1LK0A

Disulfide intermediate of c89l arsenate reductase from pi258
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
130
structure length
130
Chain Sequence
DKKTIYFICTGNSCRSQMAEGWGKEILGEGWNVYSAGIETHGVNPKAIEAMKEVDIDISNHTSDLIDNDILKQSDLVVTLCSDADNNLPILPPNVKKEHWGFDDPAGKEWSEFQRVRDEIKLAIEKFKLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords arsenate reductase
publication title All intermediates of the arsenate reductase mechanism, including an intramolecular dynamic disulfide cascade.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Oxidoreductase
total genus 51
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature ec 1.20.4.4: Arsenate reductase (thioredoxin).
pdb deposition date 2002-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1lk0A00
2R25B 2MSLA 3HCWA 3ROFA 1LJLA 5KC8A 4YO7A 3HJFA 4MQEB 1YTUA 3O1JC 1DBQA 2B4AA 4D6YA 2RDMA 3EAFA 1RXIA 4KFCA 4O5AA 3N75A 3T95A 4F8JA 1QP0A 1D4ZA 4RKRA 5KQLA 1JF8A 4IMIB 1PNTA 1E2BA 3VNAA 2FMHA 3RVKA 3O1IC 1VLZA 3SG0A 3N53A 2QXYA 1Z12A 4KK3A 4NV3A 2QW1A 3LTEA 1Z2EA 4YGXB 2PUBA 2I6FA 3SY8A 3CG4A 2JBAB 3KS9A 3LUCA 1SD5A 1KRWA 4OG2A 2HQOA 2R4QA 4FE4A 4RY9A 4MQFB 1JL3A 1NXSA 5CNKA 1EFAA 1PNRA 1RXEA 5DLEA 1EWKA 3EULA 2FKAA 4W5RA 5EWMA 3A3KA 5EWJA 2E4YA 2A9QA 3EODA 4IF4A 5BR1A 4MRMA 2B1JA 2PUDA 5JNUA 3IP9A 1DCMA 4MPTA 4H3KB 1DBPA 1MB3A 1MVOA 2IYNA 4MR8B 4ZJPA 1BVHA 3LUDA 3O2QB 3OM0A 1YK0A 3QK7A 1MB0A 4M88A 5FBHA 2AYXA 2JVJA 4GPAA 5TQ0B 5IUKC 5JS2A 1ZGGA 4QYMA 4TLLB 3T38A 3VNBA 2JB9A 4E7PA 5KQGA 5T7BA 3GV0A 2PUGA 1NXTA 2GKGA 2E4VA 3QX9A 4MS3A 5TQ2A 1BDIA 2PJUA 3CS3A 2PE5A 3RVSA 1BDJA 4S05A 2L17A 2A9OA 2VUIB 1P2FA 2VK2A 3NNSA 5TQ0A 1RNLA 1FSPA 1XHFA 1IIBA 1NXPA 2LPMA 3GBVA 4PEVA 4JB2A 5C5EA 3NNNA 1YMUA 1Z15A 2NUBA 3GBPA 4MYRA 4RWEA 1Z13A 3KTOA 3Q41A 5IBQA 1DC8A 5FWXB 4XLTA 2LP4Y 3RVLA 1APBA 2VUHB 1QNLA 3C3MA 3HUUA 4RK1A 2IDMA 1Z25A 3QELA 8ABPA 2MSKA 3HEBA 4HNSA 3FGZA 2FN9A 1ZH2A 2MYNA 4Q7EA 1L5ZA 4YR7A 3ROTA 1Z16A 4RZSA 5EWMB 3JVDA 5EWJB 3FDFA 3L6UA 4G0XA 4IGAA 2H0AA 5KI6A 4LZLA 1QO0D 4MRMB 3E61A 1QO0A 2HJ9A 1NATA 1R8JA 4RK5A 4MR9A 3Q15C 5IUNC 2MYTA 3LUAA 3MM4A 2QSJA 3OLWA 4G0YA 1ZITA 4Z99A 1A0OA 2FQYA 1GCGA 5CNMA 3SQNA 1EAYA 2F8SA 4N0PA 1ZHHA 2IPMA 1QP7A 4QICA 3DGFC 1FFWA 4Z0NA 3I09A 4MS3B 4PICA 1D1PA 3N0RA 5TQ2B 4DADA 5DKFA 3CZ5A 3F6CA 1QPZA 1U8TA 1USKA 3W9SA 5ED4A 1JX6A 2WRZA 1ABEA 2FMKA 1FFGA 3I45A 3P9YA 4PE5B 1JDNA 1PHRA 3G85A 5DTEA 1JFSA 1KRXA 3BBLA 3HVRA 2YHAA 3N8IA 1YVUA 3O1HB 3M9XA 3HO1A 1Z26A 1K68A 2WY2D 1C0EA 2O20A 4RDCA 3CKMA 1JYFA 3QELB 5JNSA 1BDHA 2PL1A 4JAVC 4F12A 3LOPA 2WJAA 4WT7A 1YMVA 3LKBA 4O1HA 3R0JA 4HYEA 5BRAA 2YHBA 1E6MA 4N03A 3SM9A 2GWRA 2AYZA 1E6LA 2E4WA 4PZ0A 3TD9A 3L49A 1LJUA 4Z4CA 1ISSA 2IPLA 4Z4FA 1ABFA 2PKXA 3OO0A 3RQIA 5I4CA 1DRJA 1UDRA 1NXVA 4MR9B 4RU1A 2FEKA 5GQSA 3CTPA 3GT7A 3N6VA 3MF4A 2CD7A 1QP4A 1CEYA 1DG9A 3C97A 4EVSA 4Z4IA 4JOQA 4NCBA 2HSGA 4EUKA 3URMA 3O21A 3RH0A 1ZN2A 3TX6A 1ZH4A 4D6XA 4IRXA 4YP9A 1A2OA 3FFWA 3EQ2A 5ABPA 1TM2A 2L18A 2ZAYA 3OQMA 3RVQA 3HV2A 1P6UA 1TLFA 2J48A 3IP7A 3C3WA 2WMYA 3N0XA 3O2JA 3LUHA 3QLTA 1EWVA 2FQXA 3NNDA 4G0ZA 3IDOA 1DCKA 2JRLA 2R47A 3BRSA 3H5TA 3TO5A 3QEMA 5IUJC 3GRCA 1RPJA 5IEJA 1D1QA 1DJMA 2NT3A 2XDYA 5PNTA 3CLKA 1JHZA 1DBWA 1ZESA 1FQWA 3BILA 1EHCA 1D2AA 3G1WA 2PL9A 2HQRA 4RXMA 3OMWA 1SXHA 1C4WA 2IPNA 4RK7A 3HM9A 3MYYA 3EJWA 4G0MA 5B3JA 3K4HA 3GYBA 4RY0A 4ETNA 5JNVA 4O1IA 4ETMA 4UHJA 1CHNA 4Z4GA 2W42A 3CFYA 1L5YA 1M2EA 2FTKE 1Z17A 1NXWA 3KYIB 4OATA 2N9UA 4G86A 4ZMSA 1CYEA 5F64A 1EWTA 3KJXA 1FFSA 3DGEC 4KV7A 3DLBA 3OQOA 4WXEA 1JWLA 1USGA 2HQBA 3MQ4A 5B3JC 3BRQA 1AB5A 1W25A 2GI4A 4EY3A 1Y1LA 1JDPA 4NCAA 4WWHA 4L4UA 3KYJB 4Q6BA 1DZ3A 4KK4A 5IEBA 1NY5A 4G0OA 1JFVA 2GX6A 3OM1A 1JBEA 4G0PA 4H60A 4EYKA 3H5WA 1D5WA 4YRZA 4ZMRA 3OLXA 2LUOA 2HPHA 3TB6A 3QEMB 3HDVA 4KREA 3KCNA 3NHZA 4N47A 5FWYA 5HSGA 5IC5A 4NICA 3C6QA 2PAFA 4W5OA 4N0QA 3Q7RA 4XXHA 2BGGA 1TJYA 5IX8A 1F4VA 3N0WA 3EQZA 2CHFA 3JPYA 1LK0A 1GUDA 3Q7TA 4KMRA 1J56A 3H5VA 4EYOA 1QQBA 2PUCA 4ZPJA 1ZGZA 3O74A 5JNTA 3LMKA 1E6KA 1VKRA 1S8NA 4OLBA 3CRNA 4OTZA 4HNRA 2OENG 2VYCA 1SXIA 7ABPA 2JCGA 1Z18A 2M1ZA 4XAQA 4MS4A 4WUTA 3F6PA 2FQWA 4IILA 4ETIA 5TE9A 1BAPA 2JVKA 1NTRA 4WXMA 4P1ZA 3HZHA 3CHYA 4KZKA 2H3HA 2IOYA 5KQPA 1P6QA 9ABPA 4RKQA 3H5IA 4LDZA 2Q5CA 4XASA 3LKVA 3JPWA 3CZCA 3CNBA 3H5LA 4KPYA 5EWLA 1RZRD 3IP6A 2F8TA 3HS3A 3E3MA 2IPAB 3RVNA 1RZRA 1PEAA 1F51E 3O2SB 1OXKB 1XWWA 2L2QA 4XFKA 3HDGA 4TLMB 1ISRA 5TPZD 1M2FA 2FEWB 5TPWA 5TPZA 4Z9BA 3TMYA 4MS1A 3UKJA 3F7NA 4JP1A 4QPJC 3RVPA 3MIZA 4Q6WA 4DN6A 5FWYB 4QYWA 3S99A 1KGSA 3NHMA 1AB6A 1JYEA 2TMYA 4FB4A 3HXMA 3SAJA 2A9RA 2OQRA 4PYRA 2FEPA 1NXXA 4FE7A 3SNKA 4Z9AA 1JH9A 4JA2A 6CHYA 3CU5A 5HQJA 1U0SY 1ZAYA 5D2CA 2PLNA 5T3YA 2X7XA 5JNRA 2FMFA 2ID9A 3HK2A 1PUXA 1BA2A 4XARA 2A9PA 3EGCA 3H75A 4MS4B 2FW0A 5FBKA 3ILHA 2FSPA 3LUFA 4YCSA 1W9HA 3D8UA 4YS6A 1OXBB 1XHEA 3Q9SA 4MLCA 6ABPA 3FFTA 3QX8A 1YIOA 3H6HA 1GCAA 3KG2A 4N41A 3LFTA 5EWLB 2QVCA 2DRIA 3I5AA 3F73A 3JY6A 4N76A 2JK1A 5FWXA 2QVGA 1TMYA 1QMPA 4EGSA 5TPWB 2E4XA 5CNIA 3FMVA 3JS5A 4WZZA 4H3HB 4Z4HA 