4RSGA

Neutron crystal structure of ras bound to the gtp analogue gppnhp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
166
structure length
162
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Neutron Crystal Structure of RAS GTPase Puts in Question the Protonation State of the GTP gamma-Phosphate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 55
structure length 162
sequence length 166
ec nomenclature
pdb deposition date 2014-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rsgA00
1E2MA 4HLUC 2C03A 2O0KA 4POAA 1YZQA 3B1YA 3RS5A 3QXSA 5IRCD 2J9RA 1YRBA 2YJTD 1E9BA 3AF4A 1SKYE 3IGFA 1XB2A 4M1SA 1AJEA 1VCOA 1G291 1E9SA 1KI3A 1KO7A 1Z8FA 2BBSA 5HZHA 3GD7A 3K0CA 3GJ3A 1VIAA 2NZJA 4C7OA 4A15A 2HCJB 2YOGA 1G5TA 1NLZA 1SHZA 4O25A 1ZUIA 2WJGA 2Z4RA 3DMDA 221PA 5FL7A 2R6AA 1EGAA 4HLCA 4FWIB 3TGPA 1ZM2A 1CF4A 5E4FA 3R7WA 2D4HA 2OBMA 3L43A 3QVVA 3IBGA 4CEIA 2FOLA 3B1VA 1U2RA 2XEXA 2GCNA 4BLRA 1NBME 3BH0A 4PTLA 1DVRA 1Y63A 4EAQA 2VHQA 4QGAA 2EFDB 5TB5A 4G5GA 1G9XA 3ONWA 1RRFA 1P72A 2XB2A 2RHMA 3K0FA 4P4UA 1F2UA 1W4AA 1A82A 4JLKA 4BFUA 4LJ7A 1ANKA 2DFNA 2VPPA 4US0R 1KK2A 1IM2A 1E9DA 1Y3AA 4AD8A 5KSYA 1W7AA 1G5RA 2ZI6A 1KSGA 3PEYA 1W0JA 4M9QA 1KDTA 2BVNA 3EAQA 3ZJYA 5FI1B 1TU4A 1XTSA 4Z1MD 2V54A 2XOKD 4C0BA 1OKKD 1FUKA 5JS7A 4ESVA 3EZ6A 2FFBA 3B78A 3TAUA 1E1RA 1G16A 3L8YA 3NDBB 2ZXUA 1YQTA 2G83A 2YC4C 5EZ6B 5J4YA 1BIFA 2G0TA 1QF9A 4HZUA 4YMWA 3EPLA 2V3CC 3TMKA 4L8GA 4DEXA 1JB1A 1X8LA 1PLLA 3Q7PA 1KO5A 5E3HA 4E09A 1GKUB 1SKYB 1ZNYA 1Z0DA 1W36D 1P9RA 1T0HB 3B8HA 4EUNA 2RGEA 2ZUBA 5EE0A 3W3ZB 1Q57A 2QM8A 4OI1A 2CNWD 3K0AA 4MITA 5FR2A 2JIZD 3TQCA 2DWQA 1XD8A 4I1UA 4KV9A 2QP4A 4LBVA 3BC1A 4RD3A 4DUGA 2LCFA 4NKRA 5AUOB 2GZAA 3RABA 2Z6VA 1P61B 4AC9A 2WWGA 4LHVA 4ITRC 2ZAMA 2C98A 1XPRA 1XMVA 2ZR9A 4TMZA 2J45A 5KPJA 2XX3A 2J7KA 3AEZA 1EFUA 1G3IA 3LLUA 1OXTA 1WQ1R 1YHNA 4QBGB 3I4LA 1JQJC 4TMXA 3VR2A 3VR6A 5JECA 3K70D 2BMEA 2ZETA 2ZE7A 1J7KA 1TNDA 3KX2A 5KSPA 4JYCA 3FKQA 3VR3A 3OE7D 1XPOA 3GFTA 3U44A 1KO8A 4ARZA 1CJTC 4XH9B 4JKYA 3KTAA 2Q6TA 2R8RA 3GFOA 4FMBB 1TUEA 2XZPA 1E0JA 1NP6A 2W6IA 3IIMA 4US1R 4DCSA 5JJLA 2ZRGA 2XGJA 2ZUCA 2C9OA 2J1LA 1KI2A 2GVZC 2R6DA 4DWJA 1NVXQ 4NCHA 2WOJA 3W34A 5FBQB 4ABYA 2JAQA 2FDCA 3OEEA 2J3EA 5SZIA 3B85A 3SBEA 4Q4HB 5JHGB 1Q0UA 4QNMA 4UNRA 1B0UA 4YMUA 4Q4HA 2Q3FA 4I1OA 3QJYA 3UXMA 621PA 4MGIR 2NPIA 5G41A 3TUIC 1KAOA 4B44A 4TMWA 1D9ZA 5J40A 1OIXA 3QENA 4LJAA 1N2CE 3W5JA 1P9NA 2OV2A 1JPNA 3TVTA 4F38A 1Z3IX 3EW9A 3K0SA 5EUMA 3R8CA 4URUR 1RJ9A 2CLSA 1MV5A 3N5CA 5GVSA 4HB4A 1J70A 1XJCA 3KQLA 1TF2A 1JR3A 2GZHA 1XEWY 2WBLC 2V6IA 1DOAA 3EIHA 2ZJ8A 4CDGA 3QXHA 3AM1A 3OIYA 3EARA 3SU8A 1MRNA 1XXHE 4A6PA 2ZRMA 4IFEA 3CWZA 4TZ0A 4DCNA 3P26A 2QN6A 4BZQA 5J4HA 3PJRA 1IBRA 2QU8A 2GHIA 3M0EA 4LC1A 5EXPA 4B3FX 3CPEA 3U3OA 4NTZA 2F7SA 4RZ3A 2IC5A 5B57C 4RD4A 5D3MA 3CZQA 2OE2A 2JLRA 4NBSA 3SEAA 5UKDA 4TYYA 1XMSA 2GXUA 4BRUA 4Q02A 4FWTA 5H68A 2Z4SA 1GITA 3PV0A 4LRWA 5BXQC 3SI7A 2CHVA 2Y8EA 4CRWB 5FL3A 1TX4B 4ZV4A 1NKTA 4HUQB 5GVRA 3ZVMA 5AUPB 3CONA 4YDSA 2IS6A 4PPFA 5KSZA 2IYUA 2EFGA 3HYTA 5E7IA 4F4IA 2ZRDA 3KKPA 4O0MA 1G4AE 2B7CA 3UMSA 2D2EA 4IXNA 2P6RA 1M8PA 3RSLA 5CIWA 4C4PA 4QM6A 2AK2A 4OK5A 5G3YA 2BBTA 5FPTA 1U94A 1OFIA 2WWXA 4PFSA 3GJ7A 2VBCA 4B3CA 4F4CA 5L3QA 1HE1C 4D4MA 1R4AA 4QOSA 3LBIA 2HYDA 4Q9IA 4DRZA 5EE9A 3KDSE 4NCIA 4B74A 1ESMA 8OHMA 1NIJA 1PUJA 2LKDA 2J0UB 3SS8A 1YVDA 2XSZD 2PCLA 5DLQC 5K8LA 2ZANA 2QE7A 5KPDA 4TZ6A 5TXGA 3FWYA 3T5DA 4QL3A 3FMPB 3PIRA 1II0A 4ZO4A 1COWD 2IUSA 3K0EA 4PZLA 4NYJQ 1OYYA 2CJWB 1KO1A 4UNNA 3RRYA 2NO6A 1E2DA 1SVIA 3C15C 4IFBA 2C96A 3WRYC 2X19A 3FYHA 1XXHB 4TQ9A 2W0SA 5JBQA 4LHXA 1F2TA 4LJ6A 3N70A 1XP8A 4BQSA 1SXJC 1UBCA 4M1TA 4TYWA 2NMVA 2Z43A 4DDWA 4RJLA 2WOOA 4Q1BA 1T6NA 5CB6A 3WNDA 1LV7A 4DC9A 3QY0A 1E9FA 1II9A 4ZIRB 1II8B 2CEAA 2W6JA 1VDZA 2H57A 4UXIA 4W5WA 3S1AA 2RGBA 4BLQA 5KU1A 1E9CA 2ODWA 2IBMA 1SGWA 3L0OA 4HUTA 2H92A 2PLFA 2NPFA 1F48A 3HU3A 4B6EA 2V9PA 2C2HA 5E7JA 3FDIA 1D2MA 2FSIA 1N6HA 5KO2A 3ADBA 1OKKA 2JJ1D 5KDDA 4DCTA 3Q5EA 1YU9A 4QHSA 4GL2A 4HI0E 1XDBA 1Z22A 3D7MA 3W8NA 2ZRKA 2IWHA 4BLTA 1RPZA 1SKQA 1Q22A 4WZAE 3KJHA 2GDJA 3IIJA 4XVUA 4RD0A 2BDTA 4KO8A 4IOMA 5JI2E 1J90A 3Q85A 1S1MA 4KSCA 2WKPA 3REFA 1W36B 3KFVA 2EFEB 2QRZA 5B2ZA 4NYIQ 3ASZA 2GAAA 3EWSA 3TRFA 2FZ4A 3CF2A 1SVWA 3B9QA 4YDHB 2LKCA 4F92B 1NKSA 3ZVRA 2B7BA 3D31A 4PHGA 2ZRHA 5KDLA 5B30A 1L4UA 1HV8A 3D6TB 2QP9X 4UNPA 4XIGS 1Z63A 2QG6A 3KUCA 3WRXC 2C78A 4HATA 1G7RA 1RW4A 2Q21A 2BCJQ 3W6OA 4YXWD 2NQ2C 2W2XA 4TTPA 3K70B 2VTKA 1NG9A 4PC3A 1PLJA 2VHCA 4IOJA 3W90A 4QGHA 3X2SA 2NZ8A 5AJXA 1F60A 4PZZA 3UATA 2VH5R 1SVOA 2RKOA 1UF9A 2RGNC 4DBLC 4A8JA 2QAGC 4S35A 2I3BA 5AUNB 3JVUA 2FGKA 4KAXA 