3GJQA

Caspase-3 binds diverse p4 residues in peptides
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
141
structure length
141
Chain Sequence
DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Caspase-3 subunit p17
publication title Caspase-3 binds diverse P4 residues in peptides as revealed by crystallography and structural modeling.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 141
sequence length 141
chains with identical sequence C
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2009-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3gjqA00
4N7MA 4QUDA 4QU8A 1QX3A 1I4OA 1RWNA 4EHDA 4FEAA 1IBCA 3D6MA 1RWPA 4NOJA 4D3ZA 1RHRA 3DEJA 4QU9A 2HBQA 1JXQA 4QU0A 2Y1LA 3SIPA 2XZDA 2QLJA 4HQRA 3V6LA 4EHLA 3EDRA 3S70A 2QL5A 4NBNA 4PRYA 5IAGA 4AWAA 4QUEA 5K20A 4JJ7A 2CNNA 1RWOA 3PD1A 3H11A 4QTYA 1RHUA 3GJTA 4QUHA 1NW9B 1BMQA 3D6HA 1NMQA 2CDRA 1PAUA 2XZTA 3QNWA 3NR2A 4N6GA 2FP3A 4EHNA 4M9RA 4EHHA 1SC3A 1SHLA 4IEFB 2WDPA 4QUBA 1I3OA 4ZVRA 4EHAA 3RJMA 1ICEA 4D3YA 3DEIA 3OD5A 2NN3C 3KJFA 4JR2A 4FXOA 2C1EA 4I1RA 1NMSA 1CP3A 3NKFA 3H1PA 3DEHA 3V4OA 1RHKA 1NMEA 3R5JA 4NOKA 4ZVPA 4DCPA 2H54A 2H5IA 1RWWA 3H13A 2H4WA 1RWKA 3R5KA 4JR0A 5I9TA 3V6MA 4QUIA 4FDLA 2J31A 4AW9A 3GJQA 5IANA 3V55A 2J32A 4D3XA 2H48A 3H11B 1K86A 2QL9A 4PRZA 4PS0A 4JQYA 2XYHA 4N6NA 2H65A 1SHJA 4QU5A 3V3KA 1RHJA 2QL7A 4JB8A 5LU8A 4ZVOA 1QTNA 3SIRA 5LU9A 2Y0BA 2C2ZA 4PS1A 3P45A 2XYGA 3V4LA 2P2CA 4NOMA 2HBRA 4NBKA 2AR9A 1I51A 3GJRA 2H51A 3IBFA 5IABA 3EDQA 4JR1A 2C2KA 4DCJA 4EJFA 5IAKA 4FGUA 3H0EA 5JFTA 3DEKA 1KMCA 1PYOA 3E4CA 3R7BA 4EHFA 4ZVQA 1CVRA 3GJSA 5H0IA 1F1JA 3PCXA 4ZVTA 2CNLA 2H4YA 4QTXA 1I4EB 2H5JA 4ZVUA 5IAEA 4AWBA 2QLFA 1K88A 2CJYA 2K7ZA 1RE1A 2C2OA 3K7EA 4NBLA 2DKOA 2XYPA 4QUGA 5I9BA 5IBRA 3R7SA 3D6FA 1SC4A 4LSZA 4N5DA 1GFWA 2HBZA 4N7JA 4EHKA 1RWXA 3ITNA 2CNKA 4ZVSA 3BIJA 1SC1A 4JJEA 4QULA 3UOAB 5IC6A 1RHQA 2QLBA 5LUAA 5IC4A 4QUJA 2C2MA 3P4UA 3R7NA 5IASA 2CJXA 4NOLA 4JQZA 4HQ0A 3PD0A 2CNOA 1RWMA 4I1PA 3KJQA 5IARA 3R6GA 1RWVA 3R6LA 2FQQA 3IBCA 1QDUA 4IYRA 1RHMA 4N6OA 3NS7A 2FUNB 2J30A 2HBYA 5IBCA 1F9EA 4JJ8A 3S8EA 4QUAA 5IBPA 4DCOA 1GQFA 5IAJA 5LUBA 3KJNA 1M72A 4HVAA 3UO8B 2J33A
chains in the Genus database with same CATH superfamily
1NQAO 4YMSA 5FOQA 1OROA 3UMYA 4U7HA 2NQTA 2J5QA 3R09A 4G4SO 1L6IA 2X9VA 4LMAA 4FFBA 1PFUA 2FFQA 2W6JD 2FSVA 3ROFA 4H6VA 2VZEA 2QXTA 1Q3TA 5H5JA 1TJ3A 2WPDD 2KE5A 4J4HA 2QX8A 5L45A 1FX0A 2ASVA 3DVSX 4RGQA 3U1BA 1O0CA 2OMEA 2CLHB 3EQ9A 1SC6A 4TYWA 2ZTVA 1N7JA 1C1XA 1I1NA 2BKAA 2Y4OA 2YW9A 3G59A 3OAAD 4R3NA 4R8MA 2RGEA 4MWSA 3VHXA 4E5MA 1ODKA 1B6SA 1NBAA 4PZLA 4U9HS 4JLAA 2FZ4A 3NAQA 1Z5OA 3HJHA 5EKTA 1W5BA 4OO3A 2I03A 1YOBA 3MTJA 1QZ3A 2B34A 2WSIA 3OPQA 4OKSA 2R6DA 2VT6A 4C7KA 4CMBA 2VQEB 3E9CA 1ZITA 2COEA 2P4UA 2Q1YA 3DHNA 4QOEA 3STXA 3TSZA 4R4JA 1GZHB 1G3QA 1PL0A 2VBIA 4NONA 2VF4X 3NBZC 4C1NA 1T2AA 5FAKA 3RJ5A 1X8JA 4RVUA 1C81A 1Y9AA 2QPTA 2OBBA 1G9TA 2JASA 1WMEA 4PNHA 3T8YA 2XECA 3JD0A 4JLPA 1JHQA 3M2TA 5K0TA 1GSOA 2FF5A 4EPWA 2C7OA 4BVFA 2VRWA 2GEBA 2DWPA 3ND9A 2ODBA 4JK3A 4ZQHA 1WSBA 4GOLD 3A2NA 1DAFA 3D9QX 4MEBA 4PCVA 1S3SA 3WIOA 2C9ZA 4PM4A 4DSOA 3DZFA 3GU3A 3Q9NA 3Q8LA 3E5MA 5F9FA 1KJQA 3K30A 1IJBA 2P6RA 2B6NA 4FNMA 4G5OA 4R0NA 5TY0A 2P65A 4JUDX 3VOSA 2GXUA 4ZVQA 4EYKA 3BSFA 5AXCA 5FPHA 4M8NE 3IGFA 2GCPA 2W2QA 1T3GA 2Q0XA 4NBLA 3JWEA 4JX9A 2AZTA 4V1CI 3U4HA 3GMIA 1MBZA 1WUHS 3RSFA 2AFIA 1EE2A 2WF9A 1YR3A 4L9WA 4DNQA 1S2NA 3MGCA 4Q48A 2AWNA 4Q4AB 3ABSB 3EGXB 5LQMA 1SUWA 3MPUA 4YRLA 1QPZA 4ZRNA 4DGQA 1MTOA 3C7TA 4MR7B 1GUAA 4PLHA 5HS4A 2I0FA 5C1OA 5FL7A 2UYHA 1H9BA 4K40A 2VDOB 2BKEA 4G0XA 4JVSB 1QR2A 3AIOA 1MHTA 4HMPA 2BGLA 3QQ5A 1PBTA 5CJ2A 2GJKA 3K94A 3PDJA 1ZI9A 4JAVC 4MV8A 3GD5A 3BJEA 4MUKA 2AI3A 1P8AA 3F47A 4QDUA 3R23A 3C70A 3LTEA 3T6KA 1L7AA 1TU0A 5LOVB 1V71A 4FCVA 3G0BA 3TN7A 4YBRA 2NZUG 3FR7A 4GXQA 4MWCA 1DKQA 3HR7A 2YWGA 4IOJA 5IDVA 2CMHA 2HXYA 3JQDA 5LXTF 5AW6A 5ESDA 1UOPA 3ZY2A 1GAWA 2VZ9A 3IOCA 1YRLA 1M34B 4H0NA 2VPIA 3HP1A 2NTJA 3AETB 5ENDA 2GPJA 3GFGA 4EKDA 1Z4KA 1NVGA 2NAFA 2F3QA 3KOZA 3QSGA 3WIUA 1ZJWA 3AFNA 4KTTE 2SKDA 3ZEAA 3UICA 1BQ4A 1FFAA 2FR8C 1C2YA 2FN3A 2ZSIA 1XJWA 3UHFA 2A5LA 3KTOA 4NLLA 3LTNC 1QTIA 1QKJA 3FGNA 3MTAA 4GC5A 3HJFA 4DANA 5T3UA 3WBBA 1KZYC 1U4NA 4S0XA 4C6SA 1M0TA 1MRZA 3H2BA 2GD1O 3UYLA 7GPBA 2C9CA 2PUFA 4MUXA 2O59A 2HRBA 5TMPA 1Q2UA 3L4BC 5LP1A 2VWHA 1JFFB 1Y80A 4KQMA 4OHCA 2O48X 1ZISA 2AKEA 2PSHA 1G3IA 2IZ6A 2ZJ2A 3OJ0A 2G9UA 3AWDA 3USES 3UT0A 1PO7A 4II7A 2I66A 3JYHA 3AI2A 2F3SA 1X1QA 3E3LA 4O2AB 3QU5A 4RK1A 1NR1A 2O8FB 1U2ZA 1U8FO 4PAMA 4R1UA 3EFBA 4RIIA 5KC8A 2IZ7A 2CMKA 2EW8A 3QA3E 1IH8A 1R0WA 1GPH1 3TTWA 5AESA 5IBQA 3QU9A 3DBHB 2C57A 2XUPA 4RF4A 4S35A 5FWYB 2J32A 3VFDA 2G9QA 1MO6A 3WLJA 2BFBB 1PV2A 4BAUA 4JYBA 3G2HA 3GLIA 1T5LA 3U3MA 4BNHA 4B35A 1OY1A 2Z6VA 1OLXA 3LF2A 4U2GA 4ZYXA 1LC3A 3OLYA 1S02A 1DRUA 3PI6A 3DOOA 3KM0A 4A2WA 3QENA 5FR2A 1ODFA 3E61A 1U8UA 3NBUA 3S2GA 4GP7A 1YRWA 4NBKA 4NENA 4G5HA 5D6OA 4B6FA 4KQKA 3AILA 4BMDA 4KSBA 2ZVJA 3DXZA 1LK7A 4BXOA 3MFYA 1P2UA 4XM1A 