1LK0A

Disulfide intermediate of c89l arsenate reductase from pi258
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
130
structure length
130
Chain Sequence
b'DKKTIYFICTGNSCRSQMAEGWGKEILGEGWNVYSAGIETHGVNPKAIEAMKEVDIDISNHTSDLIDNDILKQSDLVVTLCSDADNNLPILPPNVKKEHWGFDDPAGKEWSEFQRVRDEIKLAIEKFKLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords arsenate reductase
publication title All intermediates of the arsenate reductase mechanism, including an intramolecular dynamic disulfide cascade.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Oxidoreductase
total genus 51
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature ec 1.20.4.4: Arsenate reductase (thioredoxin).
pdb deposition date 2002-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1lk0A00
2FQXA 1LJLA 5FWXA 1YMVA 3EJWA 4MAAA 3DLBA 3S99A 1ZGGA 3NNNA 1DC7A 3QLUC 4LE0A 4MLDA 5B3JC 5HSGA 2L2QA 3LUDA 4RK5A 3O1HB 5FBHA 1Z2EA 4D74A 3FFTA 3RVRA 1JHZA 5IC5A 3RVQA 1QPZA 3G85A 4ML3A 5EWJA 5EWMB 1JYFA 9ABPA 4KRFA 3TO5A 4JAVC 4WWHA 3RH0A 4KK4A 3UK0A 2A9RA 2H3HA 4PZ0A 4W5TA 3O2SB 1VLZA 3CNBA 1JBEA 3TX6A 2Q5CA 3C3KA 1BAPA 2JVIA 3CU5A 1S8NA 4MQFA 4B09A 4ETNA 4MR9A 4QICA 1QO0D 3GYBA 4MYRA 1ISRA 4UHKA 3CG0A 1JLKA 4TN5A 3CHYA 5BR1A 1CYEA 3OQOA 1MIHA 3KJXA 4N47A 1AB6A 3QLTA 1ABFA 4RXTA 3LTEA 3HK2A 5TQJA 1BDJA 3EODA 4MPTA 5CNJA 4H60A 2FVYA 1LBHA 2NZVG 4MGEA 1OXKB 4YCSA 3ILYA 2MYPA 3LUJA 4Z99A 3NBMA 4OLBA 2M1ZA 3GL9A 1JWLA 5CNIA 2DRIA 3RVMA 2LUOA 5TPWB 2LBPA 1TM2A 3QLVC 4XARA 4O5AA 4L85A 1XHEA 2PUEA 3OM1A 4Z4EA 3FDFA 1NXOA 1EHCA 2FMHA 4XFKA 2HSGA 1NTRA 3SNKA 3HXMA 3OLYA 1JH9A 4PEVA 2R48A 4MR7B 1MB3A 1DBQA 4HNQA 4M88A 1D2AA 3IP7A 5KC9A 1NXVA 4Z0NA 3N0RA 1FFWA 3BRQA 4MR8A 3NNSA 3HM9A 2FEWB 1P8AA 4HNRA 4MRMA 2R4QA 3IDOA 4WZZA 4KK3A 1D1QA 4O1IA 4RK1A 1QMPA 5ED4A 3A0UA 4IMIB 3HEBA 2PUGA 2MYTA 3QELB 2WWVD 1JDPA 3MA0A 4JA2A 3QX9A 5FWYB 2LPMA 4G0OA 3DBIA 4Q6WA 5IBQA 1K68A 3SY8A 3QEKA 1PEAA 3GV0A 4F8JA 1SXHA 2QR3A 6ABPA 3P9YA 3H5OA 4KVFA 1FFGA 4G0ZA 2FLKA 3IP5A 1NY5A 2OQRA 2YHAA 4FE4A 2XDYA 5KQGA 1DRJA 2B4AA 2QZJA 4G97A 1EAYA 4RY0A 4TLLB 5JNTA 1A0OA 1P6UA 1RNLA 2FMFA 4P98A 5IEBA 2L19A 1YK1A 2NUBA 4ETMA 3RVSA 1MAVA 2VK2A 3KTOA 2FEKA 4F11A 3N53A 4ZJPA 1ZESA 1FSPA 5TQ2A 5PNTA 4UHJA 4RS3A 5GQSA 2NT4A 2QVCA 3LUFA 3UUGA 1ABEA 3OLXA 3EGCA 1QQAA 3HDVA 3KYJB 2CD7A 1AB5A 4XAQA 4EUKA 5IEJA 4GNRA 1E2BA 2O20A 3H1FA 2QVGA 1NXSA 4F12A 3I09A 3DGFC 3JTEA 2JBAB 3A10A 1SRRA 5GOTA 3KLNA 4G0QA 2YHBA 1JFSA 4IRXA 5KC8A 4OG2A 4MS3B 3VNAA 4EYQA 4LRQA 1KRXA 3G1WA 3OMWA 5TPZD 4W5RA 1ZITA 1MB0A 4RXMA 1E6LA 1ZGZA 5EWLA 4P1ZA 3DZDA 2PL9A 1NXPA 3I42A 5HQJA 2L18A 3H6HA 2GWRA 1VKRA 3Q7RA 2FSPA 2LP4Y 3EQZA 3UKJA 2FMIA 3GT7A 5KQLA 5JNRA 4EYKA 1YVUA 3QK7A 3M6MD 3BRSA 4QYWA 2L17A 4W5OA 2NZUG 4IMJB 3LFTA 3OO0A 1LBIA 5EWMA 3HS3A 2TMYA 4IF4A 4NV3A 4RWEA 2PJUA 2JK1A 4GPAA 3TMYA 4JASB 1QKKA 3E3MA 1T34A 4TLMB 5CHYA 1JYEA 3HUUA 1U04A 2PL1A 1W25A 3Q41A 4XLTA 2PUDA 3URMA 1DZ3A 4YGXB 4KPYA 3HDGA 2NT3A 1A04A 3E61A 1TMYA 4Z4GA 2MSLA 1P2FA 3FFXA 4Y9TA 4EYGA 3NNDA 7ABPA 4XXHA 1USIA 1Z16A 1DCMA 1EWKA 4H3KB 4KZKA 4E7PA 1USGA 4G86A 2RGYA 1RPJA 3LUKA 4ETIA 2VUHB 2FN9A 4MS1A 4RU1A 1U8TA 2ZWMA 3H6GA 4N0PA 4RY9A 5IULC 3F7NA 2FLWA 2RJNA 5C5EA 1DCKA 1L5ZA 4MS1B 2GKGA 4MLCA 3CRNA 3H5LA 3T6KA 4Z4IA 4DADA 3JVDA 3O1IC 4HYEA 1U0SY 2MYUA 5TPWA 2PUBA 1JFTA 1WETA 2JB9A 5BRAA 2QXYA 4YWHA 1SD5A 5TQ0B 5KI6A 5IUJC 4LDZA 3K9CA 3LUHA 1U2QA 3Q15C 2ID7A 1QP7A 1M5TA 1ZN2A 4YLEA 1EWVA 1ZAYA 1YMUA 2PMCA 4OTZA 1USKA 1Z12A 2VYCA 4LE1A 4KREA 4MR7A 4LDAA 2M98A 2HQOA 2A9QA 1RZRA 1JX6A 3W9SA 2JVJA 1JDNA 2CHEA 4RV5A 2MSWA 2R25B 3MQ4A 3OLWA 1Z17A 3MMNA 3D02A 1K66A 2MYNA 4NQRA 1ZH4A 4N0QA 2FW0A 3GBVA 1ISSA 4CBVA 3I45A 3KHTA 3T8YA 5JNVA 3QELA 3BILA 3D8UA 5BRJA 3IPCA 5FWYA 1PHRA 5DLEA 4EY3A 4QYMA 3FMVA 4KMRA 1D4ZA 1TJYA 2CWDA 3CFYA 3HV2A 3N0XA 4OBBA 3C6QA 4Q6BA 5T3YA 1DG9A 3H5WA 1DBWA 1R8JA 1ZHHA 3DLHA 4N03A 1ZH2A 1Z26A 3HSYA 4F3TA 4G0XA 3EAFA 1NXXA 1YS6A 2HPHA 4WUTA 4RK0A 4RXUA 2KYRA 3QLUA 2GX6A 3LUCA 3RVOA 3IPAA 3JS5A 5B3JA 3C97A 2PUFA 4KV7A 4JP1A 2WJAA 2JRLA 4QPJC 1Z2DA 2BGGA 3OLVA 4DN6A 1LJUA 3N8IA 4EVQA 4Z4FA 1NXTA 3SAJA 2PUCA 1HEYA 2ZAYA 3BREA 4H3HB 3M9WA 2QV0A 1SXIA 4W5NA 1DCFA 4YV7A 3OMXA 5HKOA 3N6VA 1QO0A 1F4VA 5FBKA 5KQMA 3H1EA 3JY6A 4RZSA 3H5IA 1YS7A 2JBAA 3TD9A 1ZVVA 4WXMA 2AYXA 3GWGA 4MQEB 4MS3A 4NICA 2GBPA 1M2EA 4RK4A 3IP9A 4D6XA 2QW1A 5DCLA 5KQPA 1CHNA 1IIBA 2R47A 3GA5A 2HQBA 3LOPA 4RKRA 3SQNA 1LK0A 3CG4A 4NCAA 1I3CA 3BBLA 2IDMA 5D2CA 2OENG 1FFSA 1JL3A 3F6PA 2A9OA 4OLAA 1TLFA 1MVOA 2FQWA 3HCWA 4G0MA 4IILA 3QEMB 2E4WA 2FN8A 4XASA 3O2QB 3DGEC 3N0WA 3HZHA 5E3JA 1DP4A 3N75A 1RZRD 3NHZA 2B1JA 2FKAA 1TVMA 3KSMA 3LMKA 3RQIA 3F73A 3MM4A 3QLVA 1DJMA 3CZCA 2IYNA 1J56A 2RDMA 4JB2A 3OO1A 3KLOA 3KG2A 4G0PA 4EVSA 4ZMSA 2RJOA 2W42A 1BDHA 3QX8A 3ILHA 3GRCA 1E6MA 1Z15A 3FFWA 3KKEA 1W9HA 4EVRA 3LKBA 5KWSA 5BQ3A 4YRZA 1L5YA 1YTUA 2JCGA 2IKSA 1Z18A 3JVIA 3ROFA 4ZPJA 3C3MA 1H9CA 2WRZA 4Z9AA 1Z13A 2FQYA 5FWXB 5JS1A 3RVNA 1NATA 1RXIA 3O2JA 3LUAA 5DGCA 5F64A 4W5QA 1FQWA 5IUKC 2X7XA 4KQCA 1XWWA 5DKFA 4NCBA 1URPA 