4CRWB

Complex of human ddx6 (reca-c) and cnot1 (mif4g)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
158
structure length
158
Chain Sequence
KGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation
molecule keywords CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 1
publication title A Ddx6-Cnot1 Complex and W-Binding Pockets in Cnot9 Reveal Direct Links between Mirna Target Recognition and Silencing
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 158
sequence length 158
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2014-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4crwB00
4YDSA 4MRRA 4JLKA 4M1SA 4LJ5A 1DELA 1H65A 2J7PA 2N46A 1YKSA 1T8TA 1DG3A 1S4QA 2B8TA 4B74A 3T1QA 2I4IA 4LY6A 2ZQ5A 5FTNA 3WBKA 2ZITA 3I5YA 1FQKA 3SYNA 4IOJA 1XCMA 1UDXA 1E2GA 4IVQA 2ODNA 4TQUS 3FHCB 3L0PA 3LX5A 2AFIE 5IF9A 5FTLA 2C95A 4ASUD 3HDTA 2J46A 2DB3A 2Y8EA 1WRBA 2ZI5A 3ZZUA 2CVHA 1Z2AA 2FX3A 1PV4A 3LW7A 1XTJA 3Q8XB 3LAWA 2GK6A 3M0EA 3BXZA 4Q7KA 4V0ME 2LCFA 3NDPA 2GEUA 1E96A 1KJYA 4YDHB 2CNWA 2IXGA 4WIAA 2BMDA 1A7JA 4F4JA 4XWKA 1FP7A 2YC2C 2QU8A 5KPJA 2XZPA 4LPKA 4PC2A 1ZW6A 1U98A 1JAHA 4P0TA 4YXWA 3P4YA 3LY5A 2EYQA 621PA 3KKOA 2RGEA 4QNRA 2F6RA 1YQTA 2JASA 2XSZD 1XNJA 2ZM5A 3B1ZA 3BH7A 2CL6X 3EPLA 2O0HA 1OKKD 2BKUA 4V0KA 2ATXA 3AVOA 4KI0A 1AQUA 1NVVQ 3RYTC 2W0MA 4KFTA 2QP3A 1ZM3A 3K70D 1NBMA 1NL3A 2XXAA 1MABA 2BVNA 2CLCX 1CR2A 1U8ZA 1UKVY 2R6FA 3QBVA 1X8LA 4AG6A 5KYKA 1Z6XA 3HR8A 1FUKA 2GCNA 3T5DA 1SVIA 3S1AB 1N6KA 1W1WA 3FDIA 4FMDF 3PR1A 4NU0A 4WXPA 3VKGA 2VF8A 3DMDA 5KOYA 2AKYA 4FWIB 2H16A 4LHWA 4A36A 2ZAOA 1GRNA 3KFXA 3CX7A 2WZQA 3QJYA 1XEXA 1W36D 3AVPA 2C2HA 4RCYA 2ZRHA 3C4JA 4M2LA 1NIJA 1II0A 1R7RA 2HEIA 4Q1EA 1P2VA 4ZI2A 1NKTA 2AXPA 1GNPA 4OQLA 4XH9B 3FMIA 1BIFA 2REOA 3A37A 1T4GA 2XAUA 2RGNC 3ZIAA 2ZUCA 2DWOA 1KO5A 3O8RA 1AZTA 4CT4B 5A5GA 4M1WA 3IDQA 2E1RA 2FH5B 4LV5B 1P61B 2QRZA 3JZAA 2W58A 1JR3E 2X77A 5DYIA 3AGQA 4MYUA 3CB4A 4S2EA 4A6XA 4URXR 4ABYA 5EUMA 1W5SA 2JIZD 4HDOB 3ZH9B 2IXFA 5G3ZA 3B8HA 3K0EA 2ODEA 2VHJA 2RH5A 3TBKA 1VG9B 2BWJA 3EARA 4GZMA 4TTPA 3QXSA 2G6BA 4Q9KA 3X2SA 1Q1EA 4OQMA 4Q47A 4JLNA 5AJWA 3NWJA 2P5SA 1CS4C 1JR3A 3GLGA 1L4YA 3QPVA 3W6NA 4Q7JB 3T34A 1QHHA 2D62A 2OLKA 2OT3B 4DCVA 3R7WA 2H92A 4NYIR 2Q9AA 2IYYA 1I2DA 3MFYA 1VYTA 1XJCA 3N70A 3EZ6A 4D0NA 3GJ0A 4JYBA 1XMJA 3O8BA 1TF7A 4OL0A 1AA9A 5JHGB 2J0UB 3P1JA 2JGNA 3C5CA 4M4SA 2XXAB 2DFKB 1M7HA 2YZ2A 1MABB 3OAAA 4HUQB 5JJIA 4LJAA 4Z8YA 4D25A 4IJMA 1M2OB 3B1XA 2FF7A 4FIDA 4U5XA 5E4FA 2OBLA 1RYHA 4LHYA 2JLQA 1W4CA 3GJ6A 2IEZA 3IQWA 3K0CA 3NEYA 1XD2B 1N0WA 2NO1A 4DLRA 5ELXA 1RE0A 4NP6A 3THOA 5KHOC 4ZI3A 4KFRA 3AUXA 1XCPA 3I4LA 5LB2A 1ESMA 3MWYW 2PJZA 1XEXB 4G5OA 1AJEA 1KAOA 5E7JA 4PPGA 1FNMA 5LPNA 4MKFA 2IUTA 4NTZA 2GZAA 3OEHA 2OO7A 1JPNA 2ECKA 5H1YA 2B7BA 2VTKA 2X2FA 1IXSB 2Q0HA 4B2LA 3FFAA 1IJFA 2YNMA 1T6NA 4LBYA 5CK5A 1XJQA 3SN6A 1F2TB 1GP2A 4QBGB 4LCBA 2WV9A 1U9IC 3U7EB 4D0GA 2GXAA 1AS2A 2D2FA 4D4LA 4M9SA 2AN9A 1D6JA 4I81A 3V4RA 1SKQA 1EFCA 4XOIA 3VR6A 4UNNA 2WWWA 5DI3A 5EE1A 2H17A 2JLXA 4WAUA 4EFLA 4TLBA 1XPOA 4C0BA 3THXA 2VF7A 4PSAA 3GFTA 5B30A 4MRSA 3B85A 1NVUQ 4TLAA 3IEUA 3IUYA 2A7QA 3IIJA 4DSUA 2V7QD 1OH5A 1RZ3A 4A8JB 4X8HA 3LWNA 5C46F 1KK3A 5L8VA 3CO5A 1HUQA 4W5JA 2RGDA 1CTQA 2VP4A 4QHSA 4BGDA 2HT1A 2CL7X 2DWQA 2R44A 2VSXA 1JR6A 3B1WA 1IN4A 3CRVA 1E2LA 4IRUB 2BKEA 4KLZA 2NO6A 2ZSBA 1OIVA 4NE2A 1QHHB 4C7OA 2BBTA 2XB4A 1HA3A 1YR9A 4OQFA 4M1KA 1ZM9A 4MRVA 2VP5A 4NCKA 5BN3A 1Z0KA 1TPZA 2IYLD 3BRWD 3NTUA 1VMAA 4NYJQ 4BLOA 2AWNA 1SKYE 3QI2A 3EC1A 4PQFA 2CHQA 3KTAB 4PSKA 4JLBA 2PT5A 2XTNA 4M22A 1TTTA 4TSFA 3NH9A 4IOKA 4MUBA 1QG4A 1Z8FA 1OF1A 4LDJA 3M6AA 2EFCB 4PPFA 4ZKEA 5LB4A 4BEBA 4QKQA 4DDWA 2YOGA 3K0FB 4B3CA 4G3XA 4OI4A 3NC0C 4KHZA 4QGFA 2PBRA 2FEMA 2O8BB 2ZUBA 2WMNB 1E1QA 2BMEA 3PENA 2RB4A 2J0SA 3FFBA 4CDGA 2FNAA 2VYFA 4RSGA 4TL6A 1GL7A 121PA 4QBIA 3FYHA 4DRZA 2RHDA 1Q1ZA 3LVQE 4W5WA 1TUIA 1GITA 2DHRA 5EQTA 4DT1B 2ZI9A 3RS7A 4G5GA 2JLRA 1G8FA 4L8GA 1S9DA 1ZIPA 2QAJA 3CNOA 2CMKA 1VHTA 4KODA 3SZRA 1T0JB 4JKYA 2R9VA 4FMCF 4HATA 4JSTA 4ACAA 3OF5A 3U60B 1E9SA 1Z22A 2ZTSA 4M1MA 4GFDA 4IEEA 1E4VA 1S8FA 4B6EA 2NIPA 4FMDB 3WXMA 4CRWB 1HT2E 1GTVA 1YJ5A 3A1SA 5FPHA 4TLEA 3UATA 3HPQA 1GZSA 2EWVA 2ZS7A 5BW8A 2QAGB 1J2JA 3DL0A 1HH4A 3T5GA 4EQ6A 3L0IB 1ZCBA 2GEDA 4OK3A 2ZE7A 1NG1A 4LX0A 3NVAA 3MLEA 2XEXA 3GEIA 1DE0A 4JL6A 1NMZA 4C7OB 4XVQA 2C03A 2A2ZA 2JA1A 1UBCA 4TT3A 4EJSB 1G6OA 1FTNA 2AD5A 2ZRJA 1SGWA 2C9YA 1CR0A 3G0HA 4BFUA 2D06A 1KMHA 4XTCS 3WNCA 3BC1A 3K9LA 4WZAE 3PJRA 1ETUA 2RHMA 4Z51A 2ZI4A 3OIWA 3EZ7A 2F9LA 2WWFA 1MRSA 3UWOA 3PCRB 4E5UA 2CE2X 1SVOA 3BJIC 3W3AA 3KJIA 2MMCA 2HXSA 4XWAA 2B21A 3T06B 1NMYA 4MITA 5FPKA 2GHIA 4ZCIA 2HYDA 1OB2A 2J5XA 3EW9A 2LKCA 4HAYA 3QOFA 1JI0A 1KOFA 2R6GA 1NN1A 4W5HA 4C4PA 1G6HA 2XX3A 1OYYA 1W49A 3TE6A 1Z0DA 4Z54A 4HAXA 4AKEA 2DYKA 4QC2A 3PXGA 3KKMA 1U94A 4OQNA 4AK9A 3ADDA 3ASYA 3VU9A 2O8FA 5ANRB 4ARZA 4ON9A 3RANA 5AUQA 4LJYA 1VCIA 1QVRA 4G1UC 5BN5A 3D7MA 3UMFA 2FSGA 1NBMD 1BMFA 1G21E 1TQ4A 4ZO4A 4CT5A 1JEDA 2ZR9A 3OHMA 1G4AE 3OFNA 