4TYQA

Crystal structure of an adenylate kinase mutant--akm2
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
215
structure length
215
Chain Sequence
b'MNIVLMGLPGAGKGTQAERIVAKYGIPHISTGDMFRAAMKEETPLGLEAKSYIDKGELVPDEVTIGIVRERLSKSDCERGFLLDGFPRTVAQAEALEEILEEMGRKLEYVIHIEVRQEELMERLTGRRICSVCGTTYHLVFNPPKTPGICDKDGGELYQRADDNEETVAKRLEVNMKQMAPLLAFYDSKEVLVNVNGQQDMEKVFKDLREILQGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
publication title Crystal structures of thermally stable adenylate kinase mutants designed by local structural entropy optimization and structure-guided mutagenesis
doi rcsb
source organism Bacillus subtilis 168
molecule tags Transferase
total genus 78
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tyqA00
2FWRA 5DE3A 1W48A 2FEOA 3MWLA 4TMWA 3U3OA 3GJ4A 2QY9A 4OHZA 1KMHB 1RW4A 3NWJA 3L2OB 1VIAA 3BB3A 4L9SA 4XTRA 4OYHA 3RAPR 2QP3A 2IWHA 3CW2A 3GEIA 1O3YA 3TQFA 3KKOA 1JJ7A 3AV0B 2QAGA 1NKSA 3NKVA 3GJ8A 2QPTA 3IBGA 4NPHA 3SFVA 2VTKA 4L5BA 1W36D 3EG5A 2W6ID 1T5LA 4JYBA 4FMBB 4L8GA 4BEJA 1Z83A 2C9YA 4RZ3A 4JLKA 3C5HA 4DCNA 4S2EA 3R9WA 4MKHA 4B48A 1OJLA 5KU1A 1OFHA 2JLZA 1ZW6A 2G0NA 4U7DA 4KYIB 2AKAB 4TMTA 4DT1A 1SXJE 2WBLC 3VR5A 4GOKA 2VHJA 3IILA 4NTZA 4PC2A 1KI3A 4F92B 5J40A 3OEEA 1OSNA 5JWHA 3OF5A 2IL1A 5FR2A 4LRWA 3PVSA 4ESVA 1YRBA 2R44A 1G18A 3HU3A 1W36B 1BMFA 2CLDX 3QENA 3LV8A 1M1YE 2VP5A 1JEEA 4FMDB 4RY2A 4LYHA 2LWIA 2W6JD 3Q7QA 4LJ5A 1ODFA 1ZINA 4DZZA 1Q1EA 1S3GA 2C03A 3PQCA 2E9SA 3TR0A 1VHLA 3ZDQA 4V0NA 2UZ3A 1LS1A 2RKOA 3DO6A 4ZIRB 1AN0A 4AI6A 2CLCX 3UANA 3FYHA 4URXR 3ZVMA 1N3BA 4E22A 3VHXA 1Z63A 5CK5A 3NIBA 3CNNA 4WXRA 3CB4A 1XDBA 3CWQA 3LNCA 3Q7PA 2X19A 4LPKA 5CLQA 1MO5A 3Q9LA 1QHXA 5BYJA 1N25A 3CH4B 4CVNA 1J8MF 5HZHA 4QGAA 1XPRA 2WVJA 4ZDJA 2GZAA 1DADA 2VF7A 2ZETA 4BFTA 1KJYA 2ZEJA 1S1CA 3AUYA 3BORA 2DWPA 2ZSFA 2CNWA 4A2QA 4TWZA 4QHYA 4GT1A 3A1SA 4LJ4A 2JJ2A 5CM8B 1I4LD 1ELOA 1G19A 3I72A 5FL7D 3TSZA 4URVR 5IK2D 3AUXA 2VYFA 2QQ0A 2NO7A 2PLRA 1Z6YA 4TT3D 2MSDB 4LHVA 3VAAA 2CXXA 2F7SA 3T15A 3AKDA 2WJVA 4Q5IA 1PJRA 2XNDD 1MRSA 4PAOA 3SC3A 2BHRA 4JVLA 4OQFA 2ZUDA 2GZHA 5C4MA 4HZIA 1JEDA 3W5IA 5TDHA 3D8BA 3DKPA 4G5GA 4KBGA 1UBFA 1TQ2A 1XMSA 4TN1A 5P21A 2PX0A 4NYMR 4Q9HA 4IFEA 3WY9A 5DNYB 3K0EA 2GXSA 1XMJA 4NL4H 4HAXA 3WXMA 5EE3A 3I61A 1E2KA 2DFKB 1T91A 5TV2A 1NMZA 3RS7A 2H16A 3GLHA 1KKLA 2W2VA 4ITRC 1OFTA 1XP8A 1W5SA 2IYXA 1DAKA 3TIFA 4URWR 5AUNB 1X1RA 3THYA 3ZYCA 2EWVA 1RC8A 1DE0A 1K5DA 3D3QA 2AFIE 1JPJA 3B1ZA 1XD9A 4C0LA 1OF1A 2RHMA 5GVSA 1RIFA 4WIAA 1WDTA 2G1JA 2R65A 5M04A 1KI8A 3K53A 5C2JB 4JLJA 1XBTA 3KKQA 3LFUA 5EUMA 2VHCA 3Q8XB 4TLCA 4JSYA 4A4DA 3V4RA 1WCV1 4M9XA 1JR3D 1TAGA 3TH5A 1AM4D 2GA8A 2IEZA 2ZRKA 5HCNA 4DLVA 3AP1A 4RVCA 4JLDA 3GLGE 4H9GA 1XPUA 4IVPA 1SQ5A 5HR5A 2P0EA 3LAWA 2CL7X 3P20A 2HYDA 1HA3A 1A82A 1D2EA 4GMXA 1G4UR 3PXGA 1MABA 3TJZA 1P61B 4ARZA 3G82C 2J0SA 1NSFA 3DMDA 3I62A 2HF9A 3QF4B 1QHSA 3RS5A 2BVNA 2NZJA 4DUGA 5JSZB 3FGNA 4PQFA 4LX0A 4GOXA 3I1FA 4IVQA 3NXSA 2QE7D 1N5JA 2HYIC 3IEVA 1AJEA 421PA 1Z6XA 1ZNWA 4KU4A 2OXRA 2QSYA 4AYXA 2GCNA 2GHIA 4IW3B 4CYMA 3KTAA 1U0JA 2CE2X 5AUQA 3UATA 4C3ZA 1I4TD 4LJ8A 1NN5A 3KDSE 1SVLA 4HLCA 5E4FA 3CM0A 3RS4A 2I1VB 4OHWA 1FOEB 3LW8A 5A4JA 4DEYA 4A6PA 1YZTA 1VECA 4XIGS 1GL6A 5EZ5A 1QHGA 3IIMA 4Q21A 1NN1A 2N1BA 4IDOA 4M9ZA 3VR2A 1XTRA 2GJ8A 4M1KA 1G41A 3SN6A 1UF9A 2ECKA 4XOIA 5FBRB 2ZE5A 3G5UA 5FPKA 2X2FA 2CCJA 3A58B 1WBDA 4GP7A 1GKYA 3P27A 1Q22A 1DVRA 3TAUA 2J9RA 5KDDA 1Z0JA 4UXIA 4W5WA 4BLRA 2Q9BA 5EXPA 1G3UA 1VG9B 2OZEA 1BYIA 4BGDA 2F1HA 1QHHA 1ZJ6A 1US8B 2CHGA 1E9BA 2GXUA 3B13B 4LZZA 2RGGA 3GLFA 1Q1BA 1E9CA 1VG8A 3U7FB 2ZRHA 1XFAA 4BLPA 1SXJA 4NE2A 4NYMQ 3N2EA 1IN6A 2X1VA 3SJAA 2O8DB 2GESA 3W3ZB 4JKIA 3N5CA 4W5HA 2IEYA 3U3RA 1DG3A 1ZM4A 5DISB 3RRMA 5BWMA 1JJVA 4CEIB 3ASZA 4HATA 3ICQB 3P1JA 4JT4A 3KB1A 4Q7LA 1XNJA 3THWA 3BD9A 1DTSA 4MA4A 4KV9A 3WNCA 5A5GA 3DMNA 2XNSA 1O87A 1U0LA 4AIIA 1QBKC 3SU8A 3ECCA 1PLKA 2GBLC 4I1OA 3TBKA 1GNRA 2OESA 3ZVNA 3NVAA 3PUWA 2GCOA 1W0KA 2GK6A 1Z8FA 1MO4A 2B8WA 4DT1B 1G3RA 1Z0KA 3RWMB 2IHYA 2ANCA 3FMOB 4UJ5A 3GD7A 2XJ4A 3KJEA 2WWXA 2R6GA 4X8MA 1ZM2A 2FU5C 1DEKA 2GWHA 4M1OA 2PLFA 3A1UA 3U44A 3QKTA 4MRVA 4IJMA 5G53C 1ZNXA 2J1LA 5GJCA 1OXTA 1KSHA 2OLKA 1XJ0A 2K5UA 3LD9A 4EPYA 4DDUA 1XF9A 2ZJBA 2V1UA 2GJSA 3IEUA 3MGCA 4OK5A 2YZ2A 4EUNA 2CHVA 3BJIC 3OHMA 3C15C 2B7BA 3PG5A 2C78A 2CK3A 3QQ5A 5BN4A 3PEWA 3ADKA 2ZJYA 4OHXA 4B3GA 2PMDA 4U02A 3F3YA 1RKBA 5DN6A 2I1QA 2RGCA 4RSGA 4HAYA 1A1VA 2G3YA 4A82A 3GCGA 1W4BA 1Q1ZA 2Q21A 3FB4A 3SQWA 2QAGC 4KBFA 1E96A 4XSHA 4PX9A 4UJ3A 2F9LA 1W44A 2OAP1 2PZFA 4ESHA 1JR6A 3TSWA 1G7CA 4RCZA 4LHXA 4MGZR 2FSFA 3W5JA 3QI2A 3KFXA 5DO9A 3CWZA 3HU1A 4IDQA 2H57A 4QC2A 2IYZA 4EJSB 2A7QA 2ZVQX 3AQ4A 4B3CA 2NQ2C 2O8BA 1L4UA 1JXOA 2JLQA 4I1SA 1HE8B 2KB0A 2VL7A 1HT1E 3HYRA 4PC3A 3A1VA 5FPHA 3OEHA 4G3XA 5SZHB 2WPDD 3SJBA 3CRRA 1Q0UA 4G5OA 4EFLA 1YR8A 1KZ7B 4UKDA 4XWOA 3GFPA 3GFOA 1KSFX 2IXEA 1NIPA 2FH5B 1GWNA 1II9A 1U90A 1KY2A 4TTQA 1QVRA 3MJRA 4JLOA 1OXXK 1TPZA 3SJZA 4B3XA 3C16C 2IS1A 2IA5A 3GLHB 4RZ2A 3GLGA 1S3SA 4PZYA 1VCIA 4MDFA 