1YRQA

Structure of the ready oxidized form of [nife]-hydrogenase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
262
Chain Sequence
b'AKHRPSVVWLHNAECTGCTEAAIRTIKPYIDALILDTISLDYQETIMAAAGEAAEAALHQALEGKDGYYLVVEGGLPTIDGGQWGMVAGHPMIETTKKAAAKAKGIICIGTCSAYGGVQKAKPNPSQAKGVSEALGVKTINIPGCPPNPINFVGAVVHVLTKGIPDLDSNGRPKLFYGELVHDNCPRLPHFEASEFAPSFDSEEAKKGFCLYELGCKGPVTYNNCPKVLFNQVNWPVQAGHPCLGCSEPDFWDTMTPFYEQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic [NiFe] hydrogenase small subunit
molecule tags Oxidoreductase
publication title Structural differences between the ready and unready oxidized states of [NiFe] hydrogenases.
pubmed doi rcsb
total genus 84
structure length 262
sequence length 262
chains with identical sequence B, C, D, F, G
ec nomenclature ec 1.12.2.1: Cytochrome-c3 hydrogenase.
pdb deposition date 2005-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 1yrqA01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 1yrqA02
4KN9S 1UBTS 4UPEA 3ZE9A 1YQWA 1UBOS 1H2RS 1WUJS 5D51S 3USCS 2WPNA 3CURA 4KO4S 3AYZB 1UBUS 3UQYS 3ZEAA 1FRFS 4KO1S 3ZE6A 3USES 1E3DA 4UCXA 4UE3S 5JT1A 4UD2A 1UBRS 4GD3Q 5ADUS 3AYXB 5A4MS 1WUIS 1FRVA 1H2AS 5A4IS 4IUDS 4UCQA 1UBLS 4KO2S 4U9IS 4U9HS 3H3XA 4IUBS 4UE2A 3ZE8A 4UD6A 3MYRA 1UBKS 1UBHS 4UEQA 4UE6A 4UQPA 4C3OB 4CI0B 1UBMS 5JSKA 4IUCS 3ZE7A 1WUHS 1WULS 4UEWA 5JSUA 2FRVA 1CC1S 4UQLA 5JSYA 1YRQA 1WUKS 1YQ9A 5JSHA 4KO3S 4OMFG 1UBJS 5A4FS 4UPVA 4URHA 5JRDS 4TTTS 3CUSA 3RGWS 4UCWA 4KL8S
chains in the Genus database with same CATH superfamily
4J2HA 4DVJA 5SZJA 1EFPB 1IVSA 4X61A 1N5IA 1YI0A 1C8BA 5KU7A 4RD0A 4YJHB 4LF7B 1FQOA 2MR6A 4JUCA 4UAVA 4OQQA 3GWZA 2PTGA 2OTCA 4GNKA 1CY0A 1QYRA 4Y1FA 1F17A 1V1RA 1FB5A 3GXOA 4A92A 2QTMA 4ALNA 1VB3A 2O57A 3BBLA 3GNQA 1DKNA 3TZKA 2BTQA 3QYJA 1Z38A 1MX3A 4PQFA 3H9JA 4EGFA 5K8JB 4W9NC 4HO1X 3RROA 3EH2A 5BSWA 4CFYA 4RE6A 1GCUA 4UXHA 2C5BA 4NYMQ 4RGVA 4RZHA 1JNYA 3EPKA 1OI2A 1KH2A 4OHMA 1L9KA 2RHWA 4YQFA 2O0JA 2X6QA 1S9DA 1VL1A 3B3AA 2V7PA 4UUAA 4CHGA 5BWBA 5KZMB 2B78A 5B58T 1AKTA 4Q3KA 5B3LA 4HVAA 2YVQA 2V5AA 2EP7A 5DYTA 3UHFA 1JSLA 3UQYS 2J3HA 1HQCA 2IYLD 3GJZA 2I33A 2PEZA 1YBMA 3TOVA 2PSFA 2PRKA 1IXKA 3WTBA 1I1QB 3EIWA 4BQPA 10MHA 1X7ZB 3S2SA 5EXPA 1OBFO 1VG8A 3FYUB 3PDHA 5LYJA 1OHHD 5FTWA 1ZCJA 4PHCA 3RUIA 3N7AA 4MV1A 2G25A 3W6ZA 3OTIA 3U4HA 4CE6A 3DDHA 4UMDA 4BKUA 4H15A 4B33A 5D3MA 1NBEA 2CGEA 4GZMA 1M1YB 4CEIA 2UZ4A 1Z6AA 2ZSBA 2FXVA 1XHEA 4UJ3A 2H51A 3HKCB 5HOQA 3PGA1 3DOOA 1WF3A 3PLRA 3RR2A 2NZ8A 3C3XA 4C4AA 4LYEA 3CH5A 1NQTA 2I1VB 1PBTA 3BIXA 3R3XA 2FW9A 3W5BA 3B7WA 1HM5A 1DXOA 5J2UA 2R6ZA 4IIGA 4GE0A 4UUQA 4OKIA 5DSTA 2D74A 4KB5A 5DBOA 2GSDA 4M7RA 5IT4A 4O1HA 2W71A 2RHTA 1MJ5A 4ML3A 1Q3KA 3DBVO 3HY4A 2EW1A 4Y1EA 4DB2A 3EASA 3PIDA 1CHDA 2CHQA 1K6XA 3OJLA 1R4ZA 2XUAA 1NQ5A 1ORVA 2Q0SA 2LVBA 1SCIA 3FSEA 5TQ0B 4GP6A 2SKDA 1WKCA 4B3JA 2DBZA 1P7VA 1YZNA 2NP7A 1E1KA 1RI2A 5KWJA 1J2TA 4MMYB 2O8NA 2HRCA 4PC1A 4TSFA 3L7BA 3N3BC 5K03A 1XNQB 4GDMA 1XDGA 4PYMA 2WT9A 2IXBA 1H5QA 3EARA 3V1LA 8GPBA 3G1TA 4QHSA 2OM2A 1CSEE 3WLAA 3A3NA 3LGSA 5IKMA 3WWEA 4PM4A 4DYDA 5C81A 4HNTA 4F7WA 4JDPA 3I9V1 3FHLA 2P6RA 3ZD7A 2OPBA 1E6WA 3ANYB 4NLLA 4K9NA 4BZXA 3FTNA 5CYOA 5LKRA 1T6BY 3S4YA 3TE7A 4YAUA 3FLEA 4MVWA 4J29A 2EKQA 2HNAA 3EIHA 4R81A 1PG0A 3ADOA 2IP4A 4FYHA 4W7IA 4F3RA 1YOBA 2FTKE 1CJUC 4WVLA 4F46A 2QJRA 4LOHA 3OIUA 4EHFA 5IXJA 3IOCA 2E5LB 1DO8A 1N8KA 2IQIA 1IPHA 2R87A 1B1CA 1DELA 1EINA 1T9GS 2FFAA 3M34A 4LRYA 2JAPA 2QT1A 1B0PA 4N3AA 4XTCS 2EVWX 4E5NA 2VHTA 4KQ2A 1LBIA 2EBHX 2KI5A 3SSNA 3T9DA 4U6QA 3VJKA 3ET5A 1TKAA 2XUDA 1ZMBA 3M6VA 4H35A 4PFQA 3T61A 4ZZ0A 2CLFB 4EKYA 2CL5A 2MYTA 4GMKA 3OOJA 5ITSA 1I13A 3RRYA 4DWJA 5GP1A 2JFUA 5ALOA 2EAUA 3K0FB 2V58A 4OSOA 1JDNA 3SSMA 5CDGA 2HXSA 3OMXA 3CYFA 1KE2A 5CFMA 1IVNA 3GW8A 4FC6A 1A4IA 5IBQA 1I2AA 2NTYC 4X65B 1MX9A 3G88A 1ACLA 4EYKA 4FBMA 5MFPA 1OSNA 4IHJA 4EIWA 1HNZB 4Q02A 2A94A 5F98A 1CUBA 4PYOA 2CXQA 3U4QA 5DTQA 4Q3EA 1GUFA 2BMEA 2HXYA 1ODTC 3FZGA 5BXQC 1N2IA 1MOZA 5CYPA 2EP8A 4L0DA 3KQLA 4WY2A 2JJ2D 1QYCA 4MS3B 5B4UA 4LNAA 3QOYA 1C0PA 1ESDA 3GQBB 3NLLA 4LOIA 4QD3A 1WQ1R 1CNMA 5E4FA 5KCZA 1Q15A 4Q00A 5KU1A 3PF9A 3ZTTA 1UZLA 4RVDA 2B6HA 1U2PA 2ZJ6A 3BGSA 1IU9A 2Z3WA 2E0IA 3UCXA 5GJVC 3SKYA 1GRRA 3V4OA 2ZIVB 5IPFA 2A0WA 3QI2A 4QPPA 4RZUA 2BVNA 5A6SA 3FW1A 5LL6P 3UCEA 4YUWA 4UZSA 5HHTA 2L42A 3RVJA 1C7JA 3NJ8A 2W83A 1SR8A 2PLWA 1V9CA 2ZYTX 3E5NA 3GGPA 1XSEA 1SEPA 4LYYA 4XIJA 2DFTA 2Q27A 3HL0A 3LU1A 4P0QB 3IVMA 1IEVA 1USWA 3LUDA 4FFPA 1U0TA 3RS7A 4NNJA 1LBEA 2CL7X 3EF3A 1DNPA 2QLJA 3OFKA 4W5OA 3PX3A 3KLMX 4QL3A 5JVDF 1JLLB 2PSJA 2Z6VA 1UT5A 3K09C 4XGRA 3OFVA 2BBOA 2I62A 3UWSA 1H4QA 2XIJA 4JVOA 1K06A 4OKNA 4CF4A 2YNMC 3KPYA 1T13A 2XV1A 4D79A 2B7CA 3BXXA 4NZZA 1YJXA 1VG0B 1FF9A 1LPBB 4IRMA 1R0XA 1THTA 5DNYB 1X2BA 1ZESA 3CIOA 2FFBA 2LCIA 1C0LA 2ZJ4A 3ILYA 3MJSA 3O0TA 4OQLA 2FPLA 4UEWA 4F5EA 1IOVA 2QYOA 4IF4A 1R6BX 3OX4A 4Z3OA 2P9GA 4RY9A 1T9GR 2ZUSA 2DR0A 1BFKA 1M8PA 2JH3A 3NO4A 1NXPA 1M6VB 4MNTA 4C0BA 4II3A 1GTSA 5LFAA 1Y3CE 3V9AA 1NRJB 1CF9A 4F1KA 4EOGA 1UFOA 4PZ0A 4C88A 2WZCA 3LZDA 