1PJ8A

Structure of a ternary complex of proteinase k, mercury and a substrate-analogue hexapeptide at 2.2 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
279
structure length
279
Chain Sequence
b'AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Structure of a ternary complex of proteinase K, mercury, and a substrate-analogue hexa-peptide at 2.2 A resolution
pubmed doi rcsb
molecule tags Hydrolase/hydrolase substrate
total genus 96
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2003-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1pj8A00
1TO2E 1Y3DE 5ARBA 4WOBA 2QTWB 1P7VA 1EA7A 1SBIA 3Q40A 4DJ5X 3DE4X 2ZWOA 1ST3A 4I0WB 1R0RE 1UBNA 1SBNE 2X8JB 1MEEA 1AH2A 3DE7X 1AK9A 2Z2ZA 1SCDA 1SUPA 2PYZA 2PWBA 3CO0S 3PTLA 3BPSA 1R6VA 1TM4E 1BE8A 2W2MA 1SCNE 1SBHA 2DUJA 3SICE 1YU6A 2PWAA 1WMDA 3TECE 3DVSX 1SIOA 3GT3A 2PKCA 1AVTA 1ZVKA 3DDZX 3ZXXA 3I30X 1OT5A 4NE7A 1Y1KE 4CG0A 1C9MA 4C3UA 2X8JA 4YN3A 3OSZA 4C3VA 2Z2YA 1EGQA 2ST1A 4OV6B 1Y33E 1SUEA 2Z2XA 4Z2AA 1TM1E 4FONA 3DWEX 4JP8A 5AMXA 1WVMA 3DE6X 3VTAA 5I9SA 3A3NA 1BFUA 3HJRA 1A2QA 4DZTA 4MZDA 3DE1X 3EIFA 2SICE 5B1DA 3Q5GA 2GKOA 1BJRE 3F7MA 5CW1A 1IAVA 4B5LA 1BFKA 1GCIA 1GA1A 1C9NA 3WHIA 3AJ8A 1Y3BE 2ID8A 2WUWE 2XRMA 5FFNA 4H6XA 3DE3X 4NMXB 1TK2A 2W2NA 4WOCA 1NDQA 3P5BA 3UNXA 2XTJA 1KE2A 1GNSA 2W2QA 1AF4A 4KG7A 1TO1E 1LW6E 5B1EA 3VHQA 5K7SA 1OYOA 3T41A 1SIUA 2HD4A 1ST2A 2Z30A 2PQ2A 3BX1A 1YJAA 1P7WA 1T1GA 4M1ZA 4AKTA 4ZOQI 5AQEA 4NE9A 1SBTA 3GCXA 3QFHA 2W2PA 3I37X 5SICE 3DW1X 3DVRX 1DBIA 3WIVA 1Y3CE 1GA6A 1SIBE 3A3PA 1PTKA 1KDYA 1V6CA 3VYVA 1BH6A 5FBZA 1S01A 1KDVA 2PRKA 2ZRQA 1CNMA 2ZWPA 1T1IA 1ZVJA 1WMFA 5JXIA 1Y48E 1C9JA 3LPAA 3SQOA 3DE2X 1NLUA 3VV2A 4KB5A 3QMPA 1Y4DE 1C3LA 2SNIE 1V5IA 1SCJA 2Z58A 3LXUX 1S2NA 2WUVA 4ZARA 4LVNA 3WQBA 4K8RB 1AQNA 1S02A 1CSEE 1GNVA 3EE6A 1R64A 3LPDA 4CFZA 4HVLA 2DQKA 1Y3FE 3VSBA 4OMDA 2IY9A 1VSBA 4OMCA 1Y9ZA 2Z56A 2WWTA 1SBCA 1SUDA 1MPTA 1TM3E 5FAXA 1Y34E 4RYDA 5ARCA 2SECE 3TI9A 4BWGA 1SN7A 1TECE 1PEKE 1IC6A 1YJCA 3F7OA 1SH7A 2B6NA 3ZXYA 3I34X 4AKSA 1SCBA 3EDYA 2DP4E 1SCAA 3BGOS 1BE6A 4HX2A 3DE5X 1AV7A 1P8JA 5JMOA 3D9QX 4J94A 4H6WA 1TMGE 5JXGA 1SVNA 1T1EA 3F49S 3D43A 1OYVA 3AJ9A 1XF1A 5JXJA 5ARDA 3DYBA 1PFGA 1KDZA 3PRKE 3AFGA 2E1PA 1GTL1 1THMA 1GTJ1 2Z57A 3DVQX 2G4VA 2P4EA 3GT4A 1YJBA 1GT91 1GA4A 1AU9A 2IXTA 4DWWA 1SPBS 3QTLA 4KPGA 3DW3X 3LPCA 3WIUA 1DUIA 1HT3A 1PJ8A 1SUAA 3CNQS 1SUCA 1WSDA 1KE1A 2PMWB 5AVJA 3TI7A 2HPZA 2V8BA 3L1KA 3DE0X 4LVOA 1Q5PA 3GCWA 1NDUA 1WMEA 2WV7A 4GI3A 4CFYA 2SBTA 3H42B 2W2OA 2TECE 1SELA 5JXHA 1Y4AE 4H6VA 3A3OA 1TM7E 3VV3A 1TM5E 1JEAA 5AVKA 1SUBA 2ID4A 1GTG1 3I2YX
chains in the Genus database with same CATH superfamily
4PBRA 2HSZA 4HZGA 3NH9A 4ZN6A 1ZUIA 3EZNA 5ALOA 4DUYB 1E6WA 3C3YA 3OUTA 2YFYA 1HO3A 1JX6A 2WD9A 2YZ7A 2ZVDA 3BHNA 3DOFA 4OAPA 3I5MA 3DE4X 5FF9A 1KI9A 2XT6A 4GPBA 4RKRA 3D8NA 2C5SA 5EJ9A 3QQPA 4GDFA 3PA8A 2GLUA 2XCIA 4LN1A 3VYWA 2W6ZA 5IT9A 4B9AA 5CEFA 4HHEA 4TLCA 2PGAA 2OSVA 1KS2A 2VP6A 3KQQA 1D09A 1I3NA 2CSUA 4I9FA 2GZ1A 4YFVA 3EYAA 1MVOA 3WYBA 5EIXA 1NI4B 1ZDMA 1N6RA 4RVHA 4PHCA 2PJRA 3KZ1E 1A4RA 2OGTA 1N8TA 2Q8NA 2O57A 4B4VA 3H5VA 1JBQA 3GGGA 1KQ3A 3PGJA 4WJLA 2RIPA 4I55F 2QL6A 1U1EA 4JJ7A 1HZJA 2XE4A 3BT7A 1HL3A 3FNGA 3INRA 1UBTS 1ZIXA 3KJZA 4OD0A 3V8MA 4C1NA 5JECA 2ZAIA 4BQOA 5KNCA 3FZNA 1KP2A 3KFVA 3QWFA 4QNMA 3MBKA 3RW9A 5JQWA 2ASVA 3TVYA 4JXKA 4WN9A 2OV4A 2PWBA 1I7NA 3WL5A 1GGHA 3E61A 3P2JA 1XR3A 2L2QA 1OAAA 2BH9A 3H9JA 3Q41A 3BWEA 4ALKA 3ZXIA 2YZNA 4ZYVA 2OMKA 1FFXA 4DA6A 1B8PA 3NHPA 1DQYA 3ND6A 4EK9A 1IRXA 3NAQA 2PTHA 4QPPA 3LBHA 4ZD6A 2XOKD 4BKQA 4YIHA 1YFJA 3O4JA 3KWFA 3C8UA 1JJIA 3E8MA 3R5HA 3RADC 4MJ3A 4DV7B 1U2DA 1HDIA 4ZVTA 5KYYB 1XRQA 2Y4NA 3C39A 2D0OB 4HB2A 4QLOA 1U2PA 3OF2A 5KYXB 4WA8A 4Q48A 4H1VA 3IOYA 2ONYA 1BDMA 1KEUA 2G76A 2P9ZA 3FUTA 1Y8QB 2L18A 3OLVA 3E7WA 4M88A 2P2NA 3JAKB 1S2IA 1XLTA 1U2EA 1VIVA 2O1WA 3QELB 4HB3A 3WA7A 1A97A 4Y6OA 5D2CA 1U90A 1YRBA 2QAGB 2RE8A 2HRBA 1IHPA 3PQEA 4TGLA 1Y3IA 4ZQIA 3W2EA 4WACA 2X1LA 5BQ5A 4M0FA 1J07A 2H7VA 1N57A 2Y0DA 3KEQA 4FDTA 3Q72A 4HDNA 4ON9A 5A5FA 2JAWA 1Z29A 1XZNA 2O2IA 3GH1A 4IMIB 1EHYA 2X77A 1GG2A 2J08A 4HOYA 4KPUA 4AJPA 3LT2A 5L3SA 4C3UA 4Q3EA 3TK1A 3EBLA 3E8XA 2XY4A 4I3FA 3KKPA 2DEUA 2VJCA 1G8FA 2IDJA 4HWPA 2KI5A 1OVMA 4MUHA 2WFLB 2W6ID 3X2FA 1CD5A 3JVDA 3BICA 5D7NA 1U9IA 5KSPA 5CB6A 4CLOA 3W5JA 1GKKA 4OK3A 1QAMA 2ZCJA 2QUJA 3DL2A 5ICGA 1M2KA 2AC4A 4LNHA 5DM70 1U0LA 3ZVRA 2FR8C 4JI4B 2VQSA 4A03A 3PD1A 3Q0EA 4H4EA 4L8GA 2J3HA 2D74A 2EYQA 1JJVA 2IX3A 4Q21A 4MGKR 1ORTA 1T2CA 1XCOA 2ENWA 5K9ZA 4AJIA 2X6QA 3K09A 3RVJA 3IDSA 3VO8A 3PR3A 2ZTHA 1WXQA 3M1LA 1O5TA 1WVMA 3VTAA 2M2IA 5I9SA 3L7AA 4PRYA 3VJKA 4UDNA 2QBYB 4OHBA 4WN9B 3NATA 2HK9A 2ZCUA 3PC8C 5REQB 3QRWA 3RASA 2P9EA 1KAQA 4GNRA 2I22A 3RJ9A 5KYTA 1VRCA 1THGA 5CLQA 3V1YA 2PSEA 2RAVA 3AF5A 2R4QA 3Q7TA 1U4OA 3HU5A 5HDBB 1EWQA 3MGCA 3OQBA 6ADHA 1IDN1 2RCNA 4PG5A 1SY7A 3DZIA 1GAQA 1NP3A 4PM4A 2C5FA 5DTQA 1OU4A 2G0NA 1N6NA 3NR2A 1PSZA 1JHYA 3N8DA 3B3QA 4R9RA 4B71A 1PW5A 1UPFA 5AW0A 2Q4OA 