2D62A 1M7BA 3R7WB 4Q03A 1G7SA 2A5GA 2YJTD 3THYB 1IXSB 3K09A 4PZLA 2ZE7A 3WYAA 4N1AA 5F9HA 2RH5A 1XD8A 2P2LA 2CEAA 2C9OA 3QXJA 2BBTA 1NVUQ 3FFBA 4C4PA 5FTJA 3A1WA 2NMVA 2GTPA 1LNZA 4AG6A 2KBEA 3LLUA 2ODBA 1JR3E 1K6MA 1N6HA 1U9IC 5FOSA 2G77B 2JCSA 3TK1A 5FOWA 3K9GA 3OFNA 5EXTA 3RS0A 2ATXA 4TL8A 4Q4AB 4D4LA 2J41A 4EKDA 5LD2C 1KIMA 1AS2A 3CKLA 1TF7A 3ZS9A 2O8FA 3LLMA 4BFZA 4EIWA 4IKEA 1MABB 1G291 3TUJC 1GZSA 2EW1A 4ARZB 5H8WA 2BBSA 1E4VA 3MD0A 3ASYA 1XD2A 2BMDA 3QPUA 4G01B 4A15A 1H8HA 1E2IA 2Z5FA 1XU4A 5CDFA 3UK6A 2FV8A 1NMYA 2AL7A 3C4JA 3L8ZA 1DO2A 4M8NE 5L3QA 1U8ZA 2VQSA 4DXAA 2WTUA 4M1MA 1YE8A 4AC9A 3QY0A 4N0EA 3KTAB 3V00A 1AKEA 1C9KA 2P6RA 3B9QA 4Z51A 1GTVA 1FPMA 1FFHA 1ZBDA 3HR8A 4URYR 1C1YA 4LDJA 4M1TA 3HR7A 4QHTA 2EU8A 2O0KA 4QBFA 1AS0A 5KDLA 2VSFA 5JHGB 2WWFA 1G1MA 1E4YA 2D06A 3MWYW 4QKQA 2PT7A 2AWNA 2YWEA 3K0AB 2D4HA 2W6IA 4JVSB 1DAGA 3X1ZA 1GL7A 4EQ6B 4MUBA 2QEQA 4TYNA 4TLAA 3S1AB 4E07A 4KFUA 2ZI9A 1WQ1R 3CLVA 3EWAA 4NKRA 5FTLA 1QHHB 5JS8A 2FSHA 4RKFA 1HTWA 4IEIA 4RD3A 1ESMA 4Q4HA 3GLFB 4ZDKA 3GQBA 3QKRB 1G9XA 1Z07A 1W0KD 4YMUA 3WRXC 4TLBA 2DFLA 1U2RA 3TLXA 3RS3A 1N6NA 3EZ9A 3R8CA 3AVQA 1IN7A 4GZMA 2IUTA 2ZI6A 5D3QA 4BLSA 4C0JA 4DSTA 1P60A 1JBKA 4KVGA 1TEXA 2OM2A 3THWB 2REXB 3HPRA 2W6JA 4XVQA 2SHKA 4JSTA 4DIDA 3TE6A 4JLPA 5JCPA 1JALA 4JJKA 2NTYC 2B7CA 3RNLA 5KYKA 3GJ0A 4QGFA 5J4LA 1LF5A 3QE0A 1KK0A 2BV3A 3DZ8A 4MRPA 1BOFA 4PR0A 3AKYA 3ZZ0A 4D82A 5EP2A 2YV5A 2JASA 5EP1A 2J46A 5DI3A 4YONB 2MSCB 4HSEA 3FHOA 1UKYA 3LDAA 2PEYA 2YWHA 1NKTA 4IHQA 4X8HA 1COWD 1D6JA 4DSUA 2WWHA 3ZVLA 1Z28A 1SHZA 2CK3D 2WSSA 4A2PA 3ZVRA 4JIMA 1HY3A 1T3SA 1CJUC 3U44B 3TAHA 3L43A 5JZVA 4RZXA 1CP2A 3KQHA 1T4GA 2HV8A 2AX4A 1XJQA 5HTKA 3NG1A 3QXSA 3UMFA 1Q20A 5JHHB 2MMGA 3X1WA 2VHUA 3FTQA 4PPFA 5JWRA 5JLJA 2ERYA 1F48A 2D7DA 5C18A 2YC4C 4PHTA 5FL7A 2OLJA 5H68A 4NBSA 4OQNA 4K8OA 1M74A 2C2HA 3U2QA 4BWYA 1KO1A 5FBQB 4TT3A 4TTPA 2Q0HA 3HJNA 3TUIC 4WAUA 4Z8XA 1WE2A 3M0EA 1G16A 2P5SA 2XNDA 2VA8A 3VX3A 3W34A 2PX3A 2Q3MA 3PR1A 4JLNA 4P32A 3VR3A 4AY2A 5IDVA 1D2NA 3QG1A 4FXPA 2AXPA 1FUKA 3U7HB 1JQJC 2GXQA 2RGBA 3RWOA 5AUPB 2BC9A 2GJ9A 1E2QA 5FUXA 2IYWA 4JVMA 4XVUA 2HUPA 4TYPA 2REOA 3FMIA 1VCNA 3A6PC 4KCGA 1MO6A 2QGZA 1NJGA 2ZTSA 1N2CE 3BE4A 1LS6A 1RZ3A 1QRAA 4Q02A 3GLHE 4AKIA 5KUTA 1FMLA 3O8CA 1W4CA 1M2OB 2EFDB 2QRNA 1YZGA 2FX3A 5DYGA 4KXFB 1N6KA 1GRNA 4XH9B 4S35A 5EE9A 5BW8A 5FOUA 4M21A 1BO6A 3W6OA 2QMUA 2A5DA 2ZRLA 3WNBA 3ZGXA 2FGJA 2BKEA 3SI7A 4E5UA 2J0QA 1XB2A 1E2GA 1XTQA 2ORIA 3WYFA 1FTSA 1G4AE 2FJUA 1JR3A 1IN5A 3LW7A 3ZIAA 1F3OA 1A5TA 1WF3A 1KAGA 2BEKA 2XTZA 4AURA 4QOSA 3CBQA 1UBGA 1JQLB 2ODNA 2ZI5A 2H1LA 3FFAA 3T1OA 3CUEF 1GKUB 3TKLA 2ZJOA 3T34A 5CYOA 3OFND 1U81A 4CDGA 1HEIA 2AN9A 1KK1A 4O2RA 5C1BA 4JL6A 3KZ1E 1E9SA 1J99A 2HT6A 1DPFA 1X8LA 2GILA 3KQUA 4HLDA 4A8JC 5G41A 1OIXA 1E79D 3IKJA 4NZYA 3EASA 5L8VA 2OBNA 2QE7A 2IYSA 4OI2A 3NBZC 5EE5B 5JI2E 4MDEA 1R7RA 4UXHA 4A1FA 1H8HD 4D0NA 4K81B 2Z0MA 3KKMA 2BOVA 3IQWA 3PITA 4KHZA 1XPOA 4KJZA 3FPAA 2IYLD 1X3SA 4ERNA 3SFZA 5CB8A 1ZAKA 1E2DA 1US8A 3TMKA 2FPKA 4BPBA 4OI1A 1EWQA 3GMTA 1OLOA 4HAZA 5LBIA 3FKSA 3SYLA 5F98A 1K5GA 2O8DA 5F3WB 3AKEA 2OXCA 2O8FB 1W5TA 3MG9A 4B3BA 1YR9A 1VDZA 3RSLA 1XD2B 4CEIA 3SS8A 5FUYA 4FWTA 3AVUA 5FTKA 3R9XA 2QENA 1PV4A 2RGXA 3Q5EA 2HF8A 1F5NA 5L3QB 1BIFA 3EC2A 1IBRA 4PZZA 5AR1A 1CULC 3B85A 3UXMA 4QXAA 2DHRA 2BBWA 1F6BA 1WMSA 3SEAA 4B73A 1AS3A 4W5JA 1R5BA 5DYIA 5FBVB 1CU1A 2IS6A 1AZTA 4EFNA 4FMDF 3GLFE 1KI7A 2CL6X 4BE7B 2J0VA 3K09C 4NYIR 3T5DA 4R71A 2DFTA 2XB2A 5J4YA 3QKSB 1G7TA 4G5SA 4P0TA 2W2XA 3GJ5A 1NNEA 4B6EA 2ZR0A 3SOPA 1QDEA 2JLRA 1X6VA 4V0MA 3NBYC 3NDPA 2ZPTX 2WHXA 2ZQ5A 1J8YF 4D2IA 1LVGA 2ZVPX 4US1R 1S9HA 3RC3A 2CBZA 3AF1A 2QT0A 4W7SA 5AJWA 4C7OA 5K8TA 2Q3FA 3OE7D 4Q4HB 1FNMA 3E1SA 4FN5A 2QT1A 3OESA 2VIIA 4D81A 4F93B 1NLZA 3DPUA 1HQCA 1Z29A 2ZSEA 1M7HA 2RGDA 4GRAA 1TUEA 1DAIA 4Q7KA 3ZH9B 1XRJA 1C4OA 1YZLA 2WSSD 3CZQA 4HB0A 4EPTA 1DO0A 3U3JA 3LO5A 3AVOA 5J5CA 1QHYA 4M9SA 3TR5A 1ZD8A 2PEZA 1S9DA 5TXGA 4Q7MB 4DLZA 1E9DA 4PTLA 1EK0A 2BKUA 4FIDA 2BIFA 2RB4A 1S1MA 4JKYA 3K1JA 1ZVQA 3EZFA 3B5JA 5DI3B 4KODA 4EJSA 2R9VA 3WNDA 3AGQA 2KI5A 2ODWA 3IIJA 1EFRD 2IXGA 1M7GA 3K0CA 1FQJA 2O0JA 1OE0A 3CF0A 5DSZA 4URZR 4QRHA 5CM9C 1KYIA 4KI0A 1JAHA 4N0DA 5EXXA 1NG9A 4FD2A 3WMFA 3VX4A 1OH5A 3H0KA 2YOHA 1RJ9A 4EPXA 1II8A 5AJZA 2ZYWX 3THOA 2CDNA 4PHFA 1TX4B 3B82A 1II0A 1Z6TA 3RHFA 1CJMA 3EIHA 4X8OA 4LPSA 4QM6A 4KFRA 1OXVA 3CRQA 4QG7A 2D3WA 5FPTA 1EFUA 1GKIA 2FE4A 2QSZA 2WOOA 4LC0A 3I8SA 2ZE8A 4Q1CA 4UNSA 2VHTA 4LHYA 1KTVA 4XVRA 2WJHA 2FNAA 3ZJYA 1F2UB 1WBBA 3R7WA 4P4TA 1IXRC 4GL2A 4KLNA 1OIVA 2ANBA 2RMKA 2WPDA 4NCHA 4BLTA 1ZU4A 4D4JA 2FFHA 2AXNA 2RGNA 1E3MA 1G5RA 1T5IA 2BWJA 4A36A 4DLYA 4PHGA 4R7ZA 5E7JA 3VKWA 5CLLA 3CNOA 2GEUA 3WBJA 4TYWA 2VSXA 2AWOA 3PUXA 5HKKA 3T1QA 2XGJA 1SKYB 3ZIAD 2IBMA 1CR2A 2JEOA 2ORWA 3QG5A 2A5YB 3AP2A 4MITA 1NL3A 5B2ZA 4BASA 1GNQA 2QZ4A 4Q4AA 3NBFA 4C0SA 1Z06A 3DKVA 4KLZA 4ZCLA 1D8TA 2ZE6A 2WJJA 4NU0A 2W0SA 3FOZA 2WKRA 2YC2C 4HB4A 2G88A 1AZSC 2ZREA 3RRNA 1SVMA 4H1VA 3CNLA 4C0BA 2GVDC 4PO1A 3GPLA 