4W7SA 2Q3MA 1W0KA 2VP0A 2VQSA 1W0JA 2XJ9A 1ZUHA 2V4ZA 2G0NA 4C0SA 1B0UA 1YHNA 3FHOA 1H8EA 4BFYA 4BFXA 1KYIA 1QHGA 4EPXA 1OT3A 2QBYB 5SZHB 1EXMA 1E79A 3C7KA 5IT5A 2IT1A 1ZD8A 2GF0A 4PZZA 1YE8A 1VCNA 2HF9A 3BFKA 3LLMA 2A3RA 5CB6A 3RS5A 4KYIB 1KDRA 4UXJA 5KNDA 1PZNA 3IO5A 2ZSEA 1T3LA 2W6JA 2ZYWX 1KDOA 521PA 2AK2A 3I92A 4PANA 1W46A 4A9AA 2IHBA 3THYB 2ZR0A 1Z0AA 4NYMR 3U44A 4URYR 2ZE5A 2AX4A 3QF4A 2EFHB 2QP4A 2ORWA 2F1IA 1F3OA 5IHPA 3ZVNA 3GJ4A 4JVLA 4DLTA 1G7RA 5K8LA 2FA9A 2O8CA 4TQ9A 1ZD9A 1R2QA 4V0NA 4FWTA 3NBXX 1D8TA 3IGFA 1E1RD 1YR8A 2Q21A 1O3YA 4BZXA 2DR3A 2RAPA 3CRMA 4HSEA 1G41A 4WW0A 1S9HA 1M74A 1NKSA 4TYQA 4UNRA 1ZCAA 3A4LA 3BK7A 1EG7A 1Z6TA 5DH9A 5FBVB 2ERYA 4LJ7A 1OFHA 4DXAA 1AN0A 4I99A 1ZVQA 2BC9A 1KSGA 2ASEA 4LJ6A 3VU9B 5JEEA 4LGMA 2ZS9A 4Q4AB 2ORIA 2P2LA 1WBBA 2A30A 3QEOA 1XZQA 4A2WA 1U99A 1CU1A 5JBQA 2IYWA 4ERNA 2FFAA 1DTSA 3TAHA 2VBCA 3OAAD 4DCSA 2OXCA 2V1XA 2RGNA 1K5GA 4OHWA 3SQXA 1R0WA 3SYLA 1S2MA 2ZJBA 4MGKR 5FOVA 2IWRA 4XIGS 1G17A 1J99A 1W5TA 4BECA 1Y3AA 2OAQ1 4XD7A 1R0YA 1KSHA 4GT1A 3P4XA 4TMKA 1ZM4A 1E4YA 1XEWY 2IXEA 4AIIA 4QJ3A 1ZUNB 4HLUC 1OE0A 3WMEA 5IDVA 3F0TA 4Q4JA 1A1VA 1JECA 3ND9A 1Q1BA 2DPXA 1OFTA 1X6VA 1Z07A 2QNRA 4BPBA 1FQJA 1TU4A 3N2IA 2BBWA 1ZD1A 3ZD7A 2IW3A 3I5XA 2PX0A 2R65A 2YC4C 3LQQA 3UMRA 1OFIA 5L3QB 2HYIC 4B71A 4MA4A 4DWJA 1LVGA 1E2MA 3ICEA 3SI7A 5JCZA 1E2JA 1HURA 4HEJA 4C0LA 2VP2A 2QENA 4RY2A 2FPKA 4FMCB 1YU9A 2FSIA 3DPUA 3WRXC 5EP2A 3ZZTA 1NVVR 2CVFA 3OESA 3GD7A 5A4JA 1LFDB 2IYSA 3CUEF 2ERXA 1XB2A 2QROA 4B3BA 5J4KA 2QP9X 2W2TA 1EX6A 4M0LA 4QFMA 1CP2A 1E0KA 2WOOA 3P20A 4RKEA 4CEJA 3U7FB 2OFOA 4DDTA 1ZM2A 3DZ8A 4DDUA 2O8CB 3KQHA 3EZ9A 2JLVA 4P4SA 1YR6A 1P2UA 4DEXA 1J8YF 1TEVA 2ZRNA 5EXSA 2JEOA 4DBLC 3QKUA 2CL0X 3VR3A 1VDZA 2YOHA 3SQWA 3IHLA 3A1TA 1DG1G 1KI2A 1QZXA 1BS1A 5HKKA 1UKYA 1R8SA 1F48A 1Z83A 4XSHA 3LQRA 2F9MA 4OYHA 4IDHA 4NH0A 4NCNA 3PFIA 1FP6A 1L8QA 4KBGA 4QGGA 4DZZA 4DLZA 2EFGA 1CJUC 2VLIA 1NSTA 3A36A 3IKJA 1J90A 1IAQA 5DN6D 1DBSA 1FX0A 3WP0A 1KSJA 5CITA 2JLZA 4A15A 4NHOA 4YC7A 3AGPA 3NH6A 3CH4B 4Q1BA 1I4TD 4F38A 2P5TB 4Q4JB 3BGWA 3PITA 5BWMA 4QL3A 1E2HA 4O2RA 4CW7A 3H0KA 1LF0A 1DPFA 2FN4A 3SJZA 2YVUA 2QRNA 2WWHA 4PC3A 2JLSA 2QE7A 5FFMA 4TMTA 1KI8A 2RGBA 1W2HA 2V6IA 4JMPA 5HTKA 1KJWA 2FZ4A 3VHLB 1T91A 1N5LA 2CLSA 4DCUA 3OIYA 1GM5A 5E7MA 4L9WA 2E9SA 1N3BA 1GFIA 4IXMA 4A82A 3TVTA 1U90A 2ZANA 4L15A 1N6RA 2H7VA 1UFQA 1KI3A 3FE2A 3I3SR 4GOJA 4UNQA 5L3VA 2OCBA 2WSMA 2A78A 2EFDB 5BN4A 4G0NA 3ADKA 4MQBA 2CJWB 1ANKA 3AF3A 5F9HA 2DFLA 2NZJA 1J8MF 3CPHA 4L9SA 2QSYA 1LF5A 2XNSA 3LVRE 4EPRA 3X1WA 2ZR7A 3GLFE 4ESHA 5KPDA 3KXIA 5KSOA 2YKGA 3U6KA 1NVXQ 4RFVA 4ZDIA 2OBNA 2AHOA 2G1KA 2QI9C 1NLFA 3TR5A 3BBPA 3DEFA 1SXJD 3VFDA 2D7DA 1XU4A 5G3YA 4AC9A 3X1ZA 3J81k 1OPXA 4KBFA 4TQAA 4DSNA 3B78A 2WJHA 2Z4RA 4TL7A 5EXXA 1N6NA 5FOUA 2R6CA 3TUZC 1YR7A 4I1VA 3GLFA 3S1AA 4YONB 3CLVA 2VHQA 4PR0A 1QHIA 2FSFA 1Z28A 2GAAA 3O8DA 2F3TA 4JLOA 5EJEA 1M6NA 5JEDA 2IBMA 1MO3A 1KY3A 1H8HA 1Z0IA 4BFVA 4D6PA 2N1BA 2QPAA 4LBZA 4QBFA 1FX0B 4X8MA 1KZ7B 1RJ9A 1G7CA 1NVWQ 2W0SA 1NI3A 1G8PA 2VL7A 2IA5A 3IHWA 4IOLA 5AUOB 1J70A 1XWIA 4QHYA 4A6PA 1SHKA 4OBEA 2EW1A 3U4QB 1NJFA 4IOMA 3SR0A 5CK4A 3DDCA 3SEAA 4V02A 3H84A 3ZD6A 4UNPA 1IXRC 1KI6B 5AUNB 1HTWA 4OKSA 3FKSD 4DIEA 2C96A 4KSBA 1UBFA 3K0SA 1G4UR 2NOAA 5FBRB 4LZZA 3TMKA 4V0MA 4M9XA 1CKEA 5JJLA 1AGPA 1RW4A 3A8TA 5JMTA 5TY0A 2WKQA 1G18A 1U0HC 3REGA 2QM8A 2IS6A 2OCYC 5FUYA 2B8WA 4Q1AA 3T15A 3GPLA 4C0JA 1W0KD 5UKDA 3F5FA 2BM1A 4IVPA 2O8EB 3QKSB 1G5TA 5DYGA 5EP4A 5EP1A 3K70C 2WPDA 5FUVA 4DUGA 1E2EA 3GP8A 1D5CA 2ZYVX 3I32A 4IDPA 4NCHA 4NCIA 2ONJA 4C0AC 2AR7A 4PC1A 2VHUA 2J0UA 1JEEA 3I73A 1AS3A 2JJ8A 3EZFA 4HUQA 4B76A 1G64A 1E79D 1VYVA 2GETA 4Q9JA 1ZMXA 2ZROA 4FCWA 3ASZA 1W44A 1JNYA 4MGZR 3GLFB 1XD2A 1M34E 3P26A 1PLLA 3TJZA 2X19A 1HEIA 2DBYA 3C8UA 1W36C 1QHSA 3EWSA 1HY3A 5JZVA 2PZFA 2FZLA 4B3DA 4PO8A 3U7HB 2VSOA 2PCJA 3IBGA 4LC0A 2O8DA 3OEEA 1DADA 3RRZA 3QSYA 3ICQB 2KWIA 2OZEA 3EAQA 3HYTA 2ZRAA 5FL7A 4IKEA 1E9EA 1RJ9B 4JYCA 1X1SA 4FW9A 3PEYA 5J4YA 3QKRB 3W3ZB 3FMOB 5JFGA 4DLWA 3SNHA 3BFVA 3HU1A 3M1IA 2J7KA 3OIVA 1F2TA 1N5KA 3RAPR 1Z47A 4WOPA 2GCPA 2WTUA 4QNMA 1RVDA 3CF6R 2IUSA 2FJUA 2P3SA 1FMJA 2QTHA 3U7GA 1AGRA 2ZSAA 3B1YA 2XNDA 1Z63A 3KXKA 1EFRA 4OI1A 2C99A 3PUWA 4PSVA 2NO7A 5JWHA 4ZCLA 4U02A 5FPTA 4PXAA 4Z8XA 2XB2A 2QMUA 3Q5EA 2ZUDA 821PA 1YZKA 2VRWA 4A8JA 4B2PA 1HT1E 4WZ6A 4Q7LA 1G8YA 4B3GA 5JJKA 2B7CA 3VR1A 3SHFA 1M1YE 3KB1A 4Q19A 4Q5IA 1CJMA 2J1LA 5KNBA 4HI0E 3DOFA 2BEJA 4HAZA 5E7IA 4XD7D 2GESA 2HJGA 5KDOA 4P33A 3FPAA 2PZEA 3ZS8A 3CPEA 4Q7MB 1WDTA 1ZIOA 4A0RA 4XTRA 2WJIA 4V03A 3HU3A 1QRAA 2ONKA 2P67A 4XJXA 3PQCA 1AKEA 4JKIA 1IY0A 5KU1A 4ZDKA 2R62A 2G9NA 6Q21A 2UKDA 2DY1A 4LV6A 1KKLA 4RVCA 1ZC3A 1IN7A 3V4FA 3RDPA 3TQFA 1N6HA 4MGYR 1OJLA 4QXAA 3RS2A 4BFSA 2WOJA 1S3SA 1TF2A 2ZRKA 1Z06A 3KTAA 4B75A 3KQNA 1XD9A 1EFTA 1IXZA 4EPTA 3LD9A 3RRYA 1VIAA 4YLGA 221PA 4OHZA 3R8CA 1DAEA 1P75A 3IILA 4POAA 2A5YB 2ZJ5A 2X2EA 3C16C 3GEHA 3K0FA 4OJQA 4DEYA 1G7TA 3QPUA 4GPTA 2XOKA 5DE3A 5BQ5A 2O8BA 1CJTC 4JLAA 2OBMA 2WBLC 