4CRWB

Complex of human ddx6 (reca-c) and cnot1 (mif4g)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
158
structure length
158
Chain Sequence
KGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 1
publication title A Ddx6-Cnot1 Complex and W-Binding Pockets in Cnot9 Reveal Direct Links between Mirna Target Recognition and Silencing
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 56
structure length 158
sequence length 158
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2014-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4crwB00
1VECA 4AKIA 1IN6A 1X8JA 4WXRA 4PO1A 3QUSA 5CB8A 4W9MC 1G3QA 4IEIA 4JT2A 3VHXA 1CF4A 2J7PA 3X1XA 1OH7A 1NVVR 2J7KA 4US1R 2E1RA 4ZIRB 4V0NA 5DHFA 4FXPA 3H86A 5TDHA 1WXQA 1L4YA 3VR1A 2XZLA 1MABA 4DIEA 1M1YE 2PLFA 2I1VB 2JASA 1JQLB 1W47A 2BMJA 2ATVA 4EJSA 3V9PA 2W58A 2RB4A 4UKDA 2XB4A 1SKQA 4PZYA 1F6BA 3HWSA 1H65A 4B3XA 1XD9A 1KI6A 1RVDA 2YOHA 3NH9A 4XOIA 2EVWX 3TAUA 2QP4A 4EPXA 3IPYA 2ZAMA 5FPHA 1YR9A 5EXPA 4RY2A 3QKSA 3PEVA 3G5UA 4M9QA 1ZP6A 3RS0A 4KI0A 2ZJAA 2C77A 4QJ5A 5JHGB 4HDCA 1JXOA 5JCZA 1DEKA 1RYFA 5FPTA 1MO6A 4FD2A 2ZRCA 4B3CA 4HATA 3ICQB 1Z6XA 2CNWD 4QNMA 4NBSA 3NHBA 1KKLA 3X1WA 5FH9A 1LF0A 2VP2A 3GP8A 4AG5A 3LAWA 3B5JA 1G6OA 4FI3C 3K0AB 2NPIA 3KKOA 4DLZA 1S3GA 2HT6A 4KLNA 3HDTA 2BDTA 1A7JA 4PC7A 1OW3B 3TVDA 1P61B 5F2EA 1KK2A 3MFYA 5FBLB 2Z43A 4CZ2A 1G4UR 4DT1A 1VG9B 1KK0A 2ZRJA 2QPTA 1OKKA 1NSTA 1KAGA 4QBHA 1T0JB 3P4YA 2OCPA 4D0LB 2AK3A 1JB1A 2JJ1D 3MSXA 4LWZA 2O8BA 4QL3A 4ARZB 1J8YF 1KY3A 1W5TA 2A9KA 2VF8A 2IS4A 4M1SA 4U00A 4EPTA 1JR3D 4B76A 3KQKA 5GJWC 1VCNA 5KPDA 3QY0A 1XEWX 4RZ2A 1ZCBA 3W6OA 3KTAB 3JZAA 2O8FA 4RD4A 1BH2A 2ZRBA 4WZ6A 1UBFA 2HEIA 4DSTA 1OHHD 2JATA 1E69A 1II8A 1FX0B 2R65A 2RGDA 1KOFA 2ZUCA 3KQLA 2ZRAA 4KSBA 1ZUHA 1NBMD 1YRBA 1ZM2A 2DHRA 4BFTA 2OV2A 1G19A 1OIVA 5CIWA 3U61B 2WIAA 1DOAA 1Q0UA 3KDSE 4XJXA 1BOFA 2ZJ8A 3QENA 4TYNA 1KI1A 2PCLA 1LV7A 1E2MA 2OBMA 5C1BA 1OXUA 1CJTC 3B60A 3NH6A 1GNRA 1GZSA 5TV2A 1F3OA 1ZM4A 4P4TA 4PAMA 3RC3A 4BZPA 4CYMA 421PA 1YZTA 1P75A 1O3YA 4XVRA 1XD8A 2BWJA 3KKPA 1R4AA 3R20A 3EPKA 1GNPA 4TLDA 4RKFA 5B2ZA 4HEJA 2OCAA 2WKRA 1GL6A 2I1QA 3LX8A 3LXXA 4HYYA 1Z08A 1Q1BA 4JLNA 4CEHB 2WWXA 2ZI5A 3QF4B 3ZYCA 1R6BX 4BQSA 5TXGA 3KJGA 2GILA 2YYZA 4MGIR 2EQBA 1NG9A 2V1UA 2IHYA 3L43A 2OE2A 4BZQA 4TQ9A 1RZ3A 2HT1A 2HYDA 2AN9A 1E0JA 2OESA 1Q20A 3LFUA 4LHYA 3FKQA 4UNSA 1SXJB 4HAVA 4I81A 4Q9KA 4IRUB 4XD7A 4URYR 2DFLA 4NYJQ 4KYUA 4OKSA 3CF6R 5DLQC 4TQAA 4F4CA 1XEXA 3AQ4A 5J4VA 2ZRIA 4FMDF 2X8AA 1P73A 5EE5B 2JLQA 3TMKA 1KMHA 5DE3A 3R7WB 3D6TB 3OE7D 5KO2A 4DDTA 3AP1A 4XWKA 3AF3A 2IF0A 2PMKA 4A0HA 2J0SA 4P4UA 2A5GA 2BCJQ 5H1YA 4TTQA 2CEAA 1XMVA 3LBNA 4RCYA 4KBGA 1N2CE 1MH1A 4BFYA 1E0SA 4FMCB 4U02A 2ZJOA 1X8LA 4C0QC 3RS7A 4LYJA 4M21A 1G8PA 1KDOA 4O2LA 4UNQA 3VX3A 2WICA 5EJEA 1ZJ6A 3RC8A 4NYMQ 5JI2E 4HZIA 1GILA 1U8YA 3SHWA 4P4SB 2VHJA 3X2SA 3EPHA 1E98A 1Y63A 4GSYA 4URXR 3H1TA 3OFND 1OB2A 1E1RD 3WNDA 2KWIA 2HDNB 3WNBA 1WCV1 3WYFA 3I8XA 1ZVQA 4CDGA 2GESA 2IXFA 2C95A 4W5HA 5C4MA 2W00A 2YVUA 4LBZA 3U3KA 3GLGA 3CX6A 1SXJE 5EUQB 4Z1MA 2O8CB 4KXFB 1VMAA 3OZXA 1GKYA 4Q4LA 4FW9A 5JECA 1P2SA 4NP6A 4BRUA 1KNXA 4JLJA 3I61A 4AK9A 4HAYA 3QNUA 2J5XA 3EZ6A 3NC1C 4LPSA 3GJ8A 1V43A 4G3XA 5FI1B 4A8JA 1Q22A 1ZUNB 5JEDA 3WYAA 4OQMA 4M53A 1XXHB 2YWGA 1Q21A 1W0KA 4EPRA 1FOEB 1CTQA 2MMCA 1OE0A 3LXRA 5IF9A 3GPLA 1G8FA 5FPYA 5FBWB 3OEHA 4NL4H 4B35A 5JJKA 5JHHB 1GRQA 3AH8A 3OIYA 4B33A 1YRAA 1N6NA 4R7ZA 5FPSA 3OEEA 4G0NA 2QZ4A 3CO5A 3EWSA 4TSFD 2ZETA 4I1SA 4DBLC 4DKXA 4PHTA 1N6IA 3UKDA 3SJAA 4MA4A 4MGZR 4Q4JB 2B92A 5H68A 5KUTA 1VYVA 3RHFA 3BERA 1KK3A 2Q6TA 3SN6A 5GJBA 3K70B 3MWYW 2OSBA 1XZQA 2CCGA 3GJ0A 1DADA 2VP4A 5JI3E 5KHOC 2ZYVX 3MJHA 1XRJA 3D8BA 5TB5A 1MRNA 3DZDA 221PA 4Q7KA 5FR1A 1IOZA 3FTQA 1HV8A 2PJRA 5DSZA 1E9DA 2CLSA 4C4PA 4LC0A 3DM9B 2GJKA 2QNRA 3NVAA 5BN4A 1UAAA 4KYIB 2GKSA 5CYOA 3NWJA 2P67A 4QGAA 4Q21A 2MSDB 1DG1G 5D3MB 4B3DA 1NLYA 1YZKA 2PCJA 5JJLA 5LDDC 4DSOA 1GTVA 2CCJA 5FUWA 1CJMA 1XMSA 2E9SA 2JA1A 3MAAC 3RANA 2VIIA 2GDJA 4M9SA 3TNFA 4E07A 1CKEA 4B3BA 2V6IA 1R2QA 3DL0A 1KZ7B 2CK3D 3C5HA 3LBHA 2ODBA 5FBQB 1HQYE 2HXSA 2ZUBA 4M1KA 4N3NA 5F3WB 2ZS9A 2P0EA 4OYHA 4Q4AA 2ZI6A 1US8B 3IIJA 2Q21A 4HSEA 3WP0A 4ERNA 2DB3A 4F93B 2GWHA 2VBCA 4RVCA 1U90A 1X1RA 2WJJA 4LRWA 3QVVA 5KYKA 5E3HA 3WP1B 1OJLA 4X8LA 1XEWY 4PHHA 1ZRHA 1SHKA 3TSOA 3SYKA 2FWRA 2ERYA 1SXJC 4DWJA 4Z54A 5JS7A 1T3HA 1FL9A 1HE1C 3LBIA 5SZIA 3LD9A 1XBTA 3Q5EA 1NNEA 2P5SA 5SZJA 4QKQA 4JLBA 5HZHA 3OIVA 1KO1A 3T61A 3U7GA 1JJVA 4YQFA 4P3YA 4LYHA 3T06B 2ZSFA 4BFSA 3GJ5A 2Z0MA 3QEOA 2WSSD 2G3YA 3Q9LA 4KCGA 4EQ6B 1KK1A 1UKEA 2V55B 2ZRMA 3OAAD 1ESNA 3RRYA 1IJFA 3AVQA 1N25A 2OXCA 4Q1AA 4LY6A 3BFKA 1KO5A 3A1WA 2ZRLA 5AJYA 2A5DA 1OH8A 4TT3A 4MRSA 1IONA 1GOTA 1G9XA 3LW7A 1G7RA 4CT4B 3T1VA 2J3EA 4Z8XA 2FZ4A 1Q1EA 1MABB 3P1JA 3Q7PA 4RD2A 3I72A 2QROA 2VQSA 2ZJ2A 3GLFB 4BECA 2GZAA 3W90A 4EJSB 4ESHA 4IFBA 3ADKA 3ZD6A 1XB2A 3PITA 1HUQA 2WJGA 3WMGA 4KITB 1G8GA 2BJVA 2OG2A 4PXAA 4OI4A 1CU1A 4ARZA 1KI6B 3TQCA 4A0RA 4QM7A 4B32A 1QF9A 1R7RA 2QMHA 