5HS6A 5LIRA 2HMAA 1AMNA 4X62B 1QBGA 4F5WA 4DM4A 2D7DA 3CUUA 5FHRA 1HZJA 3EGCA 2PA0A 1D1SA 3BIWA 4RTRA 5KB3A 1NQWA 5EZSA 5C52B 1COWA 3MWKA 3AB3A 3ZDFA 2C1ZA 5CAEB 3C74A 4GI2A 2JVIA 1UOOA 2ONCA 1FJHA 5E1OA 1C50A 3N86A 3CUYA 4JI4B 3BWXA 3RASA 2O7RA 3VSEA 4ECEA 3A28A 3QYAA 4YRBA 3ET4A 4UVGA 2Q9UA 1GD1O 1Z29A 3O9MA 1UJBA 2QM8A 4KYTA 1V37A 3V7UA 4RGBA 1TJPB 2GB4A 3N76A 2JATA 3OIGA 1QS0A 4OQDA 1VG9B 4AJIA 2G9VA 3DEZA 3G8YA 3GPDG 4P0TA 2WIFA 5DULA 2FPXA 2DCMA 2GA9A 2YHUA 4JS0A 2AFVA 4X1IA 3KJGA 5E9WA 5TJHA 3V2HA 4BRUA 4LOAA 3R9IA 3LQQA 3WA7A 1TA9A 2WF7A 3CLTD 3KKZA 3L8ZA 4WIAA 5EPUA 5FPYA 5KSOA 3BHNA 3GEIA 1XE3A 3ITDA 4FW9A 3B2NA 2GN0A 4INPA 2P2LA 1GRCA 4ESVA 1S01A 4UUNA 3X2EA 4Z51A 4Q3CA 1U98A 3WP1B 3PKZA 4GMDA 4PWYA 1C14A 1JBKA 5I47A 2XUGA 3EQ6A 4MW0A 2QLMA 3H65A 4BV2A 3PL1A 4HFNA 3V2IA 1N1EA 2EGHA 5CLIA 3GFRA 3SJ7A 1XD2B 1RCFA 1RI4A 3PJEA 5DLQC 1L4YA 1NU8A 4IFIA 4XTRA 2PEYA 2NGRA 5FTKA 3AR8A 5LB2A 4AG6A 4YPVA 1A95A 2GF0A 3D8HA 4MGHA 1TK2A 4A0SA 1H1LA 3AI3A 2Y1LA 1ZC3A 4MW9A 3JTMA 3VHQA 2CLLB 1MG5A 1ZCJA 4N3AA 4EY6A 4BWYA 2NUTA 1SU8A 1X14A 1I6KA 4TTIA 3RRJA 2AZ4A 1WUJS 5AKIA 3ORHA 3ICVA 2FE4A 1J2EA 4BBZA 1XZCA 1T8RA 1JMKC 3AX6A 1LRLA 3A1UA 1GTVA 3E3AA 1UZNA 3H1BA 4UU0A 2CT8A 2XBUA 4BKUA 1BE1A 2B8EA 2H63A 3BE8A 3RODA 2FR0A 2JFPA 4QX6A 5I9SA 5JFOA 4OYRA 1OI2A 1R15A 3P26A 2HREA 1MVNA 3SQMA 3AINA 2EFHB 3QW4B 5C1IA 5EMNA 3UWOA 3ER8A 3L8YA 1PEYA 4QVIA 1E4EA 4PHFA 3A14A 1TM2A 5H02A 4GXTA 4J0QA 2AZXA 4UFPA 4NYJR 5G3ZA 5HYVA 3JV7A 5L7WA 1L7XA 3NVKI 1KI6B 4D44A 2MWMA 3ZCVA 4K05A 1ZN2A 4IDNA 1K92A 2JBHA 4PHCA 4ID3A 3ZW8A 5BV0A 2XE8A 1GTSA 4I55B 2JI8A 4GT1A 5A71A 4UU1A 5LU8A 3KR1A 4M7WA 2VCYA 4RHCA 4A10A 1B14A 1I2CA 3M89A 3HE3A 5H8WA 3KPWA 5KNDH 2X5XA 3DOIA 5C8YA 2QPLA 1ETHA 3THWA 1T34A 3ZDBA 3B9BA 2FMFA 2Q62A 1UJ2A 2HJGA 4K6HA 4QOFA 1NBEA 5E7MA 3VYWA 3H0CA 4CU2A 3C3JA 4ZYZA 1WCV1 1TQ4A 1QCYA 2VNJA 5KX5A 1AUPA 3D4NA 3DR5A 3MG9A 1L4FA 4QTTB 4WZBE 5E3JA 4BN4A 4ZMSA 2BFFB 1V25A 4QTXA 4BQNA 3D3KA 5T6MA 3FYCA 5DLPA 3ZTWA 2X6QA 4MQ6A 2E4WA 3I39X 1ZM2A 5HZHA 3TRJA 3H86A 1VIAA 3SC3A 4PU0A 3BRWA 3A1VA 5CXXA 5FOXA 1XHEA 5J2TB 2C61A 4K0KB 5AW3A 3PIRA 1AN9A 5BWLA 1LCIA 3FNFA 1NVWQ 4JYAB 1QIIA 4CWAA 4FWIB 2A88A 3BCRA 3EWSA 3KLPX 5B6PA 5IASA 4P7BA 1XZ8A 3C98A 1V6AA 5CIWA 3RF7A 4WWHA 4JQZA 2PXXA 4A91A 3RK1A 2V74B 3KT8A 1SCNE 4GZMA 4P4SB 1BHSA 2J0EA 2XB2A 2L42A 1Q44A 2W6NA 1JRLA 2JGMA 3CPJB 3N53A 3RQIA 1KVRA 4PTZA 3A9TA 3SF8B 2BGWA 2HD4A 1E0AA 3DFKA 1TZCA 4QREA 1DG1G 2IL1A 4WLNA 2RGDA 3OM1A 1V16B 5K0CA 5CX4A 4I36A 5EIBD 2R25B 1HY3A 2RG7A 1U7XA 2OCLA 2QRMA 5LBIA 3WJ2A 4PN7A 4F12A 1N9GB 3LCRA 2HQRA 1TUIA 3FOWA 5LNK6 5ILOA 2NU6B 1EK5A 3CX4A 3I6MA 4ARSA 1W75A 5KTNA 1E89A 3FPAA 3GDHA 3MMZA 1GCAA 3I23A 4GPTA 5T5QA 2QRVB 1QIJA 3ZDQA 2A7QA 4EVQA 1R0LA 4RH1A 1FP7A 3EFOA 3DMYA 4ICIA 3U9TA 5LZ9A 1W36B 3S8MA 2NUPA 3FTQA 1OQAA 1TAHA 2Y3IA 4Y1GA 4HR7A 2IOQA 1GGKA 1Q1EA 3KKEA 4JL5A 1SPBS 3VVLA 4XWOA 2JGIA 4ZHQF 4I1IA 4ND6A 1WUYA 4DJJA 1FIUA 5C1PA 5DASA 3CLSD 3DF9A 4EUHA 4X5OA 5D2CA 3JAKA 1SIBE 3D31A 2H3HA 2PKWA 1BGVA 1CCWA 1IDN1 3NQ41 3AY0A 1L4BA 3TRFA 5JALA 1B3RA 2BKLA 2BWJA 4YP5A 5I7UA 5HBGA 4U7PB 2JFYA 4QJ5A 3H8VA 3WGKA 4F5DA 2XQGA 1SCIA 1T1IA 2HXGA 2V4UA 3IV6A 3LPLA 3ME5A 5FEMA 3ENNA 4EELA 1R12A 4WJZA 1RPAA 3FUTA 1P72A 1Y7HA 4LNHA 5SZJA 2XHZA 4U8HA 4C03A 3G0OA 3FDXA 4MW2A 1XGKA 1IQUA 4UDYX 3PEFA 1CJKC 4B75A 2V6JA 4MP8A 4H1WA 5BR1A 3C4JA 3B82A 2C4MA 3AVQA 3JYQA 1P9NA 1T4CA 1RRKA 1U8CB 1WNTA 3LD9A 1Y7LA 2AFHB 1SOMA 3CVUA 2CHVA 1H2ZA 2YQZA 4MS4A 4MW1A 5GZ1A 3F1KA 3M34A 5DFAA 3MCTA 4UD6A 4UUAA 5KOJB 1O95D 1UXOA 2A0UA 2VJMA 2JIZA 4NOMA 2AR9A 5JSYA 2N3ZA 4B3GA 1MEOA 5IABA 2PGLA 4BCBA 4JBHA 4YMIA 5DJ5A 1GTMA 4NH4A 1VG8A 2X8BA 3HWWA 3NLLA 1SWWA 3P19A 2C0QA 5CVJA 5I4IA 3TTTA 5KOYA 1F7UA 1QXSA 2B7BA 2IEDA 5C1DA 5J47A 5ES3A 3STTA 3RS3A 3H99A 3T7SA 5K0JA 1DX6A 5LWHA 4FIZA 3HA7A 3NHMA 2X3UA 1T36B 5GJBA 4ZYTA 2QYOA 2AE1A 3PXCX 2G1AA 4KVZA 3S1AA 4AY2A 3K7EA 4UMDA 3AEZA 4E7OA 1X7WB 3T9FA 4HN2A 2G71A 2HBZA 1BS2A 4HUQB 4B3BA 5HZMA 1U81A 1AF7A 1SQFA 1CDEA 3TLYA 5DN6A 5GAJA 2GCGA 3W9UA 1QHGA 4ZDJA 4WUTA 3TZKA 3UTDA 4GI7A 4DC0A 3EF3A 1U8TA 1JU3A 2E4XA 1VM6A 1UMCB 4KQCA 3E3OA 1ZBDA 1NKSA 3QUCA 3H2YA 4L8VA 1ZWKA 4IIJB 2GN9A 4NOLA 3V7NA 4Z54A 2ISCA 4GX0A 2YNMC 5KVQA 4E5PA 2QM3A 4LQDA 1JG4A 4DIBA 4OX9Y 1XXHE 2I99A 3KIPA 4A27A 1X94A 3CBGA 1NR7A 2FDCA 1RWVA 3ANXA 4KYVA 1Q7BA 3VPBA 4DJDC 4UHEA 5CTAA 1ZH0A 1C7IA 1G4AE 3NUQA 3NH6A 1E98A 3GEBA 3I4LA 5IMBA 1QIFA 1M9NA 3RYHA 3IO5A 2O8EB 1FEZA 4OREX 1YCDA 1I7LA 1GR1A 1G8YA 1S1MA 2PKEA 3TI9A 3U4CA 4Q16A 4F5ZA 1VTKA 4EHBA 1FDWA 1VECA 5LSAA 3B6MA 4WRRA 2ARKA 3O92A 4ERXA 1WWKA 3UBMA 2ADFA 2FOXA 2HRQA 1H2FA 3KSMA 1P19A 1ZJJA 2AH5A 4QDXA 3QFCA 3VZRA 1DLJA 2EJBA 4E11A 5K20A 1ZFNA 4H17A 5I3CA 2YNMA 1OLUB 1RZRA 3I8OA 4GI3A 1USKA 3ITEA 3MLEA 4RZSA 5TIIA 1RXCA 2OSVA 3PXUA 2VDWB 3QUBA 5BSRA 1FFDA 1BHJA 1I3OA 1A8UA 1CIPA 4KQIA 2G63A 4RD4A 3OZIA 4DXDA 1JIVA 3E58A 3BORA 3TR0A 3WQRA 3ZBUA 3E1GA 4KFRA 1KI2A 1RMTA 1SELA 2A5JA 1CR4A 3KK0A 4F2DA 2REQA 2YYSA 2FG7C 2HDWA 2H2GA 1HV8A 