2LCFA 4AG5A 4HLUC 3VFDA 3KUDA 1E2HA 2GJAA 4LC1A 4TLEA 2XSZD 1L2TA 3K70C 4LYAA 3MJHA 5HCIA 2GJKA 4M22A 4TYYA 4QBGB 4DWJA 3OIWA 4C0HA 2YVUA 3F5FA 4AWXA 5HE9A 4ZV4A 5DLQC 3W6PA 2VEDA 4F4CA 1T3HA 2GEDA 2P65A 2IS2A 5LB4A 3MMPA 2VP6A 3FKSD 1NF3A 2B21A 4JBXA 4Q19A 3SNHA 1XXHB 4D80A 3I5XA 3UG7A 5KSPA 1E9FA 3O8RA 2VP9A 1OIWA 3A36A 4LCBA 2ZSAA 1G3IA 1FL9A 2V54A 4ZPXA 5FOVA 5CDFE 3K0AA 4BZQA 1TTTA 2QTVB 3UPUA 4F7WA 2CHQA 1ZNZA 4C0KA 4EQ6A 2VF8A 3WP1B 4BEBA 3S1AA 1OXUA 4FMCB 1KNQA 1G8PA 2CVFA 3CF6R 5IT5A 1WA5A 1KO8A 3GP8A 5BQ5A 3L0PA 1HV8A 5D3MA 1CJTC 5DHFA 1OKKD 3W9YA 2ASEA 2QUZA 3QKRA 3EARA 2PH1A 1G20E 3FKQA 1FUUA 1YKSA 4Q00A 4ZKDA 4HZUB 1IM2A 3EAQA 4NCNA 1SKQA 3SZRA 3MWKA 1CLUA 4CIDA 3GLIB 1QVAA 4TZ6A 1EG7A 5KTYA 3HDTA 4XSGA 5G40A 5EE1A 3MLEA 1FTNA 1NBMD 4BFYA 4Z54A 4G1UC 4OQLA 1TU3A 2F55A 4D26A 1N0VC 2W58A 4CRWB 1BS1A 4MKIA 4C30A 5KNDA 1XEXA 4DEXA 1A4RA 1AIPA 3ZLJA 1G8HA 2FN4A 221PA 1P62B 1IY1A 3BXZA 1NIJA 3I32A 3SYKA 4JLAA 1DS6A 1GITA 1DAEA 1XZPA 2HCBA 1HQYE 3EZ6A 3LWNA 4JS0A 1UPTA 4POAA 1QHNA 2R6AA 3REGA 4PANA 2IHBA 1U8AA 2O0HA 4ACBA 3UKDA 4MUAA 1G6HA 3I4LA 5AK0A 4C2TA 4IEEA 3PV0A 3CF2A 3PFIA 4QBHA 1RRCA 1P4SA 1TEVA 1T8UA 2AHOA 4I99A 1T0JB 3K0FB 3BH7A 4M53A 2V4ZA 5FPSA 1E9RA 2V3CC 1P9RA 2EQBA 4BZPA 3H84A 2ZAMA 4ZI3A 3THXB 1G6OA 4OK6A 4WA7A 3QVUA 3IPYA 4B3DA 2C8VA 4HDQB 4V0KA 4WZAE 4D0GA 3B1WA 2JLXA 4C7OB 1DAMA 1KI2A 1XWIA 3CRW1 4OKSA 2QP4A 3K8YA 4NDZA 3C5CA 2ZRNA 2PJZA 1WXQA 1COWA 4A0HA 3EA0A 1OB2A 4MYUA 1CRPA 2AKYA 1P5ZB 4MRNA 2PJRA 3VR6A 2FOLA 2CE7A 2ZRDA 1LW7A 3VKGA 5KO2A 4ZDIA 1QZXA 1VHTA 2D7CA 1Z08A 2G83A 2OO7A 3PUYA 1UBCA 4B2IA 1SVWA 1KDRA 1NRJB 3FMFA 1YVDA 2I4IA 4DLUA 1CR4A 3BFVA 4XJXA 1E1RD 4DIEA 1KSGA 1Z22A 4KFTA 2Q9CA 3RVBA 4AK9A 4V0LA 2OAQ1 2VP4A 2ZJZA 4M1WA 3V4FA 4BFSA 3FWYA 4IDPA 3LQRA 3AVWA 1YZQA 4B3FX 1IJFA 1KI9A 3F8TA 4YDSA 2QN6A 3QUSA 4RJLA 4B71A 3ONWA 3KQKA 4WZBE 1X86B 2GZDA 1P9WA 5GJBA 3BIFA 3KKNA 4KSCA 3X1XA 1E0KA 2R6FA 5EQTA 1RJ9B 1RRFA 2G6BA 4FCWA 4RD4A 5FFMA 1II8B 4ZCMA 1UKEA 3I3SR 2HLDA 5JJKA 4JMPA 1YR7A 4L16A 1E6CA 2W00A 1LB1B 4B34A 1SVSA 1ZCAA 1NVXQ 3Q5DA 4DSNA 1NN0A 4FCVA 4U5XA 1E2NA 1KI6A 2BDTA 3W8RA 1FQKA 2IK8A 3P4XA 3R9IA 2IYRA 2A3RA 2XXAA 2XX3A 1SKYE 1S2MA 1CS4C 5HKKD 4OHVA 4C0QC 1ESNA 3AEZA 4HLQB 3QBVA 1Q44A 2H5EA 2CCGA 4F91B 1R0YA 2C04A 2CJWB 2F1JA 2ONKA 3A8TA 5TY0A 1MO3A 1ZMXA 4C2UA 3RDPA 1T6NA 1B23P 2OG2A 2QI9C 5E3HA 4M1YA 4GMDA 1JB1A 3L0SA 2QQEA 2ZR7A 1HURA 4YMWA 1CF4A 3NBXX 1VPLA 4A2WA 2H17A 4RD0A 1TNDA 1XMVA 4LSGA 1KOFA 1G3MA 2ZRGA 4NP6A 1I2MA 1GVNB 2OV2A 4GP6A 4LHWA 4DB4A 1OYYA 4EJSC 1IQPA 5KSZA 2NZ8A 621PA 4DDTA 1FZQA 4AKGA 3KL4A 1GDDA 2HJGA 5E7MA 4Q1FA 2QBYB 4GPTA 3CPJB 2A5FA 1ZP6A 4TL7A 2MSEB 1E79A 2QRZA 1R2QA 2ZJ8A 4RFVA 1G21E 1XXHE 1SULA 4GBMA 5KOYA 2VP0A 3LY5A 3KXLA 1CEEA 1JXMA 1OFUX 2OE2A 2JLUA 1AQYA 3BERA 4Q4LA 2ZJ2A 3IBYA 3C8UA 3F0TA 1N6PA 2IYUA 4NCKA 2NO9A 3BH0A 5FTNA 3QSYA 1W46A 2EVWX 2OEPA 3EIQA 4XD7D 3TSOA 1MV5A 1G8GA 3T61A 3QEOA 2ZIAA 3UMRA 4D0LB 3AVYA 2VH5R 2XTNA 2OFWA 521PA 3ZZUA 1ZD9A 2C9CA 2GNOA 5A0FA 3QKSA 1BYUA 3GLIE 2JLWA 3DEFA 3FE2A 4B2LA 3JVUA 1P2TA 4OI4A 2PCJA 2YWFA 5HZKA 2BM0A 5KNBA 1NG1A 4NH0A 2IUUA 2FDCA 1R8QA 3ZS8A 3T06B 4Q4JB 3ZQ6A 5J47A 2CL0X 2FPMA 1KNXA 2WJYA 3BRWD 3WBKA 3DM5A 2PL3A 1E2EA 3IQXA 4B33A 4E03A 4B32A 5D3MB 2HCJB 2KSQA 3H86A 1R6BX 4M9QA 2B6HA 4WOPA 1DAHA 3H4MA 4MH0R 2JIZA 3KFVA 3NC0C 4KVAA 3CZPA 3OIVA 4TLDA 1RYHA 1IJEA 1KO7A 4GI7A 4US2R 1SVOA 4O25A 1KDPA 2PT5A 2J59A 2ZRMA 2C95A 1Z0DA 3AF0A 2PZEA 4IXNA 4M4SA 4YXWA 2IWRA 1Y63A 1KKMA 4PPQA 4XWKA 2P6UA 4TSFD 4V0ME 2WMNB 2GK7A 4PC1A 4A6XA 1N5KA 1XEXB 1XZQA 1UKVY 2ZITA 2WIAA 3CO5A 2IYTA 1N6IA 4AD8A 1VCMA 1Z0IA 1KJZA 2YINC 3OE7A 5JS7A 1VG0B 4YQFA 4TQ9A 5SZJA 1E0SA 4F4JA 4QM7A 3QPWA 2BBOA 2C77A 4G5RA 2IXFA 1CRQA 2FSIA 4HUQA 3VTKA 2WWYA 4PO9A 4OHYA 3SDZA 1OHHA 1NLYA 4DSOA 5G3ZA 3GFTA 4CT4B 3IO3A 1UM8A 3PIRA 1IN4A 2V7QD 4DC9A 4PAMA 4L4UA 3AH8A 1E0JA 3WHKA 3ADBA 2AD1A 2BEJA 3B1VA 1NN3A 1V43A 4RFSA 4BZXA 4C0AC 3VU9B 5DIFA 4FI3C 4Q48A 3X1YA 4LGMA 1Q21A 3BWDD 1N6OA 2NO0A 3E2IA 4B2PA 1IY2A 4P3YA 1EFRA 1J2JA 2QTFA 1SXJC 4FCTA 5GJVC 2QM7A 3WYGA 2F9MA 2P67A 2QROA 1SZPA 2O8CB 2E87A 2RCNA 4DLTA 1FP7A 1F2UA 2OCYC 4GDFA 4D4MA 3U4QB 1RPZA 3BK7A 3AF2A 2UVQA 3FVQA 2ERXA 2GDJA 1Q57A 4MRSA 4TL9A 1GP2A 3WRYC 1E1QA 4OJKA 2OILA 3A4LA 3TW4A 4AYWA 1YHNA 2R6CA 1EX7A 4PFSA 5IF9A 2IF2A 2BJWA 2ZI4A 3IDQA 2HLDD 2A5JA 4ZCIA 1VTKA 4L9WA 4R98A 5EXSA 5K8LA 3JVVA 2AD5A 1NY6A 1W4RA 1ZM3A 2QU8A 3M1IA 3EX7C 2IS4A 4WVFA 2O52A 2ZSBA 3QIAA 2GRJA 4G5QA 2XJ9A 4LBVA 3AF4A 3M6AA 4MGYR 4B74A 3PCRB 4NONA 3A1TA 3QXHA 4B35A 2WKPA 4DJTA 4P33A 1CKEA 1CXZA 2XOKD 2OHFA 3VQTA 1HT2E 1LF0A 4F4IA 5L3SA 3NH9A 4PO8A 1G7RA 2ORVA 4Z8YA 4O2LA 4EPWA 1VYVA 4TMZA 3TGPA 2DB3A 4DKXA 5IRCD 3MSXA 1KI6B 1KK3A 1XTSA 3CIOA 3T1TA 3LVQE 1EWRA 2XXAB 4LJYA 2QPOA 2GAAA 3IUYA 3K0SA 5FBLB 4CZ2A 3FHCB 3MRSA 1GRQA 4Q66C 3IO5A 1N0UA 3LRPA 1G3QA 1S4QA 5CK4A 3J81k 2CLSA 4MKGA 3VKHA 3HU2A 1W4AA 5JJIA 2JLVA 3TRFA 1EGAA 4HAUA 3GJXC 5FI1B 1XXHA 4EPRA 3EPJA 2QORA 4MQBA 1A2BA 5ANRB 2QMHA 1ZRHA 1JPNA 2ZRAA 5JEEA 4Z1MD 2WJGA 