4IZ6A 4DA6A 3RU9A 3IR5A 4CETA 4UZFA 3TSAA 1DIGA 3PI6A 2PKQP 1NXVA 4QGGA 4W7HA 4Z4QA 1IK6A 2Q1UA 3K6KA 3EAGA 3T1OA 3EDYA 1CB0A 2Q3FA 5EXDA 2RGNA 1IZ7A 1H65A 4AK9A 3RQSA 4DDMA 3FPFA 2PZEA 3HLYA 4FBGA 4XFKA 1XTQA 1Z2DA 3KQUA 1QHGA 2N46A 3MRXA 1MABA 1ZL0A 1HE8B 4CCAA 5A06A 2REQB 1I6WA 2VJQA 4TMWA 3FHTA 1ZG3A 3E82A 3NBZC 5I48A 3O1JC 3HMQA 2JLZA 1L8AA 2RGUA 1YONA 4Q93A 4UU7A 2W2VA 2FWBA 5AKJA 2HA3A 4JT9A 3PNKA 4E6PA 4YUAA 5JZ9A 4ZP1A 2XMCA 2VDQB 4D9NA 3FYSA 2CBXA 4O25A 1XB2A 3BD8A 3F73A 1JI0A 4BECA 1OYVA 1ES9A 1I9CA 3CLTC 4UTPA 4P58A 1T1IA 4EGJA 4WZAE 1Z33A 2DFPA 2FWRA 1KYXA 1SBTA 2C29D 2I0FA 3DE0X 3DKRA 2FEAA 3DF9A 3RVSA 4EY6A 5JNSA 2WF7A 2JJ2A 2RMKA 2VWQA 1IMJA 1F4VA 4DJDC 3EXAA 4KR3A 1XZMA 3B3GA 5ICFA 3K2QA 2XRMA 3W9YA 1GN9A 2FN8A 1GG2A 4DV6B 1KH3A 2O7NA 3SAJA 3WLQA 1WJGA 2UXBB 2HOQA 2C4UA 1YQWA 2PMWB 5EKTA 3S28A 5KC8A 2JI9A 4R69A 4DAEA 2P0YA 3JX9A 1K27A 1LRLA 2GTIA 3O74A 5FPPA 1EQUA 1DAEA 3OG9A 4PXSA 1CDDA 1K1EA 3MBIA 4CL0A 4QICA 1C4KA 4OYHA 3LUBA 2XWPA 4WLEA 5AVXA 2QX4A 4NBTA 5LD2B 4U7TB 1SXHA 1NMQA 3RG8A 2GCNA 1MB9A 1VE3A 4EEXA 4EK9A 4O8ZA 1T1RA 2C07A 1KK0A 1PR6A 2YS7A 1YKGA 3C14C 2GZRA 3I92A 1P9LA 1QV9A 3EDOA 5EN4A 3DV2A 4FOPA 4EQZA 3REOA 3UMSA 2Q5OA 3VO1A 4WE3A 1T2NA 1T1GA 4NR0A 3UKOA 3NH9A 5I8ZA 4TKUA 4CODB 1P4GA 1JDPA 1AKMA 1IZ8A 4R2JA 5LP6C 1UKZA 5KTNA 1T9CA 2I2XB 5DLDA 1EFTA 2P6NA 4G4GA 4KQGA 8MHTA 1XZ8A 4JA0A 1IUNA 4PONA 1PFGA 2ZBVA 2BFDB 3R6LA 5JAOA 3U0VA 3VSCA 1H2EA 3IDSA 3MCUA 4XYMA 3TINA 3G82C 1MEOA 3C3JA 2GD6A 2IYUA 4NDZA 3VZRA 2DLDA 3PUYA 3WDKA 4M0UA 3PDUA 4CBVA 1B3BA 2F3PA 2OB1A 1FW6A 5HFAA 4EJ2A 1GYRA 5EPUA 2QAIA 3L49A 3IP1A 1CFJA 3KXPA 1R4MA 2WIDA 4EFMA 4CF5A 3G85A 2O52A 5LQJA 2E87A 4WBNF 1AA9A 5H7XA 4LKRA 1C8KA 1M7HA 1DAHA 2Q3MA 3PPXA 3GPBA 2R3SA 3GD7A 3GWGA 3Q1LA 4NIMA 1TM3E 1O95A 2Q62A 4FDTA 1CZHA 2IHBA 3RWOA 2A57A 3RIMA 3T7SA 3GV0A 4MW9A 4XR4A 3FCUB 3DEJA 3VBEA 1U0JA 1CR2A 4DSNA 4ZQHA 5GINE 4AKSA 2IXFA 2QP3A 4PS0A 4F8JA 1MPTA 1C3EA 3GFFA 1HEIA 3TIXB 4AJOA 4DM3A 2WUDA 4NECA 4A3SA 3JS5A 3EXHC 3H8VA 4HGNA 4IQ0A 4RFVA 2Y68A 1M5TA 3RVPA 1BRMA 1MXHA 2FX3A 2BCJQ 2VNIA 3ONWA 4IIFA 4MLCA 4H7EA 2GGSA 1APBA 1P7CA 3JAKB 2QN1A 4LY3A 4QNRA 1UBFA 4JV5B 4Z7OB 3L4SO 3CTPA 4J1TA 3W3AD 1I1HA 1XAHA 1P6UA 3RFVA 3ZGNA 2X5JO 4J9VA 3H1PA 1KZ6A 3BWDD 2A5LA 3NALA 4E7OA 5EJFA 3KK0A 2CLIB 4YRGA 3EIEA 4Q7MB 3VR6H 3AHDA 4RNCA 2QR5A 1II0A 3KELA 4DQKA 2F3SA 3KRTA 2HBZA 4J91A 3ZUPA 3MILA 3ZWNA 4FJ1A 2PCJA 1WXIA 5LLTA 1ULHA 5FWDA 3D5QA 1RYFA 3ND8A 3BXEA 4IEFB 1NONA 1Z28A 4N0EA 4ZT3A 3HSYA 2WPNA 1ZNXA 3GAZA 3MPUA 2W4QA 1SXQA 1E3JA 3KQOA 3SM3A 4E2ZA 5HKAA 1VL8A 1D6MA 4NG5A 3DV0A 4EW2A 1ISPA 1GR0A 3G23A 3IVXA 1Q6ZA 1C0IA 2UVPA 1EA7A 1LXCA 1RRFA 1Y1QA 2XMPA 4JJ7A 1FTQA 5DLQC 4JL8A 5T4EA 1VDMA 2R1UA 3C87A 1Z6GA 2WYWA 4Z54A 1U5CA 1NN3A 3Q3GE 1PU2A 5C4GB 4CPDA 3P0EA 5IAAA 4ZMRA 1RWXA 3ZNQA 2AI1A 4AJ9A 3WWCA 3ZE0B 5A5EA 1Y6GA 4ZRNA 3H0KA 1JW9B 2WD8A 3A14A 4PHFA 2GESA 2TMGA 4US1R 2DBRA 4KOEC 4X45A 5AW6A 4Q82A 1P18A 3BHMA 1AKYA 4RXUA 3VR3A 2QU7A 4NNOA 1QPZA 1ZBDA 2O23A 2PBZA 3F47A 4U6NA 1TZMA 2GK7A 1JPUA 2JBWA 2QMUA 2WG2A 3QENA 4JC5A 2FSPA 3G8YA 4TS3A 5F9HA 5AI9A 4ZIRA 3Q2IA 2W11A 3SEAA 3BMQA 3WKDA 4F5WA 5EJMA 4P4LA 4F12A 1YRYE 3D2LA 3WMRA 2AT1A 1LK7A 3U4GA 5I3ZA 2J9XB 4D3FA 3RS9A 3IJRA 3PCRB 1DO0A 4Z9YA 2E1RA 2BR3A 1A8PA 3RBVA 2VP6A 5JSUA 3D2CA 4X6UA 4F8YA 4OQDA 4BZZA 4E11A 2WV7A 5CM8B 3ROMA 5KHLB 2AVNA 2VJBA 1W52X 1REQA 2AR9A 4OQNA 2LCFA 1R6DA 3FFBA 421PA 4BFWA 1P9NA 1HQYE 3JQQA 2BBWA 3QUBA 3CLVA 1TEZA 3HVJA 2PL1A 3T15A 3GNTA 3IP8A 4L8GA 4DCJA 4G8BA 2QLTA 4GPTA 5IJ0B 4ZJZA 4DNOA 2PU5A 2Z58A 2VDOB 1KDPA 1MJNA 1T5OA 1DXHA 3B82A 3EGCA 3M4NA 3VU9A 1U2GA 2K2WA 3E05A 4NH4A 3W7VA 4AG5A 3U3DA 2F1HA 3SJ7A 1NSFA 4J0DA 2H9AA 1M83A 1XLTA 3D6HA 1ZN9A 3FYDA 5IM4A 3IXQA 3BIJA 3BZWA 3RSCA 1BN7A 4EJSB 2Q6TA 2VYNA 1KAGA 1NI3A 1ZA2A 4REMA 1G8KA 1CHNA 3MFQA 2KQUA 3O2NA 2DTEA 1VHJA 3L8GA 3NWPA 1E4OA 3JYOA 3OZEA 4KBFA 2RIRA 2YHAA 5CLQA 2JASA 5AKGA 4HX2A 4TZ6A 4YJ2A 3DVQX 1H3NA 3ON5A 5DT9A 4BPBA 2PWAA 2H06A 2P2GA 4NMLA 3NKVA 2DEUA 1RCTE 2QQEA 3MWYW 4G0YA 4JH0A 1VHLA 3T95A 3ESYA 1T9HA 2JFVA 1I7PA 1NW8A 3AF2A 1RYHA 4MKZA 4U9IS 4YRFA 3T5TA 4R1LA 2LXNA 3LCUA 2XJ9A 3HGQA 1BDJA 3NANA 4HFRA 4UTOA 4ZT7A 3QPCA 1L7QA 1I9GA 3UFBA 5IM4F 5G0TA 3VC2A 1MA0A 2ZU0C 4JVNA 2VDNB 1GVHA 1V25A 1P9OA 2ZJ8A 3LM8A 2OCKA 1U0FA 3L6CA 3QXHA 5KNLA 1ADJA 1W0KA 3I23A 3EXEB 3LY9A 3DPSA 1ZICA 4JVSB 2A9OA 3DCIA 1XGKA 2XHEA 4TM7A 3WDSA 2A2ZA 2FRDA 4F11A 1B6GA 2P8SA 2Y0EA 3NATA 4HDAA 4A0QA 4AJIA 5EAIA 4FQ7A 5LP6A 2DERA 2AI2A 2C78A 1Q1QA 4HFNA 1VIAA 1II8B 3IBCA 2GN4A 5ADUS 1P9WA 4H4DA 4YPOA 3LFHA 4AJ2A 1RE1A 1AGYA 1AO0A 1HZZC 3MCZA 4NBUA 4Q6BA 1S9HA 3WX0A 2JA1A 4JLDA 1EX9A 1G5IA 3V80A 3X0DA 4KJXA 4MHSA 1PWYE 2PZGA 4IZIA 3AEUB 2C9ZA 3RS2A 2XTJA 4WXYB 3TPCA 3ZC3A 4HB3A 5H81A 2X40A 4DJAA 3OZXA 2P9TA 1I2DA 1KKMA 4CRWB 5IG2A 4XDGA 3PFHA 4F0JA 5ANRB 3AWDA 2CVQA 4LRUA 1JJFA 4FYYA 4GG1A 4P7BA 5FD8A 3PQ8A 4PLVA 3GY0A 3QNMA 1MT0A 2VOEA 4MYHA 2X8WA 3K9NA 1EJ2A 1G55A 3OTGA 1ECBA 2G88A 4LYJA 4ARCA 4MS1A 3R8XA 5LVAA 1NYLA 2QZ9A 5GADl 1H2WA 5KOIA 5AK5A 3D02A 4ANFA 4HLNA 