZA 2QM8A 4KFTA 2JLSA 2C96A 1KO5A 5KOYA 3K70B 4FIDA 1WDTA 2IS2A 2QPOA 3VMFA 821PA 4IOKA 3FMPB 1Z07A 4A6PA 3BC1A 2OLJA 3BFXA 3I3SR 3SZRA 2QAGC 1JEDA 1NMZA 3PIRA 1OHHD 4S2EA 2FJUA 4JLJA 3L8ZA 5B30A 2J0UA 1GP2A 4FMCB 4DLXA 2A5DA 1MR3F 1G64A 1EFTA 3OE7D 1N0UA 3UANA 4M1SA 4HDOB 5JSZA 1W0KD 2ECKA 2QN6A 1M74A 5FOTA 2WHXA 3CM0A 1N3BA 3QG5A 2FZLA 4LPKA 3TJZA 4AD8A 2ODWA 4M1MA 2WWXA 2QI9C 3EA5A 1E2DA 1KY3A 1SXJE 3UXMA 4L4UA 4ZDWA 3WY9A 3QKSB 5LB4A 1KI4A 2QSYA 1CJKC 1JQJC 2OG2A 4R9UC 3FWYA 1G8YA 2IYYA 4ZDIA 1A4RA 1MO3A 4QNMA 5CJ2A 2ZRDA 2ZJ2A 4U02A 5FPYA 1P72A 3B1WA 1ZW6A 3RRYA 4K46A 4KYIB 3UKDA 4TT3D 3TR0A 4DHEA 5AUQA 1GL7A 2WIBA 3T06B 2QORA 3U7GA 2HF8A 2WWYA 2LWIA 5L3QA 1UFQA 1NVVQ 1E9RA 4TLCA 1CRQA 1RVDA 4IVQA 1DAFA 3I8SA 4C2UA 1P2VA 4B3FX 2AR7A 5TB5A 4DZZA 1R10A 5JHHB 3C5HA 3E5HA 2HT6A 1DOAA 2VQSA 4MRPA 1KKMA 2C78A 2E1RA 4DDUA 3BAFA 4URXR 5F9FA 4RCZA 3MRSA 1RRCA 2CHQA 8OHMA 2P65A 2VHUA 3WYGA 5JBQA 5A0FA 5CM8B 3EWSA 1CIPA 1XJCA 1A1VA 4G5GA 3PVSA 1SXJA 1Z08A 4Q9JA 3OIYA 4Q9LA 5E7MA 2BHRA 3RLFA 4DBLC 1VHLA 3WRXC 1SHKA 1VG9B 3ZGXA 4US1R 3NG1A 1Z6AA 1ZINA 3GLIB 1HE1C 2AK2A 3TQCA 4LYAA 5FBWB 4B3GA 3CPHA 4R2HA 3L8YA 2JA1A 2QU8A 4HDQB 2QL6A 5EQTA 1E2EA 1LS6A 5JEDA 1M7HA 3QPVA 2VHJA 2D4HA 3K53A 3JVUA 5JI3E 3A4MA 1FX0B 1JR3D 3SJCA 4AWXA 4DEYA 1TQDA 1Z63A 1KSHA 1RJ9B 1VDZA 4QHTA 2IS4A 4BZXA 1N2CE 2JLYA 1Z29A 5A5GA 1FNNA 2KBFA 2OLKA 3H84A 3C41J 4JYBA 1UBFA 4Q9HA 1ZM9A 3K0CA 1R5OA 1U90A 3AB3A 4I81A 1ZMXA 5C46F 4B76A 4NBSA 1N5IA 1GVNB 2A5FA 4UKDA 3K9GA 1Z47A 4QBHA 2I4IA 4KBFA 2NTYC 3JVVA 4PQRA 1KO8A 1LB1B 1Z28A 2UZIR 2CL6X 1Q0UA 1TF2A 3THWA 3M0EA 1Z6GA 5BN4A 3RHFA 3R9XA 2A5GA 1XD2B 1YR8A 3WP0A 1MV5A 3DMDA 4KSCA 2VBCA 1VCIA 1YR6A 2A3RA 1U0HC 4ASUD 3UG7A 1E2FA 4B3CA 1N6IA 1G291 2HLDA 1E2JA 3M4YA 2EFCB 1G21E 1FTNA 3QBTA 3B9QA 5FR1A 1OYWA 4HI0E 1W1WA 2ZRAA 4EJSB 1Z3IX 4B6EA 2OBMA 2OEPA 4TYNA 1R0WA 4TZ6A 4BGDA 3MCAA 5K8LA 2D7DA 1DG3A 3MD0A 1XTSA 4FWTA 1VCNA 4GOXA 4LK2A 1RPZA 1E3MA 5HTKA 1Z8FA 1UJ2A 1F5NA 4PZZA 2QP9X 2GNOA 1SULA 4NCHA 4Q03A 3ZD6A 3U6KA 3AP3A 2D2FA 5J4LA 1WP9A 1BKDR 2CVFA 2K5UA 1JXMA 3CRQA 1TEXA 3FVQA 4QC2A 3TUZC 3FOZA 1ELOA 2VH5R 3FMIA 1CJVC 3VR2A 4KYUA 4DLZA 3I5XA 1V5WA 4B3BA 4TZ0A 1TADA 5KSPA 4A4DA 4Q19A 2A9KA 1W2GA 5LPNA 1Q3TA 1KI7A 3F3YA 4RZ3A 5FOWA 4IOLA 1UKVY 4B6FA 1QHYA 1AJEA 2VF8A 3VU9B 3L0OA 4BFWA 1FMJA 1IXSB 2VEDA 3LLUA 1CULC 4TT3A 4XOIA 5DE3A 4W7SA 2PT5A 3AVTA 2GCPA 3LNCA 1OIXA 4NCJA 4CEIA 2IYTA 5JCPA 3BH7A 5DSZA 4AKEA 1V43A 4NYMQ 3T5GA 1A82A 5DISB 2D2EA 4HLQB 1VYUA 3WNCA 4IOMA 1U99A 4KJZA 4YLGA 2W0MA 1A2BA 3RANA 2A2ZA 1T5LA 1XEFA 3RABA 1D9ZA 1W2HA 2WBLC 1P2UA 5EE3A 4UXHA 1N25A 4ZCIA 1GNPA 1X86B 2HV8A 2NOAA 1E6CA 2O8BB 2MSCB 2W6ID 4A0GA 1OH5A 3OEHA 2G6BA 1OHHA 3TSOA 1KDPA 