4RSGA

Neutron crystal structure of ras bound to the gtp analogue gppnhp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
166
structure length
162
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neutron Crystal Structure of RAS GTPase Puts in Question the Protonation State of the GTP gamma-Phosphate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTPase HRas
total genus 55
structure length 162
sequence length 166
ec nomenclature
pdb deposition date 2014-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rsgA00
2REBA 4RZ2A 4PO8A 3LV8A 3RRNA 3KUDA 4RD1A 5CIQA 2GJKA 2D62A 2IC5A 2IHBA 3BBPA 1QHNA 4IOLA 1FP7A 2GF0A 3NC1C 2H92A 3W6OA 4P33A 2VPPA 2IF0A 4GSYA 1GKYA 4Q1EA 2J5XA 2X1VA 2FF7A 4GBMA 1JEEA 5E7JA 2FSHA 4EJSA 1N3BA 3HWSA 4P0TA 4R9UC 4DIEA 2WWXA 1NL3A 2O8BA 3KKOA 5H70A 2BMFA 4OK6A 3I72A 3VX4A 1KSJA 5K8TA 2Z83A 2JIZD 2ZRBA 4ZV4A 1F6BA 521PA 4F4IA 1CJVC 1B0UA 2NZJA 4Q21A 3S1AA 3BRWD 3EPLA 1Q3HA 1Q1ZA 2ZIAA 3FKSD 3QKSB 4GRAA 3TNFA 4DSNA 2Z4SA 1TTTA 2UZIR 1XNJA 2JLSA 4LHWA 1N0UA 4NDZA 4AK9A 2CHGA 4IOJA 3CNNA 1GILA 3EG5A 3QIAA 1QF9A 5DSZA 3E2IA 3QKRA 3ZZ0A 1OB5A 1QDEA 2RHDA 2OBMA 4DCUA 3U3RA 3ZVLA 4L4UA 4EPRA 2WWFA 3ZLJA 4D25A 4PHHA 2JLUA 3ADBA 2ZSDA 1AM4D 1ZD8A 2ZSAA 2MSDB 2J0UA 4C0HA 1T8TA 5FOUA 4ABYA 4YMSA 1KO5A 2R6DA 1ZCBA 4M9XA 1P72A 2VBCA 1JR3E 2KB0A 1SZPA 2WJGA 4MGZR 4A0FA 2FOLA 2JLYA 5H8WA 3NEYA 4OHXA 1DG1G 4OJKA 2VP4A 5E4FA 1CJMA 1E2LA 2QMEA 2YJTD 4PC6A 2OFWA 2BMJA 2CXXA 2HT6A 2JLRA 1XFAA 1ZBDA 2NO9A 1KI3A 2ZRDA 3FKSA 2RCNA 4LK2A 2A5JA 5CYOA 5EZ6B 5JFGA 4FCTA 3B5JA 1GL7A 1E9CA 4G0NA 1HQYE 1G8GA 2N42A 1IJEA 1G3IA 1TQ4A 4AIIA 1A1VA 1JXOA 5JJLA 2LWIA 2OLJA 1ZUIA 1RKBA 2DY1A 3IIMA 3SJBA 3TH5A 1KNQA 3U4QA 5TMPA 1LF5A 3IHLA 5ELXA 3QVVA 1QRAA 4MGIR 4FCWA 1GL9B 2ZI3A 1EG7A 2QL6A 2GJ9A 1F60A 3CZPA 4PZZA 3FMOB 1OW3B 4L15A 4QGAA 3IIKA 3B9QA 2W2VA 3AKEA 4TLCA 3TK1A 1SXJC 1VCNA 3NHAA 4TYNA 2CDNA 1OXVA 1ZMXA 2PZGA 2R6AA 4YQFA 5JS7A 5KSOA 1XD8A 2QGNA 2W2XA 4O2RA 2JDIA 1EFRD 4QGFA 2WBLC 4AKEA 3J81k 1IBRA 4JJKA 4CVNA 4KFUA 4LJ4A 1TADA 1SVKA 1NN1A 1WA5A 1ELOA 3CRQA 5BXQC 3KJIA 3RAPR 4Q9HA 4KLZA 5KO2A 4G01B 3RS5A 1KOFA 1VIAA 1SHZA 2CE7A 3BB3A 5KPJA 1RE0A 4TL7A 2GCPA 2QA5A 4LBZA 3ICQB 3OIYA 2JLWA 3WY9A 1JR6A 1UKYA 5G41A 4CEHA 1UBGA 1GKUB 1Z2CA 4UNRA 2QSYA 1UF9A 4OI4A 2TMKA 3Q9LA 1VG9B 2GESA 4NYMQ 3CH4B 1EFRA 2CE2X 2QG6A 5BQ5A 4CEIA 3FDIA 4D4JA 3KDSE 3GPLA 1TU3A 3NBZC 3HJNA 2BC9A 4Q66C 3SOPA 1CR2A 4MDFA 2NO1A 2ZJBA 2RGNC 3OIWA 1FW6A 2ZRGA 1FNNA 1GWNA 1BS1A 2C99A 3D6TB 4C30A 4DC9A 2D06A 3AKCA 3H0KA 2ZRMA 4XH9B 1NBMA 3PR1A 1OH6A 3DOFA 5AJZA 2KE5A 4E09A 3OAAD 3LLMA 4Q03A 5CDFA 2ZRKA 4ILEA 1W0KA 1YKSA 4BFVA 2OBLA 1KI7A 2AL7A 2BMDA 2CL6X 4HAZA 4RD4A 1E79D 4UNQA 4XTRA 3WNDA 2Q3HA 3EZ9A 3GFTA 1Z47A 1ANKA 1EFCA 4BASA 4GT1A 3NH9A 3QXHA 2J0SA 4QC2A 1E69A 2REOA 2IXFA 4M1YA 1MO5A 1J8YF 3K0AB 2GK7A 1S1CA 2BKEA 1XD2B 4EJSC 2Y8EA 1ZJ6A 4U02A 4PANA 1UFQA 3SR0A 3WP1B 4LHYA 5KUTA 4KCGA 1IOZA 3QENA 4NHOA 5FOVA 3LQRA 2G9NA 1C9KA 1NIJA 2VSFA 4WOPA 4IJMA 1GP2A 2IEYA 1MV5A 1NVVQ 1S9HA 1T4GA 2JASA 2BIFA 3GEHA 3JZAA 3LAWA 3PEYA 1N5KA 3LW7A 4KFSA 3W6NA 1LFDB 3CNLA 2ZRPA 4HZUB 3AUYA 5GJCA 3GLHB 1R5NA 4DDTA 2FA9A 3EZ7A 4QBGB 4DUGD 1GM5A 2VF7A 1VPLA 4YXWA 1KY3A 2WICA 1OIWA 4KHZA 4MRPA 1QHXA 3PG5A 3T15A 1QHHB 4UNSA 2WWGA 2CJWA 2JJ1A 3ZD6A 4NYIQ 5F9HA 4L9WA 4PO9A 3BS4A 3OEHA 4MUBA 4PSAA 5JJIA 2QRNA 3KZ1E 4DB2A 3C41J 4FW9A 4OJQA 2ZI9A 4C0JA 3AVUA 3IDQA 1E1RD 3CKLA 3EIQA 3K0FA 4LUCA 2Q9CA 1YZTA 4C2TA 2V8OA 2HCJB 3TRFA 3V9PA 1DG3A 2WTUA 3QKRB 2IL1A 4GMXA 2RGXA 3I92A 1TUEA 4D6PA 1JI0A 5JBQA 1AK2A 1BO6A 1FUKA 4PQFA 5LD2B 2GBLC 4GOXA 5BYKA 1EXMA 4LYJA 5AWFC 4C0AC 1Z0JA 1N0WA 4BFZA 3U44B 2OE2A 4KSCA 4HAXA 3EASA 5EQTA 5FPHA 4DUGA 5KHOC 4IOKA 3GLHE 1R0WA 4NZYA 4HUTA 1H65A 5DHFA 2PMKA 4KV9A 3WYFA 3K09C 4B3DA 4LBWA 4LCBA 4NCIA 3EX7C 3RNLA 1ZCAA 3K0CC 1U8ZA 1IM2A 5FL7A 1E0KA 1N5LA 2D74A 1CJTC 3I1FA 2FGKA 1GRRA 5G3YA 4OQMA 3QKTA 4F38A 1GOTA 1W36C 1JR3A 2Q6TA 4DDUA 2WKQA 1NJFA 4PAOA 5FBWB 1QHSA 3FWYA 1P9RA 3ZZTA 4B74A 2XZOA 1G6HA 4XD7D 1W4RA 1W49A 1N6KA 1EWRA 2LCFA 4CEHB 4Q4AB 5EE5B 2RH5A 1CEEA 3X1ZA 4AC9A 4Q18A 2GXUA 3SEAA 4ZI2A 1A4RA 4A2PA 3OAAA 1P7CA 1OH5A 5FPYA 5F2EA 1G8PA 1NSFA 1ZNZA 4O25A 4Q4HB 5D3QA 1JXMA 4WZ6A 4QOSA 1KKLA 1XEWX 3KKNA 1OYWA 1G3UA 3BB4A 4RD0A 2ECKA 2REXB 3U3OA 3NIBA 1R4AA 4U00A 1CR1A 4WVFA 2ZSFA 3RS0A 5JCPA 2GEDA 1II8A 1P61B 1U9IA 2XEXA 1UDWA 4NTZA 4B44A 3GJ0A 1KK0A 4OQLA 2IUUA 2YHSA 3AVWA 2WIBA 2GETA 1KHTA 2J0QA 5IK2A 2Z4RA 1WE2A 3DM5A 3LVRE 4ZIRB 4WIAA 3AEZA 3QY0A 1Q57A 1XXHA 2ATXA 2RGAA 5C4GB 1W1WA 2P3SA 4DLRA 1E2JA 2IWHA 4EFNA 221PA 1VCMA 4Q7KA 2FZ4A 2ORVA 2RGCA 1W0JA 3A1UA 5B2ZA 4IDHA 4CT5A 1E2FA 2H1LA 3K70D 3OE7D 1OF1A 1Z5ZA 2EFCB 4P3YA 4EDHA 1E9AA 1XTQA 4XWKA 1NF3A 3ETLA 1KI2A 3ZD7A 2IUSA 4NCHA 2ODBA 3SJZA 2V4ZA 4PC1A 1ZC4A 3EPHA 1DOAA 2O5VA 1VG8A 4BZQA 4M1WA 1OYYA 1G5TA 3K9LA 3P4XA 5LPNA 3U3JA 3QE0A 3FVQA 3M1IA 1E79A 3MWJA 5KYKA 1W5TA 2ZRNA 4Q1BA 5GVRA 3BB1A 3ZQJA 3AP3A 1K8RA 2V6JA 1AKYA 4C7OB 4QKQA 5JEDA 1E9FA 3ZZUA 1T3SA 5D3MA 4DDVA 4ARZB 1GSIA 