4HHEA 4FGZA 1UIRA 3ZDAA 1L5VA 1G3RA 4AYWA 4S1OA 4EKEA 1RM0A 1C14A 4KQFA 3MJDA 4X5OA 5C8ZA 1AJEA 2GTPA 4XLTA 1A1SA 2XB9A 4KXUA 4G2NA 1AS2A 5BQPA 1F6DA 2J33A 1Q11A 4OY3A 2C5GA 2ZRCA 2OZKA 1JEOA 1U3CA 4PYLA 5DW0A 4B3IA 3T5DA 3SBXA 1M2OB 3VHXB 1GGKA 4K87A 5GJWC 4ZRDA 3VO9A 1E1MA 1K8QA 1DEOA 1NWCA 1W9HA 2BAGA 2NW6A 3NIBA 3VI4B 2BTEA 4GWLA 4QQ8A 1BU5A 2YWBA 5THKA 4EG6A 1IY0A 1FSFA 2GVNA 2W00A 3LS2A 4KWEA 4XB1A 5DX8A 5KOHB 5LZ2A 2JATA 6REQB 2VAMA 1X38A 1NW9B 5BPHA 3AVWA 1W44A 1PQYA 1QIMA 2CLKB 3AQ4A 5D01A 4F85A 5LQDA 2F4VB 5CR9A 2V5VA 4E21A 4BKMA 1ZD9A 2CVPA 4RHXA 4CIDA 5BNWA 2XXAB 2JCVA 3VC3A 1QQ7A 4NBSA 3FA2A 5IT5A 2YMMA 3ITDA 3ER8A 4L51A 3F3YA 4JAVC 1U98A 1O8BA 3G2KA 1Z75A 2A86A 2B8EA 1NF2A 2FMIA 2N75A 3BXOA 4WCFB 1PW7A 4D6YA 1RI5A 4G5XA 3LE8A 3KQMA 4B4VA 5LP1A 5FUBA 1UJCA 2ZAMA 3GFGA 5BSRA 5HZKA 1PZMA 1XCPA 1X1DA 4HAVA 2BFBA 1DWQA 6YASA 4PO3X 3SQMA 3K7EA 1BDHA 3HZRA 3OM9A 4L7VA 4F3NA 4K5QA 4Z6KA 3HJAA 3DHWC 4M98A 4Y6OA 4Y9RA 2EZ4A 2WUEA 1VPEA 4FJ2A 1KYIA 2NZYA 4B7UA 1L7XA 4KVZA 4IDDA 2OHJA 3O4GA 2DFNA 1TU0A 2H1WA 2G9UA 4CW7A 4YRAA 1H2ZA 3TVTA 4N76A 3ZU3A 1DLIA 2P77A 2ZB2A 3KQVA 4WXRA 5CAEA 5MN4A 3CRRA 3VKFA 2JJ1A 2ZU6A 1D8TA 1Q5PA 3TG2A 4Q1DA 4RTPA 2LKDA 3I32A 2O7RA 2OMKA 2OZVA 3GUUA 1VCOA 4RS4A 2JFBA 4RY0A 1Q91A 2XE6A 1KL7A 2HI0A 5B6PA 1G16A 3ZNNA 5DLPA 1TI7A 5D1NA 4OGLA 5FI5A 5ESWA 2J5KA 5IXSA 2I4MA 1NBAA 1FUKA 4JSRA 1DMRA 1I1NA 2XPCA 3BKXA 4QLBA 1TZCA 4FSXA 3X1YA 3TRIA 1FXWA 1NVBA 2WWYA 4MGYR 3KHUA 3T4XA 5JXHA 1XOIA 5CT8A 3G3EA 3RSFA 4C89A 4ABYA 3Q9LA 5CXUA 4WEQA 1E7SA 5FTMA 4BCDA 2CV1A 5I4KA 2W2LA 2XGOA 3C6QA 2WSMA 3OZSA 2OK8A 4HPXB 4Y1RB 5F51A 5FA8A 2JIZD 1C0KA 4X41A 4KLAA 4BQFA 4F97A 1QONA 1Q44A 1C4OA 4Q39A 1VYVA 1FC0A 3OT1A 1QORA 3CB4A 4V0NA 1NI4B 5KOJB 5DP1A 1JMVA 1XEWX 2GR9A 3F71A 4B3GA 1TT5B 3L7IA 3SR4A 2J5XA 4U5QA 5FUXA 1YVRA 1G9SA 2A9PA 5AJZA 2X0KA 4CIBA 3UHPA 2WV9A 1NTOA 2HCBA 3DXYA 3LLMA 3VAZA 1V8BA 1XMVA 5L6MB 1Z4OA 4JWKA 1NG9A 2PANA 1JALA 4NHEA 5EXEA 4CI0B 1Z0DA 2J4DA 3KYCA 2LD4A 3I83A 1JI3A 4NOLA 4DLWA 2JHGA 5D7BA 2PUTA 1C4XA 2R65A 2BGGA 2YJ5A 3OSZA 4OGWA 2OC4A 3WIVA 5K8IA 1X19A 3H5IA 1WUJS 2IPLA 2OBLA 2QD1A 5T8KC 5SZHB 3V4LA 2PUDA 4QDJA 3G2JA 1VFNA 2IDZA 3TZQA 2VK1A 4BC0A 1NE7A 4EATA 4BNMA 1EH5A 2QVXX 2NTNA 4Q4CA 4ZYXA 1UADA 3AEXA 4JI5B 4ACBA 1E94E 1GDDA 1CVRA 2HGZA 4FYJA 2J7KA 3L4KA 4X1KA 3Q88A 3RSOA 4X1KB 1DEKA 4GWKA 1FJHA 2NO1A 1EJ6A 3E8SA 5KNCD 2ZUEA 2A14A 4ZVNA 1ITZA 1N9KA 4Z8YA 4IIDA 4OG2A 2C9YA 1U2SA 4ZRMA 4KPEC 1EXMA 3V1YA 5KSWB 2R5FA 1JR3A 1WNFA 2PBFA 2H2FA 2I99A 3F6EX 3O4IA 5EMLA 3QLUA 2QZ4A 3ADBA 1T0HB 4HBZA 1I94B 1GZ7A 1G0OA 3NHSA 5DBFA 3N05A 1ABFA 1F2DA 1MC5A 2Y1LA 4KW7A 5CLGA 1HDCA 3BE6A 2RDMA 1E2JA 4ND4A 3IEMA 3D31A 2PVPA 1PR1A 1W48A 3PDJA 3PITA 2YV2A 4OQ4A 1QBKC 5BYBA 3TLJA 1N3YA 4PHTA 3FJYA 4X93A 4ZAWA 3VSDA 4L4YA 1VSBA 3FMPB 3LX5A 2QPOA 1XCLA 5JR3A 3MPOA 2FPWA 5CG2A 4WN9A 1Y48E 4W8HA 2C2OA 4NG4A 4MR8A 4P3PA 1FA9A 5CVUA 3F5MA 4DCPA 3WRVA 1JU3A 2W2QA 5JD5A 3HJFA 2PX6A 1OLSB 4MUNA 1HRKA 4ASUD 1N6NA 2IS2A 5C2JB 4RS3A 2Z1MA 3R77A 1AHIA 3O03A 2ZUCA 3IUQA 4NH0A 3LPAA 3I58A 4HAWA 4CG1A 2OV3A 3EA0A 4DLBA 3THYA 3CUKA 4PFSA 2C9BA 3AUXA 4MX8A 1Z8NA 3GLRA 4WUTA 1L0BA 2Q7XA 2Q3CA 3AYXB 4U4AA 5CJJA 4LECA 4RVFA 2WM9B 4UHBA 2QTLA 2ADOA 3P96A 3L06A 4IGKA 1ZHFA 3F8WA 3E7DA 3C4VA 5KC9A 3ZE1B 4M1QA 3RYFA 1R66A 5FIUA 5KOYA 1AV7A 3KWFA 5DWDA 1K7SN 2QT9A 4BVBA 3ZE2B 9LDBA 2CL0X 3D7RA 4Q9IA 2WWIA 4MR7B 3Q72A 4PHGA 3BK7A 1F2UA 4WVFA 5KYWA 5CT5A 1WZNA 4EX7A 1KY5A 5GAJA 4HNQA 2IF0A 5JMWA 1YKFA 2X9QA 3N8KA 2UUCB 4GSLA 4MUAA 2WFAA 3FFWA 3A1NA 3FMOB 1ZXXA 1IN7A 1ZRSA 5AK0A 4D3ZA 3C3WA 4NULA 3DCYA 1YGPA 3LX4A 3RBXA 1GUBA 1TCBA 1IJEA 1RYBA 1W5AA 1DOHA 2QUKA 2VAXA 3NDRA 3AINA 1V7CA 2X5NA 1C9DB 3I2GA 3IHWA 5E9QA 2EZ9A 4B8WA 1U2EA 3IXMA 3N0WA 1UF9A 2HPHA 5HBGA 2DZDA 3W2FA 3VA7A 4IOJA 4GYJA 3AM5A 5FOQA 1SUFA 1EXDA 4B3MB 1VHTA 4KLRA 1YRQA 1PHPA 4KR0A 4Q9AA 1GPYA 2PR7A 5LIPA 4QLOA 5HUQA 2XDYA 4UAJA 3CUSA 2JBHA 3SX2A 1RT9A 5T4HA 1U2GC 1A88A 5I45A 2VYVA 2JKYA 1O87A 4KRFA 1E2KA 3FGOA 2HMSA 4M89A 3RGGA 3SBEA 4NE2A 3VTAA 1TAUA 3DMHA 2BKLA 1QFXA 4YQYA 2YIMA 1HUQA 3UXYA 4FLFA 5LNK1 3F7NA 1NU6A 2IIVA 1VI6A 1NF3A 1YS7A 3THSA 1MLDA 2CKMA 1DGQA 1DKOA 5IUKC 1EFCA 1T2AA 4FFBB 1BXGB 1VSVA 4S0ZA 3RO7A 3ZY4A 1CRLA 4IS3A 5ICMA 3TEFA 2QRUA 1GSIA 4RDXA 1AKWA 1FY2A 4R05A 5DB4A 4EWLA 3DLTA 4MIKA 3BMOB 2Z09A 1DARA 5IH7A 4F91B 1P75A 4Y2UA 5ECDA 2GVZC 2G7ZA 3UMMA 1WA5A 1TPYA 2E49A 1P1JA 4CEHA 2IHYA 4R4JA 3RS0A 3ZWPA 5DM1A 2W0SA 5HKLA 1NYQA 1UPBA 4QJBA 4P7FA 1V4BA 4BHTA 3R8CA 5LXTA 1EUCB 2POQX 4G1MB 4GRDA 5ELXA 4BUJA 5BT9A 3PTLA 3LHKA 1QVWA 1PFVA 4BNDA 2VHYA 1PF7E 1VE1A 2WJPA 3U3ZA 2IKQA 2OXTA 5A2QA 4H0NA 2Q1TA 2OVFA 1LTQA 2XSZD 1EDOA 1WIWA 3A3KA 2LIPA 2O4CA 3ANLA 2HK7A 3MWGA 3BG5A 3OJOA 3ROKA 1ZRMA 3FNIA 3K53A 4R1TA 2ZKIA 3V4ZA 4C4OA 2QZPA 4JI4B 3A6FA 2EGUA 1CY7A 2UUAB 1C1XA 4IQ8A 2E6KA 3SFVA 1DHRA 2JZNA 2GRAA 2EG5A 1ZH6A 4WJKB 1Y1RA 5F76A 1XDWA 3R5SA 3OAAA 1NVXQ 2DWOA 1OWLA 2B34A 2B4YA 4F4CA 3LQQA 2BHTA 2OPHA 2VDVE 1Q77A 1OZ0A 2DBYA 2VJMA 4TXLA 1QIGA 4MJLA 2PQMA 4RKYA 3R8FA 2HYIC 5KQGA 2C7GA 1CR0A 