5DNYB 1YI8A 1G7SA 2NV0A 4JEHA 4NIMA 3QKWA 4ROSA 4A9AA 3H13A 2CW5A 1VI2A 1KI8A 3A3KA 4MVCA 4D9EA 1KO1A 2FZGA 1N2CA 2I2CA 4NESA 5D01A 5EIFA 1SKAA 5TGZA 3RVJA 2CFRA 4Q9DA 2DTEA 1GPAA 2REOA 5DYYA 4Q1VA 1CLEA 1XCOA 3OCXA 3B60A 2JD1A 1DO2A 1CDZA 2IHTA 2H2DA 2O05A 1WCIA 4YV7A 3ZZNA 3DE2X 3DVLA 3HYRA 3WC4A 4RZ3A 1EEXB 4FKZA 3WLIA 1J42A 3CRZA 3N6XA 3G9TA 1R6XA 4BYGA 1BWRA 3Q8WA 2VAWA 3IFSA 5AUOB 3OCVA 1EGVB 1Q17A 3F1LA 4CCWA 4IV5A 3KXDA 1Z33A 4KK3A 2ODTX 3OBBA 4U7WA 1XJ5A 1SKYB 4IW3B 4F9GA 4M1YA 4PZYA 1U1CA 3AESA 1GZ3A 4J90A 3R0JA 1QF9A 1GYQA 3ZGOA 4BMSA 1NF8A 2JAOA 1IUKA 1N6IA 2R1TB 3RWMB 5BWOA 6NULA 3BZWA 1WZIA 1T4BA 2Y1DA 5EKXA 1QQ5A 1XCBA 2Z8ZA 5LBTA 3WHIA 3M0EA 5DISB 1K88A 5DM2A 4QATA 1I7QB 3CXRA 2D00A 3WGUA 4B7ZA 1PRYA 4M53A 3IKVA 3VR3A 2XNKA 4MR9A 5JYDA 4R41A 5EZQA 4EI7A 1KEEA 1OA0A 4KO1S 4PNZA 1E96A 3CMCO 3HSSA 3VPGA 3ZS9A 3W2IA 5L3QA 3RBXA 3K8ZA 4EG1A 3RTDA 5I9MA 4TMYA 4JP5A 1UBOS 4I4NA 3SQDA 1JILA 4MGEA 1TECE 1DC5A 2A5YB 4V2UA 4DAOA 3OCYA 1QR6A 4EI2A 4LF5B 4C5CA 2GCOB 4MP3A 1QGOA 2V7BA 3ICPA 4UPVA 4UCXA 4FOSA 4ND1A 2WJYA 6GPBA 3F7MA 3HFRA 1DS6A 1RC0A 2HJ9A 3RTAA 3S7ZA 3STYA 1RE0A 4CETA 1LBQA 2BEWA 4ZAVA 4DQVA 2VTVA 4Y2SA 3NS7A 1W0KD 1ODSA 2V5VA 3PICA 2C54A 5JEEA 3PFFA 3ZVLA 3VO2A 1JQLB 4C6HA 3GPLA 3AVXA 1J20A 4FYPA 2W22A 3W8RA 3VTKA 5LMUB 4BMCA 1MO5A 4HVAA 2MR6A 3HN6A 3A7DA 4RXMA 3IEIA 1S7GA 3TVYA 4CLOA 3NM5A 1ZEMA 2E6KA 4QM7A 2PBFA 1SZDA 2R1UA 3IR5A 5CT8A 2VJKA 1BKSB 2ZYVX 1GZ5A 5EUMA 1PZGA 3ZE2B 3PV0A 3EZFA 1L5KA 4GC9A 3S29A 1Z5NA 5LIPA 5L3RA 2GHTA 2X5KO 1TYZA 5GONF 3M6MD 1S6YA 4GG1A 2QTLA 2XGGA 4UU7A 1L7RA 1IN6A 1ORIA 3K70C 1TKCA 4LGMA 1PLJA 2BONA 2XRFA 3G0DA 3SC2B 3AL2A 4K9DA 2XKJE 1GTRA 1GQQA 2WOOA 1IMOA 3COVA 1FMLA 2VHXA 2QDXA 3VUEA 1TTQB 5I01A 3EC7A 3PQ5A 4FN5A 4GH5A 4HWPA 4XA8A 4R8RA 1EXVA 1ISPA 2YJ3A 3UMCA 1N0WA 1R66A 1SA0A 2DQYA 2VHWA 4MO2A 4A23A 2QD5A 3C2QA 3ISJA 5JH7B 2IVZA 3PDCA 4WFIA 5AVOA 2OBNA 1W4BA 3H5IA 1VJ0A 5ESXA 2PUBA 3O1HB 4L0QA 3AU8A 3COYA 3I0NA 1MORA 1SVWA 1XMSA 5FPKA 2C5HA 2PFGA 1VLZA 2PO7A 2Z9CA 3LUCA 3LL4A 3M9XA 3B20A 3GLUA 4MVJG 3IH5A 3X1YA 4YMGA 4TVKA 4JGIA 2FWAA 4EDHA 1YR6A 1CF9A 2V5AA 1BAPA 1EQUA 3VNVA 2ZJFA 3AR2A 2VQ6A 1WZUA 4AZ0A 4DLAA 3ZX5A 3IXMA 2B9VA 1JE0A 1STOA 2M98A 4OF4A 1WMBA 4QLBA 4PXAA 2PX2A 4JJIA 2YKGA 1O9BA 5JJLA 4LQCA 4OJYA 2BTQA 2KX7A 1QM5A 1NY5A 5AK3A 1JA1A 1Z2EA 2CDBA 2VT2A 3IAM1 1FFWA 1JYFA 3P45A 3I1JA 3PSAA 1P5JA 4MH0R 4X20B 5B1EA 2I2DA 1T5HX 1HTBA 2Q1WA 2HF8A 2Y6UA 3EK2A 3JX9A 4FNGA 4KO8A 3LFTA 4RMGA 4ARZB 4EPTA 3NEYA 3R20A 4BNDA 1ZHFA 4JEMA 1BGXT 2VPWA 4WAUA 2YVUA 2BISA 5H0IA 1YBHA 3EULA 2ZITA 3GLFE 2H1OA 3P32A 2XT0A 2FQ1A 3JRNA 2AJBA 2BCJQ 1HQKA 2AOUB 1OJ7A 1YQXA 3OPVA 4KNVA 1LQUA 1G0NA 4C7OA 3C7AA 3HA2A 3J80A 5HFAA 1TO6A 1WRBA 2JRLA 3JQ7B 2W2PA 4HBZA 3CW9A 4JUIA 1SH7A 4ZVSA 3WX0A 3O3MB 5KBYA 2I4NA 4H3SA 3A26A 4IQ0A 3P2OA 1EUQA 2EZ8A 3R0QA 3GXBA 5BUZA 3CZ9A 3QVOA 4WDRA 5K3CA 5HTOA 5JRZA 1N5OX 4N76A 1QRUA 3IOBA 4J7CA 1RYFA 3FTPA 4O2BB 2FW6A 2WSSD 3LI2A 4CF7A 3OT5A 1Y8CA 3W79A 1B3BA 3HNOA 3ULKA 3QEBZ 4YMWA 4ZI2A 3SM9A 4YR9A 4BGVA 3EIOA 5HJ5A 1XD9A 1ZZEA 3DCYA 3WA6A 1QV9A 1YIDA 2DCUA 3AI7A 5B3LA 2Z9BA 3A1TA 3ROKA 1JKJB 1EK0A 1YMVA 3RSOA 3ELYA 1LLCA 4OX9B 5JAIA 4OCZA 2FEPA 1CQIB 4WSOA 1I7PA 1I9CA 2GPSA 3GC6A 3QMMA 4J0CA 4W7HA 1NQ5A 4Q1BA 3O8BA 1ADFA 1MO4A 3VTFA 5CLHA 1QH1A 3DBVO 3JWGA 4CTMA 5SYAA 1BE0A 1KL7A 2ZANA 3FH0A 2VRCA 3N8NA 1RBYA 3UGQA 1Z16A 3MJVA 3EFEA 4L22A 2VTEA 4PSUA 2P9CA 4F72A 2WM9B 2HBQA 4D6PA 4ZHQA 4ZOBA 5LQRA 1J8MF 6Q21A 3FPEA 2BLNA 1YFJA 4EQ6B 1OX5A 1X2BA 1XQ9A 5T64A 5JFGA 4DILA 4PICA 3MJCA 4KZPA 1ZS9A 4IGEA 4HGQA 4UASA 4RUKA 3ZV7A 5C3MA 2DETA 2J46A 3WJ1A 2IH2A 1NGSA 1LDEA 4X3CA 3TQCA 3IE2A 1Y4DE 3A9VA 3UJNA 3OFND 3PVSA 2M1ZA 4MJLA 3BE5A 3AR4A 5CRIA 4ZYVA 3HXKA 1L1RA 1VC2A 4WY5A 1FMFA 2WF6A 3CJTA 2W4IA 4KMSA 4TSRA 1AS3A 4IIBA 4WKCA 1V4BA 5EP3A 1XEWY 1EX1A 1IWBB 4KQHA 4BRWA 1VCNA 1X1BA 3QOWA 1K7CA 1RM5A 4Q9KA 4AC9A 1VKJA 1GQSA 1OYVA 3DWGA 4IILA 1R4NA 4LGYA 1PR2A 3D59A 3T1NA 3G79A 1UJCA 3OLXA 1QV7A 4J0EA 5B2EA 1NYTA 1II9A 2Z5GA 4R7ZA 4MCIA 2PGDA 3DO6A 3KXPA 4H7KA 4ONEA 4QU5A 3K8OE 1OH8A 4XRGA 3EX7C 1C3OB 2Q5OA 2CXUA 3BRCA 1SB8A 4KWEA 3OQMA 2FE1A 5CK5A 3FD8A 2R7NA 4CU5A 2EOAA 2CKMA 5EWMB 5K8LA 4F2GA 5F4ZA 1JWBB 3EMBA 2ZCUA 1RLOA 1KMHA 2A0YA 2V97A 3M6IA 1NUHA 1HE5A 1RLIA 3BGVA 1ZU5A 1OZFA 3HJCA 3ENZA 1JZTA 2FKAA 2OM2A 4I1VA 4PVCA 3ZS8A 4EG8A 5LKRA 1LPBB 1VLVA 3HL4A 4KIGA 4R1TA 1WU7A 2H2HA 5GV7A 1JFRA 3U7EB 2JANA 1DZIA 3C5EA 3EW7A 3I5YA 3L4SO 5FBVB 2J5RA 3N8IA 3ADCA 1YRQA 3O2QB 3ZHUA 2W48A 4PRKA 1WBBA 4OMDA 1BH6A 3CZ4A 3OCCA 3DOFA 1DKNA 1M5TA 3GDWA 1VRVA 2GRAA 5D85A 4K9RA 2E5FA 4AZ3A 2Z3WA 4DOMA 1YAHA 3EVAA 2QUKA 3QP9A 1C29B 2BT4A 2FTKE 1JMYA 1GXSB 4U3JA 4DMGA 3N0XA 5DYGA 1N2EA 1W36D 2V7VA 4B81A 1IPFA 5G1OA 1M34E 1VIMA 3DCJA 3CWQA 4PBTA 4H7HA 2XRZA 3MCWA 2C92A 1TI7A 2VCHA 4YRFA 4I9UA 3T3PB 2BM8A 2A5GA 3C1AA 1RLJA 3I5MA 4PCLA 1DXYA 5DP2A 3X1KA 3ROZA 3HV2A 4Y1EA 4BCCA 3LUDA 1CIJA 2WT9A 1U2RA 2OY0A 4NAHA 3PPIA 2UYGA 4TL8A 4XGKA 4HS9A 5BRAA 1IQRA 1MC4A 5TC4A 3L0OA 2B2CA 1WXWA 