4MKIA 4B2PA 3GLGB 3K70C 1N6OA 3KXIA 1CBUA 4YDSA 4DWJA 2ZRIA 2AN9A 2GCOB 1JPJA 3RC8A 3K53A 3KL4A 3TW8B 5GJVC 1YZLA 1AA9A 1KNXA 1TF5A 3TMKA 2IYYA 3A1WA 1XJCA 4LX0A 2XX3A 2NG1A 2ZS8A 3EZ6A 2ZRAA 2I3BA 1I4DD 2IW3A 3OF5A 3RS3A 4A8JC 3PEWA 5BN5A 4X8OA 2HYDA 1YJ5A 3E1SA 4LV5B 5DISB 4QJ4A 1E2IA 1T5IA 5E7MA 3IO5A 3KJHA 2EYUA 4G5SA 4PSVA 2W0SA 3Q85A 5G3ZA 2C98A 4YXWD 3U7FB 5JHGB 5DYIA 5JRZA 4DKXA 2ANBA 4TMZA 2P6UA 4C4PA 1IY2A 5EJEA 2F1IA 4LC1A 1BYUA 2GAAA 2IUTA 4B33A 1PVOA 1KZGB 2R62A 2LKCA 4RSGA 1OH7A 3H84A 3M4YA 5EE1A 2AKAB 1WBBA 4TLEA 2ZE8A 2I1VB 4HDQB 2A5YB 4D0NA 1HUQA 1OPXA 1Z22A 1E1RA 1XTJA 3X1XA 3LDAA 1OXTA 4M22A 4V0KA 2C2HA 5CYPA 4RD6A 4ESVA 1T3HA 4ZI3A 2AHOA 4XWOA 1SVLA 3Q7PA 3DZ8A 4IW3B 1KSFX 3VMFA 2ZEJA 2F3TA 2DFKB 2IYXA 3FFBA 2FSGA 4IXNA 3A1SA 1G5PA 1US8B 1NNEA 4Q9JA 1O3YA 2EFDB 3NKVA 1E96A 2QBYB 1D8TA 3RYTC 2F43A 4PC7A 2G83A 1P9WA 3W5JA 2A5GA 3CZQA 4XOIA 1GNQA 4NYJR 4TMWA 3KJGA 3JVVA 4UXIA 2OM2A 4MRSA 2GKSA 5TDHA 3CIOA 2FNAA 5SZHB 1HE8B 1D9ZA 1BKDR 4Q7JB 1TL7C 4PPFA 4RVCA 4FIDA 1YVDA 1S9DA 1HURA 3GLGA 4TYPA 4IVQA 3W9YA 3KQLA 5FTJA 1UEIA 1KDRA 1VYTA 1PUIA 3OHMA 1NMYA 1CR0A 3N2IA 4MGYR 5SZJA 1P62B 2OXRA 4HLUA 1Q44A 1U8AA 1Z0IA 2WMOB 3BH7A 1F2UB 3A4NA 1P2UA 2R6CA 4A82A 3RVBA 3THYA 1U2RA 4GP6A 5JWRA 4PPNA 5JMTA 5FI1B 2OFXA 3MGCA 3A6PC 2ZPTX 4A0RA 2WJYA 2YVUA 5AR1A 4ZO4A 2ZYUX 3T1TA 3FPAA 1IN7A 3K9NA 3QF4A 3VNUA 3EZFA 1NN3A 1XX6A 3DM9B 4KI0A 4CEIB 2R6GA 1N25A 3DOEA 3BK7A 4FMDF 3VKGA 1HTWA 1Q20A 1QVRA 4ARZA 3TKLA 1QVAA 3RRMA 2O8CB 4KITB 1GG2A 2C9CA 3I73A 1NKTA 5J4VA 5DI9A 1JJVA 4PXAA 3NHBA 1T0JB 1WCV1 4PHTA 2GJAA 5J40A 5KDLA 4MRVA 3RRZA 4GI7A 4G1UC 2IX3A 1E4YA 1T3LA 4G5QA 4OHWA 1U0HC 3CPHA 3L0IB 2V6IA 4KFTA 4LV6A 3ND8A 3MSXA 4S2EA 4NCKA 4ZKEA 1KI1A 3T1VA 3A36A 2DWOA 3L0OA 3LX5A 1M7GA 4A4DA 4DIDA 3SBEA 4DLWA 1OE0A 2XXAB 2DYKA 3KXKA 1KO4A 3A58B 4DSTA 2PZFA 1E2HA 2J7KA 2IEZA 4LRWA 2F1RA 5HE8A 2FFHA 3BH6A 4M53A 4C0BA 2IXGA 4M1KA 4Q4JB 3R8CA 1ZNXA 2EWWA 2J59A 1TAGA 3AVOA 1XCGB 4V0NA 1E4VA 5FR1A 4DVGA 4LC0A 4MQBA 1HH4A 4JKYA 4M21A 2VSXA 4M9QA 4S35A 2JJ2A 2QM8A 4TT3D 4BLTA 1G16A 2ANCA 3IGFA 1CP2A 2CK3A 3AGPA 4QJ3A 2QN6A 4ASUA 3SU8A 2ORWA 5L3SB 3Q72A 3QQ5A 4CDGA 3GLFB 2GILA 4Z1MA 1AGRA 4MH0R 2WVJA 3UKDA 2NPIA 4II7A 5EUMA 4TMVA 3U7EB 5FBLB 3I32A 4HLDA 5CIWA 821PA 5FTLA 1T5LA 1M7HA 1JEDA 5C4MA 4PO1A 1E2GA 4PPGA 4HLQB 2QAGA 2VEDA 4O3MA 2KBFA 1E2NA 1O87A 2VQSA 1G6OA 1RJ9B 3B1VA 4M1TA 2RAPA 4G5GA 4ACAA 4K81B 1KYIA 2A7QA 4BPBA 2O0JA 1XEFA 1GNPA 1TU4A 3THXA 4XVUA 4I1OA 1ODFA 5LBIA 2NO6A 1DO0A 2ZU6A 3AF1A 3PITA 4FMDB 3CLVA 3SHFA 3QXCA 2C9OA 1VMAA 4N1AA 2AK2A 5K8LA 3WRXC 1TQ6A 5DE3A 4NE2A 4R98A 2XITA 2VA8A 5EZ5A 1J7KA 3LBIA 1SKYE 2WAYA 3I3SR 1ZP6A 5JWHA 1MRSA 4B6FA 2BHRA 1RC8A 2EVWX 1RYFA 2ZI4A 3B1XA 1S1MA 4LYAA 4IVPA 1UJ2A 2IS6A 2PJZA 1VECA 3NBYC 3LXRA 3FOZA 3NH6A 3SE0A 1DEKA 1KIMA 2ZSEA 4M1SA 4RD2A 4Q4AA 1OXUA 4DLXA 1KDPA 2B7CA 2RB4A 5FTKA 5EXSA 4A0GA 1X6VA 4AD8A 4A36A 1W46A 4LPSA 3S1AB 2BBOA 1XXHB 2ZI6A 1W0KD 4DLUA 1SGWA 3CR7A 3GCGA 2QE7A 3ZIAA 3CUEF 2ZYVX 4KYIB 1YR8A 3QPVA 1ZW6A 4JS0A 5SZKB 3UATA 5FUVA 3QBVA 2ODNA 3KJEA 1G7CA 3PUVA 4Q19A 3WMEA 3DKPA 1FP6A 4ZCIA 4RFVA 2AFHE 1OHHA 4Q1FA 1AQUA 4H9GA 1Y63A 3FFAA 1AKEA 3V4FA 4M2LA 1A2BA 3CW2A 3U6BA 1LTQA 3A4MA 1R0YA 4XD7A 3SJAA 1J90A 2WWHA 1E2KA 3RWMB 3ZS9A 3A8TA 2C8VA 1E9EA 4AKHA 2ZR7A 4CW7A 4ZDJA 2XXAA 2ZITA 1I4TD 1FL9A 2ATVA 1G4UR 4PZLA 5G40A 2QMUA 3LNCA 1RVDA 3OEED 2WJVA 4HATA 3CX8A 1NVWQ 3HR7A 2E87A 3O8BA 4QGHA 1UEJA 1WP9A 1F48A 3KB1A 5M04A 2YOHA 1CR4A 2ZJOA 4EAQA 1P9NA 4QNRA 4EUNA 4JJZA 2OZEA 1XJ0A 4QHSA 4RZXA 4XIGS 4TZ6A 1EWQA 4Z54A 3G0HA 2JLVA 1W2GA 2C77A 4EJSB 4KO8A 1E2MA 2QE7D 1MABA 5FPSA 2QRZA 1G8FA 3T06B 3F3YA 1FNMA 1XTSA 2BMEA 4W5WA 2B7BA 3OFND 1ZD1A 1P2VA 2WWYA 1W5SA 3DMNA 3P27A 5EXTA 1P3JA 4URUR 4DB4A 4P4SA 2Z6VA 3AV0B 3H86A 2C9YA 1WQ1R 1KI6A 2VL7A 5E3HA 3P32A 2CCJA 2FV8A 1DELA 1NI3A 4HAUA 4LJ6A 2JA1A 4D81A 1Z07A 3OE7A 5FUWA 1I2DA 1YR9A 1GNRA 4BEBA 2WPDD 2ZXUA 3KKMA 4MDEA 2KI5A 3TR0A 4URVR 3PXGA 2OO7A 3SFZA 3NEJA 2VLIA 2OT3B 3ASYA 1CRQA 2GDJA 2W2TA 1C4OA 3C7KA 4Q4HA 1N6NA 3FHOA 3QG1A 2FFBA 2GCOA 2X2EA 4JKIA 2JAQA 3HYRA 4PAQA 1XP8A 2ZI7A 3SYNA 5F3WB 3THYB 1HT1E 1ONBA 1KDOA 1QG2A 1R6BX 5FBVB 4CEJB 3R20A 4ZCMA 4NONA 4HYYA 1SVOA 4C0SA 2UVQA 4P4TA 1MR3F 5GJWC 2ONJA 1G5RA 1NKSA 4JLNA 1MO4A 4BFWA 3VTKA 4DCNA 3KKPA 721PA 2PMDA 3Q7QA 3PFIA 5CLLA 4D2IA 3V4RA 3AF3A 2X77A 4BQSA 4BE7B 1NBME 2H7VA 1Z3IX 2MMGA 3EA5A 5EP2A 5B30A 3IUYA 3U7GA 3O8RA 2X8AA 1NVVR 4B3BA 2FPMA 4HAVA 4BRUA 1TNDA 3CWQA 3P26A 5KSYA 1S3SA 4RCZA 2A30A 3AKDA 1SULA 1BYIA 3EXAA 1E1QD 1P73A 3NWJA 3GFPA 2V1UA 1DARA 3PUZA 3RRYA 2VHQA 3WMGA 2JGNA 2O0KA 2AKYA 1G9XA 2QP9X 1IQPA 3MJHA 1L4UA 2ZYWX 3IO3A 3KKQA 4A8JB 3ZVRA 1P2TA 3JVUA 1Z28A 4IFBA 3U3KA 3B1WA 4OQXA 3U2QA 1FMLA 4KU4A 2EFEB 2J0VA 3KFXA 3PUYA 4ZPXA 1TEXA 1YRBA 4R7ZA 2HXSA 3AF4A 3R7WB 4BZXA 5B64A 2E1RA 3VR4A 1XEXA 2BKUA 4D4KA 3B78A 2Z0MA 6Q21A 3QF4B 4EIWA 5HZHA 5J4KA 1E98A 1XCPA 2QUZA 3ZS8A 1DAMA 2XOKA 4ZDIA 3EW9A 4URXR 2D4HA 3PV0A 1HEIA 2DFNA 3H2YA 3H1TA 3UIEA 2VIIA 1QHHA 4QBFA 