4TYQA

Crystal structure of an adenylate kinase mutant--akm2
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
215
structure length
215
Chain Sequence
MNIVLMGLPGAGKGTQAERIVAKYGIPHISTGDMFRAAMKEETPLGLEAKSYIDKGELVPDEVTIGIVRERLSKSDCERGFLLDGFPRTVAQAEALEEILEEMGRKLEYVIHIEVRQEELMERLTGRRICSVCGTTYHLVFNPPKTPGICDKDGGELYQRADDNEETVAKRLEVNMKQMAPLLAFYDSKEVLVNVNGQQDMEKVFKDLREILQGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of thermally stable adenylate kinase mutants designed by local structural entropy optimization and structure-guided mutagenesis
doi rcsb
source organism Bacillus subtilis 168
molecule tags Transferase
molecule keywords Adenylate kinase
total genus 78
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tyqA00
5CM8B 3MRSA 3FDIA 2R6GA 4B3BA 1DTSA 3V4FA 3GLGB 4RD0A 2B8TA 4IVQA 4AY2A 1E2HA 821PA 4IOJA 3PEUA 3KKMA 4O25A 2QEQA 4P4SB 4DCVA 2GJAA 5C18A 2DY1A 5B30A 2ZR9A 3EPJA 2BIFA 2WOOA 4RFSB 5F9HA 2W2VA 3ZQJA 1XNJA 4P4UA 1N6RA 3KQNA 1MV5A 1KY3A 1JQJC 3LBIA 4A15A 1WE2A 5HZHA 1JR6A 1KK2A 5KOYA 3U5ZB 2RGXA 4R2HA 5LD2C 2ZS7A 4NYIQ 2W2TA 4QRHA 2CHGA 3CH5A 3A8TA 4TLAA 1SZPA 3CLVA 1YZQA 4DDTA 5E7MA 2O0JA 3GEIA 1SULA 4O3MA 1T9HA 1TL7C 2VSFA 3MLEA 1U94A 1Z6GA 4LHZA 3CRW1 2VP6A 4U00A 2HDNB 2ZITA 1ESNA 3RYTC 3BERA 3NVAA 3Q3JB 4K46A 2ZVPX 3QXSA 3WHKA 3ZZTA 5JLJA 3QY0A 2DHRA 3V9PA 3WBJA 3LV8A 1C9KA 4HDQB 2OSBA 5AUPB 2XTMA 3RS3A 3QEJA 1UBCA 2IYUA 4YMVA 4MUAA 2ZJZA 1DAIA 2CHVA 3I4LA 1OJLA 3C5HA 3W9YA 2XTNA 2QPTA 4DBLC 2FFAA 4P31A 3A4NA 3CR8A 4WZAE 1YVDA 2J7PD 4M9QA 1G5RA 2GF9A 4Q48A 5DISB 1OXUA 4URUR 4OK3A 3EARA 4QOSA 5EQTA 3PQCA 3LVQE 4YMSA 3CB4A 2G1KA 4URWR 1TNDA 4B47A 4PX9A 3LH5A 1CEEA 2JJ8A 2IWRA 2G0NA 1CRQA 1GAJA 2NPIA 1X1RA 1F2TB 2O8DB 3ASZA 4DDVA 1P9RA 2ZI9A 3U61B 2HF9A 1RE0A 3VFDA 4B3GA 4RJLA 1HE8B 3IGFA 2QAJA 2KBFA 1YRBA 5SZHB 3L0PA 4LWZA 2V54A 2QM7A 1CS4C 2D2EA 2WICA 3TNFA 4GOKA 2O8CA 2E1RA 2C77A 1GL9B 2BMFA 2R6AA 3K0EA 4HB2A 4C0BA 4QHSA 2A5DA 3KFXA 3DO6A 1H8EA 2OBMA 2V7QD 3N5CA 3SYLA 1JALA 1KI7A 1W47A 2QTVB 4ZI3A 4ASUA 1OB5A 1C1YA 1Q20A 3B1XA 3H1TA 3RANA 1WMSA 5JCPA 2FSGA 2JAQA 1Z0AA 3CWQA 3OFND 2CE7A 2HLDD 2FPKA 2QTFA 1JEEA 4CW7A 5AUQA 1Y63A 3LBHA 4I1UA 1GRQA 3P26A 3WYGA 1KSHA 4KFRA 2ZIAA 5F3WB 1CJUC 2BC9A 3SR0A 2Y8EA 2F7SA 5FTKA 4KFSA 3WMEA 3BIFA 3LNCA 4Z1MA 2JCSA 3UG6A 3FMPB 4RZXA 1OW3B 1S96A 1KJWA 4Q1DA 1OFIA 2ZXUA 3KJHA 4JVLA 1QZXA 5LB2A 1SXJB 1N6KA 3B13B 2QGZA 3VKHA 5E95A 3PCRB 3IILA 3K09C 2VEDA 5EZ6B 1Z0DA 1W0KD 2I4IA 2JDID 1JXMA 4FCTA 1GNRA 2PT5A 1E2EA 1JNYA 4LBZA 4TMWA 1K6MA 2BJWA 3DDCA 4DLTA 4US2R 3BAFA 1SXJD 3AP3A 1NLZA 2C96A 2GXSA 2ODBA 1N5KA 1E0KA 1DE0A 3K70C 2ZRKA 2WMOB 2ZI5A 5JSZA 1NN1A 4TZ0A 1N6LA 2CEAA 3CIOA 3AVXA 1WDTA 2VP9A 1XD2A 3K8YA 1ZCBA 1F60A 3LY5A 5C46F 3QVVA 2P5SA 3SJCA 2EFHB 5L3SA 1FP7A 3A6PC 3IKJA 1ZC4A 4H9GA 4E03A 1S8FA 3MAAC 3SE0A 1MRSA 4RSGA 1XEXB 2QNRA 2CL0X 2VIIA 4L16A 3RHFA 3W34A 2OCBA 3DKPA 3OIVA 3GJ7A 2ZE8A 4OHYA 1WP9A 3QPWA 4A36A 1LFDB 4W5JA 1QG2A 5L3QA 4A0HA 2WVJA 2FSHA 3QUSA 1VTKA 5A5GA 2LKCA 4HLCA 4OHXA 1OIWA 1II9A 1ZM4A 1KGDA 1AGPA 1JBKA 5FPTA 1E9DA 1M34E 5FUYA 2IK8A 5FTLA 4ZDWA 2VHQA 4QHYA 1R5OA 3RS2A 4OHZA 2FGJA 3U6BA 5EXSA 5FBWB 1L2TA 1E9CA 1HURA 2VL7A 1LF5A 2V8OA 5DI3A 1L4UA 2O5VA 2J1LA 1IM2A 3AF4A 2ZJYA 5KDLA 2XXAA 3L0SA 1G4AE 2C5LA 3SQXA 1H8HA 4I4LA 1Z47A 1SVSA 3KXKA 1QVAA 1I4LD 5BN5A 2PCLA 3THYA 2XGJA 4U02A 1M7GA 1TQ2A 4ACBA 2P0EA 2PBRA 2FG5A 1A5TA 1A82A 1AA9A 2QT0A 3OIWA 4DKXA 1DO0A 4Y0VA 3W5JA 3HR8A 1UBEA 3C14C 4KU4A 4Q02A 2ECKA 1ZU5A 5K8TA 1TX4B 1QHSA 3AGQA 4M2LA 3GJ6A 4QGGA 1R8QA 2P65A 2REXB 2NIPA 3KQHA 1VDZA 4QBIA 2EYUA 1W4BA 3EA0A 2BWJA 1ZAKA 2C9YA 4Q9HA 1F48A 4BFSA 2NMVA 3FB4A 5KYKA 1P6XA 1ZC3A 2HCJB 2QMOA 5JRJA 1AM4D 1Z3IX 2GCOA 3KKQA 3T15A 4D4LA 4EFLA 1DADA 5EXXA 3AP2A 3AQ4A 4L9WA 4BLQA 1YR7A 3DM5A 2OT3B 2G3YA 3GJ0A 4TYYA 4JVSB 2HT1A 1CJTC 2QAGB 4LY6A 2XZLA 3GLFA 4C4PA 3FHTA 3KQLA 1HT1E 1NJGA 4Q1CA 1BS1A 3PJRA 2XB4A 3UK6A 1UEJA 2F1IA 1OXVA 3CF0A 4TT3D 3K0FB 1ZNYA 4WZBE 4G5OA 4JYBA 3D31A 5AWFC 3U3RA 2BM1A 1X86B 3TQFA 1Z8FA 3RSLA 4TYNA 5FOVA 3GLFB 1TEVA 2XTZA 4C0AC 4D4KA 2GESA 4CT4B 4HLQB 3AM1A 4A9AA 4B75A 1OLOA 4RY2A 1W36B 3H86A 3SDZA 4TYWA 3HDTA 3IBGA 2IX3A 3B85A 4Q9JA 2ZUDA 4EJSC 3T12A 2BDTA 3H0KA 4K81B 2WWIA 5J40A 4GDFA 3NDPA 2C8VA 2ZRGA 1FQKA 3A1SA 4D4MA 1NKSA 1Q12A 5H1YA 1W2GA 3PR1A 3SJBA 2V6JA 4KVAA 4PC3A 4QBGB 5B57C 1YZTA 4IJMA 4YMTA 1NVWQ 5C1BA 1BOFA 5TXGA 2HUPA 2H57A 4LYAA 4NCJA 2X2EA 4PC1A 5IK2D 2OM2A 4KJZA 5CJPA 4PSAA 4EFMA 1WCV1 4MH0R 3T5GA 4A82A 2F9MA 2H18A 3U7EB 4C0KA 1EESA 1SKYE 2BHRA 5LBIA 5FL7A 5TARA 1U8AA 3AVVA 3QG1A 4GSYA 1Y3AA 3K0CC 3P4YA 1ZIPA 2CK3A 3EC2A 2I3BA 4UNNA 1KTVA 3RVBA 2PMDA 3THYB 2W0SA 5D3MB 5JS8A 1E2NA 1NVVR 5DN6D 3QKUA 2JDIA 4OBEA 3KTAB 1CIPA 4IEIA 1A1VA 1UJ2A 2RB4A 4KAXA 5FBLB 1P75A 2AFHE 2R65A 3JZMA 3G0HA 4B74A 4C0HA 1U8ZA 4RD4A 1PZNA 4BQSA 2N1BA 1KO1A 2XITA 4UJ3A 4HDCA 3OZXA 1A2BA 5HR5A 2AN9A 1KMHA 2Q3FA 4II7A 4EPXA 2BKUA 3CPHA 3X1YA 5A4JA 5EJEA 2YVUA 1XJCA 1F6BA 4QKQA 1T3SA 3A1WA 4Q4AA 3PEVA 2QMUA 1II8B 1E98A 2TMKA 3BRWD 4TMKA 5C4MA 2RHDA 4V0KA 2NO1A 