2CCKA 1T0HB 4G0NA 4OL0A 4NYJR 1DOAA 5DH9A 4KSBA 4TQAA 1MH1A 2YKGA 1NLFA 4B75A 2XSZA 1E99A 2BMEA 2GBLA 1Z0AA 4DCVA 1S0UA 1RRPA 5JECA 4MGKR 1KK2A 2ZRJA 4U00A 2PBRA 1ZD1A 1F2TB 1W0JA 2AK2A 2OCAA 3C7KA 4DDVA 3ICEA 1J70A 2GVZC 2WAXA 5JFGA 1ZU5A 3AB3A 2BMFA 2FG5A 1OPXA 1MOZA 5DI9A 4HZUA 4ZO4A 1SVKA 3A37A 3L8YA 3GLIA 2XB4A 1W2GA 1V5WA 1TQDA 2AK3A 3QXCA 2ZS9A 2DCUA 1UBEA 1ZUIA 1U99A 3DHWC 2J87A 2HXYA 3H1TA 2Z4RA 2FGKA 1XMIA 4ILEA 2PMKA 4HEJA 5GJWC 3WP0A 3ADCA 1P3JA 4XWAA 3AM1A 2DWOA 2Q9AA 1OKKA 4JLMA 4DLSA 4A0GA 1NSTA 4WW0A 4Q9LA 2RAPA 4DBLC 1ZUNB 4L15A 1D9XA 2IUSA 2J5XA 3VNUA 3JZAA 2JIZD 1GUAA 1TF2A 1NBMA 2V8OA 2ZUCA 4YLGA 3R8FA 2DBYA 3HYTA 1TQ4A 3D31A 1UDWA 3P26A 4WZ6A 4YXWD 4GSYA 5FH9A 1NY5A 4DCSA 2P3SA 3FDIA 1UJ2A 3K0FA 5BN5A 1D5CA 1EFCA 2IT1A 2KBFA 4AKEA 3B8HA 3THXA 3ZQJA 3CH5A 3SBDA 2B8TA 3GJ6A 4V03A 1T9HA 3KJGA 2ZXUA 2E1RA 4MYHA 1HYQA 3KJIA 4EDHA 2NO1A 4KITB 3PEVA 1UFQA 2QL6A 3IHWA 3KKPA 2C5LA 4LJ9A 4QJ4A 3NHAA 1OW3B 2BMJA 4C9BA 3A4NA 4YMVA 8OHMA 4AKHA 4M0LA 3QKUA 5GADl 3ETLA 1OHHD 2DFNA 2IYVA 3LBHA 4LYFA 3RYTC 2N46A 3CPEA 4URUR 3AVVA 4B76A 1UEJA 2H7VA 4ASUA 1NP6A 5JJLA 2HT1A 1E2JA 1KGDA 4HI0E 4Q9IA 4DDWA 3EZ2A 1E32A 4WBSA 2IYQA 3KJHA 4KAXA 3SE0A 2RGEA 3RC8A 1VMAA 1YR6A 1VCOA 4BRWA 1DBSA 1XTKA 4K46A 1G5PA 2MMCA 1QHIA 2ZYVX 5J4KA 1EESA 1PUIA 3DDCA 4NYJQ 3KUCA 1I2DA 2GF9A 5E95A 3WMGA 1UAAA 1P2UA 1RYFA 2R8RA 4HUQB 4IOKA 1ZCBA 2XTMA 2F43A 2YWGA 4NMMA 4B6FA 5AUOB 2VP2A 4CEHA 1PLJA 4DB2A 4BFVA 1Z5ZA 4US0R 1PUJA 1E69A 4NCIA 3OAAA 3TW8B 3U7GA 2YOGA 5TARA 1W36C 1E1RA 2HJVA 3UG6A 3V9PA 1E1QD 4LI0A 2B92A 1NVWQ 1EFTA 1U9IA 4RFSB 1SGWA 3A4MA 4I1UA 4GNKA 1QG4A 3DOEA 4PAQA 3K70D 1NMXA 2Q6TA 5CJ2A 3PENA 3PUZA 2ZS8A 3KQNA 1KDTA 3OIUA 2XZLA 1VKJA 4TQUS 1ZIOA 2J0UA 3ND8A 1YZNA 3EIEA 2EWWA 3L0IB 6Q21A 1DELA 3PJRA 1ZC3A 3BBPA 4KYUA 1M6NA 2A78A 2CJWA 4LBYA 5TB5A 4TZ0A 1S96A 3NEJA 1T8TA 3W90A 2WWGA 2JDIA 2D2FA 3Q3JB 5CJPA 4PHHA 3TQCA 2ONJA 3B7GA 1OV4A 5F2EA 3C41J 2O5VA 3ZD7A 4TYQA 1GIAA 3LX5A 1OFIA 4IVRA 3DOFA 4RKEA 1T3LA 4NYIQ 1N0WA 5BYKA 3K70B 3BC1A 3REFA 3T12A 2EFEB 2G9NA 1G64A 2A9KA 1FX0B 4JL5A 2QMEA 4HYYA 1G8FA 1Y3AA 3W6NA 3U61B 2QBYA 2F1RA 1X8JA 2ZS7A 3BB4A 5K8IA 1M34E 3DL0A 3QEJA 4IDHA 1AGRA 5DHAA 4DVGA 1MKYA 2Z6VA 2HEIA 3RS2A 2FSGA 1M8PA 3DVLA 1W1WA 5JBQA 4TMXA 2Z43A 1GNPA 2P6NA 3BAFA 2PZGA 2O8EB 2ZRCA 2V6JA 1CTQA 5L3SB 5B57C 4CW7A 1TL7C 3HP1A 4UNPA 2XEXA 2JATA 4HAWA 1L4YA 4LY6A 1UADA 3KXIA 4CEJB 1QG2A 4LV5B 1W0JD 1XCGB 2ZJ5A 1IONA 5G3YA 1Q3TA 1E9EA 5LB2A 1G8YA 3LQQA 3CX6A 1AK2A 4WXPA 1XCPA 4FMCF 3CRVA 4F38A 3L0OA 1E2FA 4Q1BA 2PCLA 1CIPA 4Q7JB 3Q85A 4PSVA 3KB2A 2VO1A 3K9HA 5J4HA 4FW9A 4JJZA 1U0HC 3T5GA 3CR8A 4Q4JA 3SYNA 3JZMA 1WP9A 2WICA 5BN3A 2JA1A 3CRMA 1MT0A 1RVDA 2C99A 1TQ6A 1H65A 1TF5A 3KXKA 5CB6A 4XD7A 2QA5A 4I4LA 1U98A 4LV8B 2Y8EA 2N42A 2WWWA 2WJIA 2C98A 1MR3F 2Z83A 4O3MA 1N5LA 5JCZA 1KI1A 2ZI7A 3LH5A 2OCBA 4MRRA 1LTQA 4PSAA 2BCJQ 4B44A 1Q1QA 1W7AA 1HE1C 2OFXA 4AYTA 4P4UA 2NG1A 4IOJA 3UWKA 2BCGY 1YZUA 2XZOA 821PA 3GEHA 3PEYA 4NHOA 2VLIA 1G5TA 2JJ1A 5JMTA 4IRUB 4KFSA 2ZJAA 2WAYA 1YQTA 1D2MA 1P75A 3ADDA 1N6LA 1IOZA 1N5IA 4HB2A 2VBCA 4Y0AA 5CIWA 3TUZC 4ZI2A 1Z6GA 1XEWX 1KAOA 2IYYA 3EA5A 2DPXA 4Q9KA 5EUQB 2W0MA 5HPYB 1FW6A 2EFHB 2F1IA 1EXMA 3VR1A 4QJ3A 5JRZA 1VG1A 3HWSA 3E70C 2W83A 3OEED 1KSJA 3IIKA 5L3RA 1OH6A 1R0ZA 3VHLB 3EPLA 2IF0A 4RD2A 2QAGB 4TSFA 3B1XA 1Q12A 3SHFA 5FI0B 4BLOA 4UNRA 1BMFD 5CIQA 4DRZA 1XX6A 1ANKA 1ETUA 4ZKEA 4BLQA 2DWQA 4QGHA 5F9FA 2WSMA 4ASUD 1Z47A 1JI0A 3KQLA 1CJKC 1E2PA 1OH7A 2H18A 5B64A 3VU9A 3RANA 2FPLA 2VPPA 4HDOB 1WB9A 5FUWA 3Q72A 2JLSA 2Q3HA 1PZNA 3EPKA 2F3TA 4RD6A 2O8CA 1B0UA 2V55B 2FA9A 3U4QA 4TTRA 3SBEA 4TMKA 3T35A 4PPNA 2V7QA 4MGIR 1P7CA 1AQUA 3X1DA 3IGFA 3MFYA 4IOLA 4UQOA 2NO6A 5FOTA 3LX8A 1YU9A 3OAAD 4PC6A 4A0RA 4QNRA 4B47A 5JWOA 2J7PA 3QNUA 5LPNA 4DHEA 2BM1A 2H92A 4R9UC 2R62A 3U6BA 1E9AA 2CNWD 1L7VC 2FEMA 3FHTA 3G0HA 4M1SA 2JJ2D 2OFOA 3O47A 4Q01A 1SVIA 3M4YA 1F60A 1YRAA 3U3MA 1UKZA 2QTHA 4CEHB 3WMEA 2F43B 2ZU6A 2EFCB 2ODEA 2AFHE 4N3NA 3CPHA 4II7A 3RSOA 2X2EA 4A8JA 2QM8A 1RE0A 5FPYA 1CJVC 3C14C 3QOFA 2JDID 1KI4A 1R10A 3EZ7A 4LV6A 2FMXA 3UMSA 4JLBA 4PQRA 4EAQA 5AWFC 3I92A 1ZM7A 2REBA 3RABA 4DLWA 5EP4A 3TNFA 3ZD6A 3TVTA 1GFIA 1D9ZA 2WM9B 2QP9X 2X77A 4NCJA 4X8LA 3BFXA 2KE5A 1N6RA 3KX2A 5BXQC 1Z0FA 3BB1A 3CR7A 5LD2B 4JBYA 2J0UB 2FFQA 4YC7A 4TMVA 5LDDC 1IXZA 2JGNA 3BS4A 4HB3A 1X8KA 4QHSA 1PLLA 3CX7A 3OIYA 1GM5A 1NI3A 3MUFA 1IAQA 1A7JA 3AKCA 2WKQA 4PQYA 3NHBA 2XOKA 4J0QA 1E0AA 4OJQA 5AJYA 4EPVA 2XZPA 2ZM5A 2F3RA 2FFAA 1H8EA 3PEUA 3D7MA 3BGWA 4Q1DA 1AA9A 3HPQA 2GXAA 1UEIA 2ZAOA 4Y0VA 1KZGB 2FF7A 4P4SA 1SHKA 1AGPA 1QF9A 5CYPA 3LXXA 1F2TA 2YYZA 1R5OA 5EE0A 1ONBA 3LXRA 5ELXA 2HDNB 3BFKA 4A92A 5JI3E 5C4GB 4QJ5A 3K0CC 4UNQA 4Q9JA 1ZIPA 2FZ4A 4LJAA 5FOXA 5C46F 1IN8A 5L3VA 5H70A 1P72A 4OI0A 1XTJA 2WV9A 2ZRFA 3B60A 3DM9B 3U6KA 4Z1MA 4RD1A 3U5ZB 2UKDA 4ZDWA 4DUGD 3MAAC 4EFMA 1UDXA 2QNRA 2D74A 1JECA 2WZQA 5IHPA 3WHLA 3X2SA 1NJFA 4Q47A 4R2IA 3FMPB 4FWIB 2W2TA 4XTCS 1GL9B 4IXMA 2JLYA 1CBUA 1VIYA 1X1SA 2H8KA 4ACAA 3SQXA 2RHDA 3NC1C 3O8DA 2VHQA 2C96A 