4LJ8A 2CMKA 3KTAA 5AUOB 2O8EB 3QKSB 3EW9A 3CPJB 1KSGA 5JCPA 1ZU4A 3ZDQA 5C18A 3KKMA 5DN6D 4QHYA 4JL6A 4L16A 4JLOA 2BEKA 1EWRA 1YKSA 2WWYA 1DELA 1N5LA 1YZGA 4LDJA 4PAQA 5FUVA 4F4JA 2YWHA 4E03A 1ZNZA 3LV8A 4M9XA 1KI8A 4CEIA 1N6OA 4PSKA 2H17A 1M7HA 5J47A 5JRZA 3BD9A 4IOJA 4OBEA 4ZCIA 1X1SA 4LJ5A 1II9A 1E79A 1RE0A 1UFQA 2TMKA 4LC1A 3RS3A 2W2XA 4DT1B 3T15A 2EFDB 4UQOA 2ZRFA 4QHTA 4UXJA 3T12A 1A4RA 4TL8A 3GLFE 1OFIA 1XCMA 2V1XA 3QF4A 4FMDB 2W6ID 4D81A 4PSVA 4YONB 2FX3A 1G5RA 4R71A 4ZKEA 5FTMA 5SZKB 2O8BB 2FSIA 3KFXA 5CK5A 3QXHA 1HY3A 1R5OA 4WOPA 1XTQA 5E7JA 3GJ4A 1ZINA 2FDCA 4ZDKA 2ASEA 4PZZA 5DI9A 3NHAA 2BVNA 1A5TA 2WPDA 2ZUDA 3HYRA 3L0PA 4PQFA 4RFSA 2ZE7A 3V00A 3ASYA 1OH6A 1E2JA 5EQTA 2O8FB 4HAUA 2BKEA 4WAUA 3FPAA 2ZYUX 5KNDA 2RGEA 1II8B 3N2EA 4RKEA 4JIMA 1QG2A 3CNLA 2IK8A 3CRW1 3MJRA 3KXLA 2XXAB 1E2QA 5EE9A 2CL6X 3U44A 3NXSA 3FOZA 1P9NA 2Z4SA 3EXAA 4AKHA 2QTHA 3MCAA 1G16A 4TMZA 4CVNA 1PZNA 2ZU6A 4WBSA 2O52A 1G1MA 2QTVB 2IYUA 1M8PA 5E4FA 4NHOA 3WNCA 1D5CA 2RGBA 4TN1A 1HTWA 1C1YA 2HXYA 3GLHB 1IBRA 2CCKA 3AVWA 3THYA 3SBDA 1R8SA 1RPZA 1E2PA 2YWEA 4HB0A 4URZR 2H16A 5HPYB 1VG1A 2NGRA 2I4IA 3RS5A 4NCJA 4EFLA 2KSQA 2WM9B 3THOA 5GADl 4QBIA 1KKMA 1NVXQ 3Q8XB 2BBTA 2GK7A 2OCYC 1CR2A 3DO6A 2ZE5A 3A4MA 4HLDA 2BMFA 1XZPA 2J1LA 1XCGB 2R8RA 3TW4A 4A6PA 2VSFA 5A5GA 1N6LA 1TNDA 4LK2A 3VAAA 3AUXA 4LUCA 4II7A 4W5WA 2IYVA 2AHOA 2BC9A 3L0OA 3O8RA 3BIFA 4Q02A 1N0WA 2JDID 2WJIA 1E9FA 1U8ZA 1XEXB 3CRRA 3JZMA 4ON9A 3UXMA 3C16C 4NCIA 3LVQE 3OIUA 1KMHB 4BFVA 3V4RA 4GBMA 3B2EA 1QDEA 4A1FA 4L15A 2QPOA 2WKQA 2GXQA 3ONWA 4JVMA 3B1VA 2D2FA 1AM4D 3CB4A 1A2KC 1TQDA 2V54A 3PEWA 1COWD 2WWIA 4A2PA 2FSGA 2NOAA 3FFAA 3AGQA 4FWIB 1AN0A 2WOOA 2PLRA 4D4LA 4IXNA 2RGAA 3CF0A 4NCHA 1ZD9A 3GLHE 3ZGXA 1U0HC 4EJSC 1HQCA 1N3BA 1I4LD 4HUQA 3TUIC 3KX2A 3VU9A 3O8DA 1VG0B 1AQUA 2AKAB 2CLDX 4NCNA 4RZXA 1NN3A 4GZLA 3DKVA 2XZPA 4NZYA 3X1DA 2JLZA 4M1YA 4ZKDA 2DFNA 3GCGA 3U6BA 2ZI3A 1GKUB 1R0XA 1ZIOA 4LJ6A 5JS8A 1W7AA 1ZM7A 4LBWA 4K8OA 1EGAA 2V9PA 3ZZ0A 3GLGB 1YR7A 2RGCA 5FOTA 1E94E 3EZ2A 1T4GA 1TEXA 2IUSA 1OFUX 1Z63A 4PX9A 4LOAA 3KXIA 1Z0JA 3A4LA 2EWVA 4A8JB 3ICEA 1X3SA 1EESA 5TMPA 1U8AA 1T9HA 1Z28A 2FU5C 1C9KA 2PEZA 4TLEA 5K8LA 1I2DA 3U7EB 4ZV4A 3FMPB 1D2MA 2O5VA 3NDPA 4A0GA 2R6GA 2BHRA 3R9WA 2ERXA 1PUJA 4OK5A 5JLJA 1AQYA 1BMFD 5C46F 3DMDA 4NYIQ 2CBZA 4RSGA 3K09C 4G5GA 1AKEA 4BLTA 2RH5A 3H0KA 3NEYA 4C0KA 2N1BA 4I1UA 1JXMA 1G5PA 5JWOA 1H8EA 4KJZA 3T1TA 1MKYA 3DMNA 3EA0A 1XMIA 4ZI3A 2JLYA 3THXA 3AVOA 2AKYA 4OK6A 1JQJC 1HT1E 4TMKA 5AJWA 4LYFA 4C3ZA 5EUMA 4Q03A 2IYSA 1BKDR 2REBA 3TUJC 3CWQA 1EFHA 2VO1A 2GNOA 2QM8A 4DC9A 2GCOA 1GM5A 2LCFA 4DUGD 1XTJA 3VFDA 1W44A 2WOJA 1IY1A 1UEIA 4MYTA 2EW1A 1G3MA 1J99A 2J9RA 2JEOA 2ZVQX 2PX0A 3GLGE 1FMJA 4EPYA 4TLCA 3A1TA 5HTKA 3TE6A 3NBXX 3B1ZA 1M2OB 4LHWA 1KI2A 1BYIA 5A0FA 2QSYA 1UDWA 1Q1ZA 3PEYA 1QHYA 4LV5B 3ZVMA 4RJLA 4RD0A 2WKPA 3ASZA 3WRXC 2C2HA 3BK7A 1J2JA 4A2QA 4ABYA 5DGXA 1HURA 2WIBA 3K0CC 1KDPA 4AI6A 2GVZC 2CDNA 3DVLA 1MOZA 4NONA 4AYTA 3PUYA 5IK2A 3A37A 2ZYWX 3SE0A 4OQFA 3Q5DA 2VRWA 2O0KA 1QHHA 4Q4AB 5HKKA 1VYUA 1VHLA 3IEUA 5AJZA 3UMSA 2JLSA 1OXTA 5JBQA 4QNRA 3HPRA 3QG5A 3GLFA 4D82A 1SGWA 2OHFA 2PH1A 4ZDWA 4L8GA 4ZCMA 1GUAA 3AVPA 3PG5A 4L9WA 4IDPA 3B1XA 4D80A 1CRQA 4BUJA 4X8MA 3HU3A 3KZ1E 4Z8YA 5F98A 2CHVA 2EYUA 3RRNA 3B82A 2JJ2A 2WV9A 1UF9A 2GEVA 3K8YA 3QKUA 3KKNA 2E87A 3OEHD 2O8EA 4Q1DA 3JVVA 1IN4A 4C30A 3L0IB 3AEZA 2IBMA 5EZ6B 3UATA 3D3QA 2NZ8A 4DLXA 1U9IA 2WJHA 3W5IA 4PSAA 2WJVA 3UANA 4UNNA 1NY6A 2XTNA 3K9HA 3RSLA 2GXSA 4UXIA 3WY9A 1MT0A 2OAQ1 2YKGA 2K5UA 3E70C 4UNRA 4EAQA 5FBVB 5FPKA 2X2EA 1M7BA 5FL7D 2F9LA 2YNMA 4YC7A 1P7CA 2Q9CA 3NBFA 4OI2A 5FTKA 2FH5B 1KO4A 1QVRA 1KI9A 3C7KA 5J5CA 3B1YA 1W36C 3W5JA 5DISB 3KUCA 3P27A 1Q3TA 2QE7D 4Q1CA 1JR3E 3MWJA 2G77B 4HB3A 2VSOA 3VR3A 3B78A 5AJVB 2ORIA 3ZIAD 3ZH9B 4LGMA 4B6EA 1U94A 1P72A 3TRFA 1T0HB 2QQEA 3ZVRA 4POAA 2G1JA 3B1WA 3AKYA 5AUQA 2R44A 1NIPA 1WF3A 2P6RA 3BBPA 4R2HA 4D4KA 1JR6A 1NVVQ 2V3CC 2F1HA 2H57A 2Z4RA 2NIPA 2FFQA 3CRVA 1E1QA 3EIEA 3HR8A 1UKYA 3M4YA 3WMEA 3Q3JB 1YZUA 3KUDA 1AJEA 4WA7A 1XP8A 4EUNA 3VR2A 1DAHA 4CRWB 1E2LA 4WZAE 2XXAA 4RZ3A 2ODNA 4W7SA 4BLQA 2LKCA 3W8NA 3T1OA 4Q7LA 3DPUA 1Y3AA 2F1RA 3ZS9A 4JMPA 1KDTA 5HCIA 1E9AA 2LWIA 2D74A 4QRHA 3VKWA 5IT5A 4CEJB 4CEIB 2EFHB 4TQUS 2DWPA 4ITRC 4AYWA 1GDDA 2FGKA 2WWHA 4GOXA 1K6MA 3AKCA 3GLHA 4TTPA 4A36A 5H70A 5FTJA 1HT2E 1J90A 5LB4A 3SYNA 3VR4A 4EFMA 3IQWA 4I1VA 1XJ0A 2HLDA 4LJ4A 4LJYA 4C2TA 1PV4A 3FKSD 2P6UA 1SQ5A 4BFUA 4V03A 2VHCA 1OB5A 1L4UA 4I4LA 1O87A 5CJPA 1ESMA 1GAJA 2WZQA 4JLMA 1QRAA 4OHZA 4KO8A 4CGZA 1GVNB 1KY2A 4IOKA 2H1LA 4IOMA 1E2HA 1DBSA 4IJMA 4YMWA 3UWOA 1N5IA 4RFSB 1X86B 3AM1A 4DLYA 3BE4A 3RLFA 1E99A 2J45A 4BGDA 4BWYA 4K81B 1OH5A 2HCJB 5HE9A 3TSZA 2XTZA 3RDPA 2AXNA 1AS0A 2R6AA 2RCNA 4JLKA 1RRFA 1M74A 1ZNXA 2DWOA 4PC6A 3U44B 2GCPA 4NKRA 2H8KA 3A8TA 2GETA 2GBLA 2V7QA 1BIFA 3KXKA 4BASA 4NPHA 4DCSA 5IDVA 3EX7C 2FN4A 2IC5A 4E5UA 3BOSA 3G82C 1YJ5A 4IVQA 1NVWQ 1AK2A 4A92A 4I99A 5AK0A 3EZ9A 3ETLA 3VMFA 4YMVA 4QXAA 1NN0A 2GZHA 3P32A 4HZUA 3THYB 3SBEA 