3I1FA 3CR7A 3A8TA 2YC4C 1H8HD 3P4XA 2GF9A 4IDQA 1P73A 4PC7A 2ZPTX 2QE7A 1I2MA 1RIFA 2D7CA 3LY5A 1E9EA 5IF9A 2ORWA 1QBKC 3DZDA 1WRBA 2REBA 5JEEA 2QG6A 3ZQJA 3MFYA 4QKQA 3QKRB 2XXAA 4W5JA 4AI6A 4TQAA 4N0DA 4DLRA 3CNLA 4AY2A 3PUXA 3W90A 2HF9A 3NDPA 1KK1A 3QXHA 2EYUA 5L8VA 4WAUA 1PLLA 1U2RA 4GL2A 4EDHA 1XZPA 4TYQA 2JCSA 1PZNA 4QBIA 2IYWA 2EWVA 5JECA 5TDHA 1E2PA 2OCPA 2OM2A 1XCPA 2ZUDA 2WIAA 3NC1C 3NBFA 5LDDC 1XJ0A 3M6AA 2CJWB 3CKLA 4DKXA 3BH0A 4LGMA 2JGNA 1MRSA 1NLZA 3DOFA 4JLPA 1NG9A 1T4GA 4Q7KA 2RGNC 3WP1B 4DSOA 1COWA 1Z0JA 1U0LA 1IM2A 3GJXC 3EIEA 3Q72A 2GA8A 1W4AA 5FTJA 3KKQA 1E1QD 2HCBA 2WJYA 2OCBA 5EZ6B 1W4RA 4OJQA 3ND8A 3BK7A 3LV8A 3VTKA 2QAGA 1CKEA 3ZH9B 4KU4A 4TLDA 2PCLA 2BWJA 1TU4A 4TLEA 1QHHA 3GEEA 5HZHA 5D3MB 3EG5A 3A1SA 3L82B 1MO5A 3QBVA 3RYTC 2EQBA 3DM9B 3FYHA 3O8DA 1YKSA 3VR5A 1AK2A 1E1QA 2FNAA 4JKYA 3K9LA 2JIZA 1IY0A 3LXXA 1LVGA 4FINA 2DCUA 3SJBA 4HAYA 3T12A 2WKPA 2XTNA 4WZ6A 4A8JC 2WWGA 2X8AA 3QG1A 1GRRA 4PHHA 3SOPA 1T3HA 3W3ZB 1JR6A 4DUGA 4IJMA 2GWHA 5JWRA 3B8HA 2J9RA 4FMCF 1OH6A 1LF0A 1VYTA 2PLFA 1N6LA 3B7GA 2BMJA 1P60A 2X2FA 3REFA 3BERA 5JSZB 1KMQA 5FBQB 1JJVA 1NMXA 1IXZA 2GKSA 3LH5A 4WW0A 5SZHB 3TBKA 2ATXA 2B8TA 3VNVA 4X8MA 2XEXA 1OT3A 4JT2A 4XWKA 1E0SA 1XCGB 2QA5A 1D6JA 3OHMA 4GZMA 4Q01A 2ZSDA 3ZZUA 1Q44A 1E4YA 4JSTA 3SR0A 1G3MA 3LA6A 4G0NA 3ZVLA 3EC1A 5AR1A 2PZGA 2ZI9A 5FTKA 3NHBA 4AYWA 4URZR 4EQ6A 2ZAMA 1AZSC 2FA9A 3N5CA 3ZIAA 1R0XA 2FEMA 4LI0A 3G5UA 4IFEA 3OE7A 2QZ4A 2G0NA 4NYJQ 5DLQC 3U7FB 4CEJB 1II9A 4IW3B 1OIWA 1XTRA
chains in the Genus database with same CATH superfamily
4HUJA 3CFYA 3UHOA 4CFSA 4XX0A 3CKKA 1SA0B 4GZ5A 2JLAA 2GZDA 3IMCA 2OE2A 5BQXA 4TRRA 1O87A 1U0RA 3JQ8A 5LWHA 5BQ5A 5KKNB 1Q21A 4MICA 1GG5A 2BH2A 3KALA 3AKYA 1RFGE 3HCEA 3DGFC 4MYRA 5P8WA 3HVIA 4UBNA 3OIUA 3TPFA 1IUKA 4D9EA 4NR0A 3VOTA 3KEOA 4UHDA 1W35A 1F6WA 3ZLTA 4B3SB 5I51A 4TQ9A 1WUIS 2EIXA 1RTKA 3I9V6 4LVNA 1O57A 2OCYC 4UM7A 5JASA 3U9SA 2BF4A 3UJNA 1OV6A 4WJZA 4O4IA 1U11A 4OQZA 1IPHA 4JUBA 5I3CA 3KE9A 2Q0SA 1T10A 3ZLBA 3FR8A 4FN5A 3V7YA 2I9KA 5EPEA 4LI3X 4MA4A 5K3SA 3QPDA 4K88A 1CNEA 3K2QA 3WDSA 5DGTA 3KVYA 1YFLA 4PZ0A 3SX4A 3E84A 1MRZA 1UXJA 2OKGA 1ZJ5A 3TQOA 1QRTA 4C3VA 2R7LA 1LLDA 1PG2A 3J81A 4IJKA 3NTRA 3TSWA 1U8XX 5A04A 4ZTBA 3U9LA 4D9NA 4EYEA 4DMFA 1ECJA 1P17A 1PNVA 2Z2KA 4PG6A 5I8WA 1IBSA 1KVQA 2ZI7A 2ZE5A 3SS8A 4KR6A 3IPXA 4UM5A 1ORIA 1Z0SA 4QM7A 2PHZA 3L8GA 3MIZA 4N76A 2AMLA 2GN8A 2J5QA 1U4OA 1ZGZA 5SV2A 3QV1A 4M21A 5C5EA 5CBPB 3I5UA 5DOVA 5KINB 2Z5VA 4OSEA 4TYMA 1MNQA 4J43A 5E9WA 1FTYA 1NDHA 4PR0A 4FC6A 1V6CA 1F7VA 3C45A 3ROPA 2I91A 4EPXA 2WYOA 4LE2A 3DWGA 4P4SB 4J16C 3I9JA 4JSRA 3X2SA 4GKKB 1N8TA 2V9PA 3KAPA 3QV2A 1UH5A 2BZSA 4GXRA 2WYHA 1RLTA 1ZD3A 1P9WA 4H0CA 2VUUA 4PLZA 