5KQMA 4MAAA 3OLYA 4MS1B 4RXUA 4RXTA 2QR3A 2JVIA 1QKKA 3HSYA 2PMCA 3LUJA 5DCLA 5HM6A 5CHYA 3OO1A 2LIVA 3Q7SA 4EVQA 4LE0A 3H1GA 4YV7A 1HEYA 4KQ9A 1LBHA 2MSWA 3H6GA 1GLGA 2NZUG 3OLZA 3KSMA 2QZJA 4RV5A 3OLVA 2NZVG 2PUAA 3RVRA 2KYRA 1VPWA 1Z2DA 1P8AA 4EYQA 3DLHA 4Y9TA 2NT4A 2MYPA 1PEYA 4RSMA 2L19A 3H1EA 4W5TA 1YK1A 2M98A 4MLDA 4ML3A 3KKEA 1DRKA 4GNRA 4NQRA 3M6MD 4LRQA 2FN8A 4KRFA 4Z4EA 2FVYA 3MA0A 4RK0A 1NXOA 3RVMA 2P4UA 3OMXA 3LUGA 4LE2A 2QU7A 2E4UA 1MAVA 1DC7A 4RK6A 2V0NA 3UK0A 4DQDA 4OLAA 3A10A 1MIHA 4YLEA 3H5OA 4TN5A 5BRJA 4LDAA 3UUGA 3A0RB 5KC9A 2R48A 2FLKA 1YS7A 2RJOA 4EVRA 1SRRA 1QQAA 2PUFA 2FMIA 2FXIA 1K66A 3RVJA 4RY8A 5JS1A 2CWDA 4MR7A 1GUBA 2QV0A 1M5TA 1KMIY 4KNYA 2GBPA 1U2QA 1H9CA 3KLOA 3IPCA 4F3TA 1T34A 5E3JA 2ZWMA 4W5NA 4JB0A 5HKOA 3KHTA 3LUKA 2PUEA 3OQNA 4CBVA 3CG0A 3MMNA 4F06A 3JVIA 3QLVA 3HUTA 3O75A 4YWHA 3C3KA 1VRVA 2ID7A 5KWSA 1ZVVA 1TVMA 3T6KA 1WETA 4E7OA 4ZYLA 4MQEA 4KVFA 3KLNA 1USIA 2RGYA 3QLUA 4LE1A 2WB4A 5DGCA 2RJNA 4TMYA 2WJWA 3QEKA 2MYUA 3EDCA 4G0QA 3M9WA 4P98A 3T8YA 3GL9A 5BQ3A 5IULC 3QLVC 1DCFA 3K9CA 3D02A 4MGEA 4KQCA 5CNJA 3DBIA 3IP5A 5JNWA 1ZY2A 3A0UA 5TQJA 4L85A 1JFTA 1YS6A 2JBAA 2P9HA 3QLUC 2CHEA 3JTEA 4W5QA 1U2PA 4MQFA 2FLWA 4EYGA 1ZDMA 1SXGA 4RS3A 2E4ZA 4MR7B 2LBPA 5GOTA 4UHKA 2WWVD 3IPAA 4OBBA 4S04A 1M5UA 1LBIA 3B2NA 3I42A 1DP4A 1URPA 3H1FA 3BREA 4RK4A 1B00A 2IKSA 4JASB 4B09A 1JLKA 3RVOA 1U04A 3NBMA 4F11A 5C5CA 4MR8A 3ILYA 4IMJB 4HNQA 3DZDA 3GA5A 4G97A 1I3CA 3FFXA 3GWGA 4D74A 4LX8A 1A04A
chains in the Genus database with same CATH superfamily
3F3KA 4L07A 4Y1RA 3TOCA 3WFIA 5KC8A 5J2TA 2ISCA 3OT1B 4JGIA 3W2HA 1OLUB 4FU0A 5JJ5A 5JH7A 1YU9A 4AFNA 1EP1B 2Z1MA 3GQVA 1M1YE 4XUDA 3I2GA 3F7OA 5AWFC 5ALUA 1XTJA 1ENZA 3NG1A 4IMIB 4FQ8A 5AOVA 1FMLA 4C3OB 3L1HA 1RYZA 4IYRA 1E7SA 1OAOC 4J76A 1VLZA 4DIBA 2A0KA 1GYPA 4H6WA 4HR7A 4RVSA 2AJLI 3ZYZA 3RTGA 4CFYA 1E64A 1KJZA 4ASUA 2XUZA 2GCIA 1K7CA 1ZNQO 2V7PA 4FYYA 2ZJOA 4EB6A 1KP9A 2C9YA 1L0BA 4RKFA 5CNKA 2X9NA 2ZGVA 4Q9KA 1HY3A 1OKKA 2Q5EA 1D04A 4LOKA 4CR8A 3CLUD 1Z5GA 4INAA 2K2QB 2HF2A 5AJYA 2IY9A 4Y2RA 2VPQA 2VF8A 3ML1A 3Q3HA 2OV1A 2IH5A 4GPBA 3CNEA 3UC9A 3PITA 1B3BA 1TA0A 3EC2A 1EPUA 4B74A 4RVFA 3LT4A 4I50B 3AR5A 2OD2A 1S1MA 4ZQGA 5JU6A 4OX9B 3IP9A 1DCMA 2BI4A 3FLBA 3H42B 4JJZA 3DL4A 2FMXA 4URYR 1ZS9A 5HK8A 5HOQA 4ABYA 3REQA 3JR7A 3R9IA 1L8OA 3FNEA 5AVVA 2DVMA 3QK7A 4PONA 3M81A 5K20A 1UFRA 2DFVA 2Q0QA 2AYXA 2NU7B 4B47A 4TLLB 3ORYA 1FPMA 4PGHA 3UAXA 4AS3A 4XQEA 4BFWA 1W4RA 1GUAA 2QRMA 3EZ2A 3KKZA 3RT9A 2SBTA 2QG4A 2WAOA 3AOEA 3CF2A 3R40A 5LMCA 5I7WA 3I9NA 4K6HA 4DWVA 4KR7A 1HE4A 1S7GA 4ZMBA 1MORA 5TB5A 1PJCA 3FUCA 2GZHA 5D01A 1RNLA 4IX9A 1EZ1A 3A1TA 1KRHA 3RJTA 2LPMA 1C4XA 1RWKA 2ZDQA 3OZXA 1QAMA 3H2SA 4FFNA 4IIEA 3PPVA 1S3GA 4F2WA 2O50A 2E7ZA 4WFJA 2CDNA 4JLSA 2I6TA 3Q41A 3S0JA 4ZCLA 5E38A 4ITVA 4Q3NA 1D8AA 4BO3A 3AOEC 5BSMA 2O7RA 3MN1A 2AG1A 2CVPA 4FOLA 3QELA 2YRXA 4BAZA 5M2QA 4CEIB 4DJDC 2NNLD 1ZEJA 4R2LA 5FR1A 3UMCA 1DFHA 3G2MA 4Q7EA 4A0FA 1Z7WA 2K2WA 1IHUA 4LV5B 4P38A 2WA2A 1JQDA 1HZJA 1SY7A 3PEUA 3N59A 1XWIA 3EIUA 3OFSA 3RYHB 1CXZA 2W93A 3L6UA 1OXXK 7AT1A 1RPTA 2JHFA 4JNKA 1J24A 5EVJA 1SUDA 4MUIA 5DEIA 2VZ0A 5K3FA 5LQNA 4UC0A 3HO8A 3RSGA 2IPOA 3IVXA 4AN1A 3NOXA 4EAQA 5BUQA 4FBMA 1N2CA 3SYRA 2WU0A 4Y1FA 4MVJF 1EAYA 4FYMA 3U09A 2PD6A 3QTBA 1YI8A 2NXJA 3VPDA 3DXZA 2WLSA 3V3KA 3K35A 1FFWA 2XVYA 1NC1A 1VHQA 4LPSA 3T9CA 2QM3A 3V8EA 2HCFA 4IDFA 1RIFA 3B52X 3AZOA 5GY7A 4BVEA 3JQGA 2IYAA 2ECOA 2GPAA 1U8TA 1DG1G 1WDTA 2JF0A 1JX6A 3O4RA 5FUMA 4PTZA 1ABEA 1FFGA 4EKIA 1EE2A 3HVKA 3SZRA 1NNUA 2VAPA 1D1TA 4BMNA 4DC9A 4AP9A 4O4JB 3T3HA 3QUQA 4N7JA 1TIBA 4BQPA 2I87A 1OWNA 4LHVA 5JYEA 1R5NA 3HDYA 2JD1A 5JFTA 4A0HA 4HNGA 1ZJZA 1KS2A 4WAUA 4TZ6A 2I1WA 2C9MA 5EMMA 4A2PA 4BLVA 3WLEA 1C7JA 4XVRA 2SKCA 4G85A 1UBKS 2PKQP 1Z4NA 1PVOA 4F46A 1G5PA 1E62A 1P7CA 2EZUA 2HPZA 4WT7A 2F43B 5EEHA 3IPLA 3OTQA 2NXCA 4HB4A 1E6MA 2JGKA 3D6VA 3UICA 3VR2D 1XP8A 5H3LA 4F2GA 5EUBA 3X2EA 3U61B 1A2QA 3EXHA 3GZNA 4HCJA 2OPHA 3SZMA 2H7YA 3JD2A 3GZTB 1ABFA 2Y0DA 4U2DA 1Q1QA 1J23A 3A1SA 1Z7GA 1CS0A 1NW4A 2YNMA 4TL7A 4HI0E 3C70A 1S8FA 1VB3A 3O83A 4PFQA 4B6SA 1VHLA 1HTWA 1KZ4A 2CSUA 1RFGE 1RJGA 2PS1A 2XDQB 3EVGA 4K40A 4KLCA 4Y9RA 3UANA 1CY0A 3SX2A 3EXHC 2N1BA 2E87A 2WSSA 3B6MA 3QKTA 1XDDA 3ZWWA 3EA5A 3ZDXB 2WMNB 1I5OA 1RYBA 3DVQX 3D7NA 5CDFA 2D7CA 3FUVA 4PWYA 2Q5JA 5IVIA 2YNMC 4OHVA 4YP9A 1HURA 2WIJA 4RVNA 5JAQA 1W5AA 5K8UA 2ZRIA 1LPSA 2HO4A 4LF8B 5LD2B 1E3TA 1UPXA 2I7VA 4FUTA 1LS6A 1NBHA 2FMUA 1JQBA 2J6CA 1OXVA 5JO9A 3RVQA 4BQEA 1CTQA 3R5XA 3GFGA 1T9AA 3INTA 1CQZA 4O0MA 1KO5A 4NSNA 4YMGA 4R3NA 4ND4A 3ZGZA 3IEUA 4O4HA 3NVDA 4D8YA 4EHJA 1EXVA 2JRLA 4EJ6A 4TKVB 2GYVA 3EMVA 3L5KA 4CCYA 2EG5A 3H5TA 1JFFA 1DIBA 1K4KA 4YYZA 1R9JA 4E08A 2HSJA 1D1QA 1IQRA 4AIIA 4NY1A 2QRLA 2OC4A 5KKCA 4HK4A 1Z36A 4IBOA 5DVZA 5EINA 1V16B 1VCOA 2WZQA 5J5CA 3VVBA 1KDPA 1YDWA 2DP4E 2IYSA 3LT5A 2VPWA 1E1CA 3T5GA 5DH9A 2WICA 2ZXEA 2NM0A 2DETA 3T0IA 2ID8A 2VNSA 4BPRA 4G9BA 2ERCA 2X22A 1PG5A 3OIDA 1SOUA 3KXPA 4XUEA 1B3RA 1GQSA 1JKJB 1DKOA 1ZXLA 3BK2A 3KYIB 4WZBB 5H59A 