1E9RA 2F3TA 4YXWD 1QG4A 4ASUD 2CVHA 1Z2CA 4DB2A 1T6NA 121PA 3REFA 2D7CA 1T5LA 3HPQA 2KI5A 2OFXA 3D31A 2V8OA 3W34A 2XOKA 2IYZA 1NMZA 2J41A 4KVGA 2WTUA 1UKVY 2ZRKA 2VTKA 1OYWA 4Q5IA 2F55A 3T34A 2VHUA 4B43A 1ANKA 3EWAA 1E9BA 2DYKA 5EXTA 4DLSA 1E2GA 3LW8A 4MDEA 4LBYA 4LX0A 4J0QA 1LNZA 3N2IA 1Q12A 4KODA 4UJ3A 1NIJA 1XF9A 3W6PA 3BB3A 1IJEA 3RABA 4JKYA 3ZJYA 5TVKA 4MDFA 5AJXA 3BFXA 4PANA 4QC2A 2A30A 1D2EA 5G53C 2ZTSA 1FUKA 1U81A 1E79D 1N5KA 3CWZA 4DDWA 2AWOA 4S35A 3PCRB 5BYJA 3WHLA 1NG1A 2C98A 1L7VC 2W2VA 2QN6A 2GK6A 4BLRA 3NIBA 3KJIA 6Q21A 1RRGA 2IUTA 4O2RA 1P2VA 2AX4A 4AKEA 4AC9A 1NJFA 5CDFA 2EFEB 3QPUA 1JALA 2WWGA 4HUQB 1E96A 3VU9B 5H8WA 1E9EA 1ZIPA 4V02A 1IY2A 2ZU0C 2ZROA 5SZHB 2KJQA 1SXJD 4V0KA 3H2YA 1EK0A 2AXPA 3B8HA 1R10A 3Q7QA 3ZZUA 2JLVA 1U2RA 3UMFA 3AVUA 1LS6A 4DSUA 3GEEA 4DCUA 2ZREA 1LFDB 1W4RA 2QAJA 3CH4B 4GRAA 3U6KA 2EU8A 5L3RA 4QBGB 2GRJA 3Q85A 2W6JD 2CNWA 3EIQA 4WVFA 1CJKC 3CZQA 1PLKA 2XAUA 4P32A 3V4FA 1W5SA 1E4VA 1E2FA 4X8HA 2PL3A 2EFGA 1N0VC 1W0JD 2WWFA 4ILEA 1UEJA 2Q3MA 1A2BA 5JMTA 4ZDJA 3AF4A 1J70A 3L0SA 2R6FA 1G7CA 1NKSA 4RFVA 2YC2C 2ZRNA 4JBYA 4WIAA 4MGKR 2ANBA 1GRNA 3U4QB 4Q18A 3SS8A 2NO7A 1KO7A 1S2MA 1SKYB 2JJ1A 3THXB 2ZI4A 1FNNA 2REXB 3SQWA 4PC2A 3BB4A 1II0A 3D7MA 5AUPB 3DHWC 1TF2A 1JR3A 2FFHA 2RKOA 2Y8EA 1IXSB 3ZD7A 4KFUA 4LV8B 2ZS8A 1H8HD 1LVGA 2XSZD 1D9XA 2GCOB 2R6CA 3CKLA 4KFRA 1TUIA 3QPWA 4AG6A 4P31A 1OHHA 5ELXA 3CR8A 3KL4A 5J40A 2CLCX 2BBSA 2GJSA 4DLUA 3B85A 1NBMA 1W4BA 4AY2A 4IHQA 2UZIR 2X77A 2J0UA 5LD2B 4BZXA 2IF2A 1KSJA 1Z0AA 1YZLA 2EWWA 4D25A 1P5ZB 1Q44A 1NY5A 2QUZA 4FMBB 3CUEF 4LHZA 1S0UA 1IM2A 1ETUA 5JRJA 2QQ0A 3SHFA 4BFWA 1TQ2A 1XTSA 5FUYA 3AUYA 1J8MF 3IHLA 5CIQA 1NKTA 3CX7A 2PBRA 4LJAA 3WBKA 4O3MA 1Z3IX 4BRWA 4D26A 3M6AA 3PR1A 5GJCA 4LV6A 3KKQA 5LPNA 1Q57A 2CXXA 4Q1EA 1Z6AA 3IBYA 3I73A 1JJ7A 5DI3A 4NU0A 3EG5A 1Z0FA 3DDCA 4O25A 2IYWA 2VL7A 3CX8A 3SEAA 2WAYA 5B64A 2FFAA 1BO6A 2MSEB 4G5SA 4HB4A 1ZNWA 3HYTA 1XMJA 3K70D 1SKYE 1IN7A 1E3MA 1QHHB 1EFRD 3R8CA 3EIHA 5FOXA 3REGA 1T8UA 3AB3A 2DWQA 3CH5A 4OI1A 1IY0A 2YV5A 3GD7A 2FZLA 4DEYA 3HU2A 4XVUA 4IFEA 2QMUA 4Q4HA 1FPMA 4PPFA 4GOJA 3CRMA 3I4LA 4Q48A 3SJCA 2IX3A 5BWMA 2BBWA 4MUBA 2XITA 1E9CA 1E0AA 2BKUA 3OF5A 2D3WA 3JVUA 3OE7A 4X8OA 3SQXA 3IUYA 4TYYA 1OIXA 1XD2A 4TZ0A 2J0QA 3PV0A 1RFLA 1Z0IA 3BFVA 3U3MA 3F3YA 3W3ZB 2ZJBA 1PUIA 1XNJA 4KBFA 4Z51A 1JECA 1U0LA 1FW6A 4QJ3A 4ZPXA 4D0GA 1OT3A 1JAHA 2IYLD 2ORVA 1KMQA 1D2NA 1D6JA 3IIMA 4OI0A 2C99A 3TVTA 5CLQA 4PC3A 5KNCA 4E22A 4TYQA 4PPGA 2DBYA 2P6NA 2XNDD 1N6HA 1N6RA 1LW7A 4OHXA 4CEJA 2FSFA 3T35A 2FNAA 4TL6A 5L3QA 3VNUA 3IIKA 1MV5A 1SVOA 3K53A 3OFNA 1E1RA 3RRMA 4TTRA 1XEFA 3TJZA 2PT5A 2O0HA 2ZSDA 1YE8A 4LCBA 4DSNA 3K70C 3X1ZA 2ECKA 4JLAA 1YHNA 1XCPA 1ZM3A 1G7SA 4US2R 3B6EA 821PA 1D8TA 2JIZD 2DR3A 2IS6A 4FIDA 2OFWA 3I8SA 2B6HA 3RWMB 1WE2A 2WBLC 2A5FA 3MWLA 1WBBA 4GOKA 4C0LA 2QSZA 1ZD8A 2A2ZA 1LTQA 4B75A 1BYUA 1ZM9A 2BEJA 4PTLA 4BLPA 1TTTA 2ZXUA 1FQJA 5JZVA 1GSIA 4AWXA 1XPUA 2F6RA 3TH5A 1GFIA 4QGGA 3A6PC 2C96A 2V4ZA 4KU4A 2ZE6A 4B34A 3P26A 4V0ME 4DCVA 2VSXA 4Y0VA 3CPEA 1NJGA 5KOYA 4KLZA 2YOGA 3EARA 2A7QA 2AK2A 4DVGA 2J7PD 3NC0C 3LWNA 1N6KA 4I1OA 3RS4A 4B73A 2IEYA 4TMWA 3TK1A 1S8FA 1OFTA 2PJZA 2WMNB 2JAQA 3E5HA 3Q72A 1JPJA 4GFDA 4PHFA 3T5GA 4AIIA 1TEVA 1UKZA 1NLZA 1NN5A 2FSHA 1QHGA 4K46A 5G41A 4B44A 4PZLA 5L3SA 3R9XA 4XTRA 1FFHA 1IN5A 3UIEA 3QXJA 3MRSA 2QGNA 5FBRB 1OIWA 3GJ6A 2F7SA 1OFHA 4Q9IA 1YR6A 5JSZA 3ZQJA 5BYKA 2ONJA 2YZ2A 2WJYA 1ONBA 5FL3A 4AYXA 2IS2A 1CLUA 5LD2C 3WBJA 2ZITA 4TL7A 3ZLJA 1VCMA 3BH7A 2QBYA 2A5YB 3CZPA 2BM0A 3GJ7A 5HE8A 5KSPA 2BJWA 5BN5A 5FTLA 3QOFA 4M0LA 3UMRA 4MUAA 2VP6A 3QEJA 5EP4A 4OHYA 4JBXA 2AFHE 2CK3A 2JLXA 1CJVC 2IT1A 4CW7A 4R98A 1Z0DA 2N46A 1YZQA 1N0UA 1BS1A 2EYQA 1U99A 3A1UA 2CVFA 4F7WA 1R8QA 5KPJA 3SFZA 3IPXA 5CITA 3IHWA 3B13B 4Y0AA 1OKKD 4B3FX 3CW2A 5EP3A 3FHCB 2QMEA 3CRQA 5KNBA 4HZUB 3AGPA 1XU4A 4PHGA 4OL0A 1DARA 4YDSA 4Q1FA 1G18A 1GNQA 1E32A 4PQYA 4LHXA 2XJ4A 1G3RA 3LX5A 3O47A 3I1FA 2IA5A 1W4AA 3LQRA 3THWB 4URVR 1QHNA 2N42A 1AZTA 1SVLA 3K9GA 2WSSA 3QSYA 4KSCA 2ZR7A 3AVVA 1EFUA 1L2TA 3OAAA 5LBIA 4TYPA 1M6NA 2WMOB 4MKFA 5DYIA 3MMPA 4DLRA 2KE5A 1DE0A 5K8TA 5FOWA 5J4LA 1HYQA 3A58B 4G5QA 4JS0A 1X8KA 2QMOA 1NMYA 2CHGA 1OSNA 1QBKC 3LY5A 4AKGA 1V5WA 4GDFA 2MMGA 3ADDA 5DIFA 1R0ZA 2O8DA 4MH0R 3TW8B 2GEUA 1NLFA 3EA5A 1B0UA 1P9WA 3VR6A 1T3SA 1WRBA 2CHQA 2GJAA 3F0TA 2GHIA 5AR1A 3RS2A 4B6FA 2OCBA 3U4QA 4XWAA 3SDZA 1JI0A 3IILA 3EPJA 5KDLA 3M0EA 3IEVA 1P9RA 2PMDA 4TYWA 1P6XA 3HR7A 1SVMA 2XJ9A 2F3RA 4H1UA 2QGZA 2AWNA 4FINA 1P62B 1UDXA 2BIFA 4LZZA 1LS1A 1E4YA 4LSGA 3PEUA 3FHTA 3FWYA 3MD0A 2IS1A 1G8YA 4O0MA 4FCTA 4PO9A 4XD7D 2YINC 2Q3HA 4UJ5A 5DN6A 2QY9A 3QG1A 3U3JA 2PZFA 3ZQ6A 1F48A 1GIAA 2FGJA 3LH5A 3K9LA 4RCZA 2W2TA 3UK6A 3KFVA 1AA9A 5P21A 2ZRPA 4HB2A 1G21E 4C0SA 3N70A 2A78A 2P5TB 4WXPA 5B30A 4GMDA 1XDBA 2KBEA 2REOA 2X2FA 3CONA 4RZUA 1EG7A 4KHZA 4QOSA 2EFCB 2ZRHA 5KTYA 1GWNA 3CNNA 1XJQA 2IYTA 2Q9AA 1VTKA 2IWHA 1CR0A 2D2EA 3C14C 2QI9C 4ZO4A 1PJRA 3ZVLA 2HYIC 3BWDD 4UXHA 1DVRA 1Z07A 4IOLA 1W36D 4B71A 1RRCA 2W6IA 