5H1YA 1IHUA 2IW3A 1OH8A 2RGAA 1KMHA 4OQMA 1XJCA 2D2EA 3UWOA 1ZYUA 3QXXA 4UNNA 5TMPA 4GFDA 1KDOA 2NGRA 2IX3A 4YDHB 2F6RA 2OBMA 4JL8A 3IPXA 4B43A 2RGNC 1IY0A 3I5YA 2EYQA 3SHWA 2BJVA 3AP3A 2P5TB 3NH6A 4CGZA 1TMKA 4P31A 4JVNA 2AR7A 2JJ1D 4UXJA 1ZNYA 3K9NA 1PVOA 4I81A 1BKDR 5SZKB 2NPFA 4JBWA 4BFUA 2J45A 1RFLA 3RLFA 1P73A 1RRGA 4M2LA 4RCYA 1KMQA 2GKSA 1SXJD 1Z3IX 4QL3A 3QPVA 1FNNA 3QVVA 2ZRPA 1XEWY 2FZLA 5EZ6B 2QPAA 1XTIA 3U60B 3W3AA 1NBME 5B58C 2J7KA 3VR4A 1KHTA 4YMSA 1GRRA 3QBTA 4LBWA 3P4YA 2VRWA 4JT2A 5FTMA 2EYUA 4HUTA 1VYUA 4GOJA 1W49A 2HXSA 1Q3HA 1E2MA 1JNYA 1LV7A 4Q18A 4LK2A 2CVHA 2R2AA 1R4AA 1TADA 1GSIA 1SXJB 4QFMA 2R6DA 4ZIRA 4IDNA 5FR1A 1WRBA 1Z6AA 1HUQA 4PC7A 4R2HA 4DLXA 2V1XA 4YMTA 3ND9A 5K8UA 1P2SA 3K9LA 5JRJA 2KJQA 2G1KA 4JZKA 5B30A 2WWIA 3EPHA 4LWZA 2KWIA 2ZYTX 4IOMA 3H2YA 4OBEA 2DYKA 4HDCA 1W47A 1S8FA 3B78A 3GJ3A 3B2EA 2FFBA 1XCMA 3MCAA 4O0MA 4OQXA 5JEDA 3B6EA 4MYCA 3TVDA 1FP6A 4DCTA 2YNMA 4JLVA 1BH2A 2GEVA 2YOFA 4PSKA 4Q1EA 3EC1A 2GCOB 1ZUHA 1NVVR 4V0OA 4LBZA 2J7PD 1ZC4A 3O8BA 4IFBA 2JAQA 2OBLA 5FBWB 1GILA 2L0XA 1K8RA 3SR0A 2NOAA 1R0WA 721PA 3AVXA 2I3BA 5KHOC 4D25A 1E2LA 2NIPA 2Z4SA 1CR0A 1EX6A 3U7EB 1U94A 3R20A 2ZROA 4QBIA 5KSYA 2NPIA 5DGXA 3AGPA 4CF7A 1KO5A 5DN6D 1P9NA 3EWSA 4LYJA 2X8AA 5KPJA 2ZR9A 3N70A 1P2VA 4HAVA 4LJ6A 4CT5A 1YJ5A 4LJ7A 5KDOA 4MYTA 5EP3A 5KSOA 4LOAA 1XEFA 2J3EA 4HLUA 4GZLA 1E98A 1GOTA 3DZDA 2ATVA 4Q1AA 4PXAA 3OZXA 3AVTA 2CMKA 5IK2A 3ZZTA 2WMOB 1OYWA 4DLRA 3I73A 1U8YA 4ABYA 1R5NA 4E09A 1Z2AA 1MRNA 3BOSA 3LBIA 3EXAA 5J4VA 1FX0A 4PPGA 1Z2CA 3D6TB 2GETA 4LHZA 4A0FA 4BRUA 1R8SA 3GJ7A 4TL6A 1OXSC 4QNMA 4BECA 1J90A 2XAUA 4MKFA 1CR1A 2XITA 3MWJA 3LA6A 5HE8A 4A8JB 3OEHD 2ZI3A 5SZIA 1G17A 3B9PA 5EJEA 1DG1G 1FMJA 3I8XA 5AJXA 4H1UA 1E94E 3LBNA 2O8EA 2LKCA 3W8NA 3IHLA 1DARA 2G0TA 3VMFA 4I1VA 2WIBA 1H8ED 1GAJA 5FUVA 3U3KA 2ZUBA 3P32A 2O8BB 3PUVA 1VYTA 3N2IA 4W9MC 3CONA 5KNCA 2ZRBA 4BQSA 4CEJA 3AVPA 2UZIR 3GEEA 5E7IA 2ZANA 3UIEA 1W2HA 1DAFA 3LVRE 1EFHA 4JYCA 4ON9A 5FL3A 4RZUA 3QF4A 4V02A 5JSZA 2VSOA 2DR3A 4BUJA 3NTUA 1OT3A 1KO4A 2GCPA 2V6IA 3B1YA 3NEYA 1A2KC 2OT3B 5UKDA 3EW9A 1J7KA 3L82B 3E5HA 3VNVA 2IC5A 2WOJA 2A2ZA 2OCPA 4QGGA 3GLGB 4P4SB 4BFWA 1TUIA 2YHSA 3AF3A 1LY1A 1L8QA 2QMOA 3CX8A 4LUCA 3T1VA 2JJ8A 2ZSDA 4D6PA 1R0XA 1ZM9A 2EFGA 2OSBA 1KJWA 1YZKA 1GG2A 1JAIA 1HH4A 1AKYA 1NVVQ 4OK3A 1I4DD 5AJVB 3BH6A 1KY3A 121PA 2A30A 5KPDA 1LFDB 1P6XA 2QAJA 5CITA 1OB5A 2ZU0C 2DY1A 5GVRA 2ZYUX 2GAOA 2OUKA 2QGNA 1TU4A 3QJYA 4FINA 3QF7A 4D4KA 2QG6A 3NDBB 3SJCA 3RRZA 4DCUA 4KO8A 4BFXA 2V9PA 3RRYA 2TMKA 5TVKA 2GF0A 2ZRIA 2LKDA 4A9AA
chains in the Genus database with same CATH superfamily
2BP7B 3NTVA 3TLAA 1WXXA 4CLRB 2VF2A 3B6IA 5KWEA 1VKZA 3BF8A 1VSBA 2QY9A 1XKLA 4HNSA 1K2WA 2EIXA 1NXVA 1MP0A 1H69A 4KGXA 1SXIA 1V7CA 3NWJA 3SZGA 3W1VA 5JPCA 1NUPA 2QP3A 2IWHA 3EN0A 2GYWA 3CQ9A 3DF9A 1I6WA 1L7XA 1YZHA 5FUMA 4LXGA 4Z1MD 5LOVB 4JITA 2IDMA 1NKSA 3NKVA 4ARAA 4M87A 4Y9UA 1O94C 1NM5A 1T5LA 2CNLA 2W6ID 2UV8A 4JYBA 4QYWA 3T0IA 3M81A 1QP0A 1Z83A 2CLIB 2J67A 1SMKA 3J7TA 4MW4A 3RQIA 4Y18A 4E5NA 4WLNA 3R9WA 2JLZA 3AETA 1V11A 1OFHA 2QD2A 2RGUA 3GWGA 4RH1A 4XYMA 4XE5A 4E5SA 4U7DA 3U4CA 4JGIA 3DUFB 4ZPJA 4MWTA 5CCDA 3KSUA 2WBLC 1Y4DE 3GOQA 3OCUA 3VR5A 3IILA 4IIJB 5LZ5A 1KI3A 4UFNA 3KYBA 5T6MA 3VVLA 4EB6A 3OEEA 4F4DA 1OSNA 4RMNA 4WACA 4BN4A 1WVGA 2GASA 2IL1A 5AKYA 1JG2A 1FU7A 4WI1A 3FKJA 4PG8A 2EZUA 1TM1E 1MX9A 3FJYA 3R1IA 3W04A 1LA2A 2DFPA 2Q28A 4FGJA 3HU3A 4JCOA 1LI4A 5KQPA 4PZPA 4EI8A 3WK9A 1Y34E 2VP5A 1AXGA 1JEEA 3N07A 2DPHA 1CNEA 1VRWA 3GD5A 3LU1A 5KVQA 4BCCA 1IIBA 2X7JA 2JCVA 3SBOA 3K94A 2D1RA 1ZINA 3K4QA 3R6GA 1QKIA 4J4HA 5FKJA 3STTA 4KQ6A 1HI9A 2PY6A 4IQ4A 5HEKA 1YGYA 2NPOA 2VJMA 2H07A 2ZSJA 4S1VA 1OI7A 1FRFS 3AFMA 3G7UA 4FNMA 5HQJA 2CDRA 3ZDQA 2HWKA 3VR0A 2JB9A 1Z4PX 3DO6A 4ZIRB 2FKNA 2DBZA 5EVJA 4HYEA 3UANA 4YHHB 1OA1A 1LPNA 4FHEA 4KDEA 4B3HA 3IEPA 3VHXA 4P81A 2QTBA 4HADA 5L4LA 3MMXA 1XDBA 2D5LA 3Q7PA 2X19A 3QTLA 4IXTA 3VU1A 5CLQA 1MO5A 3Q9LA 1UK6A 1ECGA 1DDIA 1LJUA 2VEOA 4PYMA 4Q82A 1C0KA 2W2NA 3U9TA 4DV1B 2COKA 4LN1A 4DQ0A 1KQGA 1RI5A 3I23A 1ORIA 4XZ3A 3SM3A 1W0CA 2ZP1A 1KAEA 4NARA 1AQLA 1RI3A 2ZEJA 3Q1KA 3VPAA 3BORA 4QYSA 1TJ3A 3E48A 3N1UA 3HHPA 4Q7EA 4R9VA 1C1XA 1U3DA 2CNWA 4L5YA 2BFBA 1EFVB 1SA0B 4LJ4A 3RJZA 4AMYA 4B82A 3AW8A 5IK2D 1KH2A 1I1NA 1EVKA 2VRNA 2FAXA 3PUIA 5EHXA 1KGSA 1UEXC 2JFUA 2RK4A 3FF4A 4TT3D 4PSUA 3IBTA 4ZT4A 3PQ3A 4Q4CA 4P3PA 3V1LA 4MTLA 1MX1A 4FFMA 4OQDA 1XHLA 1SNYA 4RMGA 5KOIA 3H2BA 4CR6A 4Q5IA 2VNJA 1PSZA 2I2CA 1Q50A 2PLWA 2BHRA 3LGXA 4OQFA 3ZTYA 4OSEA 3GA7A 1JHQA 4OHRA 4UUBA 5C4MA 1HPLA 1JEDA 2FPPA 1D5WA 5TDHA 4OQZA 2OV1A 4FE4A 1GFZA 3DKPA 3DE7X 1WD7A 4KXXA 4FEGA 4XM2A 1XCJA 3WY9A 2PKXA 4D9MA 7GPBA 3EFEA 2NUAA 1VZ3A 3OLVA 3QITA 3UMVA 3H18A 5KJ6A 3AEKA 3CY6A 5EE3A 3AOEC 4IJ5A 3W06A 1T91A 3WDSA 1NMZA 1JN0A 1LK0A 1MXFA 3DH0A 3DOCA 1J0BA 1POWA 2W2VA 5K8CA 3HBNA 4JP1A 2QTLA 4YLYA 1BG6A 2AN4A 4AY3A 3TIFA 4IWXA 1PZXA 5AUNB 1X1RA 4KTTE 1HT0A 3ZYCA 2GOYA 1Y3HA 3RSGA 4CFZA 4GH5A 4UM7A 2X5JO 3T99A 1EHCA 5AI9A 3WWPA 3TTTA 4OXXA 2G1JA 2R65A 