1KO8A 2O8DB 3SU8A 1SQ5A 2HV8A 3CX6A 4TL8A 1OB5A 4HDCA 4C30A 4ILEA 1QF9A 2RKOA 3RS4A 2HUPA 1UEIA 5FR2A 3QXJA 2ZRMA 3WBJA 5B2ZA 4A1FA 1ZU4A 1U81A 1IM2A 1XTRA 2G77B 2YYZA 3ZJYA 3G5UA 4BFTA 1NSFA 4DT1A 4O3MA 4TWZA 721PA 4M1YA 3CWQA 4CEIB 2WWIA 4BLPA 5FTJA 4BEJA 3GQBA 3VKHA 3MCAA 4PPQA 2NPIA 1GRQA 2F43B 3LA6A 2IS4A 2WHXA 1E0AA 3B82A 4WBSA 4MKHA 2QSZA 5HKKD 1WBDA 1HV8A 3EIEA 5SZJA 3SJCA 1P9NA 1LY1A 3KUDA 1ZAKA 4US2R 2AKAB 2OESA 1KO1A 1G20E 2BMJA 2WSSA 2ZJ2A 2QAGA 1SHZA 5HE9A 1E6CA 2V6JA 3R20A 4JZKA 1CJVC 5GVSA 3Q72A 4LHZA 3ADBA 5G40A 5JWOA 4O2LA 1ZJ6A 3LV8A 2UVQA 2JLWA 4C2UA 2EU8A 3SFVA 4HAWA 4EJSA 4KSCA 3BH0A 2QA5A 3WMFA 2G88A 4YMTA 1ZM7A 3GLIE 1D2NA 2OILA 3OE7A 4D4JA 5CYPA 3VQTA 2MSDB 3ZQJA 2B6HA 2BCJQ 2ZRGA 1Q22A 2NZ8A 1PVOA 3AF0A 5EXTA 1WQ1R 2FE4A 4JVSB 3AVQA 2GCOB 2MMGA 1COWD 2QE7D 1EFUA 4LYHA 1IOZA 4JLVA 3CKLA 1U2RA 1G9XA 1CRQA 1N0VC 2Q6TA 4LC1A 2PH1A 5IK2A 5BXQC 3C14C 3GLIA 2A5GA 4LWZA 4EPVA 3ZYCA 3KZ1E 3JVUA 2Q3HA 3H4MA 4Q4LA 1YRAA 1XMSA 3PVSA 1XF9A 4LHVA 2KBFA 2IYZA 3TR0A 4H1UA 5JSZB 2GNOA 4JLPA 4RCZA 5E3HA 1G7SA 4TYNA 2EVWX 1E98A 3K53A 4PZLA 4TTQA 2ZJZA 4JBYA 1VTKA 1Z2CA 2KJQA 1LW7A 2R6DA 1V43A 2R2AA 3CBQA 3Q3JB 1WF3A 1EK0A 1KKMA 5CIQA 5CLLA 3DZDA 2ZEJA 2JDIA 4PAOA 3GJXC 3OIUA 2VHTA 4A4DA 1IONA 2OCAA 1VECA 3EPKA 2O5VA 4B6FA 5AJVB 1R0ZA 4LHXA 4QGHA 3L82B 4EPYA 2ATVA 3QKTA 2ZRPA 4Q9LA 1K5DA 2J7PD 1R4AA 5KO2A 3AP3A 1T3HA 2H1LA 3KKNA 4URZR 4S35A 4NBSA 1GNQA 2IWHA 1IHUA 4NL4H 2GDJA 2BMFA 1C9KA 3HU2A 1V5WA 4R98A 1H8HD 5J47A 1SXJE 4QJ5A 2QBYA 2ZVQX 4UXHA 4GNKA 2O0KA 1XJ0A 1GILA 5CDFE 2EYUA 4RD3A 4YQFA 3GFPA 1IN5A 2JCSA 4IHQA 4QRHA 4U00A 5DNYB 4OHYA 3THYA 4WVFA 1Q20A 5H68A 5F9FA 2BDTA 4PFSA 3T61A 1E9CA 1UKZA 1WXQA 4RZ2A 2CNWD 5KNCA 4G5QA 3DMNA 1OXSC 2XTMA 4GZLA 1W4RA 3FHTA 5E95A 2CDNA 2GVZC 1UF9A 4OK6A 1PUIA 3OZXA 5CDFA 2GILA 1CJKC 2ZI7A 3D31A 4Q9HA 3GLIB 1TUEA 3LBHA 4B44A 3ZS9A 4GBMA 2IF2A 2A5FA 3IQXA 4YXWD 1JQJC 2NGRA 2JJ1A 3WRYC 1JQLB 3B13B 3K0AB 4TZ0A 4OK5A 1SKYB 5FPSA 1VKJA 3H2YA 4EUNA 4HLDA 2KBEA 3QF7A 1UKEA 1R6BX 4G01B 1E3MA 5FOSA 2ZYTX 1E69A 4Q48A 5A0FA 2WIBA 1OV4A 2MSEB 2Z4SA 3RWOA 2BIFA 3K9GA 4NYIQ 1TQ6A 1VPLA 5HPYB 3A4NA 2EQBA 2QPTA 4Q4AA 4UJ5A 5CYOA 4ASUA 1ESNA 1JJVA 5DHAA 4BZQA 4W9MC 1TF5A 2PX3A 3K09C 1T9HA 1WMSA 3R9WA 1F5NA 3ZVMA 1F6BA 1ZC4A 2JJ2A 3TW8B 2VPPA 5KUTA 1BH2A 4RD1A 1N5JA 3MMPA 5FH9A 4TMWA 3TSOA 3KKPA 4LI0A 5FI0B 3EASA 3MWJA 1I4DD 4B35A 1KTVA 1WB9A 3KB2A 4WA7A 3UG7A 4QM7A 3E1SA 4AWXA 3LXRA 1GUAA 1KZGB 4KFSA 3I62A 3RS0A 4KLNA 2XJ4A 2OHFA 4HYYA 1II9A 3NC1C 3TUJC 2V1UA 2K5UA 3Q5DA 3AKDA 1JBKA 5AUPB 1NLYA 5L3QA 3LW8A 3AF2A 1W7AA 1FMLA 3KKQA 3N2EA 4LSGA 1OW3B 1A82A 2F1JA 2IYQA 1Y63A 3CZQA 3ZIAD 3KXLA 1A5TA 1G8HA 1NN3A 1ZNXA 3RSOA 5LDDC 4US1R 4M21A 3B5JA 4M8NE 2GA8A 1CBUA 1R0XA 2WMOB 2ZAMA 3CR7A 2Z5FA 4FN5A 4BQSA 4DDVA 1VCMA 3SC3A 3K1JA 2XNDD 4GSYA 5AWFC 1S3GA 1XFAA 1KMQA 5GADl 1PJRA 2OUKA 1S1MA 1DOAA 3GFOA 3UK6A 3V9PA 3WY9A 1SVLA 5C4GB 4URUR 1XEFA 4BZPA 5LD2C 4BLSA 4KFUA 1QBKC 1Z6YA 2GRJA 5HR5A 2PEZA 1DEKA 2ZJAA 4FCTA 1G3MA 3O8CA 1JR3D 1HQCA 1DAKA 2QMEA 5CB8A 3AP2A 1LNZA 3KFVA 1OXUA 1SZPA 3ETLA 3PEVA 2FSHA 3CWZA 4GDFA 2P65A 3SJBA 4LBWA 2ZJ8A 1SVKA 4JLMA 1HYQA 2IYXA 1UEJA 3FGNA 2ODWA 5D3QA 1TAGA 2CCJA 2QT1A 5FTMA 1Q12A 1ZNYA 2GBLC 3AVVA 5DIFA 3FVQA 1GKUB 4R71A 3K0CC 4V0OA 4XWOA 1ZYUA 3TH5A 2ZU0C 1M7GA 3WHKA 2GF9A 3KJHA 5FUXA 4D2IA 3A1WA 1N6IA 1QVAA 1Z0JA 5HCIA 3CZPA 3T1TA 3GJ3A 1KSFX 1FNNA 3HP1A 3WNDA 4RD4A 1P9WA 2BOVA 2W2VA 4DB4A 4URVR 1NNEA 1E9RA 4TYYA 3PUXA 2QT0A 1Z6GA 2VA8A 2YWGA 3BE4A 4NCJA 3OEHD 1D2EA 5L3RA 1G19A 3VR5A 3QXXA 1NG9A 4DSTA 1Z08A 2EWWA 4QGAA 1ODFA 4PQRA 5DSZA 4K8OA 4Q00A 1RRCA 3U3OA 4GOKA 5GVRA 5TV2A 4DSOA 4BLRA 4MGIR 1OFUX 1QHYA 4C9BA 2G83A 5D3MB 4CIDA 3BWDD 4DLUA 3K70B 4LYJA 1UBGA 1QHXA 3E5HA 2KSQA 3TW4A 3MD0A 2WKRA 2CJWA 4I1OA 3WYAA 1ZRHA 2OM2A 1X8KA 2YOFA 4BWYA 2OCPA 1ZU5A 2BJVA 3I8SA 4K81B 1AK2A 5F98A 4JIMA 2WSSD 2BEKA 5TARA 3F8TA 2V9PA 4XVUA 4KO8A 3R9IA 2CK3A 2YWHA 1W36B 2RGGA 4A0HA 1T5IA 1NF3A 2ODBA 3GMTA 3MG9A 5FUWA 3AVTA 3NBFA 2C78A 1LTQA 2BJWA 3L8ZA 2YWFA 2ANCA 4D4MA 2FEOA 3OE7D 4MYTA 2VHCA 1QHNA 2V54A 1FFHA 1DAHA 1P3JA 3FKQA 5SZKB 4BRWA 4AYWA 4KVGA 1CLUA 2FDCA 4LJ4A 2WM9B 1FZQA 3JZMA 4TSFD 4OI2A 1U9IA 1Z6AA 3K9NA 1XRJA 3B7GA 2WJGA 2F7SA 4PO9A 3WP1B 5IK2D 4TYWA 3HJNA 4DLVA 5P21A 1B23P 4DVGA 3Q85A 1K6MA 3CIOA 1W4BA 2ZPTX 3B2EA 1Q1QA 2V7QA 3K8YA 1E1QD 5DGXA 1N0UA 3U4QA 2HDNB 1QDEA 3GJ8A 3GJ7A 1Q57A 3DKPA 4IEIA 3DM5A 4E09A 2VP9A 3HR7A 3UG6A 1KO4A 1KI6A 4HB0A 4ZIRB 4A2QA 1KK0A 3W6PA 3ZQ6A 3FTQA 2IYVA 3SBDA 1AM4D 2IUUA 4YMUA 4R7ZA 4Q01A 2IK8A 4AYTA 3T12A 2KE5A 3RC8A 1EX7A 1I4LD 3FWYA 5JI2E 1OYWA 2JDID 4RD0A 3IIMA 4GMXA 3W8RA 1N2CE 4MH0R 3PEWA 2R6AA 5KDDA 5JS7A 2REXB 3QPWA 4AY2A 3NBZC 2O8EA 2C77A 3ECCA 3QKSA 2BBOA 2QMOA 3BB4A 1KK1A 3CONA 5TDHA 3WHLA 1Q0UA 1SXJC 3KQLA 5BYKA 4E07A 1G3RA 1KI9A 4JT2A 4GOXA 5EP3A 4ZCMA 2ZVPX 1CF4A 1FW6A 2PLRA 4FINA 1E9DA 1DS6A 1SVSA 5K8IA 4C2TA 3TUIC 4R9UC 3FMPB 1NP6A 1XZPA 3CRQA 4CVNA 1G3IA 4TT3D 4FD2A 1E2PA 2QG6A 4RFSB 4LK2A 2XGJA 2QZ4A 2AD1A 5J4HA 4B32A 3MWKA 3UIEA 1UBEA 4KCGA 3TVDA 