5H3CA 1X0VA 3N05A 4OQEA 4ZMSA 4KPGA 3KJXA 2PNJA 2QLBA 3HRHA 4C4PA 2O57A 3RSQA 1KO4A 1USGA 3B7WA 3GVXA 9LDTA 1RLTA 1BEZA 3QVSA 2P2NA 3NPAA 4KPFC 4EMSA 2C4WA 2QMZA 1AQUA 1KDTA 3K7EA 4LJLA 4MIEA 3VU8A 2WNHA 2DBVO 3PQ8A 4QVIA 1RCFA 1E2LA 1C2YA 2AVNA 3TE6A 1EFRD 1ZLXA 2K5UA 2ZQZA 3IRVA 4NCHA 2HFJA 2VUUA 4GX2A 4PQRA 2P1ZA 1NY5A 4WLFA 3S28A 3STXA 4ZHQF 3B3FA 1XFAA 3ER9A 2FUNB 4UDYX 1QQ7A 2VF7A 3DW3X 1BOOA 2HPHA 3K5HA 4HDKB 3A8TA 4OHUA 1T2EA 3LK6A 2NVOA 1OJ7A 2IL1A 2J7PD 3D5QA 1KH3A 3GARA 1QDLB 1IUPA 3L5OA 5A4MS 3KM0A 3FPJA 4MUKA 1ODIA 4M86A 4OHKA 3JQ7B 5CH8A 1C29B 2NYAA 3AEQA 3DZFA 4CFSA 4ZCMA 1U1DA 4BX3A 2DUUA 5C81A 5GONA 1GPJA 5B1SA 3ZHBA 2C94A 1H2YA 1WVIA 3FPFA 3LGSA 2HJWA 5EFZA 1GFZA 4WNAA 2HU7A 5BV2P 4K1LA 4ZEXA 1UT8A 4ESVA 3N74A 2OPBA 4PRLA 4B7AA 3FDZB 5AUQA 4LDRA 4CMGA 1R5JA 2O2ZA 4UPDA 5I9NA 3QX7A 1YR8A 1AZTA 4QTUB 4FW9A 3M1LA 4IOMA 4WESB 1L3BA 3OIYA 1BVYF 1HORA 3UYLA 1F2DA 3GG9A 4PXAA 3ZZ1A 4EA6A 1K0FA 1NBWB 1GNQA 2CUTA 5D3MA 5TDHA 3PKZA 1C7FA 1H1DA 4TZTA 1NTRA 4Z8YA 4B34A 3GJ7A 1IL0A 2ONJA 2FSVA 2FEMA 2RGCA 1LPNA 4JHXA 5AW2A 2ZU6A 4O33A 1MH9A 3SKXA 4D4MA 1Q6YA 3R1IA 3LKVA 1I5EA 3JPWA 2DHDA 1ZUD1 2BOVA 1NLZA 1DUIA 2XNCA 2YYYA 2B99A 4FD3A 3F96A 3RVNA 1RYEA 3OWOA 4ZOAA 2Y76A 1X8XA 4IFTA 3U49A 2FSVC 3EIWA 1A8SA 1MPTA 3I01A 2ONZA 2PRKA 3AI2A 1FY2A 1PWYE 1RRKA 5TPWA 4YRQA 3U7IA 1SU4A 3AC0A 1V3VA 3FD8A 5AJZA 1UIMA 2XAAA 3PX3A 1M1ZA 5KYVA 3RPEA 3RJ9A 3EFOA 3OURA 1VJGA 2EFCB 5G41A 2WHYA 4IX1A 4O8CA 2UVDA 4U4AA 2Q2NA 1NF8A 3FIUA 3KE8A 3QZUA 1M7BA 1WUKS 1EZ4A 2FEPA 4E1AA 1JH9A 3AJ9A 3QEAZ 3NBQA 3TSOA 3WLJA 2GJAA 2EP5A 3NXSA 4PC6A 3VSBA 1KEUA 3S81A 1E3JA 2W2TA 4LAFA 2RC6A 4OA8A 3GFPA 5IM4F 4DY6A 4XWOA 3A7EA 2A5YB 5ITVA 2QRGA 1KU0A 3CSSA 5BNFA 3N0TA 1YFKA 1Y5MA 3AB3A 1YJ5A 1XT6A 4X8OA 2SKDA 3W5IA 1ZUNA 3ZHOA 1M0WA 1V47A 5CIWA 2VPZA 1E5DA 5D87A 2XCIA 1PHPA 4N3GA 2X2OA 1QHIA 3EVEA 3GNQA 4FC6A 5EJIA 3Q9SA 2QSZA 3E2IA 4TOIA 1VL1A 2PTGA 5BWCA 3AUJB 2EFEB 4MB2A 1M34E 4IFBA 4PO9A 3KKPA 4R9VA 2PKRA 4AP6A 2ZULA 2I6UA 3DFZA 3WMRA 1HMPA 2JGEA 3C16C 3UJNA 3IQXA 1XMPA 2JGNA 4M22A 3EEIA 3S7TA 2A1IA 1U1GA 2AMFA 2GN4A 2XNSA 4HDAA 3R9WA 1TMYA 1VLVA 1XE3A 1GKYA 2ASVA 2JLYA 1N1EA 1FYDA 4TUYB 3VGJA 1DBRA 3NIGB 3LYLA 1HDXA 4LV8B 4WTOA 5HCNA 4C4YA 4DA9A 1E2EA 2BIFA 3D7RA 4WK2B 1SVUA 2RHDA 2WHPB 4GL4A 1RRGA 1N5JA 3CW8X 1Q11A 1M1YA 2PZEA 3AY0A 5ERXA 3TQOA 5B5SA 3NHWA 4CVNA 3IBGA 4DAOA 1T2AA 5JPDA 1QH1A 2IHJA 1W2WB 4M8LA 3UMYA 2F90A 4XD7D 4KOEC 2OECA 3GLRA 4JKIA 1BJRE 1S4MA 3T9AA 4AJJA 4EYSA 5L40A 3BHIA 3QYFA 4P83A 1UAGA 4I6JA 1NU6A 2MYPA 5HJ7A 4MWCA 4C0LA 2OK7A 3AESA 5KJ1A 4MLDA 3BXGA 3IUEA 2Z8XA 4JMPA 3VJKA 2VHCA 3FPGA 2B0CA 2GD1O 4KX3A 4TT8A 3G5TA 2GO7A 2BFFA 2QP9X 3UGKA 4EAAA 2VUSA 4ZCTA 2ETVA 1P1JA 4PN3A 3V9AA 3LQRA 3RSOA 4M53A 4DQDA 5DRYA 4QDZA 1WXQA 5DBIA 1MIHA 3L82B 4HUJA 4F5YA 2C42A 1JBQA 1DIOB 3R5FA 1C4KA 1FP6A 4RFSB 4TLCA 4OPMA 1SN7A 4ND8A 3N86A 2I76A 3OKPA 3ZLUA 5KTTA 2RCNA 2VSQA 3E9ZA 1QOQB 4QASA 3OUUA 1ATZA 2H9IA 3DVRX 4RS4A 1XTUA 4YMIA 2CN1A 3EJ6A 3UJPA 1UR5A 3PHLA 4RY8A 3ZV6A 4OFZA 3FI0A 1RD4A 4ITUA 4D7AA 1QLHA 2F48A 2XD4A 3QOFA 3KPWA 3V4FA 2HLHA 4B82A 1ESNA 1K92A 1SWWA 2WP0A 3TQHA 4EHLA 3UPTA 4TL6A 4X44A 3GY0A 3GVPA 3PB3A 4K05A 1H2EA 1LW7A 3QVTA 1X70A 1VBKA 2O0JA 3PEEA 3PFKA 4MJ7A 5E7QA 4WK0B 5E3JA 4D44A 3U60B 3O8RA 1BEUB 1K5PA 2AMVA 4IHJF 1ADFA 1IN7A 1OY1A 1HGXA 2C3YA 2P40A 3BC1A 5AVKA 2AEFA 2VF2A 1YF3A 4QHSA 2CXRA 4ZEWA 1S2NA 4TTQA 1GN9A 4ZDJA 4YMSA 1JHUA 2HZ7A 2GK3A 2FWIA 4BY9E 4MPJA 1U28A 1ZN7A 3A1WA 3T6KA 3WYBA 1CQXA 1CW2B 1ENYA 5BV8A 1I8TA 1D6JA 4W1QA 3QLUA 5IKOA 2JIDA 3PQCA 4RCZA 3QEKA 2QLMA 1RXCA 2QNIA 2W48A 3HKEB 5MN4A 4NS1A 5JSFA 4ZYYA 3ND5A 3IP5A 2X0JA 4DTCA 2Z5FA 1P9NA 4WZBE 1U28C 4XX1A 4RLSA 3V1UA 2BEUB 2P11A 3VHRA 5K0SA 4IJWA 3QQPA 1LPAB 2BHSA 3BGSA 3PZRA 3DVSX 3QLUC 4HBZA 3T7DA 1EU1A 2GO1A 5LYJA 2Z2KA 4ALJA 4KWTA 4LXUA 2WNIA 1PUJA 4V0ME 1XMIA 4BMCA 2EJBA 5IAKA 2O7QA 1SHKA 3ASUA 2IZOA 2E4ZA 2G40A 1OT3A 2OZKA 2ZUBA 1C8BA 1RRVA 2LBPA 2H65A 1C0PA 5C7YA 5IKMA 2XNHA 1X92A 1T2FA 1KKMA 3F6BX 1JJBA 1EM6A 4FS8A 1B8PA 1R18A 3DKRA 4NCXA 4RYDA 5GJCA 5SY4A 1UBJS 1DJLA 2XMCA 1B00A 3W5JA 4DRXB 4D26A 3BUSA 3OTHA 2YBDA 2WVHA 4PZZA 3M3DA 2CCGA 1E9DA 4BMPB 4M1OA 2YKGA 4EHHA 1FX0B 3MSCA 4HNQA 4QREA 5ILQA 3UV7A 4ZN6A 5D1HA 1T3LA 1Q6ZA 2FFRA 3DV2A 4GKVA 2Y1WA 3K0EA 2NTNA 3WO0A 1EGVB 2ZTUA 1LSUA 1H94A 1AG9A 3MWGA 1NRJB 2OORA 4M9XA 4V24A 2R751 2UDPA 1XRSB 4G01B 1EWQA 1MAAA 4MCIA 3P32A 4D6YA 5LM3A 3V4RA 3EAFA 5IABA 4FM9A 2E3JA 4LJKA 1RWWA 1FNSA 2P6NA 2PD4A 1PQUA 3VDNB 1IXYA 4GKJB 1Z6GA 4AS1A 4MX8A 1I32A 2ZR8A 4MGIR 1RYFA 3OETA 2TMGA 1DEHA 2ZIFA 1R9NA 4AURA 4NHOA 5FI5A 2EHDA 1KZ1A 3RUFA 5CB4A 2CJWB 2AI2A 1OD6A 3BWBA 4ZP1A 521PA 5LA6A 4EX7A 1XZJA 3FKSD 2WPNA 4I81A 5ADUS 2GHQA 4Z3KA 1UADA 4FE4A 5CBPA 1G1AA 1SVNA 2EZ8A 5DLEA 2VSYA 5DLPA 3T0FA 4C4SA 2FKAA 4MVJG 4BFUA 4CMHA 1ORHA 2IEIA 1R5OA 8ATCA 4UUNA 2R8ZA 3BIWA 4BZWA 4NRDA 1ECCA 5A3RA 1XJ0A 2OILA 1O1YA 3D3QA 5JXWA 4OD0A 4AM8A 5ALOA 3EXIB 1TKCA 4O1MA 3RDPA 3I32A 1FP4B 2JFWA 4UXJA 3W34A 2B4RO 1TI7A 3DD5A 3R0ZA 3NVMB 3OM0A 4Y6OA 3QHQA 4MUMA 