1I2BA 5M04A 3O4RA 3RS8A 1KI8A 5KTTA 3TLMA 3K53A 3VPHA 5A9TA 4BUZA 5IUJC 8MHTA 3DMTA 3JQPA 1Y6FA 2VHCA 2BEVB 3GEMA 1R18A 4OQEA 1QJCA 3NPMA 2X23A 3A6JA 5IH3A 1WCV1 4M9XA 2PNJA 1CUEA 1AK9A 2P5YA 3TH5A 1Y8RB 4KR7A 1SVNA 3RAJA 3OLYA 3TRIA 4JLDA 1KEEA 3GLGE 2ZT8A 3HSKA 4CR8A 3PDUA 2DJ5A 4E32A 1ZJ5A 2BFEB 2CL7X 3GT0A 3UJCA 2Y27A 1HA3A 1PWXA 2AOXA 4FFSA 3GUVA 2J9ZB 1D2EA 4GMXA 1F06A 1GPNA 3DDNA 3DMYA 1VJ1A 2IEDA 4N3CA 3PXGA 2MDTA 3WMRA 2COEA 4YPVA 1Z4MA 1EYZA 4GSLA 3L4BA 3TJZA 3DMDA 3KZKA 2X7HA 3QF4B 1U0OC 1YASA 1ES9A 5I7AA 1UM9B 3RTDA 2CBXA 1GQSA 4GOLD 1IOWA 4JU8A 4KXLA 4CQMD 4DLBA 1EBBA 1UKCA 5CHEA 4R8RA 3R2JA 4RHEA 2XE8A 421PA 2NTVA 4AWBA 4C29A 1W1UA 2OXRA 1SO8A 4PM4A 3T7CA 3UMJA 1ID1A 3L7JA 1Y82A 2GCNA 1HDOA 2NSYA 3IQEA 4R8MA 5JXJA 2XUDA 3KSAC 2IE8A 4Q0MA 4GG1A 1XTUA 2J3MA 1W19A 1I4TD 2Q0XA 3KDSE 5J5VA 1QUFA 5E4FA 3RS4A 2I1VB 3FFWA 1ISHA 4PLYA 3LW8A 4J8PA 4A6PA 5K3BA 2J9FB 2JRCA 3PC4A 4HEHA 4Q21A 2N1BA 2Q1YA 3H1GA 1XRLA 4IDOA 2OBYA 3GFBA 3VR2A 2GJ8A 1CZNA 4M1KA 1ZK2A 1KFKB 2B20A 1GKLA 2JIOA 4FS8A 4KACA 1T5OA 5EA2A 1UF9A 3WGHA 2ECKA 1S2NA 3OJXA 3ZK8A 5B3LA 3ANMA 4XOIA 2ZCJA 2ZE5A 3BXEA 3IP6A 1UDBA 2VDNB 3B51X 3AEXA 4G81A 3ETDA 1T9AA 3OFJA 4WXMA 3T9EA 2NLOA 1SUIA 3I01A 3KOOA 4TTSA 5CCEA 3WGOA 1Z0JA 2PX4A 4W5WA 4BLRA 3EYWA 3E7PA 1G3UA 2OZEA 4N8SA 1U02A 2VXCA 4U0JA 3SVTA 2PUBA 3MS2A 1U3TA 4R8VA 2FY8A 4Q1VA 4LZZA 3B13B 3P9SA 3AR9A 1E9CA 4IL5A 3ET4A 1XDDA 2ZRHA 4BLPA 4NYMQ 4XKJA 3U7FB 2HGSA 1WXEA 3ABZA 2ZIUB 4KQCA 3SJAA 1VP9A 2WT8A 4KQ9A 2HU5A 2WJWA 1YOBA 1YA8A 1IDN1 1FJ2A 5CU7A 1ZM4A 3GCWA 3QYJA 4QJBA 1JJVA 1V1RA 1Z9BA 3KBBA 4CV3A 5CA1B 4JT4A 3THWA 3ITNA 1BDMA 1NAHA 1SEPA 2E2WA 3BL6A 3FDZA 1FLVA 4MA4A 1YBFA 3AZQA 3NQ41 5DTQA 1LPMA 5GONF 4ER0A 3O90A 2YJ4A 4AX8A 1QBKC 3V48A 1GXSB 3ECCA 2ZIXA 3HRHA 4I1OA 5DN9A 3FYUC 5F51A 1PR4A 3ZVNA 4FYJA 4FW8A 4MUNA 4CMEA 2GK6A 2FX5A 1E64A 1JQBA 3ZYZA 4YJ3F 5CB4F 3K72B 1QZTA 2R8OA 2YDYA 4G36A 3FMOB 4UTVA 1L5OA 5HW0A 1JHRA 2R6GA 2FU5C 3BXXA 1E7SA 2PFKA 3L1VA 2VI5A 1DEKA 4TKMA 1FTYA 3FSGA 2CC2A 3SWWA 1LFAA 1Y0BA 4H1HA 4MRVA 4C6TA 1ZNXA 4I3GA 4FFWA 4YAWA 3HDGA 4JKOA 3AR5A 5JPIA 4AN4A 3LRTA 2R0QC 5CG2A 3PHCA 3T7JA 1E62A 2V1UA 4FUQA 2QI9F 2HMWA 2GJSA 1KORA 1RWOA 4HDNA 4WY2A 2AZMA 1GG8A 2QS9A 3IOBA 3FFTA 2XKKA 2YHIA 1Q5PA 5KQSA 3IR6A 4MO2A 1H1LA 3C15C 3CZMA 2DULA 4UAJA 5AJTA 2AJLI 3PG5A 3P0EA 3A2MA 4E4TA 1UMBA 4HQOA 2Z2ZA 1CIVA 1THTA 2PMDA 3F6CA 4GRDA 4OA8A 4U02A 2EW8A 5EPEA 2VZEA 5FHRA 4V1CB 2I1QA 4RSGA 1OA0A 5KTKA 3ZOZA 3EY9A 3FPLA 1GZHB 3GCGA 1W4BA 3SNKA 3KSBC 2Q21A 2BTEA 4WECA 1R9NA 3IPLA 2P4QA 5I7UA 2I5PO 3ORFA 4UJ3A 1O57A 1QE3A 1RI4A 2F9LA 3GWZA 4O1HA 3H0CA 2PZFA 1Y1KE 3UB4A 2WHYA 5BSMA 3B52X 4J1TC 1NYTA 1E66A 4DTIA 3G5LA 2HPZA 3MQFA 4QXRA 4QOFA 3H9CA 2IZOA 5FB3A 2F17A 4HXFB 3N39C 3HU1A 2OV8A 1B00A 1GL3A 4C5CA 5C34B 4DM3A 2JFBA 3OEWA 4EHJA 5KINB 2ZVQX 3A3PA 1EP9A 4GUAA 4RSRA 1AF7A 1HRKA 3AJDA 3G88A 4MR7A 3FCYA 4MV4A 3D3NA 1JXOA 4GBED 5BT8A 4Q3NA 5BSRA 5A71A 4WE3A 3V9AA 3CTPA 4ZVSA 5IYZB 1GKKA 1IHDA 1L3BA 3E2MA 3SF8A 3T41A 2WMYA 4KQHA 1RYNA 3A1VA 1TZ2A 4OQPA 2BZGA 3PUHA 2P3QA 2UXDB 1YB6A 2VJNA 3CRRA 2VAWA 3PFKA 5F7ZA 5HK8A 3Q3IA 2RHBA 4D9BA 5KMGA 3KQOA 3S81A 2GZ1A 1XN4A 3JATB 4RA6A 4RK4A 3OWHA 3GFOA 4GBGA 2VVTA 4FP9A 1XLWA 1DIAA 2OV3A 3F6SA 3E7XA 2XYHA 2HGZA 1UPBA 1V6AA 4DSZA 1BS2A 1OXXK 1TPZA 2GDZA 3PXBA 4MP6A 4TT8A 4NZNA 4B3XA 5KJCA 4AD8A 2X0FA 2EDCA 4X84A 4XVHA 3TL2A 1CUFA 1S3SA 3ZUGA 3FYCA 4NR0A 4KRFA 2OBFA 3RFCA 2PGAA 3HN6A 1JBQA 2YJTD 4J7UA 3WKDA 3THYB 2C7VA 1F0PA 2Y1KA 2ZE7A 1L5HB 3CN7A 1PW5A 2W90A 1N0IA 2B4QA 3BWBA 2IQIA 3TGLA 4K9MA 1G0OA 2P2LA 4TWRA 4D8TA 2QDXA 3FPFA 4J6EA 1QMPA 3GU3A 4NENA 1E5VA 1BXRA 4B84A 1KYVA 1AHHA 2E37A 3FFBA 2PBFA 4K5QA 4MW7A 4UCQA 5AKKA 3A1WA 4MV3A 5T64A 1SC3A 1LNZA 3JTEA 4BKMA 2KBEA 2VAMA 1NYQA 5FOSA 1ZQ1A 2YX1A 1FB5A 2I2XB 3A25A 4M83A 2Q6OA 9MHTA 2R60A 4WERA 3PX2A 2VJQA 1LXCA 3PNOA 3GELA 3I0NA 5DTMA 4EYSA 4Q4AB 1GLGA 3AHJA 1P6UA 4C06A 3W3AH 5HP4A 1TUBA 1BA3A 4O4HB 1IBKB 4Z86A 4ND8A 2G1AA 4EENA 1JUDA 2RIRA 1Y5MA 2Q4RA 2I4OA 2IYFA 3H2HA 3BMOB 4M46A 2VFAA 3TUJC 4E33A 3HFJA 5BQ3A 3T5AA 2BBSA 1E4VA 3MD0A 2PS3A 4IIXA 3ASYA 1KWKA 3KQQA 4JOBA 4A15A 3IUMA 1E2IA 2AW5A 2IP2A 2X5KO 1EH5A 4CMHA 5HSGA 2AL7A 2A6PA 1SBYA 3HKEB 3IQGX 3L8ZA 2QVLA 4M8NE 4GR5A 1U8ZA 2VQSA 3EXG2 4C0WA 1L7PA 1CT9A 1BJRE 1V2HE 2GRAA 4EUSA 4AC9A 4IGFA 9LDBA 2DX7A 3KTAB 4DRYA 4EMSA 4INJA 3JALB 4R9SA 1THZA 1YFJA 3V7WA 1GTVA 4CTNA 1L5RA 5HQ3B 1FPMA 3CN9A 1GQFA 1ACMA 3CKMA 4PZDA 3ZHCA 3F4BA 1FFAA 3CBGA 4C0XA 4M1TA 4KQJA 3GZJA 2EU8A 3IEXA 2YV3A 4PX2A 1TYCA 1QPZA 3HR4A 2KPOA 3T38A 2F1OA 1KDZA 4CNBA 4H7IA 4KH1A 3MWYW 3I8OA 1RM3A 2AWNA 3G2LA 2WFLA 3KVVA 4AZVA 1JFFA 2LDBA 4RDCA 3TWOA 3EAFA 2F48A 4JVSB 1SWWA 1N32B 4Y2TA 3K8OE 5F1YA 4RU1A 3S1AB 4MWEA 1E6MA 1WQ1R 2E6KA 4JJGA 1VLMA 5EJIA 2Z5GA 4GKBA 1QHHB 1NWHA 1V35A 2Q6IA 4RA9A 5FULA 2FCRA 4CN9A 5KVCA 1GLNA 2D4AA 3FRHA 4NV3A 3ZGOA 3OC0A 4V3CA 1CE8B 3DG9A 1BW9A 1A4IA 2QLFA 3A7DA 1G9XA 3GQBA 4ZQCB 3V33A 4CI0B 5IJWA 1G1AA 5LYJF 1JXAA 1K6XA 4PCVA 5KI6A 2DFLA 3P9RA 1BHQ1 2A1UB 4D8YA 1JH8A 1T4CB 1WU7A 