5F3WB 1GL9B 2IF0A 3NBZC 1V5WA 1ZC4A 1JXMA 3BE4A 1QG4A 4GMDA 4LYJA 3K53A 2BKUA 5EZ5A 1PLKA 1UKZA 1AS2A 1YRAA 3VKGA 1EXMA 4XWAA 3O8CA 2O8BA 1G3QA 2ZUDA 3U4QA 1KSJA 3U3MA 1QG2A 1GNRA 2MSDB 4DLVA 2KI5A 3IBYA 2GCOA 3VU9B 1W46A 1HTWA 3MLEA 1GM5A 2QAJA 2WAYA 1N0WA 4LK2A 2X8AA 2ZI9A 2G1JA 3EIEA 3B1XA 2ZS9A 2IYTA 4PZYA 3WYFA 3OZXA 3AH8A 1WE2A 3KXIA 2W2TA 2WJJA 1UDXA 3FMOB 3WNCA 3CX7A 3BB1A 2C77A 3N2EA 2QMHA 4X8OA 2NO1A 4TL9A 3QG5A 2YWEA 3DOFA 1E2IA 1P62B 1R8QA 2ZQ5A 3T06B 4AYXA 5DI3A 4MH0R 4ACAA 1P2TA 4JVMA 3NC1C 1Z0FA 1AQUA 4X8HA 2FG5A 2ODBA 2WJVA 1G4UR 3I62A 4M2LA 1DAMA 4B6FA 1N6LA 2QT0A 3MG9A 4AYWA 3ZQ6A 3QKSB 2XXAB 3TJZA 4OL0A 2XTZA 3LO5A 3PFIA 4AURA 2A78A 2IHYA 4RFSB 3DO6A 1HT1E 2VHUA 1NVWQ 2ZRPA 4WVFA 3DM5A 3ZH9B 4BZPA 3ZQJA 3QPUA 2IYWA 1OIVA 1QVAA 2FH5B 5FL7D 4HAXA 4D4LA 2F3RA 1Z6TA 1KJWA 3BERA 2WM9B 4ILEA 3THXA 1IAQA 2F1HA 2KBFA 3LDAA 4P4SB 4PC6A 3AGPA 5IK2A 2B8WA 2NO7A 4HLUA 4JL5A 2FMXA 4PAOA 1NMYA 2PEYA 3OESA 3ZYCA 5FOWA 5FI0B 2DWOA 3TK1A 4KCGA 4NZYA 3NXSA 1ZNXA 4LSGA 1OPXA 1EFTA 2HXSA 2GILA 1NJFA 2VLIA 2H17A 4Q7MB 2JDIA 4GDFA 5EP3A 1U8ZA 2O8DB 3AQ4A 1YZNA 2BMFA 2WWHA 3H86A 2OBLA 4GRAA 2ZSDA 3X1ZA 4OBEA 1IONA 1G3MA 2ONKA 5FPYA 4NYJR 4Q9KA 4EKDA 2N1BA 1XEXB 3FHOA 5J5CA 1BYIA 3CIOA 4GOKA 1YE8A 4N1AA 3TR5A 2NOAA 2XJ9A 1C1YA 1E1RD 4NCNA 4KVAA 2CMKA 1I4TD 1CU1A 1FFHA 4DDTA 4NYMR 4DLSA 5CYPA 5AJZA 1A1VA 1TTTA 1MKYA 2PH1A 2EYUA 4JLJA 4XTCS 1D9XA 2QT1A 3EWAA 3MD0A 3AB3A 1LY1A 2QGNA 4LOAA 5BYKA 2AXPA 4HAWA 2FSGA 2HV8A 4Q7LA 3Q7QA 4WZ6A 3RDPA 4BLOA 2FSFA 2RGDA 4URYR 4GBMA 4EJSC 3ICQB 1J8YF 3ZLJA 2DFLA 4DUGD 3MMPA 2EU8A 1ZYUA 3LRPA 3N2IA 2ZS8A 4FMCF 4XSGA 1T8TA 3EZ7A 1E9AA 3D8BA 1ZAKA 4V03A 1L4YA 5CLLA 4RY2A 4XD7A 4Q18A 2ZJAA 4MRPA 1N25A 1KMQA 2YINC 4YC7A 2IK8A 3W6PA 3KJEA 3PEVA 2ZRIA 4DIEA 1GRRA 3CZPA 1R5OA 2WVJA 2IEYA 3D3QA 1YZGA 5D3QA 5KHOC 5LPNA 2FZLA 1YZTA 3A36A 2ZYUX 2CCJA 2ODNA 4FINA 1JQLB 1DS6A 1VYVA 4EQ6A 2O8FB 2G6BA 3AVXA 2W6ID 2WSSA 1Z83A 3QKTA 4TMKA 3BGWA 1P60A 3KL4A 1S0UA 1E2GA 2JJ1A 3PQCA 2ZU6A 1IXSB 3QBTA 4DLXA 4NYIR 1K8RA 1GILA 4KJZA 5FUYA 5LBIA 3U7GA 5F9FA 1W5TA 4QRHA 4ZDIA 4V0ME 2BEKA 3OEED 1ZVQA 2EYQA 4FD2A 4UXHA 5JLJA 3DZ8A 3I1FA 4CVNA 2HF8A 3I3SR 5M04A 1QHSA 1HA3A 3H4MA 2JLVA 1L2TA 4OKSA 5FUVA 3SQWA 4RZ2A 4MUAA 1WF3A 2ZI3A 2OCAA 1Q12A 2ZRCA 1H8HA 4OHXA 1FQJA 3HU2A 1RYFA 4BEJA 4CEJA 2G3YA 1ZUNB 4L4UA 4GSYA 4XSHA 4DLYA 5H8WA 1U8AA 3BFVA 1KI7A 4OHYA 4DLRA 2REBA 2B8TA 3C8UA 3LFUA 1WBBA 1G17A 2PBRA 5FBWB 2F6RA 4KFSA 3AVWA 2DHRA 2UZ3A 1DE0A 1RRPA 4KLZA 1FPMA 1A7JA 4BE7B 2P6UA 1KK1A 5JMTA 2HUPA 1JALA 1XCMA 3IHWA 3LVRE 4UXJA 3R9IA 4CF7A 1G41A 1JR3D 2F1IA 2PZEA 5KNBA 2RH5A 3QNUA 2I1QA 3AKYA 3RANA 3GJ5A 2J7PA 4CT4B 1XWIA 4OQFA 4UJ5A 1W47A 2IHBA 1VCIA 3J81k 4GNKA 2XITA 4PO8A 4JS0A 4AIIA 4R7ZA 2REOA 1W2GA 1PVOA 2L0XA 3B7GA 2QSYA 5A4JA 1E2NA 2C5LA 1T3HA 4HB0A 2BMDA 2ZI4A 5KSOA 1E6CA 3K1JA 4A0FA 3C5HA 2GXQA 1FZQA 3VNVA 3CW2A 4I1VA 3C7KA 1XCPA 2GRJA 2OT3B 1QDEA 1DEKA 4JLOA 1JJ7A 4BASA 1QHIA 3GMTA 2WWFA 2VP4A 4Y0AA 3G5UA 3A6PC 3MFYA 4BFZA 2OHFA 5JS8A 1MH1A 1ZINA 1Z2AA 2RHDA 4LUCA 4NDZA 4RD2A 4D82A 4XWKA 3REGA 4TQAA 4FMDF 4PXAA 1TAGA 2PZFA 5IT5A 2ORVA 5BQ5A 3KKNA 4IVRA 4QG7A 5KYKA 1BS1A 1M7BA 5FTJA 4E5UA 1M2OB 2V1UA 3THYA 3T61A 3EASA 5IDVA 2QQEA 3AUXA 3WMEA 3TUZC 3QF4B 1HH4A 1W44A 1MO4A 2ZI7A 4FW9A 4OHVA 2YZ2A 3B5JA 3RAPR 5EXTA 2Q9BA 4WA7A 2BOVA 2AKAB 5AJVB 4PSVA 5KDOA 4DHEA 4BZXA 2ATXA 4KSBA 3DL0A 3AF2A 4Q4JA 2QE7D 3CKLA 2AD5A 2GF0A 2IYZA 1FX0A 4C7OB 4LYAA 1KDPA 3KJIA 4JLMA 2DCUA 2IA5A 5C18A 2GEVA 1SVLA 1XX6A 2GCPA 3RRNA 3LVQE 3KQUA 1HE8B 5JRZA 1GP2A 3CRW1 4GI7A 5EUQB 2D3WA 1GTVA 2VP0A 3C5CA 3BFXA 4JKIA 3U7FB 3R7WB 4PSKA 4JSYA 5G53C 1WXQA 2JJ2A 1R5NA 4CEIB 1OFTA 3GCGA 3IILA 3T5GA 2WICA 2AD1A 3CX8A 4YMSA 2QMEA 4TTQA 1LS6A 3GFPA 2PL3A 4DIDA 1VECA 1X86B 4CZ2A 5DHFA 3NBYC 3K0FB 3LQQA 4PPNA 4W5HA 3Q72A 1F2UB 3ZVLA 5JWRA 1NNEA 3ZIAA 3LW7A 4W5JA 2BEJA 3LH5A 5J4VA 3R8FA 2AWOA 3EA0A 5EXXA 3T1QA 2W6JD 1N6KA 2HF9A 2OAP1 4KHZA 4MYUA 4TLEA 3UPUA 4WBSA 1IN7A 3CF6R 4L5BA 4GP7A 2BCGY 3PR1A 4D0LB 1BMFA 2GJ9A 4TT3A 4AKEA 1FOEB 2A30A 2AK3A 3T12A 4L15A 4C0JA 1LB1B 3DHWC 3K9LA 3LWNA 3THWA 3WYAA 3CH4B 1DAFA 3MRSA 3RNLA 4M9ZA 5EE1A 2YVUA 3WMGA 2VEDA 1IXRC 2BWJA 1CR1A 3ICEA 1SXJA 2DFKB 3FFBA 3HYRA 1AIPA 3DOEA 3QBVA 5BN4A 1G7SA 2ZPTX 4HZUB 3VHLB 3MWYW 4ZI3A 3KKQA 4ZDWA 3AGQA 1GVNB 2AX4A 3LA6A 1GRNA 1BH2A 3UG7A 4YMTA 2CK3A 1EWRA 2N42A 2ZE8A 2JATA 5DIFA 1WA5A 4M1MA 4UNSA 1NLYA 2SHKA 2KE5A 2ZREA 3PUVA 1KI6A 3K0AB 4WIAA 1M1YE 4JJKA 4RKEA 1SULA 4RZXA 4V0KA 4GMXA 4BPBA 4AKHA 1JR3E 2A5YB 3HU1A 4KBGA 3SJAA 5LD2C 1DARA 2CVHA 2OM2A 2H5EA 1F6BA 1KO4A 4V02A 2B21A 3IHLA 3CNLA 3RVBA 3LBNA 1VG9B 1T5IA 1TQ2A 3QXCA 3K09C 1N6PA 4ZPXA 3JZMA 4Q9JA 4BFSA 