3AQ4A 4HAUA 1US8B 2OLJA 1NN5A 4NYMQ 3A1UA 4N3NA 3A58B 2GZHA 3X1XA 1MR3F 1XDBA 2BV3A 1VIYA 2GAOA 2C9CA 2P6NA 4HB2A 2Z6VA 1YVDA 4IW3B 3MAAC 1E0JA 3CH5A 1LB1B 3I72A 5HZKA 2FWRA 5KSZA 4P32A 4Y0VA 3QKRA 1A2BA 4UXIA 4JS0A 4Q02A 2A5JA 2JJ1D 3PEUA 3NKVA 4QM6A 1S0UA 4M1TA 1JXMA 3VX3A 3GEEA 2QY9A 3ZVLA 4N0EA 2D4HA 4PAMA 3E2IA 3NHBA 2WICA 4BASA 1YZGA 3BERA 4D0LB 2J87A 2IYTA 2ZE6A 1CEEA 2QGZA 1P4SA 3P32A 5GJCA 1RRGA 4AYXA 1PLJA 4B48A 2DCUA 4F4IA 1DAGA 3A6PC 3THWB 2GXSA 5CM9C 1G8GA 2Z0MA 5KDLA 5K8TA 1BMFD 3AVUA 4NYJR 2JJ2D 2C5LA 4PTLA 2CEAA 1TU3A 3L0OA 3OFND 3ZLJA 3AF4A 1T3SA 3ZVRA 4F92B 2LKDA 1E2FA 1UDWA 2CE7A 3AKYA 4NDZA 1W0JD 3IBYA 1RFLA 1GVNB 4OHVA 4URWR 1AZSC 5LBIA 2QL6A 5JRZA 2ZS8A 2JATA 4IDNA 4PZYA 8OHMA 2BM0A 1H8ED 3LLUA 2Q9CA 2GKSA 2YWEA 2YV5A 4M53A 4MKGA 5F2EA 4BRUA 1KIMA 1U0LA 3IEVA 3BH6A 1VCOA 3DHWC 2GJAA 1NBME 3L0SA 4CYMA 2GJSA 1P7CA 3QENA 3Q7QA 4PC6A 4DHEA 2QM7A 1RC8A 1MKYA 1RKBA 3LRPA 4PAQA 4ZPXA 2P0EA 2W6JD 1CRPA 4PHTA 1E2DA 4Q1FA 5JSZA 2FMXA 2RGAA 4WXRA 1GKIA 1Q3HA 2YJTD 3K9HA 3BOSA 1ZBDA 3TQCA 3Q7PA 4HUTA 5K8UA 4BE7B 1JALA 3RC3A 2E87A 4RJLA 1N6OA 3K09A 1A2KC 2RCNA 2NQ2C 2W83A 1JJ7A 1FUUA 2QEQA 4KITB 5B58C 4D26A 3X1DA 4DCNA 2XZOA 3CW2A 3U3JA 2NPFA 1R5BA 1XX6A 4B47A 2QN6A 4CEIA 2ZJOA 1TMKA 2HLDA 2WWXA 2GK7A 2H8KA 2IYUA 3RWMB 3N5CA 1GKYA 1RYFA 3CNLA 1VYUA 4DKXA 5TMPA 2F43A 1XPUA 1Q21A 3AEZA 1VHLA 4D4KA 1UM8A 3BB1A 1VG0B 3HWSA 3MSXA 5JI3E 3VR2A 2D3WA 1PUJA 3T1VA 2LWIA 1AKYA 2OFWA 4CZ2A 1II8A 1IBRA 4TMXA 1JPJA 2VIIA 3SE0A 3AKCA 5C1BA 4TMZA 3UKDA 2PMDA 2ZREA 4L4UA 3A1VA 4B2IA 2D2EA 2HXYA 4C0QC 3QVUA 1W4AA 3UMSA 3LO5A 1J7KA 3KX2A 3GLGE 5FOXA 3BS4A 4AI6A 4K46A 4MUAA 4LYAA 1MV5A 3UANA 3U2QA 4UKDA 3WYGA 1UJ2A 3LDAA 3VNVA 4X8LA 1P9RA 1NJGA 2UZIR 4KVAA 1E9AA 4GI7A 2AL7A 3M4YA 2VP6A 4PO1A 1E1RA 1TEXA 2WWYA 5B57C 2PT7A 5EE9A 2FPLA 3EG5A 4NPHA 5B64A 4OJKA 2W6IA 2GCOA 3TSWA 4TYPA 3U5ZB 1E2QA 3P27A 4JLJA 4IDOA 4M9QA 4PHHA 2OG2A 4IVRA 1XD8A 4I1UA 2J3EA 3LXXA 4DJTA 3FB4A 2IF0A 3QY0A 4LRWA 3NG1A 4EDHA 2WAYA 3IPYA 4F93B 4HDQB 2G3YA 2OFXA 3U6BA 1QG2A 2IS1A 1Z0FA 1CULC 2QMHA 4G5SA 4BFWA 2A9KA 2IL1A 2WIAA 2NG1A 3RSLA 1G16A 3QEJA 4B3XA 2I3BA 4JVMA 1WP9A 2GXUA 1R5NA 3BORA 1MOZA 2GBLA 1YZTA 2I1VB 3TIFA 3B9PA 5CJPA 4QHTA 4U7DA 3AVXA 4A0FA 1OH6A 3WNBA 2KI5A 1YZUA 1GNRA 2REBA 5HCNA 1P72A 3AF1A 4HLUA 5FI1B 2CK3D 3L8YA 4LYFA 1CR1A 3SYKA 2J0QA 4IDQA 5G53C 1DO0A 1OXTA 5FTKA 1KI4A 2AXNA 3SFZA 3PUVA 1OH7A 3EPHA 2HCJB 3AVYA 3AV0B 5J4VA 1E9FA 1S96A 2V3CC 1GOTA 1II8B 1OIWA 4FMBB 3ONWA 2CCGA 2FFQA 3L2OB 5KTYA 3H1TA 1DAMA 4RD2A 3W5IA 2FPMA 2Z83A 3B9QA 3DOEA 4UQOA 4HAVA 2EFEB 4EKDA 2J9RA 1MRNA 4KU4A 4B34A 2A5DA 3CF2A 3Q9LA 1GWNA 1U0JA 1OH8A 1TNDA 2D74A 2J41A 2ZRCA 2C9OA 3LFUA 1D9XA 2HT6A 4JBXA 4RZUA 5L3SA 2QQ0A 5LD2B 3E70C 3REFA 2C8VA 1GAJA 2FGKA 5J5CA 1XTKA 1G1MA 3GLGB 4UJ3A 3EPJA 2F1HA 4DUGD 3BB3A 2ZRDA 3FMFA 3PUZA 3R7WB 5GJWC 4B33A 4M9ZA 3NXSA 4AKHA 4X8OA 1MO5A 1G3UA 4EIWA 1CXZA 1O87A 5KSYA 3K0AA 1D2MA 5EE0A 1X1RA 4TN1A 1AIPA 1KI1A 4GRAA 4E22A 2WAXA 4MRPA 4LBVA 2XITA 5DISB 2ZXUA 1KDPA 3EXAA 4F91B 5HE8A 4LPSA 3B1VA 4ZDWA 421PA 4JLDA 5DN6A 2BCGY 2GWHA 4V0LA 1KNXA 1E0SA 4TMVA 4HLCA 1OHHA 3W34A 4JJKA 5DI9A 3QVVA 2OSBA 2YINC 5CIWA 3RS3A 4QG7A 5JRJA 2VH5R 5EE5B 1T8UA 1E32A 4B3FX 3UWKA 2CHVA 2OAP1 3TGPA 4EFNA 1HE1C 2KB0A 2NO9A 3MRSA 2IC5A 5CJ2A 3QXHA 2RGXA 3SJAA 5H70A 2FOLA 4JSYA 3CPJB 3I61A 4OQXA 3WMGA 2XTZA 1MO4A 4D81A 1P2SA 1Q3TA 3VR4A 5JWRA 3CRRA 1G5RA 1UADA 1T0HB 5FR1A 3KUCA 1P73A 2TMKA 2BHRA 4RZ3A 3W9YA 1NY5A 2DWPA 3NEJA 2R8RA 5FBWB 4EPWA 3AM1A 5DI3B 4MDFA 5HZHA 1M8PA 3KL4A 4Q21A 3QXCA 1GDDA 2V55B 4KJZA 1R5OA 2HJVA 3THXB 1X86B 1L2TA 2GXQA 1TQDA 5JS8A 3AUYA 4DLSA 4US0R 1XXHE 2VO1A 3DO6A 5TB5A 4MDEA 4GL2A 5L3SB 1FTSA 3IO3A 1ONBA 4PPNA 4Q1DA 4DCTA 3SS8A 1F2UA 1SXJA 3EC2A 5BYJA 3AH8A 3QG1A 2FFBA 4KXFB 3RRMA 2W2XA 4YMWA 1OIXA 1SULA 3H86A 4Z1MA 3PUYA 3QG5A 4TZ6A 3CX8A 2WJVA 4LV8B 4C0KA 4BUJA 2F55A 3EZ2A 2PL3A 1U8AA 5GJBA 4UNSA 1XXHA 2CHGA 1ZUIA 1ZNZA 2QQEA 4FI3C 4AD8A 3CR8A 3VMFA 2DFTA 4BFZA 2O0JA 4O25A 1EWRA 4NKRA 4HB4A 2WWGA 3R9XA 1AQYA 3NDBB 2GEVA 4NONA 1WCV1 1XPRA 3PIRA 3PV0A 2WPDD 4QOSA 1NMXA 2ZSFA 4RKFA 1Z5ZA 5GJVC 1ZNWA 2ZETA 4MYCA 5AK0A 3IIKA 1NN0A 3TLXA 5JCPA 1CR4A 2WKPA 5AJYA 3T1OA 3BAFA 1E94E 2AK3A 1LV7A 3G82C 1IY1A 4P4TA 3TSZA 1N5IA 1XTQA 2IHYA 1JXOA 1XCGB 1U8YA 2OXRA 3QBTA 4L16A 3EIHA 4WZBE 3VNUA 2CXXA 1N25A 3CM0A 3UXMA 1XTSA 1YRBA 1K8RA 4Q1CA 2HF8A 3FKSA 5AJXA 2ZE8A 5CLQA 4C0HA 1GL6A 1KY2A 4DLYA 4DB2A 1YZQA 2PEYA 3BD9A 2NTYC 5EXPA 1MT0A 4I1SA 3JVVA 1WE2A 2F1RA 3AVWA 3U3RA 5DHFA 1S1CA 4P31A 5AR1A 2CBZA 3OEED 2XSZA 4BLTA 3V00A 2ANBA 4JJZA 2ORVA 3VHXA 2QGNA 5FL7D 4IFEA 2ZU6A 1RIFA 3LH5A 5EZ5A 1OLOA 4HLQB 1D9ZA 3NHAA 2HCBA 1OKKA 2I1QA 1MH1A 3D3QA 1SVMA 2X1VA 3SBEA 1DAFA 1R10A 1WA5A 3VX4A 2GVDC 2DFNA 3SOPA 4A0GA 2FGJA 4DC9A 2NO0A 4PHFA 2HLDD 2H57A 2P6UA 2QORA 3C5HA 3CF0A 1NLZA 5D3MA 1F2UB 1SXJB 1EGAA 5J4LA 3BIFA 4EQ6B 1HQYE 3AKEA 4A2PA 1JB1A 1XTIA 1NY6A 4MYHA 1BKDR 3ZDQA 1EFRD 2B92A 4LJ9A 1OXVA 1SVWA 1IJEA 3QE0A 3I1FA 1Z29A 4JVNA 5JECA 3X1YA 4A8JC 2C04A 1DO2A 2J59A 2ZIAA 4JL8A 