1PJ8A

Structure of a ternary complex of proteinase k, mercury and a substrate-analogue hexapeptide at 2.2 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a ternary complex of proteinase K, mercury, and a substrate-analogue hexa-peptide at 2.2 A resolution
pubmed doi rcsb
molecule tags Hydrolase/hydrolase substrate
molecule keywords Proteinase K
total genus 96
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2003-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1pj8A00
2TECE 1BFUA 3VYVA 3LXUX 2Z58A 4DJ5X 4I0WB 2Z2YA 1CSEE 4H6WA 4OMCA 4DWWA 1T1EA 4WOBA 5ARBA 3DE4X 3VHQA 1P7VA 2SBTA 3AJ9A 1WSDA 1THMA 3DE0X 1Y1KE 1ST3A 1Y4AE 2WUVA 3DVRX 2GKOA 4KPGA 5JXJA 1S2NA 1BH6A 3GCWA 3GT4A 2WWTA 1SBHA 1NDQA 3EIFA 1BJRE 2IXTA 4K8RB 1TMGE 1TK2A 5AQEA 1WMEA 2X8JB 4OMDA 3A3NA 3UNXA 1IAVA 4HVLA 1KE2A 3BX1A 3BPSA 3WIUA 4CFYA 3AFGA 2Z2XA 2Z56A 3D43A 1C3LA 1LW6E 3ZXYA 1GTJ1 1UBNA 2ZWOA 3VTAA 3WIVA 5B1EA 1SIUA 1EGQA 3I30X 1T1GA 1Q5PA 2ZWPA 5FAXA 4WOCA 1MPTA 2XTJA 2PWAA 1PTKA 1TM7E 3DYBA 1AF4A 2HPZA 2ZRQA 1KDVA 2W2MA 5ARDA 2Z30A 1P8JA 1R64A 2PQ2A 3QFHA 4MZDA 1GTG1 1VSBA 3T41A 1TO1E 3ZXXA 2W2NA 1GT91 3F49S 3DVQX 1SN7A 3Q40A 4C3VA 1OYVA 3EDYA 4ZOQI 1BFKA 3DVSX 3DE6X 3DE2X 1C9NA 1TM4E 4NMXB 1SBIA 4H6VA 1SELA 1PEKE 3GT3A 1JEAA 4ZARA 1WVMA 3F7MA 4B5LA 5CW1A 2ID8A 5I9SA 3WQBA 1PJ8A 4OV6B 2PKCA 1WMDA 3DW3X 1YJBA 2W2PA 3F7OA 5AMXA 3SQOA 2XRMA 3DE7X 2PYZA 3AJ8A 1SIOA 3DE5X 1C9JA 2ST1A 1Y3DE 3SICE 4AKSA 5AVJA 1P7WA 3VSBA 3TI9A 3I37X 1AVTA 1EA7A 2SICE 1TM3E 1SUDA 3DE1X 2PWBA 1GA4A 5JMOA 1TECE 2SECE 5JXGA 4BWGA 1PFGA 1AK9A 1SCDA 3PTLA 3QTLA 4C3UA 4GI3A 4LVNA 1YJCA 5SICE 5JXHA 3VV2A 1A2QA 1R0RE 3EE6A 3CNQS 1SBTA 2WV7A 4FONA 1KDZA 3CO0S 1CNMA 1S01A 2DP4E 2G4VA 1YU6A 1ZVKA 2ID4A 3LPCA 3Q5GA 1SUEA 1GTL1 1OT5A 1Y4DE 3QMPA 1T1IA 1AH2A 4JP8A 3TECE 1SCBA 4HX2A 3D9QX 4M1ZA 4AKTA 2QTWB 1AU9A 5AVKA 1SH7A 1KDYA 3DW1X 2DUJA 2V8BA 5FBZA 1V5IA 1GA1A 1HT3A 2SNIE 2WUWE 1TM1E 1GA6A 2Z57A 2B6NA 1TM5E 3DDZX 4RYDA 3WHIA 1IC6A 1R6VA 1SUCA 1Y3BE 1Y9ZA 1ZVJA 2Z2ZA 1OYOA 1XF1A 3BGOS 3LPDA 4KB5A 4NE9A 4LVOA 1GNVA 1V6CA 1DBIA 2DQKA 2X8JA 3DWEX 1BE8A 1GCIA 1WMFA 3HJRA 3PRKE 1SCNE 1SIBE 2PMWB 3VV3A 4CG0A 1S02A 3H42B 3I2YX 3P5BA 5B1DA 1C9MA 1DUIA 1SUAA 3L1KA 4CFZA 4J94A 3TI7A 1SUPA 1SCJA 3I34X 1SBNE 1SPBS 1Y3FE 3DE3X 4KG7A 4DZTA 3LPAA 1SBCA 2P4EA 2IY9A 1Y33E 3A3PA 4Z2AA 1TO2E 5K7SA 1Y3CE 1SCAA 1Y34E 5FFNA 1KE1A 1Y48E 3A3OA 2PRKA 3OSZA 4YN3A 1GNSA 1MEEA 1NLUA 1SVNA 1NDUA 1BE6A 2HD4A 2E1PA 1AV7A 3GCXA 5JXIA 1YJAA 1AQNA 1ST2A 1SUBA 2W2OA 2W2QA 4H6XA 4NE7A 5ARCA
chains in the Genus database with same CATH superfamily
1RZRD 5BW6B 1AB6A 1N6PA 4ATNA 5D2CA 2VF2A 4Z53A 3OQIA 4QUDA 1AZWA 4Q4CA 2GCOA 3CFYA 3UENA 2HUPA 4PNZA 3DVAB 3LDAA 5EWLA 3SGLA 3LBYA 5CDYA 2BM8A 1NMSA 3CLHA 3TE7A 2HBZA 5FNVA 3AIKA 3UMFA 1FFEA 4Q3DA 1SQGA 4CFYA 4GGOA 5GGXA 1F4PA 3C5VA 3VTAA 4CIWA 5IMBA 2E37A 2ZBUA 4KK4A 2O8CA 4JP1A 5A4MS 3L7IA 1W5EA 3TMKA 4D9MA 2LXNA 2C7OA 4XJXA 1TI7A 4MRMA 4N6OA 7GPBA 4ETIA 1QQTA 2D1FA 3OE7A 3PWZA 1ESCA 1PWXA 4HC4A 2ZRMA 4FGKA 1K3UB 2WIKA 4PW0A 5CIWA 4Z3KA 4DR5B 1KNXA 2IIVA 4CR8A 3CWCA 4OOFA 1BCSA 4MWOA 4EK9A 1NMEA 4RZ2A 5DSTA 3FKQA 2I76A 3ML1A 2GEBA 1NGSA 3GBVA 1JEAA 3QI2A 4DR3B 1RBQA 1DB3A 1NQAO 2X4GA 2FPKA 3ZZ0A 3GP5A 3REFA 1JKXA 2MYTA 3EASA 5DVZA 3UMYA 4RK6A 4DNQA 1A8QA 1T1JA 1VZ3A 5KKCA 4IIYA 4JCOA 4F9FA 4G89A 4O2AF 1K7EB 2Q3LA 1D0SA 2W6PA 2R6ZA 4HB3A 5FA6A 3DSRA 4WFJA 4FFNA 3EGWA 2R2AA 3QTLA 1EJ2A 1ODLA 4JBXA 5TQ2A 2F8LA 5JTTA 4AI6A 1S0UA 5BN1A 1U0HC 2IK8A 3T7AA 3F6CA 2P2NA 4IOMA 1DQYA 3ZI4A 5KWVA 4CKWB 3L6EA 5HKKD 2FAXA 3DLBA 2YJGA 1HE5A 4YRTA 5KX5F 5E6RA 4KODA 3FPBA 2JFXA 3CU5A 4IDCA 1EWTA 1SFRA 1ZI9A 1LC3A 1Q44A 5C53B 1L4FA 2ZJ8A 1SH7A 2I2AA 3TX2A 1AOXA 1EFDN 3HEAA 3GA0A 1RWKA 3K5HA 3KJNA 4Z9FA 1L4NA 1OWNA 1CUUA 4ZO8A 3UTDA 1E8DA 1ZONA 4GPTA 4IRUB 1ONSA 2EZ9A 3D7NA 4FXOA 3KDAA 1JFFB 4X1IB 4X3CA 2H4WA 2OD7A 2VK8A 3S1AA 1EP1B 1POXA 5HGJA 4RPIA 4B2YA 3U62A 1CX9B 3BXPA 5JZ9A 3TD2A 1RYYA 1QKKA 4KX5A 4UDYX 3MJDA 1IY9A 2V7EA 2B4AA 3C5EA 5GY7A 3H9CA 1A72A 4IUBS 5CEFA 3ZDAA 3WYEA 1IOWA 5ALRA 3EW9A 3ND7A 5CB4F 3R7FA 5CB4B 3A4VA 5K03A 3NBQA 1UBOS 2EEZA 3BZBA 3N53A 5K6AA 2CJWB 3KQSA 3GV0A 1MC5A 2I65A 1D2NA 5THXA 3AI3A 5ARCA 3ZDFA 5JNRA 3PA6A 4D8XA 1BHO1 1XDBA 3NALA 1BVRA 2AJCA 2B92A 3EW7A 4ZQBA 1P7VA 3V4SA 8ADHA 4MDFA 1QRDA 4DR1B 1Y4AE 2WUVA 1IB0A 3F7NA 2JGRA 3KWFA 3P0EA 2PWYA 2P4QA 1IDN1 5ADHA 2I7DA 3NBXX 3I01A 2XB8A 4FI3C 4E32A 3ZY4A 2JCSA 3NPMA 4KFSA 1QVZA 3DZDA 2H52A 2ZUUA 3GJ5A 1C9EA 1ZL2A 4MUIA 4OA8A 3GZTB 1BN7A 2TRSB 3VVLA 2JLSA 1U0JA 2VDWB 3OJFA 4OBBA 5TMEA 3SY8A 3ZXYA 2ZI5A 3RU2A 2H11A 2C2WA 2VJBA 3G6WA 4MJ3A 3AETB 4NDAA 1YVUA 4UM7A 5G02A 5KX5B 3FWZA 1ZK3A 1X1AA 1OBFO 2B99A 3INNA 4YA6A 5C8YB 1S7CA 2QZJA 4MKFA 5ECYA 3O47A 4QA9A 4EI2A 1KL7A 1JWAB 2JIPA 1GN8A 1W73A 1K68A 1T2FA 5AW9A 2IKQA 4POAA 5DW0A 1AMUA 2HSJA 5HG0A 4Y2UA 3HDYA 3DE2X 3T7KA 1YRYE 4LRWA 5B6IA 1TF7A 3MWDA 5JZOA 1MJGA 3ADKA 3ROFA 1MAWA 1E69A 4DDWA 2D74A 2I3BA 4I4LA 1KI6A 1P61B 1T4GA 5BT8A 2OKCA 3KEMA 2VT7A 4R9NA 5FBRB 