1LJ8A 1BFKA 1E2HA 4RQTA 4ML3A 1ZMXA 1N9ZA 3OE4A 4RXMA 1MBZA 3AR3A 3MRVA 2C99A 2H1WA 4JB3A 4LA4A 1L4YA 5EJIA 5JCOA 4YP0A 5IC5A 1A5ZA 3WYEA 2NV0A 1TJNA 4NG4A 4Q47A 3SEZA 1Z7BA 2WUWE 3DLBA 1WUKS 1YBFA 3FOAA 3QK7A 4H6XA 3LLMA 4U9IS 1RAAA 2IDMA 5DYWA 5MN5A 3K70B 4QULA 4ZAZA 3QG1A 2ZPAA 1YR1A 4JB8A 3ZNNA 2PGOA 2P2CA 3JVVA 4S05A 1FFBA 3FDFA 1KORA 4U2FA 2OPHA 4DUGD 2FF7A 3UNXA 3QHAA 1WU7A 5I5GA 1KP3A 2BZSA 3LUDA 5CXUA 1JA9A 3HKCB 3ZQKA 2BFFA 5CCEA 5LQRA 1FSFA 1XFDA 4G0XA 3T34A 2CLDX 1DHTA 2C1EA 3LY5A 2WWIA 1ZM3A 3PC6A 4IPTA 4PCLA 4S1VA 1NM5C 4UVIA 4D9KA 2I9KA 3RCBA 4A27A 3R5FA 1YR6A 1E18A 4WNAA 3SK0A 2X5JO 4P08A 4RHTA 1FTGA 2JRCA 2OVFA 2QL5A 3L4BC 1Q0PA 3NB0A 1NXVA 2BGUA 3EXEB 3WRYC 3F0TA 1JU3A 3OIWA 5M5BA 4PGGA 3AGQA 3GL9A 4RPCA 2REOA 3NRJA 5AUQA 2BR4A 5HEKA 1GXSB 2EDCA 2XLBA 1YZHA 4OFBA 2CF6A 1NPYA 1OLUB 3GGSA 4S12A 2BJWA 4MCIA 5DHPA 4RV5A 3K9WA 1W7AA 3ORRA 2HIAA 1SR8A 2RGAA 4EVRA 1AQIA 3OJOA 1GPH1 5GONB 3ZH2A 1EK6A 4MITA 2JHCA 1JKJA 3WGIA 2WMNB 2V1UA 4LWQA 3KPJA 2ZUFA 3OC6A 2NN3C 2YXEA 4Q3NA 5AOAA 3H5NA 3W3ZB 4BMNA 5JWOA 4O8ZA 4RXTA 3ZGOA 4JKOA 1Z22A 1J8DA 1T25A 1TTTA 1ENZA 2TS1A 3QFTA 3HCEA 1ESEA 2DH6A 5CPFA 4ZCRA 1VYVA 1HDEA 1LVUA 1JR4A 1PL0A 3GRAA 3O8BA 4GOLD 4JQZA 5EAIA 2FPXA 5JHHB 5G40A 1AM4D 3DV0B 4F4CA 3MOSA 4QFCA 1OH7A 2LKDA 5DGDA 2VPWA 4P7GA 4RETA 2YWCA 4FSDA 3HUEA 5DGIA 1OUMA 5CLLA 4PBSA 1CUJA 4Q18A 3IAM1 5BWLA 5C9ZA 1ZVJA 4UHCA 5JYCA 3TF5A 1X3SA 3TSCA 1RBZA 4AUKA 2PX3A 4MS4A 4KQHA 4QJ5A 2WIJA 5G2OA 3BA6A 3M4NA 1B1CA 5JZSA 4KODA 4G01B 4WBNF 2IW3A 1FP7A 4MMXB 3BXGA 3M6AA 3PUHA 1AUQA 1NTRA 3PQ2A 4L76A 2ERXA 2IUSA 3OZSA 4M2LA 2GETA 3LYUA 2B92A 3LRPA 3W6PA 1NOIA 5IF9A 3AY3A 2GZAA 2ZJFA 3MWGA 5AVRA 3A6LA 1B76A 3RF7A 3PEEA 3CPHA 3V3TA 1HQDA 1I6MA 3R7WB 3E15A 3LUHA 1FFAA 1PYOA 1SCJA 5H3LA 1TZJA 1WP4A 3IP6A 3LYHA 5JFGA 1BVYF 1VB5A 5DBFA 3TBFA 3TBHA 3IDZA 4Z1MD 3ESAA 2ZBRA 4WJKB 4ZC8A 1REQA 3MTEA 2ZBGA 4DA4A 3LO8A 5IKPA 1W88B 3CLSC 4KFCA 3UW3A 3HACA 4K1LA 3ZKWA 3FPKA 4O1MA 4DMHA 4HMOA 1CUIA 4ZICA 2G0AA 3LPDA 4MOWA 3T5GA 1AK2A 4ZIRA 3AKZA 1GRNA 4CKWB 3PTAA 3LDAA 3O7WA 1KKLA 4PZ9A 1QFZA 2GO7A 1YHNA 2JIBA 5EGSA 1QHHA 1AMOA 1UJMA 3BDIA 3NETA 1RW4A 3U4MA 4PWYA 5H4GA 1JSXA 1SHKA 4PEVA 3PPXA 3IR5A 4JASB 3ICOA 3WLAA 4QGAA 3NNDA 5AW7A 2CVFA 1B3RA 4R84A 4EJMA 4NPHA 4X00A 2BELA 1G21A 1PT8A 3MSXA 1PAUA 4PE5B 2XDQB 3A04A 2GILA 4UUNA 3W79A 5IT5A 1FNMA 5JIBA 1ZS9A 2R1TB 2OZKA 4XJXA 1LTKA 2HMSA 3FIJA 3A2LA 3LOUA 1I80A 1SBCA 3TZ6A 3USCS 4DREA 3IEMA 3A28A 5G0TA 3FD8A 2QI9F 5CG2A 1DU4A 1M2HA 1N1GA 4DIUA 5FUBA 2WTNA 1CJBA 4KI7A 1JG1A 3P9RA 5CA1A 5AW4A 2PS0A 4O4HF 1KDTA 1Q11A 2D13A 4ZANA 2AXPA 4EELA 1QHGA 3GLFE 2JFZA 4J7UA 1CY7A 3ISTA 2W2LD 4KC0A 1WZNA 5BV0A 3SWWA 3DBRB 5EMLA 5C37A 4EMTA 2ZJYA 2NU9A 1NVKA 1YJCA 1NJGA 3HCCA 4BNNA 2O1SA 2ZJAA 3ZHSA 5ALRA 1BWPA 1L4HA 3EHDA 1NX6A 3RRNA 4J29A 4BNVA 4EMBA 2H3EA 2EKBA 2P3QA 4L1KA 1SCBA 3ICWA 4M0LA 5LXTB 2OCXA 2YV3A 3R7NA 1N7JA 2JH3A 5U9CA 1PO7A 1R4AA 4FYMA 5PNTA 3LKZA 4GXNA 1E0SA 5ALLA 1I8TA 3V8PA 5FUMA 1T3GA 4KUGA 1FJXA 1ZGAA 3W6UA 1WZ2A 4IDPA 4MLPA 4J94A 4Y8VA 3DTNA 2QT0A 2AX4A 1T1SA 5JZOA 2A8YA 3WC4A 3LLSA 5IAJA 5EUCA 3DWGA 4CL2A 1EK5A 1KA9H 5DEIA 2BN4A 3T1TA 2JASA 2EKPA 3AG6A 4G0QA 4MVJM 3QPDA 4N6GA 5ALHA 1NJ5A 5GWXA 4E07A 3ANNA 4WD3A 4ECEA 3ZZUA 1L5QA 5FPQA 5CNIA 3OP1A 3CVOA 1ZK2A 4NU0A 3SC6A 3LV8A 2EBFX 1A0OA 1N0IA 3I64A 3KKMA 3LD9A 4YBZA 3PRKE 4X1YB 4OGFA 4IMRA 3FLEA 1Q12A 3ZHXA 4X91A 4DLLA 5DNUA 5CURA 1F7VA 1OC2A 2E1PA 2PLFA 3H8WA 3AERB 3QFSA 5DV9A 1U7OA 2G71A 1YZUA 1PJQA 3R20A 1GO2A 2C31A 3WZMA 4MDEA 5ULLA 1U63A 2YZMA 3OFND 3H3JA 2HJWA 3P0FA 3RVPA 5LWQA 5DP2A 3RRJA 4M54A 3B5IA 3BF7A 4FOTA 4PC2A 4JUFA 2RIRA 1N7GA 1JAHA 2FUG1 1P19A 4M1YA 5ALDA 1A76A 1P5RA 3E0XA 4D3DA 4NZZA 4NCHA 1D9XA 2AG5A 4RHXA 2ZJ6A 1I5RA 2PKRA 4FQ8A 2Q7XA 1DQNA 2JVKA 3I6QA 4MIKA 3RTGA 4DEXA 2FPKA 1QYXA 1W85A 4MZXA 4D4GA 1J6UA 5AP9A 1FF9A 3E7FA 1EGVB 3TRIA 1Y80A 1JJ7A 4RA6B 3DAYA 1IM2A 1NW3A 4XOIA 5E8JA 3FMPB 3O5AA 4H35A 5F2NA 1JTFA 2C2XA 4XDGA 2CYAA 3CLVA 4G5SA 1NMSA 5DWVA 2HMAA 3QEBZ 3DMHA 4E5DA 4C7OA 1VHJA 1QMGA 1QZTA 2Y6UA 3AR7A 5BWMA 4BE4A 2PGXA 2M6KA 4DG8A 1MH9A 1NW4A 4GE0A 5DRYA 4N9WA 2DUWA 3O1LA 1D4OA 2IZ1A 1RXIA 4MH0R 1Y1PA 3AESB 3LFHA 5E6RB 4MB2A 2G6BA 2W5UA 2P9HA 2R47A 5HRAA 1QO7A 1TAHA 1IE3A 3BGDA 5A0TA 1YS7A 4J9VA 4B4OA 3L4EA 4HG2A 2M9MA 1EGAA 3RVQA 4PO1A 1WNFA 1L1EA 4MRRA 2ZANA 3D4PA 1T3TA 4B6PA 3REQA 4C4TA 4HVCA 2NVUB 1U5AA 1WD5A 3HNPA 4TXMA 2I87A 4YREA 4YPFA 4XWKA 1OCEA 3I8XA 3L1KA 5AH0A 1YVUA 5GGYA 3KL2A 1RP1A 3O3MB 4LCJA 3CRVA 2N42A 4FBLA 4K6CA 2HNKA 3VDQA 2NXJA 3VKFA 5FI5A 3PE4A 2H07A 4WL0A 5HP4A 4YROA 1KXZA 5HZMA 1DIAA 3N3BC 3PDIA 4MV7A 1BX1A 5FNZA 1L8LA 4EHIA 4HFMA 4JSYA 3GMSA 3H11B 2W2OA 4H6PA 2HQBA 4CTOA 3WIOA 4D5EA 2QAJA 2YHBA 1Y4AE 3R24A 1QX4A 4BIMA 4DL9A 4H1WA 3CEAA 3F8WA 3FPEA 3UOAB 1T6YA 4JL6A 3IV7A 1JF8A 1I1HA 4N6OA 3RS5A 2ZXUA 1TM5E 3KVYA 2QZSA 3KDAA 1HSOA 2DWPA 2XTZA 4X44A 5TC4A 1XEWX 5LQJA 1IBLB 1VPWA 3WVNA 2XJ4A 1T8YA 3CRW1 4ZTZB 4WT7A 2X1HA 2D1RA 2Z5VA 4WZAB 2CE7A 3AY0A 4MA4A 4CF5A 4DY4A 1YCFA 3CSUA 5IWCA 