3A0RB 3L49A 4OATA 1RXEA 5EWJB 4FB4A 4ZMRA 1XHFA 1B00A 1GCGA 3RVKA 3H5VA 4LX8A 5CNKA 1ZY2A 4YP9A 3MIZA 1A2OA 3CLKA 1D1PA 2E4ZA 4RY8A 3TB6A 4DQDA 2F8TA 5TQ0A 4L4UA 4WXEA 3A3KA 2E4YA 2FXIA 3SM9A 3H75A 2VUIB 1U2PA 3GBPA 1OXBB 4MQFB 4MR9B 5CNMA 3L6UA 5TE9A 1EWTA 5I4CA 1QP0A 2PLNA 1BDIA 4TMYA 4IGAA 4S05A 3MF4A 4RKQA 1P6QA 4D6YA 4RDCA 2ID9A 2J48A 3KYIB 4FE7A 2GI4A 1VRVA 3SG0A 1E6KA 2P4UA 4F06A 2QU7A 4WT7A 4YO7A 5JNWA 1YIOA 2IPMA 5TPZA 4N41A 3Q7SA 4G0YA 4Z4CA 2MSKA 3JPWA 2LIVA 5ABPA 3KS9A 1GUBA 2FTKE 2PKXA 3H1GA 1DBPA 2WY2D 1QP4A 4LE2A 1C0EA 1PNTA 2CHFA 5T7BA 3OQMA 1BVHA 5C5CA 3JPYA 1PUXA 4YS6A 3EDCA 3HJFA 6CHYA 3LUGA 2PAFA 1KMIY 2FEPA 3CZ5A 8ABPA 1DC8A 4PE5B 3O21A 3CS3A 4RSMA 2E4XA 2E4VA 3EULA 3RVPA 4Q7EA 3K4HA 3O1JC 2HQRA 4EYOA 1JF8A 4Z4HA 4Z9BA 4MR8B 1GCAA 3NHMA 4MRMB 1C4WA 3R0JA 5IX8A 2F8SA 4YR7A 3ROTA 4JOQA 3O74A 3EQ2A 3IP6A 3I5AA 4ZYLA 1BA2A 1ZDMA 4N76A 3O75A 4RK7A 2A9PA 1QNLA 3M9XA 1DRKA 2IOYA 4PYRA 4HNSA 2FMKA 4MQEA 2IPNA 3HVRA 4EGSA 2WB4A 3T95A 1YK0A 3LKVA 2I6FA 3CTPA 4O1HA 1D5WA 1APBA 3F6CA 3OM0A 5JNSA 1CEYA 4JB0A 1VPWA 3RVJA 1Y1LA 1GLGA 1KRWA 3RVLA 1SXGA 4KQ9A 2QSJA 3FGZA 2AYZA 2P9HA 3CKMA 3HUTA 3QEMA 3Q9SA 4LZLA 5TQ2B 5JNUA 3B2NA 1M2FA 1Z25A 2JVKA 1M5UA 2V0NA 2HJ9A 3KCNA 2E4UA 3T38A 3Q7TA 2WJWA 1KGSA 4RK6A 1JFVA 3MYYA 4PICA 1NXWA 3OLZA 4MS4A 1EFAA 3HO1A 3H5TA 4KNYA 5HM6A 1PEYA 2H0AA 4MS4B 3VNBA 4KFCA 2IPLA 1QQBA 2PUAA 2IPAB 4S04A 4E7OA 5JS2A 1F51E 1PNRA 5IUNC 1UDRA 2PE5A 5DTEA 1GUDA 3C3WA 3OQNA 5EWLB 2WMYA 2N9UA
chains in the Genus database with same CATH superfamily
3SR4A 3BWMA 3H13A 1FNCA 2VSQA 3GMTA 3PFBA 4NEHB 4QRIA 1VLMA 1TEVA 1Y1KE 5AHWA 1LDGA 1HXHA 5FQOA 2ZE5A 3NGXA 3PFIA 3C98A 3HLTA 1KEKA 1Z38A 3KR1A 4TVOA 1KKMA 1U2SA 2QUBA 1FZTA 2MINB 1N6KA 2IXFA 2J09A 1MGOA 3EEFA 3UMJA 2ZBGA 3DOOA 3FFTA 4AYWA 3SBXA 2Q1SA 4PR3A 4TYWA 1MQ8B 5SYNA 3ISVA 3WLOA 2G9NA 3HMKA 2DM6A 1LLQA 2A14A 3KO8A 3MSXA 3MD9A 1QJCA 3GMSA 3CXRA 1V9SA 4HDSB 1JB9A 2IXGA 5D3ZA 2LR0A 3NHKA 4OKSA 1O6BA 1P45A 1SVOA 3AUKA 2WJVA 4BMYA 4F4JA 2JLYA 4U39A 2QL6A 3H7IA 4B09A 2PGLA 3CT6A 2VWHA 1W0JA 2X7JA 3GOQA 1GPDG 1TE2A 2D7CA 3F49S 3K5HA 5E9JA 5EZ5A 3RTBA 1YU9A 4RA6A 2Z95A 4D44A 5A6SA 3U44B 5BR1A 2XT6A 3TPZA 4ITUA 4DE5A 1MZVA 1R9GA 1F14A 1XCGB 3UFXA 2JHCA 2OXFA 5IJ9A 1HWYA 1HE3A 1NBEA 1MABA 2GBIA 2PK3A 1EEXB 2VHJA 4RXTA 2R6FA 3QKRA 1P4JA 4X1YB 2YCLA 5H82A 4H6PA 3W6NA 3FOZA 3WLFA 3W05A 4UPDA 3L8YA 5C53B 3DE2X 4AUMA 4BAGA 4O2AB 3DQZA 2JFQA 2QE7D 3ANNA 4QUEA 4U9HS 4HDRB 5AJHA 3FLEA 5BOSA 5C80A 3AZOA 3VFDA 2A5FA 1A8SA 2Q4OA 3KQPA 3Q0TA 5TPWB 5G40A 1UZAA 1PFYA 1ESZA 2YWJA 3EZYA 4ALIA 2F1IA 3QPUA 3C8DA 4O5AA 5A9RA 1L4KA 2IE8A 4R2WA 1ZD8A 4ARUA 2PUEA 2YHIB 4HQRA 3IP3A 1NBWB 2Q07A 2FMHA 1LPMA 1AIPA 4MWZA 5C4GB 2W48A 1POXA 1CR1A 2IDKA 4BECA 1P7VA 2C2HA 1X1CA 3BHJA 1MB3A 3HYSA 4HNQA 5FWAA 1KK3A 1NXVA 1NI5A 1WB6A 2IFTA 1FPQA 3HYTA 1QIEA 1VMDA 5ALLA 3ZX5A 3HCFA 4G0WA 1YUNA 1KOJA 4ILKA 2PT6A 3V7FA 5K6AA 3PFWO 3SXPA 3PB3A 3K20A 1WQ1R 4P8RA 2B3DA 4CQLA 5D01A 3LY8A 1UODA 2G72A 3DTYA 4IMIB 1ID1A 4W99A 3EXFA 3IMFA 4E5VA 3QX9A 4DLXA 3EPPA 2GM4A 3IH5A 3GI1A 1NJ8A 3WLRA 1JG4A 3MWYW 1TM4E 4GMHA 2QHXA 4KN5A 4HUJA 1E0DA 1G21E 2G67A 4K88A 5IP5A 1MNQA 3RPEA 5CEFA 3AT1A 6ABPA 1T3GA 3P9QA 4GO1A 1FFGA 3DKPA 2F9FA 3GJ0A 1DIGA 2ENUA 2OQRA 5FJIA 3A1UA 2BAGA 2VOEA 4XSGA 2R8PA 3TLGB 3TLMA 4EENA 2Z08A 3BDAA 3E3LA 1DMSA 1EAYA 4F2DA 4DT1A 3IO5A 3R7LA 5I45A 3QFHA 1Q0QA 1MXFA 1QZTA 5F33A 3AEXA 2VYND 1WXGA 4ETMA 2B61A 1KI3A 3RLIA 2FPUA 3N53A 4E33A 1DIAA 1G20E 1KAGA 3ZBTA 3JALA 1W4AA 3CPJB 3OLXA 4Z0PA 1EWQA 2GPTA 1QQAA 3VR6H 2CD7A 1CK4A 3L7AA 2NUPA 4W9NA 5KCMA 5HFJA 2IODA 3PC8A 4FCTA 4U3JB 3VNSA 3PU6A 3A9RA 3I09A 4QIHA 2I4TA 1O6GA 1SUWA 1JLMA 2EJWA 5KO2A 1E1CB 1V5GA 4PYMA 5DLQC 1WXQA 3THSA 5F7OA 5LMCA 1M6VB 3G8CA 1N6LA 1IVNA 1O5OA 4KC0A 2ZWOA 5C7LO 3LCVB 1WHSA 2I2FA 3MWJA 3QBVA 1C7QA 2B94A 3W4IA 4BC1A 2UUAB 4R81A 1PFKA 4KGXA 3C1OA 1OXSC 2B2XA 2C3MA 5F5XA 1EAMA 1U65A 4PANA 3ZEIA 1OBHA 3OF2A 2OYSA 1X38A 2JBWA 1L3IA 2VP5A 4QBFA 4QXRA 1DWPA 1SXJD 4FPXA 3NUQA 2OVFA 3GRUA 5D8DA 1B2RA 1CUXA 4UVEA 1J20A 3BRSA 1GCIA 3AGQA 4XYLA 3N2YA 2R6HA 2R751 1V9CA 4XUCA 4XRGA 2QX7A 3DEHA 1DPGA 4GL4A 1HE1C 2TMYA 4ERXA 5HIKA 4MK4A 3PDIB 3I0NA 4F4FA 5LD2C 5FYQA 1JYEA 3F78A 1NKVA 4D9FA 2QJOA 4GLBA 4TQGA 2EX1A 3CBQA 5TXGA 2AK2A 2EXXA 4C4XA 2CCKA 4D98A 2V4ZA 5C51B 3LH5A 4O33A 4EY8A 3EASA 1AZWA 1CCWA 2PA0A 3KKPA 5JY1A 1UKVY 3CRQA 2PD4A 4X7PA 1CKEA 1AN0A 3ZY2A 1CR6A 5CFZA 1SWVA 6Q21A 2R1VA 1E94E 3K1YA 4NAUA 4M8IA 3U48A 1E5DA 3HA7A 3KR0A 4IIEA 2W6ZA 5B1HA 1AT1A 3VVLA 1S1CA 1Z6QA 5K3EA 1QGED 1S1MA 5G0WA 4E7PA 1C1XB 1N2CE 1E9BA 4RTSA 4ZFNA 2ANCA 1YE8A 4LZJA 1N5JA 1S9HA 1E8MA 4ZANA 1Q12A 4KQ6A 1Y5NA 3STXA 5A62A 3SP1A 2DHRA 3I3OA 2QK4A 3TFWA 1VG9B 1XJ5A 4DM7A 3CRNA 3MMSA 3A2MA 2AN9A 1TK3A 3U13A 3WRXC 3FFBA 4X64B 2ANBA 3KVNA 4QDTA 3W90A 3SYKA 4ZALA 4ZAWA 1YDGA 4M0PA 1GWNA 1VJRA 2OESA 3KOUA 4NZNA 4IHJB 3GRKA 3R3YA 3GCXA 1U2QA 3ABIA 3FYDA 4Y9RA 5EIHA 3WBBA 4WBNB 5KYXB 5IKXA 3H11B 1CQWA 1QP7A 1ENZA 2OBXA 2HL6A 4IJ6A 4V24A 2OAQ1 4B0OA 1THGA 1JU3A 4TVBA 1Z6XA 1B8VA 2VDQB 