5DX8A 1D6SA 1BFKA 4OM7A 3T35A 5KYUB 1M5RA 1NI4B 1WKBA 1IAQA 2Q45A 5BMOA 3NMUF 3FYUA 4M8IA 4ZT6A 3DWFA 2QSJA 1T6NA 2FF7A 3GBVA 2DFKB 3D0KA 3DZ8A 3IC5A 3JAWA 3M83A 4MI1A 5KYWA 4CEHA 1GKYA 4TQUS 5WRFA 2R7MA 2V6BA 1U3FA 2Z4RA 4XSVA 1MT0A 3H9EO 4HOYA 2CUKA 4OEHA 5IK2D 1YJ8A 7REQB 1A97A 4A0FA 1JR3E 3AL3A 1V8ZA 5LQKA 4JXJA 3SMQA 3L9XA 2H4FA 4EUKA 3EVEA 4QG3A 1O6CA 4O08A 3EPKA 2C04A 5AK4A 4QTYA 1JB9A 3PC7A 2Q8NA 5L4NA 4A6EA 1Q0HA 2Q1SA 3HGMA 2HU7A 2VAVA 3QBTA 3R0IA 1QO0A 3ZGVA 2OQVA 4RAOA 4JYPA 1P73A 3W05A 2B78A 1I6WA 2QZ9A 2Z6QA 5G0TA 5TQ0B 4BJ3A 4BASA 1OT5A 1TFRA 1AG9A 2FG6C 3I2JA 1GFZA 3AVYA 3HBFA 4BUZA 5L8VA 3KDAA 1FE8A 2HIGA 3IRVA 3CLKA 1XHFA 3FBGA 1XTZA 3QYPA 1I32A 3GYBA 2CFCA 3IALA 4QJBA 2ZUFA 5IZ4A 1B6TA 4QQFA 4FEEA 3OIYA 4IVPA 2AXQA 4OK6A 2LDBA 3PUIA 2KBEA 2VA9A 4LA4A 4OP3A 4RK0A 5KHAA 3C16C 3U17A 4Z49A 2VF2A 3N70A 5JZ9A 4CEIB 1O9GA 1FFHA 1VL8A 2OGZA 3HDTA 1FMTA 2REXB 3L1HA 5FNVB 3RCBA 4F4IA 3N2ZB 1A3CA 2PKQP 2V7QD 1OBCA 5ECYA 1HM5A 2G4CA 3BUSA 2V7PA 4F96A 3REFA 2C9OA 5IM5A 3TSOA 4UCWA 4TYYA 2JDIA 2D6FA 2XI4A 3LKZA 1UP7A 3C1TA 5IJAA 3VV3A 4CKCB 2W00A 2A8YA 4FDMA 3LXRA 5ITZA 4WCVA 4B17A 3GNQA 3EPJA 2C84A 2VDNB 3BGOS 4OAQA 2BF4A 4E30A 4E08A 3R3HA 1X9GA 2IS2A 5THXA 3ONDA 4R0VA 1ISMA 3VPHA 2PLFA 4Q00A 5DGHA 1XG5A 3ILVA 3WFIA 4MUYA 4MSUA 3VOBA 2B4TO 4IKOA 2MINB 2NSHA 1NVKA 1G55A 3KZ1E 1ORWA 2A94A 2IP4A 2F00A 1L8OA 5DXJA 2QLTA 2VJAA 2FSPA 3E8SA 1YL6A 2F3UA 3IULA 3HPQA 4REMA 2R96A 2PH5A 1E2BA 1H93A 3JQPA 3IEMA 1Z88A 2UVPB 1K3UB 3OA0A 3I92A 4KWCA 3B6IA 3LUJA 1YUBA 2A0WA 4M60A 1VHTA 4CODB 1LX7A 621PA 3EIUA 2ZTHA 3R4VA 1RQ7A 3HB7A 1N6OA 3AEUB 1OILA 1KI9A 4BTVA 2V8OA 2FUCA 5LB4A 2HYIC 1AZTA 4LRTB 1QH9A 3LH5A 3OHSX 4L76A 4BYMA 4MQ5A 3FSGA 5KVAA 1IBLB 5AW8A 1SXJC 1VPVA 1TD9A 2HWUA 4TN5A 2D5CA 2IEGA 3O8QA 4LCJA 4MNTA 2W2MA 4RPKA 3RYTC 2RE8A 3PJFA 2C7RA 1O4VA 2LRHA 4YK7A 3SXUA 3JYPA 2J3QA 5FUYA 1WKVA 3VSDA 2WFMA 2AI1A 3PC4A 2BBWA 1NQOA 4R1QA 4DR2B 3O26A 1BWPA 2A1IA 2XVMA 1I6MA 3LDAA 5DE3A 3UWDA 1SKUA 3OT1A 4TLDA 4OBXA 4N7MA 1J33A 1YQGA 4AVYA 1LBHA 1UANA 1GGFA 2AW3A 2RGWA 1NBMA 2G83A 2EKBA 1O94A 1ZUWA 3EZYA 1G5FA 1BMDA 3GEHA 5GONA 2J4DA 5KMGA 1YOVB 3S70A 3PCTA 4NJOA 1OXXK 1QCCA 1W8DA 4KLZA 4ZYLA 2XWPA 2QTVB 3RREA 1MQAA 4IZIA 1U4OA 4I3GA 3ZC3A 3ZGNA 1F20A 2Y1CA 4Y2TA 1SXJA 4KB5A 5KVSA 1N3YA 1FPMA 2ZUEA 3G5AA 5JJKA 3Q88A 3LOPA 1OIVA 4UQPA 5H9WA 5JW6A 2AOTA 2AMFA 4MQEA 2OV6A 1GPNA 2HFKA 4R6WA 3GVCA 1X0VA 3HL0A 2D3WA 3QK7A 4II3A 5A7HA 3DEHA 4V38A 1R8YA 1ZH8A 1NN5A 1XZMA 4LZOA 2WINI 5I8WA 2WZDA 3KTAA 3H05A 1G3UA 3I42A 4AF8A 5AFSA 5GP1A 3KHTA 1ZGGA 3I6IA 4E6PA 1FFCA 2H48A 3OZSA 3WGMA 4MS3B 5KTYA 2RBGA 2JAHA 3JRXA 4ARBA 2HW8A 2M6RA 5E8RA 1V35A 1UT6A 1T15A 2J59A 2QYSA 3R2JA 5KNBH 3TSAA 2X9LA 3DDSA 4ZYYA 1IXRC 3E22A 5K3OA 2OO3A 3QNUA 3IO3A 1Y8RB 3D2BA 3NW9A 2DFLA 2PXAA 4W1SA 5TEVA 1RVDA 5F7XA 1W5AA 3QELA 3SBOA 2HHJA 1ML4A 3JZDA 4EGQA 3EMDA 2V7XA 5J40A 2Q2NA 1AGPA 2PIAA 1V96A 4S2EA 4F2PA 3AU9A 1KYWA 3HBJA 4MQUA 3HLKA 2EJUA 1E62A 1TQDA 3DOEA 1ZA1A 4GYWA 4OD0A 1NFQA 2W8ZA 3E23A 4CM1A 1OBOA 5DI3B 5JATA 1AH2A 1UWKA 4FYWA 1QUEA 2VP4A 3DO5A 3RV3A 4INAA 1YUNA 3KHKA 3U7QB 1MX3A 3E27A 2PZGA 3IE1A 2NV6A 4C88A 5MGBA 1CRWG 3FCCA 4QNNA 1PIWA 3K2IA 3NOOA 4ZI3A 2I3ZA 3EUAA 5BMVB 1T10A 2PGAA 3HRKA 4UTZA 2PWYA 5TPWB 3KOOA 1G20E 2Q2WA 4JSYA 2BD0A 4IJVA 3G5LA 4J75A 1PJ8A 2DE0X 3OJLA 4PNEA 3WBKA 2OBMA 4EYQA 2VN8A 1TQ2A 5EXEA 1G59A 1OLOA 3BAFA 1OV4A 1QIEA 3QPCA 4PG5A 1VIDA 3L8FA 4ZZ2A 5JXJA 4BL5A 4S2UA 1YRYE 4CFSA 1WSWA 1BIFA 4BNFA 2CJWA 5KNDD 3WGVA 3HJBA 1RRCA 4H31A 5KYYA 2K2WA 2H1IA 4IP0A 4YAIA 4JC5A 2TECE 3DW1X 4JU8A 4KPUB 4HFMA 1MNAA 1RSZA 2FWMX 5FIUA 1UAYA 3F5QA 2ZCVA 5KYXA 1PUJA 3T1VA 3ZDDA 1FQKA 1GA1A 3M4YA 4G5XA 1SD1A 1GT6A 4WXYB 4BOYA 5JQGF 1ZSVA 2HLDD 2JK1A 2I4TA 4FGJA 2RONA 3OIWA 3JZAA 1NVDA 1SK9A 2FN8A 2GF9A 4XD7A 1E3DA 5IH7A 1J00A 5IN4A 1W93A 121PA 2WYWA 1R4AA 4QU0A 5EJAA 1MPTA 2IEYA 4IRUB 8ABPA 1JHVA 3KEFA 5H70A 1EVLA 1M33A 3HJRA 1RI1A 3OBIA 3F6YA 5BW4A 4OU5A 2O2YA 3KVYA 1FYXA 2X13A 3TOZA 3UG6A 1JA0A 2AFHE 5T41A 3U49A 2GNAA 3TFWA 3DVAA 3TLGA 4EI8A 2F1RA 1FNSA 2VLIA 3IQIX 4D46A 4TS3A 2HLPA 2PLNA 4WNYA 4Q9NA 5C32A 2QU8A 2W43A 4A0QA 3MB5A 2LCQA 1BQEA 1PYGA 2O3JA 3IOMA 4PYMA 3M5CA 4YWHA 4D8YA 1OKKD 1MH9A 2PIDA 4XYEA 2WJGA 4B3CA 4MRNA 4I1SA 3W7AA 2YWDA 3MJRA 2ZVDA 4DCSA 5HSGA 3KCNA 1MC5A 1TIKA 5I51A 3GF4A 5T7BA 1SEPA 2WTUA 3ZLTA 4HAXA 2N46A 4Y2JA 5E0KB 3VR6A 1KWKA 1TVKB 5A5GA 4BWFB 2FHSA 3NXSA 1JHYA 4X7MA 4FTWA 5KZMB 1DJMA 1UFRA 3NWOA 1I5OA 4F3TA 4BB9A 3VO9A 3OO0A 2DERA 1UBGA 4R98A 4GL4A 4K6MA 2FLKA 5AK6A 2W6MA 4IH9A 2W42A 3D3WB 3TUIC 2DR2A 2UZ0A 2XD9A 1PVOA 5BSKA 5IKMA 2OKCA 1I8TA 2BFCB 1DG3A 4OOEA 4G8CA 1ZD3A 4EX7A 4TKVA 1Y81A 2MSNA 2WVHA 1V48A 2GQ0A 1WULS 2YR0A 3EXG2 4FFWA 4ZMRA 4JI8B 2X58A 1XQYA 1DWPA 3LUAA 3N5CA 4DWWA 2CXHA 1LS1A 3A4VA 1QC5A 1KF0A 2H1WA 3IUPA 5EE9A 5KSWB 4R1PA 3IDOA 2LP4Y 2HH9A 4YJFA 4EBBA 1CZKA 4I5FA 1KGSA 1ACLA 1VBFA 3OI7A 3THXA 1J9ZA 2GX6A 2AA3A 5AR1A 3BBLA 3CZRA 5A7GA 1V47A 2YWEA 2K7ZA 2VNHA 1L1EA 4FSDA 1T1RA 4PHGA 1G63A 3ZWPA 3HUEA 1RLTA 1GYPA 