3WRYC 1IQPA 4M2LA 1RJ9A 5L3VA 4BFZA 1KYIA 1C4OA 1CR4A 1NMXA 5DNYB 4DRZA 4GT1A 5CDFE 2FPKA 2XOKD 1GP2A 2A3RA 5D3QA 4DDVA 2DPXA 1RKBA 1KSFX 1LB1B 1OXSC 2F43B 2JLUA 1G4AE 2JCSA 4EKDA 4R2IA 1WB9A 3SC3A 1FTNA 2L0XA 4HLQB 4Z1MD 1TADA 1W4CA 5EE0A 1QHIA 1SVWA 1MO5A 2ZSAA 2VYFA 4G5OA 4OHVA 5IRCD 3F8TA 4OQLA 1PLJA 2J0UB 4NH0A 2GXUA 4DCNA 2XB2A 2G83A 1R0WA 2IYRA 2QU8A 4LJ7A 2GTPA 1W0KD 2ODEA 2QP9X 1ELOA 4B2IA 4B47A 1OXVA 4W5JA 4BPBA 1HEIA 5HCNA 1TL7C 4JBWA 4V0MA 1DAEA 2NO9A 2GBLC 1YU9A 1PVOA 2FPLA 3L8YA 4M1WA 4XSGA 4EPVA 3A36A 2C04A 2I3BA 5FUXA 3PXGA 3SU8A 4A4DA 2HCBA 4JLVA 4N0EA 5K8IA 5K8UA 2D7DA 3OEED 1E2KA 1N6PA 4GP7A 521PA 3RWOA 2HF8A 5B58C 4JL8A 4Q19A 2CL0X 4HAZA 3EC2A 3FMFA 1Z0KA 2ZSEA 1ZBDA 5DI3B 5DYGA 1TU4A 1E9SA 1VCIA 4L5BA 2HV8A 2WWWA 5GJVC 3GEHA 1WDTA 2OT3B 4MRPA 3I5YA 4DCTA 5E7IA 5GVRA 4IDNA 2GEDA 4TLAA 3CIOA 2ONKA 3A1SA 4NCKA 4CIDA 3QXCA 2FJUA 3N5CA 2JLWA 1KZGB 2ZIAA 1G3IA 4JLPA 2B8WA 5KSYA 5KSZA 2ZR0A 2CJWB 2FV8A 4R9UC 2RAPA 4URUR 2VHTA 2JDIA 3FE2A 4Q4HB 2ZM5A 3CR7A 1WQ1R 1G8HA 4BFXA 3BXZA 3LLUA 3U5ZB 2XNSA 3NEJA 4PAOA 5M04A 3RRZA 4B3GA 1NBME 1XD2B 2ZYTX 2ZI7A 3CM0A 2ZI9A 3K09A 4TL9A 2FMXA 3W8RA 4DZZA 1KTVA 2VPPA 2ZRGA 4XWOA 2GCNA 2YOFA 2ZE8A 3DM5A 4C7OA 4A8JC 3KJHA 2XZOA 3AVTA 1EFTA 3LNCA 4Q00A 1COWA 2F1IA 1XJCA 2OEPA 2VP5A 1WBDA 2FEOA 4NYJR 4ACAA 1GRRA 2CL7X 5DH9A 1Z06A 1YQTA 5CLLA 2B7BA 2XEXA 4JLDA 4FWTA 1T3LA 3K0FB 2JLRA 2OLJA 3PJRA 4LPKA 1AS3A 2Q0HA 3RNLA 2QAGA 1E0KA 3LQQA 2AD5A 5L3QB 2QRNA 1KAOA 5GVSA 3X1YA 2IEZA 1NF3A 1ZC3A 4D6PA 2BM1A 4KFTA 2RGNA 3IO5A 4AD8A 5BW8A 2IYXA 1T91A 3BC1A 3U3RA 4AURA 1G20E 5FOVA 3TR5A 4QG7A 2KBFA 2W0SA 1R5NA 4HLUA 1TF5A 4IXMA 2YHSA 4NYMR 2P2LA 3EZFA 5FR2A 2H7VA 2P65A 2OUKA 1XTKA 3BORA 4IDOA 4JYBA 1FUUA 2IHBA 3GFTA 3AP3A 3OIWA 5ANRB 4E09A 4TMVA 2IUUA 1W48A 4HAXA 2Z6VA 1VIYA 3K0CA 4M4SA 3ADBA 1KI3A 2X19A 3T5DA 2ODWA 3TKLA 3KB2A 2VHQA 2C8VA 1BMFA 5JJIA 5FI0B 1W49A 3FMOB 3AV0B 5TY0A 4NMMA 3SOPA 3ND8A 4TT3D 4C9BA 5KU1A 4M22A 5J4KA 1TQ4A 4V0OA 3QE0A 4EFNA 4YMUA 1DO0A 1G6HA 3WHKA 4D4MA 2PZEA 1R5BA 3GFOA 4QJ4A 3CNOA 2QP3A 4H1VA 4DXAA 1QHXA 3GJXC 3QI2A 2NPFA 1F2TA 3CPHA 4L9SA 4DUGA 2PEYA 2QG6A 3A1VA 5L3SB 3M1IA 1QHSA 4M1MA 3GJ3A 3I3SR 1UBEA 3BB1A 2NMVA 3QQ5A 5JSZB 3GLIB 2B21A 3SJZA 3QBTA 3BRWD 4U7DA 1AZSC 2R9VA 2D62A 1A82A 2VP0A 3AF0A 4Q7MB 8OHMA 2YJTD 2OO7A 4NE2A 2ORWA 4GI7A 3THWA 2O0JA 1XX6A 4D4JA 2WSMA 1F5NA 1W2HA 4MYUA 3I92A 3SI7A 4M8NE 3U7HB 2QBYB 2HUPA 1KJYA 5B57C 1UADA 4RD3A 2IL1A 1W1WA 1KJWA 3FMIA 2QRZA 4QBFA 4MRNA 2NQ2C 3J81k 4GPTA 3S1AA 2AD1A 2GVDC 1A1VA 1NVUQ 2C78A 4OQNA 4HUTA 1ZW6A 1OF1A 1E2EA 4HI0E 4XIGS 1YZNA 2FG5A 1VCOA 2FF7A 3MGCA 3OHMA 4TMXA 1GL7A 2OM2A 4DJTA 3P4XA 3KB1A 4G01B 4DIDA 2BMEA 2GJ9A 2VF7A 5EE1A 2NO0A 5LB2A 1YR8A 1FNMA 4EIWA 2QA5A 1P2TA 3DOFA 2JJ8A 3GLIE 3SR0A 3PUXA 2FE4A 2WPDD 2WAXA 1CEEA 2GA8A 1GL9B 4PC1A 3FHOA 3WMFA 4MRRA 1LF5A 1MO3A 1NSFA 2D06A 4BEJA 2A5JA 3C5CA 4XSHA 1SVKA 1ZYUA 3VKGA 1AIPA 4GZMA 3E1SA 3BH6A 4QGHA 1S9HA 1GG2A 2C03A 3QKTA 2DCUA 5FL7A 2QENA 2WHXA 1NP6A 4A82A 3IGFA 3VKHA 1KJZA 2AR7A 2MSCB 1KIMA 4U5XA 4DLVA 1N5JA 3PUWA 4LHVA 4PQRA 1AKYA 4S2EA 4EPWA 3UPUA 2IYYA 2O8DB 1F2UA 1TF7A 1DTSA 2H92A 2QE7A 2RGGA 2ZJZA 4JSYA 3U3OA 4ZCLA 2R62A 5F9HA 4XTCS 1JNYA 3RYTC 1P2UA 1QVAA 2G88A 3ZIAA 1WMSA 4DHEA 3U7FB 3QPVA 2GAOA 3PUZA 1UBCA 4GP6A 4WZBE 4KFSA 1E2DA 5FTNA 3KQNA 4F92B 3L2OB 2F1JA 4BEBA 1IXRC 2VH5R 4MKGA 3VTKA 2QT0A 3B7GA 4GMXA 4BLOA 4Q9HA 5DO9A 2F43A 1XXHE 1SVIA 3QKRA 3TAHA 1JPNA 1Z6YA 4YLGA 621PA 1E6CA 4A15A 3O8BA 4Q1BA 2ZJYA 1GITA 2BCGY 5CM9C 1JAIA 3T1QA 2CE7A 2ZS7A 1CP2A 4JVNA 4ZDIA 3R8FA 1DAFA 4Q9LA 2IXEA 1QZXA 1DAKA 3EAQA 3EZ7A 4PPNA 5E7MA 2HJGA 1KI7A 1JBKA 1AGRA 4B2PA 4QHSA 4ZIRA 1MRSA 4B2LA 4FN5A 4GL2A 1G5TA 3QXXA 3NG1A 1S3SA 3SNHA 3LLMA 1XWIA 2BOVA 1K5GA 2W83A 1HH4A 4MRVA 4URWR 3LO5A 4N1AA 3PIRA 3UWKA 3GFPA 2NTYC 1HE8B 1G291 2QT1A 3MWKA 1FMLA 2QM7A 4YMTA 4C0HA 1ZNYA 3I32A 3TLXA 2GF0A 3QF7A 2BBOA 2DY1A 4HDOB 4NTZA 4A9AA 1MO4A 1CXZA 2GZDA 3FKSA 1M7GA 5CYPA 1FQKA 2QORA 2Z83A 1XPRA 1DO2A 2UZ3A 5UKDA 1RJ9B 2VLIA 2X1VA 1ZAKA 3HP1A 4M1TA 3TSWA 5A4JA 4LBVA 3ZVNA 4QM6A 1IHUA 3VNVA 3BGWA 3PENA 1IN8A 1UPTA 3TBKA 4F38A 4BE7B 3VR5A 3RSOA 5J4YA 3LDAA 2CJWA 1F60A 3NTUA 3QIAA 2OBLA 4JJKA 2H18A 1VIAA 2RMKA 1UJ2A 1W46A 3KQHA 4MGYR 2WVJA 5BQ5A 3K0AA 1W2GA 2QEQA 3TGPA 4C2UA 4IVPA 2PT7A 4F91B 3PQCA 1OXXK 2XX3A 3F5FA 4JKIA 4C0BA 1CJUC 2BV3A 2DFTA 4LJ9A 4YMSA 3VQTA 4US0R 3W3AA 3W6NA 1RYHA 5F9FA 721PA 2GXAA 3CLVA 5G40A 1TUEA 4D2IA 1CBUA 1NI3A 2H5EA 2PZGA 1T5IA 2PX3A 3K0SA 5C4GB 1H8ED 4IDQA 3UG6A 2BMDA 3O8CA 4HLCA 5HZKA 4G5RA 3K0FA 4YXWA 5CJ2A 3NBYC 3AVYA 2NZJA 4ASUA 4TMTA 4MQBA 1Z2AA 1UBGA 4MITA 5CM8B 4DLTA 4MKIA 2J0VA 2QPAA 1EX6A 1S4QA 4KVAA 3RVBA 2C9YA 3DOEA 5CB6A 2ZJ5A 4V0LA 1FX0A 4JT4A 1NL3A 1RC8A 1I4DD 1KO8A 1ZUIA 1G41A 3CBQA 3BJIC 5JFGA 2J46A 2ZPTX 2R6DA 3QXSA 3KJEA 1K5DA 3LRPA 4JVSB 3SFVA 2C9OA 5BXQC 2V6JA 4L4UA 1DAIA 3AVXA 1DAGA 1I4TD 4G1UC 1SVSA 1SHZA 3EASA 5KDDA 2LKDA 1DS6A 4HAWA 4IEEA 2UKDA 4H9GA 5E95A 1FP6A 5BN3A 1EXMA 2RHMA 5AUNB 1T8TA 1VHTA 3AF1A 1KI4A 3DKPA 4CEHA 5TARA 5IK2D 