4BVBA 2BZ1A 2PMCA 1FXWF 5EG5A 4RHCA 2C5GA 4DANA 2RFLA 3H5WA 1Y3DE 1WHSA 1LPNA 2GK6A 4LBWA 3S2GA 4BZPA 5L53A 1RRGA 1NOKA 2QN2A 3A4IA 3SR3A 2BRUA 1NXTA 2XCRB 4RIFA 2C2MA 4P5DA 4YUVA 3ZV6A 1DC4A 2HJVA 4BNIA 1PRYA 3Q0TA 1H2FA 3O8QA 4HYTA 2Y99A 3NM5A 3PTZA 2COEA 3PYLA 2X14A 4RBNA 1NE7A 1IUKA 4KXNA 1FZTA 3L6UA 1X87A 1XCPA 4YR9A 4YRMA 1RHUA 1Q1NA 3WSTA 3N0RA 2GPNA 1L5VA 5HA5A 3RJZA 2AI1A 1DO8A 5TT0A 1VHTA 2VRWA 3C1AA 3QYAA 2ZFUA 2QMYA 1N1MA 2D0PB 4FX5A 4KSYA 4BMXA 3BTVA 4KXUA 1KBZA 1MRZA 1XNGA 1IN5A 4F5ZA 3LP8A 4IDHA 2FW6A 3REFA 2I7VA 4EJ0A 1RFGE 2Z83A 4L6AA 3E2PA 5LZ5A 2O2XA 1LPBB 3UMBA 2CLIB 3QYPA 4B9EA 1XTJA 3N8HA 2ZUTA 3P9XA 2X9VA 4BASA 3G0GA 4JLVA 2JPDA 3ZCXA 2IYQA 5FWXA 4C0LA 4YP7A 1CY1A 3OTWA 3RC9A 4QBGB 1ZC3A 4B4DA 4E2YA 2G0TA 4PY2A 5KX5F 1F1BA 3LAWA 1DAMA 1BD4A 3UANA 3HXKA 4M1TA 4OHUA 2WWGA 2XMQA 3CEHA 2DT5A 2IYOA 2VATA 2DTDA 3UMFA 4OQZA 3EW9A 5EXTA 2NO4A 5AHOA 2UXDB 3ZBUA 3FGOA 3G85A 5HW0A 2XODA 5CB4A 3OC0A 1LTQA 2X86A 1I0IA 3NGLA 4CM6A 3LUKA 1K5HA 3VKWA 2B7CA 2QTGA 3DVSX 4CQLA 3T06B 1FLNA 3NS7A 1SIOA 5KHAA 1OVGA 2CZQA 1F6DA 3EEBA 2GEDA 3NTQA 4LY0A 4OM7A 3ZUGA 1XV5A 1T0PA 1TI7A 5DF1A 2PKCA 1RVV1 2OAP1 4IIJA 2FUEA 2GEKA 3C85A 5LYJB 4CQJA 1WHSB 4TMKA 3AQIA 3V32A 4IO0A 1QNFA 1GIAA 1PI3A 3EDOA 3ET4A 1ZAYA 4I1SA 4D9EA 1CNFA 1L4GA 4LWZA 3N7TA 3P8ZA 1A2OA 1WXXA 3PFFA 4JMPA 4JUDX 5HG0A 1DRKA 4ZVNA 2RAUA 3VNAA 4D3SA 2Y27A 3OQJA 4OUDA 4I6GA 2PS1A 3M3PA 2GM5A 4TV8B 1L5HB 1YA4A 3OSZA 3EMBA 3MJ4A 4KQWA 3Q8MA 3N87A 4IDQA 3VVCA 4S3MA 2BFDA 3C98A 4WFJA 3O1IC 1GQRA 4BVJA 3U26A 3OOHA 1LV7A 1J0BA 5K6TA 5D1HA 1IXSB 5I7RA 1T2UA 3HR8A 4TYMA 4IFIA 4X7RA 3ZGZA 5F73A 2J5BA 1E3SA 1WULS 4MLDA 2HCBA 1YDEA 1ZK4A 3OY7A 4RLHA 4I50F 4C0BA 1NONA 2CDAA 3DWEX 4ABYA 3CZCA 1WV1A 1E2KA 1YB6A 3JYHA 5AMXA 3NUZA 1LBIA 2J4FA 1IWPB 4ZQHA 1RCFA 3CKKA 2HXYA 2R84A 2I8AA 5KU7A 3PI6A 1JG2A 1HDGO 5JC1A 5A5GA 4BQPA 1EE9A 4L3OA 1ESZA 3ZEIA 4XIFA 4BEVA 1Z0FA 1UOPA 4QFDA 4V0LA 2F6RA 1G3UA 1NJFA 3EIFA 2Y2UA 1KZ4A 2WJ3A 3I45A 2AZTA 4N4AA 3T5MA 7MHTA 1R0ZA 2I2XB 1U0SY 4TXHA 2IYPA 2ZIVB 4E4TA 4LF8B 1YMUA 3QOYA 4QM6A 3SZOA 5H59A 1LSJA 5CW1A 1DHRA 3GRFA 3VZSA 2ECFA 3L79A 2JHFA 5AW5A 4XVCA 1PQYA 1OB2A 2B1RA 2P27A 5DN9A 5T3YA 2ZE7A 3CZPA 1L6RA 3QOWA 2WT9A 5KOHA 4R1MA 3M7IA 2AQHA 3ZV7A 1Z47A 4JKIA 2VOEA 4MSUA 3IAUA 1JBKA 1PDWA 5E6UA 4AUEA 1UODA 3NVMB 1XEXB 1GUBA 1N2EA 1ILWA 1X70A 2XRMA 2MDTA 4Y2GA 3AP2A 5KCMA 3QXXA 4D4HA 5BY2A 1JG7A 3C5CA 1HI9A 1UFRA 1ZJ5A 2X19A 1LY1A 1GNTA 3EHEA 1M0TA 4IXTA 4PQRA 4XCXA 2H6EA 4XCQA 1YHZA 3ZWNA 4DXHA 4EPWA 5JT1A 2QSJA 2MYTA 3ZCRA 4LYYA 3TTWA 3A37A 3SLRA 1CP2A 4I55A 1BDHA 3RU2A 3OJWA 2C9YA 2VKTA 1VOTA 2ZR8A 1K3UB 3RRBA 2H59A 2O50A 1VECA 2QZJA 1IY8A 5HIMA 4UHJA 1M9NA 1GNSA 4YJGA 5A7HA 4LNUA 4EJ6A 5TPZD 5C7OO 1CZRA 3BTUA 1I7QB 5L7TA 3GWGA 4JJGA 1Y6QA 1M1ZA 1T9ZA 3W5DA 1J0CA 3I12A 1C9YA 3E0QA 5J4HA 2O0HA 3DEIA 4C43A 1M5RA 2WHYA 1P4SA 2H4ZA 4YDQA 1LI4A 1MEJA 2X4LA 4J8PA 1YDHA 4TX1A 1CY0A 3TWOA 3M6WA 2IEAA 4U63A 3EGWA 4MV3A 4N82A 3PGKA 3DC2A 5DT2A 1YBMA 4LSZA 3H18A 4IJVA 1Y63A 4YJHB 5FL7A 3BWVA 4ND1A 1KGSA 3PK0A 4AJOA 1B6RA 2XOXA 4R0VA 2QUAA 3AZQA 3UKJA 3FOEC 3B20A 2C96A 2B1QA 1U81A 2O23A 3H5OA 4DEVA 1L1QA 5EJGA 4M1SA 4BZZA 4KX5A 1G3QA 4TSRA 5AQ1A 2W11A 3C1UA 3ND8A 4XDYA 3NOVA 3ZJTA 5DW3A 3X1DA 2D7CA 5J58A 2GN1A 2PXXA 2PH1A 1YUMA 3S5UA 8LDHA 2V7QA 1ZA1A 3ZPXA 2WSSD 2NTEA 3AJRA 3ILXA 3MTBA 4QA9A 4UU0A 2P6MA 2JAPA 4M0EA 2JLXA 3K7EA 4Z4IA 2ZW9A 2VJDA 1JI3A 4NY1A 1QIHA 3QU5A 4MRPA 2H0QA 4D81A 2XNCA 4GFDA 4U4AA 3ZKAA 5CEEA 3UMRA 3B7PA 5ES3A 3KQHA 3OM0A 1GQ2A 4WY8A 2BMVA 2NW6A 2ZSAA 3S7ZA 2FV8A 2J59A 3K0BA 3HDTA 3SX0A 4E70A 3QEJA 3SZGA 1JILA 4DABA 2FWBA 4PS0A 2EBWA 4EA9A 3RABA 1J56A 4EUHA 3QPVA 3QV1A 1MPXA 3SIXA 4BBZA 4QG3A 1JR3D 2I4LA 1A69A 2GQ0A 2NTVA 4A8TA 4C5AA 2J7PD 1LQUA 3BXEA 4XD7A 4EY3A 3TW0A 3BFKA 4Q1BA 5P21A 4YAWA 5KOJA 1YHYA 4K87A 4BQNA 4JKYA 4WDQA 5DHRA 2VDNB 4JYZA 1NVBA 4Z9FA 1NE2A 1P7PA 1XRJA 2AOWA 5TQ2B 4DJDC 1GNQA 3VISA 1EGMB 2D54A 4CODB 1CRWG 4F38A 1TVCA 4PWZA 3D6VA 1O5IA 3TZQA 5ICCA 4Q1CA 2I6QA 3C3DA 4US0R 3EMKA 3PF8A 4LTMA 3PQFA 3TLBA 3OU7A 1X94A 3LVQE 3ETGA 3RTCA 1LPSA 2H08A 3G88A 1TU3A 2EJCA 3R5JA 4R7GA 4V0ME 3ZZTA 3L46A 3JRNA 3JQAB 5DYNA 4YMLA 1GNLA 1Q0UA 4E5UA 3GIDA 1J09A 3OQNA 3TM5A 4DMCA 2GPYA 3A9VA 1LDMA 5CP8A 2IZZA 5JJKA 1ZCZA 2DWQA 4OHMA 3KT6A 5KU1A 5AW3A 4RM2A 1AQNA 3L02A 1JNXX 1CSEE 1FK8A 2NU8B 2XTAA 5TX7A 3ZI4A 2R2AA 4YX9A 1F1JA 2PZEA 1JXMA 2ZYWX 3WY9A 5KNDD 4OQ4A 1KJYA 1SCIA 2PGIA 2Q7DA 3TIXB 3W8RA 4BFVA 5CGQB 2DQKA 5EIAA 1XLTC 2ABWA 2AOXA 1H5QA 1PIWA 1MIOB 3IVAA 1YZNA 5T6MA 5JH7B 1PD1A 2XH8A 5TRTA 3LUFA 1LDYA 4J76A 2WP0A 4X1OA 3HUUA 4WV3A 3SYKA 4UM9B 4JJKA 3I9V1 3D64A 4LZNA 1EVZA 4NV3A 5DE3A 1LX6A 2GBLA 3HDYA 3K15A 1P4GA 1G5QA 5HKLA 3RYHA 2ZE5A 3UHAA 1XMOB 1R8SA 1IUOA 2PX8A 2VDRB 4MV5A 1SM4A 1XTRA 3SQWA 2Q1YA 1WF6A 5ALZA 3WO0A 2DLCX 1CQJB 2PKWA 2A1IA 2ZRAA 3HMQA 2IE8A 3M2PA 1RKBA 3VX3A 2QTTA 1Q16A 3F8TA 2O2GA 3RAEC 1OJLA 1W5FA 1SRQA 2XNHA 1SRRA 2ATEA 4LDQA 1U9IC 1FNNA 1CERA 1DAFA 2ECOA 3L9XA 3NQ41 4RDCA 2HJGA 4OXNA 3TMKA 3UC9A 1T9KA 3S99A 