1ADCA 5K5EA 1QMGA 1YK0A 3TLGB 3PNOA 3VNQA 5ENDA 3B6IA 3ZH2A 2GPTA 1SIBE 1T8WA 2JVJA 2VDPB 2D62A 3JYOA 5IXSA 4NOKA 3ORQA 4QDOA 5BNIA 2O8DB 4EY7A 4MS3A 1HQKA 2G06A 3GLKA 1Z6XA 1L1FA 2EV9A 3CX6A 5J4YA 2BGUA 2VH5R 3CJTA 3LX5A 4U9IS 3QQ5A 3SCZA 2FWAA 1RM3A 4QPDA 3I39X 4ZCSA 1DG3A 2AKYA 3ZLTA 1Z15A 4FHFA 1HZZA 3AF6A 5KTSA 4GIBA 4XLTA 1XAIA 4QVGA 5HA5A 4EVIA 1GFIA 3HY4A 5BMVA 4YHBA 2XBMA 3K53A 3L1JA 2ZIGA 1HNZB 4UPEA 1LSSA 2W6OA 3ES9A 1M76A 3HEBA 4A0SA 2QRNA 3FGZA 5EE3A 1VC2A 2DPYA 5AXCA 5H80A 3H7IA 1BXZA 1E3LA 1IEXA 1ZXBA 1LRLA 3SS8A 1HZZC 3COYA 5A5GA 2X5OA 4BJ1A 1OLSB 2CB0A 2XQGA 1JPJA 1L4UA 2ZSJA 1OYYA 3K1JA 1UP4A 1Z2PX 4LDPA 5KWVA 2Q5IA 4GMDA 4JXZA 3BGIA 2NMVA 3BXZA 1Z3IX 3NFYA 3SSOA 3RFXA 3NP7A 4L8LA 4QJ5A 4HSEA 5LC1A 1M2NA 4L76A 5IUNC 4YCNA 1S2GA 4G1BA 3DHEA 3QIVA 3L6CA 5TMPA 1B0PA 1X80B 3MCWA 4DIFA 5EIBD 5B57C 1SC4A 4GWLA 4Y6RA 1JMKC 5CM8B 3T99A 3VYUB 4ZYUA 2RGXA 2OAQ1 2ATEA 2ZI9A 4LJ8A 1FK8A 4ARZB 4Z9YA 2WT4A 3OZTA 3TJMA 1TJ5A 1EVJA 1L4HA 4YJGB 3ZU2A 1USKA 2BCJQ 1NVGA 2F4NA 3BHNA 2OO7A 3M5PA 4GT1A 4NZOA 3AILA 3B2QA 2IBTA 4RPLA 2C4KA 2DY0A 2IYUA 1ZGJA 3EFEA 2D3WA 3U16A 2JIZD 3ABZA 3CGWA 4I4TF 4FDMA 4F7DA 5BW5A 4YT5A 3ROZA 4D9IA 1N2HA 1E79D 4HQNA 2XNJA 4FCWA 1XZFA 2GJ8A 4ZTUB 4RIEA 1EFDN 3NHFA 2O20A 2BR3A 2VWPA 2WT8A 3A6ZA 4QHYA 1V45E 5ALMA 3WV4A 4JAVC 5LNK1 1WG8A 4PLFA 2XZTA 1YMVA 1NV8A 1BHQ1 3IQDB 3EPPA 2OVFA 2NYRA 1YXMA 4HYEA 5C2JB 1ZGBA 2H4ZA 1IM5A 4ZC8A 2IPXA 2G9VA 2IZ0A 1KZGB 2WIFA 2Y6VA 3C15C 2NVBA 3E9RA 4KYIB 5IJXA 2HJSA 3E35A 3S55A 5KOJA 3BPSA 2O8EA 2O2YA 4MTLA 2FW9A 4YJ3F 2BY4A 2ECKA 3IAM1 2FU5C 2HCBA 2C7VA 4QXQA 4CN9A 3V7NA 1DMSA 2D4AA 4HEJA 3RQIA 4KMOA 2X0FA 2IE0A 3CTPA 4ZYWA 4AN4A 3AXTA 4ZIRA 1C7IA 5BWOA 1SUIA 1C9NA 2ZBEA 1CUJA 3ZD9A 1RZRA 2YWBA 3A3PA 1P77A 5MF6A 2D5CA 5IVDA 4AW9A 3KJIA 4LDJA 2DR3A 1KFJB 1EK2A 2O1WA 1PO7A 1XMVA 3I8XA 3GAMA 4MUFA 5GP1A 1W4BA 3AP2A 3V2IA 2EKZA 4MVXA 3VDQA 2BFDA 4ZU3A 5JBNA 1E7MA 3FUXA 3I04A 3ZIDA 4B4OA 2WOOA 5AVZA 1R8XA 3ESQA 4HPWA 4FW8A 1G21B 2DCMA 3N9IA 1XDZA 2J48A 1MUUA 1K7XB 1E8DA 3IP7A 4LXQA 5FA5A 3RRXA 1Y1QA 2ZJBA 1W29A 5GZ3A 1Z0SA 2RGEA 1SQSA 4P84A 2PWYA 1CS4C 3WRXA 4M1YA 3RSSA 5K6TA 5LLDA 1V0JA 4G0VA 2WAMA 3GU3A 2QUJA 2WAYA 5EIEA 1T9ZA 3E5MA 1M6WA 2NSYA 1YRAA 2Z0MA 4XVUA 4AU1A 1GU0A 2B3DA 1FQWA 4Q0MA 5CYFA 1GPLA 3U31A 3KQWA 3E82A 2GEUA 3WRXC 1QX3A 4OHBA 4FZVA 4CMJA 4WBNA 2IPNA 2OXIA 1BCRA 2B21A 3QPVA 5HF6A 5B36A 2CLSA 2ROQA 1YS2X 2A4MA 3AWIA 3F5QA 2CBGA 3HRIA 5TNXA 1W4AA 1M34A 5FBRB 1ZZEA 4JLWA 4FGZA 4UHJA 5D00A 5FYDA 4KN5A 4NWIA 2E82A 1F17A 2QX6A 4BNLA 1H9AA 1M2EA 1STOA 2ZI5A 4RA6B 4Z7JA 5BORA 1BS2A 2FR0A 2GM9A 1E18A 1TADA 2OV2A 3B3JA 3QFHA 4D92A 5IJ0B 3CZ9A 4X6YA 3T1OA 1B6TA 1G7SA 3QWBA 2HR1A 1Q0SA 2O0MA 3P9CA 3SSMA 4GM1A 3SKVA 4BAUA 1PW5A 2C61A 3SWWA 3JCZA 2Y4NA 3UMRA 4E70A 1WDKA 4EY3A 1V3TA 1JQEA 1Z0FA 3F5FA 4XEUA 1J20A 5DM2A 3QVGA 1E3WB 4JL5A 3SR4A 1WOMA 2BBOA 4CLOB 5KOHA 5B1YA 3DM5A 1EZZA 3AQIA 4OOEA 2AXNA 4BMSA 5IEBA 1EGAA 2W98A 1C1XB 4L08A 1OW3B 1Y42X 1PNVA 2HDHA 2IY8A 5K3DA 1I5RA 4TXLA 1X86B 3G1TA 2OHIA 1TTTA 4TLDA 3WP0A 3IP8A 4IV5A 1QNFA 1G98A 3CKYA 4DLAA 1H4QA 1QRUA 5COAA 1JQAA 3TKAA 4AAYA 5HSGA 4RD6A 1SMKA 2IF2A 3FSGD 3OIGA 4GYKA 4QDKA 4U7PB 3ZX5A 2PMFA 4MWOA 2W37A 4IIXA 2R68A 3NQ41 4CIWA 4XRRA 4DQUA 1RJFA 5DTIA 3FNIA 1M83A 2ZS7A 3BS4A 3TEFA 3RM3A 4B3XA 3HBAA 1YASA 3AFGA 1MV8A 3I12A 5LCXA 3B78A 2HMWA 3O38A 5COQA 4YRDA 2FPXA 3AVXA 1P9OA 4WXYB 1FNCA 1IQUA 2AHOA 2CHUA 3I8SA 4GEGA 4XAQA 2AJDA 4BMXA 4G1EB 3D0OA 3AM3A 3ILVA 1N0WA 3T41A 5TE9A 3ZDZB 2P0YA 3NKVA 1Y5RA 1N9KA 1MHPA 1WHSA 1E79A 3HRKA 5L3QA 4DR2B 4CIYA 4A2CA 9GPBA 1NR5A 3CNBA 3RG2A 1XDUA 4UD6A 1GQOA 3BMXA 2BELA 2FAXA 3PTAA 3RFTA 3LKZA 3T61A 3WLAA 4OQYA 3EF3A 4DV3B 4KMMA 4FLFA 1Y4ZA 4YYEA 4DG8A 5TPZD 2ZBPA 1ZW6A 3KALA 3OQPA 4IV0A 3KKOA 3WNCA 4ZHQB 2C2GA 3GOHA 3QV1A 1NOKA 4MDYA 4MUEA 3UKJA 1TQ2A 3VR6D 2QPAA 4BNMA 2JJ1D 4HZUA 5B58T 4BVFA 3K70D 1XELA 3MINA 4HRVA 4OJKA 3S99A 5JAIA 4H2DA 5DM70 3DUFB 3GELA 2Q1YA 1W7AA 4DM4A 5I9BA 1PRYA 2GNOA 1RJ9B 1HRKA 3LXRA 4AJIA 4FB4A 3K9QO 1UK7A 3W5CA 2A9RA 1R6DA 2OQRA 2YJ6A 1KK3A 4XTRA 1NXXA 3TR0A 5DM0A 2H4YA 3AUSA 1EESA 5KTKA 1Z0JA 1HDZA 1LBQA 1SPXA 4Y2YA 4IGFA 3ENZA 5LZ7A 4ZAVA 2C2YA 1UPBA 1Z4PX 4KO4S 4F6RB 3BFXA 2X5NA 3CN9A 1XBTA 2GN6A 2W6QA 3NVAA 4V0MA 4WERA 3A2NA 5CFQA 2LV8A 2JBHA 2XYHA 4U7JA 2XF8A 3NXKA 1ZP6A 5H81A 1MXFA 3H75A 3WGZA 3JASA 2ID4A 3ILHA 4GI1A 1RYHA 4JMLA 3ZD6A 1VLJA 1L4KA 1GT6A 2JZNA 3DHVA 3K1ZA 1XRJA 3TAHA 5LXTF 2CNDA 4UEKA 4UVDA 1N8TA 3IUQA 4MI1A 4AJOA 4KN9S 2IIPA 4C9BA 4N41A 2LW7A 5CAEA 2WYOA 2PSSA 2P6UA 4LUCA 3KSZO 4LQCA 3L4SO 3JAWB 3N5CA 5DGXA 3MGCA 4FFOA 4FX5A 1ABBA 1FUUA 3OHMA 3B13B 3PHBE 5GZ1A 5BN4B 3ZE9A 3KQLA 5BMOA 1ZBDA 3X1DA 1I4WA 3S2FA 3F6SA 1U9IC 4S1OA 3AEYA 2IU3A 2AS0A 1QB7A 3OE4A 4K9SA 4BQRA 2M6KA 3KB2A 4K9PA 3VKFA 1Y5LA 5BSTA 3FHLA 3KEMA 5HM6A 4A27A 3QU9A 4R9UC 5FTJA 4DV5B 4MGZR 4U00A 2YIDA 1S9DA 4JOCA 4EZBA 3OESA 1DDIA 5HG0A 5I9LA 1J2EA 1HL3A 2OM6A 2CXPA 5CLIA 5DK4A 3G3EA 4FDLA 4HDRA 3DC2A 5THQA 1Q15A 3W5VA 2HYIC 1W44A 3RVRA 2GZ1A 5B7GA 2ZTVA 5IARA 1F20A 1PEYA 1RHUA 