3FGNA 1EX7A 2Q3FA 4TSFA 3C15C 4Q9JA 1KDRA 3DZ8A 5FFMA 4MYHA 3IBGA 3FVQA 4OJKA 1NRJB 3P20A 3ECCA 1Q1QA 1WA5A 4JYCA 1FTSA 1DAMA 4D0NA 5HKKD 1OPXA 1D9ZA 2B7CA 2QAGB 1KNQA 4P33A 1E2IA 4MYCA 1CULC 1SXJA 1Z6GA 1Z22A 1ZD1A 2ZQ5A 3DEFA 1RRPA 1XTRA 5EXSA 1G17A 2G0TA 4IKEA 5IHPA 2YWFA 3IDQA 3VX4A 4DB4A 4Q47A 3UG7A 2C9CA 2HJVA 3AP2A 4MKHA 4EDHA 1OV4A 3EC1A 4CF7A 2ZANA 2HF9A 3K1JA 2VP9A 3ND9A 2GF9A 3R7WA 2W6JA 3TUZC 3GLIA 3G0HA 3TIFA 2JJ2D 3MLEA 4PO8A 3ZZTA 2J87A 2R2AA 3GMTA 5G3YA 2DFKB 3PFIA 2FOLA 4YDHB 4M9ZA 2NG1A 2OXRA 3WXMA 1CR1A 1W0JA 3MUFA 3PVSA 4Q01A 1MR3F 3CF2A 3HU1A 3FYHA 1Z6TA 3EPLA 2FA9A 1R0YA 1J7KA 1M34E 2ZSBA 2ATXA 4NDZA 2KB0A 5L8VA 4BLSA 1S1CA 4WW0A 4ZI2A 1IAQA 4P4SA 1TMKA 4OQXA 1AS2A 2VA8A 1DG3A 2OFOA 3ZS8A 2SHKA 1VDZA 2G1KA 3FFBA 1RIFA 4A2WA 2ZRDA 3KQUA 4B48A 2FFBA 5EE3A 5HR5A 1UM8A 4IDHA 3SYLA 1Z83A 1P4SA 1KGDA 1H8HA 1B23P 2XSZA 3C41J 1ZCAA 3B9QA 1RW4A 4NYIR 1XTIA 2QTFA 1F2TB 2IWRA 2O8CA 2AFIE 4QFMA 1Z5ZA 2D4HA 1TAGA 5AWFC 4OK3A 1KHTA 1SULA 1FZQA 1G3UA 2W0MA 2AL7A 1VKJA 3U2QA 3PUVA 1P60A 1VYTA 2IXGA 1XXHA 2GAAA 1K8RA 1E1QD 4DLWA 4Q66C 3C8UA 1JEDA 3SZRA 1U98A 5KSOA 1EWQA 5JEEA 4KAXA 4C0AC 4DDUA 1S1MA 5DHAA 2ZR9A 3HJNA 4PR0A 1G7TA 3I62A 1CS4C 2UVQA 1Z47A 1OYYA 2G0NA 1P3JA 1U9IC 4F4IA 4A0FA 3NDBB 4OHWA 1X6VA 4LYAA 4TWZA 2FPMA 3E2IA 4Q4JA 3VHLB 1W36B 3K9NA 2RHDA 2F9MA 1PLLA 4A6XA 3S1AB 1EFCA 3U60B 1ZU5A 1ZMXA 4HDQB 3LA6A 1XPOA 3MG9A 4PPQA 3WYGA 1KSHA 3SJBA 5G3ZA 1Z29A 1EFRA 4OJQA 4RD6A 2XGJA 3NKVA 4FMCF 1S9DA 3IO3A 2QL6A 3TR0A 3GEIA 2CE2X 4IW3B 2HLDD 2GJ8A 2VEDA 4ESVA 1HA3A 1CRPA 4JJZA 2NO6A 1Q3HA 2OBNA 3AKEA 4P0TA 4JSTA 1WP9A 5EP2A 4TZ6A 4C0JA 2JGNA 3FB4A 1G64A 2YC4C 3ADCA 3TQFA 4UNPA 4DEXA 1DPFA 1OLOA 3L82B 3LVRE 2P3SA 3NBZC 1GKIA 4B74A 5D3MA 4ACBA 3IQXA 1CIPA 2C5LA 1U0JA 2OAP1 3AF2A 3A4NA 1VPLA 2FEMA 3AKDA 3H84A 3K0EA 4FCVA 2NO1A 2Z5FA 1E2NA 4FCWA 4QGFA 1L8QA 3GQBA 2V7QD 2OILA 2Q9BA 4TLBA 2RGXA 4PFSA 3C4JA 4Q7JB 2B8TA 2XNDA 2OLKA 1US8A 4M1OA 3RAPR 1XFAA 4GNKA 5FOUA 1LY1A 2ZVPX 4JZKA 3W9YA 1TPZA 5KDOA 3QJYA 1F2UB 1SZPA 5EP1A 2ANCA 1IXZA 4JVLA 3R9IA 4C7OB 2QAGC 2ZAOA 3BH0A 1JEEA 3L8ZA 3OESA 3QVUA 1FP7A 3I5XA 2IYQA 3BAFA 2G6BA 5EXXA 2RGNC 4RD1A 1S96A 2XTMA 3H4MA 3QBVA 1TQ6A 1TU3A 1I2MA 1TX4B 2JIZA 2ZEJA 1AGPA 1ZC4A 4XVQA 1YVDA 5J4HA 1VG8A 4IVRA 4HLUC 1ODFA 3IKJA 4XH9B 4N0DA 5FOSA 3B9PA 5C2JB 2G9NA 4JL5A 5EZ5A 1Z8FA 5JWHA 2IW3A 5JWRA 2J59A 4EQ6A 2OZEA 3QKRB 4CT5A 3FDIA 4KV9A 1NN1A 3BS4A 4LI0A 5CK4A
chains in the Genus database with same CATH superfamily
2ZTVA 3IV7A 1WBJB 4AKIA 1X8JA 2QVLA 3EISA 1TOAA 3E7DA 1E5VA 2G9UA 2MSWA 4F45A 4Z2AA 2GBFA 5CB8A 1SJ9A 2PS0A 3OICA 1PJAA 3GI1A 1CF4A 2VJPA 4AWAA 2J7KA 3RTDA 2PWAA 2E1RA 4US1R 1GVHA 2Q4DA 5TDHA 5AVUA 1L4YA 1WXGA 2M6RA 5TQ2A 1WPXA 5B3JC 2P11A 4HL6A 1W47A 3HDHA 3OA0A 4AN1A 3NOOA 1JZQA 2IEBA 1Z37A 2WVAA 4R05A 2W58A 2RB4A 1TJ3A 4BE9A 5CDTA 4HEQA 3USCS 3VNRA 1UDCA 2DBVO 1NYTA 5K3CA 4JU8A 4NF2A 2VTEA 4PZYA 1TKCA 1O77A 3KC2A 1A8HA 4LX8A 2H3EA 2I6FA 4MWOA 4B3XA 9GPBA 1YC5A 1KI6A 5A2GA 2YOHA 3WGOA 3HCOA 3TAUA 2JD0A 4MAAA 1VGQA 4ZEOA 2QP4A 4EPXA 2CXNA 3IPYA 3N0VA 1ENPA 4FFNA 4EVQA 4OAPA 3EDRA 4RTJA 3NAGA 4M9QA 1T4CB 1ZP6A 2YHAA 1VJDA 4PWYA 3N5KA 4RKWA 3CZ5A 4YAKA 1HDIA 4O2BB 3N2YA 1YFZA 1U0BB 5DXFA 5JCZA 2PMBA 1A5AB 3ZE6A 4XM1A 4DNOA 3ZLUA 1Q83A 4FEEA 3ICQB 3GRKA 2CNWD 4B9AA 3ZYZA 2YN2A 3MVEA 5BNTA 1CYDA 3FTCA 3NM6B 2VP2A 3GP8A 3DS8A 4DQVA 1K7CA 1QE0A 1RPTA 2DJIA 1C3EA 5EZQA 1CS0A 1UBLS 4IX1A 4O2AF 4QYTA 4V39A 1VIVA 2HT6A 3LZDA 1YIDA 3HDTA 4CG0A 3NWEA 3B38A 3O2QB 4GPZA 1AQ6A 2G17A 3PJDA 4XARA 5FBLB 2R5WA 2PX5A 2Z43A 3FUTA 4N01A 2OB1A 3C3AA 1KK0A 2ZRJA 2QPTA 2FUG1 4WL0A 3TCKA 3MJDA 2WB4A 4Q9DA 1RRKA 1PQ4A 2J08A 1IATA 1KAGA 3HZRA 4D3XA 1X0XA 4QBHA 3D8NA 4EDHA 1T0JB 1AMNA 1PS9A 3ZDCA 3ZD8A 2HR1A 1JB1A 1ULSA 2R1TB 3BCRA 4YAIA 2P9GA 5I7FA 1KY3A 1GG5A 1QDUA 3AZPA 4E5SA 3LKBA 4HQOA 2A9KA 5CFQA 1CY2A 1A0OA 2H7CA 3ABQB 1LBHA 2W22A 4M1SA 5ESXA 4P5EA 4B76A 5IKEA 5K6AA 1ZCBA 1QE3A 4MO9A 5BSHA 4I7EA 1WL8A 1BH2A 2XOEA 2ZRBA 3EQ6A 3G3EA 4TV9A 4R2KA 3G9UA 3U13A 1II8A 3AHCA 4G89A 1GNSA 1HKHA 1Y37A 1NBMD 1X2BA 4BFTA 1ATZA 1ZN8A 2HDWA 2Q1WA 5CIWA 4IUYA 1Q0UA 3C5WP 4XJXA 4XZ3A 2VTBA 3EXHB 1KJ9A 1XJWA 4JJ4A 5A3QA 4QGBA 4YP7A 2B1RA 1Z6ZA 1XK7A 3SIXA 2G0AA 3WO1A 1E2MA 2OBMA 5EJ5A 4HQLA 4KG7A 4X24A 4P84A 3WRXA 1R9MA 4ECAA 1XTVA 5AW2A 2DHQA 4PAMA 4BZPA 4TMFA 1K7XB 1ILWA 1OI2A 1SHLA 3ZHSA 1FMFA 1XD8A 5IAAA 3KKPA 1R4AA 3LU1A 1GNPA 1PL0A 2ISSD 3OT1B 3AI7A 3E22A 3EPKA 4HEJA 4ARAA 1WSAA 3PQ3A 1EK6A 3LX8A 3JWHA 1QIEA 3MTGA 3DMFA 3ONEA 3PI6A 2CXSA 3FA2A 4JX8A 2ZI5A 2VUUA 3IQFA 5ALEA 5IBPA 1AO0A 1U1DA 1E5QA 4R8KA 4TKUB 3A2KA 2YYZA 4LXQA 4J76A 1GTL1 3ANNA 1SD1A 1WCIA 3FNFA 2V1UA 1P33A 5LVAA 4TQ9A 2QG4A 5ULLA 1E0JA 1TKAA 1T4DA 3S6JA 2OESA 3DTNA 4HPJB 2HWWA 4GVLA 5LDGA 1KPGA 3FYUC 4PLGA 2IV3A 4UTPA 1QPBA 4HAVA 4D45A 1W8IA 3MTDA 2WYUA 1CZNA 2GD2A 3NX4A 4IRUB 4F3YA 4URYR 1QB8A 1PDVA 2MWMA 3ZDAA 4JI4B 4H3KB 3CF6R 2IPNA 1QGED 2R7LA 3DG9A 1FW8A 2VWHA 3LI2A 3HNOA 2ZRIA 4FMDF 3KHTA 1P73A 3EOBI 4H77A 1F17A 1DPGA 1LPNA 5U9CA 4AQYB 2HA0A 5DE3A 4N7BA 