2PG3A 2C8VA 3QIVA 4ZOLB 3AU8A 3D2AA 3DDSA 3AM1A 1K2VN 1IC6A 4BNTA 5TS2A 3RS9A 1FYWA 4NFSA 4EYOA 1RS0A 2R6JA 3OPYB 3UTDA 1L7BA 4NAHA 3GJYA 2QSYA 2V6IA 3QVVA 1T1RA 3F7OA 3K09C 4EPVA 2R6HA 3QKUA 3U3OA 5C8ZA 5DI3B 4QOEA 3I2IA 4QJ3A 4YCLA 3QUCA 1M6HA 3MWDA 5IU6A 3U9TA 4ALLA 3HJFA 1P75A 2DP4E 4UU7A 3BGOS 4YRLA 5BSTA 1WVIA 4H7DA 4MI6A 3T3HA 1YR2A 3HKEB 5B1HA 2V45A 4ID3A 3X2SA 3AVQA 2HWKA 2WE7A 5KVCA 1AV7A 4KQKA 4DT1B 1VPTA 1YZ3A 3EEIA 4HAXA 5B2ZA 3AV0B 4IJ6A 5JYDA 1AQYA 3PQ5A 3UB3A 3HG7A 1AHIA 3KJFA 1A7UA 2H2GA 2VPPA 4N7BA 4N7MA 4WOPA 5AUNB 3LT1A 4JJFA 1P3DA 4UTPA 4WK2B 1FVFA 2YYYA 3AY7A 3ZE6A 1M6YA 4MX8A 4IOMA 3FMIA 3IR6A 4Q4HB 3KQLA 4UCXA 4Q7QA 3WK8A 1U3DA 2ZEJA 2I1WA 1O2DA 2JD1A 4G5RA 2IYXA 2JW5A 4RF5A 3LCUA 3G2MA 5JCOC 2G63A 2W93A 1DVRA 2QRKA 2YXLA 3JQEA 3DXZA 3K9LA 3QYFA 3S0JA 5JJCA 5JTTA 3PGA1 2X3YA 1GTJ1 3K1JA 3IE1A 3RYHB 4P9NA 4LJ6A 4EYKA 2CB9A 1FQOA 2FWPA 1DRUA 2Q1SA 2IEGA 3EVZA 1FL9A 3U4HA 4E2XA 4JU8A 1PGNA 3I01A 4KXFB 2CFRA 2H92A 1CDZA 2ZCVA 4BMOB 4DLZA 2NIPA 3NT2A 4WBNA 2G4VA 5ERYA 3I5XA 3GN2A 1ZMRA 5FLYA 3RHTA 8AT1A 4JOCA 4JDUA 5LQAA 4HQ0A 3R7AA 1E2DA 1UT8A 2A35A 3L4SO 2WPDA 4RPGA 5AOCA 4AJ1A 1VL5A 4LGMA 4EB6B 1Z07A 1FU7A 5F5LA 6NULA 1KF0A 3PKJA 3QXSA 5E9AA 4DDTA 1F20A 3D4BA 1VLHA 1XLWA 2FSUA 1DTWB 3IUNA 1K7EB 3PV0A 1DE0A 1W5TA 1F2VA 4RTRA 3LC1O 3WK5A 4IDDA 2DR0A 3BAZA 5IYZF 3SC4A 3ANSA 3CRQA 5J2UB 3HCAA 3IIIA 3BK2A 4E0BA 3H9CA 3OOWA 4F3YA 3ZZMA 2NM0A 5AKHA 2PZMA 4QSHA 3N8KA 4DCJA 5CDHA 4OK5A 3KYJB 4YUYA 3I5YA 1J1UA 4L8YA 3ETLA 4RJLA 3KSRA 4IZOA 3GFRA 1UUFA 2JBAB 2J48A 1PE0A 3ORHA 4K9KA 4DBLE 3AVVA 3QVJA 2OECA 1IXRC 4L85A 5KHLB 2NUBA 3QVLA 2M6RA 2A5FA 3B12A 3MTJA 3DZFA 4GKAA 2DYKA 3P2OA 1DOZA 2AJCA 2PA3A 3C4QA 3MJVA 1MB9A 1KSGA 3DAPA 4F85A 4NIMA 5IHXA 3K1ZA 1J7KA 1P0FA 4DQKA 3T7SA 1ONSA 1JHMA 5D84A 1IBCA 5FEMA 1E2JA 2OHGA 3X1WA 4UM9D 4BO6A 4B73A 4F1JA 4DV3B 1EA5A 3AUAA 4MLCA 1Z8FA 4H7JA 1FFDA 4L8LA 4WRRA 4I14A 5I7UA 1WMEA 3NVKI 1CQPA 1NNEA 2XVMA 4QDOA 3TRKA 2ZI6A 4A2QA 4LTDA 2JIMA 1SELA 2IIBA 1M8FA 3DF9A 2GTIA 5C31A 5M3BA 1ZNZA 2AF3C 4HJRA 3UJ3X 3VH3A 4GZ5A 4O4HA 3K2BA 1XNRB 2IELA 2QYOA 3KHUA 4X41A 5HR5A 3K20A 5CM8B 1VJGA 3KPYA 4K0RA 4B0OA 1XDUA 3DG9A 3H2IA 4REQA 3UVEA 2XUAA 4ZVLA 3D2LA 1EI9A 4BVFA 2PT6A 1VCOA 1STOA 5LZ4A 4JUCA 1VXRA 3UK7A 4H7KA 3RHSA 4L8VA 3KB6A 4FYXA 1SK9A 4BVHA 1YASA 1ZQ9A 4NI5A 1GITA 2JGMA 4MYHA 2OP1A 3G89A 1JQKA 3UHOA 2WKPA 1P6QA 2FEWB 1AS0A 4PLCA 4M6WB 3W7VA 5F7JA 1P7ZA 3ZDAA 1SU7A 3HDVA 3LF1A 4IHJB 5IS2A 1NNI1 3DZKA 3GBPA 3LBFA 1WMBA 5J4YA 1KMCA 1TJPB 4PZPA 1JVBA 3IAS6 3JQCA 3P9CA 1YRYE 1WTCA 3FUVA 3NHMA 3FLBA 3RC1A 3I09A 5MF6A 3C6QA 5D87A 1OI2A 2XCUA 5FUQA 5GZ1A 3D0OA 3H0KA 2X8JB 3KLMX 2P4QA 3QW2A 1U8ZA 4YMWA 4BTEA 5TIIA 4C4PA 1SXPA 3N76A 4MYDA 1N5RA 3OQIB 3BRQA 4BO5A 4ER3A 1PJLA 4PLVA 5CITA 2BMDA 2EWVA 1HSZA 4X1KB 3HNOA 1AQUA 4LEIA 1PZHA 2J3MA 1SCDA 4CMIB 2ALJA 2FQQA 3RIMA 1ZXBA 3QVWA 2PGJA 2F48A 2R3SA 2Y76A 1OREA 2Q49A 2RHRA 5ENVA 5AW2A 4QUBA 4A8JA 4HNAB 3ROKA 3TDKA 1FDRA 2R5NA 2C77A 3E70C 4QXRA 4XSVA 5KJFA 3F5DA 4UOQA 3FZGA 4NZ9A 1R6VA 1YJQA 2X2EA 4PFSA 1HORA 4BEWA 3ELYA 4WLFA 4CDMA 1BYIA 2VC2B 3DBOB 4FHFA 3DCIA 1TIBA 1TEVA 2A0WA 2OR3A 2V98A 3OOJA 2HXSA 5EKXA 3TE6A 3TZLA 3ICQB 2OBXA 2C9CA 2W6NA 5FTMA 3ZWAA 5HFAA 5KREA 1KFJB 1KMHB 4J07A 4LJAA 3TMYA 4C0KA 2D5LA 1J06A 3T8YA 1QIJA 3WSVA 1ANKA 1N4AA 1YL7A 1DSSG 4UOEA 3RV4A 3U5ZB 3A1NA 2IYAA 1X7YB 4QLAA 5DN6D 2DSNA 3WLQA 2RI6A 3GOQA 1H69A 3T3OA 3WBJA 1CB7A 3GFTA 2R1VA 2X0IA 5ALPA 1E1KA 4QUEA 2HDWA 1LFDB 2UZ1B 1LNQA 2QGZA 4EVQA 2AWNA 2QV7A 3MXTA 4WNYA 2ZRDA 2Q5HA 3QWBA 3QBDA 1Z0KA 4GUDA 5CDSA 2NPFA 2JLWA 5LQUA 3PT9A 4Q82A 4TKVB 3KYCB 3VI3B 4HGNA 1M2FA 2QD2A 2H65A 2O0LA 3VTFA 5B57C 3FSGA 3PJFA 3DV2A 1R6DA 3AM3A 4XASA 4FZ3A 3RR2A 3DTVA 4C89A 1VZ2A 1TFUA 3JTEA 3QKTA 2WAYA 3ZX5A 5HYVA 1JQDA 1KY4A 1X80B 3GD7A 4TS1A 5F1YA 3NM6B 3ES9A 2C1ZA 1Z82A 2M1ZA 1UADA 2AGVA 1V5GA 2GNOA 2ZIUB 3VPCA 2FMTA 4X8HA 2PL1A 3IB6A 1GLGA 2NNWB 4TPKA 5JASA 5KAPA 2J67A 1ZM9A 3K9CA 2OPBA 4GPZA 1Q6ZA 2A5LA 3M0EA 4Z2YA 1QH9A 3O47A 1FFEA 4LF5B 3I73A 1UC9A 1JWBB 4FONA 2IHNA 1OGIA 3BTSA 4PICA 4LV6A 1Y6FA 3GDWA 2C2GA 5JCPA 1MAHA 4YAUA 1FQKA 1E89A 1W9HA 2LV8A 2ZTMA 5BO5A 1FQJA 4QREA 1ECCA 5EXPA 2QP3A 3HFJA 4JNCA 1INLA 1HTBA 3V4VB 2O5EA 1CUCA 2F7SA 2G9QA 1T4BA 1BFUA 5IJWA 2XWQA 3DWIA 2JI8A 2RBKA 4BMYA 4PHFA 3CPJB 1W96A 1G1MA 1FXWA 4EPTA 1JQEA 3DZ8A 1I9CA 5HKKA 2C94A 2VJQA 3A2KA 5B1DA 3PNPA 2BEVA 3R3XA 2Z6QA 1KYIA 3EC7A 2FSSA 3CF2A 3ESRA 2AFIA 4UVDA 1LBQA 2JIZD 1PEAA 1IZ9A 4O29A 4DIBA 3EC2A 2AR0A 4U3JA 2EAUA 4ALMA 4EKGA 1A9XA 1A4XA 4X95A 5AK5A 1GA1A 1B2RA 1SU8A 2OFPA 8GPBA 1XEWY 3ODGA 2WWYA 1QQAA 2Y67A 2IP2A 1ZFNA 1NJ6A 5IJ0A 2IHZA 5BSKA 2E55A 3FMVA 1QPBA 3V5NA 1QVWA 1Z6XA 1NNLA 1O9HA 2WFAA 2YINC 4BMPB 3O4HA 4N0MA 3LHDA 3QM1A 1XJQA 4Y2SA 4QAQA 3VH1A 4BNMA 5JNRA 1UOQA 3JWGA 1RXEA 5EMNA 4J0IA 5DNYB 1IHDA 1S3IA 2WIBA 2ZB3A 3FY4A 4UVGA 4LC0A 4CKCA 1O97D 3C87A 3NTVA 3WYNA 5EZYB 4TSFA 3KUXA 3ELDA 4ZYZA 1XYGA 2V97A 4U9UA 5KX5A 1N5DA 4LJ5A 4UNIA 3IV9A 4FIDA 1KYTA 5B1EA 4G0YA 4ZDKA 5K7SA 4HX9A 1A4IA 