2QD3A 1USKA 1EQUA 1RZ3A 4KO8A 2RG7A 1KAEA 3JYQA 3ETNA 4G1FA 4LC0A 1XA0A 3SX4A 4EMSA 3KV3O 4FT2A 3FCYA 3S2SA 1WDWB 3HU3A 4RH3A 2OOKA 1UANA 4O29A 3X1MA 4UBOA 4PGAA 3DE6X 2CHGA 1LPBB 3IS3A 4MWDA 5B7QA 2G6TA 2ZPUA 5DB4A 3KSDO 1MA0A 3V5NA 1GUFA 1WCXA 1ISSA 4AWAA 5KJ6A 2O8FA 5AKEA 5LNK1 1COZA 4ARCA 5IDQA 3IAUA 2A78A 3DM9B 2NZWA 5F1PA 5FWYA 4PO1A 2C9DA 1LTQA 1TZKA 4QM6A 5J40A 1IG0A 1CS0B 3KEMA 3U3XA 1UKBA 4MVJA 1XNJA 3ECSA 1SOUA 2L69A 1QG6A 1V16A 1OB2A 3B89A 2JPDA 1GSAA 4MMZB 3RTEA 1GXSB 4G0XA 4GMDA 1Y6GA 4LF7B 3K73O 2QL7A 4QBGB 4UNIA 2XYQA 4FJ2A 4QDJA 1W44A 1GPH1 2JG3A 1WCYA 3TLYA 4WASA 4RK0A 2B5VA 1E79D 2QENA 3CY6A 5KNBA 2ZCJA 4OGGA 1EVKA 4MB0A 1D1SA 3CRW1 2JA2A 1MJGA 2RGNC 1EK5A 4DGQA 2Y0BA 4A5OA 1GTG1 1N1EA 2H1SA 4CL2A 3O94A 2X22A 2KX7A 1T15A 3MTEA 2WJYA 1G0NA 3HM2A 4MX8A 3WIOA 5HKOA 2FF7A 4UHBA 4WOCA 3OC6A 2JATA 4X3PA 3RF6A 3N8NA 4MB2A 4BB9A 2V97A 1KYYA 3H5IA 3SZ3A 3PRJA 4JEUA 1UMCB 1WP9A 2F9MA 4L2IB 2IDJA 4H3VA 4LJYA 1ODJA 4UHCA 4B81A 2C7OA 3GZ4A 1CQZA 4WERA 1DXOA 2ZRJA 2OAGA 4AICA 3H1PA 3GP5A 1A5ZA 4RKRA 3ZCTA 3WTBA 1NX9A 5K8CA 1Q19A 1QZZA 2IYSA 3T1VA 1DV1A 4AM8A 5JBIA 5ELXA 2XB2A 4ZK2A 2IUEA 4ETWA 1VHLA 2G0AA 2Y6VA 2YX1A 3AWIA 4OHUA 5I8ZA 2C2KA 4AO6A 1PGOA 1QGZA 3DHNA 1I9GA 1Y42X 3A6EA 4PBTA 2PL5A 4QEZA 1A69A 3IBGA 4PNZA 2ECKA 4Q7JB 5FADA 5EJ9A 3X0DA 2W8BA 4K28A 4P4LA 4EW1A 5DHPA 1A5TA 1VE3A 4NJMA 2BM1A 5EIAA 3EZ6A 4J0KA 5E3IA 4AAYA 2FG6C 3IUSA 3N0WA 4POAA 5E3JA 2JHGA 3X1KA 4RTRA 5DXJA 1Z0KA 4BXOA 4V0OA 3RQIA 1HQKA 1XZJA 1I10A 2IYNA 4C78A 5ICSA 3IPXA 3GFPA 2YXLA 1KO1A 4CCYB 2DXIA 3HABA 3JQ6A 1PK9A 1CU1A 1R5BA 3GJ8A 1QANA 4DEVA 1E6MA 1WG8A 4JDUA 4X7BA 4LECA 4AG3A 1G3RA 5DHUA 1OV4A 2CKDA 2DKOA 4EQZA 5KNCH 3R3HA 4ARZA 3G2QA 2O2ZA 1TO2E 3E5NA 3H9EO 1U0BB 5IBRA 4ZPJA 3RU7A 4PAGA 3K0EA 3RTAA 4I2NA 1GNPA 3UXMA 3WZ2A 3QKTA 4ND3A 4YMSA 2VA8A 4CR6A 3F4KA 4TWZA 8ATCA 3JWHA 2ZZMA 1GV0A 4XJXA 3IR7A 1JFFA 1FXWF 3VR4D 3IJRA 4O8CA 2I6TA 3KT3A 4QULA 3PFFA 5EE3A 1UMBA 2AXPA 1A88A 2FWBA 3BWBA 4PYNA 4RESA 3TIIA 1GAEO 1N6OA 4M7OA 4RD2A 5EVCA 3GLQA 1U0LA 3RYFA 4D3DA 4DQXA 1IN5A 1M54A 2HCFA 1FDTA 2HMTA 1E7QA 3PZBA 4JJFA 4PQYA 4CKYA 3COVA 2P68A 3HJGA 1ML4A 1S7GA 3HR8A 2OFOA 3RVKA 1QBKC 4MIKA 1ZY2A 5LOVB 3DO6A 1P0MA 4MW7A 1A2OA 1T1RA 3CLKA 2IHVA 2FGJA 1TYCA 4HGOA 3TQTA 1QTQA 1HFWA 3PHJA 4IV8A 3IAM6 2B0CA 3ZWVA 3H75A 4B6QA 1VSVA 1XRJA 3BN3A 1JLSA 2VP0A 3FWNA 1MC5A 2PGIA 4I4NA 1LQTA 1QHFA 1XBTA 1O57A 4B87A 4ZEVA 1YR8A 4TT3D 2EJTA 4A27A 1NN3A 2QSUA 5A6SB 1AKYA 5GJBA 4HBGA 3UFXB 3ND6A 4WKOA 2FB9A 1EQAA 3E5HA 1KVUA 4IHJF 1JE0A 4HJXA 3KYIB 5K1ZA 2VPIA 3QKRB 4LFCB 2WSMA 4HX9A 1W4CA 4RL6A 1DCTA 3MELA 1ZSNA 4UZSA 4BFZA 2GEFA 3EAGA 2WTUA 1CNFA 4D9BA 5KHOC 2I4LA 3H5RA 4B3MB 2NO1A 3OMLA 4UE6A 5BOSB 2JEOA 3G5MA 4CMAA 3O4IA 4KWHA 1XKXA 1I4OA 4Q21A 1QK5A 4ARSA 1L5RA 1UBTS 2NAFA 4QDOA 2XKBA 3N0VA 2V7WA 1B2LA 5HS6A 1QP4A 4GHWA 1EWYA 4HWKA 4LQCA 1YBFA 1T2FA 4X95A 1KSFX 3EPJA 2I8AA 1D0IA 3AKCA 3GAMA 2Q7OE 1LRJA 4NYIR 4H3SA 1BWQA 1LTHR 4HB0A 1VJ1A 1Z0ZA 2WAMA 2XVXA 3C3EA 3SEAA 3JAKA 4GE3A 3D8NA 3KE8A 3R3UA 1LRLA 1YA8A 1R6BX 2IIPA 3WYCA 3T0IA 4Z4HA 4BVGA 3T06B 3OCWA 1U8UA 1FLVA 3JVEA 1CUVA 1E4EA 3CLTC 4PLTA 1KO5A 3E3OA 4MPDA 3W5VA 3QYJA 3DD1A 1DQSA 3EQ2A 1OYOA 4R5HA 4CQLB 1GYQA 2EFGA 2WU8A 2XCUA 2GRJA 3PXBA 4MRSA 4PSDA 3FIUA 3EXFB 2ATVA 2I6XA 2D4HA 3B8HA 1DHTA 4RORA 1TC1A 2CJPA 4ZQEA 5JJIA 3E1KA 3GLTA 1Q91A 3LF1A 4IY1A 1VA5A 4HGNA 3UANA 5C4MA 3S3TA 4NIMA 2P30A 4D45A 4PLFA 5FEMA 3UBTA 4JC4A 1XVAA 3ID6C 3ZU3A 1UAYA 4NHEA 1G8YA 1Y8QA 2CLEB 4DT1B 3S2FA 4Y30A 3ZQUA 1IAQA 2W6CX 2ZIEA 2HDOA 4HSGA 3DW1X 5AM1A 4LF9B 6NULA 1RWXA 2I78A 3NWEA 3B13B 1R7RA 5K4HA 2HC9A 2Q41A 1EK6A 3IQWA 3B2QA 2KMLA 3SHVA 3TVYA 1W5SA 1NV8A 3OZXA 4AQ7A 5LB2A 1Z25A 4DMRA 4WLOA 4AYXA 2Q5OA 4LHZA 3JALB 1O0CA 4KHPB 3EGIA 2HV8A 2QM0A 1Y8CA 2WK1A 1KR5A 1JFVA 2NUPB 4O2BF 1JHYA 2O50A 2YUIA 2A5YB 2JGMA 4LF6B 1IJKA 5KYUA 2CYBA 1ZM4A 4G85A 5LPNA 1EFRD 4RD6A 2Q1UA 2GB4A 4TZKA 3WY9A 2WF6A 5AVJA 3PYLA 4Q1DA 2QLNA 2R6JA 5U9CA 4R1MA 1Z7YA 1QF7A 2WINI 4MGZR 4XQCA 1RXWA 4GMXA 4II3A 3AX6A 2B2NA 4BMDA 1AS3A 1LK5A 4F04A 2XVZA 3EJWA 3OTHA 3VR2A 4J76A 4D4HA 2JZNA 2A5DA 3JZAA 2C96A 4Q18A 1RWQA 4RJJA 4G1MB 4MLDA 4YRDA 5AW7A 1MOSA 3LSTA 1XD2A 2L2QA 1RJ9A 3AF4A 3M89A 4U6NA 5FBHA 2CV1A 2C5HA 1N6NA 3OQHA 4PTLA 5IABA 3FB4A 3OPMA 4ML3A 4WRRA 1G1MA 2H4WA 1TK9A 4WCFC 3QBDA 4OXNA 1QIHA 1V4VA 3O8DA 4JAVC 3B3JA 4OYRA 4PHTA 1BMDA 3PTLA 4Q9NA 5IKPA 2WUWE 1JAZA 1J1IA 3A3NA 3DBHA 3UKOA 1YZQA 3D7KA 5TV2A 1SG9A 3RFXA 3ADDA 3ZWYA 1YZTA 2ZR8A 3Q6NA 2NVUA 4OAPA 1P72A 1R64A 4QLBA 4CGZA 2PPVA 2WUEA 3FY4A 2Y1LA 3L7KA 4IJKA 3UVEA 1M34E 1SPBS 2Q29A 2ZRKA 5K0BA 1QHNA 2QLBA 4X84A 4ZOLF 1RM4A 2FA9A 2R1VB 3QM1A 5K0LA 3PNBA 5LOVF 1MIHA 1A1VA 5FPSA 1LS1A 2WSSD 4UQLA 5EMMA 5AVWA 5AVYA 3I8XA 1M74A 3K8QA 3AHHA 5I7FA 2JC3A 4ECAA 4IIXA 1GTJ1 4MQ5A 4MHTA 1PDOA 4YEDA 4K8OA 4YCSA 3HFRA 3RREA 2BCEA 1H93A 2YKGA 1GYRA 1LVUA 3GQBA 1AGPA 4FC6A 4F2GA 4IQ0A 1YBMA 2V45A 3CH5A 3HO8A 1EK0A 4L5CA 2LUOA 2J7PD 1C1YA 1XZQA 2BY4A 2JGIA 3T1OA 3KJGA 1Q7CA 3UHJA 3MERA 2PKYX 3B1VA 3TX2A 5MGNA 2GARA 3WZMA 1VYVA 