1T0PA 1T8UA 3AHGA 2Q2QA 1K68A 2P8SA 3IP5A 3OA2A 4C0QC 1JG6A 3F9IA 4HQNA 5L53A 1XX6A 4FYHA 4KMRA 4YONB 3P71T 4OFWA 4IM7A 1EESA 2ACEA 1UBEA 3P5BA 4FD2A 3SC6A 4YCAA 1BQ3A 4JXKA 1DKLA 1U99A 3UCEA 2V7EA 1PS8A 1BFDA 1VRWA 4U39A 2HUPA 2YMMA 4OGKA 5F4BA 1NJSA 1TAQA 1N77A 2JJ1A 3M1AA 3ED1A 3L2OB 5A4AA 1CV2A 1LK5A 2CXRA 4ZAWA 5DGDA 2BR3A 4CV2A 4K3UA 2J3LA 2EV9A 5AKYA 3RVRA 4BJ5A 1WDKA 4HSGA 1XO1A 2PFKA 2UU9B 3SPXA 3NCTA 2ZWAA 1C30A 4NZYA 1PVVA 3TX2A 2XCQA 3W7BA 3IDAA 2B61A 1PTJC 1CRLA 1LPAB 4REQB 3DDUA 3ZQUA 3AH8A 1N0VC 2BMVA 4BJ1A 4BO2A 1MCZA 4FEAA 1PFKA 1IBCA 4OQQA 5JAMA 1VA4A 3ZD6A 4NOJA 1SUBA 3U19A 3T1HB 1N25A 2OV4A 2EU8A 3SZUA 3QFTA 5FULA 2CHGA 3IA7A 2HK6A 2WMYA 5HIKA 1SXHA 2A9JA 3MIIA 2AQKA 4IFEA 1P4GA 2CGEA 4OV6B 4J8PA 1E8MA 5J9FA 3RSSA 3IR6A 1X70A 4UQLA 1NSTA 3SS8A 2UV8A 1ECGA 1R6DA 3PNPA 3IXLA 3ZWWA 4ENPA 4YLYA 5KPJA 3B2QA 1H65A 2W6JA 2Q3JA 4RY0A 1MG0A 4M4SA 1CP3A 5AJYA 3V8PA 1QE0A 2JRCA 3DGEC 4JC8A 3VU9A 4ALIA 3ZWBA 5JARA 1SKYE 2QG4A 3ZUPA 4BQRA 3DAPA 3LV8A 3WZMA 4AS2A 3FGPA 4IJ6A 4EEZA 1J2JA 1GGJA 1KMQA 4QYSA 1LV8A 1PTJA 4HNAA 2C42A 5LM3A 2JFQA 2Z8YA 3LX4A 4JKIA 4GE0A 4NPHA 3AIIA 1W2HA 1WB6A 2E4UA 4DJEC 4B9EA 1UDWA 3OICA 1D8TA 3QTLA 3TW8B 2ZSJA 3HK2A 2YFHA 3L8MA 1Z4MA 2HFJA 4OHRA 3ZYZA 3T94A 4L4RA 4D9FA 1R8XA 2H57A 1RQXA 1X13A 3GDFA 3IAHA 4M7RA 1CETA 4KMMA 4KUGA 4FMCF 5AKHA 3HO1A 1IZ8A 1U9ZA 3BB3A 4M98A 1VMKA 1W1IA 5LU9A 2GARA 1LK0A 4Q9JA 4H60A 4YPFA 2B69A 4PFKA 3BK7A 3G6KA 2ZSAA 5JDCC 4HGRA 5A6SA 3UJ9A 5LL6P 3U4GA 1H2YA 3EXHA 4EH1A 2ZU0C 1IY0A 1A69A 2ETVA 4X3OA 1IL0A 1MW8X 2GZSA 2OP0A 1NXSA 5FWXB 2FB9A 4JCCA 3ZTYA 2VDKB 4AMZA 1YDWA 2PTGA 1KAOA 1YHZA 5LYJB 1LTKA 1ISJA 1CQJA 1FP1D 2AYZA 1H8ED 3LC2O 3C6BA 5IKXA 1JFLA 5K3AA 2R87A 2GXQA 5JNSA 3GRFA 2ZBEA 3LQ4A 1B8NA 1I3NA 4LY0A 4X6XA 1Y3HA 1B76A 5CJPA 3BTVA 3R76A 2FWJA 4TM7A 2YHAA 1QGUA 1HLDA 1R7RA 3QHAA 3CVYA 5H3HA 3ACCA 1RNLA 3RU3A 4NF2A 5JVDF 2A3RA 4UHJA 5JG7A 1SJ9A 1T26A 4Z1MD 3S81A 4M83A 3QPUA 1H3NA 4P4UA 5DP1A 5KQPA 4NE2A 1FSZA 3PFHA 3CVVA 1K6MA 3KB6A 3RRBA 5JDCA 2GF2A 1ODTC 2G67A 1XCLA 1N0UA 2YS6A 2B0JA 3A8TA 5F2NA 2YWBA 1J5XA 1SNYA 5CFQA 2Q21A 3P9XA 1ZM4A 3PHLA 5AI9A 1ZGCA 3QEOA 3VDMA 1N34B 2HHHB 3U9LA 3IIIA 3OJFA 2PMWB 2I80A 1J6UA 1WNFA 4HDRA 5H3CA 5DH9A 4R83A 4EX6A 2W70A 2H0AA 4HDKA 1E3QA 3M6VA 2BEVA 3GRVA 3ZV5A 4ATNA 3GQBA 5A03A 4YREA 3NJRA 5LA6B 2YJTD 3OPYA 2MSWA 3DL4A 4V0ME 4XSGA 3T3DA 4EM6A 4Z2AA 3ZDEA 4TTPA 1XOIA 1FP2A 2I1VB 1H2HA 1IG0A 1KJYA 1ZOLA 1BXGB 2HRZA 3B13B 2GAAA 3DQQA 5H16A 3D0QA 3Q7SA 4P3PA 4H1TA 4UW9A 1IY2A 1S2IA 4UVDA 3ZXXA 1A4IA 4BNZA 4DLNA 4PG8A 1LX6A 4MAFA 4RA6A 4BU1A 5I48A 3BMOA 1YS1X 3W34A 3BXZA 5I9LA 2YMLA 1VFNA 4FEGA 4JQOA 3ZU4A 4F6CA 2D1QA 1HQYE 3CR8A 4IFBA 1MOPA 5KQSA 3ICCA 3RUCA 2IZ0A 4H3VA 1OVGA 3N6VA 2Z57A 4PHTA 1HOXA 4F4DA 3L9WA 3K6SA 3BJZA 5T3YA 5EKDA 3TFQA 1TIPA 2TYSB 1MP0A 1XDGA 3GOQA 4DDVA 3RVMA 1T0UA 5L3VA 1EZ4A 2O2XA 2NN3C 2ZRLA 3WGQA 4TYMA 5DOZA 3LAWA 2VHZA 2GPYA 3IAS1 4JBLA 5GJWC 2H4JA 3U4QA 2P3QA 1BH2A 2WICA 3LYUA 5EIXA 3BRSA 1M1NA 1OE0A 1DUSA 2QY6A 4PQYA 3KKNA 4KDEA 1NMEA 4M88A 3X3HA 4BIMA 5CEFA 4OH1A 4G09A 3O94A 4B8ZA 1M6HA 1YJBA 1DTWB 2QN3A 1RYNA 2E4VA 2WZQA 3CZ5A 3K96A 1NPDA 1Y34E 2CB9A 1TGYA 2PPLA 3Q87B 4HB0A 3OE5A 4IOKA 1PKXA 2G25A 1FNCA 3IVCA 4P82A 2AE2A 2VJPA 2L82A 3K5HA 5AKXA 3IQDB 1BSVA 4N6NA 1N32B 4AO6A 1K7YA 2GERA 3ZW9A 4Q4CA 5BQPA 2I4OA 3MINA 1FFSA 4JGGA 4OJKA 5KTPA 3SMVA 2AN1A 2GK7A 2C8VA 3BG5A 2K4MA 4B4KA 3ZIDA 1C5KA 1ILEA 2CXSA 2PWAA 3GA5A 3G3EA 2ICAA 1DRJA 1J2UA 4BKPA 4ER6A 5F2KA 4JEUA 2NYAA 2PU5A 2XQJA 5LNK1 3SS7X 1E4OA 1ZICA 3A6FA 3K9QO 2IH4A 3JVVA 3VU0A 3SE7A 2RGRA 2FPGB 4HZGA 3NIFB 3OO1A 3BWMA 4CL8A 4DKJA 5TS3A 3KEOA 4YACA 3UMSA 2PGXA 4IX9A 3QJ5A 2HB6A 4PXSA 1Z4PX 3QLVA 1BD3A 5GTDA 3DOUA 2XYPA 2WKSA 4GOND 4BFVA 1Z7EA 2HRDA 1F4PA 5LJLA 4KWHA 1T2VA 4L6AA 1HWYA 3H1TA 5KCZA 2ZQZA 5LOVF 5ERYA 5CB6A 4X1KB 5A4KA 1YJQA 4GYJA 2V7GA 2XUHA 3AKEA 3RIYA 4B3MB 1KO4A 1Q0QA 2ES4A 2J1LA 2HU2A 3HR4A 4HB2A 4OQNA 4O4JB 4OUDA 3ZQKA 5JOQA 3FYSA 4HV4A 3SQWA 1RAEA 2GM9A 5MF6A 4F3NA 1T9GS 2ESRA 3ORFA 2DBQA 2YTZA 4ZEXA 3VSCA 2B9EA 3H5OA 3PC2A 3SXJA 4LC1A 1M2EA 1OWPA 3UUFA 3F6BX 2Z1MA 1KJ9A 4XB1A 1WPGA 5C53B 1V6CA 2ZWPA 3U7QA 1OVMA 2ZR9A 5FUWA 1DZ3A 1Y1SA 1YC2A 4XWYA 1QX4A 5KOHA 1D03A 4LNUB 2CVQA 2XOEA 4J9VA 4OQMA 5JQGA 2WTBA 2VHUA 1ISSA 4R9VA 5FTJA 5IUNC 3VA7A 3TB4A 1M72A 4Y3UA 3AZQA 3CRVA 4ZT7A 5ALMA 5HF9A 4BZPA 2V6FA 4D4LA 2Z9DA 4V1CB 3I45A 1L7BA 2EG5A 1HUQA 2A35A 3MM4A 3BA1A 1B42A 4N9WA 5L95A 4CDMA 4AROA 4F7WA 3IERA 4GVXA 1XAJA 1JVBA 1G6OA 5DDIP 4AN0A 4EI9A 5EMHA 3L7YA 5I3ZA 2GAIA 3KKKA 2NSDA 4Y1RA 4R1MA 4JLWA 5EJMA 2ATIA 2VYQA 1MUUA 4KXMA 1KY5A 4BO3A 4CKBB 2FHPA 2ZM5A 2BFAA 5KYVA 3C4QA 4NK5A 3MCZA 2AUMA 3GNTA 2QYTA 3GRUA 1EJ0A 2F3RA 1FYEA 3I9FA 4KU4A 1T29A 4Q66C 2XVXA 3U7IA 4JBWA 3HKEB 4DSAA 4PX5A 2EBHX 4R9SA 2XVAA 3ACBA 4WX2B 4DABA 3QE9Y 3OZWA 2FSHA 1AT1A 1RAFA 2JFOA 3CUKA 3U6BA 5D5QA 2WKRA 1X19A 4TMZA 2BFEB 4KITB 1RXWA 4WN9A 2O2CA 1H9CA 1ZJ5A 4DYVA 3DZHA 2DEUA 1E2EA 3GUCA 2FZLA 2GPAA 4HNSA 4KKVA 2PJUA 5KWVA 4RNDB 3ZQJA 4FCTA 4V24A 1EQ2A 