2EWWA 1XTRA 2PT7A 3O8DA 4WXRA 1R8SA 1T91A 3OIUA 1E0AA 1ZIOA 2QRNA 1VCNA 2JLWA 1Z2CA 1RFLA 2C8VA 2OO7A 4ARZB 3U44B 3B6EA 2OUKA 5DHAA 4OHZA 3TSOA 1X3SA 3KTAB 2EFHB 2G77B 3ZGXA 2R44A 1ZM3A 5BN5A 3NTUA 4Z51A 3TSZA 2NG1A 1Z6YA 1LF5A 1ZRHA 1WRBA 3FMIA 2G0NA 1Z28A 5AJWA 4TYPA 1N6OA 1YZKA 3BAFA 4IHQA 5H70A 3GLFA 2VHJA 4C30A 3VKWA 3A1UA 2FPMA 5K8TA 4Q1AA 4A36A 4PC2A 2ZTSA 4OI0A 2GBLA 4E07A 4I99A 4PHFA 3K9HA 3ZVNA 2PX0A 1GFIA 4GFDA 2RGNA 2WPDA 2IX3A 2QAGA 3B1WA 5DH9A 3MWJA 3A1WA 3U61B 2IYRA 3GJ4A 4A2PA 1SVKA 4OQLA 4U5XA 2ZYVX 4FIDA 3RS7A 1RJ9B 3CM0A 3A37A 3P27A 4RD1A 4M1KA 4AY2A 2V6JA 1UKVY 3F5FA 2VA8A 1IN5A 3HR8A 3AP3A 2W2VA 2FNAA 1MR3F 4PQFA 3GJ6A 1RC8A 3L0PA 1X6VA 1M7GA 1T5LA 2ANBA 1CIPA 3KKMA 4BUJA 4YONB 3BRWD 3FKSD 2IWRA 1LTQA 2ZSFA 4H1VA 1TF5A 2DB3A 3RS3A 3FPAA 4P31A 3WP0A 2BJWA 1G21E 1A2KC 2H18A 2JASA 1RYHA 2GESA 3ZZ0A 1UEIA 4PX9A 3ADCA 2OILA 4Q66C 2ZVQX 1E79A 5D3MB 1HEIA 2D7DA 1JBKA 3ASYA 4S2EA 2WSMA 2XTMA 4MKIA 4HLDA 2V8OA 4DLWA 2PX3A 3NDPA 1ZJ6A 3VR1A 5IK2D 3VKHA 1P2UA 5BW8A 1KSHA 3FFAA 4TWZA 4A2WA 1G20E 1UPTA 3IQXA 1CRQA 1P2SA 4KYUA 2F1JA 3NH9A 4TL6A 4Q1FA 4C0KA 4OI4A 2FF7A 4URXR 2ODEA 2FPKA 3SN6A 3MJHA 3ADKA 5AJYA 1JPJA 4RCYA 2X77A 2JDID 2Q3HA 1GNQA 2E9SA 3LXXA 4GZMA 1JI0A 4BFYA 4NCJA 1BYUA 1EX7A 1ZUHA 1Q44A 1KYIA 4TMTA 4UJ3A 5L3QB 3WP1B 4R9UC 2ZEJA 3RC3A 1U0HC 2Z5FA 3M1IA 4PANA 2BKEA 5JCZA 3W5IA 4CEHA 4PO9A 1G18A 4L9SA 2V1XA 3H0KA 3PCRB 1KHTA 1MO5A 2P5TB 4JLBA 3NG1A 1VG8A 3O47A 4B43A 4M1WA 1IY2A 3F3YA 4PHTA 5C4MA 1QHHA 4ZCLA 1XJQA 3KXLA 4LWZA 4K81B 4HAYA 1OH8A 1OYWA 3QEOA 3OEHA 1MOZA 2V7QA 5CJPA 1G8FA 2CHQA 3L0SA 1XD9A 5CITA 3KB1A 5CM9C 3ND8A 3SHWA 4D6PA 1F2TB 1MO6A 2FEMA 3Q3JB 1FUUA 2VSOA 1Z47A 1N0UA 1CS4C 1KZ7B 1TADA 5JWHA 4XJXA 2XNDA 2QP3A 1OH6A 2X2EA 1Z29A 2NIPA 4DSTA 4XD7D 4R2IA 2ZRAA 3S1AB 4C9BA 3GLGA 1P5ZB 1W5SA 2VP9A 1QBKC 4P0TA 2AR7A 3GJ0A 4YQFA 2QPTA 4II7A 2ASEA 4LCBA 4EJSA 4R71A 3SOPA 2JLXA 2WSSD 1US8A 1KMHA 2WWWA 5EP2A 3ETLA 1OFHA 4NL4H 5HTKA 3VFDA 4A9AA 5EXSA 2QROA 4LHWA 5JSZA 1ZD8A 4G5SA 5DISB 1QHYA 2C95A 1E2HA 3VR4A 3TLXA 4DCUA 1ZCBA 3KQNA 1GKIA 4RZUA 1AKEA 3GPLA 3TH5A 1UJ2A 1XTKA 4JMPA 2IF2A 1H65A 4C2TA 1KKLA 1H8HD 4M9XA 4V0OA 4D0GA 3X1XA 5IHPA 4U7DA 2J0QA 3CB4A 4PAQA 3Q5DA 4LI0A 5HE8A 4B32A 1N5IA 3NBXX 2GEUA 4ERNA 1ZNZA 2PZGA 3NBFA 4A0GA 3CX6A 2O0HA 2BHRA 3CH5A 4FCTA 3CBQA 3QG1A 1XTJA 2P65A 3AKCA 4P4TA 3EG5A 1F5NA 2A5JA 2JA1A 4JLAA 2IYQA 5AR1A 4H9GA 5ELXA 2HLDA 3G0HA 4Q03A 2CL6X 2FV8A 2GBLC 2VIIA 4HB3A 4NCKA 4DT1A 4BGDA 1YR6A 2OBNA 2J7PD 4A8JB 1YZUA 4B3GA 1GL6A 4Z8YA 1ZP6A 4LC0A 1NRJB 1X8JA 1WCV1 3X1YA 4TLAA 5FTMA 1I2DA 2ZR0A 2FPLA 1CEEA 2WJHA 2OFWA 4C0HA 2HT6A 3A1VA 4JVSB 1HT2E 2O8BB 5FTNA 1PUIA 3U4QB 4DSNA 1NSTA 3BWDD 4DB4A 2GCOB 3A1SA 4Q47A 3W3AA 1DG3A 2WZQA 2UZIR 3NIBA 5J4KA 3NHAA 3SYLA 1Z6GA 3UMRA 1E98A 1L7VC 3QIAA 2FWRA 5GJBA 3CWQA 3RWMB 3BIFA 2MMCA 1OXSC 2UVQA 4MUBA 4KI0A 2OXRA 4HAZA 1VG0B 2DYKA 2ZJOA 5DO9A 4LYHA 5FBVB 3IIKA 5DI3B 4PC7A 3RS4A 1DAEA 2G88A 4MYHA 1W2HA 3QKRA 3SQXA 2MSEB 1N6RA 4NE2A 2ZRNA 3ZD7A 1E2QA 2ANCA 1O87A 2O5VA 4EDHA 3H2YA 4O2LA 5HCIA 2FFHA 2KSQA 1XRJA 4GPTA 1A4RA 3AF1A 1E32A 1DAHA 1TQ6A 2CXXA 3OIVA 1KNQA 1JR6A 2ZRFA 2ECKA 3FKSA 5CM8B 2F43A 4LPSA 1HURA 1NN3A 3GQBA 3FOZA 1U9IC 1T3LA 3B13B 4MYCA 3T34A 2HJVA 3SDZA 2GJSA 3T1OA 2B92A 3H1TA 4TLDA 3RRMA 4YMVA 2PJZA 4LX0A 4WXPA 2ZJBA 3UIEA 1A2BA 3THXB 2XJ4A 1S1CA 1XZQA 4HZIA 3LAWA 2JJ2D 4MKGA 5BN3A 3U3JA 4MDEA 2DBYA 4Q1DA 3B9PA 4P33A 3T1VA 1E2KA 1WP9A 1XBTA 2QTFA 2QTVB 4MYTA 4DEYA 3MUFA 1CJKC 3U3RA 4D4KA 1S9HA 2OCBA 2VP5A 4QGGA 2JGNA 4JJZA 2KJQA 1R6BX 2FEOA 1E0SA 1FP7A 3I8XA 4BLSA 3ZIAD 3TBKA 4I81A 3I92A 3L2OB 2FN4A 4PC1A 1EFHA 2ZJZA 5B58C 4M0LA 3CRQA 1BMFD 4TT3D 4TL8A 4BECA 2H7VA 1DELA 3I8SA 3I72A 2RGAA 2AFHE 3EC1A 1SXJD 3LNCA 1Q1BA 2PT5A 2VSXA 4D2IA 4ZDJA 2CE7A 1P73A 3SNHA 1ZU4A 3C16C 1HUQA 3IKJA 3SJZA 4WZBE 5FBLB 3P1JA 3P20A 2BV3A 5K8IA 1CJVC 3CF0A 2AL7A 2WWIA 1YR7A 2D62A 1NN1A 1PJRA 2CK3D 4Q00A 1R0YA 4M22A 1KI1A 2RGXA 1B23P 3GLIA 4F91B 4LPKA 2H1LA 4EIWA 2YOFA 1XD2A 1UBEA 3GEHA 4TLCA 3QKUA 4LJ5A 1IY1A 4AYTA 1Z0AA 1Z0IA 2AHOA 1R10A 1WDTA 4HEJA 3C4JA 1XTIA 121PA 3IUYA 2KBEA 1E2PA 2FX3A 5FUWA 4B3BA 4F4JA 5IF9A 2GEDA 1G8YA 3LV8A 1X8KA 3GLHA 3K9GA 5HE9A 3V4RA 4BLPA 1I4DD 2QTHA 4OJQA 2P3SA 3SC3A 1K5GA 4DLTA 1UADA 2CDNA 2IEZA 4Q4AA 3TKLA 4OYHA 3VQTA 4MGYR 2GXSA 3TVDA 2A5DA 5K8UA 1G8HA 4M8NE 4EQ6B 2DFTA 2R9VA 4B3DA 2Q3MA 2QPOA 1C4OA 3BBPA 1FMLA 5TV2A 2KB0A 3ZD6A 1K6MA 1S9DA 2GVDC 3EZ2A 4EFLA 2QPAA 1KSFX 3CPJB 5CDFE 1U98A 3KQKA 1IJEA 1W0KA 4RFVA 3K09A 5EE5B 3LBHA 1E1QA 1G19A 2XTNA 1N3BA 2ERXA 1U90A 3BB3A 1DG1G 3QUSA 3GP8A 1GUAA 2DY1A 3AVPA 3GJXC 3M4YA 1W36C 2FJUA 1G7TA 2NTYC 2VP2A 3X1DA 1TMKA 1AZSC 1ZM9A 4CEJB 1FTSA 1KY3A 1NN5A 