3BD8A 1D0VA 4LY6A 4QD3A 4ZVMA 1CZLA 1GDDA 4E03A 3WL8A 4HH4A 3Q8MA 2VSXA 1ZK3A 1KEVA 1PDVA 2C9OA 3ZNPA 2GEUA 4TS1A 5M04A 3FUXA 3I1YA 1DBQA 2GXQA 2BN4A 1PT8A 4HTFA 4FEGA 2QQEA 3ZWPA 2W43A 1PV4A 1SBCA 2C9CA 4DCSA 1AF4A 1XSEA 1JDSA 5BNTA 1OUMA 1T9AA 3QKSA 2NG1A 4F2WA 4NNPA 3L05A 2DFNA 1L5KA 5MFZA 5IWCA 1D1QA 2OO5A 4M49A 5SY9A 1Q0HA 2BZ1A 4RMNA 2OCXA 3Q7QA 2O8FB 3A0UA 1U0TA 2COKA 3GH3A 4UW9A 4JVNA 1SELA 1NQTA 1B6GA 3MA0A 5FWYB 4I1PA 1OWPA 5E95A 3E18A 4CKCA 2HLNA 4FYJA 4TQAA 5IBQA 3OZGA 3RARA 1Z4NA 4J0JA 1N75A 1UOQA 2F48A 1KI1A 1V16B 4JJEA 5KDDA 3FYUA 4FHEA 3CT4A 2W6JD 2FLKA 4US0R 1XTVA 1I7SB 4HO1X 4FMPA 1IDOA 1GP2A 1N8SA 2XY4A 3COYA 1V35A 3VKVA 1Z0SA 1M7HA 1TKRA 1PR0A 3OCVA 1TO6A 1G63A 4RHEA 3ZY6A 1Z2AA 2C97A 1I4EB 2IUUA 1ZR2A 2KLHA 4I36A 4TZ6A 3ORSA 3HU2A 1B6TA 3EIFA 1NRJB 4MVYA 2KWIA 4UQOA 4ZYTA 2B20A 3KZXA 3P0FA 3BSSA 5HTOA 4L0MA 4XRRA 1U7XA 2C8VA 4PM4A 5TEWA 4RCVA 3WLLA 4A10A 1QHHB 2H59A 2G25A 4EHDA 1I6MA 3CX6A 2G6BA 3DAPA 3P9IA 2BMJA 5CDTA 3A10A 5JRDS 4DR3B 3NBFA 3KLNA 2XCOA 4O4JF 4HN2A 2JCXA 5L6LB 2TS1A 1BH2A 1XMIA 4G1CA 1GPMA 4OG2A 1M76A 2ZSAA 3KWFA 4I4TA 5CXQA 2OHIA 1UJ6A 1PW5A 2Y1FA 3O2NA 4YMUA 1KC1A 3TR0A 1HOTA 2ZJ0A 4Y2XA 4TMXA 4MUGA 3LBYA 4D9MA 1YE5A 3D2CA 1CFJA 4MI1A 1YDWA 4GZMA 4PZUA 3TRHA 1L1EA 1RQRA 1Z2OX 3EQZA 5AKXA 1PQYA 3WFIA 4GM1A 1C2TA 2W8BB 4ACBA 2JL1A 1X39A 1DLIA 1E3QA 1YVUA 2GS9A 1IMOA 3IJEB 4NJMB 1WO8A 3LK6A 1H2BA 4C4OA 5ITWA 3JR3A 1RIIA 4BXOB 4XI9A 4NOLA 1JKMA 5KTKA 1WXEA 2VYVA 4UTVA 1HL3A 3TMYA 3V6MA 3LE8A 2HKIA 4E30A 3C1AA 4MLZA 4ZYZA 4BQIA 1IEVA 3IQZA 2PL1A 2A5GA 4XLTA 4Q3AA 5BSTA 1DWUA 1VHDA 1PV1A 3AR3A 3DNFA 3ZWDA 2RKWA 3HEMA 3M4YA 1UC4B 3X1XA 2OGSA 3IKTA 1VIYA 1BD4A 2Z2ZA 4ARZB 2MSLA 4N65A 5LZ8A 3BTVA 2OL4A 4CL8A 4ZYVA 2WSLA 3G0OA 4PHGA 1BH6A 2OXCA 5CDFA 4AMZA 4QQNA 4XXHA 2ZJ7A 2YFQA 3AWDA 5I5GA 2BFAA 2UZ4A 1XKQA 1JFFB 3M8KA 4Q3BA 2BUCA 2O48X 2CLCX 5DMHA 2RGGA 3BL5A 4DCGA 4BEWA 3OEED 1MV8A 3DONA 1OBVA 1UMBB 3KQQA 5TF0A 3KT0A 3UWPA 2OUIA 2BKEA 5MGBA 1OVMA 5GMOA 3RYFB 1QWOA 3N8DA 3F7NA 4WSOA 1HT2E 2PR2A 4GRAA 1LBEA 2R79A 1J97A 3HN7A 3F5SA 3SZGA 5LKAA 3UHOA 1TU4A 4LS3A 3ZU2A 2O2DA 4GDFA 2RGBA 2O14A 1RU3A 3HVIA 4JT9A 4IX1A 4N5HX 4KVGA 3H99A 3AKYA 2PIAA 2DWPA 3R5TA 3NUZA 3M0EA 5L7TA 2VCHA 3FPKA 4H1HA 4A6PA 1ZN2A 5FLXA 1KQFA 1WOYA 2P5UA 5E0KB 5A3SA 3L7JA 4RLQA 1RYHA 1JILA 4INZA 1DBRA 4O5OA 3KC2A 3MIIA 4LDAA 2M98A 1N0HA 1ZISA 1NDQA 3TIXB 1G1AA 1FNDA 1IBCA 2RH5A 3GYGA 2NSLA 5E6RA 1JNXX 3W8EA 2O0MA 2GZMA 3CNEA 3JXEA 5E4FA 1OJLA 3B6EA 4A8JC 4RJIA 4I9GA 1J0AA 4B6RA 4C6HA 5LIPA 2FW0A 1NMXA 4MRAA 3T8YA 1AUQA 4YV1A 3PQ6A 5BV2P 2P4SA 3MQFA 5LZ7A 3W7AA 4OQNA 1EBUA 1DOAA 2CN1A 3T5TA 4US2R 1IHUA 2HRDA 5I8WA 1YI0A 1CUFA 2AW3A 2O3UA 2VOJA 2W4IA 4FSDA 5JDCA 1I51A 3DG9A 2P6RA 3HDJA 1V8OA 2BI7A 2LXNA 1MT0A 4XYBA 4L02A 3IDSA 1ZMOA 3VR5A 3W34A 1J24A 1AZTA 5CVEA 4FXOA 1HR0B 1PL0A 2O2JA 4LJKA 1O03A 2BD0A 1ZMRA 3ZGYA 3L1UA 1RWVA 4DA7A 3SQWA 2I2XB 4I2VA 4U02A 4C30A 3GR6A 4J90A 5H16A 2R65A 2VZLA 4CTKA 3JAKB 4RIFA 2O0HA 3CJTA 1P80A 4UMDA 2GJSA 2PUFA 4JP1A 2XEDA 2ZKLA 4Q9AA 2AJDA 2B98A 1IFXA 4CN9A 1C3EA 1KWGA 1E4EB 2EIHA 2ZB2A 1DAKA 2J5RA 1XN4A 4MUMA 4UEOA 3ZVRA 4LFBB 2Z0MA 1XRLA 2C07A 4DW8A 1JHAA 3THOA 1AA6A 2PUCA 2H1LA 5JYEA 3RRMA 2VI5A 2QV0A 3W77A 3QUCA 3MAAC 5LFAA 1MC8A 2XWJI 1BSVA 2ZRQA 5ELMA 1QJ4A 2BHLA 2W2TA 4D0RA 5AXAA 5KQMA 2GD6A 1N0UA 3P2MA 3ROZA 3SHWA 4F5EA 5I4BA 2B8TA 1G8HA 3MWFA 4AN4A 1F0YA 2A9VA 1KEZA 4CODB 4YK7A 3QWIA 4WXMA 3SD7A 2JFGA 2BMAA 2C0QA 1NVWQ 3BFPA 1TAGA 3CMCO 3IPYA 3KZNA 5CLGA 1GTSA 4I8XA 2PWPA 3GU3A 3CUTA 3ONWA 4BNUA 5CGQB 4DMFA 1GILA 1Y8QB 1YZUA 1D8TA 1IDN1 2QN6A 1Z74A 1UQTA 2XVMA 4YMHA 1GTRA 4WXRA 4KN8A 2IU6A 2O0JA 1I4TD 1NT2A 1X7WB 1XQWA 1NOKA 1X80A 2ZT8A 2ZRCA 5F1YA 4OLAA 2E87A 4X3OA 4DPKA 1H6AA 3FVQA 5A3RA 2EFEB 3A9WA 3K2IA 3Q2OA 4KE7A 3WVNA 2B3TA 5SY4A 3BGWA 3PX2A 4JLKA 1B8OA 3EVFA 3NHZA 2X0IA 2B1JA 2V55B 4FEEA 2GLXA 3F73A 1PZEA 1QHIA 4RMJA 3CZCA 1NSTA 1C9JA 2JFYA 1NLZA 3EJ6A 3MJCA 1KJZA 1B93A 1WZIA 1ODKA 3G2LA 3LLVA 1EP9A 2W2VA 4HDNA 4P2BA 1AXRA 3KDSE 1WLSA 1AA9A 1JQLB 4MGKR 4P36A 4C1NA 5J2UF 2BKLA 4JYMA 2CXPA 3KOOA 1B23P 1BMQA 3WZLA 3HSKA 4TTSA 4YMGA 3W4KA 2X76A 1VMEA 1J70A 4YRZA 3H3XA 1N3YA 3CMMA 5JADA 1ZLYA 1B0AA 1YJXA 1AM4D 1R37A 1YIAA 1YKFA 1WKBA 2IXBA 4MRRA 2PYDA 1ZH6A 4M60A 2P3QA 4XFDA 1YJCA 4BGDA 3UGJA 1QCDA 1RKQA 2CZGA 4JQYA 3D5TA 4LPSA 2B7LA 2E4AA 2FE4A 3ON5A 4G67A 1KORA 4JMLA 4PYKA 4PCUA 5TGZA 3SX0A 2BBWA 1ULSA 1XD2B 2HRBA 1RJ9B 1Y7PA 1V7CA 4WXPA 5DHFA 4X94A 3RHTA 1NE2A 1Y1TA 1R66A 4S1OA 3T4XA 4CXMA 4BMOB 4F8YA 3L0OA 3R5JA 1NVBA 1G8SA 1B26A 4CDNA 3CF4A 2C3YA 2YFKA 3IQGX 2UUBB 2R8YA 4O4HF 4RAOA 5FPQA 1CJCA 4ZC8A 3DBHB 2FVXA 1LPOA 1SK8A 1USVA 1T9HA 1OXTA 4QFCA 2Y9PB 3LZDA 2YXPX 5DGDA 1MB9A 4U1RA 5HCUA 4E3WA 2HMVA 4Q4CA 3DF9A 4C01A 5INTA 1PL6A 3BFXA 3VTAA 4XX0A 3OF5A 3OZBA 4S2UA 4O2RA 2GYYA 3Q7EA 2OHXA 4NBKA 5I4CA 3RU3A 1TM7E 4YMTA 4ZEOA 1GZ5A 1JU9A 3FUCA 2PJDA 3PD7A 2MR5A 3G2NA 5CT9A 1DJLA 1GKIA 1P5FA 2B34A 3L7NA 3L8MA 3QMVA 1EGHA 3EOBI 4QUKA 3SG0A 1TUBA 1PVOA 1E6KA 4H7HA 1V43A 4YVFA 4YO7A 1W34A 2LD4A 4JC8A 4WOKA 4CMHA 