2CVHA 3CUUA 4O3FA 2M32A 1L3BA 4JVNA 4OK6A 3FSEA 3LQRA 2DCMA 2F4NA 5IK2D 3CZAA 4IHAA 3IC5A 4U7JA 2WU0A 2X2PA 3IBGA 4IFTA 3A6EA 3UUGA 1Q7TA 3ZU4A 3EQZA 3KQMA 3TVTA 1T2DA 1WXIA 5TT1A 1TRHA 5A2GA 1LEHA 1PR2A 3EXG1 2I4OA 3H0CA 1I36A 1NSYA 2HM7A 4OGKA 4QYSA 5ELMA 2F9FA 3OMXA 3ZIAD 5DWDA 4XM0A 4CMHA 4E14A 5IBCA 4ZOQI 4D9HA 4YJ2A 1BJTA 2BKXA 1Y8AA 3UJAA 3GDOA 2J9FB 2UYCA 3IEVA 4HEJA 4MR9B 3TTSA 1RXSA 1CVRA 1Z7WA 2ZJZA 4WZAE 3MCTA 3ZLTA 1FYEA 4AU1A 3OPXA 1GPJA 3LC2O 3ND5A 5SZJA 4EHKA 5BQFA 1QLJA 1Q3HA 1DKNA 1Z38A 1HGXA 2FSVA 2OCKA 1B6SA 2WJ6A 4MTCA 4V0NA 3A3PA 1EUZA 2BRUC 1DEOA 2ZZMA 3TRFA 4RD4A 3VR3D 3ZTYA 2QGFA 5G4KB 4YJFA 1IULA 1BU5A 1CDOA 1PGPA 4FM9A 2XMSA 1PR6A 4TL9A 3U4CA 2B78A 4EJSB 4TKMA 2NAPA 1JLRA 1K66A 2B4QA 1QU3A 2WW8A 1GEEA 2OKGA 4OXYA 4IUYA 3E81A 5JEDA 3NDIA 3UIEA 2X22A 5K51A 4HUJA 3TZEA 1V1MA 5IMSA 1ZKDA 1B23P 1RYEA 3WAKA 1I6WA 5T4FA 6YASA 1IUPA 2WHXA 4K3VA 5A71A 4PW0A 3QF7A 2CLCX 4CW7A 1K6XA 3CS3A 3ASZA 2ZJ8A 4MVCA 4QHYA 5A4KA 3PQ3A 4G89A 3AM5A 5FLKA 2QTLA 5CFNA 3L43A 1CJSA 5FNVB 3O31A 2IHJA 4QQ8A 1I51A 2Y77A 4IKEA 4YAEA 2O2SA 4X6YA 3MB5A 4J1TA 3ZGNA 4I50A 3TOVA 3RRZA 4YT4A 3V2HA 1H0KA 1BCSB 2Z4SA 2C4NA 1WETA 2X1VA 2ZROA 1PR3A 5IT0A 1OHHD 3T5CA 3VYUB 1UT5A 2Q5OA 4QAJA 4EOGA 3KZOA 1DCFA 2AR9A 5FBVB 1W0KD 1U94A 5C3MA 1DJLA 1S2NA 1L2TA 3EUFA 4K2AA 1MC8A 3NFYA 2JEYA 4P92A 3IPYA 2OBFA 4ENWA 1F8FA 1S8FA 4TVSA 1KRXA 3C7CB 1CF4A 2HHLA 1QHXA 3S8MA 1VFNA 3CW8X 1U5CA 4HY3A 2QEQA 3V1MA 1XZEA 4ADSG 3WADA 1KJ8A 1P91A 2WYVA 2BMWA 1VKJA 3M70A 4X66B 1DOAA 1DP4A 4FMCB 4BO9A 4J2HA 1W8DA 3F97A 2GNPA 1PJZA 3P20A 2ZYGA 4K6KA 2AW5A 4L28A 4NKRA 4ENQA 2Q0SA 1XCLA 1IK6A 4K9DA 4YJ2B 1E32A 3FOCA 4DKJA 1K98A 4EGQA 4NOKA 3L8GA 3JD1A 3TX2A 5DLYA 2F9LA 2X2FA 4N12A 3FMOB 4KU4A 5ALSA 5FPHA 3PLRA 4L75A 1VSBA 4Y98A 3ZCSA 2QUZA 2VK2A 5CVUA 5FUWA 2D5BA 5AIBA 2A0KA 2DFLA 3IAHA 1J2EA 2P7HA 4OBWA 1QPZA 2BFWA 4PIPA 2ZM6B 1SXHA 4U7FA 3WKEA 2JLBA 4IKPA 4ER7A 1QV9A 3OLYA 2VTBB 2X0FA 3MMSA 2MIIA 2Y71A 4ZQGA 4YDRA 2XZDA 3HUDA 5JJIA 3EIXA 3ONFA 4YACA 4FGLA 1J1IA 2IKQA 2OQ2A 1S2MA 4R5MA 1KVTA 3EVGA 3L8CA 1V1MB 4HDRB 5K4GA 3U16A 2ARKA 1D2HA 4X60A 4JJEA 3R7SA 1F48A 3TI9A 1XBTA 5LLDA 4BWGA 2FN8A 3G0OA 1T6ZA 4PRKA 5F9MA 3VZPA 4F11A 3ANLA 4GMHA 5FPKA 1EJ6A 1PEKE 3IDQA 3KSMA 3HC7A 1U31A 4UBLA 2FCRA 3CVWA 5FPPA 3ZE9A 1M2NA 1M83A 5B2EA 1KEPA 3OZTA 4D92A 5KSOA 2BKLA 1C7EA 1JTEA 3ITKA 1GCAA 5AI9A 4CKZA 4FDAA 1ODFA 3T54A 1I33A 4U8GA 4EHBA 2RGRA 3OFSA 1WCIA 4I5DA 3EDYA 1PS8A 1SKYB 4AZ3B 4YRIA 3KETA 2XNKA 2D59A 1EG7A 5F35A 3ADCA 5JEEA 1B43A 3IVXA 4IO1A 1HT0A 1WDTA 2QG4A 3T1VA 2ISSD 3OPVA 3EZ2A 1KS9A 3EEQA 4WXRA 5EMHA 4BBJA 3ER8A 5KO2A 4YAGA 3FDIA 1EP2B 3RV3A 3CH6A 1O0SA 1QHSA 3THWA 3A6PC 3H8SA 5KTNA 2AOUA 3M4JA 3HS3A 5CJ2A 1RWMA 3E3LA 3BH7A 4A5OA 4H3HB 2YICA 2JHAA 3ZBPA 1TXGA 4QWMA 3BE4A 2ODBA 4LYFA 1ZIDA 2WG0A 4QTZA 1Z6QA 2HQRA 2MT9A 2XADA 4RH3A 3UAGA 5CDTA 3H1EA 3LX4A 3JWPA 3EC1A 4GM1A 4BLSA 1YE5A 3ABRB 3S1LA 5A5DA 5KQRA 4UAVA 5M34A 4UULA 4Q3BA 3WWZA 4MI9A 1OWMA 3W9UA 4CKYA 5I3CA 1EZZA 4CKBB 2VH1A 1ZD8A 2BBTA 2Y8EA 3EFBA 3BE8A 1CWUA 4AJ9A 3SQXA 2PSFA 1KEEB 2I3AA 3G5LA 4HWRA 5DGCA 5FBHA 3T1OA 3OTHA 4WNIA 4B47A 4B6OA 2C9DA 2UZAA 1LSUA 3LK7A 3FNBA 4LWPA 1JT9A 2ZU0C 1MQ9A 1UWKA 4FYWA 3RKRA 1JIIA 4GECA 1NXXA 3AETB 2AF4C 2XI4A 3BQMB 1T4CA 1K5PA 4NF2A 4JLPA 2YFHA 1YL6A 4H7IA 3MVEA 3VPXA 3LQFA 2IEYA 4U6SA 1CR2A 2IE0A 2PM8A 1JZTA 3U1TA 2Z5FA 2E6UX 3BORA 3OD1A 4UU8A 5FYQA 5A6SB 2FPIA 2ODPA 4OJMX 5J2TB 1RWWA 2BCJQ 1I4DD 1BROA 1L5YA 5ILOA 1LBTA 2XECA 4JA2A 4L0QA 2NO7A 1FDWA 3LY7A 4M98A 4NYMQ 2VJAA 4WK0B 3V1UA 3IAAA 1ONOA 4KTTE 2N1MA 3WTCA 4G1UC 3NJRA 1DV1A 4MYRA 4EJ2A 4WI1A 1PP4A 4NDZA 1I5EA 1FDVA 1SC1A 3P52A 3MYYA 3QQ5A 4XQGA 1V4BA 1VYHA 1DS6A 1W34A 2W2TA 1B0UA 3N86A 4BVAA 1B74A 3A6KA 5AD1A 2UUBB 5EZSA 1BGWA 1RZRD 1CRQA 3O38A 1SG0A 4A8HA 2AN1A 3VO1A 1YMVA 4ZVQA 2O2JA 4Y30A 3JWJA 1CLEA 1NN5A 2PO7A 3OQ1A 3SYTA 4BFZA 4RZHA 2QRZA 2XWJI 3PNOA 5ADUS 3KAPA 4G86A 4JI2B 1UJ2A 2EBHX 2QD1A 1YS9A 3F6PA 3GGPA 3KQWA 4YGXB 3ELBA 4O2AB 1M76A 4YQFA 2VA9A 3IL2A 1HRKA 3QEAZ 1EVYA 4B7AA 3CN7A 4WDRA 3O4FA 2ZTVA 1GSOA 1US8A 1UMCB 2GN2A 2BDTA 2XKAA 3LA8A 4HN4B 2D5IA 2JVIA 2VF8A 2XX3A 4JIMA 3TCKA 4E2FA 4DR6B 1GFSA 1HE4A 1JPUA 4WVFA 5BYBA 4AQYB 2QXTA 3RFCA 4GSYA 1NDUA 1M34A 1SC6A 4N6NA 3NBZC 4GI3A 2GHIA 2OXCA 2POCA 3P2KA 3UY4A 3OIVA 1JL3A 3HGQA 4LMRA 2QMHA 3V2GA 3EVNA 3ABQB 5HE8A 1GQYA 1O77A 2FOXA 2LDBA 3QJYA 4PZEA 3V4LA 4DRXB 5KTSA 1EM8B 2VZEA 3PXUA 4ND8B 3WGUA 2BW0A 4EMUA 4NDAA 5HK9A 3KQNA 2V5VA 2B2XA 2D06A 3QVXA 2NZ2A 4ARZB 2VUTA 1MV5A 3DZGA 1K7XB 5DTRA 1WZEA 4PLYA 3ESXA 3Q2IA 2PAAA 4MVYA 4EW3A 5ADHA 1J20A 2QYSA 2XMBA 4YVFA 2F1KA 3L4JA 4Y2HA 4QUKA 1ISJA 1YUBA 3ONEA 3OT5A 2BI8A 2CEKA 1NYLA 4AMVA 2JKZA 2PVSA 2H2IA 2YWDA 3F47A 4BDSA 4E5KA 4MWBA 1RPJA 3NHSA 5EVJA 4NS1A 1RLIA 4D4IA 1Z8NA 2VVTA 4LKRA 1OBCA 4B2IA 1TUGA 5GPBA 3U3ZA 2XCTB 1VPVA 1W0CA 3AHFA 3QVGB 5SY6A 4CXMA 4YB8A 2FW1A 4V0RA 3OICA 3ETNA 4EYEA 2QMUA 4JYBA 4R98A 3HU1A 2DFTA 1P0IA 1RMTA 3MRTA 3AHEA 4IOKA 5C32A 3RS2A 1SZJG 3TQCA 2RAPA 4F86A 2I91A 1VJDA 3RYIB 4D2IA 