2YWFA 1XCPA 3GFOA 2RAPA 4L15A 4MYCA 1LTQA 4P0TA 1HEIA 2ZSEA 2A30A 3WMFA 3NBFA 1FFHA 1QHHB 5TV2A 2ZTSA 2ZRAA 5FOUA 1OPXA 1SHKA 4OL0A 1SVMA 5TY0A 4AKEA 1YZKA 2IYZA 4LV6A 1FUUA 4KSBA 3C41J 2W00A 4AYWA 1IOZA 2J0VA 4EFNA 1RYFA 2JLSA 4BZXA 2WWXA 3WRYC 1TAGA 5LD2B 4LPSA 5GADl 4PAOA 4G5GA 1GM5A 2VBCA 4NU0A 3R9XA 4HZIA 2RGNA 5E3HA 2MMCA 4LHWA 2GBLA 1MABB 2QG6A 4BZPA 1MT0A 2QU8A 3RS7A 5TVKA 3IHLA 1T4GA 2J41A 3CX6A 4PHGA 3DOEA 3ZGXA 1J7KA 3HYRA 4ZV4A 5DE3A 2IL1A 5DHAA 4YONB 3DM9B 1NSFA 2AFIE 4A8JA 2WOJA 1US8A 2QRNA 1Q1EA 3C15C 3KZ1E 4NYJQ 5AJXA 1W1WA 5FTMA 1I2DA 4JBXA 2CLDX 3A37A 3BGWA 4KLZA 3GJXC 4C3ZA 2Q0HA 5KO2A 1XU4A 4GOXA 4PQYA 3M1IA 121PA 3T06B 4L8GA 4R9UC 1SXJC 3NDBB 2ONKA 4Q03A 5BW8A 1DAFA 1JR3D 3U3KA 4V0LA 3U7GA 4DRZA 1KI6B 1A4RA 1RYHA 1QHNA 3W8RA 2FMXA 5JECA 5K8IA 4JL8A 2KBEA 1QHGA 2KWIA 3QF4A 4TL8A 1LS6A 1VG1A 3D3QA 3FOZA 3F3YA 4LZZA 5HZKA 2J0SA 3AF3A 3D6TB 4N3NA 4B2PA 3AF2A 1PLLA 1F2UB 1UKYA 3KX2A 1NL3A 3SHFA 2ZJBA 4LC0A 1S1CA 4TTRA 2WJVA 1H65A 4PSVA 1G7RA 4KHZA 1C4OA 4Q9KA 1MO4A 4EKDA 4QGAA 1P9WA 1XFAA 3PITA 4PANA 2FOLA 1ZIOA 2RGBA 2GDJA 3RSOA 1E0SA 1NMXA 4ZKDA 3CF2A 1AN0A 3QVUA 2VSOA 2IS6A 4N0DA 4QNMA 2FZ4A 2J9RA 2GJSA 1COWA 2FWRA 3ND8A 4HLUA 3MWKA 3I32A 4GL2A 2H8KA 4W7SA 1YRAA 2IYVA 3LQRA 1E1RD 4XVQA 4JSYA 3VX3A 4XWKA 1OXSC 3JZAA 3DHWC 5B2ZA 4BLTA 4D0NA 2I1VB 4NP6A 3M6AA 3QPVA 1IY2A 2AX4A 4MKGA 4KSCA 421PA 3UWOA 1W49A 3QENA 1VPLA 4JT2A 3VQTA 4HB0A 4FW9A 2GKSA 5EXTA 5FBRB 2WWGA 4S35A 3DPUA 2HJVA 2NO9A 3ADBA 2PJZA 4R98A 1GNQA 4HSEA 1XP8A 4G5SA 1UPTA 5KNDA 3A1TA 3TSWA 2NZ8A 1OHHA 3BFXA 2J59A 3ZD6A 1KO4A 4TL6A 2PEYA 3ZQ6A 1IN6A 4EQ6A 3THWB 4AIIA 5DIFA 1MR3F 2A3RA 2HCBA 5D3MA 3T1TA 3GFTA 4QC2A 2Q9AA 4X8MA 4URYR 1FQJA 5JCZA 2QENA 4PHTA 2WTUA 2QN6A 1QHIA 2VPPA 4XWAA 4V02A 4ITRC 4CYMA 1G19A 2BCJQ 1SHZA 1O87A 3IPXA 1VYTA 2PZFA 4JLJA 1P62B 5J4YA 1NMYA 4R2IA 3VKWA 1NP6A 2CK3D 2QSYA 1IN4A 2HJGA 2W6JA 4M1TA 3ICEA 1PJRA 1FTNA 1CR1A 2NQ2C 4Q4LA 4B71A 4XOIA 1IY1A 3TUIC 1RPZA 4C2UA 3NXSA 5KSYA 2ZPTX 4MGIR 3LAWA 4S2EA 3ZLJA 3EZ2A 4FIDA 3CW2A 2PZGA 1TTTA 4DT1A 4BPBA 1HT2E 4P32A 1KDRA 3B5JA 4MRRA 4IEEA 2EFGA 1P7CA 3F5FA 5UKDA 4YMUA 4OQXA 2QUZA 4B6EA 2O8FA 3GJ5A 2REOA 3FGNA 3W6NA 3BFVA 5ANRB 2P5TB 1E1QD 1T6NA 2V3CC 3TK1A 5JI3E 1G4UR 4JBWA 1X8LA 4M9ZA 5JMTA 2QMEA 4WW0A 3CF6R 2UZ3A 2A2ZA 3RNLA 2IHBA 4M53A 1E69A 2CLSA 4K8OA 2R6CA 3CKLA 1CXZA 2IYWA 2SHKA 3K0FA 2GK6A 4TL9A 2GEVA 4WBSA 2BBWA 1Q0UA 1FX0A 5FTNA 4B48A 2JLYA 3BBPA 4JT4A 1TU3A 2PCJA 3THXB 3AP1A 1NN0A 4OQMA 4TQ9A 2ATXA 3PEWA 1E32A 4UNRA 2QAGA 4B2LA 4PZLA 4EAQA 1Z83A 1CBUA 2WPDD 3DZ8A 1TF5A 4HI0E 1P2VA 5EE5B 4OYHA 4DLYA 3Q7QA 1RRGA 1GP2A 4I81A 3VNUA 2REBA 2QI9C 1VYVA 4MRSA 3THWA 4Q4HB 4BEJA 1XTJA 3LW7A 1QVRA 1H8ED 1Z6YA 1OB2A 1SVKA 2ZS9A 2PX3A 5EXPA 4XJXA 4DLWA 2QZ4A 2QT1A 4AKGA 4ARZB 3ZVNA 4F93B 4UXJA 5KPJA 1WBBA 3VR6A 4XH9B 3U44B 1UDWA 1GZSA 3L82B 4GNKA 4GBMA 5JJLA 3DKVA 2FH5B 3MGCA 4PQRA 3KDSE 1OIXA 3JVUA 4Q9LA 2NTYC 1AKEA 1EXMA 2RMKA 4JSTA 3QPUA 5EZ5A 4YXWD 1ZYUA 2WKQA 3VHXA 5EE1A 2VHCA 1Q3HA 2QPOA 3BH0A 1AJEA 4DCSA 5FOTA 1W36D 4ZDKA 5JI2E 2YWEA 4W5WA 1DELA 221PA 5HKKD 1QHXA 1MKYA 2QQ0A 4CVNA 3SBEA 1RRFA 1NLFA 1E2PA 2C78A 5H8WA 2GXAA 4J0QA 2ZE7A 3U2QA 4YXWA 4LJ5A 1E2MA 1SKQA 2DWQA 3AGPA 3G82C 1VG9B 1XWIA 4B43A 2JLZA 2BKEA 3W5IA 4FXPA 3GLGE 1RRPA 1D9XA 4Q4JA 5G3YA 2B7BA 4GFDA 3TR5A 1P2TA 3Q5DA 4TLBA 2IS2A 5C4GB 1GFIA 1WF3A 2GETA 2Z6VA 2ZI4A 4UNSA 3SYKA 5TMPA 4F4IA 1JXOA 4PO8A 2HYDA 1B0UA 2ZANA 4DUGD 1E1QA 2VLIA 4LJ4A 2R6DA 1E0AA 4GI7A 3QG5A 3W6PA 3TBKA 2C04A 2D4HA 2ZI3A 1AQUA 2ZI7A 4A0GA 2ZREA 1Z63A 4F92B 2VHJA 1XPRA 4KI0A 1N0WA 5SZJA 2ORWA 1E1RA 3PUZA 3TJZA 2IC5A 2JLWA 3SS8A 1U81A 3AUXA 1LVGA 4IRUB 4CRWB 5AUOB 4EUNA 5CB8A 2ZRBA 4A92A 2ZYWX 1NN5A 5JJIA 1JI0A 2ODNA 2CMKA 4JL6A 4A6XA 3I8SA 4DZZA 5KU1A 2IYTA 4IVRA 4BLSA 4LJYA 2AR7A 3FMOB 1KI3A 3TQCA 2DYKA 3LLMA 1GVNB 1T5LA 2AXPA 2WKRA 2OBNA 3TMKA 1N6PA 2JLXA 1T3LA 4TMZA 1OH7A 2J45A 2JJ1D 4WVFA 4Z8YA 4CEHB 3K09A 4KXFB 2EU8A 3ZVMA 3REFA 1W36C 3ZVLA 4U5XA 2FNAA 3CRRA 3FFBA 1XTQA 1RVDA 3RRMA 4LBVA 1K5GA 3TE6A 4HUQB 4RCYA 1KI4A 4P4TA 3QBVA 1G3RA 5FPSA 1OV4A 3WNCA 2GRJA 2O0HA 1P72A 4OJKA 3KKPA 3VR3A 1OKKD 5CM9C 3CM0A 3CNLA 4BUJA 1G17A 3G5UA 5BWMA 1N6HA 3TSZA 2XNDA 3UMRA 3SYNA 2ZSFA 1GNPA 4FD2A 5TB5A 1WRBA 2EFEB 3LQQA 1EFHA 3SU8A 3H84A 4MRVA 2OAQ1 2ONJA 5J4HA 1UKVY 2NOAA 4NTZA 3UIEA 4JLBA 1OH6A 1G20E 2WBLC 4LJ9A 1ZNWA 3PUVA 4M4SA 5FUWA 3AVTA 2ZRNA 1NLYA 3O8DA 4DLVA 4MGKR 4D82A 4EPWA 2YKGA 2WAYA 2XOKA 3PG5A 1E2FA 3S1AA 2IXEA 3L0OA 5G41A 2CL7X 1KI9A 5EUQB 2QQEA 1EG7A 3WMGA 521PA 4TQUS 2CVFA 4QBHA 4NCHA 3BB4A 2P3SA 5DSZA 4DC9A 5DHFA 5AUNB 3NC0C 4HZUB 3M0EA 1KDTA 3KXIA 3KTAA 1SVWA 1G7CA 1EFTA 1G8PA 2AWOA 4D26A 4CIDA 4C30A 5AK0A 3I5XA 5IHPA 4ASUD 4C9BA 4HB3A 3T61A 3J81k 3AB3A 1TQ4A 1WBDA 2A5YB 3BC1A 1KIMA 3HPRA 4LJ8A 2RGCA 2W0MA 1DBSA 5JWRA 1K5DA 3KQKA 4P33A 5DLQC 4YLGA 4TLDA 5KHOC 3BXZA 4OQLA 3D8BA 2GTPA 2R6FA 2EQBA 3HP1A 2ZRMA 1U2RA 2CL6X 4PQFA 3KQUA 1ZJ6A 1IHUA 1SXJE 4O2RA 4M22A 1CP2A 3NEJA 2R62A 3NBZC 3QI2A 2JA1A 4V0OA 1AIPA 1GKUB 1SKYB 3P1JA 4FCVA 1NIJA 2ZQ5A 4CEIA 4V0MA 