4DMHA 1JRLA 4WA8A 3T5MA 3HZOA 3QKWA 1T8UA 2P4EA 4MYSA 4Q4LA 3FSGA 3HN2A 3VYVA 2ZRDA 4JA0A 5B12A 5ECYA 2B4RO 2DMRA 2O4CA 4QELA 4DA6A 1BHQ1 4W9MC 1D2CA 2RGWA 2YBEA 2WPNA 1JLHA 4BWFB 4K9PA 5AM0A 1BVHA 4PZPA 1PUXA 2Q27A 3GRPA 1EFDN 4H2DA 2HJHA 1K08A 1U8CB 3SI7A 4JJIA 1NYLA 1I3OA 2JFUA 2FFJA 4HWSA 4O02B 5LDHA 3OT1A 4L5YA 1UC5B 3MHPA 1NV9A 3GP3A 2E55A 1WF3A 2OFPA 3K4HA 4WZ6A 3BJEA 4HTFB 4BLTA 2H0QA 4N9QA 1VL1A 1ZCAA 2EARA 1PJ3A 1HORA 1M1YE 2GBCA 3JQ7A 3QKSB 4TLBA 3SE7A 3S2GA 1I5OA 1PE0A 4HXEB 2CNWD 3VR3D 1P61B 1E69A 4JB3A 2K7FA 2WICA 4JELA 1NVVQ 5EINA 5BSWA 5C35A 2C61A 3IEXA 3U4IA 4YRKA 3LRTA 1QYRA 3NH6A 2CHVA 2H7CA 3N76A 4I19A 4XYEA 3VH4A 3O7WA 4CKCB 1DGQA 2IZOA 5D3QA 3ROXA 2HF8A 3LGSA 3IXLA 1MXHA 1TQDA 3GZTB 4XR4A 3FYUB 1G3MA 3PCRB 4HNSA 4NMXB 3TD6A 4AMBA 1BFUA 1I6WA 1JWAB 1F1BA 2W6NA 1NRWA 4DGSA 3DV9A 2PSHA 3JQ8A 3O0TA 3OHSX 1MQ9A 2X6QA 4PZLA 4QTXA 4MRPA 4P54A 4TXHA 1U0HC 3LKZA 4PQFA 5EFZA 1Y1LA 4JJAA 5AVKA 2V7EA 5AP9A 4EYEA 3MJEA 2YVUA 4KQ9A 4L9AA 4D0GA 4B3HA 3OE1A 3BAFA 4FWIB 4NK5A 4IUYA 3PWTA 5G53C 3WB2A 5IC4A 4R0NA 4E13A 2VT7A 2LKDA 3NHFA 3CZ4A 3TR5A 2V0NA 3EFOA 4OLFA 3WRXA 5AVSA 2B8WA 5AHXA 5F9MA 3W3AA 4MJLA 3CE9A 3AHCA 4JL6A 3CLHA 3LVQE 5ILOA 5F3DA 4ZOEA 3TN7A 3TWOA 1IRIA 3SEFA 3UK7A 3WHPA 4TMZA 2R6ZA 2BISA 3VO8A 4CNBA 3IX7A 4KFCA 2HY7A 1QQBA 3UH0A 4I4TB 3F8TA 3S27A 4GL2A 1JHVA 4MI3A 1GUDA 3LVRE 1QAOA 1Z0DA 4PIVA 3QJ5A 4ARAA 1GSIA 4U5XA 4DZTA 4GOOD 5CXXA 5G0UA 1UM8A 2D4AA 2QRZA 2QLMA 1SC1A 1OSNA 5I7RA 4K40A 4MAAA 4BEVA 4XOUA 3S99A 1V2HE 5EVJA 4BZQA 5EXXA 2D3WA 2PH3A 3HU1A 5JHHB 2Z5FA 4EPTA 4L9SA 1JHZA 4KWEA 3RVQA 1JHUA 5EIXA 2Z43A 1XRRA 3B9PA 1RFLA 1VZ2A 4PN7A 1ZRHA 2XUFA 2Y9MB 4KTVE 1G55A 2Q8QA 3QE0A 3D81A 3IOBA 4JQZA 1PR1A 4R8MA 3DOJA 2FPIA 2XCRB 1DZIA 3OE7A 4EKGA 4V1CA 2RJ3A 2PRKA 2K5UA 4NI5A 3DXYA 1A96A 1XEXA 1YULA 3I5UA 4RPHA 4DCCA 2NGRA 2OVBA 2LV8A 2JFWA 3DAHA 1P39A 4LMAA 1RAGA 5KOYA 2RGNA 1EVIA 3LHSA 2QA5A 3CPEA 2YN4A 4TVSA 1PJQA 4CV3A 4DUPA 1BOOA 2H2WA 1WBBA 1BKSB 4I14A 5CLLA 2QPOA 1GY8A 1G21A 2GCPA 3KPJA 1ECPA 2BFCA 4Y0NA 3HK2A 4ASUA 4IRUB 4FFRA 4KRGA 4LDRA 2CKMA 4MW6A 4L4ZA 5AXCA 1BVRA 3QA3E 4QWMA 4RETA 3X1DA 3PDWA 5DIFA 2BLLA 1ADJA 3AHGA 3ZNQA 4KQ2A 3NHBA 3DWIA 2O5CA 2BV3A 2YYAA 4OHCA 4A82A 7ADHA 1XTIA 2Z09A 4I1UA 4N54A 3A1EA 3OX3A 1RYYA 1SULA 1DDIA 1V25A 2JD2A 4UBIA 4DMCA 2ECFA 4KIJA 1PL8A 3I12A 3I53A 4NENA 1XHEA 3FUTA 1IHOA 5JS7A 2P3SA 1HE8B 5IF3A 4EFLA 2H4JA 3HUDA 3V3TA 1WR8A 4Y0AA 4NBSA 3BCSA 2IK8A 4AKHA 2ORIA 1NTRA 3QV1A 4GQBA 1QF9A 4FDLA 2CF6A 3O95A 4IAOA 4NFYA 1J9EA 3D3EA 2FX2A 2A4KA 4C4ZA 4DLKA 5KC9A 2IH5A 1ATIA 5AW9A 3OY7A 4KIFA 5E6RB 2WZDA 1UCFA 5CR9A 1JR3A 1JNYA 1YNSA 2QJRA 3KDAA 4OMUA 1Y0BA 4KK3A 4QASA 4FYIA 4ZGBA 3NHJA 4JODA 1ANKA 3R3VA 3ANXA 3GUHA 4A92A 1TVKA 5TVGA 5AVRA 2AEEA 2ZUWA 2PQ0A 3UJ6A 1HK7A 1UBRS 2C29D 3OE4A 4F5DA 5IPFA 1W7AA 1TJPB 1DDOA 1LS6A 2GN0A 4IO0A 3AFIA 5ALFA 3A4NA 3SY8A 4YV2A 2UVQA 4DM4A 3TW4A 4C7OA 3NBKA 3RV4A 3SM3A 2XB8A 4X7MA 4JBGA 1GG5A 1CF9A 2JFOA 2AFVA 4TTPA 5EESA 3R0ZA 4G0ZA 2WDPA 3EVGA 3GF4A 1NY5A 2Q9BA 2YHAA 4WE3A 4R2IA 4WKNA 3NFRA 4D96A 3VU0A 3K1TA 2V6FA 1HETA 2NXNA 4W63A 4ZDKA 9GPBA 1E2IA 1LK7A 4IUDS 3IGFA 4AJKA 4AXXA 4BN4A 4PZDA 1BOFA 2EQ5A 2GASA 5KYYB 1BWSA 2WM3A 4YB8A 1DBSA 3FTPA 3P9RA 2ZCVA 2WDZA 1YQGA 1ZPDA 2XMDA 3QKUA 4P4SB 5DDIP 1MAVA 2VK2A 4ENVA 2D1SA 1G5TA 5BQXA 1YQ9A 1K8ZB 2OZEA 4C1BA 2VDRB 1HDOA 4F3CA 2QVCA 3ROGA 3VX3A 2IF0A 2WIDA 2QVBA 3R5XA 3PC3A 4ZT3A 2C7BA 2GEVA 1VI2A 2I2AA 4C87A 1JHPA 5EN4A 1O8BA 3AG5A 1NXSA 4MQ4A 4N5LA 3WL6A 3ZD8A 1COWA 2QTRA 5FULA 3VH2A 2XMRA 5FBQB 2NTJA 5JANA 2I6GA 3RIHA 1TA9A 3M3DA 2Q0QA 1SZDA 1RWPA 3PPVA 3RAEC 3NFYA 3MBIA 4AL4A 1RVDA 3W8RA 3LQQA 4Q3LA 2IPOA 3OTIA 4XGQA 4WLNA 4EYQA 2W2LD 4RXMA 4WK0B 5FORA 3VU1A 2WPDA 4DSOA 821PA 4LOIA 3Q10A 4D3YA 3MTBA 1VPTA 2H1WA 3NVMB 1PU2A 2PTGA 4ENUA 3ZKAA 4D4KA 2F7SA 5J4HA 1CZHA 3PQ3A 2ZUVA 4KKXB 4TRRA 2PKQO 1X80B 2ON6A 3L1HA 1V8DA 1G9TA 1O2DA 2XB9A 1M1XB 1CUYA 4G5RA 4RGVA 1JHDA 4Q3NA 4V02A 4LSZA 4O4LA 1W36D 3BD7A 2A0KA 4OJQA 5BURA 2DFKB 4R3UC 4M4SA 5B37A 3L84A 4DLNA 2C2BA 3QXJA 1H6CA 1YRLA 3E5MA 3C6KA 1P3DA 3HJTA 3DEJA 2PZKA 5DHQA 4LY3A 3QVMA 1JMKC 4GPAA 2D5LA 4JGBA 1FYFA 4DA9A 4HDNB 3SVLA 4DLAA 2DQKA 3PP8A 1N5RA 2FMTA 1G19A 3WNCA 3HBJA 1GZ6A 2PUDA 5EZYA 4G65A 1C0LA 1WY5A 2I6UA 1Y5MA 1YOVA 3HDGA 5JZBA 1A04A 1M9NA 4AG5A 1C7JA 3GRVA 4C3VA 4YRMA 1B6RA 1WKVA 3AJEA 4EYGA 3C74A 1E0SA 1R27A 1P1JA 1N2IA 1VXOA 3FMOB 3WS7A 3P1JA 1F4PA 3LD9A 1NQAO 1XP5A 1X1EA 4FZ5A 4H3KB 5KX5F 5EIBD 3GDOA 2UXBB 1ZM3A 5AM2A 2IQ5A 5HZGA 4U9UA 3SSAA 1XL1A 4RLHA 5JASA 1ZIPA 4MW2A 2E6UX 4DB4A 1Z6TA 1L5ZA 2O2HA 3SZUA 1UZUA 2NNWB 5D6OA 1V39A 1RKUA 1KZGB 1GAWA 1VG1A 4ZVRA 2MYUA 3K0AB 3DBRA 3ZX4A 4IINA 5JD4A 1X9IA 1PFQA 4WLFA 3LP8A 5C7IO 3LUHA 4KRYA 1U4OA 2G8NA 4JB8A 4BZPA 3H2HA 2H1RA 5KMGA 1ZGCA 4XX0B 2EG5A 3EK2A 3OAAA 1Y6JA 1ODIA 1J2UA 1W59A 1XK7A 3P71T 3THYA 4LJRA 1F0KA 1EIWA 2PTHA 5TGTA 2Q4RA 1HFJA 3TS1A 5CDUA 3S1SA 1UXJA 5EQFA 4A6XA 5CGZA 1R0RE 1A2QA 1RQNA 3CZAA 4Q1AA 4CMKA 4PYQA 2GAIA 5FBRB 1PHPA 3KLMX 1S2GA 5CFNA 4KO3S 1PEDA 1Z47A 2JIMA 2DLNA 3D02A 