3PHCA 5EERA 1G0NA 4GMKA 5KO2A 1Z4MA 3O93A 1ND6A 4XWKA 1CZKA 3RTAA 3AR4A 4MS3B 4F11A 4ZAZA 3WRVA 3N07A 2QTRA 2J0SA 3SDBA 1PQUA 4XQEA 4P4UA 3TXYA 2A5GA 4L07A 3QJGA 3UXYA 2FMHA 1N34B 2W8BB 2PY6A 2ZB4A 1TKRA 2W93A 1R1DA 2X15A 3LBNA 5DKFA 2JFHA 4TV9F 4UEQA 1MH1A 1W4LA 4FZ5A 1YOBA 4MIKA 4WI1A 2Q4TA 4ZO8A 1MA3A 5F4ZA 2MT9A 1P2BA 2ZJOA 3DR3A 1TT5A 3PC8A 1Z88A 3RYHA 4LYJA 1E89A 1KDOA 4O2LA 3SS7X 3VX3A 4JB2A 5BY2A 5KVSA 5EHZA 3AHDA 3BXXA 1ZJ6A 3AUAA 4XYGA 3D2BA 3A9WA 4NYMQ 5DHUA 5DMHA 3TGLA 2A33A 3NPMA 2E5WA 4ZXPA 3CCCA 4RTQA 2DFPA 3EMDA 3VZPA 4KGZA 6PFKA 4HJRA 4WSOA 1JZSA 1XZKA 3ME5A 4OHUA 4IZIA 3TB4A 5DX0A 3H1TA 4JEHA 1OZAA 2KWIA 2QWXA 3NUQA 2HPHA 5AKYA 1BXRA 3CKKA 4MNTA 4MPPA 4CDGA 3PVCA 1HYEA 1PX2A 2ZIFA 2YVUA 1IMJA 3LS2A 4QU0A 2BZ0A 4W5HA 1IBCA 1LW6E 1X0VA 4LBZA 2H6EA 4NIMA 5EWMA 4Z7QB 2W2KA 5EUQB 2DB3A 3H1FA 3OZXA 2RARA 3GBSA 4X1IA 2O8CB 1TZ2A 2MR6A 3VZSA 1VIDA 3TZBA 2Z8YA 4NJMA 1B42A 4J7UA 4LPSA 3VR4H 3FOEC 1YRHA 1QF6A 5FI1B 3W6ZA 2WHYA 4JXKA 1SQFA 3R41A 2F8MA 3ROTA 2H2WA 3T41A 3ENQA 1CCWA 1Q21A 2F67A 3CJTA 2MMCA 4P2GA 3LXRA 4KAFA 1XP5A 3OTIA 3TTXA 4DLLA 4NL4H 4CM5A 1GRQA 1XK6A 3SICE 1OI3A 3E9MA 3OIYA 1H66A 3K1ZA 4UDXX 4B33A 4BVKA 1NX6A 4EMUA 3HA3A 5FI5A 3WDKA 1ZGGA 4LYDA 1YIAA 1YZHA 1O6GA 3OEEA 1BJTA 5HFJA 1GO2A 4FFOA 5HDQA 1XEAA 4RVDA 1AKNA 2LDXA 3PFWO 1MIOB 3UKDA 4MA4A 2IBTA 4Z4GA 4YUXA 1D7OA 4R81A 3G2LA 3TLYA 1FDTA 1U8CB 4K9QA 1KQGA 3EPLA 2I4LA 4R41A 1NVMB 3BERA 2WZDA 5KVQA 3SN6A 4MJ7A 4ZVLA 2PZJA 4XEHA 2A57A 4C7KA 1L7OA 3JQAA 5AM0A 1NVDA 1XZQA 3OPYA 1DADA 5FXMA 4RHTA 5K03A 4Q6BA 2ZYVX 3G7SA 1QC5A 3D8BA 4PNZA 1DBRA 3B7WA 3KOYA 4U2FA 3EXG1 221PA 4N76A 3DBLB 3FTQA 3VNSA 4Q1VA 4HLNA 4XM2A 3MTEA 1BVHA 1E9DA 1PCXA 3MWGA 4N8SA 2NXNA 2GJKA 3NVAA 2H85A 3UMMA 1ULBA 2PH7A 1SBQA 4D4HA 1N2HA 3GDWA 2P2NA 4MEBA 1NLYA 8LDHA 2PCJA 2B36A 5JJLA 2AN4A 3TZ6A 1XLTC 1YBHA 3M6IA 5D6NA 3HB7A 1U7TA 2MSLA 3IKLA 4O02B 4DV1B 1CJMA 2AMJA 2JA1A 3RANA 2GLXA 4AJ1A 1Q16A 3VSEA 2VIIA 4A10A 4ZVRA 4B3BA 1R2QA 1LRKA 1Z6PA 4GPD1 2D5CA 1WUKS 3D7RA 4M8IA 2ODBA 4R0NA 2JAPA 1ZGBA 2O7QA 2HXSA 3DMGA 3LT4A 4N3NA 5FDFA 1JWBB 1D4FA 1US8B 2OK7A 2FR0A 4F93B 2GWHA 2VBCA 3DMYA 2DETA 3K6KA 3QZUA 2O7NA 5D85A 5JCOA 3A3NA 3G89A 3MJCA 5TVGA 2XMBA 3ROMA 3BDIA 2Q1TA 4GR4A 3AZOA 4IG4A 4OKNA 2QL7A 4X8LA 1ZRHA 3WIDA 4DLAA 5KQPA 3SYKA 2X1HA 2Q3JA 3BMNB 5IXSA 5KNBD 5EPUA 2Y1FA 1CUDA 2IIPA 5DLPA 4X61A 2YJZA 3TSAA 1T3HA 1FL9A 5SZIA 1PZXA 2P5SA 1OC4A 4DJEC 5KTTA 4EI2A 3T52A 4O2AB 3OIVA 1DSSG 1KO1A 2QR2A 2Y0PA 3L79A 3CCBA 4KDRA 4LYHA 2ZSFA 5C35A 3LVBA 1ZK2A 3KSRA 3A7DA 1VE9A 1E63A 1X1CA 2NZVG 2WSSD 3KCQA 3QEOA 4EQ6B 2V55B 1UMCA 3HB9A 3RRYA 3IODA 1V71A 3GHHA 3P9RA 2OV4A 3LQFA 3FCSB 3ZGOA 1RI5A 2HPZA 1QHFA 3PNLA 1BE0A 1N25A 1FDIA 2BGMA 2HD4A 3PBKA 5DW0A 3BFKA 5HKBA 5AJYA 1EU1A 2A5DA 1OBFO 3JQBA 1KEVA 3LDGA 4MRSA 2ZTMA 3PFNA 4G4SO 3FNBA 1IONA 1JDUA 1GOTA 4FSXA 4X7BA 2EZ4A 3T0FA 1JYSA 1DTEA 4CT4B 1L5MA 2J3EA 1JQKA 1NHWA 4G63A 2WQ6A 3NCHA 4LF5B 1QTIA 4LRTB 5TQ2B 4JCOA 2BKAA 1JMVA 1GTZA 2BDUA 2QROA 2VQSA 3VR6D 4BQRA 3H99A 1ML4A 4BECA 2GZAA 3KLBA 4PVDA 4ESHA 1I1HA 4M0UA 4FZVA 3ZD6A 3PITA 3MGBA 5BNIA 4LF4B 3NS7A 1HUQA 1RZVA 3N75A 3L3BA 3NHKA 3WMGA 2NP6A 2ZWAA 3TINA 2OG2A 2QZZA 1SG6A 1JEJA 3GO4A 3O3OB 1NUHA 4PXAA 1CY1A 3WGZA 2FQQA 4ARZA 1KI6B 1KYWA 4B32A 4CJXA 3GB9A 2QMHA 2Y27A 1GAWA 2NTEA 4UOEA 1HORA 3GVPA 2W6CX 2VHVA 5CR9A 2WILA 2Y93A 2QSJA 3K6RA 3VYVA 4FCCA 2PL9A 2V4MA 4BLWA 4TWRA 2IUYA 2H51A 4RY8A 3KKMA 5IFLA 1OWPA 5CJJA 1NXXA 2FUG6 2QTLA 3AFMA 3P71T 4JLOA 4RV5A 4U0JA 1BE6A 4G24A 1BJRE 4KIGA 4CPDA 1DELA 3FYDA 2DKFA 1C3XA 4CM9D 1UBKS 3CZCA 3L8FA 5FUVA 2GN6A 2YIMA 5LNK6 5AICA 3BFJA 5CLGA 4TS3A 4PSKA 2HRZA 2H17A 1ZJ5A 4B17A 2IPOA 3DC7A 3GXBA 1QP0A 2IY7A 3BD9A 3U16A 1OOEA 1EGMB 3OCUA 6ABPA 1JHZA 4LJ5A 1II9A 3TLAA 1DEHA 4O8ZA 1NDUA 4O0LA 3H05A 2HF7A 3KVVA 3ZN2A 3HVRA 4TWJA 1PEYA 2EFDB 2ZRFA 4MVJE 2B78A 4AKSA 1JTVA 4J0JA 5BNZA 1C8VB 3GFVA 5IM5A 5BW5A 1Z2OX 5GGYA 4TL8A 4JC5A 1OFIA 1DUVG 1XCMA 1BEZA 2UUOA 2W6ID 3Q41A 4FMDB 4J0IA 2I7CA 4YONB 1OY1A 1G5RA 4BO9A 1ONOA 1PYDA 2HJRA 3QWFA 4Z4HA 1I80A 2XXBA 5SZKB 1TCUA 3RS9A 5K8VA 5E7JA 1SUAA 2FEKA 3GJ4A 3N74A 4ZDKA 1ZSYA 2GBGA 3ORRA 2H4JA 4RTRA 2JLBA 1PO7A 3EFBA 6LDHA 1A5TA 2WPDA 3HYRA 1V6AA 3QW4B 5BQOA 1VJ5A 5EQTA 2W4QA 3HZZA 2AMVA 3OQNA 4ZQEA 3M4JA 4TV9B 4HVCA 1XLWA 1JR4A 4DNQA 1CB0A 2HPVA 2ZYUX 3FPAA 4JX9A 4WAUA 1II8B 1IBLB 2GRUA 1EFPA 2X5XA 3KXLA 1NNSA 3QTLA 4KOEC 2VF4X 3L6CA 3GH1A 3NXSA 4QDJA 1BX3A 2JFWA 4RXMA 4TYMA 4P22A 3TS1A 5BV1A 2QTHA 4JUFA 4D81A 1P4AA 2VTBB 4W5TA 1XAGA 3N1UA 4CF4A 3OLZA 3PPWA 1G9TA 4WBNA 4IDDA 1KWGA 1SXQA 2MR5A 4NHOA 4RK1A 3WNCA 4D99A 2NV0A 2CGEA 1DI0A 4QJBA 1JU4A 1HTWA 5EKSA 1C1YA 1YFJA 1JDNA 3E22B 5T3UA 3QVMA 2P9EA 1YDHA 2IY8A 4IXTA 3EEYA 4RUKA 4PTZA 5TPZA 1MZVA 3THYA 2VDMB 3U37A 2YWEA 5B6JA 5JRDS 1I5RA 1M3SA 2I4IA 1A8SA 1IPHA 4OXYA 5FLXA 3W5BA 5EMLA 3JWIA 2AFRA 3THOA 2PRYA 3G5AA 3IDFA 3H1GA 3Q8XB 5BO5A 1CR2A 1DHTA 1VI2A 3RVNA 1WCIB 2V5AA 3QYAA 1JEQA 1XZGA 3EIXA 1Q0RA 3TW4A 1N7IA 2VSFA 4Z53A 2PD3A 3N28A 3ODGA 1C1XA 5FAKA 3L0ZA 4KXLA 3TPCA 2JDID 