2O5EA 3L8ZA 1IEWA 5J5AA 1HUQA 1T1SA 3I5UA 4LRQA 1XSEA 3RVMA 3PC7A 2P4UA 4F04A 4ENSA 1U7PA 2D2VA 2G3YA 2WIAA 3AIMA 1VBNA 4XCQA 1JSLA 4GGPA 4MVJE 5BRJA 2G8LA 1E1MA 2IQ5A 4QELA 4L50A 4U5XA 3C43A 3JD4A 2GJ4A 2XXAB 1V2GA 4BFSA 2J30A 4UCFA 1IONA 3EUFA 1SQ0A 2B8JA 4M3NA 3SF0A 3IURA 1BROA 1CQIB 1JSRA 2ZYRA 3BG5A 3O9VA 1I7NA 4Y98A 2HWWA 4JVLA 3E6AA 1WUHS 4IJQA 3THXA 3GOQA 1QK5A 4KODA 3TINA 4GRDA 3FSGA 3PRHA 4RVGA 1M2OB 1OWLA 4KI0A 4MINA 2FMTA 2HCJB 4WHMA 4X0EA 5HRCA 3ESZA 3PVSA 1RRMA 4HL6A 1RKXA 2I3AA 4RF4A 1IJFA 2F67A 1KYWA 3B20A 5GV7A 3NOOA 3IJRA 5KYTA 1ZX1A 2YX1A 5JADA 1Y6QA 3FMPB 2OQVA 5AM4A 4J2HA 3IAS1 4ZVTA 4DYVA 2XZLA 1LDYA 1BKYA 5CFLA 4DDMA 1YQ9A 2PLRA 1FQJA 1TVMA 3LXXA 5L7WA 1BSVA 1Z6YA 2QX7A 1UXGA 2R7MA 3GAZA 4YI3A 4RE5A 5JD3A 3ZIAD 5BT8A 3ZG6A 1ZM9A 1TM5E 2JFXA 1A88A 4ALLA 3U4DA 2QN6A 4CF4A 3UMMA 1VCHA 1U0NA 3KEOA 2GEDA 3QENA 1DIGA 1SXQA 4FTWA 1QYCA 1MX9A 4QEKA 4LF7B 2R87A 1PBTA 1SC3A 3OIFA 2PUWA 4JFAA 3I9KA 4D42A 4V0LA 3AVUA 1WMAA 2QL9A 1ZRMA 4X8MA 4AJ2A 2RGWA 1EDEA 3ZCTA 1LFDB 2YH2A 3ILXA 4LG1A 1ZWLA 2PZLA 2QJTA 5JTUA 1JNYA 4DEYA 3QVKA 3V7WA 4W5QA 1WL8A 3C6MA 3PU6A 3AM1A 4FMPA 5M34A 4DTIA 1W47A 1X7YB 4AUEA 3JTMA 3JW8A 4DABA 1PIWA 3NDRA 2C88A 4Y6QA 4M60A 4QM6A 4YRTA 1U0HC 1YE8A 2JJ1A 3PHGA 1KSJA 4L73A 1KOGA 4M7WA 4Q03A 4RPIA 2OGWA 5L4NA 1USWA 4K9MA 1NGSA 3K4QA 2XUJA 3KPVA 1QZTA 4FXOA 5HWSA 1YB4A 3ZHVA 1DBVO 2PCLA 3FOAA 4QFBA 4PIPA 5BSUA 1IBMB 4QYTA 1MQ9A 5IK2A 1NLFA 2G1JA 4P34A 1GQ2A 1AUPA 1JDZA 1RI5A 1ZFNA 1EGHA 3PF8A 3S8MA 3K70C 4UAJA 4G4SP 3CW9A 1OGIA 2VPXA 1F9EA 1K0UA 3FIJA 3P5BA 1A96A 3TLBA 3EW7A 2D06A 4XQ9A 4N3BA 4X97A 4DSTA 2G5GX 2O2DA 4YK7A 1BWQA 2H1SA 4B3FX 1Y63A 3ROMA 3P2YA 2MHCA 1V96A 1DBQA 1Z6PA 5LBIA 1L9KA 4CHTA 4DXAA 4U2GA 3DE7X 1OX4A 3OP1A 2I03A 1KYZA 1CZUA 4Y1GA 2QD4A 4ZVVA 4GAEA 5EJ6A 3U3JA 2HH9A 3VDXA 3JAKB 1QRDA 2ENWA 3NAZA 3TQSA 2XA2A 5DGHA 3WHPA 3B1FA 1GAXA 2QW1A 3KX2A 1E1YA 1VP9A 1KEKA 5KNDA 5D7BA 2PUBA 1B7GO 1UOQA 2KE5A 2VEOA 5AW8A 3IDAA 3JV7A 4QJBA 1YAJA 1QRSA 5CDYA 4MKHA 3DR5A 3ENVA 1EFAA 1C1YA 1EWKA 3EFHA 3W8RA 1HDIA 1RWMA 1KAMA 4DILA 3MTDA 1ANKA 2QYHA 4G84A 2WFLB 3PXCX 2AGVA 3OWXA 4EARA 2AX4A 5ICSA 2V7EA 2QN1A 2NU9A 5FR2A 4BFLA 1E66A 2ZSDA 4MRMA 4ZI7A 2PUDA 3CCCA 1GD1O 3UK6A 3Q7QA 4C03A 5ARBA 1SB9A 2B1RA 2WU3A 1Z6QA 4WKGA 4DZRA 1T9CA 4E5MA 5JSZA 1WZIA 2CMDA 3ADPA 4F92B 4BL5A 4RHCA 3WWYA 1IC6A 2IXFA 1YFJA 1C9DB 3GIWA 3HZOA 5IUKC 4E7PA 1M8JA 1PZMA 3AG6A 1QGUB 1TT5A 1U3GA 1FS5A 4IO1A 4Q4JA 3W0LB 4TWIA 3EG5A 2Y0CA 3EBLA 1ZM4A 5I7SA 4C22A 1GPUA 1XZCA 1E4YA 5NULA 3U37A 1US8B 3AFMA 4NBSA 3OE7A 2VK2A 3KB6A 4W82A 5DW0A 3RS9A 3ED1A 4P4LA 4D8TA 1EQ2A 5BP7A 1ZQ9A 1XAHA 5TVKA 3K8QA 2OMKA 2PXXA 1E60A 3F3SA 4TTSA 4EEZA 3BK7A 1NP7A 3VYSB 1RAAA 3LQ2A 4RQTA 3RS0A 2I80A 3DXXA 3X0DA 4QG3A 3DC7A 2SKEA 5FOTA 1Z25A 2YS6A 2ZFUA 4A4DA 3HJUA 3EQ8A 1QBKC 5EEGA 4HT3B 4EW3A 5JTTA 3GRAA 2Q6OA 4KQKA 3O6VA 3O91A 3ROTA 4DLTA 4UZFA 2CLCX 4ROTA 1E3IA 1KE1A 3TM4A 2F64A 1UKVY 3PDIB 3BIXA 4IHQA 5AVJA 3DBVO 4ZAZA 1VB5A 2I7CA 2E5LB 1O4WA 2CJPA 1MTZA 1SCBA 1NQOA 2A5JA 3K5PA 3N7UA 4R8KA 1VDZA 3ZW7A 1AK1A 5KWEA 3RS8A 5LVAA 3EVZA 3WVNA 1JRLA 3ZIAA 4GKKB 2X41A 2J3IA 4MRPA 1Z7EA 3HSSA 5CD1A 3GGJA 4DA7A 5BPHA 4MVJD 3RFUA 3HA2A 4N9QA 4N0PA 5JMPA 4R54A 3IMKA 3UA3A 3I09A 2X42A 5EOVA 3SK0A 2D1YA 3ZGVA 5SY6A 4E4RA 3F6CA 3IQZA 3KBOA 3NETA 3U3DA 2D8AA 3S2YA 4ARCA 4P4TA 3EGOA 1JEAA 1Z5ZA 2F2TA 3EZ7A 5FORA 1QFSA 1C4OA 4JL8A 7YASA 1J42A 2Z83A 1H4SA 2WINI 9MHTA 4X64B 4ND5A 4P4SB 3I9JA 2J67A 3KQYA 1XDBA 4GH5A 1U3TA 3ZPXA 3ORRA 1P4RA 4BJHB 1UBUS 4US2R 5F52A 1EX6A 3HJNA 4RIGA 3CKMA 4QTYA 5K6AA 4B83A 1NASA 3QUCA 3BIJA 1H22A 1X7ZB 4KBFA 3VZPA 1O9GA 4AZ3A 1QTRA 1J49A 5ES4B 2H1HA 4JYZA 3A2KA 2PSFA 3QKSB 1EFVA 4HADA 4MGYR 5B4UA 1N9GB 3ONFA 1VIDA 1QPBA 4YMTA 3N28A 2AG0A 3OOEA 3GAAA 3BE4A 1QZXA 3PQFA 4INJA 5CHEA 2IZ1A 3LT1A 5K6AC 3VX4A 1ISSA 4GLJA 4G24A 4UARA 3DMGA 2NN3C 4MR9B 2XKAA 3WKBA 4BNKA 1KK2A 1YR2A 2N0SA 3ND7A 5ENVA 3P97A 4S1TA 3ZV7A 2WF9A 3PICA 2KM1A 3AHFA 2W00A 1I1OA 3V4SA 5KSYA 3O9ZA 1MA3A 3SOPA 1B8VA 3IOMA 3R3WA 2E85A 3AYXB 3B3AA 4PFKA 5E1OA 2FWNA 4O3MA 3LWBA 1QWSA 2V98A 3T15A 1ZN2A 2CB9A 4ZV9A 5HCUA 2OUIA 1WV1A 1OBOA 4DBVO 2FFAA 5ABPA 1BS1A 5K8TA 1E5VA 4XOIA 1E0SA 4ALMA 1SEPA 2IX3A 4R2IA 1NT2A 1WLSA 2G0AA 2D2IA 3D4PA 1Z4OA 3D6FA 5D51S 3UN1A 2BLNA 4YPOA 1WMSA 3T1QA 4OBXA 1XTRA 3R5HA 1UC9A 4Q4DA 5TEWA 4IY1A 4XJVA 3FMGA 4I4TB 1V8PA 4X8LA 4L16A 2JKYA 4YIKA 4X3CA 1R64A 1U5BB 3HBMA 3V97A 4M0DA 4QBIA 1DOAA 5DLYA 5FCDA 3B7GA 3L7DA 4B31A 3QWIA 3PXGA 1NSFA 3ZKWA 5D85A 3J7AC 3IAEA 2PH5A 5FFFA 4IOKA 1ZESA 2VKTA 5TRTA 3VR6H 2CFCA 1FEZA 3K1AB 3B1JA 5EHQA 1HSZA 3WAGA 4DR5B 2YMMA 2HSEA 2I2CA 5HKKD 2WU4A 2VSOA 2Z95A 4I4IA 1BCSA 4YJ3B 3BMQB 4O1IA 2J9FA 3DW1X 1PK9A 1QC5B 2G09A 4UATA 4Z4GA 1CDEA 3FTQA 2WJIA 3GUCA 1AKRA 4CRWB 2ZRJA 1Z17A 4TMWA 5KYYA 4DMKA 4CW7A 5B6JA 1XXLA 3DO5A 4G5OA 1FFSA 5IU6A 4BN5A 4U2EA 2IX9A 2YIVX 5E2AA 1K1EA 4U0KA 4F9EA 5LU9A 4QBHA 1UEIA 1X6VA 5FI0B 3AV3A 3WK7A 2WIGA 2YMPA 4U2FA 2DSNA 5DMXA 3LHFA 3UT0A 4BGUA 4D9KA 2IIBA 4Q1BA 1E6CA 5LPNA 2JH9A 1U1IA 3MWEB 2XGGA 3SLGA 3DE5X 3LVBA 