1E69A 1VTKA 3V4FA 2WPDD 3W6NA 1M34E 4A92A 5SZJA 5AK0A 5JFGA 1RE0A 3CLVA 1W49A 3UWOA 2QI9C 3AUYA 3PUZA 4ZCMA 2CL7X 4D80A 3KQHA 3EPHA 2O8EA 1XF9A 5JWOA 4HDCA 1D2NA 1CP2A 4M21A 5FFMA 4C0LA 1ZC3A 2DWPA 4JSTA 4MKHA 1OH7A 3CRVA 4LDJA 4URVR 3BFKA 1X1SA 3K70C 3FB4A 2GETA 3IEUA 3O8BA 1GSIA 2ZROA 3R9XA 3I73A 2E1RA 3AVUA 4WOPA 5J47A 4PHHA 3AF0A 2WV9A 1D8TA 1UBFA 1V43A 2OLKA 2QZ4A 2XB4A 5AWFC 1WBDA 2BMJA 4EPRA 2VP6A 1RKBA 1KTVA 4ASUD 1ZW6A 1TQDA 1YJ5A 3DPUA 4JYBA 4QBIA 4BFTA 5G3ZA 3PITA 3UKDA 1W4CA 4QGFA 2O8CA 3DZDA 4DVGA 1VKJA 1AS0A 1E79D 3IPXA 1R0XA 1O3YA 2QM7A 2J87A 1G3UA 3ND9A 4BRWA 4C0SA 3OF5A 4IJMA 2F55A 2J46A 3QPVA 5FPKA 4TYNA 1HQCA 2NO9A 1OIWA 4JVNA 1E2EA 2CLDX 4DDUA 4URWR 4DJTA 3AKDA 5DI9A 1EFRA 3WXMA 5CDFA 4LHYA 1VCMA 1OXVA 1LVGA 2ZSBA 3ZS8A 1Q1QA 1SXJE 1H8EA 1OF1A 1S3SA 3RS0A 1MABA 3SYNA 5HR5A 3THYB 2QBYA 4JVLA 4Q1EA 2A3RA 2IUUA 2RGGA 4FN5A 3RHFA 5GJVC 2EFCB 2W83A 1ZNWA 2JLZA 4F93B 5CYOA 3PEUA 4KYIB 4Z8XA 1IHUA 3VX4A 2BBOA 4KFTA 4AI6A 3OFNA 1R0ZA 5L3SA 4Q4JB 1GG2A 5KUTA 4NPHA 1VHLA 2K5UA 1CJMA 1GOTA 1VYUA 4L16A 5F2EA 2YC2C 2UKDA 1FX0B 5KTYA 2FA9A 2ORIA 4D4JA 2BBWA 2QMOA 2CCKA 4NH0A 2QMUA 4QHYA 5FOVA 3WY9A 3PVSA 4W7SA 1EWQA 3SJBA 3CRMA 3RWOA 4KVGA 3OEHD 4Q21A 2HYIC 1XEWX 2J41A 2V7QD 1S4QA 2ZI5A 1DO0A 3E70C 2QA5A 3NVAA 1TEXA 1UAAA 2AFIE 3NWJA 3BJIC 2IUTA 4PQYA 1LFDB 1DTSA 521PA 1EX6A 2OCPA 1N6NA 4JIMA 1SHKA 2PCJA 3NEJA 3UG6A 2XNDD 4C2UA 5L3VA 3AVTA 3TR0A 1KJZA 3NH6A 1KAGA 1T4GA 2YOHA 2PLRA 5G40A 4PSAA 4OJKA 2RCNA 3NKVA 1ETUA 1Q1EA 3HPQA 4G5RA 3U6BA 3QVUA 1R0WA 4W9MC 4ZDKA 3GLFE 2QL6A 1FNNA 1G8PA 2JCSA 3GJ8A 2R6FA 2Q9AA 821PA 3R20A 3THWB 5FOUA 2HT1A 1DADA 4ZI2A 2ZJ2A 3OAAA 2ZJYA 1OV4A 1ZCAA 3QXXA 1SXJB 5E7MA 1Z08A 2ZJ5A 5F9HA 4FI3C 2Q0HA 5HKKA 2QGZA 4AWXA 2QENA 1QHNA 2YWFA 5A5GA 4US2R 3HJNA 3QQ5A 3U60B 5CB8A 1VIYA 5JI3E 3DKVA 3SE0A 2IS4A 1LW7A 5JRJA 2IL1A 2QORA 2R6GA 3VX3A 1GDDA 4B48A 3WHLA 2ZYTX 1KI6B 1CR2A 2YWHA 3SHFA 4OK6A 2N46A 4TSFD 4K8OA 4DZZA 4G0NA 1NMXA 1OHHA 1Z6AA 3A4LA 3MWLA 3DKPA 1IQPA 1TEVA 2A7QA 2F9LA 2G1KA 1U0LA 4V0NA 3U3KA 1SQ5A 4O2RA 1CR4A 1PZNA 3IO5A 3BH7A 4KFRA 5DGXA 1QHGA 3FVQA 3TSWA 1GZSA 2XNSA 1QRAA 1J2JA 3RYTC 5KOYA 2HLDD 2Z83A 4TYQA 5FPHA 3AVYA 1G6OA 5DYIA 5ANRB 2C99A 1ZD1A 3SBDA 1N6IA 4HAUA 2GJ8A 4G5OA 1XPUA 4EPXA 3T1TA 2C04A 4FCWA 4HSEA 1KDOA 2ERYA 2I1VB 2ZITA 3K8YA 4LV5B 1GL7A 5EP1A 3BS4A 4KU4A 3UK6A 3RLFA 4BFVA 1RIFA 4C3ZA 2OZEA 5FOTA 4PAMA 1CR0A 1R2QA 2F1RA 4B2LA 2YWGA 1HYQA 2ZSAA 4GOJA 1R7RA 5HCNA 2AN9A 1TQ4A 3GLFB 2DPXA 1KNXA 5BYJA 2IT1A 2VF8A 3UANA 4CIDA 4EPTA 4U00A 1KK0A 4NONA 5EP4A 4CYMA 1SVMA 3IO3A 4NHOA 3TUJC 1ZMXA 5JJIA 1NSFA 3PUXA 1D2EA 4RD6A 2FSHA 1NBMA 4G3XA 1XFAA 2QAGB 5C2JB 1W4RA 3B60A 3AVOA 2P2LA 4OQNA 2ZRBA 1K5DA 1OSNA 4FCVA 4GP6A 4HB2A 4TN1A 1TL7C 4IW3B 5JZVA 3SFZA 5DE3A 3BB4A 4M53A 1MRSA 2CCGA 1JAIA 2ZSEA 4XVRA 2GKSA 5LDDC 4IDHA 1LNZA 1GKYA 3MGCA 4I1SA 1N5KA 2XZOA 3FHTA 5F98A 3AVVA 1AA9A 2W00A 2ZAOA 4N3NA 2ZM5A 2R2AA 1AGRA 2GAOA 2QSZA 4A0HA 6Q21A 2XZLA 1ONBA 1JAHA 3MCAA 1OW3B 2ZIAA 3WMFA 5C46F 1XCGB 5L3RA 4ASUA 3U7HB 2FU5C 3QOFA 4IDPA 3HPRA 4QNRA 4IRUB 3PUYA 4WAUA 3SR0A 4U02A 3LQRA 3PXGA 3VTKA 3NEYA 1DPFA 5FBRB 2YV5A 4HYYA 1ODFA 3FE2A 3LD9A 3SFVA 2OFOA 3GLGE 2IW3A 4IEIA 3U2QA 1JECA 1MT0A 1W1WA 4Q19A 5DN6A 5P21A 4EFNA 1RRCA 3LX5A 3OHMA 4OI2A 3B82A 4NP6A 3PUWA 4URZR 1Q21A 1IOZA 4PPGA 3THOA 4A82A 3RS2A 4EFMA 4OK3A 4EPWA 2KWIA 1U9IA 2WIAA 3MAAC 4LJ8A 1E4YA 5H1YA 3U5ZB 4AKIA 1ZD9A 3HWSA 5FUXA 5BWMA 5DSZA 2VHTA 1KIMA 2WHXA 4BFWA 2X1VA 4MRSA 3TE6A 1CBUA 4CEHB 4M4SA 1QVRA 2NGRA 3MSXA 5HPYB 3O8RA 1VHTA 3B1ZA 3DM9B 3PENA 2D74A 3IQWA 2OSBA 2A5FA 3BOSA 1HQYE 3K0CC 4HUQA 5FTLA 1AN0A 5FPSA 1QHHB 3G82C 1OB5A 4TMVA 4DLZA 2ZE5A 5CK5A 3SJCA 4QBHA 1T9HA 3TNFA 1UKYA 2DR3A 3WBKA 1ELOA 1NVUQ 1G1MA 1N0VC 1VYTA 4Q48A 2PMKA 3DMNA 2VRWA 1ZM4A 4CW7A 3AKEA 1PV4A 2GF9A 1FMJA 1P7CA 1UKEA 4LZZA 3NHBA 2AXNA 2RB4A 3E1SA 4R98A 4Z54A 2BM1A 1KKMA 4QJ5A 4FMCB 1OFUX 3ZS9A 3JVVA 4B34A 4DCVA 4H1UA 2JLUA 2QEQA 3UMFA 1VMAA 2J0UA 5AUQA 1E4VA 1Z0KA 4MGKR 5FR1A 2CVFA 1E2FA 1KOFA 3GLGB 2IXGA 2IS2A 4D26A 4WW0A 3Q9LA 2GK6A 3BORA 2FE4A 2CJWA 3GEEA 1Q20A 4QXAA 5C4GB 1UDWA 421PA 4DKXA 3A4MA 3BD9A 1AM4D 4EJSB 4NYMQ 4DSOA 1OT3A 1US8B 1KMHB 1VPLA 2OXCA 4JLNA 3LXRA 1ZM7A 4JLPA 2REXB 3KB2A 2TMKA 4P32A 2GK7A 1XXHA 3C41J 4LYFA 5JSZB 5KNDA 4K46A 1KDRA 3SYKA 1NG1A 2PMDA 2E87A 3EXAA 1E94E 4LY6A 3LY5A 2W0MA 3PEWA 1M7HA 3ZZTA 1QHXA 5C1BA 2B6HA 1TPZA 2WJIA 1IJFA 1CTQA 1W0KD 1WMSA 4UNQA 4D81A 3EIQA 2WIBA 1E1QD 1OJLA 1EG7A 1LF0A 1M74A 3H84A 4RKFA 4ZIRA 1II8A 3WYGA 3LW8A 2OLJA 1E9RA 3E5HA 3KJGA 1DBSA 4LJ9A 4XOIA 5CK4A 2R65A 1EK0A 3AP1A 1IXZA 5J4LA 3OIWA 2H16A 4KBFA 1SVSA 5FOSA 5TMPA 4Z1MA 4TSFA 4EPVA 2XOKA 4MGZR 1R5BA 4ZKDA 4PR0A 