2XIJA 1UKVY 3D8BA 4RNCA 1ELOA 4FWBA 4QNRA 1BKYA 1MJGM 2A0FA 1HDCA 2QWXA 3CC8A 2V0CA 4OJQA 3KD3A 4K1LA 4GX5A 4M1MA 4H7JA 5IVIA 1K7XB 2ZG6A 4COOA 4Z4GA 3K1TA 3FOAA 3EQ7A 5J2UB 1YZTA 1NDQA 4CV1A 4K2AA 1UK8A 4R5MA 1A9QA 2H85A 5AW2A 3GRKA 5HKBA 2E9SA 4P31A 5EKSA 4PPYA 4ZVTA 5EJ6A 3GROA 1XMQB 4QPZA 3LUKA 4JKOA 5CYOA 3DEAA 3LUFA 1MZVA 4OK5A 1ZOIA 5I7WA 3FTEA 3OKPA 3Q7TA 4I8IA 1HDEA 4RYDA 4GNKA 2ID8A 3V8VA 1L0BA 2FQWA 2FETA 1D2AA 2XCRB 4YRCA 2VL7A 2AF3C 3JQGA 2HCBA 3ZGZA 1IQ0A 1QYWA 2Z95A 2EKQA 4LJ8A 5LUAA 2Y0PA 1JSLA 2GBLC 3RVBA 4XPIA 1XV5A 3FMPB 4URUR 5DGCA 3CIFA 2NU8A 3F97A 2A4MA 1YI0A 4D45A 1LLQA 4LHZA 5EJEA 1OAAA 3AM4A 1NUUA 5HIIA 1M6VA 1Y7PA 2BEKA 3WIBA 4XWGA 5C5IA 5TMDA 5AOVA 1NZDA 2QXYA 3LX8A 3FTCA 2OCIA 3CTMA 3KT0A 2JKZA 3MT7A 5C1BA 4JXXA 3OU2A 3P20A 1J5PA 4N7BA 4U9UA 4FFSA 3DOHA 1UODA 3G2JA 1TNDA 4I8DA 3VR1A 4FLMA 3U5ZB 4YB8A 3NHJA 5DNDA 3QX8A 9LDBA 3F96A 1DB3A 4J0HA 1XELA 3H17A 2P2ZA 4D4JA 1HYGA 4Y6RA 2BBTA 2VSOA 4KNYA 2CXOA 3P52A 5AK5A 3Q7IA 4LZNA 4PF1A 1DKMA 2H52A 4JI3B 1F6BA 1VSVA 3CH4B 3H97A 3TZHA 4D4HA 5A7FA 1A8QA 1A2KC 1K4YA 4Z9FA 2BHTA 4FFBB 1H6DA 2ATVA 2GBLA 1CVLA 2M32A 2P62A 4HQRA 3T4UA 3WXBA 2QL5A 4MK4A 1BU8A 3EBOA 4GLJA 1PJCA 2QAGC 3JD1A 2IU0A 4LXXA 2XDWA 3EUFA 4CKWA 5CGZA 3QEKA 5FCDA 1DARA 1FX0B 3NM4A 4A6DA 1LF5A 4Q1DA 1Y7IA 3NONA 1J7KA 4F9EA 1JA9A 3E6AA 3RFUA 2HU8A 3VHXB 4KBFA 4JLJA 5E1MA 4EZEA 4D25A 4ZQCB 3BIXA 1RM3A 3PLNA 4YASA 1PR0A 4IIUA 3D02A 2BMWA 4YJKA 3VPAA 3ZJTA 5AOBA 3H9UA 3I53A 2CNWA 3I01M 1ZJ6A 4Y9SA 5E4FA 2ANBA 2I6SA 2PAFA 2VTKA 2XWSA 3GIWA 5H80A 4AMYA 3ZVRA 4F86A 1J97A 4BFCA 2Z98A 4UEWA 4EGJA 2Q6LA 4HTAA 5D1NA 3THOA 8AT1A 1FS5A 4F8EA 5HRAA 4K5QA 1D2MA 1DIRA 1L2TA 5JAHA 3ZHTA 4HWSA 3SBDA 2Z56A 3GFTA 1T6ZA 5DBOA 5HKKD 1EVQA 4IRMA 3NDBB 1J39A 2R4QA 3OLVA 4YWJA 2QAGA 3SI7A 1G19A 3DMPA 2EEZA 1PZHA 2ZRAA 4L0DA 4WINA 4WLVA 2PMBA 2JGFA 1JWAB 1RJFA 1PP4A 5ALFA 3BXPA 4EY3A 3TE7A 1KKMA 2I8AA 5LBUA 3N87A 4LFCB 1SXQA 1DRWA 1XF1A 1UXIA 2JKVA 3BERA 4ER0A 4Z4HA 2NVWA 3HO6A 3IEVA 1M8KA 4PFQA 3WGGA 3NASA 4IICA 2PRYA 4ZEOA 3WV4A 4H77A 3EBPA 4LX0A 4X84A 4OVKA 4X0EA 1IFXA 5AM4A 3GUUA 4C6TA 1YCHA 3C8UA 4UPEA 1QIDA 5IJ0A 5KHLB 2O4CA 3W3AD 3UZUA 1ZRHA 4BGUA 3OQIA 1L7MA 1F06A 1Q5PA 3GVPA 2AFIB 1JALA 2NIPA 4ZCMA 3Q10A 3W1EA 1YV9A 2ZE6A 4TYPA 5JVDA 4PV7A 3IBSA 2HHAA 1YVUA 1K6EA 1P4JA 1K8ZB 2KI5A 1R6UA 2HA2A 4KGDA 3U1TA 4HLUC 2O0HA 3B85A 4QVGA 1NJ1A 3HCOA 4TLMB 3AJ9A 5CH5A 3HLYA 1RHQA 1T9DA 3MEQA 2PKYX 4QXQA 2G82A 4H4CA 2G5TA 4DMCA 1O6FA 5I5EA 2QD1A 4X64B 2BHSA 2WE8A 4W4TA 2Z08A 4L0MA 5IWAB 3G82C 1GTL1 4AG3A 2Y9MB 2A3NA 4OHKA 3VJRA 1N6RA 3EUWA 4I81A 2J9YB 4KR3A 1K97A 2OHVA 3G88A 1RKBA 2VYNA 4FHZA 1G3MA 4MYHA 4QOSA 2ZVPX 5ELMA 2R44A 1X39A 1JH8A 1XVIA 4RXTA 1Q77A 4GBED 2OPHA 2GD0A 1SCJA 3IBCA 4URYR 1UDCA 4MIOA 4C30A 1A98A 2CVFA 3O2SB 3PQFA 4MQLA 4PC7A 1FUKA 2H9IA 3RK0A 5M34A 4RLSA 4E88A 1W581 1E1QA 1E59A 4CGYA 1SBNE 3GI1A 2ZIWB 2BGRA 3LF1A 2FLVA 3A1CA 5J4LA 1QO9A 4HLUA 1HT3A 2BDEA 2R751 3B7PA 3EAQA 1EM8B 3NX4A 1L4EA 4FCWA 4NP6A 2RHWA 2J5BA 3F6CA 1MMFB 2QTWB 3TEMA 3WQSB 1TVMA 4I2NA 2H1RA 2WFAA 4XX1A 5DTEA 5BN3A 1I2AA 2PBLA 3GZNA 4P6VF 1C8KA 5BPFA 2QAJA 4MRAA 4B2PA 1JZSA 2PGNA 4RSHA 2NUAB 3ZXSA 2HQBA 1HLGA 3E1KA 4LXIA 1ACJA 3EMVA 2BVNA 4HDSA 5AIAA 3U3KA 2AT1A 1F6DA 1QH8A 4B3FX 5ALRA 4D9BA 1XNJA 3OOSA 1HA3A 4OQXA 5BV8A 5I4CA 1KQ3A 4FXOA 5F3WB 5BYKA 5D87A 1DIOB 1H42A 1WPRA 2Z8XA 2ZUSA 4YGYA 3FNBA 2W6CX 2ZROA 2ROQA 3BMQA 2C82A 5DIFA 1D8AA 1A82A 1VE3A 3OEWA 4X54A 5DNVA 4KL8S 3VJMA 2IITA 1KYVA 1A5ZA 2LCIA 2OZPA 3U09A 3ASVA 3N0VA 3E8XA 2PUWA 1QQAA 3A0UA 1M8GA 2EX1A 3K1AA 4AKSA 4OL9A 5G4LA 4TTJA 4WKBA 2IKSA 1ESZA 1DQZA 1O9HA 1TXGA 4ENTA 1V26A 1YQEA 1GPYA 3B8EA 3D1JA 4RPIA 4TUYF 1DEKA 4EGAA 3QVSA 3ZK7A 1M0SA 3LP5A 4A5SA 1WS6A 1ZIDA 1Y5IA 4B3XA 3SSNA 1XL0A 5G2OA 1N1MA 1KMMA 1NNI1 2FQXA 2R6R1 1EVIA 2VCEA 4ZOAA 3BYZA 4Z86A 5H3LA 1ZINA 3CE9A 4KI7A 4Q4AA 3TTYA 3H5WA 4ZAYA 4PLCA 2C83A 1JIJA 2QG6A 4MR7A 1N57A 4DCJA 3VZCA 4XSHA 4EJMA 3RH0A 3RNOA 3KQLA 2NZJA 1RI3A 1WZ2A 3RAJA 4CVNA 1PNTA 1LZLA 1SURA 4M55A 4EVRA 1T3HA 5KO2A 1UKCA 3OE7A 4ZVUA 2GMWA 2D13A 4YV0A 4C43A 1IXSB 3AJAA 3X1JA 4KXWA 5LOVA 2R8PA 3K0HA 1XHLA 5KVCA 1CEQA 3N0WA 3P1JA 3I6BA 4EO9A 3NNDA 1L4GA 1A7UA 4GOJA 3TIIA 4UZEA 2X9GA 3DO8A 1HXHA 1QS0B 4DV2B 3EH2A 4LECA 2BMJA 1T9ZA 2PGIA 4JOBA 4ZPJA 1Y1QA 1RWQA 3PR3A 4P83A 4WK6A 3SDZA 4X1IB 3EVGA 3FFBA 1JS1X 3AETA 3MXTA 2IXGA 1VJ1A 4KUEA 1XZJA 2LIPA 3OM9A 2G7MC 4BUCA 2DAPA 4GWLA 3U7GA 4DZZA 1SXIA 2K2QB 3P9QA 4E21A 1Q1GA 5BPHA 4U02A 2A7XA 4I1PA 1RFLA 2A0XA 3S40A 3N05A 5J1SB 4HX2A 2WWVD 4Q9AA 5F5XA 4BHTA 1WZEA 2Z83A 2NTEA 1TTTA 2DT5A 4L3OA 5G0UA 4UVEA 3HG7A 1UBRS 1X7HA 2HBYA 1E32A 4MR8A 1XZIA 1K9SA 4C08A 4RKYA 4WXHA 2AJTA 4DR7B 1E2NA 1YVRA 5JRJA 3TG2A 1RYDA 4WKGA 1JHXA 2RI6A 2WD8A 4PGAA 3GPCA 3ZD8A 4N3NA 4D82A 2XNCA 4PLYA 3FSEA 4TWAA 2PD3A 4O2AA 3GEMA 5G1NA 2I6UA 1H1LB 2R1ZA 1W0KA 1K9VF 5CVEA 1MEJA 1RQNA 2ZRMA 5AHWA 3L82B 4RVNA 1OB2A 4OKIA 5AQEA 1A96A 1ECBA 2NUTB 3DBHA 3L7JA 5IHXA 4RK7A 2RH8A 5HDBB 3VJLA 1UPFA 1FRVA 1P9WA 1N9ZA 2PSEA 1PT9A 2WWTA 5BR4A 1MH1A 