3FPSA 9LDBA 4GPTA 1U0EA 4F4IA 1DZ3A 1ULZA 2GRAA 2VRCD 2DFKB 2VYNA 1XMJA 3FI9A 4DQXA 2Q2VA 1GL6A 4CXMA 1MX1A 1CG6A 3BGWA 5JD6A 2DPGA 4ZICA 4YDHB 5LMZA 1TECE 4B5KA 3UOGA 3QFCA 1FS4A 2V8OA 3C4VA 4L2IB 3ROQA 4MWTA 1DAOA 4QO7A 1U3DA 1C8LA 1AH2A 4NICA 1RQRA 1YQQA 3NZEA 1UP7A 3GDHA 4EQZA 3C4QA 3I9V1 4JI1B 3PQ7A 4K46A 4XXHA 3DV0B 3V8MA 4A23A 5CVCA 3U7FB 1TJYA 3DL0A 5C8ZA 3D3NA 1HDOA 1H1LA 4MVJA 2QA5A 1GUDA 2CL7X 1WF6A 3GLIE 5EC8A 1I33A 1UEXC 1ZYUA 2ZBVA 4NYMR 1SZDA 5C32A 3PD0A 4NYJQ 3R5SA 3GWZA 3PJRA 4R9SA 5FF9A 4Q48A 2YV2A 3HL0A 4RABA 2JAWA 2WSIA 2JCGA 2Y1CA 3CUVA 2PZBA 4LNUB 2IKQA 1VE9A 1VBFA 4QU9A 4BNIA 4HY3A 4AK9A 4D3YA 3QBTA 2QT9A 1WIWA 1E32A 1SCQA 1ZN8A 3V1TC 2PLAA 4Y6PA 2YVQA 3L7AA 3TNDA 9ABPA 1UZMA 2F3RA 4EF4A 5LP6A 2EQBA 3TXAA 2VK8A 4BDTA 3NHLA 4J07A 1RZRD 4Z5XA 2D8MA 2DPMA 1Y3HA 1ZK1A 4WFQA 5G02A 2Y2VA 1W85B 4HWPA 1KIMA 4PAOA 1K9SA 1EP2B 1BW9A 5SZHB 5CLJA 3ZD7A 1Y34E 1OZAA 1G4HA 4Q9AA 4DJEC 2J87A 3GRVA 3HJCA 1E7YA 2J32A 5LP6C 4F9FA 1O08A 2BDTA 4C3ZA 1CUGA 1S96A 4HYTA 4PWZA 2UUAB 3UY4A 1YWGO 4ZT6A 2O23A 2P4EA 2W9XA 1KGSA 4FGSA 3ZZ0A 3B82A 5DX0A 2DULA 1BVUA 4FYIA 4XX0B 4BVBA 4G5XA 1UJNA 3HU5A 2FN4A 4FONA 4JLUA 3NASA 4D2IA 1NUSA 3K9BA 3H0EA 1ODSA 5H5JA 2VQEB 5GMOA 5HUHA 3A3YA 4TZ0A 2DHQA 4TMFA 2X8JB 4E4TA 4HXGA 3KQQA 5D2CA 3GFBA 1XNQB 2HMUA 1Z8DA 2C4NA 3IUPA 1KE2A 3ADDA 3PFWO 4Y7DA 1BA2A 2GPYA 4TLEA 1USVA 1NFRA 5DHAA 3LUFA 2REQA 4QL3A 3MJRA 3QYAA 4ARIA 2OBXA 3H2IA 1XN4A 2QI9C 3IP3A 1IVNA 3FFTA 3P27A 4IEFB 5DI3B 4EELA 2WWYA 1I24A 4NESA 1RBYA 2P7HA 3VU0A 3HHEA 4DMCA 3LPLA 2H5EA 3QUAA 1P2TA 2O1SA 2Q4DA 1YZKA 2VJCA 2GILA 1W5FA 1SCAA 3UFBA 2XXJA 2BH9A 5I7RA 1L7BA 2YXNA 1T6YA 1XZIA 1DEXA 1R8YA 3AVYA 1FMCA 1SUWA 3AL3A 3SC6A 1YR3A 3L7BA 4JI8B 4LOAA 2ODWA 2BFEB 3AY7A 3HL4A 5C31A 4N5NA 4EGSA 4NZPA 3LJKA 5KOJB 4RTOA 5F23A 1P62B 4TQ9A 2CHGA 4RDXA 5C4MA 5TEVA 5AYVA 1U8ZA 3WZLA 4Z8XA 4YT4A 1M2VB 1QH8A 3OJWA 3F47A 2QLNA 5TGZA 4CDMA 1ZUWA 5HKKA 5A1JA 4RPCA 4UUPA 3QLEA 3L9WA 1D09A 2QK4A 4HAWA 1U1CA 3SZGA 1KI8A 1N6IA 1DJOA 3NWJA 4MW1A 1Y3BE 4I9FA 5AKZA 4QOSA 4JEHA 3R7NA 2O5RA 3KR9A 16PKA 2PMWB 4NZMA 4PYQA 5KAMA 2GKSA 3CNHA 2CNOA 1UWVA 2QQEA 3E9QA 5BV1A 1X2EA 4M9RA 1UKZA 5B53A 3ZWCA 1PBNA 4UM8B 4P4UA 3ZNPA 3TBHA 1TAUA 3RU7A 3D1JA 1R8QA 3CLTC 3NO4A 2RAFA 1P73A 421PA 2FOIA 4H7KA 3MA0A 4IW3B 1W8IA 3LL7A 3BX1A 2HMYB 4CMIA 3DO8A 4YXFA 1C8KA 1R16A 2D1RA 1HK7A 2V0NA 3JYQA 4KTVE 4RK6A 2PGIA 4XCVA 3CB2A 5KVSA 2J41A 4TN5A 5REQA 2VRCA 2YJZA 1TLTA 1H6BA 2R48A 3W8EA 5LMNB 3GO4A 1X1DA 1Q57A 1VDMA 1GTZA 2RKBA 5LXTB 4N7RA 1L8XA 5K4HA 1B1AA 1HE5A 3I2KA 3NC1C 3PPYA 4Y30A 1BC5A 4QQFA 3BIOA 2QXTA 2I66A 4BC1A 4Z49A 1RABA 4AECA 1S01A 4F72A 4RKEA 3KE9A 3EAQA 4K9DA 2NUAB 4PHGA 3M6XA 3BIFA 3ZEAA 1UXHA 3NFRA 1TF2A 2RGNA 3KSAC 3C24A 4D41A 1T4CA 1UMDA 2BONA 4B71A 1H2RS 1UBEA 1RKUA 2XNDD 4DLUA 1XD2A 4AG3A 4FPXA 1IYZA 5AVOA 2YL2A 2WC1A 3NI2A 2VK4A 1WHTB 1OC4A 2P1RA 2KQUA 4JY7A 4QUHA 3X1MA 2AWNA 2JLQA 1YRWA 4LISA 4CBVA 5JCXA 4RD2A 5KCMA 4NECA 4JVOA 4FYWA 1WBBA 2RGNC 4GLBA 4MVCA 4W9MC 3GRKA 5CMLA 1QK4A 3GRUA 2P6RA 1TAQA 2YDYA 3AXSA 4Q01A 2HFKA 3KLNA 1MEJA 2IWHA 3VVCA 2WQ7A 3P2KA 1VI5A 4CL0A 4JLPA 5C7LO 1ZSNA 2NSJA 2VJMB 1KH1A 2G7ZA 4CKXA 4BWVA 1S5PA 3TW8B 3OZIA 1IEVA 1VKNA 4UNPA 4MQ5A 3SX0A 2J3HA 2JAPA 3QG5A 4DLKA 3PCXA 5LJIA 1IVSA 3P9NA 1JFTA 2GESA 3TZLA 2JAHA 5FEUA 2Y67A 1GG8A 4Q18A 2D2FA 3NTUA 2BGLA 2P1DA 4ZRDA 4DB2A 1MRZA 1ADGA 1ZDMA 3EQ7A 2HDWA 2GTHA 4C7JA 1X0XA 4EG5A 4MYHA 4X94A 3Q3GE 2WUDA 4YV2A 4EI8A 2FK8A 2W6CX 4P5EA 2OZPA 1A7AA 4OBBA 3ZC3A 4NCNA 2JGAA 2ZU0C 1GPAA 3OOYA 3BYZA 5JHHB 3GLVA 4I0WB 2HHAA 1DP4A 3DT8A 4BX9A 4ESOA 1XWFA 1V8OA 3BREA 2KLBA 5DM1A 1FMTA 4KO8A 2YVKA 4N12A 4ZO4A 3V34A 3VFDA 2V7TA 2OEPA 4B09A 4PLWA 2Z2YA 4TTJA 1GQRA 1W5SA 3ILYA 3N1UA 3QE9Y 1WQ1R 1GGEA 1DT5A 1K8XB 1P44A 4MJXA 5AO9A 4F5EA 1IHPA 1I3CA 2IW1A 4XSVA 3FFXA 4WY8A 4DLYA 1AQJA 1BMTA 3TIIA 3MMSA 4PPYA 1Z2CA 1P45A 1ZONA 4C1NA 4CKEB 1TE2A 3VC7A 5B3KA 1YTUA 3S1AA 4IWXA 2WV9A 1XIVA 3DZHA 1RXIA 1ZK4A 3PDJA 4A7PA 3MTEA 3N75A 4D25A 3F46A 4UTPA 2BM9A 2KB0A 4MVJH 1PNTA 1LDMA 3GGCA 1HT1E 1WO8A 4YDSA 4YPFA 3C8ZA 5B2EA 1XNJA 3TYXA 1YE3A 4OMDA 5KSZA 3KUKA 1SELA 4TYPA 4HWRA 3GQBB 1P0PA 3IDQA 4NPCA 4NV3A 2DLCX 3HE3A 1ID8A 1L8QA 2R6CA 4H1WA 1NW5A 1SFRA 2R8BA 3LUCA 4B8YA 4BAGA 3BXHA 1KWKA 3U6KA 1RWQA 4OYLA 5FL3A 1A4IA 1XKXA 2PQ2A 1JL3A 5DWDA 5JVDF 5A06A 4E15A 1PQWA 1PT9A 1U80A 2XODA 3EULA 3PDWA 2ZIVB 1IY0A 1CZRA 3KP1A 4EJMA 3BGDA 3MINB 5H70A 2F7SA 2IXAA 5KNCD 5E4FA 4H1UA 1JEQA 4IF4A 3ZDRA 4X6XA 4G09A 2AOTB 5AKJA 4EUSA 1YZTA 3FYHA 4AF7A 1WP4A 4KYUA 1F2TA 1N78A 1AXEA 1Y6ZA 3T12A 1VYHA 2J08A 3KOMA 3PGXA 1SIWA 2W6ZA 3HGTA 3C3CA 3OLQA 1CY6A 4CLHA 5A9SB 3ACDA 1E61A 1G2PA 1U2DA 3CNQS 1ZCJA 3NWOA 3AP3A 2QENA 3I23A 1E2FA 4HGPA 4OYHA 1BYIA 4XM0A 3IB6A 4GX5A 4Q3DA 2XPCA 3AU9A 3GV0A 3OF5A 1FTYA 1XYYA 4UNQA 4Q12A 4YR9A 3RUDA 1UC4B 4OGGA 8LDHA 4FT2A 5FRDA 2O2XA 2XRZA 3FKQA 3FZYA 2JD0A 2CEAA 4WLNA 1YL6A 3LBYA 2A9OA 1FPQA 1U2DC 4M1QA 4N8SA 5KNBA 4UDOA 1A71A 4BO7A 1AD2A 5I9TA 4ESEA 2J9RA 4M0MA 4FJ1A 1OH5A 1M2GA 1DKRA 1W9MA 1XZDA 4OH1A 4PLHA 3C3BA 3LI2A 