2GJ8A 1ZINA 1XXHB 3CRW1 2FU5C 3DKVA 3MJRA 3MGCA 5JLJA 1TADA 4ESVA 2NMVA 2IEYA 1E2KA 1KMHB 1Z3IX 2SHKA 1OSNA 5TXGA 1A4RA 3QQ5A 1GSIA 4AG5A 1ELOA 2IYRA 2PZGA 4P4UA 1GG2A 1VG1A 2ZRLA 3ZGXA 3L43A 2AWOA 2MSCB 3I8XA 5H8WA 3B6EA 4C3ZA 5FOWA 4DLXA 1KNQA 3D8BA 1G5PA 1IN8A 1PLKA 3TRFA 2P6RA 2O52A 3UPUA 4Q4HA 3DM9B 5EZ6B 2JAQA 1KI7A 1R8QA 2ZI6A 4RZXA 1BYIA 2GJ9A 4A92A 3TNFA 2OV2A 3QNUA 3IPXA 2W6ID 3U3MA 4JT4A 1KAGA 1XBTA 4AURA 3U3KA 3VKWA 2QTFA 2N42A 4HZUA 2CCKA 2JIZA 1N6PA 4PQYA 2O8FB 2QTVB 4FCVA 3EX7C 4XVRA 1LS6A 1ZP6A 3EA0A 4BLQA 3F3YA 4ARZB 3TAUA 3ADCA 2X8AA 2XOKD 3PG5A 1EESA 1L7VC 1DARA 1YZNA 3EA5A 1W48A 3GCGA 4Y0AA 1EFHA 1XMVA 4DIDA 2RMKA 5JHHB 4HB3A 4CEHA 5CM8B 1N6LA 5KSPA 1OXXK 3GJ5A 3LBIA 4ZIRA 4LJ8A 1W2GA 4I4LA 3ND8A 2WJJA 4TL9A 3VAAA 4OHXA 3KJEA 5C4MA 1YZLA 2ZJYA 4Q18A 3U61B 3LX8A 2L0XA 3RRNA 4LOAA 1P60A 4L5BA 3C15C 2V8OA 2GZDA 5J40A 2VEDA 4B43A 2OEPA 3MWLA 1C4OA 4KYUA 3RHFA 4F4CA 3GLHE 2G0TA 2JLYA 4TLCA 4CGZA 2C98A 4H9GA 1P62B 2XZLA 1BYUA 2QAGC 3R8FA 2ZYUX 2ZRFA 1TX4B 1E2IA 3C41J 3EWAA 4KAXA 4RD6A 4QJ4A 3KQKA 4EAQA 1RPZA 2Z43A 2WVJA 4G5RA 4O0MA 5TVKA 2VSFA 3SHWA 3U44B 1G291 1HE8B 4GP7A 4EJSC 1IY2A 4ITRC 1W47A 3QF4B 5F3WB 1P6XA 4MRNA 4PX9A 4ZV4A 3GLHA 1KO7A 4II7A 1KHTA 4D80A 4N1AA 4RFSA 1KDTA 3HYRA 5DO9A 4R2HA 3W90A 3W6OA 1US8A 4Q4HB 1GL9B 4JL5A 2W00A 1EWQA 4H1VA 3FOZA 1NRJB 4FXPA 1XP8A 1KK2A 1MO6A 2BBSA 2FFHA 2PMKA 2YHSA 3RNLA 4PC7A 2ZRBA 4QBHA 3NBYC 1TQ2A 3KJGA 5C18A 3QUSA 2UZ3A 4HZUB 5FOTA 5M04A 1CIPA 2F3RA 1C1YA 1P5ZB 2RGCA 1F60A 1RRPA 1TL7C 3DVLA 4R2IA 1I2MA 3HPRA 1LS1A 1L4UA 4AKGA 1T5LA 4GMDA 1FPMA 3B60A 4Q9IA 1E99A 5C2JB 1BO6A 2PJRA 1UPTA 3RABA 4CEHB 2PCLA 5FBLB 3BFXA 4XSGA 5G41A 3MUFA 4E03A 3CNNA 4MKIA 4KV9A 1G3QA 4JBWA 2PLFA 5EE3A 1OHHD 3W5JA 4EFMA 1KGDA 3A4MA 1FL9A 3EIQA 3QIAA 5DLQC 3THWA 4AKIA 1JAIA 5IRCD 4M1OA 1UAAA 1KJZA 2GTPA 1E2NA 2J0VA 3ZZ0A 4YMSA 1AS0A 2FG5A 3AP1A 1COWA 2Q9BA 4IXNA 4Q66C 2D7CA 1DVRA 1FOEB 2ZSDA 4ACBA 3SDZA 4F7WA 3WYFA 1E9BA 3TK1A 1X8JA 3AB3A 5AJZA 4CF7A 4OI0A 3KDSE 1RRFA 4N0DA 4TTRA 2OE2A 2G1JA 4TLDA 4ZKDA 5FL3A 3MJHA 3D6TB 3T35A 2ZRIA 4YMVA 1VG8A 1BOFA 3GLHB 4IFBA 1P2TA 5FBQB 4CEJB 2QUZA 1X3SA 4PHGA 4HZIA 2FV8A 1IN6A 2WJYA 2CLDX 3KQUA 1M7BA 2ZI3A 3LBNA 2JLUA 2H18A 4ZDJA 4B73A 4Q03A 1NIPA 4P4SB 2Q3FA 3VTKA 1IQPA 1XEWX 3RLFA 4NMMA 2H5EA 3LNCA 3O47A 4P3YA 3W8NA 3RVBA 5EUQB 4D82A 4J0QA 4NZYA 2IS2A 5FPYA 2QPOA 5SZIA 3TKLA 1Q44A 1GIAA 4Z1MD 2J45A 1DAIA 2IX3A 4GP6A 1XMIA 2GJKA 3NIBA 2AFHE 1GRRA 4LUCA
chains in the Genus database with same CATH superfamily
3GBSA 4M1SA 3WLEA 4MS3B 4OHKA 3DQQA 2I1LA 4XB2A 5B2FA 2V0GA 1PS0A 1T8TA 2ZIWB 4INZA 1NWCA 4DC1A 1CB7A 2VXYA 1C7IA 2JZNA 4H7FA 3MRXA 5CURA 2Q1WA 2POQX 4LY6A 4CFSA 4CM8A 5KYWA 3BJRA 4ZREA 2XH8A 1SWWA 2D6FA 5IAOA 1QX4A 3SYNA 4IOJA 1XCMA 1Z6PA 1E2GA 3PC3A 2ODNA 5BR4A 3FHCB 3LX5A 4PQGA 3QEBZ 1BVYF 4KPYA 2AE1A 2C95A 3G13A 4AUMA 1Z2AA 1P1BA 2FX3A 5BXYA 4ARBA 3LW7A 1WP4A 5I7WA 1XTJA 1U8TA 3LAWA 4V0ME 2H1VA 2ZBGA 2CYAA 5J5AA 1E96A 1EQUA 4EBFA 4IILA 3ZY5A 2CXQA 1DUVG 2CNWA 1K0FA 3NOVA 4HUJA 4P54A 1K5PA 1C9EA 4M9UA 1TT5B 2R1ZA 3MPOA 1THMA 2QRHA 1ZI6A 1NXPA 3MXOA 4HG2A 2XZPA 4LPKA 4JUAA 2BLNA 2Y0EA 3LSTA 3OZAA 4GGPA 3NTXA 4AF8A 4YXWA 3P4YA 3VZSA 621PA 4KN5A 1M1UA 3INGA 3RJZA 2MT9A 1RTKA 3PK0A 1YRYE 2XSZD 3AR3A 2I6TA 4XFJA 1QPBA 3KQTA 4DRXA 5KINB 3ZK7A 1JFLA 5BN4B 3EIWA 4OJNA 5HP4A 1QZ3A 1XNJA 3KSUA 1SCAA 3PUHA 2CL6X 2PMEA 4QTXA 3EPLA 4N82A 2XUKA 1I1HA 2XRYA 4JR0A 4LC9A 2ZTMA 1DC7A 3RK4A 4RA9A 5EZSA 3ROZA 2QLNA 1NVVQ 3DSRA 4RZHA 1NMEA 1LTKA 3NVDA 1ZM3A 3U09A 4PZDA 1J0DA 5L4NA 5AW1A 4JUDX 1DIHA 1MABA 3RTGA 4B4VA 4EUKA 1DHRA 2OHHA 4L7QA 9LDTA 1I3NA 1MX9A 3VZRA 3QPBA 1EJ6A 2R6FA 3NP7A 4N5LA 3ES9A 3N28A 4P35A 3SF0A 2XUZA 2F62A 1QIIA 3TCKA 4AG6A 5LP6B 5KYKA 3HR8A 2H4ZA 3D7RA 3KT0A 3OCXA 4E88A 1QCCA 3RBZA 1P0QA 1SVIA 4H0FA 1W1WA 3UPTA 3KYJB 4KQJA 3PR1A 4NU0A 2BONA 3OZRA 1SPBS 2AKYA 1RJWA 4IIDA 1Q91A 3D0OA 1FVHA 3B7PA 3H9EO 3IUBA 2ZAOA 1XU7A 2XD9A 3KFXA 3NHUA 3OLZA 2WZQA 4EHBA 5C32A 3K5HA 1EBUA 4ZVQA 4GQIA 2YVAA 4AU1A 3REOA 1HNWB 4RCYA 2ZRHA 4ICIA 4M2LA 5JS6A 5A9TA 1Y81A 2XAAA 2AFHB 1QYVA 2HEIA 2XUDA 1P2VA 4ZOCA 2AR9A 5JZMA 3PGA1 3RSHA 3BCUA 1V47A 2XUQA 4EUSA 2XDQA 4BWVA 4MRAA 1L3IA 3BWXA 4CDMA 3R3SA 3TRDA 2CDCA 3G88A 3PRHA 4HGQA 1SD1A 1KO5A 1AZTA 4CT4B 2EKPA 4UW9A 4ZVNA 3QRWA 4XX0A 4YACA 3OWHA 4HJRA 5BVGB 2FH5B 4LV5B 3D4PA 3DTYA 3L1VA 1BX0A 3U26A 1JR3E 1FJ2A 3GLSA 4FFOA 4D9NA 4JB3A 4MUNA 1MDFA 4OLHA 2AFIB 1GL3A 2IPAB 3NO4A 1W5SA 5TRTA 4ZZIA 2BTEA 4HDOB 4XQEA 2FN3A 3N2GA 4WNYA 4X7MA 3C3YA 2UXDB 2HF2A 4EG1A 3SX0A 4TTPA 3ORHA 3CURA 3DZCA 2ZGVA 1XRQA 1XYVA 3RVKA 5B3KA 4OQMA 4Q47A 4LJRA 3KSRA 4JLNA 4B84A 2B6NA 4CL2A 3NWJA 1HM5A 3HJTA 3ZWOA 1F4VA 3QU9A 5IZCA 1JR3A 5BWNA 2VDVE 3FF1A 4Q7JB 3W6NA 2F8TA 1QHHA 2OT3B 2C82A 5E1DA 1W75A 1E59A 4DQDA 2JRCA 4OH1A 2H92A 4L7VA 2I4NA 1VYTA 3EZ6A 1XKTA 2BI8A 1N2SA 1EHYA 1V8OA 3GZNB 1XMJA 4A16A 4OL0A 5JPDA 2PV7A 2JANA 5PGMA 3UZUA 1PF7E 2WG1A 4I8XA 4N7JA 1SUSA 2FSVC 3P1JA 1Z6ZA 1U31A 1M7HA 2YZ2A 2BP7B 4GL4A 2X13A 4IJMA 3BMOB 2GN0A 2FF7A 2R00A 5B4TA 1UXIA 4FIDA 