1NX6A 1SU7A 2X5NA 4HPJB 1ZM7A 1VECA 2OUKA 1EE1A 2ID4A 3QVLA 5LP6B 2YOHA 3FFBA 2EP8A 1FSSA 4XVCA 2IYPA 3IKJA 2JFPA 1PWXA 5AVTA 1QZTA 1NDUA 3HSYA 4YDHB 1YB6A 3C1TA 4CU5A 4FZVA 1N5OX 1YJQA 2J31A 4JLMA 1T5HX 4YTEA 2JJ1D 1QMPA 2PGJA 3FUVA 1W4CA 4I1SA 4NICA 1JW9B 2IDZA 1WLSA 3DONA 1UPAA 4PGGA 5DSTA 1Q0LA 5CGZA 3REGA 1JB1A 2H2HA 4XKJA 3W3AH 3W6UA 1WE2A 3UJ7A 4G6ZA 1VL2A 1YTUA 3NBMA 1T8PA 1YQQA 3MC1A 2Q1XA 3PKIA 4QOEA 1MRNA 5ECWA 4ZEXA 4BMXA 4AICA 3FNIA 1VE1A 4IDHA 2YWFA 2NZWA 3AEQB 2B7CA 4KPUA 5CT8A 4TMVA 4RD6A 4HF7A 2Z56A 4X20B 5EMMA 2QTZA 5HJ2A 4X24A 3GOQA 2FWPA 5FQNA 3LIPA 4QO7A 3LUGA 3DYVA 3HN2A 3TNYA 1XQ9A 4EG4A 4BY9E 4LF5B 3M7IA 1BOOA 2TSYB 3EH1A 1KDYA 4OPMA 5AKGA 1XRLA 1TAGA 1MB9A 2JEYA 2YVLA 2PUVA 4DSTA 3AIKA 1JXQA 1EVZA 1SBQA 2JI9A 3N7AA 1PL0A 2AN1A 4TTVA 2C3MA 3RJTA 2VP2A 4WASA 4BMPB 3SS7X 1S5PA 2HWYA 1JF8A 4RQTA 2D2XA 1J06A 1NLFA 3SI7A 4CLHA 3O94A 4U5XA 5CCBA 2I65A 4R8LA 1R8YA 2BC9A 5DRTA 4Z1OA 4KITB 1DGQA 5F1YA 1E0JA 2OSVA 4MRMB 2JF0A 3ZWAA 4FC7A 2JAWA 2EZ4A 1LBEA 2C31A 1IN6A 1ZQ9A 3EIQA 4XWGA 3TQQA 2IL1A 1I3LA 3AIOA 3TI9A 5JCXA 1FNDA 3ICQB 3S81A 1LLUA 1PT6A 4ZK2A 5TPWB 2O4UX 2WDZA 4P93A 2PT6A 3A7DA 3BHJA 2PXCA 2VPPA 3LCCA 1TF5A 2G8LA 3EY9A 2O9JA 3E5MA 3SXJA 3KELA 4XWOA 2O8FB 3WSWA 1FNSA 2FPUA 3A58B 4YRQA 4XJSA 1B15A 3U13A 3PF9A 1ONPA 2XMBA 5CBPA 1GZ5A 2W22A 3A6DA 3LO5A 3G17A 1SK8A 3TCXB 1XZ8A 3ROGA 1JPJA 3G82C 4E1BA 1XPUA 1Y9AA 4AT1A 1ESMA 1YU6A 3R20A 3L8EA 3A32A 4PFJA 2CHEA 2NZUG 1RRPA 1FMLA 1AHNA 1OFUX 3IPYA 3PRKE 4WLVA 2D13A 4WZBE 2BFPA 3JCZA 4BAGA 1JZTA 1MAHA 1ULBA 4KPYA 2W6CX 1NKTA 1D7OA 3G6WA 2X0RA 4DSUA 1SXJB 1P0CA 3E23A 2QNBA 4LOKA 1XNQB 1BS9A 3FTQA 1P2TA 1W49A 3KX2A 4ZQHA 4AKGA 2Q6VA 4BLOA 3TTWA 4MQEB 1O58A 1OR8A 1J25A 1WM1A 2C99A 4L5IA 1RRGA 3V7WA 3ADCA 4EK9A 1HYHA 3BGWA 2UYOA 1SUSA 4CM7A 1Y3BE 3ESYA 1HNWB 3PT5A 2X8JB 3D2BA 1PLKA 4Q1DA 1KZGB 1YI8A 3IODA 2VLIA 1HXHA 2E4UA 4YRSA 1HFEL 1Y1TA 2YXLA 1J33A 3QQ5A 1IONA 4IDCA 4LHVA 3TECE 1QXSA 2JASA 1Z18A 5NLLA 1XT6A 4TS9A 1ZIDA 2OKCA 3Q7IA 4B73A 1WY7A 1NT2A 1L7RA 4KLAA 4DQKA 2O8FA 5DYYA 3CZRA 4MCIA 1VSUA 2HMUA 2IF0A 1YB4A 1V1MA 2OM6A 1ZQ1A 1M1ZA 3O2NA 5KTOA 3EXG1 3JQ8B 1BA2A 1N1GA 1ZP6A 5FUMA 3KQSA 4D4MA 1T3ZA 3V8VA 4WNYA 2ZE6A 2QQFA 2ZRLA 4NARA 2I87A 1VB3A 2OP1A 3T4UA 4UULA 4BKOA 4HMQA 2YZ2A 2DHCA 3AK4A 3Q11A 4RL4A 2XYQA 1RI4A 2MHCA 2PMKA 5MN6A 2AG6A 4HZUB 2BFWA 3KSBC 2ZYIA 3H5OA 2I6TA 1SEVA 2B20A 1X92A 1C0IA 2BM8A 3GNLA 2DY1A 4NJEB 4PC3A 1WDMA 4V03A 5KNDD 3BM5A 2AI3A 2CEAA 3AFGA 3RKRA 4F4FA 3JWHA 4OA8A 4O4LB 4M76B 1ZJYA 4RJJA 3DBLA 4OQPA 3PR2B 4V0QA 3TL6A 4J29A 4HTFB 2FMIA 4A6EA 5ALWA 1YS4A 4DG5A 4QGSA 3ZV3A 1UC9A 1H2EA 3IIMA 3E2MA 2AJCA 4FGLA 4A92A 3GFSA 1QR2A 2VNIA 2ZTUA 2GKGA 3IAUA 3O7MA 1GPKA 4RZHA 3UUEA 