3DZBA 2CDCA 2HMVA 2I8CA 1PGJA 2ISSD 3EUEA 2ZSIA 3ZBQA 1NV8A 5ESRA 2R85A 4QOSA 2K7ZA 3VOTA 3AJEA 4GVLA 3W9BA 5D6NA 1ZSVA 3GDOA 1L1QA 3GEHA 3GT4A 2Z4RA 2GAAA 3LYAA 4KQMA 4MHOA 4PIMA 2VBIA 1L5MA 1MA3A 2Y71A 4D82A 3T52A 2W6IA 3DB2A 4E51A 2V4UA 4F4FA 3A3YA 3WYFA 2OD7A 1KMIY 2DJ5A 5FLYA 1W8DA 5EOVA 3GAAA 1BC5A 1AF7A 4OQPA 4I4TA 1DIHA 2FF7A 4LGCA 1XIVA 1GLVA 1TMKA 2W6JD 1GTRA 3OLVA 5EIEA 2JJ1D 3RLIA 2BDTA 5EJ9A 2FWPA 1AVTA 1UXGA 3TVDA 5CM2Z 4LWZA 4XARA 4XASA 1RE0A 3K0BA 4R1QA 3T94A 5LMZA 2HWKA 1VGVA 3NONA 3H1TA 3AJRA 5GPBA 1TYAE 3KV1A 4JYBA 2QTAA 3V7YA 2CXTA 4A1OA 4F4DA 4P4SA 1JRLA 4G0WA 3F97A 1GPMA 4M1TA 5SY9A 1TJ4A 5IJZA 2MSDB 1T3ZA 2BZ0A 3K05A 1N78A 2QTGA 1RXYA 2DR3A 4DIMA 2FSSA 2CVZA 1X1BA 4MVJD 4UM7A 2IEBA 3ZCTA 1PJRA 1T4DA 1H94A 2FP4B 2Q4DA 4OJYA 4JIGA 5DWQA 5F2OA 2AQKA 3EQ6A 3BWMA 1OXMA 2BEWB 3DOEA 4IV0A 1S3FA 4HV4A 5HFNA 4L4SA 3WHIA 2HK9A 4FR2A 5KVVA 3PQEA 3MINB 3T0FA 1LTHR 2RJ3A 1YRLA 2JFYA 3O91A 1Z2AA 1FP4B 2ZRGA 3FYUC 4GL4A 4DQ0A 2O5EA 4M22A 3RBZA 1SXJE 2O06A 5ALTA 4QTTB 1R0YA 2QN6A 1ONPA 2NT4A 3BIFA 3IQGX 1H8HA 1HLGA 3CZCA 3L6DA 4RULA 1LTKA 4MQEB 5H16A 3AG5A 3NRCA 3HKBB 3IPAA 3O8QB 4KBGA 3USCS 3KKMA 4ZOBA 2PSSA 1G8MA 1ZBQA 1SHZA 2DLNA 2HEIA 4R1PA 4L0QA 4U63A 3T9EA 4EB0A 4M9CA 3AJ9A 1P1RA 2NT3A 2E55A 4B3XA 1XQYA 1T91A 4XIFA 5E7MA 2K4MA 3O84A 2FY8A 4HMOA 5CK5A 3TTVA 4C6TA 4KHPB 1CUFA 4DCSA 1PNVA 3MJHA 2HWYA 1B76A 1RPJA 3ZE8A 2OV4A 4XYGA 2A9FA 1KEEB 1VL5A 4JI0B 3GH3A 3HCDA 3QLEA 2I5PO 4IIVA 4UMEA 4D4JA 3NUZA 4LYDA 5AW2A 4FNGA 1O4WA 5HSGA 2AUMA 5KMGB 3PUKA 2XB2A 4NEHB 1N36B 3WSVA 5AVZA 5KNBD 1T8WA 2YH2A 1N0IA 4N9QA 1CRWG 2IH2A 3ZHBA 1M1XB 1RU3A 1QHFA 5AYVA 1XRJA 2WB4A 1SZCA 3U7EB 2W2PA 5L3QB 3A58B 5CEJA 4BATA 1IWPB 2OG1A 4IKEA 2H1RA 2F1OA 5SZKB 2ZJZA 1N5JA 1MEJA 2RGRA 2JF0A 3OFSA 1HTBA 4AWAA 5KWSA 5B1IA 3ZXIA 1KZGB 1XJ5A 2Z1DA 1HE1C 3P27A 5FNVF 3T5CA 3PHCA 5B2FA 3WGNA 5J2TB 1EUDA 4WN3A 4TLEA 3O9MA 3RARA 4AJ4A 4S04A 3OBIA 4GRIA 4ZXPA 3TW8A 1GTJ1 1PEKE 2BEKA 3CSDA 1F8XA 1RFGE 1BH2A 3MSCA 1ZSNA 1JLMA 4RVUA 4YCMA 2GRUA 3RJMA 1ZU5A 1GKIA 4DCMA 5BWOA 2QVBA 4EMBA 1Q95A 2K2QB 5JE8A 2OGZA 3ZYCA 4FFRA 3SBDA 1RJWA 5EY5B 1QV6A 1E1RA 2G9RA 1YUMA 2QLFA 1ZM7A 4QTZA 4HN2A 4JQOA 4EFLA 4JI7B 2DSTA 2EBFX 2P3LA 2PX0A 3BGWA 3EPPA 4JX8A 3K5WA 4A2WA 4F72A 1JLRA 4K40A 2B61A 2A9JA 3TW0A 1CRPA 2VDRB 4MVJA 2AF3C 4RY8A 3GZJA 4DC1A 4GE3A 4CQMB 3FCXA 4QGHA 3SXUA 3VR6D 3IUYA 4RKWA 4CF6A 3JQGA 1U3GA 2BJVA 2GASA 1NBOA 1WD5A 4TWZA 3X43A 4BLQA 4C7JA 3Q9UA 4EAAA 4KNWA 2REXB 5BNIA 3BSFA 4RV4A 1ZUD1 1U1DA 4KAXA 2CDBA 4NCJA 3H1FA 4B3BA 1NXSA 4LXUA 3ABSB 3ED5A 2PGLA 4ESVA 1SZDA 1E5QA 5KYKA 2QLLA 5H9VA 2LWIA 2O2IA 3AY0A 3IV6A 4EY4A 3KYDA 3HBFA 2V54A 4CN9A 3X1WA 3SR0A 5JANA 4GH5A 2YV4A 3AZQA 1RKUA 4C01A 2PUWA 2PX2A 1Y5IA 5H3HA 5AVSA 3BL5A 4H17A 2VT3A 2AS0A 3DBHB 1QAOA 3GGJA 4OFZA 4W5WA 4QYTA 2AN5A 5IVIA 3U9SA 3QXSA 1MO5A 4M1SA 4EG7A 4KREA 3HPQA 1BA2A 1JQDA 4L5CA 4BVLA 2UYHA 3MD0A 1DIAA 1EVZA 4QOGA 3TQQA 1DCFA 3MAGA 4E2WA 4OH7A 3V7WA 4ZZ3A 4GU5A 1WHSA 4BTVA 1W2HA 7GPBA 1YBHA 2P9EA 3AVUA 1P6XA 4MQ6A 4ESEA 5TSDA 1ZIOA 4H1VA 4Y6SA 3EIOA 3GUHA 3O2QB 1PJZA 4YUZA 1AGXA 1XZDA 3G2MA 1O95C 3QVXA 5NULA 3TSZA 4E2FA 3KSUA 2QL5A 3SN6A 4HS9A 1T4MA 2OCPA 2H5EA 3GJXC 2QW1A 4P34A 1BCRB 3RPEA 4D6PA 3ZHOA 2GDJA 2PAAA 3A2LA 3N53A 4IMIB 5ED4A 1A5ZA 2WSBA 2E6UX 2ZPAA 1K68A 5CGZA 1K0UA 5KREA 4WGGA 2UXCB 3EHEA 2J3IA 3FPKA 3K0EA 5FQOA 3ZXUB 2X23A 5EP1A 5HVNA 5BT8A 1BWPA 4IGIA 3D6VA 4GEKA 5DH9A 4OLJA 3DS8A 1YQUA 1U11A 1VSTA 1L5OA 1H9CA 4MJXA 2MSNA 5FHRA 2CYCA 1C4WA 1OI7A 1ONOA 1U5AA 2OHOA 2DQZA 2WFZA 4GMXA 4P3OA 1LPMA 4Y2PA 1L1EA 3AB3A 2QENA 3LUCA 3I2HA 3WZ2A 2QPLA 4LJRA 1F0YA 3KD3A 1J2UA 2VDWA 1U80A 3QF4A 3EVNA 2I34A 3JVDA 4YMUA 3VNVA 1RYDA 3VX4A 4ZCMA 3EVTA 1T2FA 3AOEA 3DE7X 3DL2A 2EKPA 2FW8A 4V03A 4YT5A 4I99A 4IAOA 3R40A 5IBRA 4A8JA 3C4QA 3R5FA 4YT2A 1VPLA 4RTJA 4YHHB 2IX3A 4RVSA 1Q0ZA 2H0RA 2YX1A 2WF9A 3MWEB 2X0EA 4DM7A 3DNFA 5AW0A 1WPQA 1N2OA 3GUVA 3MGBA 3EF0A 3NNNA 1ESNA 3LUPA 2KYRA 1EWTA 2Q6OA 4JQZA 1I4EB 3NHZA 5CPFA 4HXFB 3QVVA 2IGBA 4ER7A 2RE8A 2GBLC 3EEYA 1C80A 1FPQA 1I30A 1Y5NA 2FPPA 1QIIA 4YJDA 1N9ZA 3IJ5A 3A04A 3WLOA 1KVQA 1ZMRA 5FWAA 4BB0A 4DLXA 1N34B 5F64A 1A8QA 4QPNA 1Y1SA 1QHHA 4UHFA 4ARBA 5AJWA 1G4UR 1FS6A 5ER9A 5J3JA 4OJMX 2XUZA 3G9QA 1GN8A 4XDHA 3VR0A 4BWVA 4F93B 1WXFA 3DM9B 1BFUA 4KSYA 2VPZA 5AW3A 4JJIA 4NHOA 1X7GA 2JGRA 2YXEA 2FZGA 2ZVDA 3NHUA 3PSAA 3A7DA 4YMIA 1KDVA 3ETGA 1ESMA 5SYNA 1T9DA 1NVVR 1QQTA 3A6EA 1B8PA 3ZLVA 1SKAA 5KI6A 4FU0A 4NXMB 4AQ7A 3GCDA 4WK4B 4D4HA 5E2AA 4DJTA 1IOLA 2WJ6A 3GNSA 1HT1E 4MS4B 4W5RA 1PKXA 5FWNA 3CX4A 1JFFA 3NHKA 4MICA 4CQMD 2CNBA 3A6DA 3JD1A 1XJ0A 1SCUB 3RRBA 3U80A 2F64A 2X0IA 3B7PA 3OTWA 3ENWA 3DKPA 4PLHA 4G81A 2YWHA 1CUJA 1GITA 3L8CA 1KEPA 4TQGA 2HLPA 1K8YB 4X1YB 3ZD9A 4R2MA 4B6GA 1R4NB 2I3BA 1ZN7A 2CUTA 3L0SA 4BPRA 4ZI3A 1TF5A 1WMAA 1G8FA 1W5FA 4EG8A 2I2WA 4MPJA 4MV0A 2Y3IA 1FTGA 1ID1A 1RAHA 4A6XA 4BX9A 4YIHA 1JB1A 4URFA 1W581 4V0ME 4MW2A 2ST1A 3WHKA 1VIDA 4N49A 4EG1A 4DKJA 4ZICA 2EEPA 3CA8A 1Z7WA 5A03A 1PSWA 1JVBA 4U7FA 4BP8A 1WY5A 4WTOA 3BH6A 4ZZ2A 3PEWA 3BT7A 2IU3A 2GHQA 4KPFC 1H69A 