2X2FA 1U0JA 3P32A 4N0DA 3L0IB 3LLMA 2C9CA 1KI9A 2BIFA 5FTKA 1OH5A 1GWNA 3VAAA 3I61A 3I32A 3VMFA 2R62A 1IN4A 4TLBA 4A0RA 4G1UC 1G8GA 5E95A 4DT1B 3W9YA 2P67A 4JLDA 2QQ0A 5L8VA 1DAIA 1GAJA 3E2IA 1N5JA 3V9PA 2YHSA 2EVWX 4MRRA 3ZZUA 1I2MA 2ORWA 721PA 2J0VA 2CNWA 4IVPA 4A2QA 4PQRA 2JIZA 3QF7A 3X1WA 2GZDA 2OFXA 3TAHA 2C9YA 4DXAA 2GA8A 2ZYWX 4X8MA 2WWYA 4CGZA 1LS1A 2IYXA 2VO1A 3I5YA 3TW8B 3BXZA 3DDCA 1N5LA 1NVVQ 3DVLA 2D2FA 3C14C 2FFQA 1NL3A 1IN8A 1JEDA 4TL7A 4JBWA 1FP6A 4N0EA 1U99A 4LHZA 1FQKA 2IXEA 4AG5A 4OQMA 4MA4A 4AK9A 4JBXA 4M1YA 3ADDA 3OE7A 2XAUA 1E3MA 1G6HA 2OAQ1 4MQBA 1RRGA 1EFRD 2CE2X 2AKYA 4QJ3A 2BJVA 4LJYA 2GJAA 4FMDB 3VHXA 4GOXA 1L8QA 2JLQA 2WMNB 1H8ED 3BH6A 3ECCA 2PEZA 3QXJA 2VYFA 3RRZA 3I5XA 3VR5A 4QKQA 1JJVA 1T8UA 2GWHA 3FTQA 3QKRB 5LB4A 4RSGA 1OLOA 5HZKA 4O3MA 3WHKA 4KODA 2VSFA 3MWKA 4JBYA 5CJ2A 5EQTA 2P5SA 2EQBA 3JZAA 3EPJA 2WTUA 2F3TA 2IXFA 4D0NA 2ZU0C 4DB2A 5DYGA 3GLIE 3VU9A 4LBWA 2J5XA 3OFND 4HDQB 1NN0A 2F43B 4Q01A 1E0KA 1D5CA 2HDNB 1G5PA 1P9WA 3QPWA 2R6CA 4R2HA 4IOLA 1NI3A 2AWNA 3QE0A 3A4NA 2GTPA 1XU4A 3HDTA 2ZRLA 4P3YA 3AV0B 1X1RA 2QNRA 3CNOA 4B3XA 5JEEA 4B35A 3GLHE 1YZLA 1G64A 4G01B 2GXAA 1Z5ZA 3UWKA 1E9EA 2MMGA 4J0QA 4D25A 1ZU5A 1JXOA 4Q7KA 2CLCX 3RSOA 4ACBA 1W48A 2HJGA 2P0EA 4ON9A 3CO5A 1P4SA 2QY9A 1GRQA 3QKSA 4G5QA 4B33A 2XXAA 1BO6A 2RAPA 4X8LA 1KZGB 2O0JA 4QJ4A 3ZDQA 2A2ZA 2D7CA 1MO3A 4GZLA 4LV8B 2CBZA 4RFSA 1U81A 1JEEA 3FGNA 2VF7A 1E2LA 1U8YA 3PG5A 1GNPA 1DAGA 1NIPA 2ONJA 4EPYA 2EW1A 4Q9HA 2IYVA 3CRRA 4MDFA 4QC2A 3A58B 3OAAD 3P4YA 4P4SA 3QEJA 3HR7A 4IXMA 4HLQB 4L9WA 4IDNA 3WBJA 4JT4A 3M6AA 1FL9A 4IDQA 4CT5A 1AK2A 3QI2A 4B2PA 2J0SA 1XMJA 2WKRA 1NMZA 5FH9A 5HKKD 4Q9LA 1CKEA 1Q1ZA 5JEDA 3MJRA 1AGPA 1Z6XA 5JHHB 1G3RA 2OEPA 1XZPA 4IVQA 4LV6A 2RMKA 3EX7C 4LBYA 5DNYB 1IY0A 4BWYA 2WAXA 1EFCA 2F9MA 1W0JD 4V0LA 4MRNA 3GLIB 1WB9A 2YNMA 1T3SA 4Q5IA 2O8DA 1NY5A 2WJYA 4IOKA 4Q1CA 4QBFA 1XD2B 1UM8A 1OHHD 4B75A 1P2VA 5LB2A 4AKGA 2FFAA 2HEIA 1UFQA 2V55B 3F0TA 3QSYA 3TQFA 3EC2A 2ZVPX 1XEXA 1FTNA 4HAVA 4XVQA 1RZ3A 3V00A 1M6NA 3TIFA 1C9KA 3GLHB 2XSZA 2VQSA 4KXFB 5KNCA 3FMFA 4C0AC 4IEEA 4QHTA 3EZ9A 4GT1A 4Q4AB 4B76A 1COWA 1CXZA 3NC0C 3EZFA 5EE3A 5A0FA 2ZE6A 1S96A 4DLUA 1KI8A 5EJEA 2FGJA 1VG1A 3AP2A 2D06A 4KFUA 1NJGA 3Q8XB 3B2EA 3T15A 1XEFA 4JL6A 1CULC 1I4LD 5LD2B 5CLQA 4OQXA 3CNNA 1OXUA 2YKGA 1T0JB 2QUZA 1Z07A 4FXPA 2OG2A 1CJUC 1E96A 2IS1A 4JL8A 1D6JA 1TUIA 4KLNA 1TU3A 3KKOA 4OHWA 1BKDR 1NLFA 1KI4A 2JJ8A 2Q9CA 2WMOB 2PJRA 5GADl 2WKQA 3AF3A 3WNBA 2JLSA 1OB2A 1TF7A 4A6XA 3A1TA 4JLVA 1J99A 4LGMA 2Z0MA 4BEBA 1NBMD 3SZRA 3CR8A 4LBZA 2NO0A 1YKSA 3F8TA 5CIQA 4Q7JB 1RVDA 3VNUA 1CRPA 4IDOA 5FOXA 2O8FA 2BM0A 1P75A 3L8ZA 3T35A 2O8EB 1S8FA 3GEIA 1J8MF 4UKDA 2EWVA 2J59A 1AQYA 1FNMA 1XNJA 2CL0X 4DDVA 4RVCA 4C0QC 4B47A 1Q3TA 5GJCA 2BC9A 2JEOA 4M9SA 1IN6A 4ZKEA 1DAKA 1HY3A 4M1OA 1YR8A 2ZS7A 1NVVR 4UQOA 1S2MA 2HCBA 5TARA 3A8TA 2GNOA 3KZ1E 4RCZA 4A8JC 2G9NA 4PPQA 2P6NA 2OCYC 3KFXA 1NY6A 1EESA 4PO1A 4NU0A 2H8KA 1UEJA 2A5GA 4MRVA 1G7CA 4TTRA 1DO2A 3DEFA 1Q3HA 2ATVA 1SZPA 3R9WA 2O8CB 4XWOA 4XTRA 1P3JA 1YR9A 1UBGA 4JT2A 1W4BA 3LX8A 4E03A 1OXXK 4I4LA 4B71A 4QM7A 2IYYA 3W8RA 4YXWA 1AKYA 4IKEA 2ZR7A 3HP1A 2VL7A 5GJWC 4KITB 1S3GA 4AG6A 1AS3A 1Z0JA 3TW4A 1NF3A 1KK3A 2GJKA 5DN6D 5B64A 2IYLD 2A9KA 2HXYA 3CUEF 1KJYA 4JZKA 1KY2A 1Z06A 4BFXA 1ZIPA 2QBYB 1MABB 2CHGA 3IPYA 5SZHB 1FW6A 5SZKB 2RGCA 3U7EB 4QFMA 4A1FA 3CR7A 4F7WA 3IDQA 3AVQA 3CPHA 4ESHA 4YLGA 1XMIA 1XTQA 3EPKA 3KUDA 4HDOB 4ZCIA 2V4ZA 4B2IA 2I4IA 4Q4LA 2OESA 5TVKA 5TDHA 1ZBDA 2LWIA 1ESNA 5L3SB 3K9NA 3P4XA 5JCPA 5TY0A 2MSCB 3FHCB 1AZTA 2O52A 1OE0A 2YYZA 1KGDA 1F3OA 4V0MA 4A4DA 1CLUA 1JNYA 4E22A 3IEVA 3BK7A 1P6XA 1XJ0A 4TQUS 3RC8A 4DSUA 3KXKA 4B73A 1E2JA 3U6KA 2ZRJA 5JJKA 1BOFA 2JLYA 4NMMA 1E99A 1A5TA 4Y0VA 3L82B 2IYSA 2W58A 4MKFA 3QF4A 1QZXA 3EA5A 4LJ4A 1GIAA
chains in the Genus database with same CATH superfamily
2D3TA 3KT0A 1E2MA 3MELA 3O1LA 4RHTA 3LCMA 1A9PA 1U0OC 4ZOEA 1RAFA 4U2EA 2J9RA 4CHTA 3AF4A 4FLFA 5KVSA 4U2GA 2B9EA 1XB2A 3QLTA 5DWVA 4EHJA 2ISCA 1WHTB 5K03A 1AJEA 1NUSA 5I6DA 3QVGB 1VCOA 1TXGA 5DXAA 4J2TA 1KO7A 1RXIA 1CNMA 3QWAA 4MLCA 3S40A 4HXGA 1Z8FA 3LPNA 5EN4A 4UHEA 3GJ3A 1VIAA 1HI9A 3T4XA 3WL3A 2HCJB 4CKYA 7MDHA 2BF4A 1SHZA 2Z4RA 1A7KA 4PLFA 4MVJH 5LP1A 4FCCA 1Y5RA 5FL7A 1EGAA 4Y6QA 5FYDA 4ZVSA 1G6Q1 2HQOA 4QU9A 1U9YA 4TV8F 4CTOA 1WEKA 2Q6OA 3GRUA 2ZTUA 1PDOA 2P9FA 4YRFA 2E4UA 4P1ZA 4ZU6X 4UEKA 4ZVTA 1V3VA 1GY8A 1HX7A 2CZGA 2X23A 4GBGA 4CEIA 1YS2X 3OT1A 4A23A 3H5TA 4PTLA 2PGXA 3GCWA 2VHQA 4LOJA 4G5GA 1ZXXA 1RRFA 2JCYA 2YV3A 4MO9A 1D04A 3H6GA 3OPMA 3R44A 4YCJA 4CG0A 5LQKA 5LL6P 3DBHA 4P9NA 3EWIA 4PU0A 4WY5A 3KSBC 3IPRA 2BTQB 4US0R 1QYXA 3HDQA 5BY2A 4PGFA 5TMBA 