2DFTA 3QKSA 2NGRA 3KQHA 2GZHA 1CTQA 1G8HA 2ZS7A 2XSZD 4Q47A 2VHCA 3I61A 4K8OA 2DWPA 2QMOA 1ZM4A 2YWGA 5KPDA 3UMSA 1E1QA 1FPMA 1HYQA 3GJ3A 3PIRA 1EFTA 1RW4A 5AK0A 2AX4A 4WBSA 3TIFA 1NVXQ 3K0EA 3CF0A 3B82A 3LD9A 4QXAA 2F9LA 4C0LA 3ZYCA 4LYFA 1FOEB 2DHRA 2RGBA 3N70A 3T5GA 3I5XA 2HYIC 1XD2A 5GJBA 3GQBA 4DCSA 4M8NE 1P60A 2GEVA 4I1UA 3WP0A 4JYBA 4TLDA 2QY9A 2ZE6A 2IT1A 2MSEB 4OQFA 5FBRB 2LKDA 3MD0A 2IYLD 4O0MA 2ZRHA 3KX2A 3GFOA 4UJ3A 4A6PA 4ASUD 1CS4C 2QM7A 1IONA 5TVKA 3DDCA 3Q5EA 3FE2A 1TPZA 4BFSA 3FMIA 1FQJA 1NBMD 4B2LA 2CL0X 4QHYA 3VX3A 2EFHB 2XOKD 5HR5A 4U7DA 4KBGA 1MOZA 2CNWA 4YC7A 1UKVY 3UK6A 1GRNA 1YZQA 4DJTA 5J4YA 4XTCS 2WJJA 5FOXA 2WOJA 1Q21A 3ND9A 4RZUA 1RRFA 3CRVA 2OCPA 3GLFA 2DR3A 3QF7A 2ODWA 4CRWB 1XMVA 4LPKA 4QHTA 4A2QA 5CB8A 3L2OB 5EXPA 3TUIC 3SQXA 4OI0A 1JJ7A 1I2MA 1Q1EA 4JL5A 1IAQA 5B57C 1AS0A 3NTUA 5IT5A 4A0HA 3CR8A 1BIFA 1ZUHA 4A2WA 1SQ5A 3X1WA 4XJXA 1UAAA 3C16C 4QM7A 3AH8A 2D2EA 3OFNA 1J99A 1N6PA 2OLKA 3F5FA 3WBKA 1GIAA 1G41A 4Q9KA 5UKDA 1W36B 1IXZA 4WXRA 4GPTA 2ZRFA 2G1KA 3IPXA 2WHXA 3RS2A 1G291 4I4LA 5FTNA 3AVXA 5F9FA 4PZYA 1L4YA 1X3SA 3FTQA 1BMFD 1D2MA 3DKVA 1KO8A 4GOKA 4KAXA 1E2DA 5TARA 4LY6A 1Q1QA 3UG7A 1G19A 1EX6A 4BFUA 1KK3A 1CIPA 2D2FA 4CGZA 4WXPA 4FINA 2R2AA 2NO7A 3CB4A 4Q4LA 2XZLA 3O47A 4J0QA 2PJRA 1RZ3A 4BFTA 1B23P 2V3CC 1N6RA 4TTQA 3OIVA 1II9A 1RJ9A 3T35A 2J87A 1PV4A 2VF8A 4AWXA 4ZDKA 3QNUA 2CHVA 1OHHD 5CM9C 1DAGA 3VHXA 2ZJ2A 1KK2A 1UBEA 5JI2E 2BCGY 4BLSA 2BWJA 3VU9A 2GRJA 2PT5A 1KMQA 4AY2A 1YE8A 4Q00A 3UMFA 2JIZA 3HU2A 4RFSA 4OQNA 4KJZA 4RJLA 2EW1A 5EE3A 1DAHA 4PHFA 2KSQA 1G21E 1P2SA 3CPEA 1Z2AA 5J4HA 4MKGA 2A5FA 4NCJA 1OFHA 1NLYA 1FTNA 5L3SA 4P4SB 4E5UA 4OK3A 2XJ4A 3QXJA 4W9MC 1KZ7B 2CBZA 4HLCA 4R2HA 1T6NA 2ZRLA 1N6IA 2BDTA 1D6JA 1GZSA 2Q9BA 4NCNA 3CX6A 1E3MA 1R8QA 1D9XA 2K5UA 2F1HA 2QNRA 4LBVA 2AFIE 3IQXA 1QG4A 1W47A 1M8PA 3CPJB 5FPKA 3OIUA 2WV9A 1LV7A 4F93B 1NRJB 1E2EA 1JNYA 3I4LA 1COWD 5CJPA 3F0TA 2MMCA 2WSMA 2XB2A 5LD2C 4OL0A 1W7AA 4TLAA 3FYHA 2FDCA 5CK5A 1KAGA 4CIDA 1M1YE 5K8UA 2B8TA 4V03A 1Q22A 1DVRA 1S96A 4US0R 3MWYW 4FCVA 3REGA 3R7WA 1E9SA 4HAWA 3X2SA 1H8ED 3VAAA 3AQ4A 3LWNA 4IHQA 2QT0A 2QTFA 2ZJZA 1XTRA 3QI2A 4NBSA 5KSPA 4US2R 5H1YA 1N5IA 1KO7A 2HJVA 1E99A 5DIFA 1FTSA 1XMJA 4TTRA 4B71A 1I4LD 4E07A 5HCIA 2ZUDA 4FMCB 3PEUA 5C1BA 2J7PA 2YWHA 2G0TA 1G7TA 2F9MA 5D3MB 3R9IA 4B47A 4TN1A 4C9BA 1SXJD 2F6RA 2QPOA 4LHXA 1VTKA 4MKHA 1OFUX 4Z1MD 2XNDD 1HA3A 4EPVA 3AF0A 4JVLA 3U44A 3IEVA 1N6LA 1EGAA 1NMZA 3TUZC 1IN5A 1R10A 4UKDA 2JDID 121PA 1AN0A 3QUSA 3CRMA 1U0JA 2Q21A 3WNBA 2H57A 3CRW1 4I81A 1VDZA 1ZRHA 3TAUA 4BGDA 5J5CA 4QFMA 2QBYA 4JLOA 5EXXA 4XVRA 3TW4A 3B7GA 1Z63A 3VNVA 4YDHB 3QVUA 2YKGA 2BBWA 4NPHA 1XEXB 2OG2A 1OFIA 1P6XA 2GCNA 3ZQ6A 1V43A 2PT7A 5FL7D 3IILA 3K1JA 4BFXA 4V02A 4X8LA 2BBTA 1GVNB 4JT2A 4JLJA 1ESNA 1KI4A 5L8VA 3LX8A 2CLCX 4QJ5A 5KSZA 2GZDA 2R44A 1KI8A 4FMBB 4Q4JA 4W5HA 2WJIA 1EFHA 3T12A 3SS8A 4L8GA 4EPWA 3HU3A 3EA0A 2R65A 3SZRA 1Z83A 2IK8A 2J0UB 3B1YA 2FSFA 3UWOA 1Z8FA 5IHPA 4GNKA 2OAP1 4URWR 1IJFA 4B3CA 1SVSA 4PR0A 1G8YA 2V7QA 2ONKA 4FD2A 5LDDC 1G1MA 2UKDA 2G3YA 2RHMA 2YYZA 1WRBA 3LFUA 3QOFA 2FGJA 1PLLA 4LBYA 5JSZA 3THWB 1YZGA 2DWQA 2IYQA 3KQKA 1E2PA 3M6AA 3VKWA 4HZUA 3I62A 3CF2A 4PC2A 2O8BB 3UANA 4D0GA 1K6MA 1UKEA 2QAJA 4QGGA 5FOSA 3K0CA 1NJGA 2OAQ1 4JMPA 1GKIA 3U60B 1E2QA 3A4LA 3FB4A 2NZ8A 2CJWB 3QSYA 4A15A 3MCAA 1Z6YA 621PA 1VCOA 4HZIA 1ZIOA 1KJZA 1KSHA 1RFLA 4HAYA 5AUNB 2AR7A 4TQUS 4OKSA 1WF3A 2UZ3A 1XEWY 2X2FA 4DEXA 4DT1B 4OYHA 1M74A 3EC2A 4IEEA 1FX0A 2FFQA 3F8TA 5CM8B 3THWA 5FL3A 1BMFA 4D82A 3ADDA 1JQJC 3T34A 4BUJA 1EESA 2ZS9A 3PUWA 5IF9A 4B32A 2F1JA 3BD9A 2ORIA 4IVRA 4JL8A 3OZXA 3DL0A 1W36D 2H18A 2PCJA 3TVTA 4URZR 5TB5A 2GVDC 1YZNA 2XZPA 2JJ8A 1KJWA 4GOJA 4FWIB 4DXAA 2FPLA 3AVVA 2VYFA 2QORA 1S2MA 3LRPA 3WMFA 4AG5A 3R9XA 1VHLA 1DS6A 1GITA 1OIVA 1H8HA 4Q9LA 2IYSA 4Q7MB 4B73A 1KI9A 2P6RA 4CF7A 1L2TA 1U8YA 5KNCA 2PBRA 3ADCA 1ETUA 2IYUA 5FPTA 4M1MA 3WXMA 1QZXA 3SBDA 5GVSA 1OFTA 1U0LA 3T61A 2OXCA 4PC3A 4IFEA 2OCAA 1Q12A 3NG1A 1RPZA 1AGPA 4WA7A 2FZLA 2VSOA 3VU9B 4HUQB 1VG1A 3TQCA 4KODA 4FN5A 5TXGA 4Q48A 1Z6TA 1CJKC 3W5IA 3KQNA 3CM0A 4ZIRA 3ZH9B 4CZ2A 1XTIA 5A5GA 1JAIA 3PENA 3GP8A 3B9PA 3TBKA 4HSEA 4DLVA 4DRZA 4YMVA 2ZAOA 3A37A 3HP1A 2H8KA 3NDBB 4HI0E 2NQ2C 2VP0A 3U3MA 2ZRJA 3L8ZA 1T91A 4RD3A 2O8CA 2C5LA 1KK1A 3LBNA 2WMNB 5CK4A 1HV8A 1OXXK 4LHVA 3MMPA 1F2TB 4BLOA 3SYKA 3EAQA 4N0DA 2Z5FA 4Q02A 1E9DA 1KGDA 4LJ5A 5CLQA 3KFVA 3SNHA 4D26A 1LVGA 1UPTA 1GAJA 3GLFE 3DO6A 2CCGA 3B85A 2XTMA 5HTKA 5DGXA 3TVDA 4N0EA 1U94A 2D3WA 1E0JA 1NMXA 4D4MA 4TL9A 2EFGA 3CX7A 4DSOA 3ZVMA 3B2EA 1G7RA 3PQCA 3L82B 3QXSA 1YU9A 1AJEA 4DDWA 4IKEA 3W34A 2WJHA 3K0SA 1IN6A 2RGEA 4FXPA 1XPOA 1GFIA 4IDOA 1G3QA 1HY3A 3K9HA 2H16A 4V0ME 2OSBA 1R5OA 2OILA 3E70C 4NP6A 4O2LA 4TT3A 1KTVA 1AS2A 3NDPA 1N6HA 4M1OA 1PLKA 3NBFA 3C8UA 1TEVA 2YWFA 4EPTA 2CVHA 1PUJA 2IS1A 3A1VA 5KTYA 2O0HA 2D7CA 2R8RA 1XB2A 4MRRA 4UQOA 2RGGA 4JLAA 3M0EA 3W3ZB 2IWRA 4EQ6A 3GJ8A 2ZSBA 2ZR9A 3ONWA 3IBYA 2EWVA 4QRHA 4MYUA 3MAAC 1DE0A 2FH5B 3AGQA 1M34E 3T1QA 