1QCZA 1VMIA 3KR9A 1RYHA 2VCEA 2VKTA 3SYTA 2JLQA 1ESEA 2YIJA 3K0CA 4M46A 5C31A 4N47A 1UBKS 3TRHA 4R1MA 3W4IA 1JH9A 4INPA 4NP6A 4FEGA 1I30A 2X4IA 4ZI3A 3EUAA 1E6KA 3SY8A 4GOLD 1YJBA 1DDIA 2VPQA 1ESMA 4E0BA 4Z2AA 3OX2A 4X6LA 1SUFA 1DX4A 2ASVA 2PJZA 1J5XA 1XEXB 3ICPA 4I7EA 4DABA 4OHCA 1BS9A 1AJEA 5E7JA 3GVXA 1FNMA 1I94B 5E6SA 2IUTA 3ANMA 4BNVA 1J06A 1A8PA 1JPNA 4HT3B 1VGVA 2HPVA 4ZZ1A 1MZPA 3QK7A 3Q12A 4PLCA 5B7QA 1DEXA 2X2FA 1IXSB 2H5IA 1KYWA 1UDBA 4H27A 4KWHA 3EVFA 1W73A 3TCXB 3M6MD 1X80A 3MCZA 5CK5A 1RNLA 3LL4A 3RQIA 1XJQA 1CZLA 5IDQA 4B5LA 5KTOA 1ZVMA 1T9CA 3TLJA 1DMSA 3U7EB 3IT0A 5D85A 1YUMA 4ZJZA 5DLPA 1RKXA 4YWJA 1QO0D 1MVNA 3OQVA 2Z9CA 1K8XB 1ZNQO 2VWQA 1EFCA 3L6DA 3QPDA 4RHCA 3UV6A 2DCMA 3VR6A 2J85A 5IDXA 2H17A 3NHJA 5KYTA 1EFVA 1AT1A 2DHEA 4C0BA 3THXA 3IALA 2V45A 3ABZA 3RVLA 4F9TA 1K06A 3B85A 3ZBTA 4QGBA 2YX1A 3C97A 3ENKA 2A7QA 3IEUA 4PFKA 4UTZA 3MS4A 4RE5A 4TPKA 4X8HA 4DSUA 3O3OB 2W98A 2HMYB 2P2ZA 5AI4A 1NRIA 5M29A 1HUQA 1X7ZB 3AZPA 3EW7A 1JDBB 2YDXA 3DBIA 3QE4A 5EZYF 1EVQA 3ZCSA 4LMAA 2HT1A 1MUUA 2ORED 2EEZA 3B1WA 5TQJA 4ZZ0A 2BKEA 1P4RA 2NO6A 2ZSBA 4C7OA 3D1VA 5ALPA 3EPPA 4M1KA 4YJ3F 5ICSA 3RPEA 4ZMBA 2CSUA 2I6XA 2QM3A 4PX5A 1NQWA 5BN3A 3L1HA 3BRWD 2R1TB 3NTUA 1RWPA 5TC4A 5IASA 2Y0CA 1P4GA 4XDZA 5K3SA 1MOPA 1PU2A 2X42A 5FV7A 1QF7A 3ABSB 1W6UA 4FSHA 2H2IA 4RK7A 4JI4B 2HO5A 5I4BA 1QK5A 2QR2A 1W87A 4G37A 3T7AA 3LBYA 4OP3A 1F0PA 1W2WB 4K1XA 1AXRA 4F2GA 5K0SA 3DZGA 4M22A 4CN8A 5KX5B 3NH9A 2PA0A 2F64A 3FPBA 1OF1A 3ADPA 1WTCA 5SY4A 2IEGA 1EFKA 3M6AA 4BJ3A 2QRVB 1L1FA 4AZTA 5BR8B 1BVRA 2Z56A 4QKQA 1EK1A 4DLAA 2YOGA 5LQJA 1M3SA 4MWSA 4OX9B 4NFYA 4Z7JA 3GUUA 1C7QA 3KVOA 4QGFA 2CXSA 2A0WA 4MPDA 3S70A 2O8BB 2RHJA 1E1QA 3GPCA 3KZKA 3TFOA 4E1AA 3PENA 3CX3A 4GE3A 1N36B 2PJDA 3BCHA 5EPEA 2FXIA 3BJMA 2VYFA 4RSGA 1GL7A 121PA 1AKWA 1MVLA 1TGVA 1P0MA 2RHDA 1L4HA 1VRCA 3EE6A 2C3OA 3CZ4A 3RS9A 5AI8A 3FROA 4PIVA 4W5WA 1TUIA 1CB0A 1D6SA 2X0FA 3VBCA 4DT1B 5A6VA 5I9IA 5ED0A 3RS7A 2D2VA 1XZBA 4ZV9A 1VPEA 3TQHA 1ZIPA 1OGIA 1Z7YA 2AZDA 2FP4B 4RNDB 1FFXB 2H2AA 5FPPA 3VH1A 3ANSA 4EKEA 5DGTA 4DV5B 4ND1A 1GKKA 1MXFA 4OKNA 1T0JB 3N9IA 4HFMA 4RPLA 5K05A 4JSTA 4HATA 4ACAA 2HBRA 2ZTSA 1VSBA 3EEIA 1L7RA 3KYDB 2VTDA 1UJMA 3QE2A 4IEEA 4Z9AA 4F3TA 3PHHA 5KC9A 1XWFA 2X8LA 2R11A 3E5MA 3F9RA 3G85A 4JBGA 4DIKA 1S8FA 1W30A 3WGYA 1SBIA 1U2GC 3DAOA 4FMDB 2FW1A 4NJMA 5IANA 1HT2E 1AA6A 2QJWA 4PVDA 2H08A 3ABRB 4ER0A 4TLEA 1Y48E 2BHNA 3HPQA 5H4HA 5JNSA 1T1EA 5HK8A 1Y3FE 3LY7A 5IXSA 3EAFA 3M8KA 3QELB 2DP4E 3IL2A 2AA3A 2AYXA 4GVPA 5J5VA 3OMXA 3AG6A 4KR9A 1WMAA 3L0IB 2GEDA 4OK3A 4YPFA 2B30A 3GEIA 4XRGA 5HSGA 3AKZA 3DH0A 5GV7A 4H7IA 1P5RA 1X7XB 1OBOA 3K0HA 1V16B 2OC4A 2JA1A 4TT3A 4EJSB 1JWAB 5TQVA 1DDOA 4HNSA 2AD5A 1SGWA 3O26A 5E9QA 1GCAA 3AR7A 2D13A 1PHRA 1XRRA 4KPFC 5LLTA 2D06A 4K9LA 3DEYX 4XTCS 3NMUF 2EERA 3BXGA 1S8OA 3ZI0A 3CG4A 1KAQA 3EDRA 4ARAA 4WZAE 4UTXA 2HC9A 1ETUA 1QCYA 4OU5A 2P8JA 3F8WA 2FG7C 1TA0A 3AJRA 3M2TA 4R9NA 4DWVA 2QL5A 1I7QB 4RXMA 1A50B 2WWFA 1MRSA 1S2GA 1SZJG 3HLTA 4E5UA 3RTEA 1SVOA 3BJIC 3JALA 3DL2A 3DWFA 3W3AA 2PL5A 4E6PA 4POOA 4YUVA 1Y7LA 2CT8A 4CV0A 2GO7A 3LUPA 4J1TA 2GHIA 4L4YA 5T4BA 3QYPA 2J5XA 4HL6A 1V7CA 3EW9A 1PS8A 3CCCA 3PR3A 5K0LA 3QOFA 1JI0A 1WD7A 4UUMA 5AKZA 5A4IS 4A23A 4DYDA 4W5HA 2L82A 4C4PA 1APBA 1JJIA 4WKCA 2O54A 3EIFA 4JVOA 2RJ3A 4EHFA 4NU5A 1XTTA 3BWVA 2DTXA 2XNHA 5CA1A 5C8VA 1Z35A 3LBFA 2XE6A 4OQ4A 2DYKA 4M8IA 1GUBA 2PU7A 3PXGA 3KKMA 4B9AA 1JLLA 4R2JA 3IP7A 4D6XA 2FDXA 5BSEA 3F9IA 4CQNA 2O8FA 2HA2A 5ANRB 3GJSA 4ARZA 3AR5A 1JHVA 1I6WA 5DBFA 1X2BA 3RH0A 5AUQA 4LJYA 3T0GA 5AW9A 4AS3A 4G1UC 4PZ0A 1GGMA 2L18A 2NAFA 1G21E 3JQ6A 3HO1A 1GD1O 1TQ4A 4CT5A 3GNTA 3P71T 4B3MB 2ZR9A 1G4AE 1ZIYA 3AOEA 3OFNA 4UUOA 1UUFA 2IHTA 3E15A 3L7DA 4R9VA 4WZBA 5EL0A 3VZPA 1W0KA 2RHOA 2C4NA 3F1LA 4R68A 2VQSA 3KD3A 3L8MA 4AZ3A 2XJ9A 1Q74A 5DX8A 4ZMRA 5CFLA 5C5DA 3DZJA 1LU9A 3FHOA 3GV0A 2HWYA 1A4UA 4PYRA 5CW1A 1SOWA 4AN4A 1B2LA 2ZWOA 1KYIA 1JYSA 5CRIA 5L6LB 2VDJA 3UEOA 3UK1A 4EHNA 1H2ZA 3AK4A 4NBLA 4U7JA 1TW2A 3GCDA 3DVSX 1E79A 5C5EA 3KQQA 2ZCUA 4CIBA 2IT1A 5JVDB 2GF0A 4PZZA 1JLKA 3BFKA 2ZB7A 2IIQA 2A3RA 3LF2A 5K6RA 3P94A 1M6VA 3FSJX 2FZVA 1H0RA 2HPAA 5TMEA 3EXFA 2H29A 2PKCA 2JI9A 3S8EA 4LMPA 1T3LA 1XPJA 1YVRA 3MMSA 3PB3A 4R05A 4QVIA 5K9ZA 1MGPA 5ALJA 4EVIA 4PANA 1W46A 3TD6A 5BSMA 3AT1A 3PNOA 4GXTA 2GKOA 3U44A 5IHXA 3ESAA 4URYR 5FNVF 1OV6A 2ADOA 1BQ3A 3DUFA 5TQ0A 3QF4A 3PXXA 2RH9B 3AEUB 4EEKA 5DHSA 3I5AA 1E3SA 3GJ4A 1JMYA 3Q87B 3OC0A 5EJAA 4E15A 4QUDA 1C5KA 2FA9A 1PGNA 4HWOA 4WA8A 2G76A 1ZD9A 1Z7EA 1R2QA 2PBZA 4K6OA 1DCKA 4V0NA 3NBXX 3NHWA 5BR7A 4ZJPA 4Y6GB 1YR8A 2O8NA 3IVRA 1WXEA 3HDHA 2MINA 1PT7A 1Y5RA 3OZEA 2DR3A 3QHAA 3S6JA 5M2QA 3CRMA 4FYPA 2Q41A 1M74A 3DE0X 4UUNA 3S29A 1EFAA 5FBVB 3LVFO 3NTOA 3WWCA 2JFQA 4DXAA 2F8LA 3EMKA 3QVGB 2WIJA 1JQKA 2BC9A 2Q3LA 3ZW7A 1EVIA 1NNSA 2HHCA 1NUAA 2WD8A 5JEEA 3HY3A 1CG6A 4LGMA 4BN5A 3JQRA 3L93A 5K8LA 5AKXA 4DA0A 4Q4AB 2Q1UA 1WBBA 5KWJA 1QK3A 1DQZA 4DTCA 5CX4A 3AJEA 1EVYA 1IDOA 1E1CB 1I9CA 2VBCA 3SC4A 4BVLA 4IXDA 3M5PA 1OBVA 2RGNA 4Z4QA 5JFTA 