2D8AA 1R15A 5HZGA 3MLBA 1IN7A 2E5FA 1PR5A 4GMKA 3IXMA 2IUTA 4BBZA 2Y1LA 4BLSA 4C0JA 4DSTA 3DTYA 3D4LA 2AC2A 3EDCA 3IT1A 4JY7A 1R37A 4KVGA 1TEXA 2I71A 2OM2A 1LBTA 2REXB 2VPTA 2CLFB 3O8LA 4EBFA 3HPRA 1YFLA 3AL3A 2Q4TA 2WAMA 3JQCA 3OJFA 4QSHA 2SHKA 2XRYA 5JCPA 4HZGA 5CFOA 3AR3A 5KYKA 5GV8A 3GJ0A 4QGFA 4QDUA 3QE0A 5L9AA 2PVSA 1V0JA 3DZ8A 1T8PA 4PR0A 1FY2A 4PYRA 1P0IA 1PJCA 2YS7A 1P45A 5EP1A 4FR0A 4F9FA 4W7IA 2GYYA 1NURA 1EM6A 3QY9A 4DSUA 2AX3A 2RBEA 1D4FA 1UJNA 2H4XA 3NDJA 1XEAA 1XOIA 3ZVRA 4JIMA 3VR6D 1BMQA 4JYMA 4FB5A 2J8ZA 3VNRA 1NBIA 4X66B 1YOVA 4UTOA 3Q98A 2BFOA 4H7KA 5EQFA 3NNDA 3V1MA 1WSAA 1EUZA 4E2YA 5JZVA 2G28A 3AT1A 4I08A 1LRJA 3I58A 4IFTA 1T4GA 5KYWB 3JWEA 3RADC 1Z2EA 3N6VA 3ZH2A 5JCXA 2JGAA 4JX9A 3NG1A 3MFQA 3QXSA 1VLLA 5KYYA 3X1WA 2XNHA 1SHLA 4TTTS 4ZT5A 1J2RA 3HLKA 4YK7A 3HCWA 2ERYA 1GPKA 5ALIA 4FEAA 4PHTA 3PFCA 5AW1A 5T4HA 3WHPA 3A6KA 1LLFA 1CNMA 1TVMA 1ZD2P 3PFHA 4G07A 2Q45A 3D4BA 4ZQIA 2JI4A 2WEKA 1KO1A 3WZLA 4CBVA 3PPYA 1GTL1 3TUIC 4RIFA 1MAWA 1FUIA 4Z8XA 4MROA 5EMMA 3IKLA 2AJDA 3NRBA 1R3UA 4UVGA 1HL7A 3EXIB 1LX6A 2YUTA 1LSJA 1H66A 3VX3A 3ZBPA 2A0WA 2OG1A 4RF2A 1PAUA 4JLNA 2XF8A 4C7VA 4AY2A 1XZCA 1L3IA 3L7LA 1DXOA 4ZU6X 4Z3KA 4J0JA 1AQ6A 3QG1A 1BMTA 2GCIA 1I33A 1X42A 1FUKA 5DNWA 3RWOA 2VP3A 4GZ3A 1C0PA 2AOWA 1PJ3A 2BC9A 3CLRD 4CLEA 1EP2B 5AUPB 1QR2A 2C0QA 2HDWA 2HUPA 3ZY2A 1PFYA 4FR2A 1FFBA 3H0EA 1GAEO 3GT3A 1Z5UA 4GD3Q 3FVWA 2V3VA 2HUNA 2D00A 3TQOA 4IDAA 1NJGA 2VRCD 1ZESA 3TD6A 3N2GB 2HPAA 1ZW1A 2B2XA 1R9GA 1AB5A 4PYJA 1L5VA 5EJ4A 3CVXA 3IE2A 1RC1A 1WUTA 1X1TA 5B1HA 4LJKA 1XG5A 2IKQA 1XK6A 5TT1A 4JHLA 4AKIA 3DTNA 2QRNA 1Y81A 5EUBA 2FX3A 2NO5A 4QOGA 3G5MA 2Q3BA 4YX9A 4CM8A 3ZUPA 2AOTB 1JZTA 3HYNA 3C5VA 4Z7NB 3KDAA 1ULHA 3NVDA 4C7BA 5I8ZA 2A5DA 2P9HA 2FQYA 3H8VA 4PLFA 3RFUA 1V71A 4LW8A 5DW3A 2V4UA 2JFQA 4TZKA 1WPGA 2FJUA 1JR3A 1IN5A 3LW7A 4MVJF 5KX5F 1F3OA 4IH1A 4LMPA 1QH9A 4BCDA 2QM0A 2DFDA 1CQXA 3NBQA 4DB2A 2BGUA 5ALDA 4BEWA 4QOSA 1JFRA 1JQLB 1NA5A 1PU2A 2DR0A 2H1LA 2ODNA 3G2MA 3T1OA 3WKEA 7MDHA 1X1EA 3T34A 5CYOA 3QMMA 3U37A 4KDCA 1A04A 3CLKA 4CDGA 5C1DA 2EATA 1O4VA 1L1EA 1SUDA 2M6KA 1NX6A 3KZ1E 1A8SA 3BTSA 3OQ1A 1J99A 3OZSA 1X8LA 3FZGA 4HLDA 4IWYA 4QPCA 4TTAA 2HIGA 1E79D 2PWBA 5L7WA 3HA5A 2HNKA 3AM5A 4TS3A 5IDQA 1NLUA 3DVSX 1MU0A 2IYSA 4OI2A 2C3YA 1AVTA 2Q1SA 1XNHA 2L17A 5EE5B 5ESDA 3SXUB 5BV7A 1ZJZA 5BUCA 1GLVA 1Z6PA 3FWPA 4D0NA 3K1TA 3GNTA 1ISPA 4PRLA 3ND6A 4KYVA 3F78A 3TTXA 1X3SA 2D54A 2EJCA 1O5IA 5CB8A 1EXNA 4EAAA 5ALPA 1E2DA 2FPKA 2VWPA 5TNXA 3TX2A 3UCEA 1KIFA 1OLOA 1N8SA 3ABRB 1ZSYA 3DKKA 5F33A 2HA3A 3FKSA 1I2CA 1VRCA 3F9IA 5IFLA 5F98A 3ZIUA 1GPLA 4DILA 2O8FB 2OXCA 3AJ9A 1M9NA 1QG0A 1W5TA 2GNAA 3IDFA 3NKLA 4B3BA 2R6JA 4AP5A 1XD2B 2FN3A 5GWXA 4CEIA 4HWOA 4OA5A 2VF4X 3S1SA 1F5NA 1ZITA 1R8JA 4UFOA 2WWVD 3HC7A 3VC3A 3G13A 3SZ3A 3MJCA 4L0CA 3U3DA 3UXMA 2DHRA 4QYTA 1NW6A 3H5WA 2GH1A 2MHCA 1F6BA 1WMSA 4GPD1 4D02A 2ENWA 3Q8MA 1AS3A 2QLLA 3GPBA 2WVAA 1R5BA 5JCJA 5FBVB 1CU1A 4KIFA 4B6SA 5CA0B 1F2DA 5K0JA 5ILQA 4EFNA 5AKHA 5M7EA 3GLFE 3EMDA 2CL6X 1G20B 4H3KB 1FVFA 4BE7B 2VT3A 5AYVA 1KVQA 3RFTA 3T5DA 4FOTA 5DX0A 2XB2A 4U2CA 1L8AA 3AX6A 3J81A 3C4VA 4MR8A 4U9UA 1MVLA 3FCXA 2WUGA 4YCJA 5EERA 2D1FA 1QDEA 2BZ0A 4YFVA 5ALGA 4ALNA 2HI0A 5K1ZA 1G42A 5BWNA 1PG2A 2NU6A 2QL7A 1JDSA 1RLMA 1GFWA 1P91A 3M5CA 4JASB 3BHMA 5K01A 3QE9Y 4Q05A 1S9HA 3RC3A 2BW0A 2CBZA 6REQB 2C2BA 4KE6A 4W7SA 5AJWA 4D0SA 4EKIA 5HUJA 3JYOA 2CXQA 3QVMA 4JOCA 1XRQA 3FCOA 4Q4HB 1EFPB 3BWVA 1NNLA 4W8OA 4TM7A 4JHXA 1NLZA 3PGJA 4UREA 1LDNA 4PX3A 3S27A 1NQUA 1QWOA 3NJRA 3RH0A 1GUDA 1M7HA 3IKTA 4GRAA 1H6BA 4BO3A 2RD2A 4Q7KA 3I9V1 4PTZA 2R4QA 2Q1TA 4RVOA 3TLEA 2LD4A 2ZKIA 1YZLA 1EP3B 3NHUA 4HB0A 5BPHA 1GSAA 5EG5A 4ZQHA 3FVRA 1U5BB 1ZXLA 1HDGO 4KOEC 3U3JA 3AVOA 4W8GA 3OKPA 2EZ8A 2ZYIA 4YJGB 1AK1A 5TXGA 4Q7MB 1TO1E 5JAHA 2WTAA 4WZAB 4F3CA 1H22A 4MQFA 1GCUA 4FBMA 3UUEA 3K32A 4GC5A 3P2IA 3LYAA 3PHIA 1XVIA 3QUTA 2X22A 4X20A 3PXXA 4XFJA 4BQOA 3E4CA 3FI0A 3WNDA 3AJEA 2V0CA 4R1UA 3IIJA 1EFRD 1V9LA 3QJGA 5T8KA 1ABBA 2BH9A 1M7GA 3K0CA 3NATA 4BB5A 1OE0A 1W73A 1LBIA 2H4YA 2TMYA 2GFIA 1JHOA 4URZR 4EX6A 1MB2A 5U1PA 1D6SA 1RWXA 1KYIA 3BE8A 3LHFA 2HD4A 2AG6A 3LT1A 4FX5A 4KI0A 1L1QA 1XDWA 3BWEA 2HMYB 4QDKA 1HBJA 2YOHA 5EGSA 1OH5A 3V3KA 1FU8A 4EPXA 1JH9A 3KCNA 1ZKMA 1YRQA 1ZGJA 4OKIA 4YCAA 3UYKA 2CDNA 1SQ0A 1T4MA 1VL6A 3QOYA 1TX4B 3B82A 4KR0A 1Z6TA 3GL9A 5KZMB 5KVAA 4X8OA 4QM6A 5JSFA 1DWOA 4BX9A 1EFUA 3RFVA 4OFBA 1GKIA 3H2IA 3FOFC 4Y2GA 3KHUA 3KR1A 4LC0A 3Q5GA 2ZE8A 1NXWA 2I8LA 4H0FA 4LHYA 1CEXA 3BBLA 1MIOA 3R5XA 2A1TR 1IQ0A 1OYOA 1ZONA 4W8HA 1QCZA 3IAS1 2JIPA 3ROKA 1IK4A 5A7GA 1WBBA 4I9HA 2QRUA 1Z0ZA 4DYVA 4KLNA 2GF2A 4AJOA 5LQUA 3AF5A 4GI3A 2G82A 1ZU4A 4D4JA 1AT1A 3SPXA 2AXNA 3HZZA 2RGNA 1V1MA 2GS9A 3H2JA 1I3LA 1JYSA 2Y0CA 4A36A 1JV2B 2D1QA 2WG0A 4AW9A 2WABA 2YBDA 3ZCRA 4P0QB 2YV4A 5CLLA 2CGEA 3CNOA 2GEUA 3EH1A 1L6IA 3WBJA 1SZDA 4TYWA 3BA6A 1JQ5A 4JOSA 4KG7A 2EP8A 4EEXA 3G8DA 4OAOA 5IFKA 2IBMA 4KREA 3UUFA 2H4FA 2AB0A 2EBFX 3SJ7A 2ORWA 1NL3A 1H3EA 4C0SA 5JH7F 3TTSA 3JS5A 4R3UC 3GAZA 3VXKA 5KYTA 5MN4A 