1YQTA 3LH5A 3UMRA 1AS3A 1A7JA 4JYCA 4LHZA 3RANA 2ZJ5A 3FHTA 2QPAA 2YC4C 2C96A 2JLXA 4IOMA 1KSGA 3X1DA 5JWOA 1PZNA 1CXZA 2W00A 5FUXA 3BC1A 2P67A 4OI2A 5IDVA 4DHEA 3CBQA 5JCZA 1Z6GA 4JBXA 3U6KA 2O8EA 2NMVA 5EE9A 4JL6A 3SFVA 2IF2A 1R7RA 3N2EA 1E94E 2PX0A 3PCRB 1NY5A 2OCYC 2C95A 3C15C 1JECA 4EFLA 3FKQA 4JIMA 1YZKA 4BEJA 2R6FA 4B34A 1C1YA 3EC1A 3O8DA 4Z51A 1DO2A 2P2LA 3GJ4A 4TMKA 4BLRA 1MABB 3WHKA 1G17A 2NPFA 2OESA 3WHLA 4Q9IA 3U61B 1S0UA 421PA 1TQ2A 2C03A 3QJYA 4TWZA 1G3RA 5CB6A 4JT4A 4W7SA 4NYJQ 1M7BA 3IHWA 3P20A 4OHZA 3W8RA 5JI3E 3WBJA 2HXYA 4LOAA 1G4AE 2FEMA 2OHFA 3LVQE 3SC3A 4TQ9A 2DB3A 4OBEA 1NN0A 1SHKA 2CL7X 2ZJAA 2JLQA 4Q7LA 5AJWA 4YMTA 1LW7A 4WW0A 3TSZA 2G88A 1AIPA 3HR8A 2VP9A 4D80A 1DAKA 4HB3A 1QHYA 1RYHA 2VO1A 4HLUC 5AJYA 4DZZA 3AVTA 2YINC 4JBYA 3NXSA 2CLDX 3QBTA 4Y0VA 2GEUA 1AZTA 3VHLB 3REFA 2GXSA 2HJGA 2VHUA 2XTNA 3TGPA 5FUYA 1FQKA 1XZQA 5AJXA 3GEIA 3X1YA 2F3RA 2KJQA 4IDNA 4WAUA 4HDCA 4POAA 5IK2D 1SXJE 2ZREA 2V9PA 2QP3A 4HB0A 4HB2A 1UKZA 5CJ2A 2ZM5A 4UNPA 1F2TA 4DBLC 2GBLA 2CCKA 4ITRC 4MGKR 3W90A 5JZVA 2QQEA 3FMFA 1OIXA 2XTZA 2KBEA 2AD5A 3IBGA 1MT0A 2EU8A 4LJ9A 4PQRA 5CDFE 2W6ID 3WNCA 3K70B 1BOFA 3D8BA 1DADA 4KLNA 2G0NA 3WYAA 3TAHA 3L0PA 4TYWA 1TX4B 2N46A 4MYCA 1D5CA 2GXQA 2ZTSA 2Q3MA 2X19A 1J8MF 3G5UA 2WOOA 2CNWD 2O8DB 1T0HB 4G3XA 1G7SA 2A5DA 5AUOB 1Z6XA 2GZAA 4XSHA 1ZU5A 3AVQA 4XVQA 5FOWA 1H8HD 1ZYUA 1TUIA 1XPRA 3DEFA 4WZBE 4B3GA 1H8EA 3HPQA 1E0AA 3SQWA 2ZETA 1E32A 1UDXA 4CEJA 5KDOA 4BFYA 4B2IA 2VP6A 3JZMA 1Q3TA 4TL6A 2QENA 3KTAA 4GFDA 2HCBA 4F4CA 4ON9A 1ESMA 1NY6A 4JLMA 1Z0DA 2OCBA 3ZJYA 4JZKA 3ZIAD 1IXSB 4HDOB 5EE0A 5P21A 5DN6D 5TV2A 2VH5R 2P5SA 4RKEA 4LGMA 5FH9A 2WIAA 3EIEA 2BEKA 4LJ7A 4B35A 2WWWA 1FFHA 5SZIA 2PEZA 3GLIE 2QQ0A 5FOTA 2JLZA 4C2UA 2XNSA 3EZ2A 4YMUA 3CONA 1MO3A 1K5DA 4AI6A 2JJ1D 3LY5A 1F5NA 1NIPA 2CVFA 4UXHA 3LW8A 5HE9A 5JLJA 4QL3A 4U5XA 2CLSA 1ZM3A 1VCIA 2FN4A 5LB4A 4EQ6B 1FUUA 5EP1A 3L0SA 5L3QB 3WRYC 3K09A 1N0VC 1QHIA 3C14C 4QNMA 3I8XA 4C7OA 3FGNA 3OEEA 2ERXA 5DNYB 2B21A 4ZKDA 1CLUA 3HPRA 3HYTA 1NLZA 3K0AA 1ZM7A 4MKFA 1XPUA 1Z6AA 1R0ZA 4MITA 2QTVB 1W4CA 5F98A 3K8YA 2BVNA 4GP7A 5AUQA 3SHWA 1CKEA 2C78A 2W83A 3GJ6A 4PSKA 4AYTA 2FMXA 4FI3C 4UNNA 2YOGA 1OKKA 1OSNA 2YOFA 4AKIA 2DBYA 4BZPA 2W0MA 2P5TB 5KDDA 1EX7A 5A0FA 5AUPB 2W6JA 1U9IC 2WSSA 2MSCB 3KUCA 5LB2A 2GAOA 2PL3A 4F91B 4HB4A 4M9ZA 1M2OB 2ZYTX 1T8UA 3RC3A 3VR3A 5G53C 3MUFA 3BWDD 4XSGA 1ZIPA 4ZDWA 3SDZA 4URYR 3PJRA 4H1VA 1OB2A 4MA4A 1Y3AA 2ZROA 2P6NA 1RRCA 4Y0AA 3C5CA 1M6NA 1R8SA 2QT1A 2RMKA 3PUXA 3UPUA 2QEQA 1QBKC 1OH8A 1DPFA 1S4QA 4DT1A 2L0XA 1MO6A 5DLQC 1W2HA 2PLRA 2ZJ8A 4NU0A 1Q1BA 3CF6R 4LDJA 3PEVA 1P5ZB 3B8HA 4FMCF 4UXJA 4I99A 1ZVQA 5C18A 3TJZA 1OLOA 1OT3A 1WBDA 4TQAA 4LZZA 3ZGXA 2QPTA 2WSSD 1II8B 4F7WA 4QG7A 4EKDA 4KSBA 4ESHA 5JSZB 2XNDA 1CU1A 1DTSA 2B8WA 1D2EA 1W4BA 2J1LA 2ZAMA 4TSFD 5BN4A 1FMJA 3BGWA 3THXB 4GL2A 1MKYA 2GK6A 1G20E 4PFSA 4JVSB 5HKKA 1NG1A 5E7IA 4TLBA 1UADA 2BV3A 3BAFA 4RCYA 1FZQA 3MWKA 3QPUA 4PPQA 4ACBA 1TMKA 2OFOA 2YNMA 2XAUA 3ASZA 1LS6A 4F92B 2GTPA 2AK3A 3C5HA 4G5RA 2GJSA 4QBHA 1D2NA 3TSWA 3BH0A 5CITA 3VKHA 1CJUC 2ZQ5A 2FSIA 1XMIA 4CYMA 4NH0A 3VR5A 2IBMA 1ZUNB 3Q5DA 3TE6A 4NYMR 2OV2A 3N5CA 2BJWA 4DLYA 1SVWA 3Q8XB 2JEOA 1F2UA 1S8FA 3LXXA 4LWZA 1TF2A 4TYYA 2O8FA 1VYVA 1VG0B 3AKYA 3EARA 3MJRA 3VR2A 1X86B 1GUAA 2FE4A 3RDPA 3AVYA 2O8EB 4TMTA 3FMPB 4EFMA 2NO0A 2FWRA 4PQYA 2I4IA 4GZMA 1V5WA 2YZ2A 4KVGA 1DAEA 3VQTA 5B58C 5KNBA 1X1RA 3P4YA 3RLFA 3WYGA 1P75A 2Q0HA 1NN5A 3D31A 4A6XA 3CNOA 3GLIA 2IYZA 4AKGA 2G6BA 3T5DA 1EK0A 3DMDA 5JHHB 3TR5A 4Z8YA 1W44A 2QU8A 4CT4B 5L3VA 4LJAA 1E9BA 1SXJB 3EIHA 4P32A 1ZM2A 2B92A 1US8A 3BOSA 3K0FB 2QTHA 4W5JA 1VIYA 5J4LA 4IXMA 5DYGA 1EFUA 1R5BA 1XBTA 2BJVA 2F55A 3B6EA 3VFDA 4OI1A 4B43A 1A82A 1OXSC 2G77B 2OEPA 5FTMA 4R71A 4JSYA 2WM9B 4BRWA 4JVMA 5H68A 4MRNA 4C0KA 2ZU0C 3GJ5A 2QAGC 4ZCLA 4AYXA 1Z0AA 5GADl 5KU1A 1ZU4A 3AP1A 1TQDA 5HCNA 3L8YA 2ZANA 5DN6A 4A92A 4JLVA 2FEOA 2H5EA 2NOAA 4P4UA 5TY0A 3U5ZB 3AF2A 2AD1A 4US1R 3DZDA 4KFRA 1E9RA 1SVIA 1YHNA 2O8DA 2YWEA 3R8FA 2IA5A 1SVMA 1CRPA 4RFSB 1NLFA 1MRNA 3NBXX 2ZE7A 1KI6B 1BH2A 2C04A 2PZEA 4B3XA 4AYWA 3BORA 2J9RA 1ZNWA 4X8MA 1G3MA 1J70A 3ADKA 2GXAA 1PLJA 2PX3A 1T9HA 4F4JA 5JECA 2Z43A 3HU1A 4M4SA 2ODEA 2O8FB 1JALA 3IPYA 3RABA 5DI3B 5DHAA 5EP4A 3I8SA 4V0OA 3CH5A 5C46F 3B13B 2JATA 2P0EA 4PHGA 1A2KC 5BW8A 3IEUA 2ZUBA 2HT1A 1XD9A 2QI9C 1KMHA 4RY2A 3CO5A 4JLPA 2QMHA 1XCMA 3MG9A 4B6EA 5BN3A 5IRCD 1OV4A 2HDNB 1LY1A 4H1UA 4OHVA 2HUPA 3ECCA 2QGZA 3CWZA 4TYQA 3A1TA 1WDTA 3UG6A 4Q1CA 5EP3A 2HV8A 3MWLA 2VHJA 5KOYA 2ZE5A 1IY0A 2BM1A 1RRPA 4AG6A 4B48A 4Q5IA 4RKFA 1U90A 2YV5A 4MUAA 1SKQA 2EYQA 2DCUA 3ICEA 1XJQA 1CF4A 2NTYC 3VR1A 2WWIA 2HEIA 2JCSA 4JBWA 5C2JB 4AURA 2V1XA 4D4LA 3VR6A 4IDQA 4TL8A 1X8JA 1U99A 4A1FA 2ASEA 2I1QA 3P1JA 2ZJYA 2HLDD 4N3NA 2BBSA 2W6JD 3C4JA 5FBQB 3BE4A 1GL6A 1CULC 4Z8XA 2YC2C 4NKRA 2FG5A 5E95A 5L3RA 3DVLA 2ERYA 4RZ3A 1XRJA 5DO9A 1X8LA 3GLIB 2DPXA 2VTKA 4TTPA 3QEOA 3BFVA 3ZDQA 4DLTA 2VP2A 3TSOA 3QXXA 2SHKA 5K8IA 2FFAA 4OHYA 1JPNA 4LI0A 2AXNA 4R2IA 1XWIA 