8GPBA 1GTRA 2VBIA 2B6HA 1WB6A 4L85A 3UCFA 2VP5A 1TJPB 4BVEA 3CSSA 2CVPA 4CQNA 1U98A 2DSTA 2FGJA 1I4TD 4NMLA 4MO2A 2GASA 4CGYA 4OYHA 1B23P 5C1PA 3ESYA 3NDIA 4Y7DA 1JHXA 5BR7A 3QBVA 5JXGA 4ISCA 1JA0A 1V1RA 4ALIA 3AQIA 1D5WA 3OX3A 1Y3HA 4CW7A 2XCSB 4I6EA 4QOEA 10MHA 4CEIB 3LD9A 2FX3A 4CKZA 3A0UA 1XAIA 3UOAB 4C6TA 4X62B 2B2XA 3ED5A 2YHUA 2XJ4A 5H16A 4Z7QB 2PXXA 3WY9A 3OF2A 2VJMA 4TOIA 4B3JA 1SU7A 1U3DA 1HE4A 1J24A 4M9ZA 4V2UA 3C1TA 4E2WA 3QJ5A 4I1OA 3G2JA 4UEQA 3LY7A 3TZBA 1AX9A 1K1EA 2KPOA 2PZMA 2EQBA 2QR3A 4B33A 2WB2A 2QZ4A 3L92A 1T8YA 4UBKA 4WW0A 2GO7A 3O8LA 2OAQ1 3LHIA 4IWNA 5F3DA 4IHJF 1Z25A 1N2SA 3I5MA 1N4AA 2IHUA 1M2FA 2JIZD 3IHLA 3O94A 3PA8A 4RTPA 1ZC4A 1HG1A 2BGWA 5LMCA 1SCNE 4C4SA 1A9SA 1PNOA 3U1VA 2O2YA 2A4MA 4LWZA 5E6RB 2DPGA 1E79D 2PLAA 2BFWA 4XYGA 1TFUA 2WSBA 3N6VA 4EY8A 3WZMA 3UWSA 4Y8VA 3RHFA 3GJ6A 2P1RA 4X63A 1T29A 1Y3CE 1Y1PA 2W7TA 3HJNA 3U81A 3VR3A 4J0DA 2WTXA 2GHQA 3TWOA 3DBRB 3KXIA 4NWIA 3OZ7A 2XUDA 4UUMA 4ZT7A 5KNBH 4DL9A 1D6MA 3GI1A 5CLFA 4X90A 4JBLA 2PX2A 1JIJA 2IVFA 2IWRA 4NFLA 3AR8A 4XQGA 5DGIA 5DNCA 3KUUA 2LNDA 5TEWA 1Z33A 1KDVA 2AGVA 1RWXA 2HQ1A 16PKA 2HMYB 4KWHA 4PGMA 5TPWB 621PA 1TJYA 1DPGA 4BIMA 1SBHA 1B15A 1BVUA 1QOPB 1QB7A 5K3BA 1UKBA 2H63A 3TEMA 5REQB 3IPCA 1SHZA 2C1EA 2J5RA 3AF4A 3FWHA 3ILVA 1DJNA 5ALQA 1X42A 3DFMA 3RUIA 2ILTA 2PVPA 5T3YA 2C7GA 3AO0B 4NOKA 2BFEA 3W5HA 1M5RA 3ZWVA 4N8EA 4NJEA 1MXFA 2JFFA 1KOLA 3OI7A 3T4UA 3N75A 4N0PA 3HSSA 2XODA 1RYMA 3GIWA 4US0R 5DN9A 5ITZB 4KTVE 4HWKA 2LCQA 2JBWA 1VKNA 1WY5A 3A31A 3KIPA 4M1MA 3U2QA 2ZITA 3KJHA 3QK7A 5LP1A 1O6BA 1GSHA 2Q4DA 3BWDD 2NU6B 2RK4A 3UA4A 5HPYB 4KGXA 3PPYA 4AJLA 4E3ZA 5TPZA 3D7SA 2BGGA 1WQ4A 3WC4A 5CIQA 2GM3A 1C14A 13PKA 1EYZA 1UIMA 2UUOA 4XSHA 4EY4A 1K66A 4CU5A 1NWCA 1QAMA 3QNMA 1AKRA 3FWKA 4J7XA 4CLXA 1JDVA 5BW4A 5KDOA 4YP5A 2GF9A 2HJWA 1CE8A 1P4SA 3TVTA 1QF7A 2WSLA 3IQDB 5LJIA 5LR6A 4B31A 1GJRA 2JCBA 2A1UB 5CVVA 3VSBA 4BVAA 4AQ7A 2QM7A 3K05A 3OIFA 2BFDA 4C0SA 1O8CA 5IYZB 1IAQA 4CM7A 2FPWA 1CJCA 2WLTA 3FZNA 3M9XA 5CW2A 1AK2A 4KR2A 4IUYA 4KQFA 3QXCA 4KR9A 1E5XA 1KRHA 1PUXA 3COWA 3IURA 1OTXA 2MR5A 3F5MA 1AKWA 2WV7A 4IIJB 1W49A 4JUBA 5FO0A 3K15A 4AW9A 3LLMA 3HN7A 1MA0A 4NSNA 4MVYA 2W58A 1QG4A 3F4BA 4RKEA 4UVDA 1PJZA 4UPVA 4JJZA 1RXIA 4CL8A 4KDRA 2NV2B 1E7SA 1KIAA 1YB1A 1NR1A 4RSHA 4A9AA 4AT1A 3FI9A 4HUTA 1FCJA 2H18A 2ZCUA 4AYTA 3IKJA 4BN0A 4HN9A 1ZW6A 3A27A 3NKVA 3N58A 3QXSA 4NXNB 5LPNA 1T43A 1XMQB 1AD2A 2V7WA 4QGAA 4C07A 5J5CA 3ENQA 3R3UA 1JYSA 4UBIA 5EJ9A 3TJZA 2QI9C 4EY5A 2BCJQ 1FW8A 3RS8A 3CVWA 1XEXA 3W7AA 1U9IC 5BV8A 3QPVA 1IHPA 4CMIB 4I6GA 1NUTA 3GRUA 3TD9A 1G63A 4BBZA 2DQKA 2IWHA 5A7HA 2W43A 1PR2A 2ZJYA 5F2EA 3M3DA 3VZCA 4ZT3A 4YAGA 2G67A 1Y6GA 1LY1A 2C5EA 3Q9LA 2AJBA 1DADA 5CLGA 4ZI7F 1T9HA 1P33A 1M34E 5LU8A 3FHCB 4MR9B 3UMSA 1OX4A 4JI6B 1JQLB 4OFZA 3RVLA 2FSPA 3LSTA 1ORVA 1T0BA 4YJHB 1JFSA 1EIWA 4CM8A 2NZ2A 1E1CA 2APJA 2ZVPX 4ALLA 2OHXA 3GFTA 3HNPA 3NT5A 1FNDA 3C4VA 1Z0ZA 1G16A 2DWQA 5K3FA 4QT4A 1PWHA 1A88A 3GN2A 1FRNA 3NP9A 2PR7A 4L6AA 4OQ4A 3KQTA 1DKPA 3FTDA 1I6MA 3VNRA 4ENPA 1YDFA 3P45A 3FWPA 4Q7QA 2QBYB 1UM9A 2QE7A 2KQUA 3G1WA 2PSDA 1NP7A 4RAOA 4C7MA 1RMTA 2PLRA 4YV1A 1AQJA 2OO5A 4XIIA 3HM9A 2AW5A 4NYMQ 3DPSA 2CVOA 2EYUA 4N54A 1CUGA 3B9RA 3QMWA 3GFQA 3VKUA 4NC9A 3Q41A 2JRCA 2X8BA 3E9ZA 4CHGA 2XE7A 5COQA 8OHMA 1YQ9A 4ID3A 4HS4A 2PLNA 3EHDA 5AVTA 3CNBA 4ZAXA 1QVVA 2B34A 3D4LA 1RWWA 4RQAA 1JIQA 3UMCA 2CLLB 4MAFA 4QYIB 1UPXA 1VIDA 3RS5A 2I4IA 4BLVA 4DVGA 2OHVA 4JD5A 5KWEA 1US8B 1ZEMA 3DT8A 4QLBA 1OC4A 3OHSX 3GLUA 3PYLA 4TGLA 2NQ2C 5FA8A 2NSJA 1JIVA 2VDMB 4P54A 4U2BA 4ARCA 4C5CA 1NPTO 2O1XA 2XCLA 2ZJZA 3OC0A 2EJVA 1H4TA 4P58A 1N6NA 4TTTS 5FTJA 4ZJPA 5B3JC 5LDGA 3RJMA 2I4OA 3ED1A 3TBFA 4BNFA 1XROA 4H6VA 3TIIA 2Q1SA 4A27A 2AC4A 1GDTA 5IJZA 3F7MA 5ITZA 4XGNA 4AIRA 1O94D 2HQSA 5C2JB 5DTEA 3ZVKA 1LDYA 3BL8A 4EF6A 2CHFA 4FP9A 3T3HA 1Z8HA 7REQB 4OHZA 3RU9A 4HFRA 1LPAB 4BLWA 1R9NA 3GCZA 2ST1A 2D2FA 4GRIA 4UEWA 4LW8A 2HUNA 4Q93A 2HNAA 2XBUA 1VG8A 2CMDA 1Z2PX 2CWWA 2PMBA 3E22A 3GLHA 3KEOA 4J1TC 1VFPA 4JVLA 3C3YA 4RADA 4BFWA 4O4HB 2DWUA 4E51A 2OG1A 1JDSA 3T9AA 3RTBA 3PQ7A 4WDQA 4DT1A 2C4NA 5I4KA 4IQ0A 1QHXA 3IA7A 1UMKA 1RT9A 2QUJA 3IV9A 4KQEA 1CUBA 1KSGA 4B7UA 4OG2A 9GPBA 3HADA 4Y6QA 3MMSA 5FDFA 1KFJB 4R1MA 1GZ4A 5E7QA 3WBJA 5CXXA 4C4RA 2QRZA 3O3OB 4L4SA 2VCHA 2GPTA 2ZYGA 6ADHA 1VXOA 2X9LA 3FNEA 4K1XA 3TB6A 4RTOA 3EWNA 3E3OA 2PT6A 2VUSA 2WWHA 2C2OA 1JSXA 1DQPA 1U2DC 3AEUB 4FS3A 1W88A 3QHAA 3OKAA 3UICA 2C29D 3H86A 2F67A 4KE7A 5FLEX 1L5NA 5F7XA 5IHPA 2X2FA 1Z74A 3A6FA 3NHJA 1N2EA 5KNDH 3QVLA 3NWOA 1ZVJA 2I6FA 5FJJA 1XF1A 2G9UA 2OA0A 1XNQB 1DWPA 3ILXA 4KRFA 4YRMA 3K2IA 1AUQA 4AICA 3ZNOA 4B46A 1V35A 4MW6A 1QX3A 1Z4QA 3BM5A 3DMNA 6AT1A 1RKBA 4NECA 4U02A 1SB8A 3JZDA 5D6NA 3A05A 1Y7IA 2OLJA 1NBHA 2EQ5A 3O2SB 4GPBA 2R96A 3DA8A 1ZU5A 5SY4A 2EFJA 2ZBDA 5D6OA 2Y9MB 3F8TA 3W5VA 3VDQA 3ZWQA 1AKNA 4BS9A 5IKEA 3JRWA 5GTDA 1JR6A 3GQBB 2G6BA 1GNSA 2C82A 1QPZA 3ICCA 1H93A 3ZGXA 3MLAA 3A04A 4Q3AA 5KNLA 4F9TA 1SQSA 3FGOA 4J90A 2CEAA 4UD2A 1ULTA 2XT9A 3E6AA 