3AH8A 5J5CA 3U7HB 1GIAA 2O0KA 1TU4A 4A4DA 4HATA 1UF9A 1G21E 3K9NA 3TIFA 4G3XA 2VP4A 1TF7A 2VHUA 3ADDA 4DLRA 2GAAA 3O8BA 5H68A 2P6NA 3GD7A 1HTWA 5GVSA 1IXZA 4CGZA 2F9LA 3CUEF 2E87A 1DAGA 2JJ2D 1LNZA 2AK3A 3FYHA 2WPDA 1IAQA 1LS1A 1N25A 3OIUA 4GOJA 4FINA 4HAZA 4DJTA 1E2GA 3B9PA 3SBDA 1XTRA 2VA8A 3UMFA 2A7QA 2J7KA 2JLQA 5IT5A 4RZUA 3MCAA 3WXMA 2G77B 2G83A 4KV9A 4QHTA 3PUXA 3CPJB 3MSXA 3NTUA 1P2SA 1JPJA 1NVXQ 4WXRA 2YOHA 4OHVA 1FNMA 4U7DA 1ZD9A 3SFZA 2DWOA 1KO7A 2ZUBA 4PZZA 3EXAA 4NCIA 2QM8A 4TYPA 1S1MA 1XJQA 2GCOB 4MUBA 3THXA 4DT1B 2B21A 3BB1A 3MUFA 4RZ2A 1Q57A 2XAUA 4TTQA 4XTRA 3I72A 2DB3A 4B3XA 4RD3A 5BN3A 1KYIA 5FH9A 4AURA 4KVGA 3L0IB 2D74A 2D7DA 2JATA 2WJHA 3P32A 4RKEA 1OYYA 2H7VA 4TWZA 1N6OA 2BEKA 2OLJA 4IDNA 3WY9A 4Q5IA 3B6EA 4BFTA 2FV8A 1WXQA 2F3RA 4F4JA 4PPFA 3L43A 4DDUA 1QBKC 1XEWX 5KSPA 3GP8A 1E6CA 1R2QA 2PMKA 2A5JA 1E2KA 4HDOB 4D25A 3LW8A 2O8EB 3ETLA 1J99A 2BCGY 4EQ6B 1IN7A 4UXHA 3UMSA 1UEIA 2XXAB 1JPNA 2VH5R 3ZS9A 4TTPA 4F38A 1Z08A 1R0XA 3EIQA 4I99A 2RHMA 2IEZA 1ODFA 2ZU0C 1OH8A 1OFUX 3X2SA 1OXXK 2RGEA 4E09A 2AHOA 1Q1QA 2QP3A 2FFHA 3EA5A 2YC4C 2ZJOA 1RIFA 1M7BA 2YC2C 4BFZA 1GKYA 3QEOA 3CRMA 2IF0A 4Q19A 4NH0A 5FBQB 3IO3A 2GZAA 3E5HA 3NBXX 3QE0A 1XTSA 5LDDC 4US0R 4D0GA 1HA3A 1U9IC 3R8FA 3Q9LA 2HXYA 2G0TA 1ZP6A 4M1WA 1P4SA 1XCMA 4HZUA 2Q3HA 4LGMA 1E2QA 5DGXA 4JLVA 2IYSA 4XTCS 2AXNA 1D5CA 4POAA 4JJZA 3I92A 3RDPA 3NKVA 2ZRLA 4EPTA 2JLUA 1XD2B 2EVWX 3MWLA 3H2YA 2IA5A 3AEZA 3LLUA 3CH4B 1DAMA 4M9XA 2KI5A 5DI9A 4NDZA 2V9PA 2FFBA 4RZ3A 1FOEB 2DBYA 5K8UA 3HU1A 3SHWA 3CNNA 5L3QB 1SVLA 2X8AA 3W3AA 3QNUA 4JS0A 3NBYC 2WJGA 1Z22A 2OUKA 2ZM5A 1G3QA 1CR2A 4V0ME 5EP4A 2MSCB 4HUTA 1GOTA 2ZAMA 4YQFA 2ZAOA 2DPXA 4C0LA 3R9WA 1CJMA 3MWYW 5L3SB 2MSEB 1BO6A 1EX7A 1CJKC 3SJZA 3BJIC 1EFUA 4RD6A 2ZRJA 3FVQA 2C9CA 4XD7A 3GFPA 3Q8XB 2Z4RA 3EWAA 3FPAA 1CKEA 1DG1G 5EE3A 2GCPA 3CWZA 3RABA 1TUIA 1E9EA 1XJ0A 3R8CA 3FHCB 5HCIA 1R10A 4BE7B 3KKOA 2Z4SA 1W0KA 4D4JA 1NNEA 2VO1A 4KO8A 3IQXA 2QA5A 4NCKA 1SVOA 1XPUA 4TMXA 3NC1C 2YHSA 1YR6A 2R8RA 4NYIR 5IF9A 4B44A 3E1SA 3IBYA 3IIKA 4B6FA 2RGDA 3TKLA 1EX6A 4ESHA 3UKDA 2H5EA 2Z0MA 5HPYB 1OH5A 3ZDQA 3C16C 1U90A 1W44A 2OXRA 3AUYA 4URVR 3LO5A 3I62A 1IJFA 2JIZD 4LPKA 2QL6A 2FDCA 3U7FB 2QP9X 1R6BX 2YWGA 2X2FA 2PLRA 721PA 2HYIC 2ZSAA 3EWSA 5D3QA 1NY6A 2F1HA 2BJVA 2WJJA 1RW4A 1S9DA 1US8B 3A4LA 5E7JA 1RC8A 2JIZA 1VKJA 1S4QA 2F1JA 4JYCA 4Q1FA 1CU1A 2DFNA 4A2PA 4WXPA 5GVRA 3AVYA 1GL7A 4IFBA 4L9SA 1RJ9B 3IEVA 3T1VA 1XTIA 3DMDA 2O52A 1R4AA 4ZCMA 3SEAA 1EWRA 1MABA 4X8LA 5BXQC 1B23P 1XEWY 4Q4JB 4QGFA 5JRZA 2DWPA 5FFMA 2ZJAA 4QM6A 5G53C 1G18A 4AG5A 1XCGB 2BV3A 2CNWD 5CIWA 3TW4A 3K0SA 1KJYA 2CE2X 4Y0AA 2GJKA 3TW8B 1GDDA 3K9GA 2B8WA 1OHHD 1YZNA 4G01B 1Z0JA 2FN4A 5DYIA 2F6RA 4HLDA 1MOZA 2L0XA 4B3FX 4LJ7A 3LVRE 2QY9A 1MO3A 3T34A 4FMCF 3SZRA 1NMZA 2CNWA 2FA9A 5BN4A 1Z6AA 4IW3B 2Q21A 4FMDF 4PSKA 4ZDIA 1AS3A 3EZFA 4M0LA 2C99A 5ELXA 4E22A 2KSQA 2ODEA 1L8QA 4FCWA 3ZD7A 2VTKA 4Q4AB 5LB4A 1J8MF 1DG3A 4ABYA 1Z0KA 3EG5A 2UZIR 5L3RA 4B2IA 4IKEA 1TPZA 2H92A 3JVVA 2FX3A 3U44A 1T8TA 3EIHA 1P5ZB 4A2WA 3ZZUA 4TZ6A 3TH5A 4DB2A 4OJQA 3AVQA 3LBNA 3TUZC 1E4VA 1HY3A 1G64A 1ZUNB 3K0AB 3TGPA 2B6HA 1UFQA 2CLCX 2R9VA 1JJVA 2O8EA 4DSTA 4B73A 1E96A 1Q21A 1E9BA 2PH1A 1PUIA 4X8OA 1UBGA 2ZS8A 2PJRA 1XDBA 3IO5A 2OESA 5GJVC 1YU9A 2AWNA 4MKHA 1S0UA 4EDHA 2R2AA 4OI1A 2OEPA 2XZOA 2GWHA 3NHAA 4BFUA 4TQAA 2LKDA 1FX0B 4DWJA 1J2JA 4KLNA 4ACAA 4AYXA 3EPHA 1U0HC 2OCYC 4A2QA 4OHWA 4BRUA 4MKIA 1KZGB 1D2EA 1G1MA 2IS4A 3BB3A 3TAUA 1E2DA 1VHTA 1PLKA 5EE9A 4I1VA 2GZDA 4HYYA 3PEYA 1Q22A 2ZVQX 3QJYA 4GMDA 4I1OA 3CBQA 3R9IA 1KK0A 1EFCA 2WIAA 4GP7A 4QXAA 4Q9IA 4F91B 4AK9A 2EWWA 2WAXA 5GJBA 1KSJA 3WBKA 3CX7A 1XTKA 1KAGA 2YOGA 1G5TA 4AI6A 3WRXC 3SN6A 4BRWA 2J0QA 2ZEJA 2Z83A 1II0A 1U99A 2ZRCA 4US1R 5SZIA 3QQ5A 3QXJA 4LCBA 1XBTA 2ATVA 5KSOA 3KB1A 3OEHA 4G5QA 4NL4H 3VHLB 1W0JA 1G6OA 1HUQA 1JR3E 2YJTD 5DH9A 4XWOA 1XEFA 1MO5A 5A0FA 5J4VA 3F8TA 3QKTA 2ORVA 4BLOA 4KYUA 2WWYA 4UQOA 4PHFA 5FR1A 4LUCA 1XF9A 3VNVA 3B9QA 3LXRA 3O47A 1KNXA 5JZVA 3BWDD 4NYMR 2AKYA 3OEHD 4IOKA 3RS0A 4BZQA 4A0FA 1AS0A 4OI0A 3QKRA 4P3YA 2ZU6A 4CEIB 2OFOA 2W2XA 2RKOA 4YMWA 2UVQA 1OFHA 3GEHA 4HAYA 4L5BA 2EFDB 4M1YA 3MD0A 1UAAA 4BECA 4M21A 1S3SA 1P3JA 2BBOA 5KUTA 2W83A 3A1VA 5EP2A 2MSDB 4CZ2A 3WYFA 4PFSA 2OHFA 3BK7A 3IIMA 2ZJ2A 2ZRFA 1R0WA 1TUEA 3C8UA 3QXCA 4R71A 3DEFA 4W9MC 2Q9CA 4DIEA 4DCTA 4OK5A 1GUAA 3H4MA 4NYJR 2C98A 1XMIA 2HF8A 2JASA 2YYZA 3LWNA 4JJKA 1ZMXA 1NJFA 2BMDA 2YV5A 2OBLA 2F3TA 3BFKA 4FI3C 3EW9A 4WIAA 4DLUA 1KY2A 1S9HA 2ZR7A 1LF0A 4ZCLA 5FBVB 3GPLA 1FW6A 2H17A 4TSFA 1CRPA 3E2IA 1D2MA 2I1QA 3FKSA 1I4TD 5FPYA 1GRNA 1KZ7B 4HAXA 4OI4A 1HE1C 5DI3B 4EJSA 3EIEA 4TL7A 5EP3A 3FTQA 5FL3A 2P2LA 2KJQA 5K8LA 3NH9A 5EE0A 1AS2A 4EPVA 1ZUHA 4M1KA 2IF2A 2WSSD 4TSFD 5AJVB 5C2JB 1M1YE 1RRCA 4Q00A 4Q7KA 2CVHA 1OF1A 3OE7D 2WKPA 3KJGA 4NE2A 4A1FA 2AL7A 1AKYA 1N3BA 4IDPA 3QF4B 1XB2A 4AC9A 4URXR 1IXRC 4AG6A 4HAVA 2GXUA 5BYKA 4OI2A 2D06A 3O8RA 2PX0A 1KHTA 1UDXA 1XEXA 1Z29A 1YR9A 2OZEA 4GRAA 1J70A 3K0CA 3TLXA 2DCUA 1E4YA 1SGWA 1YJ5A 3KB2A 4AYTA 2X19A 