1UBFA 5HKKD 1JQLB 1FX0B 1HQCA 2CEAA 4LJYA 2V55B 3BJIC 1XDBA 3EWSA 1GDDA 3UXMA 4Q1DA 4FWTA 1Z06A 3AB3A 2IYWA 1GTVA 3GJ7A 3OEHD 1E6CA 1IN4A 2ZVPX 5JJKA 3AP2A 4JLBA 1IXRC 1UBCA 1F3OA 3FHCB 4JSTA 3RWOA 1R0XA 3DPUA 1VYUA 4TSFA 4E03A 4ERNA 3RHFA 1WXQA 3U4QB 4KBFA 1AZSC 2E9SA 1KDTA 2AWOA 2VHTA 3TQFA 1XMSA 3SYLA 1ZD9A 3V00A 3GJXC 3D7MA 2GNOA 5AJVB 2HLDA 1NVUQ 3BFXA 4L16A 4YONB 1XU4A 1MH1A 2W6IA 1DBSA 3THOA 2WPDA 4B3FX 3IQWA 3U7HB 4IDPA 3HDTA 1ZINA 5A4JA 1TF7A 2F43B 4DCVA 4V0LA 2OUKA 3TLXA 3W8NA 3MFYA 5DI3A 1NP6A 2IXEA 2A78A 3L43A 2IS2A 3QKUA 4TMXA 1IY1A 3IIJA 4YLGA 4KXFB 2FU5C 4PTLA 1HE1C 2BCJQ 2CMKA 2AWNA 2V54A 2PH1A 2BEJA 4JLKA 2ZRCA 4Q01A 5BYJA 4M9SA 2D7DA 1XZPA 1J2JA 2F7SA 3B1ZA 2RKOA 5HZKA 4V0MA 3O8CA 3NVAA 5ANRB 1JR3D 1SKYB 3GEEA 1N5JA 2NIPA 3RS4A 2B6HA 4P31A 3CRRA 4DCTA 2J7PD 2HF9A 4NL4H 5L3QA 1L8QA 4PX9A 2VP5A 1OJLA 1Q0UA 1NSTA 1K5GA 2GA8A 3QG5A 4L5BA 4DSUA 3BIFA 2ZVQX 3SN6A 4A9AA 3BXZA 3K9GA 4HUQA 2RGNA 1Z08A 2OBNA 2WKPA 3GD7A 4X8HA 3SI7A 3AM1A 4EPXA 1DAFA 2QP4A 4E22A 1XF9A 2GJ8A 3W6PA 1Z29A 1ZM9A 1JBKA 1YR6A 3NC0C 5JEEA 3H4MA 3LQQA 5DH9A 5J47A 8OHMA 4C3ZA 3G82C 2PLFA 4BECA 3BFKA 3QPWA 2W58A 1II0A 3E5HA 3RSOA 2GVZC 1X1SA 1IHUA 1PJRA 1E0SA 4LV8B 3TUJC 4IEIA 1KAOA 2CK3D 4MYHA 3AUXA 2J46A 4DLSA 4L9SA 3GLGE 1OKKD 1S3GA 1ZC3A 1U98A 1W0JD 2WKRA 2ZI5A 3GLHA 1YR7A 1KY2A 2EQBA 3OESA 5BWMA 3AVPA 3B60A 3RSLA 1NG9A 4WZAE 1XTKA 5FI0B 4G5OA 4UJ5A 2AXPA 1VKJA 3LLUA 3RS7A 4LYHA 3LA6A 2GHIA 4GZLA 2FJUA 3BERA 1U81A 2P65A 1G64A 2WAXA 2V7QD 4JLDA 1KMHB 5EUQB 2BOVA 2GF9A 4BLQA 3DHWC 4JVNA 3R9WA 2DFLA 2Q9AA 3EPKA 2PCLA 3KXLA 2QZ4A 2J45A 4K46A 1YZUA 2IYRA 1UM8A 3D3QA 4OK5A 1W48A 4EPYA 4DLZA 2PEYA 3EWAA 4B75A 2XB4A 1RIFA 5JRJA 1HT2E 4A8JA 1Z0FA 3KTAB 5HPYB 3ZVNA 2O52A 1A5TA 3LBHA 4YMWA 4LJ8A 4KYUA 1SXJA 4NMMA 2KWIA 1LB1B 1DAIA 1ZNYA 1N2CE 1WMSA 3MLEA 2A3RA 4M0LA 1X8KA 4XWAA 5JS8A 3EPJA 2WZQA 3KQUA 5FFMA 2J41A 1RRGA 1AQYA 1ZAKA 3PVSA 4IRUB 2RGDA 5FR2A 1JAHA 1LF0A 2ZUCA 1Z0KA 2Q3FA 3MRSA 2IYTA 4BLPA 4C0QC 2N1BA 2IYVA 2CHQA 1GRQA 1VHTA 3UWKA 1LS1A 1W4AA 4I1SA 2QROA 1KJYA 2G1JA 3LO5A 2IS4A 2JJ2D 4DEYA 1KO1A 4NYIR 4QM6A 2ZR0A 2IHYA 2QSZA 1G18A 2XJ9A 2J3EA 1KKMA 1R2QA 4GMDA 2A9KA 4Q1AA 4B76A 2FX3A 1COWA 2A2ZA 1IN8A 1QHGA 3GMTA 2QAGB 1WB9A 4LSGA 4PAMA 4D0LB 2VRWA 4GDFA 3IKJA 1LNZA 4QBIA 3I5YA 3Q3JB 2R9VA 3W3AA 2XGJA 1YRAA 4HEJA 2XSZA 3T1OA 3SJCA 4I1VA 4MYTA 1JB1A 1L7VC 1P4SA 2BM0A 2FPKA 4BWYA 1XXHE 5KNDA 2HF8A 3QEJA 2H17A 4KVAA 4TZ0A 2GWHA 3KB2A
chains in the Genus database with same CATH superfamily
3VNQA 1L5YA 1L5RA 4IGAA 1KGSA 4OPMA 5EGSA 4AJNA 4ZJYA 3G9XA 4P22A 2D1SA 4RD1A 3WLLA 4EHLA 1BKYA 2IC5A 4NCAA 3WG9A 3WO1A 2H92A 4UHKA 3C7DB 4LDAA 4GR4A 3TLGA 3RFUA 2IF0A 1FFBA 4ZQIA 1GKYA 1Z68A 4YUYA 2J5XA 2X1VA 4MLZA 2RHRA 1RHUA 4JP3A 3IPRA 1T36A 1WO8A 3PFFA 4EJSA 2IXAA 3H8WA 4PGHA 1BEEA 4P0TA 1QYVA 1W96A 1XKXA 2X4DA 4R9UC 3T1YB 1B42A 1GO2A 1M8KA 3FYSA 1Y5RA 3LPDA 4RIGA 1G4HA 1QBGA 4RH3A 2BT4A 3R5SA 1UT5A 1OTHA 3KZNA 1J2TA 5ALQA 4KPUB 4ZV4A 1F6BA 521PA 3TEMA 3U49A 1DV1A 1I1OA 4XFKA 3RV3A 1B0UA 2NZJA 3S1AA 2P6PA 3EPLA 1HRDA 2J3DA 2ZIAA 3MJ4A 3PWZA 2NU8A 4DSNA 4ALJA 4R5MA 2HPZA 4H4CA 4BTEA 4PLHA 4L78A 1GGEA 2O4CA 4NDZA 4BWVA 3QIAA 1N5MA 1QZUA 3I34X 3QKRA 3RSZA 1QDEA 2RHDA 2XQJA 2GK3A 3H6HA 4DVJA 5C5EA 3KU1A 1UJNA 4N4AA 3FZQA 3PTLA 4EPRA 4NR0A 3N53A 4R8VA 3LYHA 3TGWA 1BVHA 2MSDB 4K28A 3GLRA 2Q6LA 3T3NA 4MR8B 3ZWNA 1T8TA 2B8NA 3DXFA 5FOUA 1UMBB 4YMSA 1YB4A 2Q3CA 2R6DA 1SD2A 5ADVA 2J6HA 4REQA 2ZJ3A 1E3IA 3GDFA 4RIIA 1EDEA 1PNOA 1FMCA 2I4MA 2V3WA 4MGZR 3U7QB 3F6RA 5HXAA 4AT1A 5B58T 4OQPA 3UMGA 1HFEL 1RKXA 1DG1G 4G4SP 4G24A 1CJMA 3R0QA 2QMEA 2YJTD 3TEFA 1XXLA 1FFXB 2IZ7A 1OYVA 2BMJA 2JLRA 1ZBDA 2ZRDA 5CYOA 3V2GA 5JFGA 4LK2A 2A5JA 5FPPA 5C5DA 1Z6QA 3B5JA 1GL7A 1E9CA 3F4LA 3PL1A 5AJUA 3ZY3A 4BEWA 3RF7A 2GS9A 2PX2A 2V3VA 5GOZA 4TKVA 1G3IA 2DJ5A 3ZLTA 1TQ4A 7MDHA 3KEMA 3CSUA 1PNTA 1L5HB 3ONEA 4GECA 4H0NA 2IPNA 1J24A 1GHTA 4J1NA 1WTCA 1WZEA 3IT1A 3HXQA 2BONA 3WQRA 2F8MA 3V42A 4XWWA 5EKUA 2R6HA 1NATA 4A1OA 3O9VA 4NNJA 4II2A 3T7CA 1QV7A 3CPSA 1VA4A 3PQ2A 1B1CA 1RWQA 4I9FA 2DF8A 3CZPA 3HVJA 3MEQA 4L3VA 4L76A 4O0LA 2K2QB 4PZZA 4BXOA 4WUVA 1RYYA 1WNFA 2IXBA 1NI4A 1RAAA 1RAEA 5DHQA 4CCYB 1O0BA 3M4NA 3FPLA 1V4VA 2XVAA 3Q6NA 1DFGA 1SXJC 3KB6A 4LZLA 3TK1A 4LZOA 1ZMXA 3AINA 2PZGA 3OHPA 3R3XA 2FX5A 4D4HA 1YKGA 1XN4A 1NDHA 2GZSA 4RO0A 1BHQ1 3SQNA 4L72A 3Q11A 4DG5A 5F73A 4QOIA 1H6DA 1IBRA 1NNSA 1RBMA 4UUQA 4CVNA 3QVKA 4KFUA 3SR3A 3CRQA 2AYXA 4HRXA 4NOJA 1XTBA 5BXQC 1QYIA 2PQ6A 1RHKA 4X3PA 1KYXA 1PFKA 5F64A 2R1TB 3IH5A 5ALSA 3KR2A 5KO2A 3RS5A 1KOFA 4Y6RA 5JTTA 2EP8A 4CEIB 2O2XA 4CM5A 2C29D 3KO8A 4Y2HA 5G0VA 3R74A 4ZOQI 4EY8A 4RIEA 2ZRQA 4OJYA 3HZHA 1FDUA 1A7KA 1SC6A 4FZVA 5B53A 1DJLA 3WY9A 4OHKA 2DKFA 2FZKA 3SXPA 1PV2A 1RQLA 5LNK6 1VSQA 4FYXA 1SNYA 1CQXA 1Z2CA 4XWYA 1JDUA 4WNCA 1UF9A 1YQ9A 4Z99A 1HFWA 5K6AC 3REQA 3TO5A 1VB5A 2GBGA 2QG6A 1U3CA 3AHGA 2Z8ZA 4L6CA 1B43A 1RRVA 4OQZA 4L3OA 1UBRS 3KDSE 3NBZC 3SHQA 1ZVMA 3PPYA 1OA0A 2ZJBA 4OLHA 1KU6A 1QVVA 1RPJA 1UC5B 2IELA 1QFJA 2RGNC 3OIWA 2Y3IA 