1WDMA 4GQBA 1JKIA 1XRQA 1L5KA 3ICOA 3ZGZA 3AR7A 2I6TA 4MV8A 1J90A 1MTOA 4BV3A 1N9KA 2NU7A 5EERA 3AIIA 3MWLA 3X3HA 1WETA 2JJ1A 3CV3A 2A1TS 2C2YA 4RV9A 1CUWA 2FP4A 3DKKA 5AKEA 4TRNA 1COWA 3IOBA 3TDNA 2AYXA 1UT5A 4EY7A 2RCNA 4HNRA 3KSAC 1YL6A 4RW0A 3EPJA 1MO4A 2R8YA 1U3UA 4JI3B 3DMHA 2OBMA 1IM5A 1ZP6A 3ECCA 1Z0JA 1HG0A 2ZAIA 3LM8A 3R6LA 3O1IC 5CK5A 1K8YB 4A2QA 1GNTA 1V96A 3R0XA 1F3LA 1Q77A 1ZGZA 2IHJA 5C5IA 1A0OA 3PEUA 4OPMA 1YZQA 1GZ5A 1XVTA 2F1HA 2IPAB 2Y1FA 5DM0A 1PSWA 4GU5A 3H2JA 3RJ5A 1COZA 3I3OA 2QL5A 3VAYA 3ANMA 3TRDA 1JDJA 3WGOA 1N3IA 2UYQA 4TTQA 4YRIA 5GIPE 1J0DA 1XDSA 5JJKA 1V11B 3IVAA 1H6CA 1EAMA 1ESZA 2I3GA 1MHPA 2LW7A 2PTHA 5CW1A 4HEJA 4DMMA 3MCAA 3MWGA 5SY6A 2ZIZA 3QKRB 1TCAA 2WM2A 4H4EA 4LXGA 1A5AB 2C0PA 3WK5A 1N0UA 4YRNA 1KY3A 1O6GA 2YQ4A 5TQVA 1O4VA 1M2KA 3GFOA 4L9WA 2P6RA 2H1RA 2D4AA 2JIBA 5H70A 1UOEA 4Q3NA 4XX1A 4CWAA 1L5HA 5BUCA 3IP7A 1BXGA 3OFND 4KQ9A 4M9SA 3LL7A 2M6KA 1NJ5A 1D2MA 3F8WA 4NBTA 5DU2A 4BWGA 4F46A 1XL1A 4CXMA 3TLBA 4PBSA 4RHXA 1PK7A 1OKKD 4ZANA 2O7NA 1F60A 3GJ8A 2HR1A 5CFPA 3HXQA 2ESRA 1OQAA 1E4EA 1OCEA 3IJEB 2QTLA 5DO9A 3VSDA 3QF4B 2ZPUA 4FKZA 2YWCA 3PHBE 3TTVA 3LK7A 3OQBA 3STXA 4JL6A 1WXEA 1GN9A 2DPYA 3KEFA 3BE4A 1F0NA 1XXHE 1FRVA 1R74A 4EG0A 3I04M 4QNMA 2W37A 5FLXA 3ETNA 5CDFE 2PIAA 1H3NA 2F00A 5COAA 2WPNA 4DJ5X 5LQAA 3L9WA 2BISA 2RGGA 4JBGA 3TUJC 5TF0A 4DIFA 5DZSA 5IANA 1BS9A 1W48A 1E7YA 1X9IA 3PDIA 3T4XA 3S8MA 1D1QA 1U81A 2JBAA 4IRMA 2EDAA 2JJQA 2ZJBA 5AJVB 1Y1TA 2ZJ0A 5DHUA 3SHVA 4AYWA 4ETMA 2XDQA 3KHUA 5K9ZA 2CFSA 3ZHUA 3B82A 1N2ZA 4IYRA 2RG1A 5A0FA 5CDGA 1NNUA 3OIGA 2WVHA 2X7XA 1K7SN 5ABPA 1D8TA 3EXFB 3TGWA 1VBNA 1QR6A 2NO1A 3GDWA 1HWYA 4BB5A 2DT8A 3B2QA 1XEAA 3FCOA 1V6SA 4TWAA 4OU5A 5JCJD 2YN0A 4OSEA 1J2TA 3JWHA 4LOKA 3CT6A 3RSHA 1DBQA 3VXKA 1L1RA 3FOBA 3T5BA 2OZLB 3HJTA 3U13A 1OH5A 4WI1A 3FHJA 3Q7SA 4LHXA 3W9BA 1XT6A 4BQOA 3PDCA 4NONA 5JAOA 2FWNA 1J4AA 1TZKA 1ADFA 1QVAA 2IEYA 2IUFA 3AY6A 3EVCA 2OUIA 5CUQA 2E6UX 5E6SA 1RRFA 1E4YA 3KP1A 5HQTA 2YWBA 1KVUA 1R0CA 2WOOA 6REQB 1M2EA 1HL7A 3X1JA 3PLNA 5E2IA 2NU9B 5B1EA 2VT2A 1UFOA 2DBRA 2ONZA 4C0QC 3H5IA 3UA3A 4AF7A 2XNCA 4DV6B 4JB0A 4URFA 1G6HA 2RKWA 1I2DA 3AKCA 3D1VA 5F9MA 1MPTA 2H3HA 2XQFA 1NJFA 5CA0B 3TCKA 3TR0A 4ALKA 4NBSA 1OH8A 4RXUA 4LZWA 4DA4A 1SXIA 2M32A 1P9LA 2C5FA 1LLQA 2FWRA 3FFTA 3KPJA 4K46A 5JTUA 2GOYA 5TT0A 3P19A 4B6EA 2H0QA 5KNBD 3I4LA 1H2FA 3KZOA 1SKUA 4BFZA 4M60A 1Z0DA 1TFRA 3H2IA 5EZ6B 5JNSA 1MQ8B 2D5BA 5SYAA 1PR9A 2OAP1 4JLOA 4AN4A 3RSSA 4CF6A 2DCMA 4ND7A 2GAIA 3KHSA 4NPHA 3DE7X 3OP1A 1V8OA 2Q4OA 4B3DA 2WHRA 1OLOA 4RVSA 2FPIB 5T4FA 3WK9A 4BGIA 4C22A 3UUFA 2B21A 1X7WA 2P27A 1J00A 1HSOA 4OGFA 3UXMA 2D7JA 4ENTA 3HXKA 4EA6A 5AUNB 4M8LA 2ZBPA 1TKBA 3ASYA 2M6SA 1OXMA 3V9AA 4Q24A 3SYRA 1V6AA 2I6GA 2WVAA 3LVFO 2VTEA 3A9CA 2H2WA 4R1OA 4WL0A 4MWDA 3HUDA 5FD8A 3K5IA 1PIWA 1KEUA 5FCDA 3ZJ5A 4MRNA 2VHXA 1IY2A 1G41A 4YQEA 3F73A 3C6YA 2Y1KA 1QYVA 2L42A 3ZW7A 4ER3A 3GL9A 3F97A 5FUYA 5EKTA 1Y6ZA 3Q0EA 3S2IA 1A04A 4WNIA 2DY0A 3UYKA 4LDJA 3NHWA 3OLYA 1T91A 3DKRA 1PQ4A 2WAYA 4PC3A 3PUIA 1CR1A 5CFLA 2IH4A 2PKXA 2IUTA 5CM2Z 4MNTA 4MIKA 3SIXA 2G6TA 5TB5A 1H4QA 1ZVQA 3EXEA 1I7QB 4JK3A 2P79A 3QVJA 2IZOA 4DLSA 4NE9A 5H82A 3AF1A 1X74A 3L43A 1OR8A 4HGRA 2WNHA 4DDVA 5JFTA 3B1YA 2W4IA 4RJKA 2BH9A 3HJUA 5ILOA 5BWLA 2J32A 3UBTA 1GPKA 1P62B 1PVVA 2E49A 2XADA 4MMZB 5FR1A 1XA0A 3DVAA 1EVIA 2ECKA 3H11B 4UCXA 2CV1A 3D6HA 3UW3A 1ORRA 1DINA 3QEAZ 4P0QB 2ZYRA 1QF9A 2A5FA 2CZQA 4LC9A 1I0ZA 1U8XX 4YP6A 3W1WA 2C00A 3T99A 1YHYA 3E3AA 5E4YA 4YP7A 2HAEA 2PZAA 4ZEXA 1ISPA 4ISBA 4ZK6A 4N3BA 2PA0A 1V45E 3ZHXA 3KV1A 1T5HX 4M88A 4OIFA 5IX8A 2VZLA 3I6MA 5EGNA 2F3UA 2H2FA 3BQNB 3L1IA 3TIFA 3TJMA 1ZVVA 5CCBA 3GEDA 3OJ0A 4ZMRA 1Z4MA 1LBTA 2V74B 5ARBA 3UMMA 3L01A 3N9IA 1LLCA 2IVZA 4WDRA 2J6HA 3PDIB 4DLTA 1R0XA 3HQ4O 3QOYA 4N7MA 1IU9A 3A6LA 3KO8A 2OYSA 1Z35A 2PRZA 1CY2A 3B7GA 4QU9A 5T6MA 3ZKAA 3TVYA 5A5EA 3LVQE 3VPXA 2REQB 3VNVA 1YQUA 4F85A 4F60A 1L5ZA 1YS7A 1OPXA 2QRNA 5EIOA 5ICSA 4ABTA 1MD9A 2Q3EA 4AMGA 4F3RA 2KBEA 4P7FA 4X60A 5DHRA 1SUSA 2A88A 4KQHA 5JAMA 1TZJA 4BB6A 1BE0A 4DZZA 5JR3A 1Q5PA 1QFJA 4X44A 2ABWA 2FETA 3WKBA 1EK6A 2PWAA 2O1SA 2BLLA 4UM9D 3ZLJA 5JWRA 3ZV5A 4DMFA 4CMEA 3VA7A 4AS3A 3DMDA 1Z7BA 2CUTA 4JY7A 3SYMA 4ZVTA 4EGAA 1FUUA 2VRWA 1J5XA 4PHGA 3V4OA 4BX0A 4PG8A 1IXSB 3CURA 4DDTA 2QLJA 1PI3A 4B4WA 1W19A 3LG2A 4JYBA 3AEYA 3CPJB 4B1FA 3SHFA 4LY6A 5GZ3A 4RVGA 4UXHA 4WAUA 1PEAA 4EVSA 1JLLB 4G0OA 4R0NA 5WRFA 4OQQA 3UMBA 5F64A 1KYQA 3D4NA 5E9JA 4CM3A 4CHTA 4EAAA 3F7OA 5BMVF 3D8TA 4HZUA 2YV5A 1CEXA 1YDWA 2HSZA 2VAWA 3VZPA 1YCFA 4X1YA 2ZVJA 2IPMA 2PT7A 5I7SA 2V4MA 2R6R1 1DUSA 5AKGA 3W6NA 1YK0A 3WB1A 1EA7A 2Q4BA 3MSXA 2X3YA 2O2DA 3KJFA 3O03A 5DBFA 4CMAA 2X9GA 1TC2A 4EHJA 4JI0B 1ECGA 1I9CA 3PP8A 5FULA 3SSOA 3S5JA 5E3IA 5CHYA 2X6TA 1QQAA 1ZD1A 1LDBA 4HHEA 1L5MA 2EARA 4D9KA 1DKMA 1N2OA 3UFXA 4HN2A 3ZU3A 2C07A 3BL5A 3RYHB 3L6RA 5EJAA 2HCBA 5HZGA 2J7KA 4LOHA 4KMSA 2HLNA 3B51X 1HY3A 1ZM7A 4P33A 3TFQA 1NAHA 3EGDB 1R4AA 1XTTA 3MERA 2WI8A 3NLLA 1KWKA 5CVEA 3Q8WA 2H85A 2Y1CA 1FSSA 