3UWSA 1TUBB 5IDYA 3ND5A 2I55A 4UVIA 1PJLA 3ENZA 2BRUC 4J6FA 1B0ZA 3AV0B 2I9PA 4FGKA 3OZFA 4AT1A 3OTQA 4K8RB 3DFIA 3PD1A 1DKNA 3C43A 1OXMA 2EHDA 5ITVA 1K63A 3OKAA 1GKYA 3FNFA 5LMZA 3DA8A 1KI8A 2EU8A 2O7NA 4BGEA 3NEJA 5BYKA 3BB1A 3L1JA 1Q1QA 3ELWA 1TJ5A 3AIIA 4TLDA 4HT3B 1CUSA 5K7SA 5MN5A 4GOJA 2Q3HA 2YHUA 4Q4HA 4JYZA 2B25A 3OT1B 2XKJE 3GG2A 4I50A 4X9XA 1I0LA 3G9UA 1KC3A 2PZMA 3PTZA 4DSNA 1NVDA 2FZWA 4M76B 4XGNA 5H4HA 3JQ7B 4DMUB 3T9AA 5BORA 4RMGA 1GHTA 1Z2DA 2UVPA 3HDHA 3HO6A 3TCXB 5IAOA 4WCFA 4Z4FA 2DJIA 1XQYA 1FNNA 5LD2B 2ZJ8A 5FWDA 4LRXA 4RAQA 2PEYA 3JD0A 3PXXA 3V7NA 2I4NA 3AKDA 1VCMA 4HPXB 5CA0A 3V7UA 3WWEA 1T29A 2JBAA 4AF7A 1E9AA 5KVQA 3WAJA 5F1KA 1W581 4FZVA 4B48A 3UHFA 3VX4A 3GWGA 1GZUA 2ZRFA 4R2KA 4RK4A 4ZWNA 4B3DA 4IIDA 2ZYWX 2JH8A 2VYFA 4BNVA 2GILA 3WSTA 3KEGA 1K4KA 1NQXA 3JQ8B 1MDFA 1PT5A 1SO8A 3OI7A 4ODIA 4Z51A 2KBFA 3L7MA 4H4EA 3KYCA 3U9LA 4HXGA 4LQDA 4FN5A 4FLFA 1RWBA 1GJRA 3ZHYA 2H17A 4BZWA 3L7DA 1UKEA 1EXMA 1S2OA 3TW0A 3UCEA 4WL0A 2B83A 3FDIA 3ESXA 1JEOA 2HWUA 4IILA 1KYZA 2WHYA 3GJSA 3IEIA 4K1LA 4BZZA 5A2QA 3LY9A 3T3HA 3O91A 3HZHA 1CDOA 1M6HA 1SZPA 3BH7A 3IULA 3NJ4A 3P0EA 4DG8A 5A02A 4YFYA 3HWWA 1EEHA 4FMBB 5KYWA 1DJMA 5FX2A 3M6WA 4N0DA 1LLUA 1NKTA 3C5WP 1TAUA 3BTOA 3TLEA 4F9EA 1CUZA 1GCOA 1P5JA 3H4IA 5ALTA 3AOGA 3WHLA 2EJBA 1SZCA 3A9VA 2WMDA 1GLNA 2JEZA 2ZB4A 4YJKA 2JGEA 1NPYA 4X6XA 5KNCA 2J7KA 2XB6A 5BWOA 2Q1TA 4LDQA 1FFBA 3HPRA 3R7NA 1SXPA 2BUAA 2JLVA 3MUFA 3ASYA 1HBJA 3HVKA 2Z2YA 2NP6A 4PCAA 4EZBA 4NMLA 1RXIA 3DTTA 1GZ4A 1JPNA 2WBLC 2PNFA 2J6BA 3IAS6 3SFVA 2XRYA 1GKUB 1DFGA 1P5ZB 3E84A 3M49A 4BQRA 1VPLA 5B6IA 4QVIA 4YJ2F 4DY6A 2AJBA 3JD1A 4B3TB 2H8GA 2QZ9A 2ZJBA 3ZG6A 2FN3A 4MMXB 1SHKA 4MRVA 2DECA 2HUNA 3KXKA 1EA7A 1VSQA 1YCGA 1KKLA 3E1GA 3H5VA 1S2NA 4A8PA 3W1WA 3CLUD 3WGNA 1W0KA 2AOTA 16PKA 2PJZA 4EUFA 2FUG6 4WXHA 1RAHA 4JX9A 3U81A 1U3GA 1E2UA 1NSYA 2DHDA 3Q3JB 1XXHE 1KK2A 4V1CB 2PVPA 1ACLA 1W6UA 1ZOLA 4G89A 5GM1A 3JASA 1C3JA 5H4GA 1XEXB 4TTJA 1WEHA 4LYDA 5EFOA 3EVEA 1XK6A 4BUCA 3PQ4A 1YA6A 2YJ3A 4GECA 4TMYA 5B58T 5DTMA 2GHRA 4KSCA 1R18A 4R9RA 4AZ0A 3NJ8A 5E2BA 1OFGA 3WYFA 1MO3A 1SHJA 3T5BA 4EGCB 1G21B 2W6ID 1ZGHA 1UXGA 2BFCB 2J48A 5JLAA 2P4QA 3FRJA 3FR7A 4L76A 4AY3A 4EYSA 3A27A 1JTVA 3EG9A 1YIOA 1FLNA 4FCVA 3R74A 4C4RA 4ZI2A 4K9DA 1FRNA 3M6IA 4EKEA 2OHFA 3EGDA 1RR6A 1TX4B 4GLJA 4PRYA 4WX2B 4G84A 4K6MA 1I0IA 2VJOA 1U0EA 3QXXA 1JG2A 4QUHA 3ZU5A 4GVPA 2FOIA 2PU5A 4IWNA 1PYOA 1ZJ4A 4NENB 4OF4A 4Z7NB 3FHLA 3OQMA 1MO2A 4JKYA 4NRDA 2C04A 4YS6A 2BZSA 4AW9A 4EHFA 1E32A 1AUXA 2DWUA 4W7SA 3GWZA 1U2RA 3C5VA 4DJ5X 3OZIA 2E4VA 3CSSA 4XPZA 3H0CA 1Y1QA 4MULA 3K53A 1PVDA 3LI2A 3VRHA 1ORRA 3W9YA 3GFGA 4TLEA 1SMKA 2EYQA 5BN5A 1SCAA 5JSUA 4EEKA 3I9JA 2FPOA 2QF7A 3BYZA 2XUQA 2P6UA 3MEQA 1CR2A 4YP6A 4NYIQ 3WB0A 3DBOB 3KXLA 4L51A 1Y4UA 5DSZA 5JJ5A 1TVKB 1IOZA 2I6QA 5HCIA 2YWBA 4N76A 3WXMA 2GZHA 4HAZA 1TCBA 4CMJA 3HBAA 3ODGA 3ZHCA 3I2KA 2WAOA 1WZNA 5ALXA 5HF9A 1XAJA 1YB4A 2FKNA 4TKVA 2X3YA 2OGZA 4YGYA 3ZGLA 4GXTA 4C7OB 2Z3ZA 4RF4A 5B57C 1O95C 2FMKA 4GYYA 1N1GA 2AI3A 4JJ6A 4ZT5A 3SJZA 1Y5RA 2GFQA 2IL1A 2J3HA 3LKVA 3RIXA 2A0UA 3NRBA 1NP3A 3OQPA 1KNQA 1R4MA 1T3HA 2QIOA 3H65A 3MNFA 4OMFG 3ESBA 4F0JA 3EYAA 3FCAA 1DQYA 1SXGA 1TJNA 5FTNA 5EQTA 3T3DA 3LX6A 3KELA 2P9HA 2G36A 4NS4A 1Q57A 3ABZA 5B3LA 1K92A 1QZUA 3U49A 1DG3A 1JVNA 2WHQA 2XXAA 2DY0A 3C4VA 2W2NA 3UAXA 4JH0A 1RXCA 1KGSA 5KPDA 3MYYA 5F51A 4PICA 5CT8A 5CPFA 5DK4A 3LT4A 4AUEA 3L6OO 1WXHA 2GKSA 2OV6A 4GDMA 4YUVA 3U3OA 1GSHA 1P4AA 5A9SA 1DC5A 3LC7O 3ZDQA 4EW6A 4UOQA 1P74A 1N2CB 1SKBA 1L4LA 3GLUA 4JL5A 2A84A 1TW2A 5T5QA 4UCWA 3FZEA 3KLBA 4HTAA 5ALQA 2QQ5A 4NESA 4RKFA 3AYZB 2CUZA 2HLDD 2NQTA 2HLPA 3OQNA 3UG7A 1DHRA 2PZLA 3Q1KA 1L8QA 3RB8A 3HSSA 2I2BA 5F1OA 2J6HA 3ZDRA 2PNJA 4URWR 1C7ZA 4JJKA 4OXQA 1QG4A 4A3SA 4A8JA 4QHTA 1UH5A 2ZYUX 3VBCA 5HR5A 1DC7A 1LXCA 4JIMA 1JSRA 2HWXA 3GIWA 3HI6A 5LA6A 2XTNA 4DCJA 2VO1A 4JLBA 3U4DA 1ZK2A 4O4LB 3KJIA 4LI3X 3Q6MA 5EHZA 1WDTA 1N3BA 2Q5QA 1UJ2A 2KSQA 3DM5A 2FDRA 4OK5A 5J3JA 1E3LA 2G0NA 3OT5A 1JHRA 5ALUA 3W7BA 3TXYA 4WWHA 1L5MA 3P96A 3UK0A 3RUHA 5A5DA 1GQFA 5C8DA 3IFSA 2CY0A 3VJKA 5A4JA 3AB8A 4TTRA 4BNHA 1SBZA 4QHSA 5GZ3A 1P62B 5EZYB 4B32A 2QTHA 3IAHA 3IEKA 1K8QA 1GPWB 1YOVB 5K3CA 1JG1A 3TFQA 3HI4A 4RQUA 4CTMA 2YBDA 5BR7A 4DHEA 3IVRA 1JLKA 3ISTA 4D81A 3A2LA 4EZIA 3WFJA 3BFKA 1YZLA 1X14A 2Z9BA 2W90A 3O8BA 2H08A 3RR2A 3ZH2A 4AXBA 4LSWA 4H1VA 4B44A 1HTTA 4F9TA 4WN3A 4Y6OA 4TUYF 3TBFA 5JD5A 7MHTA 5CURA 3F74A 5K3BA 1YKGA 4OK6A 2P6MA 1VHQA 5KYKA 5AT1A 1LBHA 2V7UA 4NV1A 3VXKA 1OXKB 3MB5A 2GWHA 3RRXA 1YC2A 4MA4A 1N25A 3AETA 5SY6A 1QYXA 2JKYA 2VH5R 4BV3A 2ZULA 4DV1B 4GVLA 2JLAA 3HXPA 2FDCA 1F1JA 3PIRA 3MUNA 1M2WA 3DBRB 4DIKA 1Y4ZA 2GEBA 4NOMA 3EC7A 3DC2A 5JC1A 2XF2A 3DMRA 4L8VA 4LJ9A 1DJPA 5GONA 3RHSA 3SX2A 5ADHA 5KMGB 4L15A 2CDAA 4ZA2A 2JI8A 1ZN9A 4B7XA 5ICFA 3THYB 4BNXA 3SNKA 5EKXA 5DE3A 4UAUA 2VTVA 1M2NA 3AR4A 1XMPA 1A7AA 4KQMA 4RF2A 2BSQA 2MMGA 4IEFB 1R00A 2PBLA 1D2AA 5JBNA 2NPIA 1OH6A 4URUR 3INNA 4YJ3A 3BDVA 3P9PA 2HCRA 4I46A 1MF7A 1JXAA 2YJTD 4U2BA 4ZVVA 2IEIA 1LDNA 1O7JA 2AF4C 1EINA 