2Z5FA 1I4DD 4LYHA 1JQLB 3SNHA 4DIDA 1W0JD 4QBFA 5FOWA 4HLUC 2XB2A 4A0RA 3LX8A 3ASYA 3CX8A 1BYUA 4GMXA 4HUQA 1VG0B 1W48A 2BVNA 2GZHA 3ZIAA 4BASA 1DO2A 3MG9A 2XNDD 1M6NA 3WNDA 3QXXA 3W8NA 5JSZB 5CLLA 2OV2A 1BMFD 4Q7MB 6Q21A 2FEOA 4TLCA 3IDQA 4LHVA 3BS4A 4PC7A 1OXTA 5BQ5A 1P61B 1KSFX 1VCOA 1Z5ZA 2GVZC 4HAUA 3I73A 2VF7A 4ZI2A 1VG8A 1DVRA 2V7QA 4DXAA 3N70A 4IOMA 3NEYA 3VR2A 3DVLA 1XX6A 2AD1A 4LRWA 621PA 1CTQA 2O8BA 1T0JB 3WP1B 1ZCAA 1W5TA 2C2HA 3CNOA 2QSZA 1UADA 3VR5A 4B32A 3OAAA 1K8RA 1NSTA 3R7WA 2QMHA 3TAHA 1BH2A 5E4FA 1JAHA 1KI1A 3EPLA 1W4RA 3A58B 1DPFA 3ZZ0A 1ETUA 2OFWA 3KL4A 5AJYA 3PXGA 3U60B 3UANA 2RCNA 1XRJA 5JS7A 2VYFA 1EFRD 2Q3MA 3IIJA 4YDHB 4EPYA 1XPOA 4XSHA 2VHTA 1W7AA 2VSXA 1W4CA 3L8ZA 5LPNA 5HTKA 1IBRA 1P9NA 1CJVC 1II8A 4Q21A 3GJ8A 1L4YA 2FEMA 2IBMA 4PC2A 1QDEA 1KMHB 1EFRA 1E99A 4LV8B 4Q66C 1ZM2A 4M1MA 1GG2A 3FWYA 5JWHA 1YR8A 2XZPA 2VP2A 1O3YA 4A8JC 3K53A 1ONBA 1G9XA 3EZ7A 1Q1ZA 4MRPA 2GF0A 1TQDA 1E9FA 3TR0A 4EPRA 5CB6A 4BGDA 4MDFA 4ZO4A 4KODA 1D2NA 1S3GA 4URZR 4DDWA 5FPKA 1F2TA 3Q7PA 1G8HA 3GLFE 1QF9A 2OXCA 1NBME 2ERYA 3GQBA 1NG1A 2FJUA 4LJAA 1X1SA 2JEOA 1KJZA 4PAMA 2W6IA 4G0NA 4NZYA 1VECA 2FFQA 1FNNA 1EWQA 2J3EA 3NIBA 2XJ9A 3K1JA 1UBFA 2FSFA 1N6NA 3T35A 3ZIAD 1FTSA 3CONA 1R0YA 1ZBDA 2QROA 2XX3A 4QGHA 3RC3A 1E9SA 4AKHA 3QKSA 3Q85A 2BBSA 2H1LA 4JKYA 5CK4A 3RAPR 5JHGB 4JLKA 4RFSA 4M9SA 2FE4A 3DL0A 1D8TA 1R5NA 3OHMA 3C7KA 5F98A 5FOSA 4NPHA 2AKAB 3GLIB 1X8KA 2J0UA 4QNRA 3SOPA 3V00A 4IDQA 1Z0IA 2VRWA 1BKDR 2GVDC 4WA7A 5FR2A 4B35A 5EP1A 2G88A 3RLFA 4AD8A 1GRRA 3CZQA 2HEIA 1G3MA 2NPFA 3LFUA 4BEBA 1SQ5A 2IYYA 4LV5B 2OAP1 4QG7A 4KFTA 4JLOA 3EAQA 4V03A 3X1WA 5CLQA 1ZD8A 3LXXA 1UKZA 4HAWA 1Z06A 4NHOA 1YE8A 3GJ3A 4ESVA 4JLMA 1G7SA 1ZVQA 1V5WA 4N0EA 1WA5A 2WWFA 4JZKA 4WZ6A 4JVMA 5FI1B 3AV0B 2OFXA 2ZYVX 4DUGA 2B92A 3FMIA 2EWVA 2ORIA 2DFKB 4QJ4A 1PLJA 4P4SA 1DS6A 5CK5A 3NH6A 4LJ6A 3A4MA 5AJZA 2O8FB 3ZVRA 1U0JA 1N0UA 2VP0A 3GLGA 1KKLA 4Q1BA 3AVWA 2XEXA 2V1XA 3BE4A 1Z6TA 2ZE5A 3CRVA 4MA4A 1R8SA 3LD9A 1OE0A 1P73A 3OE7A 1NG9A 1GKIA 2NG1A 3PVSA 4IHQA 2GJ8A 2V55B 2PLFA 2VQSA 2ZUCA 3HU2A 5CJ2A 3HYTA 1FMJA 4DLXA 2RGNC 1I2MA 4ERNA 1SVIA 2XNSA 3ONWA 2JGNA 4JLNA 3VU9B 2G1JA 3L2OB 5L3VA 4KCGA 1N2CE 3TVTA 3WNBA 4XSGA 1QRAA 1A2KC 3B1VA 1H8HD 4B33A 4TMTA 3X1DA 1X8JA 4MGYR 1RKBA 2ZETA 1HYQA 1ZU4A 2EFCB 3DZDA 3KUDA 4GPTA 4BLPA 2WWWA 1YZGA 4N1AA 4TT3A 4W5HA 2O8BB 4LBWA 1FMLA 3ADCA 2P6UA 4JKIA 2W6JD 1U0LA 2WHXA 2IXGA 4X8HA 1ESMA 1IY0A 3IEUA 2GXQA 4NMMA 4DSUA 2ZRDA 2Q9BA 1HV8A 1E9AA 2WV9A 1FUKA 4D6PA 4BWYA 2OCAA 3OEED 3KFVA 1Z2AA 2BEJA 3UATA 4B3DA 2Q6TA 2A5FA 3LRPA 3MFYA 1GWNA 4AWXA 4B3CA 3W90A 4DEXA 4GZMA 1G8YA 1NF3A 3EZ6A 4C7OB 5JBQA 2P6RA 4M8NE 1KNQA 1TADA 4YC7A 2A78A 2JJ2A 4M1OA 3SC3A 2QBYA 1G16A 1GSIA 2CJWB 3CPEA 5J4KA 1Q1BA 3HWSA 4WAUA 2ZJ8A 1JEDA 3VAAA 1GILA 4BFXA 1JR3A 1TF2A 4ZDJA 3CO5A 4BFYA 1XZPA 2XSZA 1ZNXA 4JL5A 3I3SR 3GLIE 4CEJA 1NIPA 3QXHA 4QM7A 3AF1A 1HH4A 2QPAA 1A7JA 1GITA 4MKFA 4TYQA 4DCUA 5M04A 2RGAA 4RD1A 3RRYA 1HQCA 5HCNA 4FN5A 1NRJB 3EZ9A 3Q72A 4LYJA 2ZSDA 2BBTA 2YNMA 4IFEA 4IDOA 4JLPA 2PEZA 2GHIA 1N5JA 2IEYA 3P20A 2D3WA 2YZ2A 4DSNA 1ZINA 4ILEA 1VYUA 4Z51A 1NN3A 3VR1A 4MDEA 4QJ3A 3MMPA 1F2UA 2B7CA 1JAIA 4PHHA 1IN8A 4KBGA 4ZCIA 4KITB 2W58A 2WIBA 2WSMA 1RFLA 4LDJA 3OAAD 4O0MA 2VP5A 3LDAA 4MGZR 3HJNA 5G3ZA 1AQYA 2ZROA 1DAEA 4CEJB 1ZNZA 1NY5A 3Q5EA 1KI6A 1CLUA 2K5UA 4PAQA 2CCGA 3RS5A 3OF5A 1KO5A 2CHQA 3AVPA 3AKEA 3QF7A 4QFMA 2FU5C 1SXJA 3SJAA 2OILA 1NKTA 1E2LA 4CDGA 1E79A 2D2FA 2QBYB 4XVRA 4A6PA 4C0QC 1BMFA 5GJCA 4RVCA 3I61A 2NO6A 4C7OA 2QE7D 3LA6A 4C2TA 4ZIRA 1Z0FA 1KI8A 1NBMA 3OFNA 4QJ5A 2ZR0A 5DYGA 1T0HB 2PL3A 1XMVA 3UPUA 2EYQA 2Z43A 4LSGA 4FWTA 1D6JA 4A8JB 1KKMA 2AD5A 2C95A 1M74A 3BOSA 4F7WA 4JVNA 1E79D 4HB4A 2ZJ5A 2ZE6A 2P67A 5HE9A 3AVUA 3U3OA 3QKRB 1U8YA 1G5PA 2PZEA 5JJKA 3T1OA 2WJYA 4BFVA 5JEDA 4KYIB 2IHYA 2FSIA 3KKNA 4WOPA 1T5IA 4IOLA 1T8UA 1X3SA 5FUXA 2EW1A 3EPKA 4NKRA 2IUSA 5SZKB 3CZPA 2XOKD 3AKCA 1E3MA 2F1RA 2W6ID 3B7GA 2O8CB 4TN1A 1XXHA 5CDFA 3BD9A 3MJRA 4L4UA 2X1VA 4PPQA 4Q01A 3U4QB 5AR1A 3QIAA 4NBSA 1QHHA 4XD7D 2G9NA 2FPMA 1J8YF 4YDSA 1R7RA 2YINC 3DMNA 3PUWA 1N5IA 1U98A 4MYUA 4XIGS 3ICQB 1X6VA 4DSOA 4QL3A 3SQWA 2DFTA 5KDDA 3UWKA 5IRCD 4H1VA 1Q44A 2QP4A 1PVOA 3GLHA 1D9ZA 1M8PA 4Z54A 1IN5A 4JIMA 1ZM9A 4IXNA 3M4YA 1WB9A 1G6HA 1R0ZA 3TVDA 4CF7A 1JECA 1YZLA 4LYFA 1OSNA 4Q47A 3U6KA 1VCNA 1DARA 2CXXA 2IUTA 4D81A 2VF8A 4MYTA 2IYRA 3I8XA 3B1ZA 3QKSB 2QAGC 3AKYA 3U3JA 2IWHA 1ELOA 4LC1A 3GJ4A 2QTHA 2LWIA 1E0JA 2PT7A 2ZRHA 3ZH9B 5J47A 3X1ZA 1EK0A 1OFTA 2QGNA 2NZJA 4PXAA 5KPDA 3D7MA 5FUVA 2OE2A 4GP6A 2D7CA 3FKQA 4M1SA 3QOFA 3A1UA 2F43A 4GZLA 3ND9A 4UXIA 2J46A 4LI0A 1IQPA 3ZS8A 1V43A 4DEYA 3TSOA 3RWOA 1ZM3A 1E9RA 3ZYCA 2FGKA 4MQBA 4H1UA 3T5DA 2J0UB 3GMTA 3GLIA 2QRZA 2DFLA 2WZQA 3PFIA 2IT1A 3SI7A 1OIVA 2IYLD 4FMDB 4LK2A 3SFVA 2WJIA 3K0AA 1S2MA 4BFWA 1KI2A 1QHYA 1W4AA 3B2EA 3P27A 3UXMA 3OESA 2QE7A 2GCNA 1FL9A 1LV7A 1MRNA 3FE2A 2D62A 2DR3A 1NI3A 4KBFA 4PZYA 2ZSBA 5JWOA 3ADKA 1VIYA 2C03A 2GNOA 1LB1B 1AZSC 2GEDA 4ON9A 1ZM7A 2FPLA 4UNPA 1YZUA 1IJEA 3IPYA 1QG4A 2ERXA 