3V3KA 3PNLA 2X9NA 1KTVA 4MVXA 1CRLA 2C9DA 3NYIA 4MEBA 2WQ7A 2F3RA 3A9VA 4OQFA 1CHDA 4CDNA 3KE9A 1I4OA 3LF2A 1E77A 3NNSA 3MMZA 5BURA 2CD7A 3NOOA 1QV6A 2X8JA 3HJRA 4WFKA 4EKNB 4BZXA 5ALUA 1INLA 4GOLD 2VLIA 2O2ZA 3O31A 4PPNA 3LL4A 3C5CA 3QE3A 1W2WB 1KS9A 4QLAA 1VGQA 1ZDMA 3A4MA 4ZIRA 3ILSA 1JI0A 3N8IA 3K8OE 3KYJB 1BMTA 2QX9A 2POQX 1OVGA 3OCXA 2CHEA 2ZI6A 4M8SA 1A9OA 4Y1EA 1NFQA 2JB9A 5JECA 4L27A 1M5UA 4M99A 3T15A 3DO5A 3RUEA 1K6EA 2O0KA 2VWPA 1EUCA 1NOJA 2XHEA 4J9UE 4JL5A 4DOMA 5IF3A 2HHHB 1TX4B 3BJIC 5G4LA 3ULKA 5IJ9A 2A86A 3MJVA 4E0BA 2DERA 2ZRCA 1JZSA 4L3VA 2BY4A 4C29A 4KMMA 3C6ZA 3QEJA 4D46A 1IPFA 4JJ8A 1F1JA 4UM8B 3I5XA 4E5YA 3DR5A 2BEVB 3AJEA 2W4MA 1BDHA 2XF8A 1RE0A 4B3GA 3CEJA 3L7DA 1AA9A 1OLXA 3GCWA 1PL6A 1Z8FA 3TQTA 3ZLUA 2PL9A 2A14A 3M4YA 4Z0PA 3NONA 5H8WA 5H9WA 2ZYWX 6Q21A 1WMEA 1Y7PA 3BOSA 1VLJA 2Q99A 2QJWA 2FPUA 5TPZD 2HCRA 4QJBA 1ORWA 4PQGA 2HEGA 4U2DA 2DR0A 1IY0A 2PIDA 4YDRA 1SWVA 5JDIC 1HDYA 1XJCA 5CB6A 3VO2A 2WZDA 2QS9A 1TDJA 5F3RA 3AEKA 3MCUA 4JDUA 2P3LA 4X97A 1I3KA 4Z51A 4OL9A 3R09A 2QP9X 3ETEA 4HH3C 4FMBB 3GFGA 4RKQA 2W8BB 1X94A 2NO6A 4DNFA 5JNVA 5EL0A 3FGZA 1IXKA 2BUAA 2C88A 2CUZA 5JHHB 1Y7HA 5KUTA 1ZO8A 1MRZA 5DHSA 3D6UA 1EFHA 2G5CA 3D7LA 3MRSA 4BVBA 4NTZA 1JVSA 2QRLA 4J0KA 1E3DA 4TXLA 2AHOA 3VC2A 4K26A 3ZBUA 1YHZA 2GM9A 1B4DA 2JHFA 4XYEA 4LOLA 1XTUA 1DRVA 5T41A 3UJ6A 1Y8CA 3GOHA 4ZZ1A 4PINA 2FUKA 3O3MB 3DOEA 3WKDA 3JAWA 2PN1A 1N6OA 4PYNA 1DSSG 5K3FB 2X19A 3UGTA 3PEWA 4XD2A 1XVUA 2CF6A 5KYWA 2IJGX 1E9BA 1Y5IA 5LB2A 4FEGA 4PR3A 4F96A 1DEHA 4QOGA 5EJ4A 4I55B 3CGWA 5CFNA 2J3KA 2EIHA 1ORDA 4W1RA 1GDDA 4A8JC 5F77A 5CG1A 1TEZA 3ZD7A 4J7CA 4OEHA 3I2FA 2Q5LA 4V0ME 1ZH0A 3KSMA 1NJ6A 4CIAA 4LOAA 2B25A 1E3EA 2HX1A 2VDLB 4JOBA 2XCRB 3AJRA 1E4EB 1KRWA 1NMXA 1U5AA 5E6UA 4HB4A 2JLZA 2JZNA 4BFXA 3OT4A 4RIEA 4WZZA 4I9UA 1VTKA 3P26A 4K6HA 3C4JA 2WG2A 2W6OA 3M0EA 3I72A 1M6HA 1FDVA 1TYZA 1TVMA 1RI5A 2AG5A 2GK7A 2QJFA 4N6NA 4ZOAA 2CLDX 2IS1A 4XPIA 3EQ9A 1R6VA 3G2IA 1XG5A 4CR6A 5DLPA 2V7BA 2JEZA 3E70C 3R0QA 3VOSA 4ZRMA 1M72A 2VDOB 3P5BA 4CG3A 2TMYA 1FYFA 3NWEA 1RWOA 3PUJA 4P5DA 2D59A 3MJSA 4RIFA 4WT7A 3K6SA 1CDZA 3N2IA 1VHQA 2HA4A 4ZD6A 4S0XA 3PB3A 1YC2A 4L07A 3UJCA 5LWHA 1F2VA 1AC5A 4XVUA 3ZX5A 4FC7A 3ER9A 3MA0A 3UWMA 2XCIA 4NJEB 1VE6A 1CIVA 1AZSC 1K97A 5KCZA 1NLUA 2J31A 1XJWA 1VKOA 3OQOA 3Q6MA 3ROQA 4N12A 4MV7A 4RVCA 3SHTA 5KYYB 3BXXA 5EMMA 5E1OA 1MPXA 4EFDA 1G1MA 4MVJE 3EEQA 1C3OA 3D4IA 3TRKA 5JV5A 3O73A 4GYKA 5I9IA 1B6TA 3VHQA 3PEYA 3DBHB 2GGSA 4TYQA 1Y1QA 4I5GA 5KYXA 1S1MA 3IODA 3PNBA 4J4TA 4OXNA 3ZZNA 3QYPA 2ZYSA 4P82A 2FZVA 2IUSA 3P2KA 4GICA 4TMKA 4A5OA 1GU1A 5B4TA 4P34A 1Z6QA 3G2KA 5HHTA 4KPUB 1NKSA 5CVDA 1H1DA 5CNKA 3B3JA 4KLCA 1DXHA 3O2NA 2ZB4A 1KQ3A 1Z12A 2IYVA 2LE0A 3G2NA 4LAFA 1SHUX 4MV9A 4D3XA 1NSYA 2W93A 3STWA 2G1PA 2XPCA 1JSLA 1FMCA 3RO7A 2BJHA 2O4CA 4O63O 5CLIA 5GJCA 1R9JA 1VJRA 5LA6F 3RTGA 4CM9D 4DBZA 5JZMA 4H3HB 1QHNA 2PFKA 1LK0A 3JV7A 3MTDA 4KPFC 1TIBA 5EMLA 3D4OA 3D8RA 3EXIA 4PPQA 5KWSA 2IGBA 2ZG6A 4C4AA 2XUQA 5KOJB 2H17A 1LW7A 1V5EA 4R81A 3W5BA 1EDBA 5CAEA 1X7HA 1B8NA 2PO5A 1SY7A 1YASA 4CCAA 1ZOSA 4O4JF 2P5SA 3M4NA 5DNDA 2YYZA 2I6XA 2IE0A 4MR8A 4MA4A 5I9SA 1KZHA 1M1ZA 1QHIA 3W90A 4TL8A 3LOPA 4DSTA 4BFLA 4PX9A 4YAEA 4PR0A 3K1JA 2Q3DA 4B3XA 2OBNA 3RG8A 3ZGOA 4KAFA 1Q1ZA 4UTVA 1OU0A 1SK9A 2G8NA 4U00A 1HDOA 3FOEC 1R4ZA 1XEXB 2G04A 2MINA 1R10A 2FPIA 2OCXA 2R1VB 4N5NA 4U7GA 3VR6D 2JHCA 1JHRA 2ALJA 5FWXA 2L19A 2VZEA 1Z34A 3DAYA 3HDVA 1D2CA 3OZEA 1EFVA 1B7GO 4TLMB 5FV4A 2VKQA 3GDOA 3JASA 4NBWA 2YMQA 4E12A 4EUNA 4JKIA 1T1SA 3QU7A 4YAKA 3K4HA 3V2UA 3MFYA 1SG6A 3VDNB 3WLQA 1P77A 2J4FA 1NF8A 1BQ4A 5ALXA 3HJCA 1EBBA 4GWGA 4YGXB 5J2TA 2D8AA 1GTVA 1DQZA 1F4VA 1YBHA 2E6KA 1TAQA 2IU4A 1GYPA 1JB9A 1U0GA 3LCUA 1I1HA 4OJNA 3GH1A 1ICIA 1ZMTA 3PPXA 3E84A 5A3SA 5FWYA 3W5CA 1FUEA 3JZAA 2X9VA 4KAJA 5F52A 5LOVB 3RK4A 3UK1A 1W0CA 3UB2A 2RHWA 3GRYA 4GPIB 3TGPA 4YPFA 5FBHA 4MKGA 3ZHCA 3FY4A 4N7RA 3HJFA 1PFWA 3EPRA 1NURA 1V37A 4BLRA 1RTTA 1H8HA 4G0UA 4BRWA 2P0AA 2G28A 5LJLA 1ZEJA 2PMWB 3EQ6A 1FB5A 1XHLA 2V7QA 4Q3LA 1DUIA 4B9AA 5BV1A 2ZIAA 3DONA 2HZBA 3BH0A 2E85A 4GF5A 4RDIA 4ZYYA 1W25A 1ILEA 1B14A 3VBEA 3VR2D 1FDSA 2WLSA 2A1TR 3DEFA 3N2GB 2F2TA 2G5TA 1U8UA 2IZZA 4XPIB 3O8BA 3CNHA 3ZW9A 5JRZA 5E1MA 3IUQA 4HOYA 5FUXA 2JVKA 3BA1A 4JI5B 1V4BA 3A2NA 4YCNA 1JEJA 2JG3A 4KU4A 4G1VA 1KAMA 3L18A 1UKAA 5JXIA 5I8WA 1UC8A 3AI7A 5AI9A 1FQKA 1TQHA 3U1TA 4CF3A 4XVCA 4H1HA 4TX1A 3FYTA 4W5WA 3D5QA 1JPUA 1WWKA 4HCJA 2EL7A 1B2LA 5EFZA 3VYVA 2QUAA 1M8JA 4I0WB 4CM4A 1W59A 3LW7A 4RA9B 1M1XB 1TEXA 3KQYA 1RR6A 1KI6B 4EPXA 3H99A 3G8YA 5L95A 1PWYE 4E3WA 4ZU1X 1E6CA 2GXSA 2YWFA 1PV4A 3F6RA 1U7XA 1UKEA 3WZ2A 2GLTA 2OD2A 3DLIA 5CYFA 1QTQA 2BN4A 1M8PA 3TSZA 3VR3D 2M1ZA 5AVQA 3COJA 2N3ZA 3UFBA 4MUBA 3ETCA 3LDUA 2VPWA 3R9WA 1WLYA 1SULA 3V1KA 2GCOB 3AUYA 3L8CA 2GKGA 3WIVA 2ZSAA 1M8GA 2Z1MA 3DBHA 1S89A 3A1DA 4GZMA 4JGIA 4X6LA 4DJJA 3B7WA 4TMTA 2IIBA 4JVNA 2MR6A 5MGBA 3AR6A 2OO7A 4MJLA 2LCIA 3UMVA 1FXSA 5ALKA 1MX5A 1BCRB 1Y1LA 3GEGA 4OB7A 1UMCA 3F6PA 1JEDA 3E7WA 3KJZA 