2I2DA 2QYSA 2WJYA 3E2MA 3ETCA 4IFBA 4KXWA 4YAIA 1LX6A 5JU6A 4FYXA 2W7TA 3Q5EA 4QG3A 4NXNB 4RSGA 7REQB 2HQRA 3QOXA 1Z26A 4EB6A 2YYAA 4JROA 1N6PA 4ZYTA 1UMCB 2AC7A 3GIWA 4NYMR 1Z39A 1NN1A 1W75A 2F59A 2OXEA 3G49A 2Q4RA 5EXXA 5DYGA 4O2AB 4ENUA 1W34A 3W9UA 4HCJA 3R5KA 3DQZA 4MDEA 2Y76A 3A4TA 2AQ8A 3FPBA 3W8DA 2V65A 3CF6R 4PINA 3TZCA 5CDUA 1VFPA 5KIAA 2Q1WA 3K09A 2JK0A 3KVOA 5AHKA 9LDTA 4JJ6A 3A1UA 4WERA 5FEUA 1L4MA 1OV6A 5CFOA 2EATA 1SUWA 3EQ9A 4TV8F 4TUYA 2GZ1A 3PJFA 4RETA 5B7NA 1YRHA 3SZ3A 1J49A 2J9ZB 2C88A 3DBHA 3EYAA 4Q01A 2A1TS 2Q1YA 1XZBA 4Y6PA 1K75A 4I08A 3P4YA 4D7AA 5GOZA 1JPNA 4JUIA 4MEJA 4UM9B 2F1RA 2FA9A 3GJ7A 4WFKA 1UBOS 4RHTA 5F5XA 5HBRA 5DCLA 1O8CA 4YJ2F 4GMFA 4ZJUA 2O8EA 2OCXA 3QWIA 1DEHA 3KDAA 1T8TA 5H5JA 2DT5A 2XBMA 2WUFA 2EJTA 3OZBA 5JBQA 2HYDA 1P0CA 1WP4A 3NHPA 2H07A 3OA2A 4HB0A 3N07A 1INLA 3LBFA 2SCUA 4CUKA 4CM5A 2D2VA 4DLSA 1EI9A 2UKDA 1ISFA 4LZNA 5LKAA 3F3SA 3FRIA 2OBNA 4EPTA 2A5GA 2QD5A 3H1AA 5DHFA 4QAJA 4CKEB 3E5MA 1X8XA 4O2AF 4LY6A 1Y8QA 2EFGA 2GA8A 1K4MA 1VLQA 3IOMA 3VQTA 2QJOA 3BTUA 5HE8A 4JP2A 3RDPA 3VV2A 4CLDA 4N3GA 1FTNA 1L4KA 2XQGA 4BFLA 3AP1A 4HDQB 2CB9A 1GT6A 3QBTA 4E46A 1O6FA 2ZDGA 4ZU6X 5JAPA 1XRNA 4LUCA 2D4AA 3D59A 1QIEA 3FWHA 2ZYHA 1KQNA 4H1WA 3AUTA 1KJZA 3DXFA 2JLUA 4UOZA 1UC8A 1X7WA 3BJIC 3L79A 3U3KA 2HHHB 3A1VA 1EZ4A 4D8XA 2IS6A 3AL2A 3RIYA 2RC6A 4EJ0A 1ZPDA 3HP1A 2FVXA 4X60A 5J4HA 1NX9A 4KIJA 3MHTA 1DO2A 5EA2A 4QHTA 4AN0A 3BK2A 3JYHA 4MYDA 5KKCA 1I36A 4KL8S 3ICEA 1NX6A 1R0BA 5LQMA 4DV2B 1S01A 1MUUA 3Q8XB 3HQ4O 5FPTA 1CIVA 1G5FA 1SXJB 1T2UA 1BCSA 1XZQA 2HDWA 2WJVA 3C15C 4P08A 2F8TA 3SC6A 1Y6ZA 3AVXA 1F6BA 2PMBA 3TX2A 4NE7A 4PWZA 4LF8B 3N2KB 1SCNE 4RD1A 1UMDB 2H4XA 4HNHA 5E3JA 1QE5A 3FMGA 4D2IA 4H6XA 5DSZA 5COQA 1AUPA 1CUAA 1CY8A 3GARA 2BW0A 2VQ6A 2ZR0A 3B6JA 4V0KA 2M1XA 2Q2OA 3ENQA 4UCFA 3USZA 4EJSC 3FOBA 3IFSA 4CU5A 3QYPA 4ZK6A 4LMBA 2F8SA 3FSRA 3LW8A 1UODA 1VZ2A 3W6UA 2BFOA 2AFHB 2R62A 4URVR 5HDQA 1ZOLA 2O1XA 2V1XA 1A5SB 1SU8A 2PYDA 3U4IA 3EMDA 4LSMA 4X0EA 5HMMA 3VVCA 2AX3A 5EZ5A 3B48A 3BQNB 3VPFA 5C8XA 3IAM1 1XHFA 3BMNB 3GIDA 3TJRA 4CI9A 1IZYA 2O2HA 4YECA 5TF0A 1L8OA 3OKPA 2WJGA 3HXLA 1NSTA 5GGYA 3STTA 4CLRB 3V8NA 7MHTA 1BFDA 3K2IA 1P4AA 4DR4B 1C1DA 4HZGA 4TWAA 2IW1A 2AKEA 2PUCA 2FUG1 4JEUA 1ABEA 1AB5A 2Q6LA 1YB6A 4EFDA 4C21A 5FBRB 3TIGA 1LI7A 4LJ6A 2WK1A 3NFYA 3ZQ4A 3W5JA 4V1CI 2AVDA 2PYZA 1Z74A 2WA1A 3M5PA 4J1NA 4TV8B 2NUPA 1NQUA 2XXAA 3IP5A 4MA5A 3TR6A 4LK3A 4G0XA 4HMQA 4Y6LA 4DTCA 5CD1A 4PYKA 4M1OA 5GVRA 3M6WA 4O08A 4UBIA 3E0QA 2R5WA 2C8JA 3BHIA 2ZT8A 2YQ5A 4QULA 4JLUA 5EHZA 5ARBA 4HEQA 2GUWA 1E92A 3B1XA 4M0KA 1S3IA 5EQJB 3VR2D 3MOGA 2E2WA 5AHWA 1PLLA 1QCCA 5GM2A 1N3LA 1M2OA 5CM9C 4QWMA 3CN9A 3SQNA 2XWSA 2VNHA 4ER5A 4HWOA 4KUGA 4XCQA 2R1ZA 3KSAC 2E21A 4O4HB 2J0SA 1JDZA 1XHLA 2G0TA 3B52X 3BRWD 3OSUA 4HDSB 4TZKA 3QXXA 3JWHA 3ZBUA 1F2UB 1NMZA 3HK2A 2DM6A 2PXAA 1UBMS 5C8YB 1ENOA 5C8DA 1Q17A 3CQ9A 3K5IA 3O4RA 4AECA 1V6AA 3GCXA 2AEEA 2VAPA 3E1GA 3I45A 3OC0A 2VPQA 4YAKA 3KTAA 2C4TA 4WNAB 2NTJA 4WXPA 2CYAA 4K26A 5ALKA 4RZ3A 1X7ZA 2QX9A 3C7KA 3C2QA 3Q3VA 3E22B 3H2IA 3K6JA 3C45A 1R15A 3KALA 1B41A 3PNOA 2O8FA 1R3UA 3KSDO 4MW1A 1EHIA 4NEGA 1ZIPA 3HB0A 3TNJA 3TZLA 3I30X 3K71B 1ECGA 5EYPA 5IF9A 4B6EA 5FTJA 3OZGA 2ZROA 4IYRA 2YVKA 2SBTA 2AOTA 1HQKA 3CO5A 3HLTA 2NSDA 4J0IA 4EGCB 1VPWA 4RJLA 3C3BA 3DGEC 4AW9A 5KO2A 1JMKC 4PRZA 3HDQA 3ROZA 3VPHA 1MEEA 1PS8A 4L95C 2BM0A 3UWKA 2AXPA 3TM4A 4JEHA 4RA6B 1YQXA 2ZCUA 1FDRA 1SHTX 4RTMA 2VJMB 1A7AA 4XB6B 4RUKA 4AZ3A 2C5AA 1XKXA 3KTFA 1KNQA 1KIMA 4M6WA 4CDRA 5HZGA 1BX1A 4PZYA 4B34A 1OZFA 1RBYA 2I7DA 1O4VA 2RK4A 4D1YA 3PNYA 5ECGC 1TCUA 2CXSA 1MW8X 1Q0LA 2VF5X 2PMEA 1DJNA 4WKGA 2AE2A 2WJJA 4MB6A 3EQ8A 4K1LA 4UHKA 3S29A 5EKUA 4MARA 5AH0A 1P7YA 4FT4A 1QIDA 2XXBA 1JHRA 1L7VC 1YZGA 3EEIA 1ADYA 3FPHA 3H3XA 3P9CA 4H7IA 4IDAA 4N1AA 1T36B 3MT0A 1EA5A 2FSVA 3H5VA 4MRAA 2XZPA 5KHAA 2HA0A 3OPYB 2FETA 1WG8A 1BRTA 5JDCC 3GRCA 3D9QX 1HDEA 3GJ3A 4HOYA 3VNBA 3MIZA 1B43A 2P2SA 4JBHA 1JG2A 2ZSFA 2WINI 4US2R 1OILA 4RELA 3V8MA 1PZNA 2BD0A 2V5UA 4HADA 2R48A 2QRKA 3CBGA 4L4ZA 3HN2A 3DDWA 4Q12A 1QYWA 4XWTA 1N7JA 4GX1A 5ICGA 2H3EA 4ON9A 4EA7A 1SQ6A 5KWVA 1G2IA 4Z4GA 1AXEA 1H23A 2RH5A 3BJMA 5JATA 1U5BA 3DZGA 1JILA 4URUR 1YB5A 4F2HA 3GFPA 1U3WA 3RU7A 2C3OA 3L7JA 4IOKA 1OW3B 1UBNA 1VKZA 2CKDA 4K8RB 2RGCA 1K7YA 3CZPA 1QOZA 4IHKA 4OHBA 4UD6A 3QSGA 4WN9B 2C4WA 2NUTB 5HJ2A 4PZLA 3WL8A 3ZX4A 4D46A 1J7JA 3M2TA 1F8YA 5MN5A 1RCFA 4CEIB 3KYCB 4YV2A 1RRGA 3C6YA 3E3OA 3IL2A 3INGA 1GEGA 5E6RB 1T2DA 4L0MA 1C9KA 5DTJA 3S2EA 4C0SA 1TJYA 4AF7A 4F3KA 4ZC8A 1DAOA 5HIMA 3QVGA 4QXPA 2I1LA 1IN4A 3G0BA 1L4HA 4GOJA 2KBEA 3TYXA 5K0CA 1SXPA 3WNCA 3C3DA 1ZRHA 8LDHA 1U7ZA 1NW4A 1Y1TA 3BD9A 3K9CA 2QRHA 2IWRA 4QEZA 3TKYA 1EVLA 1U1GA 1XD2B 3C6KA 2V6IA 4K9MA 4YPFA 1Z4QA 3KQQA 4DN6A 3K32A 4P5PA 5BSVA 4LZPA 1XVUA 2GCPA 3ZV3A 1YL7A 2XAUA 4N82A 3ROEA 5I9IA 1OXXK 4FR0A 1G4AE 4WRRA 4P1ZA 1U4SA 3MLEA 4A5SA 4E5PA 5LQRA 1YXMA 3K1YA 1ZMOA 2J30A 1XMIA 1ZUNA 2C1ZA 1CLUA 3T1HB 2QEQA 2RCYA 2H7CA 3H5LA 5EPEA 4NAUA 5K0GA 4ZVOA 1QDLB 5BSKA 2W6OA 5G4KB 4I50A 2OAEA 3EFOB 1XWIA 1KYQA 1V4NA 