4PPNA 1YMUA 4RZ3A 1L7PA 5FNVF 5DMHA 4TWRA 3R7DA 1DC8A 3SC2B 1NBMD 3LCRA 1AK9A 1W94A 4Q3AA 1DLJA 1QONA 3AO0B 2F6RA 5A03A 1F7UA 3G7UA 1UFOA 3K9LA 3MWDA 4G8CA 4OHWA 1TTPB 1RHJA 4FOTA 2ZANA 2MYNA 3PSAA 7MDHA 1IHOA 4E2ZA 3IEVA 3ZWXA 1M6NA 1KMHB 4QRIA 3RYFB 2LD4A 3HXOA 2X1LA 1THZA 3GDGA 2OGTA 5J4KA 4IHJA 2ONKA 5DBFA 3I3OA 4UUAA 2FWBA 5M5BA 4LYFA 1CK4A 1R8JA 3EGXA 1N7HA 3LWDA 1U7TA 3V4VB 4BE4A 2H52A 2ZRNA 2EX1A 5H9WA 4G41A 2IUEA 1MCZA 1ZVMA 1TQ6A 2YV5A 1WSWA 4ZGBA 1BKSB 1KMNA 4ARUA 2HK6A 3KBBA 2J07A 2PR7A 5JROA 4FS3A 4MA4A 1KYQA 1YKSA 4FFPA 4ZA2A 3TLYA 1EUCB 3KTAA 2FJ0A 1K88A 4A1FA 5TQ2B 5AQ1A 1EVZA 5L3SA 1AS3A 5JXIA 3E22A 3KOOA 3MJ4A 3IDSA 4W6QA 1FU4A 2QQ5A 4RH0A 4E88A 4E51A 3N2NA 6ADHA 2GJSA 1EI9A 1YGYA 3I45A 3IVMA 3MK31 3WQBA 4EFLA 1PWXA 5FH9A 1KRXA 1NW3A 1G8FA 3RV4A 1EX1A 4K9RA 1QF9A 3TMKA 3G8AA 3M9XA 1WVGA 2PRYA 1A5AB 4X92A 3WTCA 1OFTA 4FYPA 3R3XA 1C0EA 2C04A 2C2KA 2E5FA 3QNWA 1T29A 4LC1A 3GLIA 1P0CA 2CXTA 3WOVA 1OV4A 2EGHA 3FE2A 3G2JA 4IZ6A 1H66A 4QT0A 4U7DA 5ALHA 4F93B 1HYQA 3PQEA 4XM2A 1YAHA 4TTTS 3ZCQA 3IEIA 4CHGA 2G4LA 4JJEA 4AZ0A 4M7RA 4DQLA 2VJPA 3W05A 1MNQA 4LZWA 1VJ1A 2IPLA 1CUYA 3OEWA 1DXHA 4L1KA 1A50B 1K9VF 1V1MA 3A6JA 4Q19A 4REOA 4C4RA 1BGVA 2XVXA 2PVCA 4IQ4A 5BSRA 1R8SA 1DRJA 1UDRA 2E4AA 5GQSA 4HWOA 3FVWA 3UGQA 2OFOA 1EAMA 3BFJA 1LI7A 3FZGA 3IE2A 3L8HA 4U3JA 2NO7A 3QE4A 3ORHA 2NP6A 1NLUA 3OSZA 3R0VA 1FRFS 3W7VA 5B3LA 2BWJA 1J2JA 1P61B 1UT6A 1E7WA 3O21A 4FKZA 2JFHA 3LH5A 3N0VA 1KETA 1NW6A 3QUBA 1SVOA 4L5IA 1UEJA 2B36A 2WWIA 1H0SA 2I71A 2VP9A 3DOFA 2L18A 3UC5A 2A3NA 1PL0A 1ZVKA 4HDMA 4UHEA 1EB9A 1E1LA 1EFHA 3PL1A 3DTTA 4P93A 2ZZKA 1U9CA 1XL1A 2R6AA 3GJ0A 3JQAD 3R3HA 2GPNA 5JEDA 3P4XA 2HA4A 1HR0B 3CZRA 4YFVA 3V8QA 2JI9A 3WXBA 1C3VA 3LXMA 1MJGM 2QLJA 4YT2A 4D4LA 2Q7DA 4G5GA 2HWXA 3U80A 1JZTA 4PAMA 3HKBA 3E8MA 1U4OA 2W22A 4TLBA 4H7JA 4KSBA 2QTCA 5EKDA 4FBGA 2R1TB 5AM2A 1XL0A 4HPXB 1UKAA 1PX0A 2VSNA 3QVOA 4UNSA 5B1IA 1N5MA 1L1EA 4PQGA 4QPPA 3W4KA 1RVV1 3FWPA 4GICA 1C4WA 1OB2A 4I9UA 3PJEA 2Z6QA 1FSGA 4HB2A 2WUVA 3N58A 4GX0A 4HNVA 2J6BA 1PDOA 1MAUA 2MSCB 2ZIXB 2WIDA 4N82A 1L5YA 1R66A 2VJLA 4TSRA 5F33A 1KI3A 4LSWA 3UWOA 3WQSB 4CIVA 2AZ4A 1I2CA 5F64A 4PQEA 1F3OA 3ON5A 4F96A 1JLHA 2ONYA 4TXMA 1P4SA 3OQOA 3WKAA 1P0QA 2GFHA 3ETDA 4GRIA 4R1OA 4UAGA 4RJJA 4E2FA 4B79A 4JXXA 1TFUA 4GLLA 3DYIA 3PC2A 3QEOA 5AK6A 1QZUA 3PZBA 4DB4A 1DQZA 2G1UA 1Y5IA 1EDZA 1UUFA 2NV2B 3ZNOA 4B40A 4E21A 2ZRCA 1PL6A 4L4UA 4AJ1A 5JFOA 3DLAA 3OJ0A 1X1CA 1WX1A 2VRWA 1JFVA 3SJ7A 3OM1A 4CG0A 1JBEA 2AJCA 1G291 2ZQYA 3HXTA 1PYGA 5E3IA 1B2LA 3MAJA 1A4XA 1YULA 4M7PA 3U17A 5JOQA 3S3TA 1XDSA 3IO3A 3PYMA 4S1VA 2Z8ZA 1KEZA 2PUVA 3HDVA 4XQCA 2XYVA 1XN1A 2YDXA 1AHIA 4J0KA 3FVQA 4I99A 2J0QA 1G9TA 1W75A 3RYTC 2ZRPA 1SA0B 3DE1X 4NPHA 5LQSA 3EXG2 3PHIA 4UUBA 3S2IA 3NEAA 5FUWA 3RWOA 1ESZA 1ZI6A 1W88A 1OMOA 3SDSA 4G2NA 3EQZA 3DP7A 2I2FA 2QN8A 3LC7O 3Q7TA 2HMAA 2AFHB 5BV7A 1E9FA 1O95D 2F1IA 3UJ3X 5JC8A 1U0OC 1UBLS 2IYWA 2Y9MB 3CF0A 3OJFA 4OJQA 4YQEA 4DIDA 1S8NA 1WMBA 2BKLA 4MEAA 4TTIA 4HNRA 3PQ2A 1NHWA 3D54D 2YXEA 5HZHA 1OI3A 4CF5A 2OFXA 2PX6A 2R8YA 4WFKA 3SJCA 1ESDA 2C78A 5C3UA 4G1VA 3ESYA 5F4ZA 3BEOA 1U0LA 5EYPB 2BTOA 3L18A 4FR0A 3NTRA 4L95C 4QARA 2DT8A 4L75A 3MGBA 4KZKA 3HKDA 2Q6IA 1B8UA 1DAKA 2Z8YA 2IOYA 4RIFA 4BWGA 3GA7A 5AXAA 4ACAA 3QOXA 2AQIA 3H5LA 4LF4B 3FOBA 1XRLA 1XO1A 3HP1A 3SXPA 3TNYA 4GZ3A 1F51E 2Y1GA 4PLPA 4P4GA 4K26A 2O1EA 3SPXA 3E8SA 1KDVA 3C39A 4EG1A 3DDCA 1FFXA 4EGCB 1TU4A 2RH9B 4Y3UA 1PE0A 3I6BA 1COWA 3LVQE 1OE0A 3AEKA 4MS1A 1O7JA 2Y8EA 3T3IA 1B23P 3VISA 2EW2A 3ANMA 3EHDA 3MIZA 3OKFA 3VTKA 4CLXA 5K0EA 4G23A 5K01A 2DBQA 4QU8A 4BWYA 1R0XA 3K5WA 2C5SA 4MITA 5BUZA 3NDPA 3EXEB 4UM5A 4QDUA 3HXMA 4FGLA 3UQZA 1D2EA 2P8SA 5KB3A 5FFNA 3D2BA 2A5DA 1PL8A 6CHYA 1XP5A 2RKWA 4BATA 1U0SY 3FHOA 4WX2B 5KSPA 3MHTA 4OQQA 2EZ4A 1B6SA 5L8VA 1ML4A 3HK2A 4WDRA 3U39A 3ET4A 1XZKA 2OCXA 4AX4A 4KRYA 1PEKE 3OZDA 5CFMA 2WF8A 5EP3A 4YCSA 1PFUA 4E22A 1RC0A 1Y8ZA 1I2AA 4Q9DA 2XQKA 5EPEA 4M8IA 3QHAA 5JT1A 4OXNA 3ONVA 4QYIB 1VSBA 1SAYA 1SCIA 1BVRA 2D1SA 2ZIWB 3JQAA 4A0RA 4QUIA 1V41E 1N25A 1H6DA 4CG3A 2FX2A 1LDBA 1I7QB 4TV8F 5LUBA 2N46A 2MINB 3UW1A 2JCVA 4RMIA 3P9KA 2OGZA 1U6KA 1GTMA 4Q4CA 3A2MA 3TECE 1SNYA 1R00A 2HMVA 3GPIA 1TKAA 5JJLA 2O1XA 1DRVA 2BZ0A 2VP0A 1E9RA 1XZ8A 3F4LA 3EGEA 3MC1A 3HN2A 1SCJA 3R23A 2OZEA 2PM8A 1II8A 2OHJA 3AR9A 3SJUA 4MYUA 3UV6A 4RFLA 5KYWA 3I5YA 4F0JA 1Z83A 4HDSB 3RF7A 1O54A 4LNAA 1YJBA 1LXCA 4HZGA 2AEEA 1DQNA 3LWNA 4ZALA 1AKUA 1DJPA 5DHFA 1NQUA 2PQ6A 2YFHA 4AKHA 1KAGA 3KO8A 1HEYA 1CE8B 1I7PA 1O3YA 5J1SB 4JUCA 3RGGA 4ZCIA 2PX3A 2W6PA 2NZVG 2XQIA 1QVZA 4IH9A 4L9SA 5EKSA 2XYRA 4ZRNA 3BB3A 2CUKA 2DWPA 1YS9A 1J22A 1G2IA 2WWGA 2PSEA 4XJSA 1WKVA 1R6TA 2VQDA 3O4HA 3RSLA 3VR4A 4LJRA 2P27A 2Z4RA 3OICA 4MQ4A 3VZSA 1MO4A 4HN4B 4GOJA 1YHZA 3FPEA 3DH0A 1FYWA 2IS6A 2V5UA 4LDAA 2QM7A 2QYSA 4B2LA 1J99A 1Q1GA 3A0RB 2Z56A 3GRRA 5H82A 2Q5LA 4XCXA 3V6MA 1DCTA 3EZLA 1SRRA 1WCIB 4KLAA 1P3Y1 1QV6A 1NMEA 1FYVA 1LF0A 1P7VA 2GAJA 2OG1A 2V5AA 4IFIA 4PO3X 1QZZA 2REXB 1VKJA 4TM7A 1DS6A 1I51A 1LX7A 1XVAA 3CISA 2ZE8A 1KEEA 