3R3XA 4DNFA 1ODCA 5JQGA 3G8DA 5I9NA 4FOOA 4HFRA 1EFAA 4GOKA 4UBJA 1IQRA 5E2IA 1XQXA 4KCGA 2I67A 2IYAA 4RLQA 3REQA 1DTSA 3TH5A 4EZBA 1L5SA 2DTDA 2EFHB 3UK1A 3ZLVA 4KR2A 2AYYA 3OOWA 3U37A 1DKUA 4TM8A 4BX3A 4YUAA 1JEYB 3K6SB 3ZHSA 3GT0A 4ZD6A 5K3OA 2VNKA 3BD9A 3KPJA 1EFRD 3Q5DA 4YPVA 3DC2A 1XTTA 2WIFA 3WHKA 1UP6A 2L2QA 1OASA 4C4YA 1LQUA 2R84A 1ORVA 5AM4A 5LZ8A 4TROA 1N0WA 3AOEC 4MCAA 3WGLA 4M87A 1AU9A 4QG3A 3HR7A 4G26A 3X2FA 1ZGHA 3I01M 1CVLA 2V6IA 3O8QB 4L2IB 4X6YA 1PJ3A 1VIYA 4YDQA 2J3IA 3DAGA 4O08A 3ML1A 3LHKA 2CV1A 2J3MA 1L1EA 5J1TB 4NBRA 4CM6A 1A76A 4C5AA 3UMYA 3AF0A 1EFLA 1QS0B 1CDOA 2DSNA 2NYVA 4CMEC 3LTNC 2YXEA 4XD7A 1DC4A 1IDOA 1ESNA 4BJ5A 4C88A 3HKEA 2YHIB 2GN6A 5KS2A 1QTQA 2V96A 2F8TA 1E5QA 4JQOA 1H65A 1ST3A 1LQ2A 2WIJA 1FS4A 2OA0A 5KX5F 3V80A 2FEPA 2YV5A 4NZMA 2WHRA 2RK3A 1SBZA 2YHSA 4KAAA 5FQOA 1F06A 4WINA 3UENA 5IAKA 1SC6A 3IQXA 3OVMA 4IQGA 4RJKA 3F6PA 1CUCA 4FOTA 1ZUWA 3AGPA 4NXNB 3W3AA 1MOPA 4OY3A 3WLQA 4IO1A 4RTQA 4RPHA 3ZZ1A 1LFDB 1D6NA 1XRQA 3MOGA 4Q4HA 3HI4A 3O8OA 2VHZA 3I2JA 2YR0A 2JLZA 5JFTA 3O5AA 3KG2A 2CNNA 4AFNA 3A6PC 3KQQA 1PJAA 1RE1A 4FDAA 4QDUA 2A9FA 3VGJA 4ZI7A 4FP9A 1NR5A 3HYRA 2RAVA 2DH5A 4NMLA 4RPCA 2ZI4A 3Q1KA 1MB4A 4UEKA 3VPAA 4AJLA 5ABPA 1RCFA 2WSMA 3EQ7A 4LZJA 3TR5A 3AT1A 4X62B 1V3QE 2ODQA 2VUSA 3I6IA 2EBHX 4L6AA 2O5EA 1AOXA 1IB0A 2GN1A 4PLPA 1M5RA 4IDPA 2FOXA 4GH5A 2W4MA 4D2IA 1OBVA 2GK3A 5I4CA 3FUWA 1EFUA 1I6LA 4LSMA 4GICA 1DKMA 2PKWA 2O5VA 3IMGA 4RDHA 2J6HA 2HUNA 1QV9A 4CT5A 2DPHA 3EFOA 1AIPA 1GADO 3F6SA 1GNLA 1E63A 3R9KA 4BUZA 1JJIA 1QS0A 5T6BA 4LJ7A 1ECCA 3DE6X 2K2WA 5IM5A 1MF7A 3VR3A 4BO8A 2FRXA 3NASA 3T0FA 1PTJA 1Q83A 2C9ZA 3EOBI 5ALFA 1YRYE 4DIEA 5KX5A 3ZZTA 2JFXA 4UBKA 1UJCA 2QAIA 3LL7A 4ZJUA 4OI0A 4BO5A 3GY0A 3K5PA 4E31A 1EWRA 4PBTA 3TLZA 1DJLA 5E6SA 3UICA 5AH0A 1ZNQO 3NWPA 4MINA 3WYBA 4J7UA 2OCIA 2HY7A 4XX0B 5AICA 5ADHA 5I5EA 3DZGA 1H9CA 2GM9A 1ONBA 4C0LA 1TEVA 1J8FA 1WLYA 1XKLA 1C14A 1SIWA 2B5WA 2ORYA 3NYQA 3WLLA 3P9YA 2NLOA 3A36A 2D3WA 3GEBA 5DDIP 3ZE2B 4ZI7F 2ASEA 3OJOA 1AUQA 1K4MA 4HLDA 1WBDA 1DFGA 5B58C 3A2KA 1R7RA 4Q3KA 4P38A 1R0ZA 3BKWA 2J48A 1IQ0A 4CFZA 3EGWA 1LUAA 2IQ5A 3L4SO 1CRZA 2IGTA 3RWBA 1PS0A 3K8YA 3ZU4A 4WZAB 2QXTA 1K4YA 1G18A 2DERA 2DUJA 4CI0B 2GDZA 4KQIA 4PLYA 2Q9BA 4ZVLA 2G4VA 1JX6A 3DZKA 3RRJA 2BGGA 4F56A 4F93B 2AUNA 4LMPA 1DQRA 1HLFA 4R84A 3O8RA 4ZEMA 1A9SA 1ODJA 3JATA 2ZVJA 2GESA 1SPBS 2JIOA 2XB4A 1UBJS 2OV8A 2Q1UA 4OA5A 5EIWA 5DNUA 3TG2A 1CUZA 4HAWA 3UAWA 1EEHA 2WJVA 1DBPA 3LWDA 2WKRA 1RD4A 4UJ3A 4AZWA 2YNMA 4NU0A 2FETA 3VPFA 1OXXK 4NQRA 4Q02A 3QPUA 1Z0ZA 3NVMB 4OAQA 1HFKA 2FPGA 1RAAA 4M8SA 3RYCB 1GFZA 3NGXA 5ELXA 3PXBA 3E0XA 3KOUA 3F5SA 2ZJFA 4QU9A 1GL9B 5IWAB 4E22A 2AYXA 4DV7B 3RWMB 2ZSJA 4CCSA 4Q4AB 3HRIA 