2JGLA 5A7FA 2WJIA 1DCFA 1U8ZA 3CRRA 3JZMA 3C16C 4W8HA 2W42A 1GCIA 4YMHA 5JCXA 3K72B 4AUEA 1IOVA 3V4RA 3QM1A 4GBMA 3B2EA 1L5WA 1PS8A 4EEKA 3AX6A 3WR5A 3G5TA 4CTMA 3RGGA 1XU7A 2GXQA 2Q5LA 3OEYA 4K3VA 5J23A 3EW7A 1R6VA 4H7PA 1AM4D 4JEIA 3OQJA 4RJ2A 1TQDA 4CL0A 3QFCA 1WB5A 3EQ8A 1PJ8A 3A4YA 1GKLA 3PUKA 1HLFA 4P38A 3RV4A 3ZGYA 5ADHA 2XUIA 3RIHA 3LUJA 2WOOA 1TT5B 2EW2A 2PLRA 4UNIA 5D7BA 3WSTA 5F7ZA 3H3JA 3GLHE 2DQSA 3H0EA 5EKUA 2QE6A 2A4KA 1DQPA 1RBYA 1XVLA 4EJSC 1TM7E 4YPOA 2W98A 2NVWA 3E2MA 1HT3A 3EGXA 3OZWA 5DM2A 4OH7A 3OY7A 3D5TA 5LUBA 4WBNF 4OCZA 3DKVA 1QNLA 2XR1A 4PBSA 3U6BA 1EFAA 4ZV9A 1SURA 1RJEA 5I9IA 2CEKA 1BXRB 3G8BA 4LJ6A 4MUMA 4OLFA 2BE9A 2W2KB 2Q99A 1YDGA 2NQ8A 5DNEA 2FLKA 3KR1A 4MKXA 4PINA 2DT5A 1U31A 3H1EA 3MTAA 3FPFA 4X1IB 4IV8A 1SUEA 4EUSA 3HVJA 4BQNA 3N2ZB 5EESA 1TEXA 2RAVA 3L7MA 4Y0NA 4NJMB 1M1ZA 1OFUX 2EL7A 4LOAA 1ZCFA 1Z0JA 2EWVA 1O08A 2X14A 3F9RA 3ICEA 1EESA 3HFJA 1U8AA 2FW9A 3QFSA 1Z28A 2FU5C 2PEZA 3GC6A 4TLEA 5DXJA 1A2OA 3U7EB 2A0FA 4YUVA 4C87A 3A9VA 4ZV4A 4Y98A 2WU1A 3MXOA 3QU2A 1T5BA 4I1IA 4XGKA 2R6GA 4Y9DA 3RH0A 1G8AA 1FU8A 4JCCA 4OK5A 4CMIA 2ZB2A 3BAZA 1X1AA 4RU1A 3V3KA 1T2UA 1CEQA 3DW1X 4RSGA 2ERCA 3KELA 3K09C 4WLNA 1AKEA 3ZLVA 4BLTA 3H0KA 1GR0A 2N1BA 1XCLA 1G5PA 1T36B 1P6UA 2EFYA 2C4TA 2GERA 4E2XA 2JLYA 1UUFA 3STVA 5THKA 3U1TA 2AKYA 4M54A 3HL4A 2B2NA 2B7LA 1RXYA 3FI9A 3SJUA 2WC1A 5GQSA 1SAYA 4Q03A 1H3EA 1HDCA 3BSWA 4YV0A 4C1NA 1FVHA 3IVRA 1VMKA 1SOWA 5JH7F 3JQAB 2C83A 4W5OA 1G55A 3OPYB 3S8EA 2LCFA 5BQ3A 2IEDA 4DUGD 3LPNA 2B94A 4XCVA 5KTOA 1W44A 1QC5B 5BV8A 2YICA 2WOJA 2IXDA 2P8JA 3TI9A 2II6A 1UEIA 3Q5GA 2QUKA 3BZBA 4MYTA 5COQA 4A73A 2J9RA 2MU1A 2JEOA 3BQMB 3UY4A 1F4LA 3S0JA 4BN4A 1TZMA 1TJ4A 4L0MA 4BO7A 3GLGE 2RHHA 3CHYA 3I1JA 4TLCA 4EPYA 4MV3A 5KNBH 3A1TA 3I9V1 4UVIA 2K87A 2C7RA 4W6ZA 3R76A 5HG0A 4P0PB 4IBOA 5A0FA 5ITWA 3V55A 4ZA2A 3PEYA 1GTMA 3ZVMA 4RJLA 3H6GA 1SIWA 4RD0A 3LBYA 5B4TA 1KERA 1ZFNA 4H0CA 2OY0A 5HJ5A 1EJ6A 1U1FA 4JYZA 1J2JA 4A2QA 2R8EA 3I28A 5B5SA 1HURA 2VN8A 3B9RA 3DT9A 3G68A 2PXCA 2GVZC 2AZ4A 1JU9A 1K8QA 2I6UA 4MRAA 3RWBA 3O8NA 3E9RA 3RB8A 3PUYA 5TMBA 2Q3DA 1YBFA 3HXMA 1ZMOA 2XMSA 1EB8A 4MCIA 1YQ9A 4BIIA 5JC8A 3I23A 2XZTA 3OI7A 2R4QA 2PN1A 4W1SA 1MRZA 3EN0A 3EEBA 5HKKA 5HKLA 3TQOA 4F5EA 1C9EA 1FS4A 3UMSA 4CODB 5LM3A 1OXTA 1OAAA 1PYGA 5JBQA 1ZJZA 2D4AA 3OZEA 3ZVKA 5DGDA 4D82A 3WL3A 2WIFA 1SGWA 3H6KA 4Z1OA 4ZCMA 1GUAA 3AVPA 1RWNA 3HJCA 4DIKA 4YAFA 4BUJA 4X8MA 2RAFA 2AMLA 1UK7A 3C4VA 3VR6H 1UBUS 3HU3A 2WYHA 4DDKA 4O33A 4F8YA 2QTAA 2PV0A 1W5BA 4DR6B 2ZRQA 1PZMA 3SSOA 3QKUA 3KKNA 2GDZA 4AF8A 4C30A 4BL5A 1RAEA 5B1DA 3UWPA 1ISGA 5CVCA 3UGTA 1EWKA 3NPAA 4XR4A 4L27A 4PSAA 2WJVA 2OTCA 3KOZA 4OMFG 3UANA 4NH4A 1T8RA 3K9HA 4S3MA 4RZIA 4GM1A 5EJ8A 2OAQ1 1RI2A 1B0AA 4BNIA 1EAMA 4CDMA 5INTA 1OR8A 2NXWA 4EAQA 3L7KA 5FBVB 2JGEA 4TT8A 1C2YA 2Z2JA 4LE2A 5I48A 4KN9S 2CFTA 1FSFA 3V7UA 1FQOA 4HDMA 2F9LA 3KLNA 5JCJA 3REOA 1WY7A 3UAZA 2TRSB 4OI2A 2RBEA 1DG9A 3W6UA 3TW0A 3CGWA 1KI9A 3RW9A 4DYDA 2FPOA 3DTTA 1RM0A 1V5GA 3AF5A 4MWCA 4TSRA 3S4YA 1UMKA 4BMZA 1W36C 1MHTA 3ESAA 3P27A 1Q3TA 1WXWA 1P74A 1M10A 1QRRA 4KO2S 1JR3E 2HQSA 4KWCA 4UHJA 3VR3A 4RF5A 4DG5A 4EKNB 1QGAA 5AJVB 1E0DA 3SQMA 4X54A 4QXRA 4EM6A 4YS6A 2GCGA 3DB1A 3ZVRA 3MS7A 2OZLA 4LYGA 3QUAA 4POAA 1EE2A 1PWZA 2WTNA 1JG7A 1I10A 3OUZA 1J7JA 1I24A 2R44A 1NIPA 3MGGA 3VUFA 4B3IA 5DSTA 2P6RA 1BS2A 1JR6A 1WB4A 2F1HA 3H4VA 3E84A 2NIPA 2FFQA 5HCUA 4DJ5X 3BSFA 3L8MA 3U5TA 2RJOA 5AIAA 4DHWA 1RHRA 1GTRA 1GQQA 2Q5IA 3D9QX 2XIQA 3K8OE 1NDHA 1T10A 2B83A 2N3ZA 3KDPA 4LWPA 2CFRA 3BFPA 3CISA 1IULA 4M37A 3WMEA 4WA7A 2Y6UA 1T4MA 1TO2E 1VMDA 5IARA 3VR2A 1DAHA 2B4YA 1I8TA 4CL3A 4K5QA 3H2JA 2V65A 1DV1A 4HQKA 3DFMA 1VSVA 4BLQA 4ARCA 4Q7LA 2Y71A 3UFBA 2BY4A 4ZJZA 1QH1A 1IHPA 1YRLA 4E4YA 4GICA 4JMPA 1V95A 4HH4A 1SUFA 4FEYA 1E9AA 4TTJA 3EAGA 2EFHB 3HM2A 5K5EA 4ITRC 4AYWA 1UJBA 3CUKA 1NVAA 3AKCA 3MCUA 2A9JA 1G9SA 4A36A 4NS4A 1SA0A 1O95C 4XIIA 2TECE 4ZT6A 5FRDA 3NT4A 3SQNA 3TIVA 3BMXA 5LB4A 3VR4A 3WRYA 4EFMA 2JFFA 3CUTA 4I1VA 1XJ0A 3VYTB 4DSAA 5K4HA 4C2TA 3RC2A 1L9XA 1P7WA 1X42A 4V03A 2R86A 1YZVA 3W5HA 3ZTWA 5TC4A 5CJPA 3IMFA 3EGIA 1U5AA 4NNOA 4CGZA 1JA0A 1KY2A 4IOKA 4UMDA 2ZIVB 3KAKA 1E2HA 1TYAE 3M9XA 4IOMA 5C1IA 3DLHA 3VR5D 1RXSA 3VPCA 3AM1A 2GM9A 3BE4A 5HYVA 2Z2IA 3HJAA 1USGA 4C6TA 4BGDA 2YXPX 2X8BA 3ZDXB 1WTCA 2EX1A 2HCJB 2ZAGA 3SHOA 5AVVA 1JLRA 1H5UA 1TMYA 2XTZA 2ZB7A 2IYNA 1ODCA 3B3GA 2P1DA 2R6AA 1EFPB 3HLYA 2RCNA 1NU8A 2Z04A 3QH4A 4J91A 2R11A 4CFZA 4V1CA 4HX2A 1MQ9A 1TT7A 2DP4E 2EC5A 3OZTA 5B3JA 1AQNA 1KZ4A 5DZSA 3PUHA 3TXXA 5IDVA 3M4XA 1F20A 2P91A 3CINA 4WBNB 4HD8A 2WY2D 3WL7A 2Y4NA 4XFDA 4PLYA 2Q4EA 3ITEA 5JSYA 2JIQA 1M73E 4ZEMA 1UQUA 1RQLA 1L5SA 4X1OA 4YACA 3VMFA 3FCUB 2GZHA 3N3AC 3O2JA 3FJ1A 4OXXA 4QXAA 2BTQA 2Q5HA 4H15A 4ROSA 2F3TA 2XKJE 3P0IA 1QG4A 1KBOA 2RD2A 4LXIA 5SICE 4DMCA 2C3UA 4DB2A 4R8VA 2VP3A 4M1ZA 1OZHA 2D7CA 5D86A 3LIIA 5T8KC 2GYYA 1AF4A 4INZA 4N5LA 4PG8A 2I3ZA 1DWUA 1JEQB 2X22A 3NRCA 3HYCA 4EGAA 3TN7A 16PKA 1DXQA 1UKVY 3EODA 1ECJA 1MLDA 1PNOA 4W4TA 5DRTA 1SIOA 4RF2A 1JKFA 