4EI7A 4KBFA 5LBUA 2WJPA 4J1SA 3T1QA 3PK0A 5IT0A 2WWVD 3UN1A 1PR2A 7YASA 3GFVA 1AHHA 5DBGA 2EGUA 4ZAVA 4EKDA 3TLBA 1TAHA 2P79A 1NR7A 4NJEA 4HQKA 3H9JA 1QP8A 5E8RA 2JIDA 4EK9A 3DE7X 3X2FA 1KH2A 3OIYA 4E88A 3H5OA 2D00A 1V8PA 1E1QA 2QORA 2WG1A 5CH8A 4KRFA 1RLIA 2V1XA 1MZPA 4X71A 4HLDA 4W6ZA 3W78A 5KQGA 1L8OA 3LBFA 3ZHTA 2QGFA 2ZUCA 3G82C 2J0VA 2RIPA 3BRCA 3B7GA 1DU4A 1JR4A 2J9RA 1UBOS 2C2OA 3AGPA 4QGAA 4EB3A 1S02A 3NMUF 1KI7A 1XRQA 5AKIA 1U0JA 2WU3A 4HWTA 1HDEA 4I50B 4P98A 4Y7CA 5AVXA 2WV9A 2PH5A 2EWMA 3DFFA 2DFPA 3E70C 4OXYA 4ZVPA 4S0XA 1WRBA 2CUKA 2P1ZA 3KTOA 2VPXA 3MINA 4R8LA 4CMEC 2UVPB 3H2GA 1R50A 1E5LA 1E4YA 2C7PA 1FSPA 3B9BA 4WCFB 2NTNA 3WYBA 1PBNA 1EH5A 4BU0A 1MRZA 3OQVA 4ALKA 3H1FA 4X8OA 2FCAA 1P91A 2GCOA 2H5LA 4A2QA 2I8CA 5TLSA 3UMMA 3OIUA 5CA0B 4CM5A 1GRQA 2P9EA 3UATA 2JBAB 3QXGA 4GLLA 2ALJA 2CFTA 3PUKA 4HRXA 3ZHOA 5KZMB 1Z4PX 4IRXA 3DL7A 4G6ZA 3GLGA 3F7MA 5LVAA 4J0GA 2CXSA 2E37A 3ZHZA 3OZCA 4MGHA 1DAHA 1QHXA 4U7DA 4C4SA 2XWQA 1HYGA 4BASA 5BUCA 5JDIA 3ZWQA 1LNZA 3KYCB 1U02A 1YF3A 5DTQA 5HQJA 3CUUA 2AOWA 1SOMA 4LWOA 1Z0AA 4BV9A 3A1CA 1E96A 4V0ME 4GMKA 2LWIA 3ZXIA 3BICA 1N9GA 1P1CA 2BBTA 2ZI6A 5JZSA 3VNUA 1AN9A 2G3YA 4G1EB 2ASEA 3ES9A 1IZZA 3WGLA 2NZUG 4MHOA 2EKQA 3ECCA 3O31A 4WDRA 1U31A 4RD3A 4EG5A 3L0DA 4FFDA 4UCQA 3IC5A 3HS3A 5DI9A 3PKZA 4Z0TA 5KYWB 3K8ZA 2C31A 3I4CA 4ZZ2A 4HVLA 2OV1A 1A8UA 3HP1A 1JE1A 3E8MA 2C99A 2EZTA 2OBBA 2P7HA 1Z37A 4DLPA 1KMQA 4FDMA 5J43A 3ADOA 4MEJA 2EBHX 3EG5A 3QVOA 3ROEA 1G6Q1 2BL4A 2GPBA 2NT3A 3Q8WA 5D84A 3CEPB 3L6RA 2ZM6B 1ODCA 2J45A 2JAUA 2VK4A 4HFJA 1N5LA 4R3NA 1I24A 3GJZA 4YAUA 1USIA 1Z16A 1GITA 5LQNA 1D6MA 3WKBA 2RAUA 5DFAA 3QW2A 3EFHA 1FFEA 5EZYF 3BULA 4CT5A 2XCIA 3LS2A 2VHZA 2YRXA 1YRYE 1ZL2A 2AUTA 1FYVA 5DT9A 4F84A 3C5CA 4MI9A 1H05A 2IHKA 1GAJA 2CCJA 2W71A 3IE1A 2V8OA 2Z1MA 2VNIA 2WP8J 3FFAA 3I04A 3QEJA 3BXOA 1UPBA 4DADA 3QU7A 1U0SY 3U7JA 2GBFA 2AOTB 4J16C 4PLVA 4E5MA 5CD9A 1EVZA 1NX6A 2OCDA 5IM4A 1WZCA 2ZUBA 4OFXA 5T4HA 1Z8HA 2RBGA 1I2CA 2ID7A 2QD1A 3EEBA 3FUWA 1JZQA 1S2MA 1LI5A 4B73A 1K89A 3JASB 1Z8DA 4KN9S 1G6HA 4YLEA 5J4LA 3OP4A 4LSGA 4NXMB 1E2MA 5C1DA 1XT6A 2ZJYA 4NQZA 3U9TA 4YASA 1U7HA 4MR7A 1C3OA 3JQFC 4QSMA 2EL9A 4AZ0B 2AD5A 3AK4A 1FX0A 3JVVA 4TXMA 1I14A 2N3ZA 1GA6A 4HLCA 4GFDA 1E7SA 3OLWA 1ZD4A 4EECA 4OJTA 3TXXA 7REQB 3GBVA 2X42A 3EG9B 2AMFA 3GPDG 1BG6A 4JUIA 4TTQA 3V3KA 5ARBA 3QELA 4XEUA 4BVKA 2SHKA 4MUYA 3T3OA 4WMLA 3EGDB 1MHPA 5A5VA 3ADBA 3EIOA 3CFYA 1P2BA 3EBPA 2JIBA 3P2OA 4Q6BA 5T3YA 9MHTA 1M2HA 1CNMA 1R8JA 1R0CA 3FMIA 4A6EA 5DGXA 3BX1A 4HGQA 1UBFA 1SIOA 2BFDA 2NU9B 1USWA 3BT7A 5L3RA 4CVNA 3SJCA 2ZTLA 3LW7A 1S3SA 2UV8A 4GWKA 4HHEA 1QVWA 1P9NA 4MO9A 3K6SA 3GEPA 3IXQA 2GK6A 3ESAA 4R05A 5BN5B 2AFHE 2D59A 4G5HA 4QQKA 2VJMA 3FTCA 5ALWA 2AJ8A 3F6RA 3IIKA 2DERA 4FNGA 4E94A 2Z6UA 1LJUA 1YVEI 2BHSA 3QXSA 4GC9A 4HH1A 1WL8A 1Z0IA 1Q16A 1W0JD 2OB2A 4GLFA 4UHDA 5EE1A 3VKUA 5HOEA 1Z68A 2Z1DA 4X1KA 1H9AA 3BREA 3CSDA 1RI2A 4UATA 2YASA 3FCCA 1HQDA 4I81A 5EKUA 1AKWA 2CFIA 1I2ZA 3BWEA 3SSNA 4TKVB 4WZBE 2LW7A 2BGRA 3CCBA 4W5WA 5FUVA 3G2KA 1C4XA 4QVKA 2BBSA 2XW6A 3TCNA 3EVZA 1M2EA 3QU4A 3ZD6A 2IXEA 2NPOA 3A25A 1PS0A 3EMVA 4K81B 5EIOA 4KI0A 4QJ5A 2PXAA 4V38A 4ZVUA 1NBOA 1B41A 2BGLA 3LPMA 3RVBA 4AX4A 2Q3MA 1R4MB 3CG4A 3QX3A 3H7AA 421PA 5BR8B 1LC3A 1HOXA 1REQA 1CHDA 3PPYA 2H65A 5DI3A 4YRNA 1ZS9A 3Q3VA 2A9KA 1PT7A 5EGSA 3SIRA 1DRVA 1U2DC 1W1WA 1YV9A 3H42B 5E1DA 4DF3A 5H5JA 4XB6B 3CVYA 3O4HA 5F76A 4C5AA 3DCNA 1RIFA 3R44A 4R1SA 2XXAB 1F0PA 1WZ2A 2QTLA 1U0GA 2UXCB 1BMFA 3A4LA 1UR5A 2FKAA 3ZDCA 1LW6E 3OICA 4GYKA 4JR1A 2EF0A 4KQ1A 1XJ0A 1R6DA 1TIBA 2P3OA 3AF5A 3IJ5A 1C8LA 4IXWA 2RDMA 4PGHA 3GNTA 4JB2A 5DNWA 3KLOA 4EA7A 1GFZA 5A9SB 2RJOA 1L4BA 4PLPA 5F4ZA 5CB0A 2ZATA 2JGJA 3C5EA 3EF0A 4GEGA 1U98A 1XCBA 4I4LA 4IDFA 3GXBA 1NW5A 1RI4A 1W9HA 3OH8A 3O8OA 1QC5A 4IDCA 1TTHA 2PMKA 1I7DA 2IYQA 3IOEA 1W8IA 3T1NA 3EVTA 5CJPA 2PMFA 5YASA 5M2QA 1UBCA 4J29A 4CTJA 3R7SA 5KOJB 3E82A 3UPUA 1EKXA 2PBZA 4A8JB 2ZXFA 3NKVA 2I67A 3PI7A 3QHQA 4Q1VA 5DCWA 3M1LA 4AWXA 1RCUA 3FUUA 2GXUA 4IKPA 1XWWA 4O59O 4YAWA 4OQZA 4TM8A 3KOWA 3ZUPA 4FDVA 2ODNA 1NUAA 4ZRMA 5KVVA 4D97A 5M3BA 1X19A 1XHFA 5G1PA 1G8AA 1K0FA 5DYIA 3GO4A 2VH1A 1HDIA 1X8JA 4JJ7A 4P80A 5ERYA 3F5MA 1E3IA 3B78A 1HL7A 2JS7A 4DQDA 2JHFA 3FZQA 3VR6D 5CM9C 3UFBA 4WXEA 3K6JA 2X9GA 3DSRA 1EDZA 1OA1A 3A14A 2CFCA 3F5DA 1P6XA 2NU8A 5KDLA 3VO1A 2F4NA 1KSJA 3SQDA 4U00A 4CM6A 4ZEMA 5JEEA 4QXQA 5TE9A 1EWTA 1ATZA 5IJZA 2BFNA 2IS1A 3ZZNA 1JHXA 2C2MA 5GWXA 3ZN2A 1N7JA 2A8YA 2RC6A 2TMDA 1J99A 3CJRA 4LXTA 2PLAA 3WIUA 4GP9A 3I83A 4KR2A 1D09A 2ZE8A 4B6OA 1XEWY 1Z4MA 2XOEA 3AXSA 4MVXA 4PONA 4Y3UA 2H9IA 2Y8EA 4HX5A 4HQFA 4RDCA 3V1MA 5LQMA 3RBVA 2VLBA 3OJFA 2OYCA 1K6IA 4ZYUA 1PR4A 3ZZTA 4A0HA 4WBXC 3C2QA 1UAGA 2ZSKA 3H83A 2W6QA 4WT7A 3T7JA 3COZA 3QE2A 4G0YA 2WYIA 3D9QX 3AETB 3JQPA 4JSRA 1K7YA 1HG1A 3I4FA 3LOQA 2OC9A 5DEOA 4HLNA 2WWYA 3U40A 4L5JA 4HWGA 4LNHA 1TEHA 3LLCA 2YS6A 3E4CA 4G63A 3VYWA 4NABA 1F3LA 3M1IA 2QPAA 1U11A 5GONB 4L50A 2ORED 1QSGA 2ZS7A 1YRAA 4NARA 4Q5IA 1Z5UA 1X86B 1RQ7A 1G8GA 4ITRC 1HF3A 3LBAA 1ZC4A 