4MRNA 3P4XA 1G3IA 4IDHA 4ZKEA 4CT5A 4OQFA 1JJ7A 4E07A 3EASA 1Z2CA 4Q7LA 5HE8A 2FF7A 1LW7A 1Q3TA 2F43B 3TRFA 1KAOA 1KMQA 1YQTA 3IHWA 5L8VA 3QSYA 1G8FA 4XVUA 3I5YA 4DHEA 3B82A 5KDOA 5FTJA 3K70D 5KSZA 3RS4A 5FOXA 3WP0A 1VIAA 1XXHB 2OLKA 4NYMQ 4ZPXA 1KO8A 1DAHA 5F9FA 1W2HA 4Z1MD 5JEEA 3GCGA 1GL6A 3RRNA 3S1AB 3OEEA 2E9SA 4PR0A 1KDPA 4F4CA 3FMFA 2N42A 1ANKA 1CR4A 4OQNA 5JFGA 2V6IA 4OKSA 3C4JA 3N2EA 4PO9A 2JLRA 4D80A 1G291 2AK2A 3VMFA 2IYXA 2FZLA 3IQWA 3GLHB 4JMPA 2KE5A 1RJ9A 1XMSA 1W5SA 2GAOA 5FL7D 4FMBB 2IUUA 4B76A 3B78A 2HLDA 2BMJA 4KFUA 5GJWC 3L8YA 3F0TA 2BMEA 3HR7A 4RD2A 1KDOA 1OT3A 2UKDA 5FI0B 2J7PA 3U4QA 2ZI6A 1KK1A 4I1SA 1AK2A 4ZIRB 3THOA 2CDNA 2J5XA 4G5RA 2N46A 1M2OB 5DNYB 3R7WB 3RC8A 3K9HA 3B8HA 1HQYE 2IYQA 1Z28A 1MO6A 3EC1A 1T3HA 1LY1A 2ANBA 4RFVA 3X1XA 1GTVA 5H70A 3HPQA 2YOFA 4UNQA 3ZJYA 4CEHA 2OG2A 5FPHA 8OHMA 2HT6A 5CIQA 1IXSB 3PENA 4D0LB 3B60A 4LHYA 1T91A 4LOAA 3GEEA 4C0JA 4G1UC 4HEJA 3EX7C 1M7HA 3MWJA 3T1QA 3N2IA 5KNCA 1BYIA 1DAKA 1YKSA 3W6OA 2JJ1A 3KXLA 3MJHA 1G7TA 4NONA 3AKDA 1G8GA 3BH6A 4DLZA 2WWHA 5BYJA 4JLAA 1VMAA 1OYWA 4MITA 5G40A 3WHLA 4AKIA 1P60A 2BOVA 4RKFA 1N6IA 4PPNA 3C5CA 4RCZA 1UKEA 2V4ZA 4IVPA 3BORA 2OO7A 1TQ6A 2NO0A 1TEXA 1OKKA 1ZRHA 3O8CA 1W46A 3KUCA 1KSGA 2CBZA 3R20A 1E2IA 2ANCA 3VKGA 1ZW6A 1ZD1A 4D2IA 1AGRA 1CR0A 1XMJA 4GT1A 5DN6A 4EIWA 3NHBA 1XD9A 3RWMB 2J87A 4Z8XA 4E5UA 4DB4A 2ZYUX 4LBYA 4PTLA 1FP6A 2A5GA 2R44A 2IS1A 1XXHE 5CDFE 2ZRPA 1XD8A 3K70B 1DOAA 1PUJA 5IK2A 2GILA 3QBTA 3VTKA 4TMVA 2ASEA 1XZQA 2CJWA 5F2EA 4UKDA 1F5NA 4DLSA 1CULC 2ZYTX 4V0NA 3OIYA 4LX0A 3FFAA 1J90A 1KK3A 1E2JA 4EJSB 4OK6A 2XSZD 1AZTA 2GK7A 4Q7JB 2V1UA 2ZRIA 2IW3A 4JLDA 3TUJC 1BIFA 1DEKA 3HU3A 1N5LA 2A9KA 1N0VC 2CCKA 4TLEA 5KTYA 3IUYA 3KJEA 3CRQA 5TDHA 4Q18A 4R7ZA 2C9OA 4MYHA 3A36A 3GLHE 1FPMA 4Q1AA 5E7IA 5P21A 3VX4A 1YHNA 2MMGA 1COWD 2HXSA 3KJIA 2IXFA 2XJ4A 3PIRA 1FZQA 4FMCB 3DOFA 1WQ1R 2GEUA 3LX5A 2ODWA 3WYAA 3FKSD 1G41A 3E70C 1U9IA 4O2LA 5CITA 1PV4A 2RH5A 1Z07A 1NBMD 2WM9B 4B34A 4ARZA 1Z6XA 5AJWA 2CCJA 3AVOA 4PPGA 5CYPA 4BLRA 5B64A 2LCFA 5KNBA 1RZ3A 4PC6A 4PO1A 3B1WA 4DCNA 2WMNB 4FWIB 3V4RA 1NVUQ 2HV8A 3REGA 2KB0A 4Q4HA 4C0SA 2QORA 2OCPA 4IXMA 1UM8A 1L7VC 3K9LA 3VR4A 3PV0A 1VCMA 3CR7A 1JB1A 5B58C 5JHHB 2YWHA 2GBLC 3U3MA 5HKKA 2NGRA 3I1FA 1KOFA 3BH7A 2G6BA 4JBYA 1IONA 1CF4A 5J4LA 4DVGA 2RGGA 1MH1A 1ZUIA 2GA8A 4LHXA 3NG1A 1F3OA 5DO9A 2GJ9A 1VCIA 2JLVA 1VHLA 2F55A 1NVVQ 5EUMA 3VU9A 5IDVA 5CYOA 3PUYA 3AF0A 1TMKA 3B1YA 4UJ5A 1E94E 2X77A 1R5BA 3FHOA 3NWJA 1P2UA 4Q1EA 3W3ZB 2BM0A 2H16A 4NCNA 2NO7A 2WSSA 1EGAA 2O8DA 3RRZA 3ECCA 1G3UA 3UG7A
chains in the Genus database with same CATH superfamily
4MVJH 1F8UA 1IVNA 2F2TA 3LBAA 3MRSA 4ZYUA 5IFKA 2VDOB 2R7NA 2O7NA 2OCKA 2G9VA 3GLGB 3V42A 4YQZA 4XGKA 4X91A 2CC2A 3KKMA 5CVJA 4DCVA 1M6WA 3FETA 2PD3A 4UTNA 2D8MA 1NBEA 2YZNA 3L0BA 2BIFA 4BY9E 2WOOA 1JNXX 4CKWA 3HVRA 1GPJA 1L7AA 3ENQA 1ZUNA 3RC9A 4L5CA 3ZQJA 2F67A 1JILA 1KY3A 1JQJC 2OY0A 2Q99A 1PQ4A 5E9WA 1WE2A 4EENA 3A6EA 3U5ZB 2RGXA 5J2UB 2WG0A 4UEKA 5BW6B 2XZTA 3H75A 5D8DA 1NUSA 2DFVA 5BN1A 4KOEC 4RA9A 2O7VA 1M6HA 2RDMA 5HCUA 1J0DA 1VJ1A 4QWWA 3DLPX 1X38A 1SULA 2IHZA 4LXHA 1KEUA 2IP2A 5I3CA 1TO1E 2VSFA 4LHZA 1H9CA 1Z6GA 4ZCQA 3RU7A 4PR3A 1KRXA 1ZH0A 1PEDA 2C1EA 3EVCA 2R00A 3R2JA 3VC2A 2DQZA 3EC7A 1P17A 2VA9A 3OZEA 3PHCA 4UZFA 3QY0A 3ZZTA 4CMHA 5K5EA 2FN7A 3V9PA 4ARBA 5HF6A 4D8YA 3KIPA 1C9KA 5ENZA 2FFRA 3ANYB 3D7LA 3KOOA 1GKLA 3MD9A 3GEBA 3P45A 1ZY2A 4P84A 3TMYA 1P44A 1Q0PA 2NYAA 4YMVA 3QOXA 1MW8X 1XCOA 2OXTA 1KIAA 1UMDB 1O7JA 1OJLA 3PQDA 2FRXA 3C5HA 4OKIA 3GUHA 2E4WA 5B55A 3W9YA 1KPHA 2QPTA 4DBLC 3A6LA 3PK0A 1L4GA 3VO9A 4X7RA 3A4NA 3CR8A 4WZAE 1YVDA 3SWWA 4EA6A 1G5RA 5DISB 4K9PA 2B30A 2H3EA 3INGA 3PQFA 4URUR 2ICAA 1SXGA 1C3XA 3E53A 4WH0A 4LYGA 2X8JA 3H1GA 2HSEA 3P0EA 4QOSA 5EHXA 4XIIA 4NICA 3MXOA 4EDFA 3E7DA 1YR1A 1RACA 1TNDA 2O2CA 3SF8B 4MHOA 1CEEA 5FHQA 5JANA 1CRQA 1OZHA 1AO3A 3AJRA 1ODLA 3ASZA 3LI2A 2XW6A 4PZ0A 1H4TA 4QSMA 4AM8A 3VFDA 2HNKA 2QAJA 3MJCA 4LKOA 2XCQA 1B8NA 5JAOA 4LWZA 2JIDA 3PCXA 1CS4C 2QM7A 1MN6A 2LBPA 2PXHA 1UFVA 4GOKA 4BMPB 2O8CA 2H08A 2L17A 1QO7A 3K0EA 3VNRA 4BXOA 3H5VA 1UFKA 1N2EA 3UH1A 4CM7A 5EKSA 1H8EA 4GYYA 4JH0A 3IIIA 2V7QD 3N5CA 1B3BA 3O8QB 3OETA 3SYLA 1TK9A 3WTBA 4BQOA 5EHZA 1W47A 4MPDA 4JI2B 4ZI3A 1Q20A 3B1XA 4Q93A 3DNMA 1QYVA 2AI3A 1Q6ZA 4MVJP 5IHXA 1MENA 2Y1CA 4IWYA 5ALMA 3W06A 4ZAGA 4BV8A 3GDOA 8ABPA 1X3LA 1K27A 2XIJA 3CWQA 5FNZA 4B6SA 2FP3A 4ZTUB 3IUJA 2FPKA 1T9BA 2QRUA 2QTFA 1JEEA 2OUIA 5BWCA 3NEPX 4UMEA 1G5IA 2L69A 1TKCA 3CRNA 4KQ2A 4OEHA 5SV2A 4N3BA 2CWWA 4Q24A 2BGWA 4HTFA 2A1UB 3FNQA 4G5FA 3EA4A 2I2WA 4JITA 4ND5A 2E18A 4PCUA 1ST3A 1U2SA 2ZIAA 4KFRA 1PJ2A 5AHRA 5F3WB 4MKXA 2HGZA 1FYDA 3E6AA 1VM6A 1FSPA 5ALEA 4D0SA 1E3QA 3OY2A 4Z1MA 2DFPA 3G79A 2AN4A 3QWBA 2AOWA 2P0AA 4U2BA 4DR3B 4X93A 2ONCA 1P1JA 2AXQA 1OW3B 3MILA 4RZXA 2PT9A 5B1EA 4Q1DA 2HO4A 2NO4A 4Z6KA 3D81A 3UHPA 2ZXUA 1YIOA 4ISBA 2QD2A 1N9KA 2WF9A 3W5UA 2CDBA 1SXJB 5JNLA 2P9BA 1N6KA 3DDWA 1U0OC 3ABRB 2D3TA 3GEGA 3PCRB 3HSYA 3L40A 3MMSA 1Z4JA 3CXRA 4PLZA 5EZ6B 3T7DA 5JCJD 