The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
84
|
sequence length |
262
|
structure length |
262
|
Chain Sequence |
AKHRPSVVWLHNAECTGCTEAAIRTIKPYIDALILDTISLDYQETIMAAAGEAAEAALHQALEGKDGYYLVVEGGLPTIDGGQWGMVAGHPMIETTKKAAAKAKGIICIGTCSAYGGVQKAKPNPSQAKGVSEALGVKTINIPGCPPNPINFVGAVVHVLTKGIPDLDSNGRPKLFYGELVHDNCPRLPHFEASEFAPSFDSEEAKKGFCLYELGCKGPVTYNNCPKVLFNQVNWPVQAGHPCLGCSEPDFWDTMTPFYEQG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural differences between the ready and unready oxidized states of [NiFe] hydrogenases.
pubmed doi rcsb |
| molecule tags |
Oxidoreductase
|
| molecule keywords |
Periplasmic [NiFe] hydrogenase small subunit
|
| total genus |
84
|
| structure length |
262
|
| sequence length |
262
|
| chains with identical sequence |
B, C, D, F, G
|
| ec nomenclature |
ec
1.12.2.1: Cytochrome-c3 hydrogenase. |
| pdb deposition date | 2005-02-04 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01058 | Oxidored_q6 | NADH ubiquinone oxidoreductase, 20 Kd subunit |
| A | PF14720 | NiFe_hyd_SSU_C | NiFe/NiFeSe hydrogenase small subunit C-terminal |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | NADH:ubiquinone oxidoreductase-like, 20kDa subunit | ||
| Few Secondary Structures | Irregular | Cytochrome-c3 Hydrogenase; Chain A, domain 2 | Cytochrome-c3 hydrogenase, C-terminal domain |