1IEVA 2K7ZA 4MLDA 3Q10A 3HSYA 1FFEA 1LNZA 4DSZA 1Q12A 4KODA 1I9CA 1G21A 1QFSA 1WG8A 2ZWOA 3MB8A 1AGXA 1BGXT 2I66A 4O4LA 1XPRA 1TIBA 4IZOA 2V0NA 2WHPA 3ZJYA 3OPVA 4O29A 1E3JA 5ILOA 3HJUA 4JQOA 1ZN7A 5AJXA 3B52X 4EHHA 2ZM6B 1AQJA 1C0KA 1D2EA 4W99A 3CTPA 2JNWA 1BE8A 4GRIA 3LKVA 1Y4DE 1FUKA 1U81A 1R9NA 3CWZA 4TV8A 2PGNA 1L6RA 1RADA 2ISQA 4DQDA 3KVNA 3D7SA 5JAZA 4X71A 5JW6A 4CR8A 1I7QB 4QLOA 1NU6A 1U2DC 3DP9A 4JI3B 4BLRA 3NJ4A 5AM4A 5KKCA 1I2BA 4D8VA 5C3MA 3BJMA 5CFRA 3F6RA 4O2RA 1SBNE 2AG5A 3C8DA 4WX2B 1T8SA 4EYQA 5CAEB 1VGVA 1OTHA 1E5LA 1NJFA 2HV9A 3H2GA 3EY4A 4D0SA 4GQIA 5F3DA 3GP5A 4DTIA 5K3OA 1HG0A 3ZIDA 3E03A 1JALA 3L8CA 3EGXB 1DX6A 4X6LA 1ZIPA 3VVCA 4V02A 4EOGA 3WLRA 1EWTA 3L93A 5SZHB 4ZMSA 4TXJA 3ZBUA 1BWQA 2X9LA 3VSDA 3HC7A 4DRYA 2AXPA 1R10A 3Q7QA 2JLVA 4QUBA 2O8NA 3UOGA 1L5GB 3UMFA 1U5BB 3R0XA 2NAFA 3CZAA 3OJXA 3QE4A 3U56A 5KSWB 4DCUA 3O4IA 4P53A 4NPAA 1GDHA 4WN9B 3U6KA 3PQ6A 5EWJB 4X66B 1F6DA 2XF2A 4QBGB 4S05A 3LBAA 4KX5A 1ST3A 2CNWA 3EIQA 4WVFA 1CJKC 2HSJA 5ENDA 1U2TA 2EKBA 2J4DA 4FPXA 4P32A 4P81A 1W5SA 4Y9SA 3WOVA 3IAAA 1U65A 1E2FA 2EEZA 1K68A 1PGNA 1WW2A 2WWFA 1W0JD 4XKJA 4NC9A 1UEJA 1VKNA 5I4IA 2XUDA 1A2BA 3EMKA 4TXMA 5JADA 1ZOLA 1D1SA 3AF4A 3FZGA 2VAMA 3L0SA 4S1WA 1TFRA 1G7CA 2JJYA 2B34A 2YC2C 4CMIB 2J3DA 4WIAA 3RC1A 3I2FA 1B14A 3SZLA 4K9LA 3P97A 3PT9A 4MJLA 4MGKR 5DNDA 5LMNB 3ELYA 1EYZA 1GZ7A 2EBHX 4XAQA 4F86A 1FP4B 4O4LF 3C3XA 2YMQA 4ITVA 2NU9A 5JAPA 3WIBA 4LRUA 3FYUA 2CWWA 3ENKA 4R31A 1LPOA 4FHZA 5E6UA 5CXUA 2OORC 4ZYZA 1II0A 1X7DA 3I9V6 3PK0A 3D7MA 4K86A 5JAIA 3LKZA 1TF2A 3H04A 2FFHA 2Y8EA 3FNGA 2D54A 3ZD7A 2C5BA 2WNHA 4TV8F 1LVGA 1OLUA 2R6CA 4W82A 4CKEA 3S3TA 1TUIA 3ZV4A 4AG6A 5ELXA 5GGXA 4M55A 4HDNA 2EZTA 2GJSA 2J9FA 3ANSA 3B85A 3VJRA 1NBMA 1H0KA 4AY2A 1M2EA 2X77A 3LC1O 4IHQA 4LVUA 3KYBA 4BZXA 2IF2A 2EWWA 2H5LA 3F74A 3L7OA 4N5NA 4GBED 4QFBA 4FHDA 1CQZA 1E1DA 3QMVA 1Q44A 1NY5A 2JD1A 5JRJA 3SHFA 5EJ6A 1SXGA 1XTSA 5BUCA 4AB1A 2BGJA 1Z6QA 1J8MF 1PP4A 4HFRA 1W1IA 2ENWA 1H2WA 2VYQA 3ANMA 2BFAA 3LUKA 4M9UA 5F7JA 1ZI9A 3OZUA 2DRIA 2ALJA 4FKBA 2RG7A 1B0PA 3E9ZA 3I6QA 3M6AA 4GPAA 3L7AA 1MC1A 5GJCA 2CFCA 1RP7A 2NYAA 1MJFA 2CXXA 1Z6AA 2VJNA 1C7FA 4MA5A 4WKPA 4BCBA 4OLJA 1JJ7A 3I04A 4ARUA 2WD8A 2HU2A 1WTAA 1Q84A 2PKXA 2DKNA 1D2GA 2F59A 2M98A 3DDCA 3EG5A 3I6IA 2EWMA 1PFUA 3IDZA 4GEGA 4LRQA 2EF1A 1QFXA 1GN8A 1I1NA 2XCUA 3WKEA 5KINB 5BYAA 2ZSIA 5C80A 3M81A 5GOZA 3MSCA 1LRLA 1VMIA 3EJ6A 4U6NA 2WJAA 4JNKA 4RC9A 5FOXA 2RHOA 4KTVE 1HM5A 2DWQA 1IY0A 1WD5A 3FYSA 2V9CA 3QBEA 5C32A 5JNRA 4DEYA 4QATA 1N5DA 5M3BA 3SFTA 4IFEA 3PIDA 2QMUA 4XUGB 3OWOA 5JXWA 1YI0A 5AYVA 1XTBA 4B5KA 1CNEA 4QUJA 3TM4A 3O0DA 1OD6A 3TE7A 5F35A 2BKUA 2D3WA 3JVUA 4X8OA 5AJHA 5AW0A 2BZGA 2H4WA 1YA6A 4RTKA 2TMYA 4PYRA 2J0QA 1RLMA 4WTOA 4JT8A 2RBGA 4K7JA 1EEHA 4NV0A 1BKSB 4OATA 1AHNA 4FZ3A 2FP3A 3Q88A 1XNJA 4KMOA 5B4VA 3T7DA 2OMEA 3WLFA 5HUHA 1ADYA 4LRSB 4Z4QA 3TZKA 1Y8AA 4WFJA 3KAJA 2IYLD 2B6NA 2P9HA 3QLTA 1KMQA 4N49A 3U9TA 4OREX 5M7EA 1D6JA 4OI0A 2PFGA 2QR3A 1NQUA 5CW2A 4M88A 2C3PA 3WGKA 3B1KA 4E22A 1K3FA 1HE2A 4TYQA 4PPGA 2P6NA 3H16A 2K7FA 1FK8A 1SUIA 2P2YA 1LW7A 3QFFA 4JOCA 2XUFA 3T35A 3CA8A 4KXWA 3ESBA 3LTEA 2CVQA 1U3FA 1ZKMA 3B70A 3RRMA 4NDNE 1VZ2A 3DXZA 4I8XA 2ZYHA 2VRCA 4ZTUB 2PL5A 2VZ8A 1EK2A 2XYHA 3IBTA 4Z49A 1CUWA 3IVCA 3GQVA 3H7AA 4D9FA 1ZM3A 3LOPA 4F2DA 4YMGA 4M0MA 3PKJA 3B6EA 1DXOA 4OFWA 3ZW7A 2OZLB 4DG9A 4K9OA 4U9IS 5G0TA 2I2XB 1Z15A 1D5WA 4HNSA 1QGDA 3AR9A 2QXUA 5GM1A 2G82A 1YDFA 1H4QA 1XKLA 4C5AA 3NLLA 2E55A 2WBLC 3VVBA 4DDHA 1QR2A 1WBBA 1UXKA 2GEKA 4WJKB 2JI7A 2UU9B 2A2ZA 3QFRA 4O63O 3O73A 4EYEA 2QIOA 5FLYA 5JNUA 3SKYA 1XPUA 1E6EA 4DIMA 3OF3A 2PJDA 3IV9A 2A67A 2ZE6A 1Z13A 1KVTA 2XQJA 4NY1A 2H07A 5FUMA 5IKPA 2EG9A 3B53X 3EQZA 4Y0VA 3U4AA 3VR5H 5LMCA 1T1GA 5I9SA 4OYLA 4RESA 3EARA 4Q3DA 3PC4A 3ZHTA 1PJLA 3RFUA 5JXHA 1KOJA 1QH1B 2VJQA 4RKYA 3LWNA 1N6KA 1KBZA 4IKOA 4TWBA 5AD1A 4MKZA 1XZJA 4TMWA 1ATIA 2VZEA 4AO8A 4GFDA 3R3UA 2WMNB 4MVJD 1R15A 3IESA 1Z5OA 4NQZA 3T54A 1N3IA 1P0IA 1HFKA 4IY1A 4C03A 1NN5A 3WLSA 1QHGA 3NHFA 4AMVA 4B44A 1R00A 2ILTA 4PZLA 4JOSA 5LL6P 1SA0B 4YNBA 4TZTA 1IN5A 3C7DB 1PFWA 2FPGB 4L4XA 1JHAA 2QGNA 1D4OA 3PJEA 5FBRB 2F7SA 4C7VA 1QPGA 3JYPA 1QKJA 5E38A 1SG0A 2X9NA 2FPIA 5F1OA 1V5IA 4O4HA 4BEWA 2A1IA 3FROA 3PRHA 2GN0A 4R6XA 4BHTA 3FHJA 4CM7A 2VYCA 3SVTA 3D4LA 4IILA 5FL3A 2Y0BA 1T6ZA 1X3LA 3EZXA 3SX4A 4YJ3F 2IS2A 1NHGA 2IIQA 2R1UA 5TSDA 1GSHA 1PJ3A 3NM4A 4LXYA 1Z33A 5L7TA 2ZITA 1H9BA 1E7QA 3ZLJA 4H0FA 4IIXA 3BH7A 1B6RA 2QUIA 1U9JA 4NEHB 2XMRA 2QBYA 2CXQA 4C6TB 1A5ZA 3H97A 4GYJA 2QRPA 5AXCA 4QPDA 2VFAA 4HBGA 3JQEA 2IKSA 3DMPA 1LJ8A 5I9LA 4M0LA 3F6PA 1L4BA 3W2TA 1WKBA 4PYMA 3F67A 3UMRA 1D4AA 1H1TA 3QEJA 2WW8A 2AFHE 3TJMA 3UA3A 3FSGD 1B3RA 1SH7A 1JDVA 2PMWB 1VPVA 3A1UA 2CVFA 1C3JA 4RTMA 4DR5B 2GPWA 3VSBA 5CITA 1LBIA 3PEEA 4XD2A 3SWWA 4LK3A 1QJCA 3ZCQA 2C82A 2GZ3A 1SKMA 4RH1A 1ULZA 4TS1A 2Q2OA 4WZBA 3NWPA 4R1TA 3E18A 3PQ5A 5KNBA 3LIPA 4HYTA 4PHGA 1XU4A 3BMQA 1Y3IA 2BTQB 1O94D 1PFYA 3BD8A 3GDGA 3T3GA 1O4WA 4J0GA 4RJTA 5F1PA 3Q0EA 4KN5A 1DKUA 2XJ4A 4D9EA