2O8FB 4Y2RA 3OEED 2YFKA 1R0RE 2DUMA 3GLGB 2C7QA 2Y0EA 1Y7PA 3AV3A 2GA8A 1E4EA 3H6GA 4MK4A 4WX2B 2A57A 3V2UA 1K5GA 3FM9A 1PUXA 3R75A 1GU1A 1SURA 2FPGB 1RRFA 4Y6PA 4NBVA 4H27A 1JXQA 1X92A 1TYDE 4FHZA 4JUBA 4ZJPA 2GAAA 1A2BA 2XD4A 3LGAA 2MSCB 4CGYA 2PGNA 3D7LA 3IPXA 4IDBA 2BEUB 1L8AA 1ZN9A 2DHRA 4F3NA 1WY7A 2R8YA 2MYUA 2PYDA 1P5HA 4YT5A 1Q22A 2I0FA 5AK0A 4ZVKA 4KACA 3QE3A 4B3HA 1UDXA 4IIGA 1JYSA 3GRYA 3QEMB 1NLYA 1PCXA 1GP2A 2HIGA 5I47A 3SXUB 3LOQA 4OFZA 1L5HA 4GXQA 3A05A 4GG1A 1JALA 1JH8A 2Q4DA 3L0IB 3GPCA 4O6VA 2B8TA 4ARAA 1F14A 2AEFA 2Q8QA 3GCGA 2XGGA 1AKNA 3L82B 4MRSA 1EFVA 2AOTA 1ZK3A 1JQBA 1QOPB 1N9GA 1Z0JA 4RK1A 4KXWA 5IWAB 3QPWA 1P62B 1CQIA 4WQMA 1JPVA 1NDHA 1PJRA 2Q5EA 1E3IA 1URPA 3M3HA 3TECE 1CEEA 4XSHA 3IEKA 2ZB7A 1YD7A 1ZD2P 4NPCA 4BKRA 4CEJA 2EQAA 1RE1A 4BGVA 6PFKA 3DLIA 4DV4B 1VLMA 3WKDA 4NBUA 4Y18A 5IYZA 4X3CA 2FX2A 1E2QA 3WDMA 4IIFA 1A1VA 3DPUA 5TVGA 5KNLA 3R9XA 3K9GA 1ENOA 2IOHA 2Q5JA 3KJHA 4BX0A 4GEGA 2GD6A 4KN8A 3OOYA 4BRSA 4QYWA 3CJQA 3H3FA 5AJYA 4UUMA 2PLAA 2BCEA 5JAQA 1HR0B 2WQZA 4IOLA 4X6LA 4DYVA 1HFEL 4CM3A 1OH5A 1EUCA 1VLLA 3EMDA 4NE7A 3VUFA 1LI7A 2ECKA 1AGYA 4DDMA 2C0QA 2WIKA 2IWHA 2D62A 1Z5UA 4G5XA 3LHIA 1R4ZA 4LOAA 2XSZD 2GEVA 4CR6A 5LVAA 4C3VA 1FY2A 3QG5A 3SX2A 4FP9A 4HLDA 1P1CA 3MCZA 3U6BA 2WBLC 4MGEA 1YACA 2C4TA 4NRDA 4EITA 3R5TA 3J81k 3G1UA 3K4PA 4YI3A 4HFRA 4IHQA 3C8ZA 4FFSA 4ENRA 5FOQA 1IZZA 2GEJA 2BKAA 2ZUWA 3HR7A 1U0JA 1X7GA 2B7LA 2VNSA 4IFEA 4E4YA 3DXXA 4J0QA 5KAMA 3AF0A 1OFTA 3U7GA 1V9LA 3PHCA 1D6NA 3B13B 2Y1WA 4HZUA 4WH0A 4OATA 5J23A 4GPEA 5AVSA 3ZD8A 4XJVA 1BG6A 3T5PA 2Q6KA 3DHWC 1SXIA 3DDCA 1CP3A 1NVMB 3DUWA 3E9NA 1NN1A 3FKSA 5BN4B 3RUDA 3ZZ0A 4AP5A 3COZA 1Z28A 3FNIA 4IZIA 3WJAA 4LRQA 5KNCD 1NRIA 2IPLA 3CXRA 2HRRA 2C2ZA 3CX7A 2R6CA 4NBSA 4YO7A 3AR2A 4PSVA 4RY8A 4UFNA 5AESA 2NYUA 4WESA 1FNCA 3DBVO 4BQIA 4WJZA 2ZJ2A 4D41A 1QUFA 5D85A 2QTVA 4HL6A 5D3MA 4RTSA 3H2HA 3PNLA 2J3QA 2OHIA 1G5TA 4MYTA 3URMA 2ZBDA 4L7QA 4NNJA 4AJLA 1SD1A 4OB8A 4DDVA 2P2ZA 1JIQA 2HWUA 4LXGA 1WXEA 3U0BA 3L8MA 2PZFA 1ZICA 4NQZA 2JLZA 2YW2A 1V3QE 4OJTA 4QUGA 4KK3A 1KZ6A 2IOYA 2I2FA 3U7HB 5EP4A 4OH7A 2CT8A 1SKBA 4QFBA 3EY9A 1J5EB 3DO6A 1U02A 3GB9A 3FHTA 1C9NA 2Q3LA 1I13A 1F3OA 2FQXA 2OCYC 2WTMA 1PG0A 3I2KA 4PYOA 4ZCIA 1TE2A 2FZWA 4BGIA 2WC1A 3L9WA 2OD2A 4J0JA 4WADA 3GAMA 3C5EA 4X1IA 4R1TA 2WY2D 4YUXA 1AD2A 2R96A 2YJ3A 5IJAA 5EMKA 2IV2X 5IM5A 1EXNA 4MV9A 1MX1A 4MS3B 4QATA 1WVGA 4XGRA 1PEYA 5EHIA 1RRMA 1U9CA 3K70D 3GAZA 3HADA 1MOSA 5C7IO 1L1FA 4YS6A 2OHFA 4AXXA 1NDQA 1Q2XA 2B1IA 3P5BA 5I9BA 1GQSA 1G8PA 4RKWA 2BFEB 3BWDD 3H2JA 2D3TA 4WZBA 5I8WA 4A1OA 4JUIA 4F84A 3N2IA 1OOEA 2IHYA 3DH0A 4PN3A 1O57A 1OPRA 4RPJA 3I6YA 1F2DA 3IXMA 1NURA 3AKYA 4RDIA 3VHQA 2GASA 1GTSA 4RY0A 2O48X 4MYCA 3PX2A 1RRVA 2QI9C 3M83A 1HETA 3N07A 3Q0IA 4JCCA 5IAKA 1YE3A 4NYIR 3BB1A 3OZGA 3UJCA 1Z39A 1RT9A 3PUKA 3TXXA 1NMEA 3EWIA 1T1GA 1JG4A 1IJEA 3F7TA 5EE9A 1D7AA 3ST7A 3UF0A 1R18A 3QXGA 4AVYA 3C7KA 1XXHB 4NV0A 3RH0A 4XWAA 3GCXA 3HE3A 3L0BA 6ABPA 2JATA 5ICEA 1Y0BA 3KLBA 3OIGA 2GFIA 3HJCA 3RSQA 2EX0A 3D6FA 4FKZA 4TV9F 1I94B 1DAHA 3DP9A 4LV5B 5IH7A 3EF0A 3GRRA 4FE3A 2X5KO 2VUSA 3RRMA 2WWXA 2OLJA 2WG1A 2X0JA 1GEGA 1O94A 2I2CA 1QJCA 1J70A 1TYAE 4ZQCB 1X7DA 1D8AA 1PV1A 3DLAA 3ODPA 4IY1A 5HIJA 5FX2A 1DJQA 2R85A 2BTQB 3I9KA 3K6RA 3L6CA 5FRDA 4EW1A 5FI1B 3TIIA 2ZRIA 4CETA 3EN0A 4RL4A 1KKUA 4URFA 1CZOA 1ZKMA 2OZVA 2ZWPA 5K0TA 4WZAA 1GRCA 1UOOA 4RSRA 1MO4A 4KIUA 4FD3A 4F56A 3RVNA 2IITA 2QRVA 3BOSA 4GGPA 3WJ7A 4URVR 5J4VA 4JBIA 3SKYA 1V1RA 3PDJA 1XP5A 2DMRA 2QAIA 2H1IA 3FPFA 1JH9A 3GD5A 2V74B 3VDNB 1NVFA 1RXYA 2WUGA 4A6DA 3I6BA 2Y0CA 1IFXA 3KZVA 2QX6A 2VNAA 3HGTA 4Y7DA 4P4NA 3A6FA 4IG4A 3NBQA 4TOIA 2O7NA 2R6FA 1NVDA 4EG4A 4CGZA 5LUAA 3DYIA 3MS4A 1T15A 2FFAA 1T2AA 3AEXA 1Z88A 1C3XA 1UM9A 2MTBA 3EXG2 2BOVA 1HXHA 2HB6A 3L84A 1ZL0A 4QOGA 4YMIA 5D01A 1L7EA 1XX6A 4WZBB 2QD4A 1YC5A 4DR7B 4A8JC 3LVBA 4B76A 1G19A 4EX6A 1FRVA 1TJ4A 2ES4A 1JIJA 1HE8B 3DONA 5JPCA 2IYTA 3GG9A 4U02A 3DBIA 4Y7CA 4AMBA 3EUWA 2HRCA 3D81A 2E37A 3AM4A 5DNVA 3GRCA 3H7AA 5FCDA 3SYRA 1U4NA 2LW7A 4K8RB 4OI2A 3V33A 1RAEA 4CU2A 1IXYA 4CVNA 3NHYA 1C30B 4YQEA 2PEYA 2HADA 2ZS9A 4H1HA 2ORYA 3EE6A 5JVDA 1IVNA 3X2EA 4Z0TA 2BSQA 5CGZA 3FTQA 4KWCA 2QR3A 1AKQA 2G1JA 5KQLA 3UYKA 3EW7A 4F8JA 1RR6A 1WTAA 3TSWA 5J40A 1J39A 4OQQA 1NVTA 3I4CA 3K16A 1CDDA 1TZMA 1U9JA 2FLVA 3FFXA 2JLYA 4ZRDA 4AY5A 2R1UA 3PRJA 1U8XX 1ZGZA 1G2PA 2MYPA 2X8WA 3OZFA 2D3WA 4MQFB 3P45A 3SSMA 4BU1A 3BSFA 4LBVA 1P2FA 3JXEA 1WY5A 4UJ3A 5CB0A 3C6MA 1K08A 4QUDA 4UEJA 5SYAA 1UANA 4L27A 1VFPA 2R8PA 1U3TA 1KI8A 4FE7A 3U9LA 3T4UA 3I04A 2G8NA 4HDSB 1XDGA 4JGBA 2PRZA 3P2IA 1PLLA 1MPTA 4TTRA 5DWQA 5FAXA 5LDDC 2AZDA 3V4SA 4YUAA 1Y34E 3EAQA 5JQGB 3NWBA 1DUVG 4GX1A 3D3KA 4BJ1A 2V7PA 5LOVF 5IVKA 3BRCA 5BN5A 1CR4A 2O6HA 1IIRA 1EK2A 4NCBA 3L18A 2QTNA 3GP3A 4UE3S 2PYIA 2ZLBA 1TW2A 5FNVF 1CF2O 5FHQA 2DY1A 2QX9A 2GT1A 1YUNA 4CQNA 3NOOA 5FTJA 3TDMA 1C8BA 2D2EA 5A1JA 3BEDA 3KEMA 3LQQA 4KXMA 4P8RA 5JJLA 1FUYB 2BM0A 3C15C 3DGFC 2VJBA 3LBNA 4FZVA 2CNWA 5EQTA 1U3CA 1XD9A 4LVUA 1ORHA 