3ZWYA 5DU2A 5KSYA 4KXNA 1KSGA 2PGAA 3KXPA 1W0JA 4IINA 3EAQA 2BVNA 4R2XA 4KNWA 1ZOIA 1VSBA 1UK9A 4Z1MD 1ORDA 3ZHRA 2IQIA 2V54A 1UMDB 2HQBA 3T5CA 4EQZA 5CVJA 1A9ZA 2I6GA 3PQEA 5JVDA 4J0FA 4NE9A 4L8VA 4G0UA 2H7CA 3B78A 3HBMA 2GPJA 4AULA 2YHUA 4H7JA 4HX2A 1ECPA 1LRLA 4WH0A 1J21A 1G16A 3NDBB 2CD7A 2ZXUA 2H85A 4RIHA 3IP1A 1T5SA 2Q49A 2YC4C 4BNJA 1PX2A 1BW9B 1TVEA 2A9VA 2XNKA 1WZUA 2HUNA 3ITDA 4NZMA 2G0TA 2QLJA 1QF9A 3S2FA 5IMSA 2O19A 4LVOA 2CXSA 2WI8A 3CINA 2FRDC 3DEHA 3ZY5A 5FJIA 3O9VA 3HVKA 4YPOA 4CCAA 1PLLA 2XZTA 2Q99A 3L18A 4Z9YA 5A5FA 1W36D 1DC6A 5E6RA 1UK8A 3Q3CA 4COKA 1V8FA 4OQPA 3T9DA 1T1EA 5ALOA 5EE0A 1Q57A 2QM8A 4PLZA 4DF3A 4DGSA 5KNBH 3TQCA 1FS5A 4EOGA 4M60A 1UT6A 1IM5A 2QP4A 3G3EA 4IDGA 4KV9A 4ZANA 4E6EA 1PJ8A 1PVDA 4EKYA 1P61B 3RU3A 4AC9A 4WY2A 4LKOA 3N8KA 5EIXA 1VOTA 1UT5A 1XMVA 1XPRA 3R5FA 5AI8A 3OM1A 1Y0BA 3E5RA 4XGKA 3HCOA 4HH4A 1BS2A 2UZ0A 2R4TA 4DV1B 1TVCA 4QLAA 3LLUA 2ACEA 3PFWO 1YHNA 5EG5A 1VJCA 1GGJA 1U11A 1JQJC 3C8DA 3D2AA 5FNZA 3VR6A 3ESAA 3WYCA 1YIAA 2H0QA 5KSPA 1TNDA 1XPOA 3HA5A 5JAZA 1HOTA 1KJJA 2J4DA 2UZAA 3R41A 1FUEA 3D0KA 2VJLA 1U1GA 1LDMA 2NQ8A 1UJ4A 1XDWA 2C2ZA 2A1TS 4OBWA 5H7XA 1NP6A 2W6IA 4DCSA 2B78A 3OZEA 1ZI8A 4C04A 1EHIA 4P3KA 4AO8A 2ICAA 1KZ6A 4B4KA 3HXOA 4NRDA 3N2KA 3P2MA 4DJFC 3KQOA 1KI2A 4ND3A 1P19A 2Q3DA 2X15A 5FBQB 4ABYA 2CWDA 3AR2A 3BVPA 1C0PA 1WCIA 1WDLA 3BSWA 2CJFA 5CAEB 1S7CA 2FLVA 2WSBA 4BNDB 1P5JA 2NZUG 3TRKA 1KZ4A 1RBQA 3MB5A 2NU9A 2HJHA 2G7MC 4IGAA 4YMUA 6REQB 2NP6A 1PJCA 2FTKE 2JEZA 4ARVA 4BP1A 4DGQA 3DB1A 4ZHSA 4C4TA 2VDJA 1RLOA 1SIUA 1YZHA 4M88A 5CCEA 1YB6A 3O7WA 2NZ2A 2ZJ1A 4RK0A 2CB9A 1KAOA 4IFTA 4O0LA 3DFMA 3G17A 5IABA 3D3KA 2OBFA 2P7IA 4LJAA 1Y3CE 1P9NA 1M8GA 1Z3IX 2ATEA 3D8SA 2IV2X 4A91A 1L7MA 3R8CA 5HRUA 1FP2A 4PZ9A 4KH1A 3RYFB 2PUBA 3LDFA 3TLEA 6PFKA 5KKAA 1A96A 4MQ5A 2Q46A 4EKEA 3QFTA 2OWEA 4HDKA 4XWWA 3A14A 2Z04A 1CEXA 3OKAA 5K0LA 3KQLA 4BQQA 4IHKA 3WO1A 3FVTA 1E1KA 2EFJA 5HQJA 4EMUA 4JY7A 1DOAA 3AEUB 3EIHA 1B15A 2ZCVA 1KMIY 4CDGA 1CCWA 3WGTA 4C87A 5ADHA 5C4IA 4IJQA 2OKGA 2WYOA 1MRNA 2PGJA 3CHYA 4Q0MA 5L4NA 5KS2A 1THZA 3NM4A 1QTRA 1XJWA 4WASA 3PJRA 2QU8A 2KMLA 3M0EA 1DBIA 5KWIA 2R48A 1EJ0A 1GPUA 2G4LA 2P30A 2J4FA 1AMNA 4NTZA 4S1NA 1X77A 3Q6MA 2IEBA 5F2OA 1SU6A 1KP9A 3F3MA 4Y7CA 5J5AA 4YBRA 5KI6A 4ND4A 4O4HB 3CZQA 2OE2A 2JLRA 1GTZA 3MT8A 3SEAA 1NVBA 3OCCA 4JOBA 1XMSA 2A0YA 4FSXA 4LN1A 4Y2UA 3SLKA 4TYYA 3LCCA 2VK1A 1KEPA 5H68A 5IMBA 1GITA 5CBPB 4RA6B 5BYKA 1Q6ZA 2OCXA 4L2IA 3M6LA 3TQIA 4DQ0A 3DHVA 4B5KA 2IBTA 2J09A 2Y4OA 3COVA 4B85A 4MVXA 3U16A 4IGEA 3BWEA 3UOGA 5C5CA 3UPTA 1XVVA 4HUQB 1Z25A 1UWCA 2FW1A 3ZVMA 5AUPB 1YDEA 3C7AA 3CONA 3VU0A 2IS6A 3C85A 1OREA 3C8HA 3HYTA 1TM1E 5ENDA 5BMVB 1FE8A 2B7CA 5MGBA 3IJRA 4ZVLA 1GQSA 5CIWA 4QM6A 1L1RA 4L1KA 5G3YA 4BTLA 3F2IA 1DJNA 1PT6A 2FKAA 2WU4A 4LDZA 1ISIA 2G9ZA 1QQ5A 3KAPA 4QATA 1P3DA 4LRUA 2VQ3A 2K7ZA 3GJ7A 1H9CA 2X58A 5KNLA 1HE1C 4D4MA 2COUA 5JSQA 3SLRA 3H11A 3NEPX 3RAGA 2JI6A 4C08A 5EE9A 4NK5A 4X97A 1N2CA 1ESMA 1K0UA 2O5RA 1PUJA 2I78A 1Z6ZA 1NBOA 1YVDA 3U4MA 4PCLA 1IPHA 4TZ6A 2GWRA 5ESXA 4Z9FA 1Y3FE 3FMPB 4KREA 5LQAA 2RH9B 2JKYA 4ZO8A 3TOZA 4CKWA 3E8SA 2IUSA 3K0EA 1YA6A 3JSXA 4DJJA 1EWYA 2GZSA 4QASA 1HBJA 1RHUA 1V0JA 2G1AA 1NJ6A 1TO2E 1BU5A 3GGSA 4PLCA 3RRYA 4N5IX 2VHVA 2YL2A 3BMNB 4DOMA 1H3EA 3GLKA 3UWDA 2C96A 3CUSA 4YS6A 3UYLA 4QUIA 3VR6H 5B7GA 3UJDA 3FYHA 1XXHB 4X6UA 1LC0A 2W0SA 3LY9A 4PLGA 3NATA 3VSDA 2PZ8A 2ZTVA 1P0PA 1QPGA 2AG1A 3GT7A 4D9CA 3R5XA 4L22A 1YVEI 4BQSA 4P4NA 4YP1A 5T3UA 4JLUA 3PHHA 1RACA 4LAFA 3HC7A 1T6NA 1KKUA 3WNDA 1LV7A 2VZ0A 5CB6A 3OUZA 1FIUA 1P18A 1QP8A 4ZIRB 1KR2A 3E9DA 3L84A 2W6JA 1VDZA 3WLLA 1HEUA 3O9ZA 4W5WA 3WL7A 5LBUA 2RGBA 2R8BA 5KU1A 4A8HA 4YAFA 2IBMA 1SGWA 1GKKA 3JQDA 4CLEA 1F48A 3HU3A 3KKEA 4B6EA 5KO2A 4UMDA 1WCWA 1E20A 3JCZA 3WO0A 3NFRA 2N0SA 4K9MA 1ONNA 3DF9A 3AHHA 5KDDA 3BA1A 3Q5EA 4DCTA 4QHSA 2RGRA 2BGGA 1XDBA 1PHRA 4IIJA 3V32A 3D5EA 1XR3A 1X39A 3DP7A 3D7MA 3G68A 2XE6A 3OZ7A 4KH0A 1WUJS 2ZRKA 1EIWA 1Q22A 1PV1A 1L7PA 1T2DA 3KJHA 3LKBA 1QIMA 2GDJA 2OHIA 3M5CA 1FVFA 4RD0A 1UMCA 4DV5B 1J90A 3OWXA 4KSCA 1O95D 3F67A 2D0DA 3ELYA 3NHWA 3P2IA 4AZ3B 5F4BA 1E64A 1PI3A 5ALFA 1ZA1A 2GAAA 2Z8YM 1KPHA 2H4YA 1CUFA 2DH6A 2X3UA 3TCXB 1SVWA 3RIEA 1TQHA 2LKCA 1RXUA 4OH1A 2XADA 3ZVRA 3H75A 4K0KB 2QW8A 3D31A 3O4VA 2FSPA 1HV8A 2C2KA 2ZSIA 1NXXA 4HNTA 1Z63A 2OM6A 1UBRS 1XAGA 1YI8A 3EXIB 1QIHA 1H0KA 3IR6A 4M7PA 5LMCA 3W6OA 1Q95A 1X7XB 2VHYA 2VTKA 1NG9A 2HLHA 2Y0DA 3QUQA 4YT8A 3I30X 4IOJA 3KZKA 1MPTA 1WVGA 3W90A 3X2SA 3PIIA 1F60A 3IQFA 1LV8A 4PZZA 4ZQGA 1P6UA 3UATA 4BMSA 3ZHUA 1UF9A 1UXKA 4FYVA 1PWEA 2C57A 1PS9A 2I3BA 3CEMA 4H7EA 3S1LA 3VHXB 4AN1A 5AUNB 4KAXA 1BDIA 1C8KA 1GL9B 4KQXA 3C48A 4N3GA 