1AZWA 3MMZA 4FD3A 5KNCH 2OO3A 2GAFA 2A1UB 1L9XA 3L46A 1JI0A 2DKFA 2R65A 1AV7A 4MNTA 4DJFC 2QBYB 1GSHA 5JRDS 2MT9A 4EOGA 4WPGA 1X2EA 1X0VA 3F8SA 2XMQA 4GQIA 1U9CA 1N1EA 1OGJA 2YFKA 2YJ6A 1M2NA 1VPTA 2R4UA 3EUFA 3W6PA 4Z4HA 1UPCA 2GGSA 4JLBA 1Z0IA 2NU7A 1QHHB 4XD2A 4Y6RA 1JP7A 3VQTA 1UZNA 3RSSA 4CFYA 4DWJA 2H1IA 3GG9A 3UWOA 1GUBA 4P22A 3GRFA 4AVYA 2J5RA 2VP3A 4R4JA 2VJYA 3T6KA 1FVXA 3I4CA 1PVDA 2BRUC 1DBIA 4PRYA 5EWLB 3UHAA 5C8YF 1N2HA 2EFJA 3JQCA 2GX6A 3W5VA 3B78A 3G9TA 3GJ0A 3CF6R 1RAHA 1ZVKA 4PO9A 4UBMA 3BHIA 3UC5A 1K2WA 4GWLA 4J76A 4QJ5A 4QEZA 1Z2EA 2F64A 1DKLA 3PQ8A 4V02A 5AKJA 2RGAA 2BOVA 4F0JA 4HLUC 4ZT2A 3Q8XB 3R44A 3GJ4A 5JAHA 1IN4A 2WU0A 3L2OB 2HK6A 5TGDA 2EWWA 4D45A 1YQDA 2J9FB 3R6TA 2PLNA 3P71T 2CJWA 3NVKI 1HDYA 2H0AA 2HD4A 2QTVB 3N8IA 5DNCA 2W2PA 3V1MA 2QRNA 3C7KA 3SOZA 5H82A 3HJRA 1AM4D 1UWLA 3BF7A 1J4AA 4UJ5A 1EESA 3E3NA 1ZLYA 1KO1A 2OOSA 1XEAA 1XXHA 5BYKA 4NDAA 1SVLA 3W8EA 4F60A 4BRZA 1IZ0A 1ICEA 4BNIA 3NAQA 3PGVA 1CS4C 1L5WA 4KQCA 5K99A 4ETNA 3GP8A 3Q10A 1JRLA 3DMYA 4GZLA 5H4HA 2I6GA 1KI1A 1OX4A 2FSSA 1EUCA 2C95A 2ZDHA 3DDZX 3INTA 4ILEA 1K27A 3GJ8A 5HBRA 3W7VA 5JBIA 1Q0ZA 2RH5A 2XMGA 4G3XA 4AF7A 4KLCA 3HP7A 3HU3A 4GECA 1G8SA 1SRRA 1KMCA 1KMNA 1Y3CE 3EB9A 2E6KA 4QNRA 2PU5A 4N48A 3PUYA 4N18A 4PGHA 5CYGA 1V3UA 1Y1PA 4LYEA 5T57A 2JJYA 4JUDX 4NECA 2C1EA 1PBTA 5KDLA 2BKEA 2H11A 3ISVA 1ZX1A 1SKYE 1XDSA 2B92A 2XX3A 4OM7A 4M9XA 4DGSA 1J90A 2G9ZA 3F4KA 3ACBA 3WL5A 5KPDA 1AKEA 2H1FA 4DTIA 2PD4A 3KOWA 1IEXA 3R24A 4GR9A 2X42A 4KRYA 2EVWX 1R8JA 2AD1A 4FZ5A 1RM5A 7MDHA 1ESDA 5B5SA 1UK8A 3G9UA 4EBFA 1N1DA 1OJ7A 2JI4A 2X5OA 3EAFA 3I45A 3OFKA 3OF2A 3GMTA 2XZPA 1UKEA 2Y0PA 1QORA 1QRRA 3NPMA 3ID6C 2AXPA 2QQ0A 3Q2KA 2RKOA 5A6VA 2GDJA 2QAJA 2QROA 1Q0TA 1M8JA 1E2GA 1TTPB 1FTQA 2J3KA 4P35A 4QUEA 5E8RA 3R76A 3JD1A 3HA7A 3K72B 1BCSB 3B6JA 2JIPA 4KPUB 3HWWA 3K30A 5IJXA 5JLJA 2PX0A 3ZGNA 4ML3A 2HW8A 1OXMA 1WXFA 4AU1A 1JKIA 3FE2A 4Z8XA 3G2OA 2ZVPX 2ZPAA 3I4LA 1U1DA 1PGJA 2XIJA 1NM5C 3GH3A 1TCVA 3ITNA 3JYPA 3LIIA 1E7YA 2QHXA 3M5CA 1W88A 4UATA 4RETA 3MJCA 3WHPA 1U7XA 3GLHA 5GV8A 1XVUA 1LWOA 1XA0A 1A88A 1EWKA 1DIOB 4EHAA 2G63A 3GPIA 3ONDA 4KMSA 4Z4IA 2WY2D 2P0AA 2Z1MA 3KR1A 3LUBA 4JZYA 4FFWA 5TJ9A 1AB5A 4HZIA 4FNAA 3C1UA 4OSPA 3Q2OA 3WMEA 3BE8A 4UDOA 4YCDA 4DYVA 4LHWA 5IC6A 4RVCA 3BXEA 4G2NA 3RK0A 4NPAA 1L5MA 4CTOA 4NOMA 3PEWA 2V4ZA 1L0BA 3Q4GA 5B1EA 2AF3C 1YCGA 4JBWA 1PUIA 1A04A 1TM2A 4PSDA 5KCMA 1Q0SA 3NYWA 4WBNF 2YC2C 3MJDA 4Z53A 5JS8A 4F91B 2FFJA 3L1UA 4Q18A 4BMZA 2XODA 1B8UA 2JL1A 3VPDA 1XEWY 3C3XA 3OO0A 2MSEB 4XVRA 5M04A 2FPRA 2Q8QA 2C2HA 1KYQA 4HEA6 3WMFA 3GVIA 5KAMA 4BYMA 3L4JA 3MWDA 3ELDA 2FAXA 2H4FA 4YAFA 3ZS8A 3CISA 3K9NA 3M3DA 1NN3A 4JC0A 3HXTA 3RSHA 3SY8A 2ZZMA 1XAHA 2OGZA 4Y6PA 