2ZRGA 1MQ8B 5GGYA 4IH9A 1FW6A 4AQ7A 4MMXB 2AN5A 1Y3IA 1GFZA 1JQKA 3EGVA 2H54A 3AKCA 4DANA 3ZLVA 2QW1A 1NBMA 2VDWB 5AJZA 1Z7BA 5AT1A 4CLOB 2NTEA 4CKXA 2QTRA 2ECPA 3E7WA 1DB3A 4E09A 3OAAD 4EW3A 2W2KA 2IY7A 3LLMA 3VPHA 1WDLA 5KNBH 1B3BA 1B74A 1RQXA 1YKSA 4BFVA 5CFZA 4GLOA 3T7RA 3S8MA 3OZVA 4RD4A 3R0ZA 1ZBQA 5CBPA 2JVKA 3EZ9A 3G02A 4FQ5A 2X0IA 4RVNA 1XI2A 4GT1A 3NH9A 3G7NA 4BASA 5IFKA 4V3CA 1WWKA 4GI1A 4LGVA 5F51A 2D5CA 1MO5A 1J8YF 3I9JA 2AYZA 1S1CA 3ZDZB 5BP7A 2F64A 5DM1A 4F3CA 4OSOA 1ZJ6A 4U02A 2BGJA 4LHYA 2YN2A 3G2IA 5FTWA 3LUBA 2FFJA 1IOZA 3QENA 1AB6A 2C31A 2VHYA 4P82A 3U80A 4DLLA 4EA6A 1Y3BE 4BNXA 4FSDA 1NIJA 3UOWA 1U8UA 2AG1A 3WZ2A 2XE8A 3WHKA 5HWSA 5K05A 2P75A 2CXHA 3W6NA 4KFSA 3PEYA 3N87A 1VJTA 2JBHA 1Q11A 2C0QA 2V0NA 5BURA 3KKZA 1TAUA 3KQQA 5KCMA 3MJCA 3FSEA 4LW8A 5BW4A 3LWDA 4D8WA 1PEKE 2HRCA 4NG5A 4Q9NA 4Y2VA 5H0IA 4DDTA 5E2IA 4QBGB 4PICA 1DMSA 1UFRA 2VF7A 3N5KA 3HBFA 4X1IB 5GOTA 4YXWA 1V8PA 2HBRA 1F1JA 2VT6A 2ZB7A 1QHXA 1O5TA 3O1IC 3O5AA 2FN3A 3T15A 1QHHB 3C48A 2CJWA 3F7NA 3UXEA 1BMQA 4PO9A 1JSXA 2G28A 3SGLA 5DT9A 3OEHA 4MUBA 4PSAA 1YQEA 5JXWA 2DR2A 3OQOA 3BL6A 3KZ1E 3OEWA 1YZHA 5IC6A 2ZI9A 3DKRA 2JVJA 1EQAA 1FJHA 3DAFA 1QLHA 3HBAA 3AVUA 2FMTA 4K0RA 2QR2A 5ALRA 3D5EA 4B3JA 2PUDA 4EB6B 3ZY5A 3QHPA 4CU5A 4C2TA 2PKQO 2P0YA 2V8OA 1IYZA 3PRHA 1OR8A 2GN2A 4BS9A 3QKRB 2IL1A 3IKTA 2LDXA 1LPNA 3RJTA 1RWVA 2Y68A 5IAGA 5A3QA 4CUZA 3FTEA 1U3UA 2AJTA 1SU6A 2P4UA 1WEKA 3FOBA 2BGRA 3DAHA 3PFCA 3V8QA 1LDEA 4HK4A 2HSZA 2R1TA 4UBIA 1AK2A 1BO6A 1K2WA 1VGRA 1FFAA 4RL4A 3FSGA 4PQFA 3VJKA 4YRIA 4DV4B 4UVEA 1T6XA 3OX4A 2W6PA 5AWFC 2AOUB 2AZDA 4HBZA 1N0WA 4NG4A 2NP7A 4MGHA 4BFZA 4H3VA 1SB9A 2OE2A 4KSCA 3W6UA 2X4GA 3EASA 2Y05A 4IUBS 4DUGA 4PM4A 3UK7A 1PZXA 2XIQA 3GLHE 3K1TA 3DQZA 3WS7A 1U0BB 2BHNA 2A9OA 5KYGA 4YCAA 2GCIA 2CWWA 3E84A 3K31A 4EK9A 3JWHA 3EX7C 3UEOA 2CT8A 1ZUNA 4ZHQF 1V6AA 1I94B 3CUTA 4LNUA 3ZGLA 1XYVA 2D74A 1A96A 2L42A 4HEA6 4UBLA 3FDXA 3IAS1 5L40A 4OQMA 3QKTA 5ALLA 3HO1A 4RVDA 3WL8A 1GOTA 6YASA 3V7YA 1JR3A 4TTIA 4DDUA 1W36C 2JANA 2QR5A 3G8BA 1QHSA 4Q39A 1P9RA 5FBWB 3VC3A 3ZZTA 4EH1A 1DQRA 4J29A 2PU7A 3LXUX 1RMTA 4XD7D 4ZTUB 3ZTTA 4ER7A 1W49A 2EW2A 1ZUD1 5EE5B 3R4VA 3K4PA 5LP1A 1CEEA 3X1ZA 2E5WA 3AEQB 4JJIA 2GXUA 1ZH0A 4PEVA 5DRTA 1A4RA 4XASA 3E7PA 3OAAA 3GJQA 2QMQA 1EP9A 1NYLA 2QUIA 5FWXA 5D3QA 2C7OA 4XQGA 2X3FA 1KKLA 1XEWX 3AXSA 4E2XA 2Q7XA 3WJAA 3A2KA 3Q88A 2ECKA 2X1MA 3RAGA 1U3VA 2REXB 1D03A 3NIBA 4WVFA 1CR1A 5KVSA 5JISA 5F5XA 3RS0A 1W9HA 4GVXA 2G6TA 4KLRA 1U9IA 1YS2X 4B44A 1WM1A 3DAGA 1KK0A 4LY3A 3AVWA 3B5IA 2CL5A 2P9BA 1L4GA 5KYNA 3WIOA 5KB3A 2Z4RA 3VVCA 1WE2A 2P3OA 1GSHA 5TLSA 2NZYA 1PG0A 1MA3A 2Q5HA 3F71A 4PCVA 4WIAA 5CAEB 1SN7A 3S55A 3C6KA 2RGAA 2JHPA 4NNPA 3ULKA 3WB1A 3GARA 1I36A 3B2NA 3CZ4A 1VCMA 3AUJB 2FZ4A 4Q7KA 5JQGA 3T5AA 2RB5A 2A9JA 2W4QA 3M5WA 2W6MA 1LSJA 1U3DA 5B2ZA 4AY6A 4U6SA 5I9MA 4GYWA 3PTZA 4OXQA 3HXMA 5I4BA 3JQDA 2IW1A 3WLNA 3DS8A 1PQUA 1EA5A 5IASA 4L2IA 1FU8A 1NF3A 4NHEA 3CKMA 2D1TA 4U7DA 1R0BA 1IQRA 1YBFA 3HWWA 4D4GA 1G1AA 2H4ZA 4K9NA 2V4ZA 1OPRA 4IIVA 3JZIA 2O5VA 4II3A 1VG8A 1GLVA 3D8UA 3SM3A 2QX6A 1QP0A 3SZ3A 1G5TA 3WGJA 2D13A 2CYBA 5JE8A 5BW6B 5C7IO 4BMOB 5DRYA 3ZCVA 5IZCC 1T26A 4BO3A 3MWJA 3WGUA 1W5TA 1ZRSA 3OZFA 4JEUA 3BB1A 3ZQJA 1IEWA 3AP3A 5ALNA 1K8RA 5JPIA 5EINA 1T3SA 5D3MA 3O2NA 1THGA 1GSIA 1W85A 2PGDA 2Q4BA 4ME6A 1Z88A 5DCLA 1ACMA 5DULA 2OXIA 5BVHB 2H4XA 4XPIB 1DUIA 1ZIDA 1Q84A 2HC9A 2PKRA 2BE7A 3G9UA 3HUTA 4WE3A 4XUDA 3CGGA 2WIDA 3L1KA 3KL4A 1G60A 1G42A 2ODPA 2ZQYA 3TW8B 3I5UA 3DMFA 1VZ2A 3ZCRA 1TF5A 1YBVA 4PF1A 1IUOA 4RGBA 1NW3A 3EFOA 4F7DA 4F6LA 3TKAA 1L0BA 2ZS8A 1KMMA 1H2EA 2JEZA 3DVSX 4DMUB 2I3BA 3ASUA 2HA7A 2IW3A 1K0UA 1TYEB 3IEKA 4YP0A 1JP7A 1OU4A 3RS3A 3E1SA 4TVBA 4RMHA 5JMOA 4FT4A 4XARA 3HDJA 2WYWA 3OZWA 3Q8LA 2W0SA 3UMCA 2FPWA 2PL1A 1Z15A 2XE7A 4RL6A 2ZVDA 3KYIB 1NWHA 2P6UA 1IY2A 1TFUA 3WE7A 4AP9A 4BU0A 3VPBA 1NI5A 1VQ1A 5KOJB 1PFGA 1JL3A 4C88A 1VKZA 3C87A 4KAJA 1MVLA 1ABBA 4OUKX 5AKHA 5EJ9A 1WBBA 3M4YA 1I1HA 1P1RA 4YUAA 3IV6A 4G86A 3RUCA 1W35A 5EHXA 4HDQB 2V45A 2A5YB 1I10A 3FGZA 5D6OA 1E1RA 4UD2A 3FCXA 1LPSA 2OORA 5C52B 1XQVA 1ZONA 4NPAA 5FD8A 4IUCS 4LQLA 3VGJA 4QTYA 4XWOA 3DZ8A 3GVXA 1KSFX 1ZGBA 4OHOA 2VS1A 1DC7A 5H82A 3AERA 4FFDA 3RUHA 4ZZ1A 1JWLA 3D3NA 1SBNE 2C1EA 4YBRA 1P1JA 3K2IA 4CL8A 5IUJC 3RNOA 2ASVA 3SD7A 1SO8A 2C4WA 1DX6A 3O31A 4I5IA 3VR3D 4QYSA 1X2EA 2MR6A 1FIUA 4GS5A 3AM4A 1US8B 1NT2A 2NQ8A 4HWKA 1QKIA 4MQMA 4P38A 2QTGA 1QNFA 1U4SA 2VI5A 4R1QA 2QBYB 3NFRA 2YW2A 3QU4A 4PC7A 3RYTC 3RJMA 2DHQA 4ARCA 1P9WA 3RC2A 2PG3A 3AG6A 3LDFA 2A5GA 3C6MA 4NYJR 4R6XA 5EZYA 4J49A 4ZVLA 5TDHA 2WYHA 3CIOA 3EVGA 4KMMA 5SZHB 3GGJA 3BZBA 4P4GA 4MVJA 1ZKDA 1T24A 1BKDR 4RK7A 4WBNF 1B14A 5FUQA 5HKBA 7REQB 3RJZA 5DXFA 1KERA 4M87A 5HBRA 1A8HA 3OJCA 4HNGA 5EJFA 4CFYA 4EA7A 1S9DA 2EC5A 1FRZA 1UJMA 2B0CA 3MINA 4TYPA 1UEIA 1KDRA 1VYTA 2BKVA 4J6EA 4C05A 3LUKA 4GSLA 5SZJA 4URFA 3PNQA 1OT5A 4C89A 5AVTA 2FN9A 3OZUA 1PR5A 1A4IA 3ACBA 3BH7A 4ND3A 1JMKC 5EPUA 4NMWA 4BBPA 1UQUA 2J3IA 2V97A 3LOPA 3QLVC 1FDIA 3JCZA 