3JW8A 5JCJD 3CGGA 3WLFA 2FUG1 3PQFA 1QCCA 3GG2A 4PHCA 1QG4A 4YAJA 3YASA 1E1LA 4P92A 3LDHA 5K3CA 5CG1A 5EZ5A 2B8NA 2HMWA 4U9IS 4LWQA 4PZEA 3C6MA 3WA7A 2EX0A 1MU0A 1YRAA 2GDZA 3VKGA 1EXMA 4XWAA 3O8CA 1FDSA 2J3KA 4WCFC 1VM6A 2DBQA 2IHJA 3NOQA 1QG2A 1SCAA 1GNRA 1GUDA 4DLVA 1C29B 2PA3A 2PO7A 2BE7A 2KI5A 4NAVA 1I7NA 2GCOA 4Y1EA 2Q07A 4OYYA 1W46A 1Z4KA 2HB6A 2PX2A 3NIDB 1GM5A 1U9ZA 2X8AA 3D7LA 3PR2B 3EIEA 2G1JA 3OBIA 3B1XA 3SYMA 3ZK9A 3M6FA 2IDMA 3I04M 5FB3A 1UDXA 2WJZB 3IS3A 1DEXA 3BB1A 4J7UA 1LDYA 2FUKA 5IKPA 5GWXA 4X8OA 1EAYA 2AC4A 1KBZA 3PX2A 4XWTA 2D2VA 2YWEA 1GTRA 3A0RB 4EO7A 2NSDA 3DOFA 3ZE1B 1E2IA 1U7OA 3FCSB 4AYXA 3T06B 1CUHA 1R6DA 3A6HA 5DI3A 1AB5A 2A3NA 2Q2VA 4ZOLF 4MH0R 4OGLA 3T52A 4KKXB 3TQHA 1D4AA 3GLRA 3I9OA 1Z0FA 3U9LA 1AQUA 2WJVA 3T9CA 4B84A 4IYJA 4TS9A 4MWBA 3H5NA 4J43A 3RSGA 2F3PA 5CT8A 4RPCA 1A04A 4HKTA 4M2LA 4J3NA 5C34B 3O1JC 4IH4A 4NU5A 4WCDA 3V97A 3RADC 3L1KA 4MP8A 3MG9A 1CZNA 3ZQ6A 5CA1B 1RU3A 4BOYA 2AVDA 3AT1A 1IHPA 2IZOA 4OL0A 1JFFB 2XTZA 4M6WB 1MA0A 2JC3A 1UJMA 2EF0A 3LO5A 3PFIA 4AURA 4F06A 3ZQJA 3QPUA 2XGMA 1L8XA 2V9ZA 4I2VA 1LFAA 4I1IA 4IKPA 4OB7A 1UJ5A 2Y1XA 2F3RA 1WW3A 2PUVA 3HWX1 1STOA 2WM9B 3HDJA 5E1MA 2W70A 3UYKA 4PONA 1IAQA 5C80A 3THXA 2F1HA 3LDAA 4QIHA 3AGPA 4HLUA 4I4TF 4JL5A 4RHCA 2FMXA 1ISHA 4BC1A 1NMYA 1GPAA 3HB5X 5JZBA 3OESA 3KEQA 4BMNA 5FOWA 5FI0B 4E2WA 1DEOA 4KCGA 1FRZA 4NZYA 3NXSA 4BMZA 1ZNXA 2G76A 4EF4A 1QMGA 1EFTA 2XMPA 3GB9A 3VR4H 1K4KA 3IX7A 4E5PA 1Y9ZA 3KD2A 4ZPJA 3HV0A 1RYDA 1YTLA 4CM8A 2M6LA 2QVZX 4LGYA 1QCZA 2GRAA 4BQOA 4ZJZA 2O8DB 1XELA 2NVWA 4EDFA 4Y9TA 3OSZA 3PZBA 2HBZA 2OBLA 1NNLA 1K3UB 4UEOA 3OKPA 2VJMB 3F78A 1N9GB 4J2OA 4PN3A 2QX7A 2XUDA 2YMMA 3AF6A 1Z74A 3R7FA 4EKDA 1X1EA 2C92A 1NOJA 2IIPA 1VLVA 3GA7A 1PCXA 4N1AA 5A5DA 2C31A 3NEAA 4KVAA 2QE6A 3TTWA 2CMKA 4AMUA 2DPHA 2PR2A 4UARA 2I3AA 4DDTA 4EG5A 2XLBA 1UMKA 3TG2A 2FRXA 1VMDA 1Z2OX 1MKYA 4R8RA 3WQSB 5C5EA 1KQOA 2I4NA 3ST7A 2OHVA 5CB4B 1I6LA 1DCFA 2DQYA 3ESCA 5A4MS 1EP1B 2FSGA 3FPLA 3AYZB 4HWSA 2FSFA 1WNFA 4F1JA 1ECLA 1JHOA 4GBMA 5L45A 3N7UA 4UCWA 4F2HA 1BE8A 4DUGD 3MMPA 1FFSA 2EU8A 2IHUA 2FR0A 2FQQA 3LRPA 3N2IA 4JB0A 3T7EA 3FSJX 3LTNC 3ROXA 2ZS8A 4EATA 5J1TB 4MV4A 3GI1A 3ZWVA 4XSGA 4ZO6A 1UFVA 2FPSA 4V03A 3G85A 2A92A 3EDQA 2B1QA 4QOGA 4GXQA 3EZNA 1T5TA 1WTCA 2PZKA 3HB4X 4XD7A 4MRPA 4A10A 1EJ6A 2YINC 4RADA 5CLHA 4YC7A 3ZU5A 3WGUA 4QEZA 3F6SA 4F21A 1GRRA 1U7HA 2APJA 1HC7A 2QV7A 1R5OA 3O1HB 3DLBA 1YUMA 3WFIA 1YCDA 3RVMA 4BKQA 5C9ZA 4EARA 1YZTA 3PDIA 1RFGE 2HTFA 4FINA 1JBEA 1N2HA 3OLCX 1JQLB 4KK4A 3DWIA 5I4BA 1VYVA 4EQ6A 2O8FB 4FFNA 4BNNA 2JGIA 2WSSA 3QKTA 1P60A 1B0ZA 2VC2B 3KL4A 4BMOB 3OICA 3EQZA 1E2GA 2ZU6A 1OZ0A 2QHXA 3JTEA 4D43A 3ZHOA 4JA2A 2I54A 5B2EA 2VPQA 4RDIA 1W5TA 3GVPA 4FLMA 3GJYA 5LQNA 5LZ5A 3OEED 5DNAA 2I3GA 4UXHA 4J4HA 3RTEA 1A69A 3DZ8A 3I1FA 1NKVA 3H18A 3WE7A 2VDWB 4WNAA 1W5EA 4DL9A 3W2TA 5M04A 3OWOA 1RHKA 3N39C 1A0OA 4HY3A 1HOXA 4P83A 3JD1A 2WVHA 1WF3A 4MUAA 1IXYA 2XUKA 5D01A 1H8HA 1Z0ZA 1V16A 4OHXA 3HU2A 1XDUA 3D3EA 3DBLA 3U0BA 1KFCB 2G63A 4GSYA 4QRDA 4JQZA 3X0DA 1RVV1 4ZYVA 2JZCA 5E2BA 4DLRA 3KFLA 4RLSA 5JARA 1PIWA 1DX4A 3LFUA 2XUQA 2GUWA 3DQQA 5A2GA 2ILTA 2VDUE 3GH3A 4OYRA 3AVWA 3KSAC 1NONA 2DHRA 2DT5A 1OTHA 4HH1A 5CGZA 1DE0A 4KLZA 3EA4A 1UM9B 3JZIA 4WXMA 1N1MA 1HFWA 3K1TA 3WK8A 2HUPA 2HSWA 5TS2A 1JALA 4LRXA 1JBQA 3IHWA 4PG7A 4BMPB 4CF7A 1FQOA 1G41A 3WGZA 4RSHA 3M4ZA 4WESA 2HDWA 5JNTA 3HGMA 3QNUA 2V59A 2I1QA 1SQFA 2J7PA 4AN4A 1CJCA 2CL5A 2JGMA 4OP1A 4JGBA 5EEGA 1XWIA 4HDRB 4OQFA 4UJ5A 4W63A 2IHBA 2O14A 5LLSA 3W2HA 3FDJA 1HQKA 1ID1A 4FGSA 4GNKA 3ROQA 4E21A 1HZJA 1J7JA 5KOJA 4MAMA 3J81k 1P7WA 4AIIA 5HSGA 1B6GA 2REOA 1W2GA 1OQAA 2PRKA 1PVOA 1XZIA 3ANYB 2WHRA 5B1IA 3FN4A 4O59O 4TRMA 3V8QA 4WBNA 3S8EA 5CT5A 3A2LA 1E2NA 2BRUC 2C5LA 3L05A 4B17A 4I6JA 3C6ZA 1E6CA 3A1FA 3K1JA 3AUAA 3LO8A 3P2JA 1MW8X 3OU7A 3CW2A 2RHOA 3QE4A 2GRJA 3FCUB 3KU4A 4Y1RB 1QAQA 4EGSA 1SFRA 4CM7A 3F6CA 1MC8A 2IXDA 3UXYA 1GJRA 1JS1X 1BEUB 1ZRMA 3GIWA 2LPMA 3MFYA 4MV6A 3K6RA 1GT6A 2IYEA 5EY5B 1D2CA 2W6QA 4LUCA 4XWKA 5BSRA 3REGA 5NLLA 1J39A 1DCKA 4M0KA 3AERA 3QK7A 5BQ5A 4KDRA 4PWYA 5IHXA 3H2GA 1HDYA 2WFAA 1M7BA 1IULA 2MJLA 3PC8A 4JXZA 2V1UA 2W4IA 4RC9A 5EYPA 4Z3KA 5G0VA 1UOPA 2I80A 3AUXA 3WMEA 3GNQA 1JIJA 3L0BA 1E59A 3PQ8A 4NZPA 1H2AS 4EB6A 5A62A 2WD8A 4M99A 3RK4A 3HWWA 4PW0A 5G1PA 3PKIA 4OHVA 1I1NA 3B5JA 1VXRA 3QMVA 3RAPR 2Q7OE 2BOVA 1FSZA 1NVAA 3GUCA 5AJVB 3S0JA 3OLQA 5A05A 5EZYF 2A57A 3W06A 4ROTA 3HGQA 4CCWA 4F56A 2DAPA 3QA3E 1YUBA 5HKBA 4H31A 1GFSA 1MOQA 4XVCA 2DP4E 4YRAA 1W4LA 2P7HA 3KLOA 3NHRA 2XUJA 3TRDA 1LBSA 3M1AA 3RT9A 4J49A 3C6XA 1FLVA 1E4EA 5JLAA 5AVWA 3CUTA 2GEVA 5D1NA 2JHGA 1TGYA 5C18A 3V6LA 1DRKA 3ESYA 3LVQE 4BTVA 5CFMA 