2MTBA 3B2QA 4G23A 4C7XA 1ZK2A 4UDXX 2ZDGA 1CUUA 4FCTA 5K9ZA 1D04A 3EZYA 3B6ZA 1PS8A 1R4NA 4LBZA 1YB6A 3GRPA 1RXVA 3CO0S 3D0RA 1IUNA 1D6MA 1PT7A 1K7XB 3I9OA 2HQOA 4JJGA 5DBEX 1NLZA 2F64A 2BFDB 1Z7BA 2F1KA 2GXSA 4R05A 1N5KA 1OWOA 1V5EA 1AO0A 1MTOA 1T13A 3DB2A 3SDBA 3K70C 2V7XA 4H35A 2Q9UA 2R8YA 4V3BA 2CMFA 1TPYA 3OVMA 1EI9A 1U2DA 4LS3A 1ZH2A 1NN1A 1CUSA 3AJEA 1NVMB 4MQFA 5AVQA 1U04A 1FXWA 5GZ6A 1XD2A 2IY9A 1EE1A 4A8TA 2ZOSA 3OTOB 2I67A 5C46F 5JLAA 3GFVA 4FT4A 3E7PA 1LC3A 1ZC4A 1ZUD1 2EZTA 2PGLA 3EMBA 4H0FA 1S8FA 3MAAC 4H9GA 4LJSA 2QTLA 3SE0A 5JOQA 2C2KA 5DXAA 4HLNA 4CF3A 1I2AA 8GPBA 1QDUA 1RQNA 1J2YA 3VU3A 3CVJA 1P4RA 1GQSA 1QGUA 4L16A 4HNQA 3W34A 1LZLA 1T1SA 4QFDA 1R4ZA 3GJRA 1M0WA 2ZE8A 4L75A 1WP9A 4O1IA 4W4TA 4A36A 1LFDB 1M76A 4MAAA 2FEAA 1QG2A 5C34B 4FN4A 5L3QA 1HOTA 1KFEB 3CCFA 4F84A 2WVJA 2FSHA 1VTKA 5GONF 4YBRA 1W6RA 2LKCA 2X8BA 4ZQCB 1C9JA 1II9A 2QDXA 4CM5A 4KIUA 4CKEB 5IPFA 4EEXA 1AGPA 1OLXA 1JBKA 1N7HA 2AJ8A 2QQ5A 3OCVA 2HA5A 3AFHA 4Y6LA 3BF8A 5FUYA 1ZHHA 4ZDWA 3PXUA 4HNHA 4L8YA 4RL6A 3CZAA 5E4JA 1R5OA 3ZBTA 3T3MB 4OHZA 4BVJA 4BL5A 3IE0A 1OBVA 2NAPA 3Q11A 3KVVA 1YK1A 3C0KA 4J29A 5KDLA 3U0BA 3QMWA 4GOLD 4D43A 2XXAA 4X20A 4I4LA 5A4IS 1AG9A 1K4MA 3H0EA 2ZP1A 4YJ3F 4NK4A 5C9ZA 4B3MB 2DQSA 3ICCA 2AE1A 2JFUA 1I4LD 2PGJA 3RROA 1N2GA 1M7GA 3BTSA 4AJOA 2D2IA 1K7SN 1SUDA 2P0EA 2PBRA 3PRJA 2FK8A 3KU1A 2DP4E 5EJFA 4YCCA 1AA9A 1R37A 4DKXA 2OKGA 2Z2YA 2V3WA 5ARBA 4LE0A 2DHEA 1UBEA 3HR8A 4KU4A 2QG4A 5H4GA 4UREA 5A9SB 3K94A 1QHSA 5EG5A 3GJ6A 1URPA 1LPBB 1HI9A 2Q29A 2BUCA 3HWWA 5AVZA 2P65A 2REXB 2BFBA 2Q0SA 2NIPA 3Q40A 5ECYA 5JSFA 3EIUA 1Z4NA 2JGFA 2EYUA 2IUFA 1RYDA 1W4BA 4UUBA 3ZDEA 4L07A 1WSWA 4BFSA 3TPCA 5IBQA 4D9CA 2NMVA 2ACVA 5KHLB 3HJFA 2RAUA 3FX2A 3N0RA 1HSOA 2V8BA 1FS4A 1AM4D 1ZGZA 5JRJA 2GCOA 1TCUA 3KKQA 3I0MA 3T15A 5JXWA 1DADA 3GA7A 4DAEA 1ZVVA 3OJOA 1UBMS 4X6YA 5EXXA 3DKKA 3SEFA 4EP1A 5M34A 5ISMA 4RYDA 3I1JA 2OT3B 4MLDA 3RKRA 2FKNA 4CQJA 4TYYA 4AY4A 2ILVA 1TJ5A 3SHWA 3E61A 2XUGA 4MYRA 4X63A 5AM5A 4CKBA 3LXMA 4WLUA 5DHPA 1XSEA 1U2GC 4FFWA 2LNDA 5E9AA 2FLWA 2QV7A 1N2OA 4HVLA 3GLFA 3EXFA 3S81A 1NJGA 1BS1A 3PJRA 3UK6A 1UEJA 5AKKA 2Y6VA 5FDFA 4TT3D 5JNVA 3DJYA 3K0FB 3DH0A 4QFBA 2J5BA 1T29A 5HGJA 3RAGA 4AULA 4PQEA 3P19A 4EKEA 4WZBE 4JI0B 2FEXA 2FMFA 3W3AH 3ANTA 3PQEA 5ICCA 3W5DA 6REQA 1SC4A 3FVVA 1J42A 5AWFC 3BGVA 2Y76A 3U3RA 1KDZA 1BMDA 1X86B 4TKLA 4B80A 4D5GA 2KHZA 1H1LB 3H1EA 1KJ8A 4GGPA 4KWCA 3GJSA 4MQUA 3ZGNA 5HQ3A 4EFKA 2HRRA 1NQTA 4D4KA 1UPBA 3HEMA 4Y7CA 2C9ZA 4X61A 4L72A 4RY2A 4A9AA 4KK3A 4AF7A 4B75A 5CFNA 5LP6F 2LR0A 2XCOA 3E9YA 3UWPA 4AWAA 4F2HA 2XMZA 3NYQA 2NVBA 1XALA 1Q0TA 3LOQA 4BN5A 1C2TA 4UEOA 2JJYA 3BEOA 4GX1A 4TUYF 4YCLA 5AK4A 1ZGGA 2P9HA 4MW0A 4PXYA 2Q3BA 2RH9B 5K0BA 4KR0A 3U1TA 1FQKA 3TFWA 4D4MA 3N2YA 4GX0A 2J9YB 1W2GA 3H2SA 2FQQA 2V6JA 3K1ZA 1ECLA 4PC3A 4QBGB 1DRWA 4IJMA 1NF8A 2OGZA 3IE2A 4R9RA 3H5NA 3NORA 3OT5A 2VUSA 4AUKA 3GRKA 2X2EA 2CVZA 1D8AA 5CJPA 1M2KA 1KYYA 4KTVE 4EFMA 5KTRA 4QQKA 3NCTA 1TM5E 3T5GA 2HSDA 3AUFA 3U7EB 1VE5A 1CY6A 5FL7A 5TARA 4ER3A 1VI2A 1QPBA 2DQ4A 1J20A 3INNA 1TQ8A 5CPBA 2H0AA 3DFKA 5D2CA 1WB5A 2IDMA 2VZLA 2DH6A 3TTVA 4CQMA 4BAZA 5BMOA 3T38A 1FSZA 2AH5A 2OV1A 2YXPX 4H7JA 3DBOB 4RGQA 4UNNA 3T1NA 1OA1A 2PMDA 3GRCA 4J0CA 4MW4A 3DMRA 4L27A 3ZI0A 3D2AA 1J0XO 1ZOPA 4L78A 5JS8A 3THYB 1IBMB 1NVVR 1PNQA 4NBLA 5DN6D 1JH8A 2BGGA 3STWA 4C0WA 1VZ2A 1SBHA 2P2CA 3FNBA 4IEIA 4PINA 1UK7A 4BIIA 1WZNA 4JODA 4KAXA 4N5HX 3TLKA 4BNMA 1GG9A 1P75A 3R09A 3WDMA 1WHTA 2R65A 4KQ6A 4B74A 2JF0A 1JDBC 3GNQA 3P0RA 4MCAA 3PFBA 2L42A 5BPFA 5E6SB 3OZXA 2PDAA 2AJLI 2ZUUA 3LECA 5DWQA 5LUBA 3O3OB 2BKUA 4XASA 1ZISA 1P19A 5A4JA 5EMMA 2F8LA 2YVUA 1PYGA 1XJCA 2O07A 1T3SA 2CUNA 1R5JA 4O2BF 4KGVA 4Q4AA 3AJ8A 4ZWNA 4D57A 5L6LB 1E98A 4TMKA 3LBFA 3FSGA 1RQ7A 1ATIA 4LHSA 5A3QA 2PWBA 3O83A 4RK7A 2A88A 4PG8A 1WS6A 2R7MA 1JKXA 1OVMA 2RAPA 4UE3S 1DEOA 5B6IA 2F59A 2VQEB 3HLTA 2CMDA 1TZBA 3ULKA 2YWCA 1XZHA 3WMFA 4AMUA 1T9DA 3W6ZA 4E1BA 2Z2ZA 4KIWA 2HN9A 5TQVA 2ZTSA 2HAEA 2UDPA 3H7IA 1A8IA 1ZN2A 1SHKA 3N2GB 2K7FA 1G2QA 4JP8A 3BMCB 1LBIA 1DKLA 3PE6A 3C41J 1IOZA 3CN7A 3BD6A 4EFNA 1ZGHA 4UBLA 3TW8A 2BDUA 1RYFA 2JLSA 3UENA 2WWXA 1Z7WA 1TAGA 4RHXA 3QU5A 4NK5A 5GADl 3MWGA 4RZIA 1GM5A 5AI6A 4LQDA 4F2GA 2RGNA 3WDLA 3WYNA 5E3HA 5JQGA 3CKKA 2QG6A 4LRUA 2YVKA 2JGDB 1C9NA 2HH9A 5E8JA 3QE3A 3RS7A 2E4YA 3WL6A 4F3TA 1JQ5A 3DOEA 2BKXA 2HEGA 1N9ZA 4ZAYA 2Y99A 3MTAA 2ZZMA 1R3DA 3S7ZA 3PTLA 5IJ9B 1MQ9A 1NSFA 2I9KA 2XB6A 3MT7A 2WOJA 3VJMA 2XADA 2Z09A 1Q1EA 1L0BA 3C15C 1LWOA 4OP1A 1TM7E 3UUGA 4AO8A 5DM4A 2WILA 1XOIA 2PAFA 3RI3A 3NHPA 4N5IX 3FCEA 2R7AA 4BEWA 1I2DA 3RU3A 3SP1A 4GKAA 4JC4A 1FLAA 3A37A 2VTEA 3BD8A 3IPRA 4ZAFA 3KLBA 3KYJB 4DMHA 4QDZA 1B42A 3UK2A 5AVTA 3SM9A 3WQHA 4U8GA 2CFSA 1SPXA 1SA0B 2C4HA 1KR5A 3DEYX 3FHLA 3VHRA 2Z5VA 5ULLA 3TX6A 4TXNA 4DTCA 1RIIA 1X1BA 3IHTA 4RHEA 4FBLA 4ZCTA 1KI6B 3KU4A 1V3QE 2H63A 4Q15A 4HWKA 3W8RA 2Z3VA 4LQCA 5SYAA 4JL8A 2BMAA 4B4UA 4YK7A 2R85A 5FLEX 2KWIA 5JSYA 3FOZA 4Z9FA 3IQGX 1LPMA 3F3YA 3BDIA 1T4CA 1Z7EA 4MDHA 1NLMA 1L9XA 3E2MA 2J0SA 3AF3A 3D6TB 