2UUBB 1OBHA 4MPRA 1K3TA 1QE3A 2Y05A 4F6RB 4EJSC 1QJCA 1ZUNB 3T3PB 1VMAA 2AE1A 1RQ7A 1FNBA 5L53A 1QFZA 3KKEA 2HA3A 5FOXA 1MB9A 1Q3TA 4EYEA 3JYPA 3KTOA 4JJIA 3TLGA 2C4WA 2WTAA 3EIEA 3R5XA 1MB3A 1NUPA 2C1ZA 3B36A 4K3VA 3H6HA 4UM5A 5AJHA 3WK7A 1Z0SA 3HJGA 1P1RA 3TD6A 2BKVA 1VLLA 3D0OA 2DJ5A 1G5IA 4R1LA 1VI2A 2CDAA 2OYCA 4LTDA 4ETWA 3ZI0A 4LRTB 1ZUWA 1GZHB 3FDZB 1Z2NX 1B0UA 3RARA 4EELA 4QG7A 2H1CA 3CRVA 1UCFA 4B2LA 1JPNA 1MF7A 3BHIA 3D0QA 5DNEA 3QM1A 4TKVA 2Q50A 1DWUA 3UO8B 2HSGA 4F9EA 4PLTA 3DMPA 2AYZA 4IJMA 5ICGA 2AMVA 1NBMD 1NLZA 1M67A 1Y4UA 5DGXA 3GJTA 5FEMA 3UJNA 3IE1A 2CMKA 3EMVA 4MVJD 4WOKA 2LIPA 1SVLA 3IKVA 3Q10A 4MVJG 1XI2A 2CLSA 3WRVA 1ZISA 4PYOA 4YQFA 3T3OA 1ORTA 3O8OB 4Q7MB 4EEXA 5K2OA 1PX0A 3H8JA 1XMVA 4MP6A 1EK0A 2A8YA 4PC6A 3R9KA 2PAAA 5KTKA 1J33A 2ACKA 3OECA 3HKEA 4GSKA 2VAVA 3WGVA 2FLKA 5MFZA 1VL0A 1WX1A 2YXDA 3AW8A 2B6NA 4LFCB 4UDNA 3NTLA 3GVXA 2BRUA 4KE9A 3FF1A 3SSNA 3II6X 5FV7A 1NIJA 3R3VA 5BY2A 4DDUA 1FNMA 4XRRA 2HK9A 2IDJA 3QG5A 5FAKA 4XD7D 1RS0A 2XNDA 1P4GA 1X1SA 2QP3A 3TPZA 4DQLA 5EA2A 4UUOA 1WP9A 4LZAA 3VDXA 2UXDB 1SPBS 2QQFA 3DE3X 5J63A 3WDKA 4D4GA 1SBCA 1DTEA 4DXAA 3AU8A 3ZDEA 3NWBA 1IEQA 3GB9A 3RB8A 4MWTA 4A1OA 5JCOA 3M9LA 4F72A 3D6TB 4DV2B 4N3CA 5AICA 4CIYA 1BNCA 3CTPA 1OBOA 1SHTX 2QVZX 3H4MA 2G40A 2LRHA 4HEHA 4HR7A 1FZQA 3W5IA 3WNZA 4DA0A 3T3GA 2NNWB 2YHIA 1ZHFA 4ZQFA 4EGSA 4OBWA 4B73A 1T0UA 2Z2YA 3BRWD 4PQEA 1JFTA 2B1JA 3L8FA 3RVOA 3S4YA 2JAHA 2DQSA 1UOQA 3QBEA 4MVJM 4PZUA 3SKYA 3OCJA 4B48A 1E0AA 3CO5A 3QU9A 4G5FA 4BMYA 4YT4A 2O8DA 2W70A 4QXPA 5K0BA 2OL4A 4OU4A 4R0VA 3TAUA 3UKOA 4M8NE 3HBMA 1IAVA 1OIXA 2HQOA 2Q6VA 3UAOA 4L8GA 3ICQB 3Q7TA 3O21A 1SD1A 3FRIA 3ZTYA 2WICA 5DEOA 5T7BA 1EDDA 3B5JA 4BLSA 4IF6A 1N6KA 2G5GX 4UEJA 2RAFA 1POWA 1F5SA 3DZBA 3WZLA 3JARB 2G0AA 1LDGA 4Y0AA 4MVJH 1P8JA 3N0TA 4ZVMA 1B8OA 2VKTA 3H3XA 3L7YA 5A1TA 4Z4EA 3IFSA 4TUYB 1U1EA 1L5FA 2YS7A 5LZ2A 1DRUA 2O07A 1U3VA 1Q7CA 1ISJA 1YNSA 4BMSA 3COSA 2JS7A 4FZRA 5LN1A 5L3QA 1DJMA 2P67A 4CKYA 2I7VA 4LV5B 3IBSA 4JS0A 2G9ZA 5KQMA 1WCWA 3IERA 4ZGGA 5LMZA 1A5BB 3GBSA 1WUYA 3KWJA 3RQIA 4DADA 1MGOA 1W1IA 4DLKA 1N1EA 5L7WA 1HT2E 2PD6A 3CSDA 1CP3A 2R25B 5ESWA 2RH9B 5BN4B 3SQLA 5JC1A 3K9FC 2JGNA 4V3CA 3NDBB 1T0PA 1Z2OX 2VTVA 4YDSA 1UWKA 4EG3A 4J03A 3I92A 5HP4A 4OREX 1P4HA 4W1PA 4ENVA 1S1CA 1R8XA 3GPBA 4CGZA 2VYND 4FOLA 3OWOA 3NTRA 4O2BB 1XZLA 1XC7A 5EY5B 1V1MB 4CCWA 1PVOA 4H7DA 2X58A 4F5YA 2HWXA 1C0LA 5BOSA 1L7RA 3U37A 3QVOA 1EK1A 1Y8ZA 2MMCA 2O1EA 4I55A 2FSGA 1XNGA 3P0IA 2VHCA 3MCVA 4JFAA 3S7ZA 3T0IA 1YBMA 3K71B 4ZP1A 1TRHA 4YRZA 1QHYA 5PNTA 3LKBA 1MN6A 1FJ2A 2CXTA 4OJKA 4YO7A 2VTBB 3PC3A 2ZRGA 1H05A 2TMKA 3ZWPA 3ANYB 1N3YA 1TF5A 3AIMA 3PK0A 3QKSB 3HO1A 1UM9B 5E4TA 4AO7A 1C1XA 1ZU4A 1R9GA 3OT1A 4BQPA 1RYFA 2BUCA 2GPBA 4F9GA 4WLVA 4G8BA 1FC0A 1UFRA 2R751 3FLEA 5H3HA 2YOFA 4II2A 1N2CE 1RMYA 2PS9A 4NYJQ 1GL9B 2OESA 2ZBQA 1XVIA 2ZBRA 3TBKA 5LFAA 1VL5A 4FEAA 3PQEA 4EUFA 4FLEA 5DGDA 4M6WB 5HRAA 3PENA 3QWBA 4BRUA 4QNNA 3I2HA 2BC9A 3QFFA 1Y3FE 4FBLA 4HTFA 3QKWA 4BO4A 1QOQB 5FL7A 4DF3A 1W4BA 1IOLA 2Z4RA 3BWMA 4QIHA 5LZ8A 2I91A 3KX2A 5IMSA 4XI9A 4P92A 5H68A 1CRQA 4EGQA 2IDKA 1DEOA 2XBLA 1AV7A 4PG7A 1E0DA 1I7NA 4HATA 1QXSA 3ORHA 1DV1A 4WKGA 4B81A 3VO9A 1R6UA 1FTNA 1Y8QB 1Q7BA 4MUFA 4BCBA 1GFZA 5I3ZA 5AO9A 3JQRA 2UZIR 5K5EA 3S7TA 3SZRA 3BL6A 4QO7A 4J75A 1DIHA 3RUPA 1JVBA 3ZD8A 3RVSA 3RU7A 3CF0A 5AK3A 4YDQA 5KSPA 2HBRA 2A4KA 3E5NA 3OZTA 3ME5A 5DNVA 3VU9B 1R8QA 4Q3OA 4DQVA 2WWGA 1WPQA 1VRCA 2IHVA 3B1ZA 3QBDA 4F6CA 2J4DA 3A9UA 3L1JA 4EH1A 3WLIA 1UPFA 4N0DA 4YROA 2F7SA 5FBWB 4E88A 5JQGB 1O95C 3AVOA 3MLBA 5CDHA 2BZ1A 4D9NA 2ADOA 3L7JA 3T1QA 2ZVQX 1OILA 3SLGA 1SVIA 2YR0A 3CUUA 4MVWA 4JIMA 5DLEA 3AP2A 4W82A 5F73A 5J4HA 2ZRDA 1YZUA 1V39A 1I4DD 1MORA 2XUJA 3IHTA 1QGUA 1XAHA 1RLIA 3TN7A 2QLNA 2V7PA 3Q40A 4BNIA 2OSBA 3TLCA 5JDCA 1FJHA 1YZFA 2XX3A 1LSUA 3A3KA 1SBIA 3IUYA 4P8RA 3WNCA 2VSNA 1CS0A 3NATA 4Y6LA 4CJXA 2JLUA 1HFWA 2HPVA 1PK9A 3BUSA 3JZFA 3PFCA 4NU6A 4MYRA 4YNBA 3AHIA 2AOUB 5E7IA 1YZLA 1WZNA 2VYFA 3HVKA 4YCMA 3HKBB 5EZYA 1PYGA 2GHRA 3E9CA 1Q17A 2AIRA 3DB2A 4ZYUA 1C41A 4LKRA 1ZGCA 4UCQA 4ZJUA 3Q3EA 3LGAA 4MI9A 1WMSA 3WIOA 4ZFNA 2WWXA 3F1LA 1LU9A 3OE7D 1U3FA 3VH1A 4KI0A 3EEYA 3EXEB 4BO7A 4XQ9A 3T0FA 1JAIA 4PG5A 1Z0AA 3KE8A 1NDHA 5T57A 1C9DB 1T36A 2BEKA 2ORWA 1CC1S 2EKDA 2JIDA 4N5HX 4V1CI 5HK8A 4ARIA 5M7EA 1LS6A 4RVHA 2CL5A 1JJVA 2FUEA 1MENA 3N86A 1DL5A 4IVRA 4UE2A 4AWAA 5LD2B 2FPOA 3LZDA 5TT1A 5FPSA 1H6BA 3IKTA 2VP4A 3SBDA 3EA5A 2Z5GA 2QL6A 1Q11A 3UMJA 3ZK7A 3H97A 1E59A 1O94C 3W2GA 4X20A 2D7CA 1NBIA 2YJZA 3B6ZA 3IV6A 3KHTA 3FMVA 3O7MA 1WD5A 4NZMA 4YJ3B 2HRQA 3CS3A 5JAQA 5BP7A 3HFGA 4XAQA 1EVYA 3D6AA 3DL2A 4ZN6A 1E7RA 3FUWA 4YYEA 4F45A 5J58A 4TM7A 3P2JA 3KB2A 1ONNA 1ESEA 4DV3B 1G20B 1GUDA 3NGMA 5TS2A 4K6CA 5ED0A 1G98A 1YO6A 4J91A 2YH2A 5EFOA 1L1FA 4QFBA 4ND2A 2ZIWB 1FDUA 4M4SA 1XB2A 1DBIA 3M6FA 3QYFA 4ZAVA 2EJCA 3NWJA 1U4OA 1W44A 3FCSB 1S02A 1RU3A 2AMJA 3VMMA 3ADPA 4RQTA 1SXPA 1JHOA 4GZLA 4Z5XA 4J29A 2J3DA 4JOSA 2P7HA 3OU7A 2I6SA 1WCIB 2VTBA 3T54A 3QOXA 3IAEA 