2RI1A 1S2MA 4TV9B 4PIMA 3RI3A 5KNDH 4MGKR 4MQ6A 5FOVA 4R5MA 2OK8A 1W5TA 1F3LA 2P1RA 1C3EA 3A9TA 1NYQA 2A0KA 3R3XA 3I9NA 5AW5A 1P45A 5T6MA 4R3NA 1N7GA 3BD6A 2KX7A 2YY5A 2I7TA 1ZUNB 3MJTA 4I1PA 2NXJA 4QXPA 4UULA 2VPZA 4Q4JA 3ND9A 5FUBA 4JC4A 1W5FA 4FR5A 1FQJA 4BPBA 5BW6B 2BBWA 3OQ1A 2BTQB 4DLLA 1U3WA 4Q6WA 2EKDA 3I5XA 3UMRA 3LQQA 2G4CA 1EGHA 2FWNA 2W2LA 1LVGA 2Q2NA 1YRLA 4OKIA 5FD8A 4DADA 1EP9A 2OFPA 3B52X 2GFHA 4B7XA 2VP2A 4RY2A 2FPKA 3NIFB 3PKIA 4EY5A 5KREA 6ABPA 1GJRA 1NBIA 1NVVR 2CVFA 1WEHA 2H3HA 3IT2A 3PDJA 3GD7A 1U11A 5A4KA 1KMCA 4QT0A 1XB2A 1HDCA 2JS7A 2WT4A 1ZIDA 1U65A 3LK7A 4P38A 1GUYA 1RHRA 2RI6A 4QFMA 2WOOA 4H1WA 4CEJA 3VJRA 2GUWA 1VA5A 4WK6A 3ZCXA 3U7FB 1PQWA 1JEYA 2PAAA 1FU4A 3BD8A 2Z58A 1WB5A 1BEZA 1NJ6A 3OCVA 1YR6A 4B3TB 2ISCA 1X13A 4OAPA 2NWQA 1CP3A 2OCXA 2GBGA 2DT5A 3RNOA 5AKIA 4WJKB 5EXSA 3SYRA 4G6ZA 4YRQA 3S0JA 3FTEA 1VDZA 1X15A 1XQWA 2IVFA 2O4CA 2YOHA 4U8GA 4ROTA 4G8DA 2GO1A 3F6RA 4CL3A 2RARA 5JC8A 4RVOA 4G97A 5A04A 4P3PA 4ZPJA 3V1LA 4XQ0A 4YH1A 1Y6ZA 3LWZA 1Y1TA 1JG2A 1PX0A 4FKZA 2NN3C 1FK8A 1OROA 1OTYA 2FOIA 2CWDA 3D3NA 3HUDA 4IDHA 4JQOA 2DULA 4NH0A 4Y0NA 5JD4A 2BFFA 3TLBA 3PNSA 1QKJA 2O50A 1Z74A 3NBQA 2DKNA 5EJ8A 2V3VA 1R0BA 1C8LA 3W77A 3QNWA 2GKGA 3ZHRA 1BROA 2WFLB 3BE5A 5T4EA 1QGUB 2V97A 4MEAA 1X7WB 4FR0A 1W8DA 3WP0A 3DWGA 3QEMB 2YWJA 5CITA 1YAHA 4EGSA 3OURA 2A9PA 4E7OA 5AKEA 2AG6A 3AGPA 1E0DA 1RAIA 3O3MB 3IMEA 3TF5A 1X7DA 4UBMA 2OV8A 1TZJA 3BGWA 3C8MA 5FT9A 3DBHB 4IIYA 4QT4A 2B25A 4U8HA 3DBLA 1LF0A 3W2EA 1H3FA 2YL2A 3GG9A 2YVUA 2FQQA 4TM8A 5CVUA 2QRNA 2HJ9A 3D7NA 3H4VA 3HGTA 5LLSA 3KPYA 3ONDA 1O6CA 2XBLA 1E6UA 1O54A 5B3JA 1KI8A 2V6IA 1W2HA 4WI1A 2HL6A 1WDWB 1DBQA 2J5KA 2Q9UA 3MELA 3O84A 5HTKA 1N5LA 2JFFA 4IZHA 5REQA 3IP6A 2NUBA 4IJ6A 1WW2A 4YX9A 3NQ41 1N3BA 2WM3A 5BUQA 4PN3A 4DKJA 3Q2OA 1OFVA 3PS9A 4QOGA 4EK9A 1V41E 1UFQA 5DMHA 3J7AC 3ENNA 3UAXA 3K1ZA 3IURA 4D9EA 1RSZA 2A78A 1AUPA 5ITSA 4P8RA 2NQ8A 2CJWB 1ANKA 4DJ5X 5A2GA 3OLYA 3K96A 2QVCA 3CPHA 4M36A 3MEQA 1X7GA 2GAIA 4ND7A 2QSYA 1LF5A 3U9SA 3H4IA 4AN0A 4OHPA 2ZR7A 4E4RA 4JC0A 4EPRA 5KPDA 3D4BA 3H87A 1ISJA 2C3PA 1GQSA 4ZDIA 2XKBA 4MUGA 2QLTA 1XN1A 3I42A 4FWBA 3TR5A 5MF6A 3NC4A 4NCXA 5IAEA 3VFDA 1YS4A 1RQXA 4QEDA 1R4NB 1KYXA 1PCXA 4KZPA 5H5JA 3WDLA 3ZKWA 4AC9A 4KBFA 4FFBA 1KZYC 1L5HA 1O5TA 5HRUA 1DFHA 4QUGA 9GPBA 2V5VA 4LDAA 3VSBA 2JHGA 3NGMA 1DWQA 2ZIZA 1RLMA 4OA8A 5FOUA 5I47A 3URKA 3LC7O 3UHJA 3G79A 1E1MA 3S1AA 2HH9A 2VHQA 4RU1A 2PVCA 5L7TA 2IH5A 2OYRA 1DEOA 4AB1A 2VDWB 2R6R1 4S3MA 4F56A 5JEDA 2XBUA 2YJ6A 4YCLA 4QE3A 2Z3VA 1BWRA 2VK2A 4F3YA 3PQ7A 3AIMA 1XP5A 4IGAA 5HIAA 2ZBPA 3EEQA 1FX0B 4LZWA 1QOPB 2DHQA 4ZTZB 4DN6A 4IYJA 3EMBA 1RJ9A 1G7CA 3SSAA 2W0SA 1G6Q1 3BM5A 2SKCA 1SCQA 5KYXB 1VZ2A 2IA5A 3IHWA 2CV0A 4YJGB 3SIXA 8ATCA 2QVYX 4CM9D 1AMUA 5HIMA 4OBEA 2EW1A 2XGGA 4F85A 2JZOA 5KSWB 1QV7A 2ZT5A 4GOMD 4IOMA 1SOUA 3UJNA 2FK8A 3DDCA 4Q9AA 4V02A 2QD2A 1IEXA 3GT7A 4DV6B 4UNPA 5K3OA 2A14A 2Y1GA 2Z04A 3WNQA 3GMSA 4YRAA 3TX2A 5TT0A 1AK1A 4KSBA 2VP3A 4KAJA 1O95C 3V8QA 1G4UR 3LI2A 4OAQA 5LZ7A 4UNIA 3WGKA 3V3KA 4C29A 4HN4B 3TMKA 3Q6IA 4A03A 1YZ3A 4ZU1X 3O4GA 1JHYA 3AR4A 4PU0A 4R1OA 1RW4A 3A8TA 2C20A 3C98A 3DQPA 4R31A 4V0KA 1NW3A 2IJGX 3UNXA 2H06A 4BAGA 5CFPA 6LDHA 1Q1GA 1PIWA 4KX3A 4JHXA 2F59A 3LX4A 1Z4JA 2H6EA 3SJ7A 1CS0B 4JCOA 3E8SA 4LAFA 1JIXA 4F21A 2A5LA 1G5TA 3BZWA 4TRRA 4B8WA 4AJ1A 4Q15A 1IEVA 1Z0ZA 1PJZA 3EOAI 1A76A 5EP4A 3DFIA 5EP1A 3O82A 4DZRA 4Q12A 5K1ZA 3L4EA 2J6BA 4IDPA 1W93A 2ZYVX 4NCIA 5EIAA 4O0LA 1G8KA 1U1GA 1YR3A 2VHUA 2VDPB 2FZEA 3ISJA 2J0UA 3QYAA 4FKBA 4G0XA 3JD4A 4YAJA 4ZARA 5B37A 1AS3A 5D51S 3U0BA 3VTZA 5B55A 5HKAA 4HUQA 4B76A 1G64A 1QFMA 3JZFA 3UJDA 4Q9JA 3TZHA 4F5WA 5LMCA 1QYCA 2PXCA 1KIFA 1AXEA 1N5OX 1JIVA 5CFZA 4MKRA 5CT9A 4EL5A 5EMNA 1W44A 3E8MA 2YV4A 1A4IA 1M34E 3P26A 1PLLA 3TJZA 3ZWAA 3ETDA 1QUEA 4B0PA 2FW9A 1HEIA 2QJOA 3P2IA 1W36C 1UP6A 2O9JA 3CEAA 5JZVA 3UJPA 3GVPA 4MPJA 5HUHA 2AW5A 1IZ9A 1LGYA 3IBGA 4G84A 5JCOA 2X0IA 3RTBA 2B4KA 4G85A 3ICQB 1NHGA 3A9RA 5IUJC 2KWIA 2ZRAA 3PR2B 5BMVB 3WICA 1E9EA 4JYCA 1FFWA 1NXWA 2Y6VA 3PEYA 5J4YA 3QKRB 3ECSA 4BTEA 1QDLB 3VPFA 4DLWA 3BFVA 4MO9A 4O2AF 1MAHA 4A73A 1B8NA 5ICCA 1T24A 2JF0A 4J03A 4QNMA 2C7RA 3FOAA 5IDWA 2IUSA 4AY4A 4XYMA 4KQWA 3KE8A 5CCEA 5LDGA 1KYQA 4KO4S 1Z63A 4D3ZA 3KXKA 2YHUA 2C99A 2DT8A 4FU0A 5HOEA 1UBSB 2NO7A 1R50A 2VC2B 1R0CA 4NHEA 5JWHA 2QHXA 3M9LA 1U5CA 3NATA 5HFNA 3FUVA 1BWSA 1FRFS 2CXRA 4U2BA 4Z8XA 5I7AA 2ZUDA 3O1JC 821PA 1CY6A 4B2PA 2LW7A 1HT1E 4W1RA 2CUZA 4AROA 4IZOA 3FOWA 1M1ZA 4WFIA 5JJKA 3MLBA 3VR1A 3N0TA 3SHFA 1DNPA 2LPMA 2V96A 2OBBA 4GUDA 4Q5IA 3AR2A 4EJMA 2VA9A 1CD5A 2QX6A 3N8KA 4HI0E 3SSNA 1BHQ1 1ZN2A 2WTBA 2Y92A 3HO8A 4BTLA 2NTVA 3AXSA 3OO1A 3KLBA 3DZBA 3LYHA 4M76B 1EZ4A 1Y7TA 5KDOA 1OPRA 3CPEA 4J94A 1WDTA 1YK0A 1ZIOA 3BBLA 3Q3IA 2WJIA 4V03A 3UB4A 4A0RA 5JAHA 1BHJA 2VQFB 3B3FA 3VM6A 3PQCA 4Y7DA 1IY0A 2XVMA 5KU1A 3RC9A 5A03A 2DY1A 4RVCA 4K0KB 1JNXX 2PGXA 3CEMA 2FR1A 4R4JA 2NUAA 2VK4A 3FYUA 2CC2A 2D8AA 2AOXA 1IN7A 5CYFA 3RVOA 3RDPA 3TQFA 3UQZA 2BH2A 4MGYR 1OJLA 3BWEA 3VC2A 4BFSA 1DX6A 1FA9A 3BE8A 