1YZQA 1OWNA 1Z37A 3QFFA 3IDZA 2PMFA 4QXRA 3FN4A 4UCXA 3ZU4A 1NQVA 5SY4A 3N2NA 4P2BA 2J3MA 5A4KA 2P3QA 1KHHA 1PHRA 4P9NA 4XLLA 3I2JA 4JJKA 1ULZA 1RC8A 1F4PA 1I6KA 4LK2A 1SUSA 1TRKA 1ZXLA 3D4PA 3O5AA 4Q34A 1M76A 5AJUA 3QHQA 4XM2A 3RVNA 4R16A 4MR7A 3P2OA 3C97A 3W5UA 3KCQA 4LVOA 2B9VA 4OFWA 4H7PA 3FKQA 3LZ6A 4CGZA 1AF4A 4RPCA 4RJ2A 1E7QA 3HP4A 3WRXC 4ZZ1A 3ZJTA 3SZGA 1N3BA 2HQ1A 1Q19A 1WE2A 2BP7B 4G0MA 4FYMA 4H18A 4HRYA 1ZH4A 3FE2A 5EHIA 4ZMSA 3SKXA 2PS0A 1QP8A 2QMQA 4KIGA 1YK0A 1X1EA 3IQFA 2JC3A 5J40A 3LUHA 4DNQA 4LJ8A 2BZGA 3DP9A 1KVTA 2BDUA 3LCVB 3LGXA 3PKZA 1AXGA 3CW8X 3CZ9A 3FNEA 2ZVPX 4KUEA 4MW6A 4TN5A 2I7XA 5FF9A 2X2OA 5BNFA 4DV5B 5HQJA 1K9SA 3U3XA 5HIJA 1SBCA 1UC5B 5EJ2A 4ZCPA 3WHLA 2RGAA 2IPAB 3CIFA 3ZI0A 1J0DA 1KMHA 3EDCA 1WUKS 3ZHXA 4F6LA 5ALVA 3ZS9A 3V00A 2XUPA 3BXHA 4TL9A 4ZQBA 4BB6A 1O3YA 2B8NA 3C24A 4LRWA 1II9A 3L0PA 1A2QA 3COVA 2IZ6A 2PUEA 4Z4EA 4Y9TA 4A1FA 1ZX1A 4F5ZA 1EGVB 1GNSA 2ZYVX 1O96A 1UM9B 1I4OA 2IDKA 3I8XA 1KEEA 4ARIA 4UBLA 3I61A 1YTLA 2PJUA 4ZT2A 4BDTA 5ITZA 3T34A 5HF5A 1WBBA 4ICIA 2ENUA 2QTNA 1U0HC 3UZUA 1IM2A 3FF1A 4HY3A 1ZM2A 1DFGA 4RH0A 3BWBA 4RK0A 4AY4A 3TTYA 2JGKA 1V6SA 2Y1EA 4JQYA 3IUNA 5C1BA 5JFOA 4YMLA 1YASA 1W4LA 4ADSG 2Z4TA 3COSA 2FN3A 2F7SA 1NW6A 2D7CA 2VP9A 3H3FA 4W7SA 1RXIA 4QU5A 4YS6A 2H16A 1GRQA 2AB0A 2CJWB 3PCTA 3CWCA 3SWWA 4Z4HA 5EJ7A 4BNXA 5JCZA 4MWTA 1P1CA 5SZIA 4LOLA 4HNUA 2EKBA 3E2PA 1PVOA 1ZIDA 1SQGA 4XB2A 3A25A 3AM4A 5J5AA 1H1LA 3K0CC 3STVA 3B78A 1RC0A 5JSZA 4WBNB 1JAIA 4L15A 2QTVA 2HV8A 2K87A 2O2GA 3BQ9A 2WTAA 4UVGA 3ZD8A 4YCBA 3HNPA 3K5PA 4E5UA 1KVRA 1QTIA 2JL1A 4HR7A 4TTPA 2F9MA 1JIQA 3PFIA 1R16A 4ZGGA 3NIWA 2FMFA 2ATXA 5DHAA 3KPJA 4M1YA 2ZIXB 3VVLA 3IMKA 1A0OA 1EXWA 1YOVB 4M46A 3EAFA 4KSBA 3KEGA 3WQHA 4HVLA 1TW2A 1BMQA 1WMSA 4LVNA 4Q24A 4OBWA 1WPGA 1FNSA 3CS3A 4R2HA 4IH1A 2BISA 2ZUVA 2O2XA 4I1OA 1IHOA 4AMYA 4YCAA 3TRHA 1X7XA 3X1MA 5MDHA 1CZLA 2JD1A 3FWYA 2Y9PB 4AWXA 4EENA 4PSAA 2OXFA 1XZIA 4F6RA 3CCBA 3MCAA 3B5JA 4QT4A 2BMAA 2HREA 4IDCA 2NN3C 3LQYA 4NBKA 3BB3A 4DMKA 1TM5E 4DW8A 4C3OB 3KP1A 4M0PA 1I3OA 2OENG 1LWNA 5EJGA 1KYVA 4EY7A 3SIWA 5KNDA 1MH1A 1UT6A 1GL7A 4A8HA 2H08A 3PTAA 3ROTA 4KRGA 3IT1A 2HKIA 3MCTA 2LW7A 1XZFA 4B83A 4ER0A 4N48A 3ZWXA 5SYAA 1MQ9A 4Q4JA 1FRNA 3DO5A 1X6VA 2XSZA 5F77A 1BWSA 3S40A 4AY2A 1G7RA 2WF6A 1YQQA 4JWTA 1QP0A 1KK1A 3QG5A 5AVKA 4J2OA 3UO8B 1FNDA 4E5YA 5FUQA 2P2ZA 4YR7A 5ECYA 1XRSB 4TUYB 4DCTA 1ENYA 5A4MS 4NF2A 5JYCA 3D4LA 5ESXA 4C9BA 4BRUA 4C5AA 2ORED 1U9JA 3EEQA 4WNCA 4XYBA 4BE4A 4R6XA 3DE3X 1O9HA 1Y1KE 2NX2A 4NYJQ 2EWMA 4AMBA 2IPOA 1KJQA 4D44A 2UYYA 4BL5A 3RSQA 4YRPA 1ZQ1A 1FUIA 2ZJ2A 4YRJA 5TEVA 3LNCA 5LZ4A 1ML4A 1V6CA 4FD2A 4QYXA 1J7KA 4JLNA 2FE4A 1GGFA 3Q8MA 2FPIA 4MVJE 4C20A 1CX9B 3I6ZA 4Y2XA 3AH8A 4KMOA 1FMTA 1USVA 3JY6A 4EPWA 1MTZA 2BFCB 1XEAA 3GEGA 2XH8A 5CURA 2YV3A 1ATZA 4QYMA 3EUWA 5ALDA 3UK7A 4CTOA 2IBSA 4RXMA 4RYLA 2BH2A 3NETA 1E9FA 2JI4A 5AK3A 4BVJA 4MWZA 2Z6UA 3N8HA 4BCBA 1HI9A 5BY2A 4U0KA 1MF7A 1LSJA 4F5YA 2R8XA 1IZZA 2B37A 3OKCA 1G8SA 2FOLA 5EUQB 1D5CA 3DDSA 1R5BA 3N28A 4KI0A 1O95D 5ITVA 5JSYA 2VPYA 3L2OB 4A91A 2PIDA 1Z88A 1OYOA 2GEKA 2W6JA 2F6RA 4ROTA 4N8DA 4WOBA 1P4HA 2N1MA 5EWMA 1HX7A 1DTEA 2JFPA 2B4RO 2FHSA 3GPIA 3TRKA 4NOMA 3W77A 5KJEA 2ERXA 2WHEA 1B6TA 3HRHA 4C30A 3CURA 3JCZA 4PZPA 2IGTA 4RAOA 1X15A 3O90A 3RNOA 3IURA 3ELUA 3GJRA 4FE4A 4E0BA 1ZD8A 3DMYA 3TQSA 4YB8A 3WLJA 3C6MA 4Q1CA 4GP7A 1T8UA 3WLTA 4D8UA 5JEEA 3WGQA 1F38A 1NMYA 2Z56A 4N01A 4E6EA 2BGTA 3D8NA 4HYQA 3IIMA 1LWOA 5DXAA 5EHGA 5ILGA 3S5UA 4DEXA 5LQUA 4UOEA 4Y6RA 4AUKA 5B7GA 5ILQA 2NTEA 5TARA 5CU7A 4DWVA 2HLNA 5HTOA 2FRXA 1TO1E 2VZ8A 1BCSB 3HI6A 4BFYA 2YFYA 1UOOA 2ETVA 2H54A 3OLYA 5H3LA 4EO4A 2HCJB 4BLTA 4AQDA 1NBME 3UT5A 3R76A 2AZDA 4QDTA 4WKNA 3OCJA 4DSTA 2Y1FA 4HWRA 4DA8A 4HMPA 3PUHA 1BE6A 3QX7A 2C0PA 3GOQA 4JUDX 1Q3HA 1T25A 3OVMA 4MDHA 1B0AA 1GKUB 1ZK0A 3TBHA 3ZWVA 4YAWA 4IEIA 3L7DA 1FDTA 4AX8A 2CN1A 4FMPA 3MWDA 1H5NA 5ALFA 5J63A 4A0GA 4YCLA 5JY6A 4K86A 4UM9D 3NWJA 4PTZA 3CUWA 2DLCX 3UPTA 1DTSA 1OXVA 4PY2A 2Q1XA 3ETNA 3ZZMA 2I6XA 2QUAA 5DX1A 3PGXA 3FVRA 2CDRA 3OCZA 1GZ6A 4L50A 4KN9S 3CNQS 3SMQA 4JS0A 5KYUB 2CMFA 1V16B 1XKLA 1YU9A 4V1CA 3QLJA 3DTTA 5CT9A 1T0IA 2GHTA 1NJGA 1I32A 2NSYA 1NXXA 3EZNA 4FYKA 1GZUA 1LBQA 1YS9A 2DPLA 3D3WA 4XX1A 3U7QB 3T7AA 3F46A 2X7JA 1GNVA 1QV7A 3FVWA 2AUTA 2RGWA 4U7GA 1PNTA 3W5VA 2RAVA 3UMYA 2ZYIA 4V02A 4LYFA 1LPPA 4KC0A 4GYKA 2PLFA 4C29A 5AVTA 4KQHA 4ID9A 5JCXA 4WLOA 3KC2A 2YYSA 2FLWA 4RPLA 4DGSA 2E9SA 3O8RA 1PNQA 3ZCRA 5JSZB 5FLEX 3N3AC 4Y67A 1CEQA 1D2EA 3EOAI 5D3KA 3I01A 5HM8A 3DJYA 1UBEA 5E0KB 4FFOA 4LEIA 3SS8A 1DBWA 3M1IA 5TS2A 1T3SA 5AP9A 1QIHA 1NVVQ 2ODTX 4AU1A 4BVGA 4HNSA 3UNXA 4IXWA 4OMUA 1GAJA 4BV2A 3WVNA 3ZDYB 3D0OA 4FGKA 1MT3A 1RHJA 4YLGA 2YIVX 3PNPA 5CW2A 3F1KA 2JCXA 4NCKA 3B6MA 3UK1A 1COWA 1VLZA 1YS1X 4TTQA 2F43B 2PKXA 3GLHB 4G8JA 4RPHA 4V38A 2PAFA 4XI9A 3DBRB 4IDOA 2HF9A 2Q4TA 1E1CA 4GMDA 2FWMX 1RM5A 1SVMA 2PN1A 2PTHA 5EL0A 4DUZB 2XGMA 1Q7GA 3EXG2 3JQAA 1B93A 2PJZA 3I76A 4C14A 2D5IA 3II6X 2DUJA 3WGOA 1OKKD 3QUSA 4PLZA 1Z5PA 1IEWA 2Z1NA 2QMEA 4XEHA 1NATA 2W4IA 5F5LA 