3FOEC 1RE1A 4MLPA 3EZNA 3IDZA 4WGGA 1PRYA 5D7NA 4XXHA 2WTEA 2IIQA 2ZE6A 4JEIA 3WQHA 5CFNA 4TV9A 3AESB 4RLSA 1ZCJA 1S6YA 4M76B 5JASA 1YQWA 3FOZA 5AVYA 1ZIYA 4LJSA 1T3ZA 2ZREA 1AZSC 3L4JA 3RRNA 2JAXA 2VDOB 3CNLA 4J16C 4LDRA 2G08A 3GPLA 4YP1A 3I5UA 2PIDA 1BCSA 2ZBPA 4FLEA 4WK4B 2I2FA 3REQB 5DWQA 3AY7A 3K70C 1GARA 3N28A 1H9CA 1SBCA 2GCGA 3ENZA 5E0KB 4DWJA 4C0HA 4AWXA 4MKXA 5DLQC 2E1PA 5C31A 3VYVA 4KW7A 3W6PA 2VPXA 2GEDA 1E3TA 2C59A 2BD0A 2O2SA 3N2KB 3KM0A 4OB8A 5JNTA 3LKZA 5LB4A 4F12A 4QOJA 1SIWA 3DDWA 1MTZA 3STXA 3TIXB 1YL5A 4JXKA 4Q19A 5FBHA 3C7AA 3MCTA 1XXHB 3PQ2A 5BURA 3QX3A 2OXTA 3MELA 4CQMB 1XALA 3I5XA 3UG7A 4GF5A 4EG3A 1ISSA 4ZHQB 1CUUA 1DJMA 1X7XB 1SU7A 2BFDB 3ODGA 1G8JA 2J0EA 1FL9A 2V54A 5FOVA 5CDFE 3WGJA 1TTTA 2LTAA 1CUXA 4IIBA 4R83A 3DZHA 2VQEB 1BC5A 4Y7DA 1JHXA 4OUDB 4PE5B 1Y6JA 4EQ6A 4UQLA 2YIJA 2DCMA 4NV1A 3QWBA 4ES6A 4YAGA 3ABOB 3ZV7A 2YZKA 4MW9A 3ZV4A 1F4PA 3GP8A 1H4VB 5BQ5A 3VYSB 5J2TA 1HV8A 3DP9A 1Q16A 4Y9TA 1OKKD 3BHNA 1ODCA 5IVKA 2CNKA 1Y37A 5BORA 3CZ9A 3WA6A 2JFWA 4EMUA 1TJYA 1YKSA 4YCSA 1IM2A 2X9NA 4NCNA 3LA8A 1T9BA 4RPJA 1R00A 3QHQA 2GM4A 5KTYA 3HDTA 2P9QA 5G40A 1LK7A 1Z17A 1FTNA 4XLTA 4H0NA 4Z54A 4G1UC 5A02A 4D26A 5KOHB 3INYA 3R9XB 3LQ1A 4FZVA 1Q6YA 4CE6A 1BS1A 1WDMA 3DAGA 1X14A 5DTEA 5KNDA 1XEXA 3R75A 1XRPA 4DEXA 3ZLJA 3C1AA 4R1PA 5CBKA 221PA 4O2BA 3VSDA 3BXZA 1NIJA 1U8XX 1GD1O 1OMOA 3KQPA 1DS6A 3M34A 3LP6A 4GGPA 4ND3A 1XZPA 2CKDA 3RROA 4LMBA 1HQYE 3EZ6A 2ATCA 3AJRA 2RBGA 1V2GA 1VIVA 3HJBA 1UPTA 2VDQB 4AQDA 1SK9A 3TXXA 3KNZA 4UCWA 2R6AA 3ELDA 1PDVA 2IHBA 1X80B 2O0HA 3ILHA 4ACBA 1KYQA 3UKDA 4G97A 4MUAA 3UOWA 5EJGA 4HQLA 2A88A 2IPLA 4O4JA 1Z7BA 2PSEA 3QTTA 4PFQA 1BHJA 1UMCB 3JYQA 4QA9A 3L7NA 4ECEA 1TEVA 2GD6A 5SY4A 4NULA 5KJ1A 4BZWA 5FPSA 4MVCA 2VR1A 1P9RA 2IZZA 2QYTA 4G37A 1NHGA 2A7XA 4PS0A 1G6OA 3VVMA 4NABA 4B3DA 4WKCA 3A26A 4D0GA 3B1WA 2JLXA 1ST3A 4C7OB 4LXTA 1EG2A 1Q95A 1XWIA 4FKMA 4QLBA 4OKSA 2QP4A 3A6FA 4YBZA 3C5CA 5DBEX 4LFAB 4U3JB 3L7CA 4A0HA 1COWA 1SIOA 2XY4A 3FDXA 4DLNA 1L8OA 5A5EA 4GQAA 2CFIA 3H7IA 3JPWA 2PJRA 5E3JA 1KAHA 5GINE 3G9UA 1GA6A 1CUSA 1EJBA 2CLMB 3NEPX 3P9KA 1M54A 2GMWA 4MVJG 4TUYF 5KO2A 5CDHA 1QZXA 2OO7A 4B2IA 4BFCA 3CLTD 1SVWA 3IVXA 4UC0A 4NHEA 2I4IA 3QE4A 5LU8A 1DKOA 5EZYB 3G3EA 3NAMA 5GM2A 3BFVA 5K0EA 4DIEA 5CJJA 1KSGA 1UODA 3RIMA 2Q9CA 4P3XA 1IQRA 1GN8A 2PMWB 3MZ0A 3QYAA 1PVDA 4ZRMA 2A9FA 4BXOA 3UENA 3NHPA 3A3NA 3NB0A 3M33A 4F5DA 1B6GA 5AVQA 2P5UA 1KI9A 2PX5A 1Q84A 1ZZGA 1A7UA 1EZZA 2GKOA 2ZULA 3M4JA 4YDSA 2WYVA 2QN6A 4K8RB 1ADGA 2A3NA 1YSCA 5FQOA 5G0WA 3LYHA 3U81A 3I2IA 3HGQA 3RK4A 4HX2A 2ISCA 1CZRA 1WB6A 1ZVKA 3SYTA 3T7EA 5FHQA 4RIGA 4B4DA 2CNBA 5EQTA 5FFMA 2B1RA 5CBPB 4ROTA 4AMUA 2RAVA 3VTAA 3K9CA 1UKEA 3B9RA 3I3SR 1DFHA 4U7HA 1YR7A 2H6EA 4D3YA 2HAEA 2V0GA 2ZCVA 4DIFA 5AVSA 1X13A 1QZ3A 2W00A 2EOAA 1S2OA 3D4IA 4MTCA 5ESWA 5TT0A 1T6YA 2D5AA 3Q5DA 4W9NA 3JQ9A 1NN0A 1TCVA 2ZJ3A 2ZIGA 1B6TA 2J33A 3DYIA 3NBAA 3FAZA 3RYIB 1FQKA 1JDPA 2IXTA 2P7IA 3W8RA 2VTBA 3CV3A 4RAOA 2XXAA 2PIAA 1QV6A 1SKYE 4ZO9A 4C0QC 2Q27A 1CF9A 1Q44A 1U7ZA 3ZWAA 3F46A 2O2ZA 2C04A 2ONKA 2F1JA 5TY0A 4TZTA 2FJPA 5FI5A 4WGFA 3ED5A 1N75A 2CLKB 1T6NA 3V8NA 1QQ5A 4XWWA 1UBNA 1EK1A 2L18A 1O89A 2FJ0A 2OD7A 3N8IA 4GMDA 1GZ3A 4M1YA 1XAGA 2QKYA 2ZGVA 1C9JA 2ZYHA 3P0FA 3RRBA 4RV4A 5TQ0A 1W9HA 2ZR7A 1XYYA 3FLMA 5KTSA 1O94A 4Z99A 4AECA 3DKRA 3LGSA 4G5XA 3L41A 4NNJA 4GYJA 1QFYA 2C2ZA 3KBOA 3N76A 4LSGA 1KOFA 2ZRGA 1LGYA 3U4HA 5ITVA 1GVNB 3MAJA 2H65A 2OV2A 2RK6A 2MR5A 4DB4A 3N6XA 1FTGA 3HB0A 1LBHA 5K2MA 4EJSC 4K9DA 4I8IA 2H5IA 5KSZA 4H1TA 3UPDA 2EZTA 4P4LA 2RH4A 2AMFA 4DDTA 621PA 1FZQA 3UFBA 4HYTA 3OTWA 1WNFA 2KW5A 4Y3UA 9ABPA 3EGEA 5ICCA 3GVHA 1N2HA 4GX5A 3WS7A 4JJEA 4J2HA 2INGX 3D0QA 3K4PA 4AS3A 3D3JA 1RTTA 3EZYA 3M6MD 1G21E 2QIPA 2YTZA 3W6UA 2AOUB 1ESCA 1IZ0A 1J56A 2VP0A 3KXLA 5ALOA 1A5SB 1HDYA 1PSWA 1SKAA 1OFUX 3EGWA 1KEUA 2JD0A 4MS4A 2GBPA 3P9XA 1FSZA 3HG7A 3BERA 2MIIA 1M66A 3Q0IA 4KR9A 1P7PA 3C8UA 3F0TA 4YRCA 1YA4A 1KJ9A 4ME6A 5EHIA 1NVTA 2JFGA 2EEPA 4WFJA 4DSAA 2REQB 2DQYA 3MBOA 1W46A 3VH1A 4F9TA 4MMYB 3EIQA 3TSOA 1NF9A 1TLTA 1DIHA 1GQOA 2GPJA 3DBLA 4G4IA 3OCYA 5JDCC 5JZMA 1U7UA 2VH5R 4GUDA 5HGJA 4E1AA 2P79A 3EQ6A 1PK7A 2NXEA 4QVGA 2YRFA 3INNA 3IVRA 4L0DA 1ULZA 1WETA 1RRVA 3NRJA 3DEFA 4IIFA 2A9PA 4A10A 3CZ5A 1MPXA 2YWFA 4OI4A 5HZKA 1DIGA 3KQMA 1NG1A 3AIMA 1IK6A 3ZS8A 4DA7A 1TMOA 2YS6A 4EEKA 4ENVA 2ZQZA 4YRFA 3WQBA 2CL0X 2AEFA 4NU6A 5L6LB 2YVAA 2Z2IA 3ADPA 3BRWD 3P9CA 4Q9NA 2PL3A 3SF8B 5ER9A 1MEJA 2HHCA 1RPNA 4M0EA 3USES 4B33A 4CLDA 4DMLA 5LQMA 3GP5A 2O8VA 1RJWA 3ETNA 2BMAA 1Z56C 3NC0C 5AKXA 3PGLA 1I0ZA 3EFOB 4QUAA 5A7HA 3IJ5A 2QQFA 1RQLA 3PICA 1TB4A 1GNLA 4O25A 4IDBA 4I4CA 2PT5A 3EZGA 2V5VA 4AX4A 1Z0DA 3C3WA 2JI8A 4YXWA 2WMDA 4TMFA 2IWRA 3IULA 3OJOA 4U7WA 4BV8A 5B1YA 1KKMA 2B94A 2P6UA 3NVMB 4JUBA 1TD1A 1QV7A 3T9DA 3VZRA 2OPBA 2DHDA 2GK7A 1LUAA 5C37A 3EIFA 1UKVY 5JANA 1QTNA 5CAEA 4RX1A 4P08A 4BZZA 3G8YA 1EVEA 3AOEA 1ZSVA 3H19A 3NXKA 4WY5A 1VCMA 2I7TA 1KJZA 2V5AA 2YINC 3L6OO 3TZKA 5FWYA 1VG0B 4YQFA 3GNQA 1PL8A 1TKAA 3LGAA 1XAIA 1ZRNA 5SZJA 1T34A 2I6SA