3RVBA 1QX4A 1NUQA 4JWTA 2HSEA 2WKSA 4GP6A 2IU4A 3C6BA 4PLWA 3OE5A 4KVZA 4X6XA 5FI1B 1U4NA 3MGCA 1J09A 1I7QB 3DLAA 2YVUA 4NAUA 5TSDA 4ZO4A 1ODSA 3MNFA 2R25B 4AMUA 3RH0A 3TOSA 1OOEA 2FSUA 3T94A 4IO0A 3JALA 4TPKA 5DGIA 2JC3A 4YIKA 3FPAA 5GV8A 3JXEA 3QF4A 3UBTA 4OHBA 1F1BA 1ZR2A 1XX6A 4ROSA 4FP9A 4KI0A 1WSBA 1XZDA 3GCXA 4KMSA 4JXKA 1CZLA 4D8XA 4BQFA 5BWCA 2ZUVA 1RJWA 3FUCA 1ZA2A 5AKEA 3ZK8A 4B3HA 4BVKA 3EVCA 1GSOA 4LMPA 4U9HS 4D74A 4YIHA 3RRMA 4XM2A 5LA6A 2O8CB 2HMSA 4FHZA 1H4QA 1PP4A 4IINA 4MCIA 2F67A 4BGIA 3QX3A 2IH4A 3TX2A 4H7FA 5DFAA 3A25A 3CEPB 4UDXX 3UH1A 4ZJUA 1OU0A 1QMGA 2SCUA 1L5VA 2Z2YA 3A9SA 3NHBA 3O95A 4PS1A 5FULA 5HF8A 2H9AA 3CVYA 3L8GA 5J40A 5JMWA 4X64B 2PS9A 2O5CA 1IN1A 3EVDA 1LLFA 3K9WA 4X3OA 1N4AA 3G79A 1QX3A 1E4YA 3WOVA 3L0IB 2V6IA 3C1TA 1HOXA 3MSXA 3WWDA 4IH1A 3HM9A 3VC2A 1KI1A 3A36A 1UDAA 3K1AA 1QV9A 5LSAA 1M7GA 3DWEX 2XQIA 4DIDA 1X1DA 4L3WA 2GEJA 3TMYA 2XXAB 1UAYA 3KXKA 3OJFA 4TWIA 1KO4A 3A58B 5D3KA 1VRWA 1CNFA 2J7KA 2YJ3A 3QLEA 1U0NA 1DRKA 4BKQA 4NULA 5FUBA 2C4UA 3ANSA 2EIHA 2XLCA 1KP3A 2FZGA 4KSYA 1M0WA 4GX5A 4BQRA 5CH3A 1S2DA 1E62A 3AVOA 1M2OA 2ETVA 3FDZB 4I3HA 3QA9A 4D6YA 1FVHA 3DXZA 1RXIA 3V4VB 1E20A 1NUPA 4PFQA 3NASA 2RAUA 2VSXA 3SYRA 2PFKA 3KOXA 5A6VA 1QF6A 1NFQA 1RWOA 2D00A 3OM1A 2ANCA 3IGFA 2PO7A 3EWIA 2VJPA 3EISA 3RYCA 1LDYA 2OCDA 2YV4A 2ZUWA 2HIGA 3PPVA 3SU8A 3R76A 3AI1A 5A03A 1XAJA 4CIBA 5L3SB 4C08A 4ENWA 1D4FA 2TSYB 1I33A 4DQDA 1VFPA 1BRTA 3FBTA 4II7A 1W4ZA 3VYSB 3OC0A 5K0FA 4FEEA 2L17A 2WJ4A 1GZUA 3INTA 4Y9TA 5C4MA 4PO1A 1CFJA 1E61A 3AMVA 3BMQB 1K27A 2YUTA 3HHEA 1ISIA 1E2GA 4IZIA 4HLQB 4J1SA 2QAGA 3VU0A 2D2IA 1DDGA 4O3MA 1U9ZA 3JY6A 1ECGA 3MGAA 4J2HA 2CFRA 4EECA 5HQ3B 1K92A 2VQSA 2NZ2A 4G5GA 1OVMA 4OMCA 1ZJJA 4Q3LA 2B8JA 3VVBA 2GLTA 4ACAA 5AM1A 1Z34A 1TU4A 4YDQA 3ZHZA 4I1OA 1ODFA 1ZJZA 2HF2A 2GOYA 2QZZA 3EY4A 4ITVA 3PITA 4ND6A 4X93A 1GEGA 2EIXA 2UDPA 4BO8A 3SBOA 3L84A 4X44A 3M6LA 1VMAA 4YRZA 2FQYA 4HT3B 2POQX 4PG4A 3O82A 3IT3A 1GV1A 1QCCA 1QTNA 2NV0A 4GW3A 1X1AA 4XIYA 3C8HA 3CCFA 4PAGA 1R16A 4RLHA 4EJ0A 2WWTA 4HH1A 4INZA 3TD9A 4MA0A 4D9FA 2FK8A 2IY8A 1RMQA 4EI9A 3I01M 4V0SA 1EVLA 2O57A 1NR7A 1RC8A 2BHRA 4KW7A 2EVWX 2YFQA 3R7LA 3WIEA 2WT8A 4Q0MA 4F9FA 4LYAA 3WMWA 3PQ6A 4K6OA 2IS6A 4H7PA 3HEBA 4DM7A 3ZNOA 2FUKA 1TTPB 2PJZA 2VPYA 3S2ZA 3ET5A 2ZWMA 4I3GA 1DEKA 1CE8A 2ODQA 2XRFA 3DC7A 3G5TA 4S12A 4D97A 3PA8A 1KDPA 4XQCA 3D9QX 4PIVA 1JQDA 5EXSA 4F6CA 3GG9A 3QOXA 4A0GA 1CR6A 1SUSA 1X6VA 2P9CA 5JY1A 4JI0B 1E6UA 4M0FA 4ARSA 2MINA 4LPSA 5IYZF 3S1AB 1U9YA 1NXXA 1XXHB 1ZKMA 2C3PA 3TYXA 1WOMA 3MIIA 3PXUA 3TF5A 1SGWA 2VCEA 2YZMA 3CR7A 2LXNA 3QI7A 3WX0A 3WL5A 3CUEF 2ZYVX 3LVBA 3TQTA 2R5WA 4EG3A 1ZW6A 3WAKA 5SZKB 1URPA 2YS7A 3HKCA 5FUVA 3FJYA 3SG0A 3QBVA 1B6GA 2NYRA 3VZCA 1XV5A 4QTXA 1JHAA 3WMEA 1C9JA 4CLRA 2MCFA 3DKPA 3GZ4A 2ZKLA 2XGSA 3PL5A 2O0LA 1OHHA 3EZGA 4J76A 1UOQA 3N39C 1JAYA 3DL2A 5HMMA 2XUIA 3A4MA 3SJAA 1J90A 2NXJA 1XTUA 2SKCA 3RWMB 1TUBB 5BSUA 4B3SB 4KE7A 1KJQA 3W8EA 1E9EA 2GN9A 4AKHA 4ZDJA 4TRRA 2EGGA 4EX6A 4TRJA 4NECA 5B4TA 1XE3A 3C7TA 3LWZA 1G4UR 2WINI 2IU0A 1KXJA 3LNCA 5TF0A 3OEED 2D6FA 4EEKA 1V3QE 3B9BA 3MT0A 1G21B 1D2AA 1QV6A 1EK2A 4L8FA 5ARCA 4A8TA 3A1FA 2IGTA 4LX8A 1T6ZA 4P3OA 1NOIA 1T5SA 3IUEA 4JA0A 4QNRA 1UDCA 4EUNA 4F06A 1XJ0A 4XIGS 4B5LA 3D0QA 2E6UX 3MTIA 1IG3A 3PFWO 2JLVA 1ATIA 2C77A 2H52A 1E2MA 2RC6A 4AJKA 1SCUB 2BFFA 1MABA 2CUZA 4PYJA 2Q5JA 2QG4A 3HB1A 2QRZA 1G8FA 2GPSA 3F3YA 4ZAWA 1FNMA 1M5UA 3QWHA 3T06B 3WWYA 1ULHA 4CR7A 4JYAB 1D1QA 4GI3A 5H02A 4F3TA 5K3DA 3T9FA 4YRNA 5HW0A 3P27A 4G37A 1GFSA 3IAS6 4OHCA 5EXTA 5AI6A 4DB4A 1ZCZA 1KVTA 5I01A 5CW2A 4LYYA 3AV0B 4IKOA 3H86A 1SFRA 1VPTA 2C9YA 2P40A 3VPXA 3IUMA 3LX4A 4YP9A 4BNHA 1Y6JA 3BTSA 3EIWA 3G5AA 4NJOA 4UASA 3H4IA 4UCFA 4D0SA 2C8LA 4D81A 3JQBA 2E89A 3TIIA 3TTXA 1J42A 4G9EA 1YOBA 2WPDD 2VSYA 3KKMA 1NW9B 3W2GA 3P9IA 4URVR 1EHIA 2OO7A 3LP6A 3MQFA 3TPCA 4ZAFA 3ABOB 1XL0A 5BN5B 4HRAA 2PS3A 4JOSA 2W2TA 2BGGA 4Q4HA 1C4OA 1YTUA 2OV4A 1N6NA 2C2BA 1R1DA 2GCOA 2X2EA 2JAQA 5EMJA 4BB6A 2EW8A 2YRFA 4PAQA 1NTRA 5F1YA 3G88A 2XYVA 2ZBGA 4W1SA 4H6PA 1QG2A 2FPIA 4IG4A 3L8FA 1MN6A 3C3WA 1W4LA 1VJ0A 3HBNA 3R20A 4L85A 4NONA 3W5HA 4ZCMA 4XYMA 3HCPA 4NFHA 2H65A 1ZL0A 4JNCA 1MR3F 3BWCA 3H2HA 3R44A 2JK1A 2ONJA 1G5RA 3U7JA 4WQMA 4DMCA 3H04A 4MR9A 1PIWA 1DFHA 1S01A 5GMOA 1QRUA 2QTZA 4OI0A 4OAPA 2BISA 4C6HA 3NT5A 3GRYA 3OCWA 1TGVA 5SICE 1DKOA 4UREA 1FF9A 3GXBA 4N0MA 1XTVA 3SIWA 4BQSA 4BE7B 3E18A 4D2IA 2B94A 8ATCA 5EP2A 1ZZGA 4C7BA 1Y1LA 2X8AA 1NVVR 3L8DA 3QX7A 2FPMA 2C5BA 4FZJA 1BXGA 4HAVA 3TZ6A 4B3BA 5AM4A 1UMCB 2H1FA 1UKAA 2X5KO 3C6XA 4LRSB 3R5HA 3CWQA 1DKQA 1QAOA 3P26A 4JCCA 4XI9A 5DOVA 4A73A 1N2ZA 2A30A 3RYFA 3N3BC 2VZEA 5ICGA 1SCAA 2A0XA 1I9GA 2GUWA 1KZHA 1NJ8A 3GFPA 2V1UA 1PAUA 4P83A 1RNLA 2OCKA 1U0EA 5CVEA 3CZRA 3PUZA 4BV8A 1AO0A 1FU4A 2JGNA 4RXUA 4BE4A 3FWZA 4UZSA 4FFSA 5EJ6A 1CUVA 3H1AA 2QP9X 1IQPA 2G0AA 2ZYWX 3IO3A 3RHTA 3ZVRA 3GRVA 5BSVA 3JVUA 4TRNA 1GAXA 3JYHA 4ENUA 1L6RA 2IYPA 1AKWA 1G5FA 3KUUA 1BKSB 4GF5A 5H9VA 3U3KA 2YFHA 5HKAA 1EFDN 5CA0B 5KTOA 2EFEB 