1NYTA 4K9SA 3I1FA 4GVPA 3IJPA 2XA2A 4M86A 2WJZB 5J4YA 4GKAA 1AY0A 1E3SA 1DE0A 1TO6A 2QSZA 4CTMA 3G59A 3USES 1A95A 3EFEA 4OU4A 2HIHA 4YAEA 1EVQA 3CR8A 1DBSA 3RC2A 1M0TA 2G72A 1GAEO 1U2DC 2EZTA 2NXCA 4S12A 1T3GA 4TGLA 1KI6A 1TNDA 1XTJA 3DFFA 4MKRA 1JFSA 1WLYA 2JVIA 4B1FA 4E5VA 3B2NA 3WY9A 4GI7A 1SC4A 2CLCX 2ZK7A 3O3CA 5TQJA 1WV0A 2QIPA 3G7UA 3IEUA 1AD2A 2Z95A 1E2FA 1P33A 4XD7A 1FJXA 2VQSA 3JATA 2GCOB 4JELA 4BMYA 2IPMA 3G1WA 1HBJA 1NR1A 2FMHA 2NADA 2IZZA 3FNBA 1O94C 2FZLA 3LX8A 1L5ZA 1GYPA 4DA7A 4N7JA 2FU5C 1TPZA 2HF8A 5JZVA 4B2IA 3BTOA 3DMDA 4C06A 1KMQA 1OLXB 2VP5A 4L02A 2V7TA 2QL7A 3RSSA 3M6FA 4Y6GB 1EWRA 4MZXA 1UJ6A 2JBAB 1GG9A 2D13A 1ELOA 2PXHA 4D9GA 4LDQA 4WZBE 5FYDA 5U4QA 5B3JC 2AX4A 1I2ZA 3AHFA 3ZH2A 5F9FA 5HFJA 5CB4A 4TV9A 3TUZC 1JQJC 1SOWA 1XNJA 3KQWA 5EWMB 1W0CA 1QHSA 1WEHA 4JITA 3KVVA 4YBRA 1PJAA 2AZTA 3K8QA 3D6TB 1KPHA 2XT6A 1A9TA 2IV2X 3JQ7A 4E14A 1C7RA 1RAEA 1OAAA 3I6YA 5AI0A 3I1JA 3TB4A 3OEYA 1R2QA 1OLSA 1PT5A 2B20A 1M8KA 2HD4A 1DCMA 1XG5A 2G17A 2JGEA 2PZKA 2WU4A 1V9SA 3AKDA 3AHGA 1LDBA 4FW9A 1QTQA 3HJRA 4IGAA 1NQAO 4L6AA 4EF6A 3NTOA 3NKFA 2D8AA 5BV7A 2YZ2A 1SCBA 1Z06A 2P9FA 3BGVA 1G5RA 1XZNA 5DO9A 2D7DA 2B69A 5JJKA 4F86A 1UDXA 3UGKA 4MQMA 4CR6A 1E9DA 1UQUA 3NNDA 2HWUA 2COKA 4KXXA 3MTBA 2B4KA 2KLBA 4MUHA 3HWX1 5KYWB 3ZDBA 3AK4A 1BE8A 3MG9A 5IEJA 3K70D 3CE9A 1HYEA 1H8ED 3CO0S 3CXUA 3QLUC 5DCUA 3NCHA 1HDXA 3G89A 4NNPA 2WVAA 5F5NA 5B1DA 3VMMA 3ROXA 2H4HA 1EVJA 1R18A 2QL6A 5BSGA 4IIJF 1VKJA 1MO4A 3DD5A 2RHJA 1A96A 1PK7A 1TE2A 3SHWA 4OCZA 1ZAKA 1YT5A 3C6ZA 4S3MA 3C1AA 2FJPA 1ECLA 5DGCA 2HO4A 3I9OA 3IKJA 4EARA 1A69A 3HWWA 4GOMD 2HGSA 3DEKA 1O5TA 1ND6A 5LJIA 2PUGA 3I9LA 1R0LA 4E5KA 6ABPA 2JD2A 2W5UA 1T10A 3EFHA 1KK2A 3FVVA 2NMVA 2FPKA 3NM4A 3OWOA 4NZNA 3KOZA 3SQDA 4B6SA 4EGAA 1BG6A 1UK8A 2Y0CA 4MDYA 4AURA 2YHSA 3VGPA 2HMAA 4E12A 1QH0A 1SD5A 5JROA 2OFPA 3QKSA 3QPVA 3VPDA 4CCWA 1NUPA 4RFSB 1G21B 3ZQJA 3JARB 4IY1A 3KLBA 3BL6A 2WI8A 3HEAA 3KS9A 1FFEA 1MNAA 2X5KO 3JRNA 4OHOA 3HGMA 3DYVA 3Q7PA 3DA8A 4KVAA 4B9EA 3BMCA 4ER3A 1A98A 1L5HB 1JKIA 2HX1A 2GYUA 1G20B 1OV4A 2NWQA 5AXBA 3RYHA 4DXDA 4AY6A 4RM3A 1FX0B 4RDHA 1AN9A 4IMRA 5FO1A 2YYYA 2W70A 5KJ6A 4PAOA 3CG0A 3WMXA 2J45A 3STHA 1QK5A 1DQYA 1NUHA 1ZY2A 2BDEA 2F67A 2YWEA 3CLTD 3L6RA 4TRRA 1X2EA 4OYYA 3AONB 4ZU3A 1J8MF 2OBYA 3NAMA 3T7DA 3VH2A 2XNKA 4A0FA 3PXXA 1CUZA 4LX8A 3GGGA 3HO1A 2JFOA 4QRHA 3BD7A 5I3CA 4IL5A 1EFUA 1FQWA 2FKAA 1QKJA 2AYZA 3I3OA 5IC6A 3BXZA 3WK8A 1KRWA 4GLFA 1X74A 5EWJB 3VYSB 3L84A 1OBVA 1XDBA 4TYMA 3T3NA 4YCJA 1Z5UA 3DW3X 4GYYA 3MAAC 2Q5LA 5A7HA 1QCZA 2O50A 4QBTA 2W8BA 1DC5A 4POAA 2FDRA 3KE9A 2H1HA 3RVMA 3ESZA 1UJ4A 3HYSA 3QZUA 1W93A 3UAYA 4EVRA 4X8MA 5AD1A 3INYA 2BOVA 1DU4A 2WE7A 3DKIA 2IVZA 4LVUA 4Z9FA 4WT7A 2ZYGA 5CFRA 2H8KA 3WL6A 1PN3A 2CNDA 1P29A 3CRMA 4ZXFA 1BMFA 2X8AA 2VQEB 3PZRA 1EK0A 1LNQA 2L69A 2BSAA 2V6BA 4IX1A 4R1MA 3AUUA 2E7ZA 1NGSA 2VA9A 4ONEA 3FMVA 3RTBA 3HKEB 4BQOA 4NS4A 1D2AA 4KR2A 2C92A 4XDZA 4CDGA 1OD6A 2Q6KA 2ZRIA 3KSZO 3WV4A 4EI8A 1JHQA 1KDYA 2R68A 3B36A 1JWLA 4C4RA 2IXGA 4TRMA 3KZXA 4AF8A 2MCFA 1YJ8A 3NJ4A 4B6QA 4AKIA 1D2HA 1V5EA 3F3KA 3CPHA 3ZKWA 2WJAA 4JBLA 5REQA 5DGDA 5TGDA 5C5IA 1Z18A 4CKCB 3NYWA 1Y8QB 2JGAA 1PJCA 4GW3A 4IDPA 3VPXA 3WRYA 3X44A 1EXNA 1FFSA 5TXGA 3ZZ1A 4OJNA 3SVLA 2GDZA 5EKDA 1GXSA 3HL4A 1RJGA 2B82A 2IJGX 1BKYA 1GSAA 2E48A 3GFSA 5AT1A 1V5GA 5JD3A 3V4SA 4Q1BA 2JVKA 2ACWA 4LV5B 4NCNA 3PVZA 1R0CA 4O4LA 4WESB 4XQGA 5B1YA 1S96A 1X94A 2D8MA 2OAGA 5DK4A 3QKUA 2HBQA 2D1SA 3DFKA 1NXOA 1TTHA 3NI2A 4DIDA 4B6PA 1YU6A 3P4XA 4DARA 1DRVA 4BO8A 5JD6A 5DULA 4DNFA 1RFLA 2YZGA 4IYJA 4NTZA 2QF7A 3JQCA 1OPRA 3T5GA 1CBUA 2ZB7A 3NT5A 3EWNA 3NBQA 4OHRA 4ERNA 4RWEA 1C5KA 3IIJA 1CKEA 4CFSA 3OZIA 3W6PA 2YJ6A 2HU8A 4HDRA 2PMCA 2YNMD 4BLOA 2LE0A 1CUCA 3AJAA 1ZVVA 4X9XA 1FFBA 1U65A 1Z25A 1O2DA 4MKIA 3GMTA 3N0VA 3V8PA 3GLIA 1P2UA 4EHDA 2G9ZA 2VAWA 4IUBS 3DT6A 3GJ8A 5FTLA 5ALQA 4BLWA 2AYXA 1J99A 2B4AA 5IDXA 2YR0A 3H1GA 1G59A 1YDFA 2CHEA 2JLSA 3I6QA 2C20A 1QO0A 2JIRA 2OHIA 2CK3D 3LY8A 4LX0A 2D1RA 2PRIA 3KNZA 4EHNA 2VRCA 5B6JA 4JB0A 1R27A 1Z4NA 2GO7A 2Q29A 3H75A 1VE9A 4MYSA 5ELLA 2XXJA 2YWRA 2FR8C 1HT0A 4OREX 2YOHA 2V7UA 1HKUA 4IJ6A 4PZUA 2XKBA 1W4AA 4CLRA 3AKYA 4WL0A 1SXJA 1H2XA 1F2VA 4RMGA 2C4VA 1CUYA 1Y9AA 1RPNA 2XGGA 1TT7A 2IUSA 4MVJI 2ZXEA 4U2KA 1RTKA 2A6PA 5JMTA 4OATA 4G24A 4CUZA 2YY6A 2A8YA 2EFDB 4KITB 4B3RB 1NR5A 4I14A 4B3TB 4AZTA 5FEMA 1AG9A 1FVXA 1BHJA 3J81k 4TMFA 1M2KA 2A5DA 1Z73A 3AUAA 4MVYA 1Z4JA 4DE5A 5EG5A 4CKZA 3NPAA 1SQSA 4G4IA 5IABA 1LLCA 3VYUB 4ZIRB 1V1RB 2P1DA 4RQBA 3FPSA 3ROGA 4D3YA 3M9XA 3BJZA 4FS8A 4GC9A 4Q15A 2C42A 2QRPA 5AFSA 2YOGA 3EGVA 3Q2KA 3U81A 4DBVO 2IH5A 1M0EA 1NC3A 2W58A 4MQUA 5LDGA 3TXAA 1SPXA 2AZMA 4GKVA 1C2TA 1SIOA 1U28A 1K88A 3AUYA 3IRUA 1AS0A 1R10A 1CY4A 3U5ZB 3U1TA 1J97A 5C4MA 2HDOA 9MHTA 2HJVA 3O9ZA 4A27A 3AUKA 3E1SA 1WULS 3ESDA 3FYUA 3SJAA 3HYRA 1GKKA 3NDJA 3CEJA 4RK5A 3EZ9A 3V7NA 4DRYA 2FFRA 1YDEA 5C4IA 1TFRA 4ZHQF 1FZQA 4D56A 5E0OA 5A3VA 3AEYA 2RGBA 3L40A 2ZM5A 3E7WA 3KJQA 4GGMX 5J58A 4UDOA 2F1IA 2KB0A 2Q49A 2C95A 3S6JA 1E64A 1WOYA 1JQ3A 4Q7KA 3EWIA 2C4MA 2O1SA 