2XVAA 1AC5A 2Y1EA 4I1IA 3Q0IA 4UOEA 5AQEA 1G19A 5EI5A 3ZCTA 4NNPA 1BXGA 5SY6A 1E89A 1H66A 1EFVB 3N28A 2G4CA 3ADPA 4U39A 1BGXT 1PZGA 1KU0A 1Y7HA 3DKIA 3QLEA 4FQ8A 4KQ2A 3V4VB 1CQPA 2XVMA 3GXBA 1ODFA 2EZ9A 3TLGB 4XCQA 3T1TA 2C3PA 1H0HA 1IHUA 2CHGA 2WI8A 2VWQA 4JLNA 3T1NA 4GYWA 2N1BA 1T9GS 4NE9A 5CM2Z 1J24A 1EUDB 1T15A 2WSSA 2PAAA 3LLCA 3NUGA 4FT4A 4JOSA 4O1HA 5ARDA 4EH1A 3UPUA 2YJ5A 2AR9A 4BE7B 2NXJA 3ST7A 1BIFA 2Q28A 5K0EA 2KYRA 2DQYA 2PUFA 3TUJC 2XIQA 5M5BA 4XYBA 3KQLA 4KLNA 3FNBA 4AUNA 3Q8MA 4P53A 1DXOA 1P18A 5MN4A 3LP5A 3RSFA 1WBBA 4KG7A 1W1IA 1YXMA 3UW3A 3QVSA 2JFBA 2GK6A 5E2AA 3F5MA 4HMPA 3QVKA 5AVXA 5JVDF 2F8SA 3UVEA 2YUTA 3ZXYA 2SKCA 2Q3JA 4MVJM 4NZNA 5ALTA 4DMLA 1G60A 1BCRA 2DMRA 4TXHA 4EO4A 4LEIA 3CUUA 1I4LD 4C0JA 1JB9A 2XGSA 1SVKA 3X1JA 2RGBA 4GX0A 4JX8A 2F55A 1GPNA 2FPPB 3GFGA 4X6XA 1BG6A 1V37A 1KHTA 2ZQYA 1ZK4A 2P6UA 4ZOEA 3MWFA 2MINA 2C2WA 5CW1A 5I7AA 4DYHA 4XW2A 1JNXX 2ZK7A 2RK6A 3ZLUA 2PKXA 3PUZA 3UBTA 4MR8B 1TQHA 2RIRA 4BKPA 2HPHA 2FPSA 3V4PB 4RL6A 1WCIB 2AXEA 1G59A 1I3MA 3VUEA 2E87A 2EEPA 3NIGB 4B8YA 4F3CA 1WD5A 4ZKDA 1AHPA 2XY4A 3PDIA 1AQNA 5ESDA 5IVIA 3KZOA 3VC1A 4EHIA 2FDCA 3N0RA 1FPMA 4AJEA 2GUWA 3N3AC 3GDOA 3VKWA 1II8B 5IBRA 4JJZA 3PXAA 3ZCUA 4G0XA 4MUHA 5HPYB 1N32B 4MYCA 1N9GB 5CYOA 1H5QA 2PSEA 2ENWA 2RJOA 3V1UA 1Z0KA 5CVTA 3X1XA 4HMOA 4DLKA 2DBVO 3USZA 4B2LA 2A30A 3KAKA 1CFZA 4B35A 4PYKA 2ZJ3A 2H17A 1U8UA 3OECA 4A5OA 1K86A 5K05A 3A4TA 3IUBA 1KC3A 4XGQA 3WE7A 3KJEA 4MDEA 2FUNB 1FRNA 3GF4A 3OSUA 3GUYA 5HYVA 4JGIA 1KBQA 2B0CA 1BHQ1 2VJQA 4RW0A 4BP9A 1CLUA 3QHPA 3RUIA 1RFLA 4JLOA 4TV9A 4CR7A 3KWJA 1TKCA 4O33A 2AIRA 1C3LA 1P9RA 3B1KA 1S2LA 1WXEA 1FK8A 4LC1A 3U4QA 4MW7A 2D62A 1QG4A 2B21A 3V4OA 3EVEA 1NN5A 4J0DA 4YQYA 4A27A 1YA6A 1W85A 2GOYA 2QTHA 1HY3A 1X7XB 4I6GA 3ZGYA 1OIVA 4HDRB 2DGDA 3FPGA 1NMQA 5SYMA 4CUJA 2OXEA 1ULAA 1XVVA 1OILA 3AMVA 1K66A 3EAGA 3U9TA 2AMFA 3IDSA 5IT9A 3D6TB 3NHJA 4IKOA 5FPHA 2I3GA 3CGGA 2V8OA 3M2PA 1KQGA 1E6UA 3AJDA 1NQXA 1PT7A 4IL5A 3ZOKA 5I47A 2XR1A 3KQUA 2GJAA 1GTVA 1KK0A 3KQWA 4G0UA 4HDMA 3V97A 1UBCA 3IHWA 3WWOA 2OO5C 2O8NA 3NRCA 1SHZA 1TJNA 5D1HA 3D8BA 3RTAA 4CGYA 1ZR2A 4TV9B 3CSDA 2WPDD 4MIEA 1K06A 3SCZA 1B76A 1HWYA 4HY3A 2J0QA 1JG3A 1G8KA 4BV3A 5B7NA 1SOUA 3I12A 3B1FA 2GXQA 3QSGA 4Z4CA 4CG2A 1Q6ZA 1NMYA 2PU7A 3HQ4O 5EJ9A 3TIGA 3D7RA 1GYRA 3PCXA 3D3WB 1RYYA 4JKIA 4NV3A 3AFMA 4KFSA 4EFNA 3MTQA 3FPAA 1WL8A 3BS4A 4JS0A 2O1EA 1EB9A 1PR0A 2XE7A 4HHEA 4IV8A 5AI8A 3TB6A 4RJTA 1FUEA 1S2NA 4Q48A 4H16A 3ZNOA 3FSGD 3ZQKA 1TEHA 2HIMA 1J1IA 1HDZA 2XQJA 5CLLA 3TVTA 4A23A 4FFSA 4URHA 5GV7A 2E85A 4RCYA 4QIHA 3P5BA 5J4HA 2J1LA 1WMDA 2QTTA 2TECE 1RPNA 4M6WA 3PFFA 4GMHA 3PDIB 4WXYB 4BJ6A 2BW0A 5DX0A 2C4TA 1S3IA 1L7QA 1X14A 2V4MA 1ZGAA 1WCIA 