5BUCA 3WXMA 1DINA 2GZRA 4C2TA 3AOEC 3PXEA 1TT5A 1IAVA 3D8TA 2HEGA 2WIGA 4FI3F 4P9NA 3RSLA 5ICSA 1IBMB 3B2EA 1XRPA 3PUYA 4MUIA 4OHOA 1J21A 5EPOA 2EERA 1U6KA 3QY0A 2RH9B 1RHKA 2FPKA 3L8GA 2WJIA 3N8GA 4O59O 4BVGA 1YQTA 4MDHA 3LO8A 5DM1A 1NW5A 2WE7A 1TJ4A 3Q41A 1E4EB 1VYTA 2QTRA 3AM3A 1D7OA 1JG1A 3G1WA 3PPWA 4O0LA 1MJGA 1AM4D 5C4GB 1L5GB 1N1DA 1X38A 2PK3A 3DNMA 4FYVA 3IDSA 2PL5A 1W96A 1WSDA 3RRXA 3E81A 1VCMA 1FMCA 4HYTA 3VUFA 1DWOA 1Y3BE 2VK2A 1GDHA 2ID9A 5ECGC 3RC2A 1THMA 4XEUA 5H4HA 1E0JA 5DCWA 1XAGA 1YR1A 1USGA 2VXCA 4QDZA 4RQAA 3DZDA 3D6VA 5EZYF 1VE1A 5C31A 3RRYA 1ZVQA 1B2LA 2NZXA 4GM0A 4H27A 3PX7A 1PBNA 3C6KA 1LW6E 1L4KA 3P2YA 4QGAA 5AJVB 2HT1A 2HBRA 4B45A 1IXKA 3P9IA 5C8YB 5FL3A 4O29A 3NHRA 3ZD7A 3TRHA 4Q3LA 4J16C 5CXQA 3EC2A 5SZHB 4AL4A 1WQ1R 2OZKA 2HMYB 4HQ6A 5KX5B 4BV9A 5ANRB 4HTFA 4FNAA 1HBJA 2XBLA 3T12A 2L69A 3BFJA 4LUCA 5JPDA 2AEFA 2C97A 1ML3A 2ZUWA 1GNLA 3DAYA 3MUNA 4RHFA 5J5AA 3ADOA 4ZEWA 3UJCA 2OPBA 3U4IA 4TL7A 1JDBC 2HYDA 2PUTA 2XJ9A 4P53A 1WTCA 1YRHA 1NQTA 4LSZA 4EKIA 4DV5B 3OQJA 3OX4A 2DQZA 4CV3A 2QRUA 4DF3A 1MJNA 1LI5A 3GFVA 3HCFA 3RYIB 1O8CA 1UJMA 1MIHA 1P9RA 5IC6A 1O89A 2FZKA 2QS9A 4F46A 5KS2A 3I1FA 5FFMA 5A2QA 1SHTX 2FWPA 2XE6A 2X4IA 4XASA 5EQJB 1AIPA 2ZT7A 3BA6A 5EE5B 2C2XA 5A1JA 1LSOA 1QKIA 2QD2A 1YCFA 1WBDA 3VNSA 2I9KA 1DEXA 3ZJYA 2GJ9A 3K8YA 1L5FA 3SQNA 2HOQA 4J16A 5ARCA 4MI6A 1GAJA 4N0MA 4Y0VA 4QG7A 4Y2GA 1LDBA 1ZGHA 2COKA 1PS0A 2IIPA 3W8FA 1W19A 4F60A 5JNLA 5CIYA 3EVTA 1V8FA 5BN4B 3FZEA 4QYTA 3KQOA 1AXEA 2E5WA 3DOCA 3N07A 2RJ3A 1TJYA 1NF2A 1GNSA 1BDIA 1U02A 3O8OB 3Q3JB 4WKPA 4PYOA 2Q5QA 3IEPA 1E8NA 4CI0B 1WQ3A 2WM2A 4R40A 1VSBA 3N5KA 3M6XA 5KTTA 4C4RA 2BC9A 2D0IA 1VGVA 3F78A 3UXMA 5HM8A 2Q4EA 2NUPB 3NVDA 4IHAA 4OHUA 4X8LA 5HCUA 2B1RA 4EW3A 2P5SA 1WVIA 3KZXA 4O5OA 1YASA 3MAAC 1SVUA 2IPXA 3CUVA 3U1VA 4RS3A 4U0KA 1OYWA 1NVBA 2ZTUA 2DVMA 4U2CA 3I01A 2JGLA 3JAKB 3K0EA 3GOHA 4M6WA 4AY5A 4DC1A 4EQZA 2GD2A 5CDGA 3SHFA 3MWLA 5GIOE 9MHTA 1DJNA 2ZQYA 3ZIAD 4AUKA 1YS9A 3W6ZA 3D43A 2FP4B 1BOOA 3NGXA 3RFTA 1VPLA 1N6KA 1SQGA 3KJXA 2X22A 3QJGA 1RKXA 3VR4H 5HUJA 3U61B 2W0SA 2ZB3A 4FLEA 4I1RA 4MO9A 4DR6B 4EA9A 1XDSA 2BEJA 1CJMA 1N2JA 2WMNB 3IVAA 4IJMA 2ZAMA 2YZ2A 1DOAA 4ZAZA 1Z2DA 2V9ZA 3G5UA 3X1MA 3G8CA 3UJBA 5MN5A 2XYQA 3WAGA 4KGXA 2XGJA 4GZLA 4IVNA 1NLMA 3UMJA 3VKUA 3TQOA 1T4CB 4G9EA 2A1UB 2DQ4A 2O0JA 3KQKA 1JQBA 3BCHA 3O31A 1IXYA 2KLBA 1E3TA 3FLBA 3OKAA 4EG7A 4F04A 3E1SA 3M4NA 1XZQA 2A67A 1G42A 2FWRA 4MS4B 3ZQ4A 5JNRA 2V0GA 4QJIA 4XD2A 3SLRA 3KQYA 1IEWA 1KDPA 1Q12A 1J1UA 3AO0B 3QJYA 1DWUA 2VJMB 4BB6A 5J2TA 5ALPA 2WQZA 3NCHA 2YRXA 2P2CA 4NFSA 4QXMA 3VR2D 1P9OA 1ULSA 1U2EA 3HB0A 2E49A 4Q47A 5K3FA 3T3EA 4AKTA 2H51A 1Q6YA 4KIWA 4XCVA 5K01A 1DEHA 1UBLS 3ZI7A 1R0BA 5C4IA 4G0OA 4CF5A 3HDGA 1ZM3A 4DDMA 2YY7A 1NYQA 5CX1A 3F3MA 3ZHRA 4KXUA 4UATA 4K9QA 3OQ6A 1JL3A 3L49A 4P4SA 5BSVA 1K8QA 4MIEA 1I4DD 2CNLA 3G5TA 3AUTA 4FFMA 3R8CA 3S1AB 4PO9A 3F46A 3FWHA 1AXGA 1E9AA 3HA5A 3ZH2A 1RE1A 3F5SA 5TS2A 3T7CA 3EGEA 3K0FB 5J3JA 4V0SA 4LV5B 5E6RB 2LKDA 2X3FA 2I7CA 3CUEF 1H94A 1RKQA 2INGX 1BEZA 1GKIA 3KX2A 4R01A 3G7NA 1WL8A 3TOVA 1P17A 1BOFA 1XYYA 2C4TA 1N6HA 4K9PA 4L57A 4LWOA 4KPEC 5BSGA 4EENA 1U7DA 3BSYA 3PNOA 4X3PA 1KJNA 3URKA 1LSSA 1TYBE 1FU4A 1NHWA 2QRVA 2C9BA 2ZKLA 1QAOA 3A9CA 5I45A 5KWJA 4M22A 4QECA 1FS4A 4DDWA 3VMMA 4TN1A 2NO9A 4Y2QA 2ZTLA 2QTMA 5CT4A 3TYXA 1SCAA 2X76A 4FJ1A 4U6NA 2CNOA 4WCFA 2YV3A 1S2LA 3G2IA 4MV3A 5JCPA 2UUBB 1KI4A 4PFJA 2GCEA 5LXTB 2GTHA 1VA5A 4P80A 1BVHA 4MA5A 3RYHB 3FNGA 3C5WP 1CTQA 1XTQA 2W6OA 4I46A 3TLMA 1RLUA 1ZNZA 1P2TA 2Z43A 5TEWA 4TRJA 1BD4A 7AT1A 4ARUA 3HXQA 2Z6UA 4ALMA 2WJJA 4G89A 4R2LA 1VL0A 3ESXA 3KJNA 3OLZA 2C00A 3B3QA 3FVRA 3WMEA 5KTMA 3AV0B 5JSQA 1RWNA 5TXGA 3T41A 3GCWA 4DYDA 3NTUA 5A3VA 1ZVKA 3OCWA 3TH5A 3G02A 4JJKA 2XXBA 1OOEA 2RHTA 1B93A 3EDRA 1AKNA 2ZJBA 5CURA 5I4BA 1JE1A 1LDNA 4U9IS 1WTAA 3H5TA 3WG9A 4L73A 5TE9A 5K6TA 1B26A 5K6AC 4QPDA 4DT1A 3RAPR 3AEKB 1YS2X 4GQBA 4M49A 1M74A 4JLSA 4WMLA 3RUAA 3LNTA 4I6GA 3WB1A 1WUKS 3LGAA 4C9BA 3TCXB 4JMPA 3N2NA 2NTYC 2Q6IA 2REQB 3PGVA 1E0DA 3FSJX 4O02B 4XX0A 4ZVVA 1EIWA 5JTTA 1GT91 1GKLA 3FMGA 3TZQA 3S55A 2EARA 1A8HA 4B44A 1RQGA 2P9HA 3CVWA 2I87A 3AWIA 2BIFA 5JY1A 3GT7A 3SK0A 4K3VA 1XK7A 1ZGAA 4FDVA 4LAFA 4X9XA 1LDMA 4ZCLA 3T5PA 5KYKA 5DNCA 3S2IA 4S05A 1W1UA 4TUYA 1WF6A 2C88A 1D4FA 1SK8A 2R62A 3QZUA 2ID4A 3NUZA 3PE4A 1T36A 3OQBA 4LDRA 3U0VA 2R6HA 2Q1TA 4B7CA 5IULC 4IUCS 4LDPA 3TS1A 2OZLB 5E4YA 2I34A 1JU4A 5DHUA 4BBAA 4X8MA 3NOVA 3NC4A 5DNWA 3CYFA 3W77A 2MYTA 4HLDA 4F5EA 4G0YA 4HUQA 5K6AA 2TMYA 3BVPA 1MLDA 4A36A 3ZKAA 3I9NA 2VWQA 1K2VN 2VNIA 1VP3A 1VE6A 3IBFA 1G98A 4US2R 2OBYA 4UU8A 4WH0A 1XRJA 2RGGA 1FVOA 4MV0A 1U04A 3DHYA 3WK7A 4UAUA 1UR5A 4Z7OB 2ZYSA 1PYOA 5KI6A 2XUOA 3DMNA 1Z47A 3O3CA 3P4XA 2AN3A 4BZQA 2MU1A 2B8WA 2O1WA 3UK0A 3BEOA 3FETA 4PLZA 4B6PA 1XMPA 2ZDQA 2GYWA 3HXLA 3HXPA 4JQSA 4MR9B 1CIVA 1NDUA 2BH2A 1HE4A 1KEEB 3MJDA 4G0PA 2CN1A 2XMRA 1N8NA 5A1TA 4RTLA 4B7XA 4GWGA 3DQPA 3WGTA 5HK9A 4MV5A 1KQFA 1ZH2A 2JIRA 1CX9B 4YRSA 2IY9A 5DWQA 1QLHA 4UTOA 3JPYA 3UQZA 