3AINA 4I9HA 1ENOA 3I3SR 3PICA 2E3JA 3BMNA 4R8LA 3ZHSA 3TUIC 4CRWB 5H4GA 1C8VB 2LKDA 4E7PA 5JJIA 3U56A 2ZI3A 3E8SA 1P6UA 2FZKA 5K09A 3P9NA 4MR9A 4FX5A 4OXKA 2DLCX 1CUCA 1LFAA 3N7TA 4MVCA 4XIYA 5ILGA 2M1XA 4LWOA 1XKQA 3ZVLA 4OHVA 1X87A 3NBUA 5K3AA 3ZH2A 2FEXA 1Y1KE 3VHLB 3VPBA 1CYEA 1EGHA 2ZRKA 2MT9A 1N5KA 4WY8A 4D9JA 1XZBA 3EUWA 4O02B 3VAZA 2XEDA 3GJSA 3RT7A 3S1SA 3L6BA 4CU2A 1MT3A 1Q7RA 4NPCA 1SOUA 1MQSA 4WACA 1NVKA 2KBFA 4ER6A 3UT0A 1ZRHA 1LF5A 3M5WA 1N7GA 3K70C 3DTVD 1U0EA 4XE5A 3RYIA 1P2BA 2QM0A 2WUGA 1NNI1 3ND8A 3DQQA 1G1AA 2YOHA 4HDOB 2XGMA 2QPTA 3TQOA 5K6TA 3TX6A 4R2KA 1CDDA 3WDSA 2CKMA 2O6LA 2CXHA 3EVDA 3E3MA 3LVRE 4UUNA 5DASA 1KFEB 2ZULA 1XMOB 1LVGA 3CGGA 4JB8A 1Q3KA 3SS8A 3A58B 2MYUA 3FM9A 1C9NA 3HU5A 3LT5A 1ZJJA 5IVIA 3BEDA 1KMHA 2IS4A 1DC3A 2ZYTX 3BH7A 2QUIA 3EVFA 3I9OA 1CZKA 3VJKA 4L22A 1FYDA 3ZUGA 2JA2A 1KY4A 2FZ5A 3GGDA 5K3CA 4LGVA 3EWSA 4LQCA 3AJ8A 3TNDA 1JR3E 1IOZA 2G06A 2OGUA 1C9JA 3L2OB 2FH5B 3KVOA 2XI4A 3T5MA 3W7BA 3S2EA 1X6VA 3KLPX 1DP4A 4B4KA 5AW7A 3OWHA 3COVA 3MIIA 1IVYA 3QEBZ 4IIHA 1GGHA 1XZKA 3MTGA 1JHAA 1KSHA 2ZLBA 3OJXA 4EVQA 1J2RA 1J0EA 3P2EA 3IOEA 1SPXA 2LV8A 4D9BA 4HUQB 3E9NA 4X3PA 4F4FA 1YJCA 4YRSA 4YAOA 5KNBA 1NW3A 1QH8A 5ILQA 1NC1A 3U6KA 1JEEA 3DR3A 1EFTA 1EX1A 1HA3A 2C4TA 5FWAA 5KCMA 1W36C 2IXBA 5L45A 3L3BA 1EX6A 3KVYA 5HVNA 2VI5A 1N7HA 3NTQA 4IVQA 1V3TA 4NCNA 4AZ3B 1NSTA 1ZX1A 4DNXA 1B8VA 2G72A 1L8OA 3D8SA 4KOEC 5AKJA 1VBKA 1ULAA 3E82A 4TVOA 4JBNA 1ND5A 4RS3A 3QVVA 1NI3A 2KM1A 4HDKB 3LUKA 2GILA 1XALA 4HGPA 1TQ2A 3UGQA 2FSVC 7ADHA 3TQFA 3JQCA 4PQFA 4YMLA 5K99A 1EVJA 2Q4TA 5G0WA 2GEKA 4CTKA 1OIWA 4NY1A 2YIDA 4HGOA 3MCZA 3EVNA 4KQCA 4EVIA 1G0NA 3FUXA 4R3WA 5K0CA 2IDZA 3VHXA 3H1PA 1QYRA 4R16A 4B3HA 5HZKA 1XTRA 1RRCA 4PS1A 3M1LA 1WL8A 5JAUA 1GGFA 3H87A 1D0IA 4MJXA 3C7DB 1Z6TA 2D2XA 3X2EA 5KBYA 4KO3S 5JISA 5CA0A 1X2EA 2WIJA 1DX9A 1V3QE 2YN4A 1MX3A 4O4LA 1ZNZA 1RD4A 4O2RA 4RS4A 3DG9A 1MG0A 1PW7A 4OHFA 3FTEA 4NE2A 1Q95A 2H57A 2Z04A 4NHEA 3WL3A 1X3LA 1T3ZA 1RCUA 5HGXA 1F48A 4RIIA 3UQZA 1AGYA 4CBVA 3DFZA 1CUZA 1LC0A 4BNJA 1CZNA 5KJCA 1PV2A 4B8ZA 1QU2A 3PGJA 4GP9A 1G6OA 2SBTA 4TLAA 4C6HA 2QV7A 2IHNA 3ZD9A 1HX7A 1L4GA 4R69A 4XJVA 2O2IA 2PUDA 1AXGA 1BH6A 5DV9A 3RFVA 2FWAA 3I32A 3EIFA 5FKJA 1LI4A 3VPDA 2XTNA 3BCUA 3V7WA 4A6DA 2XUOA 1U7OA 1UPAA 4CQLA 2NV0A 1QFXA 3A6DA 1Y7LA 5DT2A 1AMOA 1S3IA 2XMPA 5CJJA 1QHHB 1Z2CA 5JD5A 1JXMA 2ERXA 1FDTA 1JP7A 3GZNB 5JI2E 4YBRA 4OHXA 1W2GA 4FSHA 5FAXA 1P9OA 3LT2A 1V16A 3OD5A 3SHOA 3UY4A 2GBIA 3EZ2A 3W5SA 3QUCA 3WFJA 3TNYA 1SXJB 2W2MA 1VIYA 5AW3A 3VR6A 2WJAA 4EDFA 4YX9A 4DW8A 4WMLA 1XYVA 1LLUA 5LNK6 3PFKA 1SOAA 3DVLA 4QVGA 4CG2A 4B4UA 5K05A 3DVSX 1QF6A 2W71A 1T9GS 3T7RA 1APBA 1Y6FA 3MOGA 5ANRB 4IZOA 3IHKA 3OU6A 2OAEA 3GT3A 4JJFA 2AMYA 1C7FA 5BV7A 3W3AD 2PKQO 4DB2A 2GD0A 1P1FA 3FNBA 4GSLA 4M22A 3UATA 3M5DA 4AZWA 5JD3A 2RHGB 1ZSVA 4PICA 4HSEA 3C45A 4GC9A 1Q0PA 3KALA 4FLMA 2GI4A 3SOPA 1OUMA 3R7LA 1YT5A 1ZLXA 1M34A 1L7QA 2HV8A 4G85A 5JD6A 2X5JO 4MRRA 4CTJA 1ZNQO 5GPBA 3PT9A 4OI2A 3LO8A 1PNQA 1G21B 4TN1A 4PONA 4EARA 1P0FA 1UBEA 4XUCA 5AVZA 1GCGA 2HNBA 1L8AA 4F21A 2DH6A 1KXZA 3DCJA 2PH1A 8AT1A 1Q21A 1WDWB 1T4BA 5BUSA 2FQQA 3NASA 3MW8A 2GFIA 3OT1B 2XECA 2YW2A 4K87A 2NAPA 3TLKA 4C14A 2IQIA 3LCJA 2HI0A 3T7CA 2F55A 5ERGB 1MRSA 3G8CA 2YVQA 3N76A 2BSXA 5EZSA 1HFEL 1NSFA 5TGTA 1II8A 4NNOA 3NM4A 5CFRA 1U3GA 4GO1A 1PJCA 3GT0A 3E27A 3FUVA 3HFRA 1QGAA 2WZQA 3AUJB 3P27A 4QQNA 4X71A 1EFKA 2RFLA 3M3PA 3QA9A 3EVEA 4WCDA 4F8JA 5IDWA 1P5FA 3DDSA 4TM8A 1Y89A 3ROGA 3WQHA 2LD4A 1ORHA 5IUNC 3BWBA 1DO8A 1CZLA 1ENYA 1EFUA 4BVHA 3GJ0A 4TROA 1PT6A 1NVFA 1U1DA 3FNQA 5IKOA 2ZSDA 3RBAA 3WG9A 2KWIA 2QU7A 1IZ8A 1IVSA 2R65A 1D6JA 3BEOA 9MHTA 2C2GA 1V71A 4PZPA 4A2PA 4EKYA 1RPJA 2VPPA 2I8CA 3Q11A 1SEVA 1FRZA 1BS2A 3G3EA 2O8FA 1JQKA 1PG5A 2XWBF 5IASA 4HV4A 4AIIA 1T4CA 5EZQA 3RFUA 1LBHA 2E55A 1Z5PA 5DM70 3D7KA 1E9SA 1M8FA 2BR3A 1S2IA 3FUUA 1PU2A 4TXJA 2W42A 4Q16A 2EWWA 2XUKA 4B40A 1DI0A 1HZZA 4C4ZA 3NEJA 2ODWA 2YYSA 3PZRA 3QP9A 3OY2A 3FMOB 4C78A 3SQXA 3ONWA 3GVCA 2C5HA 5ALSA 2V0CA 3AI2A 2E89A 1ZIOA 2IXTA 3GFPA 4TLLB 5JHGB 4ITRC 7ABPA 1Y9DA 1L4EA 2C8JA 2CMHA 1NHGA 4H1TA 3F90A 4PXYA 1RADA 4YRAA 4WFQA 4KVZA 1LW6E 3U7HB 4BXOB 3VX3A 4JC0A 1RIIA 3EXHC 3FJ1A 3GROA 3PWKA 3JWJA 4BNYA 1JYFA 4OJQA 3AHEA 3EISA 3HO6A 1NP6A 4AP9A 3OICA 2R4TA 4DLYA 3FOCA 4KH0A 1JB1A 1V5WA 2GZHA 3NOQA 4XZ3A 2IF0A 4KJZA 5TDHA 1ZAYA 4GPEA 2UYHA 3AHGA 3KYCA 4HXYA 3E2PA 5DISB 3VOBA 1KEKA 2FK7A 3QVUA 2BFBA 3KJQA 3UKJA 1DO2A 1BMFD 2IW1A 1XCPA 4M1KA 5C34B 1RRKA 5G41A 4K88A 1ZITA 3I6ZA 3S2UA 5HMMA 3RNLA 3WJAA 4L0QA 1V8BA 1UJCA 2BFNA 2C98A 2WAXA 3FJOA 1PLKA 2OG2A 2WPDA 5JZVA 1XNHA 3U48A 4C6SA 3PSHA 3EARA 3F6SA 3AUSA 4CUJA 9LDTA 3SICE 1MXHA 3MHTA 4Y2YA 1GQQA 3F6EX 5IABA 3RC8A 4QT0A 5SZIA 2XDAA 3UV7A 5LD2C 4DR7B 4U7DA 3ZJVA 1MO2A 3C3MA 1BW9A 3NP7A 4BTVA 3GFSA 3IB3A 2PUVA 1H2ZA 2BI4A 3NHUA 5EJ8A 2GN6A 2WY2D 2UYYA 3MQFA 4FS8A 1CLUA 4GKKB 3FLAA 4XD7A 1QVWA 2XNDD 2ASEA 3BRCA 1MW8X 1W30A 3PNPA 3ZHRA 1CBUA 1ZJ5A 4NVRA 4OK6A 3TTWA 3FOWA 1NAIA 4M1ZA 1QCDA 3L1VA 