2YXNA 1NMSA 3LRXA 4LZOA 1U7OA 2C92A 1EFDN 1QH1B 4QRIA 4FYHA 2XDQB 1NL3A 4ITVA 4LC0A 1S1CA 4TTRA 2K7ZA 2XIQA 2AOXA 3OZUA 4PSVA 2Y1GA 4KHZA 5G02A 4JI3B 4H1WA 2XNCA 3BMCA 1IPHA 1Y6JA 4GLJA 4ZGWA 1VJRA 3IA7A 4BE4A 1JX6A 4G0OA 2LCIA 2HDHA 1NMXA 3OLWA 2C4NA 2J4CA 4BCCA 2POQX 1AN0A 1K7FB 1IVYA 1DWOA 1QG0A 2IS6A 1Y9ZA 4Y2SA 1G63A 2PIDA 5DDIP 4KQGA 1XRQA 4H3HB 2GJSA 3GH1A 2FWRA 1GUYA 2I3AA 4HNGA 1N0HA 1ZK1A 5LVAA 1SZDA 4FDUA 5ESRA 1YASA 3EVAA 4WOBA 5K4AA 3EAFA 5E2BA 1XHFA 4ZEVA 5A4DA 3JZAA 3ZWWA 4NP6A 3M83A 2AX4A 4KSCA 4BB6A 4YCMA 1ZK3A 3QENA 4JT2A 3TDKA 4HB0A 4FW9A 3BEDA 3VQTA 2G1AA 3NTRA 3OWXA 1CUGA 3DPUA 1DX6A 4M49A 5C5DA 3HKBB 1OI7A 3GRYA 5FLKA 1PJZA 2NO9A 1NDQA 3ADBA 5K0TA 3IIEA 4R98A 1GNQA 5BR1A 4EHKA 2RJ3A 2D7JA 2KQUA 1KU0A 1T5TA 3A1TA 2XUZA 1H2EA 4NCXA 2I6GA 3EEIA 2J59A 2PEYA 3HBLA 2HBQA 1MR3F 2A3RA 3LFTA 3V1KA 1ODJA 4BVGA 4X8MA 1CY7A 2G4LA 3IRUA 2BM8A 3OT1B 4HG2A 4PPYA 4GC9A 3STUA 3VYVA 2WTUA 2POCA 2QN6A 2Y92A 5HS4A 1XZDA 2VPPA 4N0QA 2WQ6A 4HZGA 2Q5QA 4AXXA 3QVXA 4B6QA 2WQZA 1M1YB 3EXHA 4D3YA 5E2IA 4KXXA 5HRUA 2OXFA 2PBLA 2ADMA 4E46A 2DUWA 1YUNA 2CK3D 4FQ5A 2QSYA 2BYTA 5TJHA 2Q0QA 2OOKA 4X71A 1SWVA 2GZ2A 2VS1A 3TLZA 1X87A 1VLHA 2VHVA 5BRNA 3NXSA 5IDWA 1JTVA 4MMXB 5ECGC 1MCZA 4CKWB 3U16A 1L3CA 3DXFA 2V0CA 1TTTA 1EM6A 3MWFA 1YFLA 4BPBA 3A1EA 1UZMA 1XAHA 1K7YA 4HVTA 5KCMA 3B5JA 4DM4A 2O2GA 4IEEA 1P7CA 2C2ZA 5UKDA 2G5PA 4YMUA 1FNCA 3UK0A 1EUDB 2ZBFA 1C81A 5ERYA 3VR2D 3GJ5A 2PWAA 2REOA 3VPHA 3A26A 3W6NA 4FOTA 4R1NA 2C7QA 2NZXA 4BE9A 5CFZA 2P5TB 1E1QD 3SLRA 2AJTA 3PVZA 2BZGA 4Y98A 1XQ9A 2V3CC 5JI3E 1FJ2A 1WB4A 4WQMA 1IMOA 4AQ7A 3SFTA 2VQ3A 1D1SA 2PUJA 4CM4B 1M10A 2NNWB 4YRIA 5JMTA 4WW0A 2ZUFA 1XZGA 4RH3A 5EIFA 2UZ3A 1CWUA 3CZCA 3E3LA 1Y98A 3RNLA 4YXFA 4ZYTA 4DV2B 3BXEA 1RP1A 1FU8A 3PJFA 5HVNA 2JBAA 2IYWA 2SHKA 2X7HA 3TPFA 2MINA 3ELDA 2QLNA 4IGKA 4E5NA 5FTNA 4B48A 1TU3A 2PCJA 3EIFA 3LDHA 2E6KA 1L5NA 1V4NA 4OQMA 3HV0A 3KZOA 5SY4A 1XYGA 3IMCA 2GPNA 5LR6A 3PEWA 2QTMA 2CMHA 4PZLA 3OT4A 4RVNA 2HNBA 2WPDD 3T7JA 3E22B 4WK6A 1R88A 4HI0E 1ZOLA 3PICA 4AB1A 4OYHA 5JCJA 1GP2A 3HV2A 1GG5A 2REBA 1UBHS 1ZRNA 4GPZA 2Z04A 3PBKA 2YJ5A 5JNSA 4Y6QA 3JQAB 4MO9A 4Q4HB 5IJXA 4BEJA 4EB0A 3LW7A 1QVRA 4H3VA 5BWNA 5JSKA 4ARUA 3EE6A 3DTNA 2VRNA 4R3UC 4A6DA 4AX4A 5FWYB 1EDEA 2I7XA 2VDWA 1VP3A 1NJ5A 1C9YA 4ZAXA 2GPBA 2Q1UA 1D6NA 4I36A 2ST1A 5KPJA 3LT4A 1WKBA 1Y4AE 2BEUA 1GZSA 1YRWA 4GNKA 4OXNA 3HKCA 5INTA 4FHFA 1CQWA 5K3FB 4CG0A 5FNVF 2FH5B 1D3AA 3MGCA 2J5RA 4DYHA 3D4NA 3JSXA 4QQFA 2NTYC 3OLCX 1EXMA 4ECEA 2RMKA 4MVCA 1B6GA 3FPJA 3UJDA 1FLDA 1GKKA 1M75A 1Y9EA 3MJSA 5EZ5A 1ZYUA 3DVQX 3VHXA 3T52A 4F11A 3ITDA 1UMCA 2ZVDA 3GPDG 4JP2A 5HKBA 1VE3A 4M8IA 1KS9A 1PR9A 1TB4A 4O0LA 4W5WA 5JI2E 1AGYA 5HKKD 1QHXA 1GAEO 4X0EA 2QQ0A 2O19A 1CCWA 3HO8A 2RI1A 3VC3A 4KXMA 3O91A 4NHEA 5H8WA 5AT1A 1RC0A 4R1UA 4WY8A 4AKTA 2PGAA 1WKCA 3RTEA 4J0QA 2C4MA 2FSVC 1NBOA 2ZE7A 3IXQA 5B3JA 5BQPA 1E2MA 3DR5A 1I2BA 2OQVA 2Z57A 1IEVA 1ES9A 1VG9B 4P53A 2OBXA 4B43A 1GRCA 4PN7A 1JQ3A 4FXPA 5U9CA 1TZKA 1D9XA 2V97A 2K6GA 1FFCA 4GFDA 3TR5A 2BRUA 3E82A 3PGA1 1YQXA 5C4GB 4CTKA 4YNBA 1USGA 2W6PA 5I9MA 4PO8A 4OQZA 1B0UA 5K8VA 3T9AA 4IIXA 1E1QA 2VLIA 5CDGA 4EVQA 3CW8X 1RFGE 1K8YB 4HGYA 3QTBA 4J0FA 2I66A 3QVWA 2G0AA 3TBKA 1U7PA 2D4HA 2ZI3A 1AQUA 2PLNA 2UUAB 1Z63A 3ABIA 3G3EA 1WXFA 4UHCA 1XPRA 1L5HB 1ZA1A 2HNAA 3HZOA 5SZJA 3D5TA 4B3TB 3RC7A 1H6DA 3TJZA 5DNEA 4Q9NA 3OTHA 3AUXA 4E5PA 1LVGA 5I4BA 4P3XA 3GG9A 4WXMA 5TT1A 4FSXA 3V5NA 4CRWB 5G1PA 1NR5A 2EV9A 3K0BA 4B7ZA 4CIXA 1IVSA 2QYOA 5IJZA 1TZMA 5CG1A 4QVGA 2GO1A 4FM9A 3CB2A 3N76A 4UDYX 5JJIA 3R3UA 4KKXB 1M83A 2CMKA 1HL3A 2KLHA 3GQVA 1TCBA 3KQMA 4Y7DA 4A7PA 2YVQA 5LBUA 2CXTA 1H1DA 2JCXA 4RF4A 2CYCA 4CV2A 5MN6A 2AR7A 3FMOB 1KI3A 4WSOA 4X60A 5EJ6A 4OPMA 1GVNB 3TI7A 5AYVA 1RCFA 1WD7A 4MTCA 1YMVA 3HN7A 3TMKA 4UOZA 4WXYB 1RAGA 1JXAA 2OV3A 3BULA 4RMIA 3T4PA 1BU8A 1T3LA 4LVNA 1V2GA 4HNTA 1T2VA 2J45A 2JJ1D 3CW9A 4XWYA 1EVJA 4KXFB 2PGXA 3ZVMA 2R6JA 1QK3A 4OIFA 3CRRA 1TEHA 4HTAA 3TRIA 4GQAA 3PT9A 1ZIDA 2W11A 2W98A 4BVFA 3TE6A 4HUQB 1BDHA 2X6QA 4RCYA 4KO4S 3BSSA 3WL5A 5C1DA 1L5HA 4YJ2F 3A4VA 2JAXA 1S6YA 1H2FA 1UKAA 2IXDA 2O0HA 2GJ4A 3G9UA 2XMSA 3VR3A 4TS1A 1OKKD 5CM9C 1C8KA 5LCXA 5L7TA 1G17A 3G5UA 4R4JA 1N6HA 3OFJA 3WB2A 4L50A 1KFBB 1UANA 1FRVA 2XNDA 3EPPA 3HZHA 2EGGA 3PDWA 4FD2A 1N2HA 2C7RA 1EFHA 3H84A 3Q0IA 3P9XA 4I0WB 4DTIA 1VQ1A 2HY7A 2EX1A 2ON6A 1W88A 2OZPA 3LKZA 3HJCA 3PE3A 3UJ8A 1U0GA 5B7NA 4NZZA 5DNWA 3LUCA 1QZ3A 4NEGA 2W71A 3RVMA 3VBCA 4XWWA 1N7JA 4YLEA 1ZNWA 1B93A 2DOKA 2Z98A 4HDMA 2FK7A 4JHLA 5FUWA 1NLYA 1R16A 4GM0A 3VNBA 2YKGA 1FU7A 3IOBA 1NQ5A 4PGFA 1YCGA 3PXBA 4KQWA 5AM4A 2CL7X 2O8VA 1KI9A 1A2QA 2CBGA 3GGDA 2FQWA 4J49A 4RM3A 3WL7A 1DLJA 4XI9A 1MVLA 4XLLA 4FDAA 3RKSA 5DHFA 3O2JA 3B6JA 1VHQA 4NFYA 2CFRA 1PJCA 1K9VF 2I34A 5NLLA 1G7CA 1H85A 1G8PA 1NWCA 4ZOLA 4D26A 3OJLA 1I2ZA 4C30A 1JG1A 1NVDA 4JN6B 4CIDA 2QPLA 1BMTA 3I9MA 5LYYA 4BV9A 3OQIA 4LNHA 3AB3A 3D8NA 2R1VB 3U56A 1TQ4A 5D84A 1WUJS 3BC1A 5FLYA 2WE7A 4R0NA 3AJDA 2EEZA 4PLYA 5KKNB 3ZC3A 2RGCA 4M7WA 1CZNA 4QTZA 4B45A 1XLTC 1BG6A 