1KSHA 4LXHA 4N3CA 1U1DA 5AKYA 3V8MA 3U6KA 1P1FA 4JLDA 4G0UA 4YJ3B 1P4SA 1NJFA 4R40A 1I30A 1HDXA 3HY4A 4TYNA 3DWFA 1MUUA 4K6HA 3PE3A 3QW4B 4CIDA 1RYEA 1GO2A 2H4HA 1OYWA 3PUJA 1CC1S 4YT4A 1QF6A 3KSZO 2MR6A 1FJGB 1CY0A 1Q5PA 4Y9DA 1VJCA 4F72A 1P7ZA 1FSZA 4N6NA 4GYWA 3JWJA 2BDTA 4TXLA 3ZYCA 2BOVA 2Q2OA 4NJEB 4BV8A 2WG2A 2J3EA 1PFVA 3H8WA 4KAAA 3I23A 1J9ZA 1RC8A 1EESA 2RHBA 1QFZA 3T5CA 3TLJA 4B7ZA 1OJ7A 2VDMB 3VR4H 1XXLA 4EH1A 1Q0LA 4C0HA 3SS8A 1XTTA 1YAHA 1GPYA 1GL7A 1VLJA 1WMSA 2FOXA 4S12A 1A9PA 2WUVA 1GA4A 3B38A 2X9LA 4JB0A 5DVZA 3NB0A 4ZKEA 2R8OA 1I13A 3HRKA 3T5DA 3VAYA 2ZROA 1DADA 1L9XA 1ISPA 2RGEA 4IVNA 5ENDA 2RARA 2X5NA 3ZTYA 3HDTA 3MINB 1V7ZA 5EXEA 2ZYAA 1ORTA 4LWZA 2H06A 2O2EA 3VVCA 5FOQA 1W85A 1J8QA 3Q9SA 5LZ9A 2V6IA 3PUYA 1F8UA 1JKFA 3VHLB 4D0NA 2R86A 1ZQ1A 1B15A 4YO8A 2JRCA 1C14A 3I01M 3IHWA 5E1MA 4LAFA 2EJUA 2EP8A 2H7YA 4WNCA 1TTPB 3AOEC 2GCOB 4D5EA 1IBMB 3DP9A 3R8XA 3RASA 1RC0A 2C58A 2XE7A 3DE5X 3ZJTA 3HO1A 1OLSA 3NHUA 2IDZA 4FGWA 4MVJP 4ESHA 1JEQA 6GPBA 2OPBA 3HCCA 4JX8A 4MSUA 1SVIA 4Z9XA 3IIMA 4YDQA 3OFKA 3PF8A 1FTSA 1N9ZA 4RSGA 5JS2A 4AF6A 4WNIA 5IUNC 5D5HA 2PE5A 3U2QA 4QJIA 2BFBA 5D51S 4MICA 2GA9A 4IIVA 2WMYA 1XU9A 3CWQA 5NLLA 1QHYA 3DUFA 2H4XA 4MVJD 4BDTA 4YJDA 4PWZA 2ORWA 5HP4A 2EYUA 4B3RB 3EHEA 4J0FA 1GNRA 1QRRA 2VWGA 5EP3A 3R7FA 4FYVA 2BRUA 4NE9A 5ER9A 4G0VA 5HSGA 4N8EA 1N9GB 4TMVA 5HEKA 4HUQA 5JEDA 3EGVA 4CUJA 4C7VA 3FNGA 3IKLA 3PX7A 1RCFA 3ZGNA 2XYPA 3K70C 2CL7X 3CNHA 1STOA 1KJYA 1QV7A 1RPZA 3AJDA 4G5YA 3CPSA 4H31A 2GN9A 1CQXA 1JV2B 4UXIA 3ZWCA 2YXNA 2OEPA 2IUTA 5TMPA 2ZPTX 2Y99A 3K4QA 5HFNA 3VYTB 2C4WA 6AT1A 4EPVA 2C94A 1Q1NA 2CVOA 3EOZA 4YRBA 4LJ6A 1EBFA 1XJWA 1CSEE 2ZTSA 3CG0A 1HMPA 4MVJG 1T2UA 5B2ZA 1CQPA 1ND5A 2K6GA 5G3YA 4RACA 9ATCA 4NMWA 3CKYA 2AJCA 3E6AA 3JARA 3KRTA 3N8KA 1WX1A 3NHSA 4MUJA 3QG5A 2R6AA 3LHIA 2NYUA 4B8YA 3I9KA 1R88A 3IMCA 2WKWA 2XGMA 3SFTA 1VLLA 2UZ0A 4BJ6A 5IKMA 4NCJA 3UW3A 3ZDDA 2F3QA 1OCEA 1VL2A 2ZYSA 3BE6A 2R8ZA 1JZTA 4BMXA 4FYWA 3WWDA 1ZD1A 4KPUA 4L6AA 1ZM9A 4QDUA 5HJ5A 4WGGA 1DEHA 3NTUA 3BZBA 3FE2A 2NXCA 4RQTA 1DXQA 4WIAA 1M73E 3H17A 9LDTA 1T9ZA 1MRNA 1Z4LA 3GGGA 4U0KA 1H6BA 3T5AA 3Q85A 3V8RA 3YASA 5JZ9A 2Y92A 4E5UA 4P7FA 3SC3A 5A05A 2VXOA 3T35A 4KITB 3ABRB 2YUTA 3GLIA 1CUIA 3VAZA 1X7DA 5ALYA 5HG0A 1DAOA 3OLYA 1QTIA 2VA9A 5B1YA 5EZSA 2XLBA 2GJ9A 3PPWA 4MR7B 1C3OB 4BP3A 3L2OB 3F98A 2VJAA 3QH4A 4M88A 4MWBA 4NFHA 5I7AA 4JC5A 1OZFA 1Y3AA 4Z0NA 4EA8A 4KODA 1R0WA 3MGCA 3UGTA 2UZ1A 4MRMA 4K46A 4QPDA 5GONF 2GYUA 2AN4A 1ISHA 2OGUA 3E9EA 4TTVA 1MR3F 5T4FA 5ISMA 5ED4A 1KIFA 3IUEA 4OBWA 3QELB 1GN9A 1K3TA 2O8NA 3D4IA 1CJBA 3GVCA 4B75A 3R77A 2NVOA 1M8GA 2Q5JA 1T1GA 4JOBA 4V0NA 5CU7A 3ZKWA 3LZ6A 4MARA 2FRVA 1A7KA 2X1VA 3IQFA 4D3XA 4CF6A 4RH1A 2WYHA 3D64A 4BFSA 2BFDB 4BNFA 1YR3A 2ZAOA 4UM9B 2X3FA 5JR3A 4MEAA 5BYJA 1II9A 1MOZA 2C59A 2QLJA 3U31A 2MSNA 1R4AA 2WTBA 3WYDA 4F97A 3LCJA 3K6SB 2JLUA 1K88A 1T6BY 4LJ8A 721PA 5KSYA 3A04A 4L9WA 2L19A 3EPKA 1MENA 2VJMB 5JNLA 4XGIA 1EFPA 2FZCA 3T5GA 4DM3A 1Y8ZA 3ZJVA 1F38A 1GAXA 2QX8A 1SVUA 2A1IA 4D4IA 4YREA 2NT4A 1SXJE 1XG5A 4X1KB 1AHIA 1N5MA 5AJVB 5BSEA 3OD1A 4R9VA 1XA3A 3VV2A 4DNPA 1E2BA 3B8EA 1SUSA 5ARCA 1LVHA 1KPGA 1N0IA 3D4PA 3P2EA 5ALNA 3DGFC 3JTEA 4UTOA 1C7FA 3ZWWA 5AVQA 2YWGA 1IY1A 3LQ1A 5JXHA 3U0VA 2BEVA 2LNDA 2NYVA 1A27A 2H18A 1IVSA 1FJ2A 4D0LB 3TNDA 1MIOA 3Q0IA 1H4SA 4JWTA 3IR6A 4CKEA 2QL5A 4DPLA 2Q8PA 3G1UA 4Q02A 3GLGE 3MRSA 4G4SO 1REQB 3I42A 1KXJA 4BX2A 2ZRGA 3VTZA 4RZIA 2I7VA 4D9JA 4HRYA 5DI3B 3TQRA 1JB1A 4WFIA 1Q95A 3PLRA 4HNVA 2H9YA 2BM8A 2RAFA 3DEKA 1UC8A 1XZEA 4ANFA 5IT5A 2FUKA 1J23A 4Y9UA 2V98A 5D5PA 5H3CA 1TQ4A 1NVUQ 3I37X 3LUBA 4IMJB 5JCJA 3RTGA 3THXA 1G42A 5E2AA 5G3ZA 3RK4A 2QD2A 4DIDA 5KJCA 2VP9A 2ZJ5A 4OQ4A 5A0VA 2H54A 2B7BA 4RWEA 1Z5NA 2HFKA 3E81A 2VXBA 3IDQA 3GFTA 1ENPA 1SQ0A 3O3CA 1Q1ZA 3JQEA 3EA0A 3LDAA 4TGLA 5D3KA 4D9KA 5EE9A 4V39A 1SHZA 2OA0A 1HDGO 3B53X 3DBLA 2O3JA 4TSKA 5FR2A 3O8OB 3EW9A 1QC5B 4LGVA 3RSOA 1RXYA 5EIFA 1XZMA 2AS0A 1MPXA 4EABA 5DX0A 3EDQA 1HLDA 3DMHA 2J30A 5D6NA 2NLOA 3G0CA 3QMMA 3C24A 4Q39A 4B4VA 2XB4A 4LYFA 3ZZMA 3ILXA 4WZAE 5ALRA 3L6DA 1B0PA 4MWTA 4LHXA 3F3YA 2GN1A 1K27A 1V5IA 4WH0A 1AQYA 4UVDA 1U1IA 3H6GA 4LEIA 2VHYA 3CM0A 4RY9A 4TQUS 2OAP1 4U7HA 1A8PA 4MLCA 1XCOA 3I64A 3HZZA 4FJ0A 2IP2A 2ACEA 1MX9A 3ZHQA 5KHLB 4IH9A 1SC6A 4HYEA 1O95A 2P78A 4NVRA 4Q05A 5F77A 3V9PA 4D43A 1UBKS 1L6IA 1PRYA 4J2TA 5DM4A 2OHOA 2A4MA 2QXYA 4I1VA 2FN4A 4ISBA 3RUFA 2NU8B 5BPHA 3P5SA 4A8TA 1NJ2A 5I9TA 3QI2A 3WJ7A 2AW5A 4C4PA 4F3YA 5CCEA 3QBTA 5AIBA 1UKAA 3HXQA 3WSWA 3X44A 4CV1A 2XRMA 3ACDA 4IGEA 1ZW6A 3W5AA 2IQIA 2ZR0A 2HK6A 4PGGA 4R9NA 3RNLA 3ZK9A 3AESA 3GH1A 2CFOA 3ICWA 1JA9A 5DCUA 3MG9A 5JFOA 4RV5A 4CHGA 3QVWA 2WABA 1BS1A 2YZKA 4MQUA 4MKZA 5DK6A 5GTDA 4NQRA 4GI3A 3UMVA 2O2YA 1RFGE 2D5AA 2WA1A 4NZPA 5BRJA 4DA4A 4JOSA 3M3HA 3VR2D 2B6NA 1HURA 2GZDA 2ZIAA 3GGOA 3GZJA 3NUGA 4JMPA 1LY1A 4E1AA 5JAIA 3DV0A 3FTQA 1B1CA 3HN6A 3N0TA 1SIBE 1NLFA 2FCRA 1YRBA 2WUGA 2WWHA 3C6QA 4ENQA 1BO6A 3H5WA 2VSNA 1QOQB 2IYLD 3BJMA 2CDNA 5EUMA 4FYKA 2NPFA 3WMEA 5K03A 3V46A 4RTPA 1E2HA 1RLTA