4LYGA 3NOQA 5AUNB 4PE5B 1AOXA 4G5YA 2YZ7A 3JVDA 4FI3C 3D4PA 1RMYA 4PBRA 2NT4A 4DDHA 5L51A 2YZMA 1U7OA 5JAOA 1US8B 4V0QA 2C8JA 3A11A 4B79A 2NO5A 1CNMA 2VRBA 4AWXA 3MWJA 3OM8A 4TRNA 3PK0A 1LB1B 1GRVA 2RFLA 3R5XA 3QI7A 4Q12A 5HJ7A 2G6BA 1SG9A 4TLAA 2E89A 3VI4B 3A9UA 3KR0A 3K53A 1Q0SA 4GX2A 4MLPA 2OQIA 1PGPA 3HBNA 1YDFA 3PP8A 5D3ZA 5K8VA 1C9MA 5AW9A 1DXHA 3L5OA 4CLOB 3ZCRA 1B1CA 4IQ4A 5LQJA 2XSZA 1ENOA 4AD8A 2DWQA 4FFDA 4KXXA 4NH0A 1PJQA 3VTZA 2WHQA 3CRW1 1CQPA 4MWTA 1V95A 3X2FA 1CY7A 4EHLA 1SKMA 1AQ6A 2VP5A 3ZCXA 1N2OA 2F1IA 5IS2A 5JY6A 1EU1A 1M6NA 2PMDA 2PR2A 1D4AA 3ANTA 4DNPA 3C8MA 2ZAYA 3UEOA 3DE1X 4XLZA 2XDYA 4L4XA 3DFMA 5MFPA 3RU9A 2J7KA 3UQYS 2YIMA 3KAQA 2CE2X 4RC9A 4ZVRA 4FFRA 3FKSA 2CLIB 2HNBA 2FSGA 4D3YA 1YZKA 3AR3A 4PW0A 3T4EA 4CKYA 4DSUA 4CCYA 1COWD 1SA0B 3B1XA 2C1EA 3I8SA 4NBRA 4P3XA 3BIFA 3TL2A 4AECA 4BNKA 1ZQ1A 3NHFA 2FYTA 1LTQA 1U0FA 2FMKA 1V3VA 2ANCA 3WNVA 3L8CA 4J2OA 2IA5A 1EUCB 1TAUA 4F97A 2FKNA 4LI3X 3VYTB 3WFJA 4AX8A 3R3YA 4UFNA 4LE1A 5C7IO 1UXHA 5CB4F 2J31A 3AL0C 2R1TA 3PEEA 3DLPX 2QX7A 3DLCA 5FTNA 4YT5A 1WW3A 4F3RA 4RPHA 1E1RA 4BX3A 2GEFA 4JUBA 4ILKA 4FHEA 4OGLA 1EFUA 1R3DA 2VP6A 3B9RA 3FWYA 4QICA 3AHEA 5DV9A 3K70B 4EFMA 4D3FA 1REQA 3GV0A 3Q6NA 5AOCA 3SICE 4Q3AA 2I71A 3HEBA 3LGSA 3RPEA 4UEQA 4KE6A 1PK9A 3IQWA 5FOTA 3GLVA 3AYXB 3T15A 2PSJA 1OXMA 1G7TA 3R75A 3IDQA 4FXPA 2NT3A 4ZKEA 4P92A 5CP8A 4JITA 1DBSA 4XUDA 3RJTA 5HILA 1FRZA 2OCBA 3ABIA 5HUHA 5EHNA 3RAFC 3WNZA 4FEYA 3MJTA 4XGNA 2C5FA 2R7AA 4RJ2A 1EZZA 1Y4UA 4F21A 4G0QA 2CE7A 4OQZA 3R7FA 3R7SA 5AXAA 5IBRA 4XR4A 3PEYA 1OFTA 4N5DA 3F71A 4F0JA 5BW6B 1Z0JA 3NANA 1WXXA 3Q1LA 4QXOA 4RV5A 5ENZA 4Z3DA 2ZRDA 4PYQA 3W1WA 2A1TS 2XYVA 4J0KA 2XDAA 4OHYA 1OI7A 4RE6A 2C5BA 4KRFA 5JS7A 1PR6A 2NG1A 4I50F 3THRA 3AUJB 4JI2B 2Z2KA 3GJZA 2OLJA 1PKEA 2YS7A 1ECFA 3E5RA 3IHKA 1YIAA 3TBKA 4LFBB 3BHJA 5F78A 4AT1A 3BH0A 4DEXA 1PJZA 4MEAA 2QL6A 3EIEA 5CDYA 2GHRA 5HQ3A 3H4TA 1KTIA 1LKZA 1O57A 1XRMA 1WW8A 3FYTA 2IXAA 3NC1C 3K09A 5DEIA 1PZMA 4ZANA 3UMVA 4FB4A 1M66A 2WT4A 1C4OA 1QFSA 1UT8A 2QEQA 2XUKA 3MUFA 1BC5A 1XRLA 4FW8A 3U39A 2AK2A 3SC2A 4RWEA 4E22A 3EXG1 1PJTA 3I8XA 4EUEA 3M3DA 2XHEA 1AUXA 2X8AA 3ML1A 3AMVA 1IY9A 1QH1B 3T3HA 4F84A 4NYMR 4AY6A 4KO4S 3IV9A 3P94A 1W52X 3FKJA 5EKUA 3Q72A 3TSYA 3ZGYA 1TA0A 2AS0A 3I32A 2QUIA 5F51A 4R6XA 1KO5A 2V4ZA 1A5SB 2CFTA 1ZXLA 2CLFB 3C14C 2JGJA 5FI3A 4OXIA 1E3JA 3C3YA 2EX4A 4IWXA 4ACBA 2OEPA 5KHOC 4E2YA 3SZRA 4ZHQB 1RAAA 4MQBA 3DXXA 4RESA 2O7QA 4ALJA 4J4BA 4CTKA 3U7RA 2ZJ5A 2HM7A 2WOJA 3J7AC 5IAGA 3QMVA 4JB0A 3EIWA 1HK7A 4JJ7A 1ZSNA 4GR9A 4YQFA 3MWYW 1VCOA 2VQFB 5BV1A 4M0EA 2G36A 3QNWA 2CVOA 1R0KA 1WMDA 1XQVA 4MDYA 3SHWA 4OQPA 4EF4A 5DXAA 3AUYA 1PCXA 3L7BA 3L6UA 5FTWA 2IEIA 2WKWA 4DDTA 4LJSA 2B20A 4PG4A 1UINA 3H5LA 1MO3A 3NKFA 2P9ZA 2QMOA 3B3AA 3HCEA 3LHIA 4F9TA 1V1RB 2O9JA 3G2PA 2O3UA 1BDBA 4TXNA 1M0WA 1RXSA 3EXEA 2ATXA 1JXMA 3NBQA 4ARZA 2XZPA 2B83A 3NC0C 4ND8A 3BRWD 1R4NB 2IOFA 2I2FA 3EMKA 1QRTA 3EUEA 2GZ2A 3JQRA 1OKKA 2WNSA 3QQPA 3GW8A 3MGBA 3DAHA 4IZOA 1I9GA 4MA0A 4XUEA 1ZUNA 2AFIE 2AOUA 2Z3ZA 4TT8A 5ALXA 4F7DA 1L7DA 4KX5A 3W1VA 3CEJA 1KJJA 2HO4A 3CO0S 4MV9A 5C37A 2EC5A 5DLYA 1QVVA 2JJ2D 1UQTA 1CFJA 2OVBA 4J3JA 1LPSA 1YR9A 2QRZA 4MVJF 4WOKA 5CFMA 4BZZA 2P6MA 2XKKA 4OQLA 4N4AA 5JS8A 2ZI4A 4LHVA 1KMHB 1U65A 1G1AA 2SNIE 2XMSA 3U13A 5BWBA 2VDPB 3OG9A 3P27A 1Q7RA 1XYVA 3LIIA 3RSCA 2OV8A 4MVJM 4MP6A 1P62B 1KI1A 1WLSA 5E7JA 3CUWA 4KXNA 3ZHCA 1Z0SA 2APJA 3OZ7A 3WYGA 4BKMA 2P35A 5JI2E 2AGVA 1XDUA 4AZ3B 5L7YA 4PGHA 4C07A 3D7NA 1XVUA 3VR6H 1JKJA 2IPOA 3TVDA 2GAOA 3TTXA 3MB8A 1YBVA 5D00A 3ON5A 4ARVA 3HKBB 3O74A 5DBFA 4D0LB 2CDAA 5EI5A 5F73A 3WGIA 1A27A 2CMDA 1F8XA 1HEYA 2JBAB 4J03A 5EOVA 1XK6A 1NRWA 3T7RA 4PAWA 4GBMA 3V3TA 1TADA 1CK4A 3T38A 3OZGA 3R7NA 3WGHA 2AC7A 1FTNA 3BAZA 2DQSA 3PXDA 4C04A 1HLFA 3HYLA 1PZFA 1X1AA 3A2LA 4Y67A 1Z6ZA 1UOQA 1EXNA 2X4DA 3C6ZA 5GOZA 5L7TA 1JYSA 1Q16A 4E1AA 3IUMA 4AF7A 4NNOA 1JJFA 3SX4A 1T9HA 1T24A 3A10A 1RADA 3BGWA 4B73A 2GTIA 1B41A 1DELA 3PNYA 5I8PA 1DTSA 1ZH6A 2QPAA 2WRZA 4MWGA 3UA4A 1KE1A 1XU4A 3K9CA 2BMDA 3SJCA 3JAWB 3K16A 1H2BA 1R5NA 3M6UA 4A1OA 4CQJA 5KYWB 4CEHB 2ZE5A 1D2EA 3Q8XB 3W8NA 2BSQA 4WXPA 3QKUA 2CXPA 3SZ3A 2RCNA 4B85A 4JNKA 4U2EA 4IXTA 4Q7MB 1HYBA 1Z6YA 4EG3A 3ILYA 1OMOA 1RWPA 3MTGA 1JHUA 3OWXA 3GARA 2YUIA 2J9ZB 3E7PA 4PLWA 2QLJA 4G6ZA 3O4VA 2O6HA 5DWDA 3H1AA 3GLIE 1UMDB 3JVIA 3ECCA 5L6MB 2RGYA 1Z74A 2OD9A 1HLPA 1CBUA 2H9AA 2JJ8A 2DH5A 3C85A 4FFPA 5CNMA 1BGWA 4H1VA 5ALLA 4HNTA 3UOWA 3HSKA 4XQ0A 3KJFA 1JEAA 4EJ0A 4ZAXA 4DQDA 4B4VA 1A04A 3F6PA 1KIAA 2WIJA 4MAAA 3RKSA 2DWUA 4DQKA 4ZVPA 2BDUA 2HGZA 2AFRA 3CT4A 3PKIA 3QVGA 2FW1A 3JYLA 4CDNA 3GBSA 5TR9A 1UC8A 4QUIA 5B3AA 2BUBA 5DN6D 4MKHA 2RK3A 3CHYA 2ZS9A 3S1LA 2FH5B 3OJXA 3GFQA 4DARA 4V0KA 4G1UC 3RG2A 5GMOA 3A06A 3NRJA 5I7VA 2EBFX 4HX5A 5ALKA 1OXKB 4GDMA 2V9CA 4CMCA 4MI3A 3S6JA 1ZGBA 4OAPA 5JO9A 4J7AA 1EUYA 1MN6A 4Q01A 4FOLA 2D1TA 3L01A 2VOJA 4ZAFA 1PYDA 3OF3A 2Y2VA 4MS1A 1DI0A 2H3EA 4EB6A 3PWSA 1U8AA 3KFXA 1ND6A 4LY9A 4L3WA 2QYHA 4XQ9A 2Y05A 4LYYA 4W9RA 2XTJA 5KWIA 4AN4A