3PUYA 3AJEA 4RHTA 4R7ZA 4RLSA 5DTQA 4BZXA 2J07A 5B64A 4D4KA 4CI9A 5HOQA 1SUWA 2JGFA 1JF8A 2DTXA 2YY7A 3AIIA 3QF4B 4RPGA 4G9BA 3JASB 4WI1A 1E98A 5JS2A 1F4VA 1XCPA 3RR2A 2Q2VA 3ZS8A 1DAMA 4A23A 3KR9A 3K6KA 3SWWA 5E9WA 3W9BA 4URXR 1N3IA 1E3QA 1E1CB 1L5OA 1NJ1A 4BTVA 4HS9A 4KDRA 1AHPA 3H1TA 3KTFA 3K71B 3RS9A 3W79A 1USKA 3EOZA 4IMIB 4MNTA 4F21A 4ZGGA 2EJTA 2NVUB 1RHJA 3BHMA 5ADUS 2Y1CA 4Q47A 2FG6C 4RV9A 4RV5A 1XRMA 1WCXA 2GEFA 2YWGA 3IHKA 2FN7A 3NTRA 4IIHA 1E1QA 1HYQA 4P80A 4MWGA 4X7RA 1EFTA 5J5VA 2BGTA 2HRDA 1P2BA 1MAWA 2WHEA 5AK0A 4JX9A 3L7NA 4WBSA 3TIFA 1ZD2P 4YUXA 1CB0A 4IDGA 4JI5B 1DBRA 3CF0A 3EQ8A 3RM3A 3LD9A 1HGXA 1O4WA 4QXAA 3ZYCA 3I5XA 1XD2A 2R1UA 5HOEA 4M8NE 4DJAA 4MWZA 4I1UA 1RSZA 1N9GA 4YJHA 3W7BA 3GXOA 3WDMA 2ZKIA 3KK0A 4JJGA 2OGZA 5BWNA 2ZAIA 5FBRB 2PSFA 2LKDA 4W99A 5LYYA 3MD0A 4D43A 3K2EA 1CC1S 3GFOA 1YB7A 4A6PA 2E4UA 3DBHA 3S7ZA 1TVKA 3A9VA 1A4XA 1Y6QA 1S89A 1KFKB 1C3OA 3OE1A 4WFJA 5C8YA 1TPZA 2NV2B 3GRFA 4AS1A 1F0YA 3HGQA 2Q1WA 2H1RA 1L7EA 3FSGD 4LF7B 1NBMD 4A0SA 3ER6A 3S68A 3JX9A 1BS2A 1TFRA 1OZHA 3VYWA 4NMHA 4YC7A 1U0GA 1QGUA 5BOSA 5FOXA 1XZBA 1TTHA 3IP1A 4M6WB 3LUDA 2Q3LA 3F6SA 3PKZA 4I6GA 4Q3EA 4RZUA 4A6EA 4DLAA 1ESDA 3Q3EA 3EUWA 5DP1A 4I1YA 5TGTA 2AUTA 4LPKA 4XLTA 4HNUA 5LQSA 4MPDA 3U13A 4YCNA 4F84A 3HO6A 3GPBA 4FC7A 2DGDA 2HH9A 1IAQA 3DT6A 1JR4A 1AHNA 1YH3A 3HKCB 4HYTA 3E9MA 4JB0A 4N8EA 1CZUA 3NTUA 1A2QA 4NZZA 4Z9FA 1EVQA 4U6QA 3CW8X 1QDLB 3X2FA 4A2WA 4DRYA 1SQ5A 2AZTA 1B41A 2X4LA 2FP4A 2EF0A 4O5AA 1QAMA 2NV6A 3KOWA 1BA2A 3AH8A 2D2EA 3T9CA 3V1YA 2F8TA 1C30B 3TLCA 1N6PA 3HJFA 1CRZA 4LF6B 1GIAA 5IBPA 3I5MA 4R8LA 4Q9KA 3ZCXA 4B9AA 3HDQA 3QV2A 3ROFA 2BHTA 4IDFA 3LRXA 2VZLA 5KWEA 3B48A 4X20B 2I2WA 4UHEA 3RS2A 2WHXA 4WZBA 1N8TA 5T5QA 3KIPA 1KYVA 3DV2A 4ZQCB 1LBSA 1T8RA 1ZA1A 3FTQA 1Y9DA 2J5BA 4DNFA 4KAXA 4YI3A 1E2DA 3KZXA 1LDMA 3ZJUA 3ONVA 5A6SA 1O94C 1Q1QA 4HG2A 4RPCA 1JB9A 2JHAA 5DYWA 4HNQA 4N9QA 2XWPA 4KQJA 4NBVA 4FINA 4AECA 3NBAA 4KWEA 4KVFA 4R1NA 2AVNA 3AEKA 2YYAA 3DT8A 3UAGA 3TZKA 2VRBA 4HV4A 3EGCA 2A92A 2R68A 3K2QA 1GL3A 3HN2A 4JXJA 3KHSA 4PZDA 4X6LA 1WZ2A 4BFTA 2V3CC 2VKQA 2RDMA 2G70A 4TTQA 4QUJA 1RJ9A 1TMOA 1VE5A 2Q9UA 3T35A 1Z4PX 1M83A 3E61A 3OZIA 1KP9A 1TCBA 4AWXA 2OM6A 2RAFA 3QNUA 4GH5A 4C20A 1EWVA 1QORA 4ZQEA 4EUFA 2I99A 1RTKA 3EODA 1Z5OA 4QOHA 1WULS 1SVUA 4L57A 1WHSA 4UHCA 4L2IB 2LZ0A 1QYDA 1UBEA 3AEQA 3GN1A 2BCGY 3IVCA 3NHUA 3P9NA 1REQA 4Q16A 2GRJA 4RMIA 4GE3A 4X61A 3M33A 1J5EB 4CXMA 2ZATA 1QGUB 5BOSB 4K9LA 4R2LA 4Q00A 2JIZA 4DGQA 3HU2A 3DAYA 4OQNA 4RJLA 2EW1A 5DT2A 1CZRA 4U2DA 4DFDA 3ASVA 1JEYA 1GZ4A 2JFBA 1TZBA 4N0QA 3TXYA 3WGGA 3EGEA 2VOJA 4UFOA 3L7JA 2GYWA 5GONB 3FCCA 5L3SA 4KIUA 3AEUB 4QU9A 4BAGA 4CI0B 2QWXA 4AUKA 4W9MC 2FXVA 1KZ7B 3SVTA 2CBZA 2OZLB 3D2BA 3NQ41 1M2KA 1OAKA 3Q0TA 3G0DA 4MUJA 4OVKA 5EWJB 5EQJB 3M3DA 2P11A 2BDTA 5EZYF 3OLXA 3KYBA 1ST2A 4XFJA 1FPQA 2CLEB 4CIAA 3FPJA 4N7JA 1E3MA 1EP1B 5KMGA 8ABPA 2ADMA 5K45A 3IQXA 1QNLA 1ZI6A 3O0TA 4I9GA 4F5ZA 1Q0LA 4Y9DA 3HDVA 1NC3A 2GPWA 3OIUA 3A27A 1DIRA 1I2BA 3FBGA 5DXJA 4IL5A 1SIOA 2QZSA 3PSHA 1NRJB 1E2EA 3I4LA 3ZNNA 3CS3A 3CVUA 1M3SA 2WSMA 3EXHC 1AKRA 1MIOA 2JGDA 4NZ9A 1UANA 4OBXA 4O4HF 5FNZA 2RG1A 1PFVA 1TJ3A 4TLAA 1MZPA 3FYHA 5CK5A 2IJGX 3QKIA 4FVTA 4LDZA 1GADO 1YAJA 4OM8A 4XDZA 2B8TA 2FUG1 2VF2A 3IODA 3MWEB 5F3RA 3CRNA 5FBZA 4CDRA 1XCBA 3LLCA 1AK1A 2VNKA 1HR0B 2Y1EA 1PG5A 2HY7A 3LU1A 1C2YA 5EJ2A 3KD2A 1QG0A 1ISRA 1H8ED 3I58A 2YCBA 4OHUA 4O4IB 4TS4A 3JQ7B 1T9CA 3WBFA 2QTFA 5HUHA 4ZANA 4XR9A 3X1KA 4HLNA 5H1YA 5BYBA 1E99A 3DONA 1FTSA 1XMJA 2FP4B 3OOHA 2OSVA 3C3XA 4TTRA 1D1PA 2OGSA 4U1RA 5HCIA 4CLHA 3PUJA 2IOYA 2PPLA 1UBJS 3PEUA 4MHSA 2YWHA 1KY4A 2G0TA 1OX6A 4HDRA 1UFKA 4P36A 3H2ZA 2F9MA 3ZH2A 1PJ2A 1PCXA 1XOIA 4BBZA 1BXZA 1SXJD 1NZDA 2A4KA 2ZJ7A 4C9BA 5JSQA 3DEAA 3B1JA 4R2MA 1XKQA 1YZ3A 4XCVA 3AZPA 1EQUA 4MKHA 4HNVA 3II6X 1HA3A 2XDAA 4EPVA 3AF0A 3EA4A 3DPSA 3F4BA 3IEVA 4X6YA 4AXBA 1WHTA 1EGAA 1D07A 1KBOA 2WTNA 2XT0A 3D4PA 1IATA 1PZMA 4ROTA 5AVWA 1IN5A 3T5PA 2UYGA 4N5HX 4UKDA 2WU4A 1EQ2A 4QUDA 3TS1A 4JC4A 3GIWA 1AB5A 3M9WA 3RVDA 2AZMA 1AN0A 3QUSA 1GNTA 2FWAA 4XUCA 3WNQA 3WNBA 4FT2A 2O48X 3N8KA 3NV9A 4I81A 2PA3A 4PU0A 3P9PA 3TAUA 4BGDA 5J5CA 4YAKA 5JAIA 3Q15C 4GR5A 1IPFA 1CE8B 3HCAA 3RB8A 3B7GA 3E2PA 3K1AB 4MOWA 1KYZA 4YDHB 5COBA 3QVUA 4FZRA 1S5PA 3IT2A 2BBWA 3QELB 4DYHA 7ABPA 3DF9A 1NW6A 1RCFA 4N6NA 3U4GA 1V1RA 5EHNA 5IKPA 4FQ8A 1KXZA 2XYHA 4C04A 4UE2A 3UAVA 2P8SA 4UM5A 1Z56C 3D2LA 4CTOA 3KE8A 2ZJ1A 4Y0NA 5LXTA 1FNBA 4CM9A 3LHKA 4YPVA 3JU3A 2XOEA 2BBTA 3FYCA 4DN6A 2Q5EA 4INPA 4CM4A 2OHGA 2PH7A 1ESNA 3F5QA 4YJGA 3ZJTA 2Y99A 3WTCA 1T35A 7REQA 1ZD5A 4ESOA 4Z5XA 1PSZA 2R44A 2DHEA 4LYEA 4AN4A 4Z1OA 4O1MA 4FFPA 4L8GA 4L27A 3T12A 3UUEA 3K32A 1IHXA 3VGPA 2R65A 1C41A 3V7WA 3WQHA 1NM5A 2FSFA 2HU5A 5AKKA 5DEIA 4U2KA 1MC5A 4YQEA 4EATA 4YY3B 2G67A 3HEAA 3IQGX 4PR0A 5JQGF 1E3EA 3FGOA 1Q0SA 1BDJA 4GMGA 1TW2A 4FD2A 2RHMA 2ZWPA 3GN2A 4HFMA 3RTBA 2QRLA 3EGWA 1PLLA 4LBYA 5JSZA 3IB3A 1Y8ZA 3DO8A 1YZGA 2DWQA 3GEBA 2VSNA 4MYSA 1HYHA 4A10A 1ISHA 3ELDA 3HVHA 1HT0A 3GRUA 4H