3KTAA 3J80A 1XD9A 4L6AA 4UEQA 3VJLA 4K03A 3FZQA 3PPWA 2IZ7A 4YLGA 4AZ0A 5BY2A 4Y2GA 1DAEA 1I4EB 1P75A 2QZ9A 4ZAVA 2ZJ5A 2ZG6A 2X2EA 3C16C 4OJQA 3TQRA 1SQFA 2FMTA 3QPUA 2XOKA 3T7KA 4RPJA 4Z9FA 2WYOA 5H16A 2OBMA 5F2OA 2O8DB 2XIJA 1SQ5A 3G7SA 3GIWA 3RSSA 2Q3JA 2I2AA 3L04A 1QF9A 1ZCFA 4HDCA 1N1MA 4HAIA 1PR1A 1C3XA 3OG9A 5ALDA 1UEIA 5FR2A 3C8ZA 3QXJA 5AKYA 5ALFA 5JSUA 2JIPA 1ZU4A 2G77B 3FETA 5EC8A 3K73O 2ECQA 4GBJA 1BXRB 1ECBA 1XQYA 2BGJA 3BMCA 3M83A 3Q4GA 3ZH2A 4BWGA 5L53A 2Q5EA 1XV5A 3LTNC 1A2OA 4BLPA 1NM5C 1SHJA 2M6LA 5CT6A 3RHSA 5KNBH 2Q4OA 1YH3A 1JTVA 2IUYA 2I65A 1IHYA 2WQZA 3MCAA 2RBEA 5FWAA 3VR3D 3TFWA 5HW0A 2AE2A 2F43B 2AR0A 2IS4A 2WHXA 2R68A 6GPBA 2G4VA 1BE0A 5HKKD 2NV6A 1HV8A 3EIEA 3K8QA 1Z2NX 1JG1A 3DB2A 4CKBB 5KQPA 1LY1A 4OB7A 1ZAKA 3U4DA 3L07A 2Q5JA 4V2IA 1EUYA 3HCRA 1EK5A 3CSUA 3TTYA 2WDZA 3NXKA 3PJDA 3FYCA 5DBGA 4CMEA 1SHZA 1E6CA 3M5WA 2X9VA 3HRHA 3VYUB 3WBFA 4IO1A 4RSHA 2R8OA 1CJVC 1V1RB 5AW4A 3L9WA 4RTKA 5JWOA 2E5LB 2UVQA 3R0IA 1E5TA 1L9KA 1LI4A 2DUJA 1CY0A 4R2MA 3SFVA 1KWKA 1FQOA 3E27A 4D92A 2XMRA 1FLDA 2QA5A 3WMFA 4QTYA 4Q3OA 3Q8WA 1MO2A 4ZGBA 2O6LA 1D2NA 3PUIA 1ONNA 4HWSA 3RIGA 1TU0A 1Q7EA 3K9FC 2JAXA 2XYRA 3EZXA 2B6HA 2ZRGA 3S7ZA 4A26A 3RUDA 2FMHA 4KIJA 4OBXA 2HSJA 1N2JA 4NEHB 5JNUA 2RIPA 1Q19A 2GCOB 2ATIA 2MMGA 5MHTA 3IVCA 1CQZA 1EFUA 1ISGA 4Q4CA 3HZZA 3GGSA 5IBQA 1U63A 4FYVA 3P9NA 4BU0A 3ROTA 1U2RA 5I9NA 3KHUA 3ONVA 4J7CA 1N0VC 4LC1A 3VVCA 3C14C 4GBED 4NVRA 4LWZA 2PUBA 1VIMA 1E7RA 2OCLA 3ZYCA 5JFOA 1HOTA 1KBQA 1DC4A 1C29B 3I30X 3HEMA 1VJ1A 2BSQA 3IP9A 4Z49A 1KVQA 1SBTA 3TR0A 3H1GA 4NESA 4IDGA 2DVMA 2G6TA 5DV9A 2F3PA 1K0UA 4X45A 2HQ1A 4MV0A 3LPMA 4RCZA 4YA6A 3R7DA 1UC8A 3AY7A 3IELA 4ABTA 4TYNA 1UK9A 3QTTA 1E98A 2ZIUB 3FW1A 2HWKA 4JBYA 1ZHHA 1VTKA 3M4XA 1FUEA 3IV9A 1VA4A 5AW0A 3HN7A 2P4QA 1NULA 4FHCA 2XDYA 3Q0EA 1KZ9A 5CIQA 1SA0A 1M76A 2M1ZA 3ZI4A 4KUGA 4R01A 4F8EA 1VP3A 4PAOA 5DRTA 3GJXC 4P82A 2FLVA 1VJTA 3QVXA 5HKBA 2OCAA 1VECA 2CF6A 2EF0A 2O5VA 3GR6A 1GPBA 4CUKA 4C08A 1FCJA 4YDQA 1JDZA 4LHXA 1NVAA 4EA9A 1U7DA 2ZRPA 3FNRA 1EXVA 1R4AA 5CFNA 3AP3A 1N9GA 3V55A 3KKNA 4L5IA 1WUIS 4RIEA 2IWHA 1ZN7A 1RYNA 4X63A 1PR6A 2GDJA 1L4KA 2BMFA 1NUTA 3OD1A 4LVUA 4JI6B 3H2HA 2AXEA 2P9TA 4R98A 5J47A 1H8HD 4JUIA 1AKNA 1B2RA 1FY2A 3QX9A 2B69A 5IU6A 2A0XA 4MGHA 1UC4B 3ZU5A 4E14A 4UFPA 3KZOA 2HU2A 5EKTA 1GILA 4KLRA 4S1OA 4AMYA 4D74A 3OPYA 3RYIA 3WIVA 4C21A 2CZGA 3EXIB 3GFPA 5T8KA 1IN5A 2WINI 4IHQA 2BELA 3DXYA 5JMPA 3AFIA 3TLYA 1QQ6A 2ZTVA 3N7AA 1K75A 4FYWA 1RYMA 3MCTA 4HGYA 4I50A 4S12A 4Y6SA 4D9MA 1ID8A 3ABQB 5F9FA 4K7JA 1K8YB 4PFSA 1WXQA 1PSDA 3GU3A 2CNWD 4G5QA 4MCAA 3ZDXB 4DMRA 3FHTA 1WEKA 2HJSA 4RULA 5GONB 4PSDA 3KKLA 3CCBA 1H05A 3VU3A 1PUIA 2ROQA 3OZXA 4FW8A 4M0MA 4RADA 5CW2A 4GXRA 5BSGA 5FUQA 5LQAA 4IV0A 1KJJA 5AVVA 2BZGA 5H83A 4B44A 1FW8A 4Y6RA 3ZS9A 3CXUA 2JCGA 5TQ2A 4YXWD 5BUSA 3PWTA 3WRYC 1TM7E 3B13B 3ZBPA 3K0AB 4C3OB 1SKMA 1SKYB 4TZ0A 5JXIA 3QNMA 2N3ZA 3WFIA 1ZEMA 2ET6A 3PJGA 1NYRA 2PYIA 3KYCA 1JIJA 1NC1A 1X0VA 2WIBA 3C45A 5A0FA 2Z4SA 3RWOA 1Z5PA 2CFSA 2FB9A 3QMVA 3K9GA 4K6KA 1JDPA 3R0VA 3QUAA 3A3OA 3K4PA 1VLVA 5EA2A 7ABPA 2JFXA 4ASUA 1UMKA 1ESNA 4PGAA 2QN1A 3F46A 4O4HA 2VAMA 5ALRA 1NT2A 5KEIA 4W9MC 6YASA 4QXRA 3DVAB 2J6HA 1RJGA 2C57A 5ER6A 3NFRA 5DULA 1VI5A 2J0EA 4BO8A 3V1MA 2O1XA 5BORA 2FUG1 3BRQA 2ID4A 3RV3A 3OIGA 1CIVA 4Y9SA 2FW6A 4LNUA 1I4DD 1H5NA 4EB6A 4GQBA 4QM7A 5E6RA 2VUHB 3H05A 3WB1A 5AQEA 4UOQA 1JZQA 1TK2A 3DCYA 3PFHA 3LXRA 3KG2A 3HV0A 1CRLA 1TJPB 4KI7A 4AWAA 4AWXA 5INTA 4CKXA 4NENA 4HYYA 3QBDA 1ST2A 1TW3A 1QCDA 3OP4A 4ARVA 4OEHA 3DBVO 3GIDA 1VL6A 4YDRA 2V1UA 3A06A 2JFWA 4MWGA 2R60A 1F9AA 1FFGA 1FS5A 1ZD2P 3HCBA 2G9QA 3LIPA 3NUQA 2KQUA 3IPLA 1U7WA 5AIBA 1G8JA 3LW8A 4AX4A 2F3QA 3NT2A 1R16A 3ICWA 4B45A 3KKQA 1W7AA 1F2VA 3INNA 3MJCA 3QV1A 2WFAA 1A82A 2F1JA 2GS9A 2IYQA 2BEVB 3OT1A 1Y6FA 4OOEA 3MINB 2O1SA 2FG6C 4L8WB 2X1MA 4U9HS 3UAZA 5DGDA 1G8HA 1NN3A 1ZMRA 3VMMA 3RSGA 5LDDC 4RTOA 1TM5E 1PKXA 5JAIA 4CM1A 4GUAA 1CBUA 5GMOA 2ZAMA 1ILWA 4BQSA 4S04A 1JI3A 3DVQX 1JQBA 2O2DA 4GSYA 4PE5B 4E4TA 1KMQA 3ITDA 3GDOA 1PJRA 2OUKA 2PSHA 4XM0A 3WA7A 1MTZA 5F4ZA 4U9UA 5B12A 4URUR 3FPLA 4D98A 4BLSA 1ZKDA 5AW6A 1V2GA 1OILA 3RGGA 5J43A 4UBIA 2IPNA 3FBWA 2PEZA 3MIZA 2P6PA 2R66A 1WAMA 3PL1A 4NZMA 4OUDA 1NQVA 2GGSA 1JR3D 1SAYA 3HI6A 1RHQA 4RESA 4AJ9A 2C2BA 1XRLA 3HMKA 1AZLA 4PGGA 1HDXA 5CA0B 1SZPA 1N33B 2Y27A 4LGYA 3CWZA 3T7IA 4PZEA 3A0UA 4LBWA 4UPVA 4M0FA 5CHYA 2NZUG 1SVKA 5TMBA 4JLMA 2W2QA 1HYQA 2NU8B 1RD4A 1USKA 3WLMA 5JBIA 1UEJA 1Y5LA 3RT7A 4YAFA 3VI3B 1AY0A 1LWOA 5D3QA 2C94A 1EKXA 4YRJA 2RGRA 2P4UA 1J42A 5K2MA 5GIOE 4MHOA 1Q12A 3NWEA 4EGAA 4OHRA 4WOBA 1KS2A 3D7KA 1ZYUA 2ZU0C 3W05A 3WGIA 5KYGA 1M7GA 1OY1A 3SQDA 4IMJB 5TNXA 1HC7A 1RU3A 1NXTA 2IHZA 2PX2A 3JRWA 3LPDA 4PBRA 4I1RA 2HRDA 1A9OA 1QVAA 2Z5LA 1A2QA 2IPMA 5E8JA 1DV2A 4FD3A 5A7FA 4EG3A 3T1TA 2QW8A 3OZVA 4DJAA 1NUSA 1P9WA 3MRTA 3AJAA 4AAYA 1NNEA 1PJ3A 1Z6GA 5KTKA 2YWGA 4R16A 4LF5B 4M0PA 4M7OA 3VHXB 3VR5A 1IBCA 4B4OA 1THZA 1FNBA 1CHDA 2NYAA 1T36A 1J5PA 4D41A 2C2KA 4K9SA 4MTCA 4EY7A 1W19A 1KZ4A 2AMJA