3U7RA 1AZLA 3ZDZB 5CX1B 1KA9H 2H57A 4L6IA 4C22A 4DV7B 3T9FA 5IM5A 4OAPA 4S0XA 4YRKA 1JG7A 1ZXBA 2DU8A 2O2EA 4RTLA 1E5TA 9GPBA 1GAWA 4DHEA 3M4XA 1YQ9A 4RMNA 1EM6A 3R3HA 4JN6B 2I4TA 2PGAA 2PX4A 1DI0A 4NRDA 2C0CA 2ID4A 3BCRA 1XCOA 3HB4X 2IYNA 5PNTA 4YT8A 3C16C 1HE3A 2GMWA 3E3AA 4LHYA 4Q7JB 4HNGA 4A8PA 5HUHA 3HVIA 3K0SA 4BFCA 3PHHA 2R8PA 3VKVA 1FMCA 4QJ4A 4XSVA 1C3OB 4WDQA 5IJAA 4RZIA 2CK3A 1KAQA 1G8JA 1OU0A 2CFOA 4X6LA 2CMGA 3GJ5A 3NM6B 3OPVA 3RVDA 1W87A 2WYIA 1YS2X 5DHSA 3ZVLA 4JUAA 4WLUA 1GUZA 4HH4A 5F52A 5H0IA 1FK8A 5MHTA 3D0RA 2CCJA 1H2AS 1YMQA 1YZ3A 2B1GA 2OOSA 4JBGA 4L72A 3VSBA 3Q85A 2R8ZA 1B3RA 1SXJD 5I51A 1FBTA 1Z07A 5JPIA 4BNYA 1OBCA 3U7FB 1I2MA 1ZWKA 3K16A 2BI7A 3SZLA 4B17A 3AESA 2AE1A 3DBIA 3LDUA 1E61A 2PV7A 3L7AA 4UTVA 3DUWA 2XE4A 5L45A 4K88A 1O1YA 4RADA 1ENZA 2UUOA 4CQNA 1NBHA 3EODA 2HPZA 4E3ZA 4EY8A 1XMSA 4MRMA 1PDWA 3OU6A 5A0VA 2ZBUA 1JA0A 1X1QA 5LC1A 3VR6A 5KB3A 3UJ3X 2YN4A 4JCOA 5F2EA 2YJGA 1L6IA 3RUPA 3PF8A 4HDKB 1FJGB 3GHYA 3R6WA 3T3DA 4LGYA 3QKTA 1ZVKA 2G0NA 1C7IA 4B40A 1SUAA 2J6BA 1ZUHA 4B84A 1RACA 4IUCS 1P9RA 1FJ2A 1NAIA 3TCKA 1QFJA 4B09A 4JXXA 3LVRE 4EQ6A 3GDHA 3K3PA 1M6WA 4NE9A 4TROA 4IXTA 5DM60 4A6EA 3K9FC 1I0IA 3H17A 4Q9DA 3H1EA 1RWNA 4MS4A 1BX3A 4DT1B 3NASA 2CUZA 3ACDA 3AF0A 3RC3A 1V47A 4DCGA 1NOIA 1S0UA 4J3JA 1TJPB 1ZS9A 2I87A 4D8YA 2JLXA 4YJ3B 1UAGA 5DXJA 3L1HA 3WXBA 3F98A 4GQIA 1GRNA 2G08A 4TWBA 1E63A 2LKCA 3KU4A 5EVJA 1F9AA 5LYYA 4TV8A 1IOZA 2OHXA 2BI4A 3A8TA 3T3IA 3A9RA 3NW9A 1ZI9A 4OB7A 4CLHA 2QTZA 4FFSA 4H59A 1XU4A 1SMKA 2I3ZA 4KDEA 4D4GA 4LKOA 2QLMA 1EX1A 2MU1A 5CRIA 5E6UB 1KO7A 3FYTA 2PRSA 3PKJA 3AFHA 4R40A 3UF0A 4Q7QA 1CQIA 1DWOA 1Q1GA 1P1BA 1MRSA 1TJ5A 2X22A 3LVBA 3NGMA 4L0CA 4O4IF 5ALNA 2RB5A 3IP3A 5B3KA 4RDIA 3AIMA 4LVCA 4CG2A 1PFUA 3PGMA 5DM0A 5H1YA 1FUYB 1GGNA 2I2BA 3CHYA 2FWJA 4QOIA 3TRDA 1FDSA 1V8PA 3SP1A 3UOGA 1WZEA 2EDAA 3BJEA 4MQ5A 5M04A 4KQ1A 1ODJA 1HURA 3A4YA 3GJ6A 1B6SA 3A6GA 1YIOA 4MW0A 5JAIA 5CDYA 3FOZA 2FSVC 5T57A 2HEGA 3ZJVA 5LR6A 3BBPA 1PRYA 4ARVA 2PT7A 5HE9A 4MAAA 4WCFA 4GPBA 1U28C 2CLEB 1GARA 2P9ZA 2QRLA 4JYMA 4L76A 2O5RA 3WRYC 3W5DA 2V4MA 1S4QA 1MAHA 1NW7A 1WTAA 2FSUA 2IYRA 2XOKA 4FMBB 3CB2A 3REGA 3TSCA 4X1IA 4C7XA 4R71A 4BO4A 3IPYA 3PJEA 3IOYA 1BKSB 1Q22A 4NWIA 2WWTA 3QX9A 5GY7A 1DT3A 4ENTA 3WADA 4JL5A 4PS1A 3TZ6A 4LQCA 2IOFA 5LA6F 2B7LA 3UB3A 1JYFA 1SH7A 3FOAA 4DCCA 3UXHA 1SA0B 5AUPB 3O2SB 3G2LA 4JGIA 3NS7A 5FUYA 2OC9A 4PSCA 4B0OA 4JJEA 3U7QA 3DB1A 2PWBA 4KPUB 3M6UA 3EJ6A 3PXBA 4J7CA 1OLUA 1VMIA 3AJ8A 3O8DA 3OCYA 1H1DA 3KJEA 1U2DA 4GGPA 4XJSA 821PA 3UV7A 2I6GA 4IFEA 1XZEA 1DKQA 2F1JA 4RVCA 2XUJA 3LBNA 2D1YA 4LG1A 3R7AA 3KQNA 4FCWA 5E6SB 3JZAA 1X70A 2HB6A 1U0EA 3IKMB 2IZ5A 4ZVQA 1KAMA 1VA4A 2GN6A 1E3DA 3DBLB 1JU9A 4YP5A 4DV3B 2C58A 5IN5A 1L6RA 4U00A 3KR2A 3L6OO 4U39A 2IHUA 4RJIA 4W6QA 1Z0ZA 2PX8A 2WW8A 1ADBA 4WXEA 1MOQA 1DBPA 1G3UA 4OJKA 1Y82A 4LDPA 1SCJA 4ZI2A 1ZVQA 1HLDA 2ZRBA 3E35A 4I4NA 4HK4A 4RXTA 4BWYA 2Z2YA 1QFZA 2GBFA 1EK6A 5GJBA 4UPDA 4TVOA 2N47A 2Q5FA 3SD7A 1TMOA 3JYQA 1DB3A 1CRZA 1P4RA 2ZUUA 2Y2UA 2JG3A 3QU7A 1MX5A 2XNHA 4MHTA 1FFWA 3CT4A 4C87A 4CKWA 2O8BB 1EESA 2LGJA 1SUDA 1CZRA 3HUEA 1Z12A 2XNDD 3ORHA 1O6CA 1MW9X 3NC4A 3TMYA 2DQKA 2PKYX 5A02A 5DDIP 3F9IA 3TLGB 1P5ZB 2HIAA 4ZAVA 2NVUA 4D3DA 3MUFA 2FQWA 2O2YA 3WG9A 2O2SA 1OH5A 4XPIB 1S5PA 2QP4A 5T64A 3VAYA 3D3NA 1QTRA 3I2YX 1QQ5A 4JZKA 5JWOA 4CMGA 1N1GA 3MBOA 2VT2A 5KSPA 4C78A 2NO7A 1IIRA 5CHEA 1E5XA 5LDDC 1G8PA 3TS1A 3N2IA 1X8LA 5EC8A 1T0UA 4B6JA 1OC4A 1VPDA 3COZA 1B26A 5CVTA 4HFMA 5JV5A 4PO1A 5L95A 3GG2A 1E4EA 2RK3A 3RFTA 1QRAA 3G7NA 2FWIA 3QHAA 5B1SA 3R9IA 3EAQA 2BEVB 2XYVA 1F1JA 3GRKA 1B8VA 1XO1A 3KYDB 4OSPA 5FCDA 2X0FA 1JLKA 2HN9A 4BJ6A 4CM6A 2IS1A 1V1MA 1UWLA 4IDGA 4DLTA 3JVEA 5J4VA 2R79A 4TKUB 3LTNC 1CP3A 5KNCA 4K81B 3PSHA 4PNHA 1OFHA 1M6EX 5JQWA 5HP4A 2BFFA 5HZMA 1D4ZA 2JDIA 2GZ3A 4JR1A 1OCEA 1TK3A 4W9RA 5GV8A 4IPTA 1N75A 4B44A 5JCJD 3SE0A 3KLPX 2AMLA 2Z08A 4O4LB 1IRXA 4CU2A 2RHLA 4DCNA 5E7QA 5GIOE 4QM7A 2PMDA 3RLFA 3EG9B 4RV5A 2BFWA 2NU8A 4KFSA 5K8VA 2Q8NA 3BWYA 2OT3B 4JL6A 3IHLA 2R0QC 4M21A 3FPAA 5DI3A 1YDGA 2LDBA 4IIUA 3RV4A 5BR8B 5K20A 1WCV1 2D3WA 1BKDR 3E61A 4MYCA 4PE5B 2KMLA 3RT7A 3EBOA 3PYMA 4PVDA 3PHLA 2PHZA 5DN6D 4JEIA 1NM5A 5JJLA 1CY2A 5EKXA 1WUIS 2COUA 3RK0A 5LOVA 2OECA 4JSTA 1G60A 4NMXB 1OE0A 1ZLYA 4TVKA 5T3YA 3U44B 4EZEA 2IV7A 3ZY5A 1RJDA 1JKJB 4HDRB 4A2PA 1ZNYA 1QFYA 2FCRA 1DLJA 5BYKA 5JDIA 2FMUA 3DBOB 4QOFA 5EE9A 2G4CA 2KJQA 2X3UA 4IILA 3IQXA 4Q9HA 3CRVA 4BNTA 5DXFA 4D45A 2A9QA 3QOWA 1AUXA 2XMGA 4MW4A 1HZJA 1XEXA 2PG3A 3FY4A 4N8SA 2D5AA 3EFOA 3HH8A 4UUMA 3EOZA 3G13A 1B23P 2PKWA 3UUEA 1FP2A 2XWJI 5TPZA 3V6MA 4LJSA 4CNBA 1H9BA 3I9FA 1KMNA 1EUZA 1E8MA 2PO7A 4HXGA 3OQPA 4DYVA 2Y0PA 4H3HB 1NC1A 2ZWPA 4L8FA 2XT9A 3UJAA 4DVGA 1FP4A 5IKXA 1J22A 4RY2A 3ZX5A 3NOXA 2R11A 4PQEA 3EX7C 5LSAA 4LF4B 2IUFA 2ORIA 1MG0A 5JO0A 3PD1A 3R7WB 4GZLA 2G5PA 3GELA 1IJFA 3MELA 3P9KA 1D03A 621PA 5JYBA 1FSZA 2VC2B 3RSGA 3ZOKA 2NYUA 2BGWA 4YWJA 4ALKA 4GZ3A 1H4VB 3PC8C 1SKMA 5CA1B 3PFCA 2YJ3A 3B85A 3BCSA 1G5HA 3AHCA 3BS4A 3DR3A 3TL6A 1EWQA 4MWSA 1M1YA 2V3WA 2ZTUA 1ICIA