2HRZA 5CK4A 2FWRA 5CH8A 2VF7A 3L5OA 5A05A 3T7EA 2AX4A 2BHLA 3SN6A 4RTSA 3QITA 4FE3A 5FI1B 3LPCA 5J2TB 1TO1E 4IFTA 1LTQA 1J2YA 3LK6A 3H8WA 4MMXB 3F6EX 1KI2A 3JW8A 5KYGA 5JW6A 4U63A 3UGKA 1S4QA 3ESXA 3S8YA 4LZOA 2B6HA 2P30A 4XIYA 1E1NA 1MAVA 1NI5A 2B83A 3ZHRA 2DJIA 2PPLA 3R6LA 2OZLB 3VAZA 2B9VA 4P86A 3DOOA 2BFBA 4O8ZA 2DWOA 2YTZA 1GEEA 4CW7A 3EDRA 3LZ6A 4OF4A 5HXAA 3S1SA 3NDBB 1KVSA 2WAXA 2ZYVX 1XU9A 1YBAA 4WK0B 5AK0A 5BR8B 4A9AA 3AJEA 5I9TA 1NW6A 3ETDA 2BRUA 3G85A 3IBYA 3JAWB 3GEIA 4BEVA 4W6ZA 4Y3UA 4GLOA 4C14A 2GYWA 4UHBA 4KWEA 4WJKB 1CERA 5CA1B 1US8B 3LP6A 4GXTA 4KN6A 4D8WA 5D86A 4WKNA 3PHLA 4PHGA 5LDHA 1TM7E 4K05A 3TOCA 5K9ZA 2PKQP 1PWHA 4RA6B 4PTLA 3N74A 3DEHA 5EQFA 1NVUQ 2DHRA 5T7BA 5EIFA 2GCGA 3HGTA 3D6MA 2YIMA 5B3JA 3I92A 3WK4A 3UA4A 2HYDA 1DC6A 2WWWA 3DT9A 1DV1A 3HVJA 1OC2A 4PYRA 1I7LA 4Z9AA 5B3JC 1EFDN 5CK5A 4EGSA 4OQNA 5AJXA 4Q93A 4D02A 2VDNB 3AYZB 4C4OA 2WTUA 2HA5A 2WM9B 2R44A 1QF6A 3TE7A 4C3OB 5CD1A 3GLUA 4ER5A 1UADA 2FWAA 4Z7QB 3PU6A 3E1SA 4GX5A 1UEJA 4A0QA 3PC8C 1KIFA 1A5ZA 1R6AA 3VPSA 1B0AA 1NVGA 2AK3A 2OHGA 3FOWA 3MWEB 5EESA 2YNMC 4DC0A 4ZIRA 3DV0B 4YACA 2LIVA 3AERB 1CR2A 2PYIA 3H1GA 4GU5A 4OP2A 1L7XA 3W2EA 1R4MB 5CYPA 4ID9A 4UVDA 3EQ2A 3ENWA 1VMDA 1XYGA 3FSGA 4GGOA 4K6CA 5IJ0B 2XE4A 2YQZA 3CF4A 4KWIA 4JEMA 1F2UA 3SJZA 3SYNA 4YUZA 3SZGA 2Q7OE 3WAJA 2O06A 1MG5A 3LUPA 4MLZA 1CHDA 3NV9A 5J5VA 4OH1A 2NT3A 1UM9A 4L75A 2NG1A 5MFPA 2FVYA 2Q3CA 3TUZC 3QA3E 2OB2A 2VZEA 1A7KA 4IAOA 5F51A 2HNBA 1X80A 1CF2O 3NP9A 4Q21A 5AKLA 2H1RA 1PN3A 1QQ6A 1SWVA 2J9XB 4F85A 5KNLA 3ZVMA 1JDJA 3INRA 3DXFA 3GLHB 2COKA 2C9MA 4LUCA 4RC9A 1PEKE 2RSLA 3MVEA 3U4IA 3JX9A 4Q1EA 3WQQA 4RDXA 3SDSA 2PUAA 2P7IA 5AK5A 3V55A 4LVOA 5ENVA 4XARA 2Y67A 3VSDA 1QP7A 2FUEA 1S3FA 1WU7A 2HF2A 4F2DA 1LI7A 4L0QA 1TAUA 3CX8A 2UUAB 3E70C 2OZPA 2ZROA 5FUXA 3UT5A 4RD3A 1FYXA 4ZRDA 4HQOA 1NBMA 3DO5A 4JROA 2XE8A 1G8FA 4IZOA 4D8VA 1C8VB 4AS1A 3CLSC 4WT7A 2ZIUB 4LRUA 1GTSA 4QGBA 1GO2A 2ET6A 5DSXA 4YCNA 3WOHA 1YGYA 521PA 1H8HA 1ZOLA 4QFBA 3G0HA 3DVAB 3IBFA 3RIHA 5IKXA 4R9RA 4JJ8A 4RGBA 5CW2A 5A7HA 2Z8XA 1EM8B 1TM3E 4I1UA 5AK3A 3QNMA 2W6IA 4TXMA 3G5AA 4ZCPA 4EFDA 5JADA 1Q1AA 1Y7TA 4F9EA 4D92A 3IBCA 3BE4A 1P0PA 4OLHA 4DA8A 1ODIA 1Y5LA 1YT5A 2HGZA 4ZJPA 2IIVA 3R0ZA 3ICPA 1JFSA 1L7MA 4Q34A 2P4UA 1AKRA 2BGRA 2H92A 3GJQA 2OFFA 4FYYA 1JLLA 4HZGA 5C1BA 1H2RS 1UDXA 1FSPA 1UEXC 4P4GA 3ESBA 3UCEA 2X5XA 4LJ9A 2O7SA 2UVDA 2FHPA 1I6KA 1M8FA 2WF7A 3HNOA 3U3MA 3ZEIA 5I9LA 4PYOA 2PJZA 4ED9A 5CEJA 3I01A 2IEAA 1GZHB 1UZAA 3C8ZA 3KXLA 5KU1A 1YZ3A 1GKYA 4DLBA 3DDNA 4LY0A 2IYQA 1L3IA 4QARA 2HXSA 1DBSA 1MORA 5A71A 1Y6FA 4LXQA 4LDQA 4LWZA 5JXJA 1WB6A 1KEEA 1T3LA 2ID7A 4D79A 4UNSA 1SEPA 4LXGA 3SG0A 5DNYB 3E1KA 3M4ZA 4UHHA 1A8PA 3KOOA 3U1BA 1LBTA 