1YZVA 4I7EA 1XN1A 1N5KA 1MF7A 4CHGA 3R7LA 4PLGA 4JVLA 3C7TA 3WIEA 4ASUA 3NU1A 2FR0A 2QL7A 2UYQA 1MHTA 1H4SA 2C83A 1AB6A 2ASEA 2DFKB 3I1YA 4H6WA 4RIIA 1VSUA 2JD0A 3LUBA 4MCHA 1OXKB 3R0VA 4XE5A 3KUDA 3QP9A 2YVLA 2WJAA 4EHHA 1NIPA 4WXMA 2N0SA 3UO8B 5KYVA 3WK6A 1GRRA 2I3GA 5KNBH 2I03A 3GK3A 1NXWA 4FGKA 4ZPXA 2WG2A 2IYFA 3FYUA 4R9NA 1ZH6A 3RJMA 1Z0AA 1GGEA 3D2CA 3E3OA 4RA9A 1J2YA 1UJ6A 3QF4A 1U7TA 4QPCA 4L5AA 1XHLA 2IK8A 3OZEA 2F1IA 3IXLA 1SG6A 4UBJA 3TKAA 2CNLA 5MHTA 1KKMA 1TUEA 4FYVA 5CYOA 1MAVA 2J3KA 4DRYA 3MB8A 2I34A 1E77A 3H75A 2HMWA 4XGKA 3ZW8A 1FBTA 2XMCA 4KQXA 3TQHA 3EA5A 3HDGA 4IWNA 2V3CC 4MKIA 4ZO9A 3ZW9A 2OENG 4HV4A 1NBOA 4QUIA 3PEYA 1EFPA 4ZDIA 1TUBA 1N0VC 4K9OA 2X23A 1R4NB 5EWMA 1A4UA 5FBQB 1MVNA 2G4CA 4EHNA 2IHTA 4GKBA 3NPMA 1BHO1 3I1FA 4GR9A 3S2IA 1L3CA 3CUYA 3JALA 4TRNA 4DQLA 3OU6A 3BMCB 1EZ1A 2MSDB 3ESQA 2CLOB 3FFWA 3NXKA 2JIOA 4AJ2A 2G1PA 3CF0A 3FNQA 5BOSA 1AUXA 1Z0IA 2P4SA 3BD8A 3AYXB 4PLZA 1NP7A 3A9WA 2HL6A 2LD4A 3HB9A 4CZ2A 4DXDA 5JWHA 3RFXA 4B31A 2MSNA 1XRPA 2IYZA 1ITZA 1O87A 2B30A 3HU2A 5CM9C 2O3SA 3KYBA 2HK6A 4FGJA 5FEUA 2AW3A 3WGZA 3AJEA 3FTDA 2HCFA 2VRBA 1HOTA 4OJNA 3SQLA 4ODIA 4CM9D 2HNAA 4LRUA 5CVJA 5BQXA 5ALJA 2XKKA 1DMRA 1NW8A 4MPJA 5CA0F 3SF0A 2FP3A 1WABA 4IUCS 4UPDA 4PPYA 1CZUA 1OMOA 3ZK7A 5JD5A 1KEZA 1HY3A 4F1KA 1FP6A 1QWOA 2D2IA 1P2VA 2VSNA 3QH4A 4JJZA 4UUOA 5FPTA 1D0VA 5FADA 3C48A 1HQCA 2XDAA 1QS0A 3NIBA 2WZCA 4K6HA 4V0QA 4CIWA 3U09A 1RYBA 1T9GS 2I33A 3MMPA 4WGFA 3GT7A 2I7DA 2ONJA 1L7DA 2EG9A 4KMRA 3TNDA 3YASA 2PSHA 5TQ0A 3WGKA 5EJ7A 3PYMA 2FSVC 1P5ZB 4AZ0B 2DM6A 2CXHA 1K9SA 1NQUA 1NXOA 4PX9A 5DRTA 2V8BA 2YWFA 2DFNA 4M49A 5F64A 1S8NA 2A0YA 2F62A 3FHCB 3QNUA 5JADA 2XUGA 3O0TA 5FOXA 3FOZA 4RPHA 1KAOA 3ZNOA 3EF3A 3SFTA 2F4VB 3K32A 1R6UA 3VJRA 2IUFA 1Z36A 3MJRA 1BS9A 3UKDA 1UK6A 4E11A 1KARA 2QXYA 2IZOA 4EABA 3WV5A 5AJXA 2XUQA 5GZ6A 3UTCA 3GEIA 3GV0A 2IEZA 3VOBA 2VAPA 3H42B 4HDKB 2JG3A 1EE1A 1TJ3A 4CV2A 1HFJA 1FB5A 4H6VA 4LVCA 1Q83A 1V48A 5B30A 4ZA2A 1ODSA 5FOSA 1TF2A 3VR4A 4ZVOA 1XK6A 4Y0VA 4OXIA 3PNYA 4BLWA 2L17A 1BEZA 1EHIA 4Q9HA 3K92A 2V3WA 2MSWA 2ZRFA 2J8ZA 2WMOB 4J1TC 4OG2A 5FTNA 2ZYDA 2OV3A 2YMMA 1OTYA 3MERA 2PLRA 4GW3A 4L4YA 3V7NA 2LVBA 4PG4A 1N4DA 1OY1A 1C4WA 2FG6C 4IDNA 4HMQA 2VEDA 4NZMA 4UE2A 1BYUA 5E2AA 3UHFA 3W4KA 1NL3A 2L0XA 1KJZA 3AIOA 4F3KA 3EASA 1Q95A 3VHRA 5HJ7A 1QOZA 1GR0A 3ZY6A 5HXAA 4V3BA 1B0AA 1P7VA 2QTWB 4N5NA 4RE5A 1B4DA 1QJ4A 4KFSA 4U6NA 4UHDA 4D8YA 1RM3A 3PDUA 4R2JA 2H2HA 3HA5A 4YK7A 4J4TA 4YBRA 1L5GB 4CM4B 1ISFA 2EW2A 3IKMB 3MW8A 1NVGA 1E9SA 1H1LB 4RPIA 2PZGA 4ETMA 1W2WB 4EDHA 1R8XA 1TKAA 3CCBA 1Z2AA 1FW8A 1C14A 5AI4A 4PBTA 1SZDA 3O6VA 3RC2A 1OLXB 2IXFA 4BPBA 4E15A 1MFZA 1FJGB 2WWFA 2ZSUA 3IYLW 3EODA 4MW7A 2AMYA 2YW9A 5DM2A 3I92A 2ID9A 3BDVA 1SHTX 1ZCBA 3B9BA 1KYVA 3JPWA 3CLRC 3ED5A 3P0EA 4I5EA 4O2AF 1AK9A 3SF8B 3GJ5A 1E79D 3WNZA 5TQ0B 1JPNA 1JGTA 1KI7A 4R9UC 3LIPA 4KYIB 3UJBA 4DLKA 1NXPA 4U6QA 1EX9A 3VVBA 5KNCH 2MSLA 5JZ9A 2V3VA 2BP7B 3AG5A 2ZQ5A 4FYIA 2WTBA 4I99A 4Y9TA 1H4TA 3PFKA 3UK0A 3OCWA 2D2VA 2J85A 3FHLA 2VZ9A 3N05A 3OCXA 3OCJA 1SHZA 4KYVA 4E09A 5HKOA 4RF2A 3VPAA 4KH1A 1TD9A 1HDOA 3CT6A 1VYTA 2JIRA 3E5RA 4BWFB 1POXA 2CWWA 2W6OA 2Z8YA 3GO4A 2AVNA 1ISIA 1S8AA 2LUOA 1VL2A 1E1QA 1OV6A 4RTPA 1IY2A 1WMDA 4X64B 3UAYA 3GG2A 4NENB 1QF7A 1FFHA 4ZEXA 4AO8A 4B7ZA 2H1LA 1NW5A 1IHUA 3BMOA 3SZMA 2YQ4A 2AC2A 2BGKA 3L0CA 1U6KA 1Z0ZA 1YB4A 2FFQA 2POQX 2EL7A 1DFIA 3PD0A 4JQYA 4HH1A 3DKRA 3G1TA 2UUOA 4GKKB 3LPNA 1QH8B 1CVLA 4RORA 4ZMBA 2BE9A 4CMBA 1AVTA 2PRIA 1GGJA 2V1XA 4PSAA 3O9ZA 7REQB 1P29A 1JJBA 4EPRA 1SKYE 3G8YA 5CXXA 1I30A 2HJSA 3AIMA 5BVGB 2JFQA 4LQCA 2NADA 2B99A 3HLKA 3E22B 4RLSA 3TUJC 5LQCA 5GQSA 3E5NA 4MQEB 1GU7A 3TCNA 5LLTA 4M7RA 1N8SA 1OLSA 4XDZA 3IO3A 1GZ6A 2B6HA 1QGYA 4ECAA 4QUAA 1UM8A 1WBDA 2GCIA 4FHDA 4OL0A 4LDPA 4TL6A 5IUJC 1H6AA 1U6JA 2X6TA 3BD9A 3LZCA 4BDTA 4DVJA 2ODTX 3Q4GA 3TRHA 1JLLA 4HTFB 2DKFA 4GVPA 1KH3A 2CVPA 3AUXA 2DOKA 3JSXA 5EE3A 1M2OA 3SN6A 1CRLA 1BCRB 4L78A 5BR7A 1G20A 2ZUBA 1KAMA 4JC4A 5E6SA 2EEZA 4C21A 1ZD3A 1KAHA 3CVYA 1H8EA 2NSHA 3L7KA 3ZNPA 3B1WA 2H9AA 4BXOB 1RWXA 4FNMA 4S0ZA 4IH4A 2OD9A 3JD0A 4FLMA 2X5OA 1E2IA 1WNTA 3K3PA 4DADA 3N59A 3IQDB 1IPEA 3WLIA 1USWA 1X7XA 4JOQA 1P1JA 4CCYB 2DKNA 3EG9A 1HPLA 1RJGA 2YY6A 4BVLA 4DZTA 4FYJA 5DASA 4XYBA 1M72A 4G0NA 1A82A 1F5SA 1NMXA 4ZPJA 3JU3A 4LYDA 4MIYA 4R31A 4KR7A 4CL8A 4JJ6A 2JBHA 2KE5A 1AKEA 4U8HA 2PZAA 2H00A 3LDGA 3KQVA 1KU0A 3CBGA 4H15A 1S3FA 1VCMA 1K63A 2QW1A 4C3ZA 5AVQA 2WMDA 2XNDA 3QE4A 2HA4A 4LGYA 4PNHA 3BJIC 1R0XA 3GJXC 4MW1A 4PPNA 1RAHA 3X3HA 2C8KA 1DO0A 3AJ8A 3PDWA 2YC4C 1QGUB 4MVJP 4NABA 1KZYC 2VUUA 4XX0B 2FN4A 1T6XA 1KJNA 3DV9A 2OGUA 2WD7A 2ZS7A 3L3BA 3W4IA 3O03A 2DHEA 5EKSA 5C8YB 5F9HA 5E4FA 1EFCA 3TCXB 5FB3A 1NJSA 3PHIA 1QGOA 1NR5A 2A9VA 3W5BA 1HDXA 2O8EB 2YNMC 4DCNA 2OHOA 2RHTA 1CJUC 1QC5B 3A9UA 1UIMA 1TEXA 1B14A 2GNAA 2NXEA 3OI7A 3FWYA 4YR7A 1M1YB 1WKBA 2G36A 1XVIA 4DBVO 1JE1A 4MV8A 4QGHA 4ER5A 1CK4A 4V0KA 4URHA 1L4KA 4FYHA 1S2DA 4ZXPA 2W2QA 2UV8A 3SG0A 1KU6A 3VR2A 1HWYA 2R6ZA 3KRTA 1DEXA 1TO1E 2YJGA 