2V7TA 3HKEB 2W0MA 4JXJA 5LZ2A 1LNSA 2CNOA 2OENG 4KDEA 4LMRA 4PYIA 3KQKA 1OLSA 4JYAB 5E6SA 4P33A 2VPQA 4FSHA 3GJTA 4PSUA 2FAXA 4TLDA 3SZMA 2O6LA 2Z6QA 2GCGA 2Q2VA 5EWLB 3GLQA 4BX8A 2GTPA 2WF6A 2R6FA 4R8VA 1B2RA 1HZJA 2R4QA 3IMEA 3PT5A 4GX2A 5H82A 3ZDRA 1CB0A 1LBQA 1SIOA 2CL6X 2HA7A 1ZJ6A 1Z62A 3ZK9A 1L7DA 2FW6A 2PE5A 3OC0A 4M22A 2C29D 2UYGA 3L8MA 3W2TA 4Z3OA 4H3KB 1TKBA 3ZXSA 2FXIA 5DGIA 5E4YA 5F21A 4AP5A 1K86A 5ER6A 1AIPA 5I45A 3DFFA 1UPUA 5KOJB 1FRQA 1SKYB 1JYFA 3C2QA 3P1JA 2ZQ5A 1NHGA 4V0MA 5F23A 5LOVB 3U7HB 5JXIA 1DMRA 3KOMA 1BOOA 5KS2A 1TU4A 3GCXA 4LZJA 2J85A 1EAYA 2AMJA 3WL3A 4QAQA 1PYOA 4EK9A 4G3XA 2PUTA 2P8SA 4HDRB 4PZEA 2ZYIA 4R8KA 3FDJA 3WYCA 4EW1A 3OX1A 3A0UA 3CY6A 4HX2A 3F5QA 4CGZA 1EWKA 4E51A 1YKGA 3HZZA 4NZMA 5CVTA 5ITVA 1DAGA 4F9TA 3LYAA 1LS1A 4UAVA 5BVGB 4WNAA 4HAZA 4MWGA 2CHUA 4L22A 4ALJA 1FUIA 2PWZA 2NSDA 2R00C 3KL2A 3R5KA 4WJZA 1RPTA 1TVEA 3BMXA 5TPZD 1XQVA 5IT5A 3IMGA 5EAIA 4RZUA 1WU8A 2G83A 2H9YA 5F4BA 4CM4A 5C37A 4TS9A 4HWRA 2PN1A 2TS1A 3VSEA 4D9MA 3GJYA 1NX9A 5C7LO 4ALKA 1PGOA 2AC7A 3WRVA 4M7PA 4HP8A 2HD4A 4KR6A 1M1XB 2RG1A 5IARA 2P2GA 2DXIA 1CC1S 1KO7A 2EKLA 1M2FA 1M5UA 5AK5A 3ILSA 3T3OA 1XO1A 4PZZA 3CVWA 4LGCA 2D4AA 2D1SA 4NCIA 3TEMA 3P2JA 2YQ4A 2WA2A 3GIWA 2AT1A 4FHEA 4H7KA 1XJQA 1IZ0A 1S8AA 5JYBA 3MUFA 5T4BA 3ZK8A 1QYCA 3A6FA 4XTRA 1YO6A 2CUTA 4PSDA 3T3EA 5CR9A 3ZKAA 3HY6A 4RENA 4B3XA 1WR8A 1KYIA 1GUBA 2O2DA 3NXKA 2JBAB 4TMYA 5BQOA 2ZGVA 5F2NA 4A03A 4ICIA 4NV0A 4FILA 5DM60 4AWBA 5IT0A 1JJFA 4AURA 2YCLA 3L0IB 3WHPA 3RW9A 1RAEA 3Q6MA 4KE8A 2XOXA 3EQ9A 3K5WA 4WJLA 3M70A 5CNIA 1JDUA 3HB7A 2JATA 3LPCA 2QW1A 2VXCA 3A9TA 4FK8A 1A5ZA 1O6FA 4KWIA 5I7VA 1JPUA 4EO7A 2XODA 3WJ1A 2VDLB 4IDNA 3WY9A 5EJ7A 4RAQA 3B6EA 5T8KC 3JD0A 3OPXA 5A9TA 2BR4A 2F3RA 2MSLA 5BSVA 4JEHA 4OX9Y 4MUKA 4PPFA 1XMQB 4L8LA 4MV7A 3SSAA 3T7KA 5KSPA 3IUNA 3GP8A 1QGOA 2A5JA 4CM3A 1NR1A 4M88A 5E9QA 1XJWA 3AFIA 2PSDA 5IM4A 5F73A 4YWHA 3S5UA 5FWNA 2ZBDA 4EQ6B 1SKMA 3L84A 3B89A 4UXHA 3BSWA 2K2WA 3EBPA 4FFSA 4OUDB 4OH1A 4RH1A 3EGXA 1R6DA 1SIUA 1JPNA 4MCIA 3UUWA 3VZDA 3ESYA 3CXUA 2H4HA 3OCXA 3ZS9A 1F7UA 3UOGA 4AF6A 5AVXA 1R0XA 3EIQA 3PDIA 3AHEA 1UZLA 1RI2A 2I6UA 1L4MA 3AUKA 3JWHA 3P9NA 5CBPB 4B8YA 1OH8A 2MYTA 1U5AA 1Z5UA 2WU3A 1TECE 3F96A 3S2ZA 4DS3A 4PNEA 2AI2A 3X2SA 2NQTA 3RM3A 1H23A 2YS7A 3RHTA 1OXXK 1Y4SA 2RGEA 5CBKA 4PLGA 1FFWA 3UJCA 3DHNA 3ND5A 2YC4C 3L6UA 1M7BA 3JY6A 1LBTA 1F17A 3DKIA 3OJXA 4X54A 4G63A 4LQLA 5FBQB 4Q9AA 1A98A 1P2GA 2BFCB 1X1AA 2GZAA 1U1GA 3E5HA 3F97A 3KR1A 4LRXA 4P6VF 3ZHXA 4MV1A 3VUEA 1HA3A 4H0NA 4D0GA 5LDDC 3R8FA 1V5GA 1M5RA 2HXYA 2QR3A 4JB0A 3KZKA 1RT9A 1P4SA 3R74A 2CDAA 3M3HA 2Q3HA 2IBTA 1U3DA 4JLVA 3L4KA 1NVEA 4LMAA 3DE0X 2XCRB 3RDPA 3O4GA 4UD2A 2NU6B 4BNVA 3TG8A 2ZRLA 1Z26A 3B3JA 3FKJA 5BNTA 2JLUA 1WOYA 2CV1A 2GBPA 3TIXB 5GV8A 3H5AA 1JDPA 2O5RA 3QELA 3C8ZA 1XGKA 2VYND 2JGRA 3QI7A 3DLBA 1V6SA 4IIVA 4BQFA 5DI9A 1P0PA 1JQEA 1RMYA 4XUEA 5DP1A 3RNOA 1OR8A 4EHBA 1QKIA 5AFSA 4J0IA 1O6GA 3AK4A 1ZMBA 2Z8YM 1EK1A 3HU1A 4KC0A 1U1IA 1M2NA 1Z73A 1I01A 1AUVA 1SVLA 3CNNA 3H9BA 1JHXA 3QNUA 5DM0A 4JB8A 4ZK2A 2OHOA 1Z22A 3SK0A 1W85A 1Z39A 5K0ZA 4V0ME 5EP4A 4EVSA 3FD8A 4YQFA 2ZAOA 3K6JA 1KA9H 4DY4A 3CJTA 4HL6A 4C0LA 5IUNC 5AHWA 5TJ9A 2ZWIA 4MLZA 4E5VA 3R3XA 2UYYA 1NBHA 1H0HA 1BQEA 1Y34E 4QASA 1O0SA 4YN3A 4F5YA 2WIGA 3M1LA 2DQYA 1X42A 3GFPA 3Q1LA 1B1AA 4U6QA 4MQFB 3AERA 3O8OA 4CCYA 3LUJA 1DG1G 3OKCA 3RFVA 1RAFA 3ANMA 3RABA 3I42A 4YAOA 1BFKA 5IM5A 1XJ0A 2H1HA 3E35A 3R23A 4EAAA 3F6EX 1VE9A 4BBPA 2WABA 4RJJA 5BSHA 4FOLA 3MOGA 1XPUA 2PGNA 1X80B 3T9DA 1EJ6A 4P93A 5IYZB 1R4NB 2C83A 3IBYA 3IIKA 4CIBA 5AKHA 3ZUGA 4HDKA 5I47A 2RGDA 3TKLA 4UZEA 4ESHA 3PDCA 1EQAA 2ORED 2Z0MA 3IAS1 2ET6A 4WK0B 3SC2B 3ZDQA 2VT2A 3C16C 3AUYA 1M1NB 3LO5A 1OVGA 1H9AA 3LC0A 1IJFA 2FWPA 5F4ZA 3NO4A 2Q7OE 2FDCA 3U7FB 1A50B 6AT1A 2QP9X 5AW7A 3F46A 2KMLA 5KYGA 3ZBQA 1HPLA 1VFPA 3AB8A 2HYIC 3PA8A 4YJ3A 4KL8S 3B9BA 4RJKA 2AR9A 3OQHA 2IZ7A 1NY6A 5EGSA 1Z2NX 1WULS 2ZSJA 3GLRA 3M3PA 4IX9A 4XYLA 5B6JA 2RGRA 1US8B 2GFHA 1SAYA 2WJAA 1RC8A 2YMMA 4Y67A 2JIZA 5LYJB 1MX5A 1VKJA 1S4QA 2ID9A 3DV0B 2X4LA 4G85A 2DFNA 3FOFC 2HRCA 3KQSA 5HK8A 4IFBA 4ENPA 5AI4A 1RJ9B 2C4TA 3IEVA 2ACEA 1OFUA 1F8GA 3TRKA 1HR0B 1PZMA 1QYXA 3ZBPA 4ZCMA 1QTNA 4CLEA 2Y1KA 1B23P 1DX4A 1Y3DE 3R0IA 3LHSA 1JIIA 1PU2A 4KE7A 4EHJA 5I3ZA 1Q0ZA 5JRZA 1VMDA 2ZSHA 2ZJAA 1C0PA 5JSHA 2YYAA 4D4IA 4AG5A 4ZJPA 5CIWA 2DHDA 1LVUA 1S7CA 1W25A 2CE2X 3TW8B 1YZNA 1UMKA 2PU7A 4G01B 1JWAB 2QD5A 4NX2A 4QAJA 4QTUB 5KYUB 1DXOA 3C6YA 1PS9A 2WUFA 3KHTA 2F6RA 4HLDA 1YSCA 4QXQA 4X00A 4KLAA 2DPYA 2IZ1A 3GFQA 2B9VA 3EF0A 4JMLA 2PVSA 2X42A 3IS3A 2FA9A 2CNWA 1IOWA 1NMZA 1OPRA 1YS4A 4G4SO 4ZT3A 3SQDA 4TV9F 2ODQA 1ABFA 4ZDIA 4M0LA 1BFUA 2C99A 2OP0A 3SF8A 5ELXA 4X85A 2ZCUA 1ZKDA 4EKIA 5TRTA 2LPMA 1L6RA 1D2AA 2VTKA 2YFHA 4Q4AB 1THMA 1W5AA 5LB4A 5DMXA 3RFTA 4ABYA 2FX2A 4XDZA 4I7EA 1QFSA 1HGXA 3JD3A 1LBHA 2EJUA 4JX8A 4UM7A 3HDGA 1AXEA 3EIHA 3GGCA 1P5ZB 4RAOA 1H93A 1QS0B 1UK8A 1YIDA 2KPOA 2BFPA 3ABQB 1E77A 2HFJA 3OOEA 4DKJA 4DB2A 1I3CA 4UPVA 3RSZA 2JFVA 3LBNA 3O4RA 3PYLA 4FE4A 2RHBA