1EX1A 4LWQA 2AEEA 3AG5A 4PC6A 2GN9A 5DYTA 1YJCA 5BNIA 1E7WA 4HS4A 4Z54A 2BGUA 4KN8A 1LQTA 5GOTA 4B85A 1PZXA 4F45A 3U6BA 1ND6A 1Z5WA 1AS2A 1DRUA 2QY9A 3B13B 4E6PA 5A7FA 4WD3A 1T26A 2P6OA 2AQ8A 3HCRA 4HWKA 4JL5A 4B82A 3GJSA 3LDFA 3LUAA 2WE7A 2W5UA 1WSBA 2F1RA 2D1RA 5JCJD 1E66A 4N5HX 3K8OE 4YCCA 2UVQA 4OH7A 5B57C 1GCGA 4AC9A 3LQYA 3DOHA 3QVWA 3PEVA 1FRZA 3CSUA 3NM5A 3GGGA 1KH2A 2CBXA 2FR8C 5CHEA 3R9XB 3GFPA 3SZLA 2NP6A 3KAJA 2VJLA 1KXZA 4H3KB 4HFNA 4R31A 5KIAA 1OKKA 3CJQA 1WETA 1Y6QA 4PIMA 4F8YA 5A5FA 2ZYWX 3VYSB 2EDCA 3EC2A 3IPLA 5IYZB 4OM8A 5C0OE 2ZJOA 1Y9JA 4QG7A 4UHEA 1DRWA 1GSOA 4W1SA 2XVZA 3CX7A 1Y5MA 7ADHA 4DABA 1SVMA 4NHEA 1L5KA 1ZAKA 1GVHA 1E96A 1IBRA 4ND4A 5DNWA 3KT3A 2C7RA 3IBTA 4RS3A 5J2TF 4M1KA 1A3CA 1PT8A 3ETNA 3OZGA 4QYIA 5HFAA 5AOAA 2FZWA 4ER6A 2VH2A 2FSPA 3AP1A 4LZPA 5AOBA 3RQIA 4XXHA 6LDHA 1WB5A 3OJXA 1BU5A 4WA8A 2HLDD 3F1LA 3L4BC 2J3JA 3KTAA 3FX2A 1I7QB 1K98A 4D99A 3JQDA 2JFQA 2OC9A 1XJQA 4H6WA 3UN1A 1SVWA 2X7HA 1UP7A 2Z1NA 3FWHA 1JXOA 4EG6A 2FF7A 3IVXA 3WA6A 5E7QA 4GSYA 4WZZA 3SC6A 3UTCA 3OQIB 4CIWA 1XDUA 4S2UA 4RVUA 3UT0A 1C0LA 4FYWA 5DN6A 4F1JA 5C80A 1KWKA 2IXGA 3AZOA 4RFSA 3W9UA 3IOBA 3R3SA 4QODA 1XA3A 1HL7A 1HE5A 1OU4A 2SBTA 4XGIA 2WOJA 2G9VA 3OOSA 3DDCA 4EARA 4TUYF 1YS2X 3V2UA 5JSUA 1ZN9A 5DT9A 4LOJA 3RVNA 4HX2A 5AKEA 3VI4B 3W5DA 3F73A 2QQEA 3NW9A 3KD2A 1FJ2A 1OCEA 2XGOA 1K6MA 4Z2AA 4EENA 1WHSB 4UOQA 1JNYA 2V55B 5DEIA 3QWBA 3D0OA 4EHJA 3OLZA 3H5AA 1ETUA 1DG1G 2VBFA 4AJ9A 1RWOA 4FW9A 2PJRA 2EW1A 2PT9A 2A3NA 2PVPA 3SU8A 2YWBA 3DHYA 1YB7A 5F7OA 4HGZA 5AXAA 2ZU6A 4BXOB 2FG5A 5IDVA 3EXEA 3S40A 4MQ5A 1YZUA 4C9BA 3AIMA 3HG7A 3TXXA 1GTRA 4R0VA 3QNUA 3RS8A 1Z4KA 3ZY4A 2JFUA 4W1QA 2FEKA 3QH4A 5I7RA 4YRMA 1B41A 3ZEAA 1CJCA 2R6JA 3FTPA 1N8NA 1QP8A 3D7LA 3VPBA 5GIOE 2P69A 3DTNA 2BMDA 2IP1A 5K01A 2DSTA 1VTKA 3VHXB 2DETA 2QQ5A 5UKDA 2R4TA 1TTHA 4CZ2A 4C07A 4QYXA 5BSEA 1FDTA 1SXPA 3DEKA 3VDNB 4CKEA 4ERNA 3EEIA 1F2TA 3EGXA 4H77A 4ZZIA 2UYHA 1QG0A 3FKSA 1EK6A 2VYVD 1P2BA 3GROA 3OU7A 1XC7A 2V58A 2QX8A 3BMQA 3K4HA 4NH4A 4YUYA 5JXGA 1S9DA 1M2OB 4E0BA 5KX5B 4X5OA 1XEXA 4LF8B 4MV0A 4J9VA 4WX2B 2QTBA 4AO8A 1E0KA 3QJYA 4B5LA 2DYKA 2RH4A 3BSWA 3RK1A 5KWJA 1DO8A 2R4QA 3R77A 3KWFA 1NN1A 2YDXA 4FWIB 2ZIZA 2B61A 4B2PA 5L4LA 3HC7A 3I2KA 2VVTA 2R47A 4WWHA 5DBHX 2XB8A 1ZY2A 3DL0A 4XH9B 4UZFA 4ZOLA 2WNSA 1ZUHA 3RT7A 4OHVA 2AF4C 3Q41A 4I1VA 2O1SA 3UFBA 1U0FA 1NNSA 4QXQA 1PIWA 3TRFA 3NQ41 4O4IF 4MMZB 1TA9A 1IMOA 5IHPA 1H0RA 2R1VA 3RIGA 3STYA 2GXSA 2XZOA 3EVBA 2ZUFA 3ZV6A 1JE1A 1JG7A 4TWZA 4RGYA 1B0UA 4FFMA 4EZIA 4HB0A 2I4MA 3K0FB 1G1MA 5DWVA 1IN8A 1VLQA 3V1TC 1QH9A 3EAQA 4BLQA 2JVKA 5DX8A 4X7RA 1PD1A 1EZ4A 4QL3A 1XELA 3F78A 5K45A 4J3NA 1Q2XA 2KJQA 5LM3A 3PPIA 1N34B 1JSRA 1H1LB 3FGZA 2PRKA