1HNZB 1RYBA 2OR3A 2OCYC 3I6IA 3TZEA 2VJCA 4BP3A 2HRDA 1PZGA 1B3RA 1GA1A 3CWQA 4AMVA 1VB5A 3HACA 3L02A 1GUBA 2R68A 2XQIA 1K63A 4FNOA 4ZT5A 1NUHA 1MO3A 2HLHA 4RANA 4W5NA 2D1SA 1XYGA 3GDGA 4YT8A 5J2UF 3LC2O 2WJ4A 3NGLA 4GMHA 4TUYA 4DIKA 1L3CA 3H42B 1Z08A 1MH1A 2OO5C 5IUKC 3EVAA 4DUPA 1ZPDA 3AB7A 1U31A 2F59A 2FK8A 5K0NA 4EL0A 4W8GA 4WCVA 1SU8A 3TLEA 5JU6A 2W6ZA 2ZRJA 4FHFA 3IV7A 5AUQA 2B1QA 2Q8PA 4JLKA 3H65A 4COKA 3ZN2A 3O4FA 3G9QA 5T4BA 3WO1A 2Z2JA 3ZHYA 1RI2A 4B6FA 2L18A 4Z4FA 4TV9F 1N2CA 3DNPA 4E7OA 2DX7A 5B2FA 3GEHA 1ZJZA 3HR4A 1X1CA 1YUBA 2CCKA 4GNRA 4U7HA 3L07A 1VMEA 1TCVA 2ASVA 1IATA 4MGEA 5F5NA 2Z08A 4DSAA 4NE7A 5JCPA 4ZMSA 3K1AB 2DJIA 4AJKA 4H31A 2KJQA 4KN9S 4HNHA 1HQDA 1R4MA 2HJRA 3U19A 1QLWA 2I1LA 1X7GA 4F6RA 4Z86A 1T5DX 2QU8A 4FNMA 1D1PA 1SD2A 3HWWA 4XFDA 5B7PA 1UBRS 3C70A 5CYOA 3CEMA 1GKIA 2XGGA 1Z22A 3PUZA 4ZOBA 1CVIA 2FUG1 2PEZA 3RS2A 1K6JA 3V7NA 3M6MD 3WGQA 1HRKA 1K75A 1YAJA 1FYEA 3HWSA 5K01A 4CMHA 2NZXA 4L9SA 4C08A 3K92A 4E4RA 4KITB 2VDVE 5E9WA 4CDMA 1E3WA 2D0IA 2RGUA 1T5BA 5E6UB 4GW3A 5A9SA 5DOVA 3E9EA 2R8BA 4CI9A 3PQ4A 3DMTA 4C3ZA 5GJBA 3N39C 1Q7EA 2ZWPA 3AHDA 1Z68A 4BQNA 4RGBA 1QGED 2Q5OA 4P6VF 5HIJA 3V1TC 2G1JA 3BJZA 4Q66C 1QP0A 2CUNA 1O89A 1JE0A 1YS6A 3PNOA 2BEJA 4LGYA 2INGX 4L75A 4M6WA 1J0BA 1FX1A 3SMVA 3T61A 1E3SA 3EUAA 5B36A 2WK1A 1E7WA 1FDRA 1T10A 4M1WA 3K4PA 3K6SB 1B74A 3O8QB 4V03A 3AEXA 3G0HA 4LC0A 4YUVA 2PQ0A 2FPPB 5A06A 5DWQA 5LCXA 4R9RA 2YL2A 3GRKA 1PKEA 1D2RA 4ZHQB 4M83A 2A5JA 2N46A 4QGGA 3JATA 5I9TA 4LJ4A 2ZJAA 3C0KA 4Z4GA 4RZXA 1I14A 3CR8A 1ZW1A 3RUFA 4MWGA 1SQ0A 4GBJA 3AGPA 2OHFA 2H54A 4ZQCB 4F5DA 4E6PA 3O93A 3VZDA 1AY0A 1WOMA 4W5HA 4EBFA 2XKBA 4D5EA 3N0XA 4HFNA 4DA9A 2CVHA 2BTQB 3AJAA 3UWDA 3BH6A 3BORA 1EZZA 4KRXA 1FTWA 2EW8A 4IEEA 2CJPA 1GPJA 1PQUA 4N7JA 2VXYA 4RJLA 4D4HA 3BFKA 3WYDA 2W90A 1QZTA 4P36A 1QG2A 2P8JA 5K8LA 4H7EA 1U28A 4GI1A 1RBMA 3FCCA 1Y8AA 5DYWA 4OI1A 1FYVA 3A6HA 3IOCA 4FGJA 4OP1A 4PQYA 4XARA 1XCJA 2CBGA 2EFYA 3H05A 3PYMA 4KAXA 3SOZA 3W7VA 5T4HA 1FNNA 4AWXA 3LPDA 3GAFA 4PCAA 3EG5A 4XJSA 3GYBA 3RC7A 4WN9B 1WU8A 4N49A 1N8KA 4LV6A 4PSDA 3ZY2A 2O19A 3IAHA 3AL0C 4BNZA 1BEUB 1XQ6A 3TQCA 4JSRA 3WDMA 1KOJA 2GK4A 1NUQA 1CJTC 1J97A 2BUBA 1YB2A 5H80A 5EWJA 1DG9A 3A2KA 3AHJA 1JIXA 3EXHB 3RWMB 5HR5A 1IHDA 1SXJC 5KNCA 4Y18A 5B3KA 2NUTA 2PRKA 3QVGA 4PGFA 5E7MA 3I1YA 4P2BA 5DX8A 5BRJA 1V9CA 4WK0B 1E58A 1LRLA 5GONA 2Q8QA 2H1SA 4YB8A 2E1PA 1QYDA 2R6CA 5DTQA 4IIVA 1O08A 1H94A 5EGSA 4G0ZA 4JODA 2C5GA 4QQKA 4UTPA 3IDZA 2Q5HA 3K0CA 4GGPA 5TQ0B 2NUAA 2X22A 8ABPA 3DMTC 1D8AA 1GRVA 4K9KA 1L5OA 5AH0A 3VJRA 4RFVA 1I1NA 2IZ7A 3TQIA 3MPOA 3GLTA 4RZIA 4XIGS 5LQJA 4UVIA 4LTNA 1Q6ZA 1T2AA 1ZUHA 1U0BB 4QDXA 1X8LA 1HH4A 3QQ5A 1SK8A 1YL5A 2VYVA 2XIJA 1UEXC 1T4DA 2WJZB 2ZR8A 2MINB 1FFCA 1HGXA 4MS3B 4Q9DA 4RLHA 3W2HA 1N34B 1BWQA 3V1LA 1D7AA 2VDKB 1R3UA 2O57A 3VJMA 3OIYA 1HKHA 2ES4A 4HDNA 4JUIA 4OAPA 4QPJC 5LOVA 1LI5A 4YRLA 1G20A 1R6DA 4F12A 4XVHA 4LWPA 4TV8F 1E64A 1V4NA 4F3TA 1GFWA 5CT4A 2G7ZA 4DNOA 1QWOA 2AI2A 1ZMXA 2DPLA 4IFIA 4UAGA 2ZT5A 2IA5A 2F3PA 1Z06A 1UQRA 2QVGA 2ZTSA 3LQRA 1E2FA 1J20A 4TWIA 4ZT2A 1JMVA 4JQOA 1PUIA 2V6BA 3C3WA 2ORED 5BR4A 2Z4SA 3NVDA 4ZARA 3LUCA 4DUGA 1NXOA 5GIOE 3LHSA 4ND5A 2J48A 1CERA 1F5NA 3PD0A 1R8YA 3L7NA 2DQZA 2R8RA 2VCYA 3NAZA 3GHHA 5A5VA 4BMZA 1IUOA 3DP7A 5C3MA 3FFAA 3LS2A 1B16A 3MMXA 4WLNA 2DYKA 4WOJA 3VM6A 3ZQ4A 2Z9CA 4H6PA 3QBJA 2HA5A 3I45A 1FQOA 3KDPA 3MT9A 1HC7A 5DBHX 1P7CA 3AF0A 3T6KA 4JGGA 4PZLA 3ZQJA 1R6BX 3N2GA 1OHHA 2RGNC 4ALJA 3U6BA 2VN8A 2XZLA 1LBSA 1ESNA 3L4EA 1U6JA 4Y2HA 3DOUA 1II8B 5D87A 5BN5B 4DQUA 2DKFA 5ADUS 5BSHA 4MV5A 4M7WA 3L1UA 1QRTA 1TKRA 4NOMA 3CA8A 3V7UA 4MYUA 4YECA 2YY6A 3INGA 2ZXUA 5I4CA 1RRPA 3M33A 4L6IA 4M55A 4WPGA 1EG2A 1CY7A 3VMFA 2DUJA 1U0LA 1G3RA 1BE1A 2J3LA 3CKYA 3FETA 1TYEB 4WFIA 5CLQA 2NW6A 2IHTA 5T67A 1DFGA 2EP7A 3EA0A 3P4UA 3PEFA 5HUJA 1G9XA 3NC1C 1U80A 2JAWA 4C30A 3PXUA 3A1EA 3E7XA 4LVOA 1C1HA 3HFJA 4IEFB 3OQMA 1NL3A 1NPDA 2CDCA 3CVYA 2BH2A 4Q3BA 1T13A 1Q2XA 1V9LA 2PLWA 5B12A 2EFGA 3A4TA 1OA1A 4WXHA 5AI0A 5FBKA 4V0NA 5JNTA 3QYJA 1CJVC 5I5EA 1SQFA 2UU9B 1UL1X 3K32A 1TLTA 2C58A 1Z5ZA 3DZKA 1U0FA 3JWGA 4LE0A 5JW6A 1YTLA 5F7ZA 3LZ6A 4LNUA 1ZRSA 4JLBA 2PFSA 4J9VA 3SEFA 4CKEA 1UZUA 3TFOA 1SG0A 1Q0RA 1JEYB 1KQOA 2BF7A 2R9VA 2VK2A 2CLHB 2Z8ZA 2V4ZA 1DAMA 1WUIS 1Z73A 2BLNA 4UATA 4G36A 4MW9A 4IHKA 3RAPR 3ZV6A 1N1GA 1C7EA 3L6CA 4L51A 4WUTA 2POCA 2HZ7A 3KZKA 3MB5A 1OC2A 3H9BA 4HMOA 4U1RA 4DAEA 1JDUA 1ZN7A 3LU1A 2JAXA 3A26A 1WF3A 2GBPA 2OBBA 3ZDZB 2XDWA 5JXJA 2AUTA 3GHYA 1OWPA 4WK2B 3WHLA 3Q8MA 4Q1EA 1VJ5A 1TZCA 4HY3A 3IIKA 2VHQA 1M8KA 1WG8A 2IYYA 3OPXA 4M86A 4TL9A 2GSDA 1TC1A 1CQZA 3EZ6A 1FBTA 5GJVC 4K6MA 1IPEA 1KU6A 5KKNB 4IDGA 3OO1A 4F7WA 1GKLA 2YRWA 1US8A 3OE5A 4W9NA 3KBBA 2V58A 1D4ZA 2JLWA 1FLDA 1TL7C 3ZBPA 3R24A 4L28A 1XV5A 5IBPA 4A8JB 2G25A 4MA5A 4GM4A 1A7KA 4RSRA 4JN6B 4IILA 1SRRA 2BD0A 1OASA 3AUTA 5BT9A 2AJDA 5JH7B 4P84A 4RENA 4MV6A 1QNFA 2VP3A 3G13A 2H6EA 2TSYB 4UNPA 5D5QA 1AIPA 2A9FA 1SM4A 3CRQA 4IJUA 2Z4TA 3EDYA 3R5KA 2V6MA 4KBYA 1OZAA 1KAHA 1ZIXA 