3OZCA 5BV7A 1H23A 2GYYA 4RMJA 3WL4A 1A5AB 1YSCA 3O7MA 4LHSA 4QQNA 4G85A 4FVTA 1P77A 5ITZB 3MT8A 5ALNA 5K0CA 4WTOA 4EA7A 4D0GA 1N5IA 5SV2A 1TQ8A 3OQ6A 4IX1A 5DBEX 2WTXA 3FCSB 4QXOA 4ZV7A 4B1FA 4F1WA 1C3OB 2W2KB 1OXUA 4DR1B 2DLDA 4B6EA 3QUQA 1P7WA 5EJ5A 4ZTUB 1JHAA 4IG9A 5ERXA 2BV3A 5IUKC 2IU6A 1XMQB 1WW2A 2A1TS 4I4TB 2YXNA 4WWHA 4HS4A 4ZU1X 1IOLA 2N1BA 3BMXA 2VL7A 3PD7A 3TOZA 4CT5A 4EI9A 1SUFA 3G5MA 5HTOA 1MOPA 1JDVA 1CJTC 4B4WA 5IANA 4Z4CA 1NIJA 4ZCSA 5T8KA 3QVKA 1TEZA 1RMQA 1KIFA 4KLCA 1KDYA 3STVA 4L5BA 4DLNA 1T35A 3A4VA 1PJSA 4KZPA 4MO2A 5FBZA 1BDBA 4EO7A 4XWOA 2WAOA 3LKVA 2JVJA 3EPLA 2CNBA 2RARA 2C4UA 521PA 7ABPA 3HV0A 1O95A 5BYJA 2FGKA 1GQQA 5LQSA 4A6XA 3AINA 4XM2A 4IGFA 1C7ZA 1W4CA 3W1WA 5BSHA 3QSYA 1SVUA 1TYZA 1G3MA 1U3VA 4L4XA 2C97A 3OLWA 3P9YA 1WDLA 2Y92A 4I46A 1QIFA 3TBKA 3GLGE 2HLPA 3H1BA 4TROA 5IH3A 3RS4A 2UU9B 1CE8B 2FEMA 1D2EA 1R74A 2F8SA 3UMCA 4LSMA 2HSDA 4HAIA 3RK1A 2VHVA 1C81A 1ESDA 1UBHS 5DM1A 3SHFA 2I5PO 2UKDA 2PD3A 1YS4A 2O8DA 2Y0BA 1E63A 1OGJA 2PH5A 3DS8A 3SFZA 4ZOAA 4WLOA 4P93A 4DN6A 4FDMA 2X0RA 3VV2A 1EFAA 3LECA 4DDHA 5A4FS 4TYYA 5ECWA 1P81A 2G4LA 2PFGA 2ATXA 4A10A 4WBSA 4OJYA 4C2UA 2ZR7A 1TDJA 3A4LA 4N7JA 1IDOA 4HN9A 2WR8A 4IXNA 4DDWA 4DCUA 2JGIA 4KNYA 5HCIA 4GBGA 2G5PA 2IXGA 5TY0A 3NDJA 3PUZA 2Y9PB 3BB4A 3GDFA 2WUVA 3JQAD 3PXEA 3MLAA 4ZCMA 2OORA 1W5BA 3TLJA 1XZDA 1KQPA 3K96A 1RLMA 5E7QA 3TLGB 1W1UA 3WISA 3MCAA 1O6GA 3C6BA 2W37A 2XZPA 4JYAB 2OAEA 4QM7A 3KJIA 1YFZA 3H9GA 4UUQA 1E1RA 1VIYA 2BFCA 2WPNA 3CH4B 3ZE7A 4B3JA 4OF4A 1WJGA 4PXAA 2EKDA 2FB9A 3ZN2A 2XWSA 2XBLA 4B3IA 3FLAA 4L22A 4RVCA 5JRZA 1Q0LA 5LMZA 3PE6A 2Q1UA 1VSTA 2JK0A 2JFFA 4KR2A 4Q19A 1FA9A 4QVIA 2II6A 2PBLA 2REXB 1M7HA 2DBRA 4MA0A 4DG9A 1VJ5A 2AFHB 1C1DB 1QG4A 3IGFA 3KSZO 4IXWA 1Y9ZA 1RKVA 1XAHA 4J1QA 3UATA 5J4KA 3IDFA 3NHAA 1TCVA 3OKPA 4B7XA 1VLQA 4MR7A 2CXPA 4ZEOA 3KP1A 5IVDA 3H16A 2DGDA 5JR3A 2VPXA 3EFHA 4NHOA 4C88A 2GZSA 2NO9A 3D5TA 3PPWA 4RCVA 4BC1A 3I39X 3G2NA 3OJEA 5FA5A 5B6JA 1XQYA 3FHJA 2GCOB 2ZRHA 3BZBA 4P98A 4R7TA 4FGSA 4BS9A 3KL4A 4UHHA 1SVIA 2HCRA 2IIPA 1AGRA 3BA1A 1YB1A 1FRZA 1TECE 3A3YA 5IUNC 3DC7A 1L4MA 1UBFA 3PXXA 1MAUA 1H2HA 4F4HA 1H5NA 1MO3A 1Y8RA 1FPMA 4C22A 1R2QA 3L5KA 3EZ6A 4PSUA 5JAZA 5JMPA 1CF9A 4AG3A 3T1YB 5BSVA 4J16A 3RYCA 5JJ5A 2HPHA 3LKBA 1QP4A 1FX0B 2CNDA 1YQWA 3DLCA 1F06A 2NQTA 2IYEA 3PJDA 2VYNA 3RIXA 1EQUA 4BYMA 1E1LA 4D43A 3ZJUA 4OLBA 2C9OA 4DVGA 3A4MA 3WZLA 4IW3B 2YWJA 4W1RA 2VZ0A 4ZO8A 5G3ZA 3ZCVA 1DDOA 4OI1A 2XBMA 2ZYVX 1P8JA 1U2QA 4IF6A 3R7BA 3L6RA 2XUFA 3PXAA 3N2KA 2B83A 1X86B 1WZCA 5ER6A 3T7DA 3UA4A 1QHYA 3LCJA 5HIIA 5JY1A 5LA6A 1T9DA 1JMKC 2B8JA 4ZYUA 2D7JA 2ZWAA 5ITWA 2CC2A 4C6TB 3ABOB 3IIEA 2CHVA 2PX4A 1SVNA 3OEHA 3PFCA 1P33A 3RE1A 4A4DA 1JV2B 1XB2A 2PWYA 4C3OB 5MGNA 4QXMA 1HYQA 4TTVA 3EYWA 4LCEA 4LJSA 3K1YA 5A04A 1BDIA 2HMYB 4W82A 2QNIA 3IMGA 2VPYA 1MORA 2HBYA 3Q6MA 4Z0HO 3DNMA 4BN0A 1V8OA 1KYWA 4KR6A 4X92A 1NRWA 3F3SA 3B8HA 1VG9B 3ZVLA 4O8CA 3B8EA 2LBPA 2RSLA 4QL3A 2P35A 1TA9A 4LGCA 1WPGA 4ABTA 5ESDA 1THMA 2XQKA 5I9LA 2HLDA 2P9CA 4G5GA 4GNKA 1TZKA 4PHHA 1TU4A 3CEPB 3HP7A 4RHEA 5BMVB 5BP7A 3ZHQA 1RZVA 4HJXA 4II3A 2WHQA 3IKLA 4NV1A 5HTKA 4BFYA 5HJ5A 2OCAA 2PJZA 4G24A 4M0MA 1JEQA 1MG0A 1VDMA 2GJ4A 3CLHA 4JBXA 4RSGA 2QTHA 2IV3A 1JHPA 2HQSA 5BW5A 1QK3A 5EVCA 1MB0A 3RARA 1QCYA 3UMGA 3D8TA 3NX4A 4LSGA 4WPGA 2O8BB 3L92A 5K5EA 4XPIB 2H29A 2PZLA 3AO0B 2PTGA 4LF9B 2X58A 2OC9A 5FPYA 3JWHA 5T5QA 3ETEA 1EFUA 1M6VB 4AROA 3UYLA 3TQRA 4KIWA 3DSRA 3LY9A 1UP6A 4D44A 4X6XA 2O8CB 1RJ9B 4H3VA 4LZZA 3ZQ4A 2HLHA 5KYKA 3JATA 2BDUA 1P74A 1HT3A 2FMHA 4IDFA 3GYGA 1HE1C 2TMGA 2WU8A 2G1UA 1NJ2A 4L4UA 4OU5A 5KSWB 1GLNA 1SUAA 1UMDB 1X42A 2QVZX 4KEAA 1LQTA 1XXHE 1YA8A 2OXFA 3IAXA 1MJNA 2COUA 4G2NA 4NK5A 1W4RA 3BRWD 4OAOA 5A9SA 4GT1A 4PSDA 5KQGA 4H59A 1X1TA 5LP6F 4FFBB 1Y3AA 3OJXA 2QRLA 4EWLA 2JLSA 4XLZA 1U0BB 1XTVA 1DZ3A 2ZPTX 3B9PA 5ALVA 3FG9A 1N2HA 1N6LA 1X15A 5B3AA 2QU7A 4B87A 4UZSA 2BUBA 1Y4ZA 3DMTA 1UXOA 3U5TA 4W5RA 5ADVA 1W46A 2EJUA 4YRBA 3ADKA 3EJ6A 2A84A 5JRDS 3EAGA 4AN0A 5ALQA 4S24A 2V65A 3I2JA 5A3JA 3A1WA 3W2HA 2YS6A 6Q21A 3A1SA 4K0KB 4GRAA 1SVWA 1A88A 1GLVA 3LK6A 1JSZA 1Q7BA 3UUFA 3TFQA 2EQ5A 1NN3A 5CM2Z 5ED0A 5LOVA 1FNDA 2GHQA 3VGPA 5BNZA 1ZD9A 1A95A 1RYFA 4I1RA 4ZYTA 5GM2A 3HN7A 4CM8A 1AQLA 2O9JA 3UFXB 2HJHA 2WJGA 3VZQA 1S5PA 3QEKA 1FOEB 5EI5A 1KVUA 4IJKA 3E8SA 3F6YA 5KJ6A 1NQXA 1K5DA 1K1EA 1SUBA 4K3UA 3UOGA 5IAAA 1T9BA 3RM3A 2Y1DA 1GGFA 1Z6AA 5BN3B 2XYGA 2P2LA 3HA2A 4B74A 2OTCA 5BQOA 2ZWVA 4FFNA 4GM0A 4O2LA 3KJXA 3CR8A 1ULHA 4KHPB 2IFTA 4WZBE 1QUEA 2D0IA 1A9RA 4J6FA 5JI2E 2EEPA 4GZLA 2BGNA 1C2TA 3JVUA 3B1JA 3N74A 3Q40A 4HB4A 1ENPA 3A2NA 1X1CA 4XQ9A 4XUDA 1QB7A 4TXNA 5KQMA 3ABZA 2QJRA 1DLJA 2CLSA 4LQDA 1SXGA 1WQ1R 2XWPA 4PLHA 5ENZA 4DSUA 3OTGA 1VLVA 1VJTA 4I0WB 4KO4S 3ZH9B 2MJLA 1RLOA 4QG7A 1OFVA 5CAEB 1B3BA 1RPZA 4K6FA 4YALA 3TYXA 2I3ZA 3QBVA 3WL7A 1UBNA 2GFQA 4EI7A 3HDHA 1N36B 1F7UA 3OKAA 2C4MA 5C1DA 5C81A 3UMJA 2W90A 1ZNWA 4E32A 4KE8A 4M86A 3SJZA 4RFVA 4LTNA 1QIMA 3HDQA 4HC4A 4PN7A 1JT2A 4NU5A 4XYMA 1MGPA 4UXJA 1D5WA 1JVN