1SBCA 1V11B 2C8VA 1JTEA 3AM4A 2QNBA 3A28A 1L3CA 4YRFA 2HDOA 4H4DA 4UBKA 1YJ8A 1H1TA 3H05A 4ZVLA 4C6TA 3SQXA 1Q7RA 3KJNA 3OX2A 4BNNA 1XZQA 2GBPA 5H9VA 4B35A 4ZVOA 1H9CA 2GEJA 2V65A 1K5HA 2YIJA 1NPTO 1C8VB 3M2PA 3TWOA 4AKTA 2AFIB 2R9VA 3G0OA 3R3JA 4R16A 1Q92A 5LN1A 5KNCH 2HN9A 2EYUA 2A1TS 3EE6A 2R8PA 3PUJA 3LZCA 1K4MA 4DWWA 1U8UA 4ZVUA 5DV9A 2Q62A 1Z07A 4K6MA 5K0LA 2I1VB 3IFSA 1KFBB 3TTSA 3BICA 2ID7A 4HVTA 3RANA 1U2ZA 4IQ0A 1F12A 4E07A 4ALIA 1HM5A 3W4IA 1N6PA 2PBRA 5E4YA 1YVPA 1MJ5A 4OSPA 3SF8B 2OKGA 4DARA 1FB5A 1I30A 1U90A 2BEVB 4ISCA 3HJBA 1O6FA 2Q9CA 2ODEA 3NRJA 3PGVA 4MW6A 3UT6A 1ECBA 3BVPA 1FDRA 4RW0A 3GRPA 1C9JA 3T7EA 1B15A 1HXHA 2G5CA 3UUWA 2PY6A 4QXRA 1QIKA 4LZOA 3QYJA 1NR7A 2XA1A 4GF5A 3E7FA 4WOBA 3CVUA 2CEKA 1W0KD 1ZCAA 4BFYA 2VAVA 3CRVA 1Y4UA 3COJA 5TMBA 1TPZA 2BUAA 2TSYB 3QE3A 4HMOA 4M8KA 4RSGA 1U1FA 3CLVA 4G56A 4E5SA 1UQTA 5I7EA 4DLRA 4OJTA 3FNHA 4FK8A 5BQOA 2J8ZA 4ENPA 1XEXB 1Y3FE 2WJ6A 5IVHA 1ONOA 1NF9A 2J0UB 3D7KA 2G0NA 2PN1A 1CLUA 1M5UA 1NVVQ 1A27A 2GA8A 3AV0B 2DPHA 1QGZA 3U4QB 4PHFA 2WK1A 1E3DA 5BYAA 2LNDA 3H1FA 4PTLA 4WKCA 3RAGA 2C3PA 1NFQA 2H6EA 2QUAA 2O2SA 3H2GA 3WYEA 2B2XA 2YRFA 3O8NA 2JGRA 1RTKA 2YCLA 1N8KA 5LLSA 2CLEB 3RWMB 4R5HA 2HT1A 1J70A 3HCCA 5AP9A 3VPHA 3RROA 2OY0A 1GO2A 3CE6A 1PVVA 1QOZA 2IHKA 3ROFA 1LJLA 3PWTA 1J7JA 2VL7A 2WHRA 3IAHA 4LRYA 3S70A 3FWYA 4MQEB 2X19A 2BM8A 1U99A 3DMTA 3A4MA 2ORWA 3ZCSA 1NKSA 5HF5A 4UMVA 4AYTA 2DR2A 1SWVA 2CLMB 2QYOA 4MKGA 3L7MA 4WNCA 1YO6A 2DWCA 3UH0A 3OZSA 2FGJA 3DMRA 1FSFA 3H6KA 5HJ5A 2PKYX 1LX6A 3GZ4A 3WKDA 4D8XA 3B1VA 4F4CA 3EC7A 1RC8A 1NNEA 4NAUA 3LCMA 5A6SA 3DE2X 1T8SA 3CG4A 3KUDA 4P9NA 2O48X 3DMTC 1SD5A 2A7XA 1YRQA 4UAUA 1ELOA 5D7NA 5FUYA 4PYLA 3ZU6A 3O8LA 4LBZA 3U3MA 1L8LA 1Q7EA 2AMYA 8AT1A 2IS1A 3Q8KA 4PZEA 5J63A 4FR5A 1KNXA 4ER0A 3FCXA 2CZGA 4WZAB 4KIJA 5DZSA 3GT0A 4ABTA 4FOOA 4IXNA 4DLSA 3EODA 4JYBA 4YPVA 2AW5A 1CJBA 4X71A 3QPAA 2RGRA 1Y6JA 2RGAA 1CJKC 4FFSA 4EGQA 5HKBA 1YBVA 5KPDA 3UMGA 2NIPA 2OD7A 4UFOA 3AQ4A 2FK7A 5J47A 4H3KB 5KTRA 1M72A 1OFVA 3TLKA 3TR6A 1UKBA 4MJLA 3CINA 3LUDA 1II9A 1PJTA 3ICCA 1HPLA 4D9HA 1TAGA 3EG9B 3QGMA 4TSFD 4F3YA 3U4AA 2W0MA 5H16A 1A76A 2AEMA 4L72A 3DFFA 4FEEA 3KD3A 2PSDA 2GKGA 1ODLA 4GBED 2P91A 1BDIA 4NV1A 2AN5A 3MOGA 3ND6A 2GA9A 4L9WA 4WY2A 1SKBA 5K4GA 1BRTA 1D0IA 2IOFA 1Z0DA 3QPUA 1RHQA 1XHFA 4FGKA 1XKLA 4DWOA 5JNLA 3R6DA 2JFBA 3HLTA 3NTLA 4OXRA 3I0MA 1P31A 2FEXA 4WE3A 3GBPA 1RKVA 3U1BA 3S6JA 2E0IA 3VDRA 1R4MA 4ZVSA 3HFJA 3C3MA 2DHRA 5B1EA 3IHTA 121PA 2PA0A 3CBQA 3NYQA 4M38A 4HVLA 1VGQA 5KYXB 3T4PA 4L27A 2GLTA 3HB4X 5A7FA 3E7XA 5JVDB 1XEWY 3BKXA 4IIYA 2RHTA 1EVYA 3AIKA 2YJ4A 1XI2A 1JQ3A 3IE1A 5CP8A 1MIOB 3WGIA 2Z6UA 4CTJA 5HW0A 1TYCA 3P2EA 1NJ6A 2Q6VA 1SG9A 2Z9DA 4RHXA 2PIDA 2ZT7A 4CUKA 1AKYA 5I7HA 1AMOA 2ZYWX 5DHSA 4X1KA 3QXXA 3THWB 1F0PA 2XRMA 5AHOA 5EA2A 4BBAA 3K0SA 4XSHA 3O4GA 4PYJA 3NGMA 2N42A 2PKQO 3OZ7A 4JJ6A 1PV2A 1SPBS 1ZRHA 1TJ3A 3OH8A 4KPUB 3D4BA 4MPPA 3STTA 4DHEA 3DF9A 2FN7A 1ZICA 4CTNA 3GPLA 2P2DA 1QS0A 3FKJA 1CPYA 3WZMA 5E9AA 1NLYA 1GGMA 5JISA 2WD9A 4NJEA 1JHXA 2P2SA 3LQ4A 2YWXA 3WK6A 5AOAA 5HFNA 5J59A 3R9XA 1PV1A 4C21A 4MP8A 3F78A 1Y9EA 3VSAA 3IIJA 4MW9A 2F1RA 4IJVA 1NY6A 3N8IA 3O92A 2BTQA 2EF1A 3RWBA 1JWBB 5FNVB 2GYWA 3ZUGA 4TPKA 4D3DA 4HFMA 2WY2D 5P8WA 4TMVA 4G0UA 2VHEA 5HQ3B 5ALDA 2NUPA 5T6MA 3OZEA 2GXQA 3VHLB 3KVVA 4CI0B 5EJ2A 3TCNA 2GSWA 4JD5A 2RSLA 5BWMA 2VTBA 1OFGA 2QORA 2YHBA 2JFZA 3CSDA 3IC5A 5F7XA 1PR2A 2QMOA 5SZJA 5K3EA 3ZE1B 1V5GA 4KQMA 3K0FA 2ZUCA 1SKYB 2PRIA 4XEHA 3AL0C 3A32A 1TUBA 2RCYA 4RMGA 4RANA 4EB3A 4V2IA 1PG2A 2QL5A 2YVUA 3CUKA 4IDBA 3B12A 4BU1A 4LQDA 1EBUA 1N77A 1E2KA 1ZHOA 4E46A 2VDVE 1J1ZA 1OLXA 3BB4A 4HPJB 3TW4A 4EY5A 2C5EA 3P4UA 3BH7A 4BQQA 3URMA 1CVIA 1P75A 4P81A 1LTQA 2EWMA 4O29A 3NAGA 4K88A 4QXPA 2YASA 3GNSA 1UF9A 4RACA 4D6XA 1CQJA 4H18A 3WJAA 1CUAA 2QM0A 5GJBA 1H05A 2RHJA 2R96A 1Q1BA 2A9JA 2PO7A 4A10A 2Q4BA 4IEEA 4L5BA 5IKPA 5L6LB 5ADHA 2XCSB 5JIBA 2O2EA 3R9KA 2AUMA 3UEOA 1GCOA 5A62A 3U6BA 3LUHA 4C7OB 4FZ5A 2ZWOA 5KAPA 5KWIA 1PK8A 4CCAA 1MEEA 2C8KA 2VPIA 2V96A 1WD7A 4IZIA 2P3LA 3Q1KA 5TGTA 1MV5A 2BF7A 3QEMA 4UM7A 2A2ZA 2PX8A 3JVUA 4INPA 2EF0A 5ITWA 5ESWA 3GLGB 4R01A 4HQ6A 1NNLA 3LU1A 4FYVA 4OXXA 5BVHB 4OP1A 1O96A 2BMAA 2ILTA 3ONDA 5BYBA 2EBHX 3ACCA 4GEKA 4CKZA 4CG2A 3MEQA 5AVSA 2QRVA 1H3EA 3AR8A 3L1IA 2JFYA 3D5EA 1NDHA 4I5IA 4ZOQI 3N2YA 3LQQA 1YFZA 4RF3A 3ZWQA 5ITZB 4NMLA 4I46A 4CM9D 2FR1A 1VA4A 4F1KA 3AYZB 4RPJA 5CJJA 2W42A 2PGOA 3G0HA 3Q88A 4EK9A 1YQXA 2IHVA 2GAOA 3L0DA 3OF2A 1XYVA 4OATA 4P3YA 4QFDA 4EG0A 5FO0A 3OLCX 1RQGA 3DGEC 1ZOPA 3GP8A 4I55F 4MI9A 4KQEA 5LUAA 4I1SA 4IRUB 2FHSA 5JQGA 2E9SA 4C0XA 1SQGA 3ANSA 1OYOA 1TO2E 3ULKA 4D97A 1S6YA 2FPGB 1FNMA 4JJ8A 4YT8A 2CJYA 5C4IA 1QF7A 1N5OX 1WZUA 5HJEA 3GXOA 2YYZA 4C0JA 3NHKA 4M0CA 2H4WA 2YHSA 5G4KB 2XMGA 1CJMA 3M8KA 4KTTE 3AUUA 1F8FA 4H60A 1D2HA 2MTBA 3VZDA 3OLXA 3QMVA 4BX2A 5DT9A 3DT6A 2UYQA 3ET5A 4DUPA 1FFBA 3TB6A 2JFNA 4UW9A 2QR2A 1RI1A 4A6DA 1T4MA 2HU8A 3TNFA 5ER6A 3BQ9A 1L7OA 4N0QA 1Z56C 2CY0A 2W2QA 2OFPA 5IH7A 1F2UA 2ZPUA 1SOWA 1S4QA 5JS7A 1LDGA 2A33A 4A16A