3H0EA 3CLTD 3GJXC 3K8QA 4PAGA 5LYJA 3W1EA 3ESRA 1EM8A 3WWPA 2D5LA 1NF9A 1Y6JA 3IHWA 1RLTA 1UDRA 5L4SA 4QYWA 2BMWA 3KSUA 4IJ6A 3BD7A 2P1ZA 1EVLA 2NT3A 5CT6A 4TPKA 2R84A 3WFIA 4FR2A 3Q9NA 4BQSA 5I7OA 2PYZA 1EFRD 1YDEA 3U7IA 1JRLA 1ZMOA 5F7OA 5AW2A 2ZCVA 1P0MA 2NSYA 1ELOA 1O9BA 2EG5A 2ZR0A 3KD2A 5FYDA 2XRYA 3ORSA 4DCPA 1L4BA 1SKYB 4E31A 2IEBA 3DLHA 4YMUA 4JLPA 1XA4A 3D7RA 3JVVA 4RVDA 3BCSA 3NC4A 2GAJA 1D2HA 4RNCA 2RB4A 4ASUA 2GBGA 2PD4A 3IVRA 3CF4G 3DBLA 4AP6A 1NIPA 4NMWA 4PTLA 2E21A 4QYMA 1E2QA 1RZUA 3VR5H 5FEUA 1U7DA 4EPTA 1S01A 4EENA 1ZVKA 2EHJA 3CW9A 1W9MA 4BPBA 2VQDA 3QMVA 4HN4B 4UZEA 4Y67A 4FNGA 3LPMA 4YRFA 3T5PA 1EDOA 3LP6A 4AX4A 4WERA 1ZKMA 2Y8EA 3DDNA 2G0TA 2YIMA 1JIKA 1M6YA 3MBIA 4GXRA 4AB1A 3C8MA 3SJUA 1G2QA 3U3RA 1CR4A 4ZEMA 3UKDA 1RQXA 2VXCA 3B1VA 2VYNA 3FZGA 1ZIYA 4MTLA 3ZWMA 1AGPA 4ES6A 1TTTA 3QPUA 4FSDA 4HX9A 3KZCA 5E7JA 2A1IA 2RGRA 1XL0A 1XZGA 3I4FA 4JP3A 5I7WA 1RBYA 3KZNA 2HDOA 2B3TA 2Y6UA 4ZYVA 4INZA 1VRWA 3FFXA 3G8DA 3D2AA 4U2FA 2ISCA 4L02A 5H4HA 3BGDA 3UXYA 3JASB 4N9QA 2WFMA 3P20A 1R12A 1HE3A 2B30A 4R8RA 2XWQA 1VKRA 1ECLA 2MCFA 1W6UA 2VOJA 3OFJA 2P9GA 4O5AA 1JA1A 3GMSA 1YJAA 4EX7A 1XLTC 2PPVA 2W2OA 2NZYA 3MGCA 5HSGA 4DXDA 4LZZA 1O95A 1GO2A 3LBNA 2KX7A 2R11A 4DUYB 3TCNA 3SC4A 2CV0A 5EEHA 4IIEA 2YMLA 5A9SB 5K0TA 2CLOB 3COZA 4UPDA 3RIMA 1XD8A 3HCCA 1OTHA 5KNDD 1JLRA 4ILKA 1H2YA 1HZJA 2QAGB 1Q74A 2WWTA 5FA5A 4LSZA 3VKFA 2Q2NA 2ZT6A 3WMRA 4A0SA 4BFVA 4LRQA 4LNUB 5KOHA 2H1OA 3CF6R 1OWMA 3PBKA 3PJRA 1P0QA 3LBAA 4GXTA 3U49A 3SQWA 1K88A 5IAJA 5LZ4A 3R3YA 2A35A 5F23A 4I1UA 1RAFA 4O25A 1WXHA 4RD2A 1MOSA 1UBGA 4FCVA 1MQ9A 4I1VA 4QXMA 4AJJA 4RTNA 1EVEA 3IP3A 1WXIA 1EFCA 1DC4A 2DOKA 3KXDA 3O4VA 4O5OA 3TQRA 4LBVA 1MUUA 1QX4A 2HPZA 4KKXB 3GUYA 4FCCA 1P5HA 2PWZA 4I8XA 1EM6A 1KAQA 2G0NA 2O7SA 1MABB 4HL6A 2EHDA 4G65A 3TZCA 3FDIA 4N5LA 3EVGA 2QN7A 1P2SA 3SEAA 3MLEA 3NTXA 5KO2A 4X7BA 2MTBA 3UK0A 4CKWA 1NKTA 4AQYB 3DV9A 2PMFA 3IIMA 1XMSA 1PS9A 4DR2B 1P9WA 3WWZA 1TA0A 1LLDA 2E5WA 4MYHA 3D6JA 1MMFB 3H2HA 2EYQA 2AFVA 5KSZA 3TLJA 3PUHA 2AFHB 3SBXA 5L4NA 1P5RA 2DE0X 3NIBA 5BOVA 4BNDA 2A0WA 4GBMA 5FP0A 4NS1A 4I2NA 1AKUA 4FD2A 3H0CA 4MWBA 6NULA 2ZANA 4WZBB 1YAHA 1BHSA 1FIUA 2XTZA 2YWEA 4LYGA 3ITEA 2DFPA 4J1NA 4Z3OA 5JJLA 1RYDA 3IESA 4HSGA 1F6BA 3TS1A 4L3OA 1A2QA 3C7CB 3HFSA 3BQMB 4IX9A 4OQLA 1YR8A 1RQRA 3OKCA 4YJFB 4D3ZA 3FF4A 1WB9A 1Z0KA 4Z8YA 4DDHA 3C3XA 4WBXC 1T8WA 3U80A 5TIIA 1NN5A 3OIWA 1XDZA 2WJJA 4KL8S 3UH0A 4PC7A 4U9HS 4DLNA 2QVBA 1WBJB 1KMCA 1NW5A 2V97A 3V8MA 3SI7A 2CYCA 1PW5A 3AB8A 3Q88A 2WA1A 1NQXA 3CY6A 4WN9A 4NQRA 2FFHA 2GN8A 1L3BA 1ZIPA 1ENZA 2CB0A 2IW3A 3F5DA 4F3NA 4JT9A 4OQZA 3FNIA 4UW9A 1QRAA 5D3QA 5ED4A 1A4RA 3RTAA 2YZMA 1JHQA 1Q57A 4DV5B 2EP5A 3CYFA 1OYOA 4ZOLB 2WR8A 3AFIA 4RFLA 4J8PA 3Q3JB 1CQIA 1N9GB 3E58A 1BE8A 3KYCB 2NUTB 3EZXA 4EECA 4CN9A 1UBJS 3R5TA 1KYYA 4O2LA 1KZ9A 1EX9A 3MXTA 3PD1A 3SXUB 2X0KA 2PA3A 2P3SA 2WTMA 2E5LB 4Y1FA 3KETA 1J8MF 4G2TA 3RJ9A 1S96A 3OSZA 1E3QA 2FR8C 2V59A 3JZMA 4RPJA 5EPUA 3QLJA 4U4AA 3P9IA 4R5MA 5FYQA 3V8PA 4Q9NA 4Y98A 2OO3A 1VGVA 3T3MB 5HOEA 4OATA 4G0QA 3FYCA 1T8SA 3E9DA 4ROTA 4FB4A 3HHEA 5IT4A 4G25A 1U8ZA 3ZBTA 1YE5A 2H7XA 5BSKA 3OD1A 2HO4A 4NDNE 2FW7A 2RONA 1AS0A 1HO3A 1W4AA 3DHNA 4NEGA 4O2AB 5FUVA 1R66A 4UDOA 3S55A 1MDFA 4G8DA 4YV7A 1F38A 1ZA1A 2A78A 2GB4A 3I8OA 1C7IA 1JKJA 4P81A 4YAUA 1CJKC 1V8FA 2X3UA 3MHPA 3OVMA 3ZU2A 4BJHB 4F2WA 3HDTA 1S2GA 2TYSB 4ENUA 3R7AA 3MT7A 1XP5A 2WD7A 5L9AA 3H1GA 1EGQA 1LLFA 3I30X 2CLIB 3KAKA 4QHTA 1MZPA 3O4GA 3EFOB 1JG7A 2Z9BA 3F3MA 1ACLA 1EBFA 4PZEA 1NRJB 3ZQUA 4V24A 4EIWA 1KEEB 3PE6A 3IEUA 4RQBA 4FCWA 2Z5FA 3FCYA 1E1DA 1VG0B 1S8NA 1X38A 4N01A 1EWYA 4UMEA 4I6JA 4Y2TA 2PZBA 1GZ3A 3U4QA 3FCUB 1L5SA 2QK4A 4GLBA 3NRCA 1TGVA 1XQYA 2QROA 4BDSA 3T5CA 3I2GA 5ALDA 3TFWA 4J3FA 4J1QA 3CLTC 1HRDA 3I1IA 1VHDA 2ZS8A 1YRBA 2BFEB 3AEQA 4Z7JA 1U6IA 3RF7A 3PWSA 2JFQA 4LY3A 4TL7A 3ZCTA 3KQWA 1BDIA 5EAIA 4BUJA 3QLUC 1VZ2A 4LZPA 2J9FA 3TI9A 1O6FA 2JC3A 2FKAA 2QYOA 4YMWA 4FOTA 2RC5A 4GOMD 4Q3KA 3T1HB 4HWGA 3KWMA 1XEWY 2AR7A 4RD6A 4ZXFA 2WW8A 3PXBA 3AOEA 4GNKA 4V0KA 3VKHA 1YZNA 4HLCA 4WZAA 1XJ0A 2C2HA 3SKXA 3VPCA 3HGMA 4KQWA 1DBPA 3RRMA 3HLYA 4NEHB 1RJFA 1S9DA 3T3IA 3DFIA 1I2MA 1KA9H 3I9FA 1T6YA 3AZPA 2NYRA 2J6IA 4EKIA 3EDMA 3GPLA 4JXJA 1FMJA 1GZVA 3E81A 3IEXA 3N2KA 1QAOA 2YIVX 1Z2DA 1RJGA 4OGLA 3K0AA 3U09A 1XWFA 5JO0A 3DBRA 1E5DA 4I5DA 3QF4A 2YZGA 1C3VA 1LX6A 2FPSA 2YICA 5B64A 2C9YA 2QKYA 1IN4A 4MB6A 4C7BA 4ERXA 2IYEA 3KOUA 1TE2A 4QDTA 4U5XA 1Z2EA 3LA6A 2O0MA 3UFXB 5B7NA 1N32B 4X84A 4N40A 3EVBA 5IYZA 4HQFA 3OLZA 3S2GA 4F11A 4EY6A 4XKJA 3AOEC 3VPFA 5LQRA 1G60A 1GCIA 2DHEA 3ZCRA 3J80A 4HH1A 1F8UA 2J3QA 3T9FA 1FP1D 5B4UA 2I80A 1K06A 1SCJA 1J7KA 4RY9A 3UJ7A 4I8DA 3O8QA 2GZRA 1RXEA 2FEKA 3WBFA 4JI1B 4M49A 2WSSA 3I9MA 5CFMA 1L5QA 1YHNA 1RC1A 2XSZA 4JSYA 3BGIA 4OA5A 2NPFA 4RJIA 4KNWA 2EL9A 1W96A 4WKPA 3K5PA 4DABA 3M82A 4B17A 3VO1A 2D2IA 3Q0IA 2HK6A 1E3TA 1JHMA 3DT6A 4XGQA 3WSWA 4CDGA 4EFNA 5C18A 1JQDA 2BFCB 2FWBA 4E70A 5I7HA 1B1CA 3JYNA 3L41A 4TT3D 1B42A 4PAOA 3PL5A 3ADBA 3GO4A