2O3JA 3K15A 1HE8B 4BV9A 5HYVA 4GI7A 5EUQB 1MJGA 1GTVA 3P4UA 2PO5A 3RYIA 3C5CA 3BFXA 4AQ7A 4JKIA 5AKGA 1OAOA 1U1IA 4JSYA 1YAHA 4CEIB 4YQYA 3OT1B 3LHIA 1UPXA 3EOBI 5KKCA 1T3GA 3CX8A 1T9AA 2ONZA 2XUAA 4G0QA 3KDPA 4TTQA 2J5QA 1Z36A 3GFPA 4IL5A 2POCA 1VECA 3EZYA 1X86B 3BGIA 3F9IA 1MG0A 4OIFA 5HG0A 4Q7EA 3S2UA 4BO5A 4F46A 2IBSA 1WV0A 1M5UA 1T2EA 4OXXA 3KSRA 1TLFA 4E3ZA 5JWRA 3DBHB 4GYWA 3ZLBA 1G66A 2HBRA 3LW7A 1QKIA 3UMJA 3W5SA 2QRQA 3WYDA 3EA0A 2Q6KA 2HF9A 4H6PA 2OAP1 3DDSA 3W6ZA 1YB5A 2X76A 5ALGA 4ZEMA 3LY7A 4ZD6A 2GJ9A 4TT3A 4JVOA 3HDYA 4GLJA 3N74A 4L15A 5EHQA 1NLMA 1U2GC 2Z98A 5JVDB 3QU4A 2G28A 4GGOA 2D1YA 3DHWC 4R2MA 3A2KA 4NZOA 1GLVA 4KIWA 2PS0A 3CH4B 2YZGA 3LZDA 3MRSA 3IESA 1QE3A 1XZAA 2YVUA 3IKLA 1IXRC 1USUA 2DECA 1YJBA 4HQNA 4ZQEA 7MHTA 1SXJA 3I2YX 1L4LA 2DFKB 3JQ9C 1IFXA 2AG6A 5HF9A 1AIPA 1ZKDA 4FVTA 2C7PA 2ZPTX 1JU9A 1X70A 2G25A 1YI0A 4NLLA 5E0OA 1KQ3A 3VHLB 4FONA 4MTLA 5I48A 4E5DA 3KLBA 3LA6A 1Q16A 3FFXA 1GRNA 4AO6A 1BH2A 4EF5A 4D42A 5AOCA 2N42A 5E6RB 4JI1B 4AM8A 1XWWA 2JAPA 4M1MA 4DMRA 2WT4A 1ONPA 1JUDA 4N3AA 2W6NA 3IODA 3K31A 3EVNA 2RK4A 2H5IA 4FILA 4NZZA 1JR3E 5J59A 2YVKA 3WKDA 3ZDYB 6ADHA 3SJAA 4BPBA 4EELA 1DARA 2GAJA 2H5EA 4QBKA 2D2IA 3NCTA 5ESRA 2VYVA 3TO5A 3TAXA 1LBEA 3WWEA 4C43A 1N2JA 1H2RS 2B21A 4OAQA 5BSVA 3CNLA 4KI7A 4W6ZA 2XKBA 5DHSA 2XKKA 1T5IA 1IBSA 3SP1A 2QR2A 3GVCA 4S0ZA 5BRJA 3DWGA 2RHBA 2EWWA 2E18A 4RTPA 4N18A 4D9GA 2BGWA 4G26A 1HT0A 1N92A 3LPDA 1T91A 1MNQA 4HO1X 3WLOA 1U7ZA 1I30A 3S81A 3PBKA 4DPLA 2OO7A 4MS3A 2OWDA 2OUKA 3L6BA 4ND8A 3DHYA 3TSOA 1QV6A 1X3SA 2O4UX 5IAEA 3F6YA 3R4VA 5J63A 1DFGA 3D8NA 1HE4A 1QS0A 5B4UA 2G77B 2KX7A 1ZM3A 2W98A 3AR8A 4JGGA 3P71T 1CUEA 3EXHA 3M6IA 4MQMA 3CYFA 2FWNA 1Z6YA 1M0WA 3N2KB 4GQBA 1Z28A 5AJWA 4TYPA 5JFTA 1N6OA 3T9EA 2FN3A 1NURA 2JJMA 2X5JO 1N2ZA 1O9BA 1ODTC 3JU3A 1WCIB 3IQHX 4IS2A 4IHQA 5DLDA 2XF2A 4C30A 3WRXA 4BB6A 2FAXA 1UDCA 2Q4DA 3AFNA 4PC2A 1S8AA 2ZTSA 2NU9B 4UFPA 7GPBA 1RHRA 1EWKA 1XIVA 1GQOA 3N8GA 4L8YA 3TZQA 4CUKA 2GBLA 4KE6A 2DU8A 4GMHA 3U9SA 4RORA 1VIMA 2OC9A 3RBAA 5ALTA 1JHMA 1MT3A 4BNIA 2C7BA 3KOMA 3K9HA 3ZVNA 2PBFA 5EFOA 2QD4A 1VPWA 4HGYA 3V4ZA 4R8KA 1GAEO 1JQ3A 3J80A 4JFRA 1GFIA 4GFDA 1LPSA 1CYDA 1X0VA 3G5AA 5F2KA 5DH9A 1FMTA 3WWOA 4P58A 2C3MA 5P8WA 2IYRA 3FNQA 3JQ6A 4WNIA 1N8NA 3ZY2A 2QVYX 4U5XA 3RS7A 2ALJA 2WK1A 3LHDA 1HFJA 1IQUA 3FCAA 4PYIA 2V6JA 2VF4X 2VA8A 3F5FA 3HN6A 4HDKB 3HR8A 4K8RB 1FEZA 2B0CA 4Z0TA 3TWOA 3TIIA 1K2WA 2XUPA 1CR6A 1M1YA 2QRGA 4EY7A 2EIHA 4RZQA 10MHA 3ED5A 1M7GA 2EXXA 1QWOA 1FLNA 1H66A 1PQ4A 2YN4A 1ZWKA 1T5DX 1P80A 3MT9A 3QEKA 3FKSD 4HBGA 4C21A 2ZSFA 3FJOA 2FHSA 2G06A 3ONDA 4BQIA 2X9GA 3PJDA 1XC7A 2J8ZA 3ZV3A 2BJWA 1G21E 3LM8A 6ABPA 5LQSA 5E3IA 2RHRA 2YRFA 1DIOB 3OOEA 1LPBB 1JFTA 1EB8A 3E27A 3DAYA 1USKA 4DR7B 4JBGA 4Z3OA 1M2KA 4HL6A 4Q66C 3CX3A 4R2WA 1W581 1KU0A 2BTEA 1HEIA 3CZMA 3PZRA 4M38A 2RIRA 1MP0A 5LMZA 2HNBA 4N12A 3KO8A 4QUHA 2GD2A 3W2FA 3WHIA 1GAXA 1M6WA 3RSFA 2HRZA 1FQWA 4QTXA 5IK2D 2ZM6B 3VKHA 4L2IB 5FBWB 1JB9A 1P2UA 2QUHA 4TWZA 3T7SA 1G20E 1UPTA 4QRIA 3KR9A 2YXBA 3L8DA 3NVDA 3P52A 4IRMA 4KYUA 4L72A 4QQFA 4U63A 1SRRA 3NHKA 2WA2A 4Q1FA 4C0KA 4MUEA 1DRVA 3FTFA 5HRCA 2PUEA 1GPKA 1BFKA 4MR8A 1V8PA 3K94A 3QVWA 5L6LB 2FPKA 2OCLA 1Y7PA 2Z08A 3ER6A 3GUVA 3MJHA 3NTOA 3CY6A 2OMEA 3WYBA 3ZI0A 1JPJA 2CZQA 5BSMA 2Q3HA 2E9SA 3LXXA 2O20A 3KBOA 4NCJA 2NWQA 1OASA 1KYIA 3VVCA 4UJ3A 3X1KA 4LXYA 4DXHA 4BB9A 4LMRA 1WB4A 2GJ4A 1L5FA 3H11B 4YQZA 5JCZA 4K6MA 4CEHA 1N2CB 5IT0A 1G18A 3W8FA 4BB5A 3W5AA 4MLPA 1VBMA 3HKCA 4W1SA 1MO5A 1YMVA 3CCBA 3FKJA 4BCBA 4YXFA 5BWOA 1VG8A 2GYWA 3CRZA 3UV3A 4CKWB 3VM6A 2FPXA 3EIWA 1KQNA 3T7TA 3RAFC 5C4MA 4MZDA 1J0AA 3FOFC 1OH8A 3OEHA 3G9ZA 2BFNA 4ITUA 4GX5A 3OY2A 2VSNA 3BDAA 3Q8KA 4NZNA 4WUVA 3OE4A 4ZQIA 4EW1A 4RKYA 3CVWA 1MO6A 4J0JA 5HIIA 4X41A 5BSKA 2H4FA 5T64A 1ULSA 3N9IA 1JP7A 3JYLA 3B48A 3HS3A 4ZK2A 1A9RA 1TADA 1HDIA 1LDBA 5EMLA 2QP3A 4ISBA 1H6DA 4OLAA 2AJTA 3QHPA 1Z38A 3S55A 1Q77A 1BS9A 2GCEA 3VZRA 4ZCRA 3L5OA 3L4JA 4EI2A 5H59A 3TZCA 4IUCS 1XKQA 1QTQA 1KZHA 1N7JA 2NVUA 3EOAI 4LZAA 4C9BA 3GLGA 4KX5A 4IJVA 3SY8A 1E6LA 2VP9A 1NI4A 1UBHS 3GJ0A 2NUBA 4YQFA 2QPTA 2CKMA 3ZHCA 2YWXA 3LS2A 3EYAA 1LUAA 3QX9A 4TSRA 3A6LA 2WTXA 2P11A 2VXBA 3VFDA 1XMPA 5EXSA 3UN1A 4AJ1A 5B4VA 3CH7A 5DISB 3ZGLA 4ALMA 5JSZA 1XN4A 2XTJA 4XGIA 2ODQA 4IIJB 3PHIA 4DCUA 4F04A 1JW9B 1MC5A 1E9VA 3DFIA 3PGXA 1GKIA 1UIMA 2BF7A 3GUHA 2ZBQA 1UMCB 2PKXA 3OQJA 4L4ZA 4MKXA 4UFNA 3W9BA 3E4DA 4Z4EA 2ZYIA 3HZOA 3LUDA 1PE0A 1UJ2A 1XTKA 4JMPA 3R3HA 4YRLA 2OQRA 5DM0A 3ZNOA 4BGEA 2ENUA 4EW6A 5AM3A 2CFIA 1XZHA 4C2TA 2E85A 3LBYA 1YE5A 2X6TA 3H2IA 4GAEA 3GX1A 3NM6B 2UYQA 2AC7A 3ONEA 3G9TA 4JC5A 2WQ6A 3E0QA 5BVGA 3SF8A 5DBGA 1IBKB 1VE1A 2D2XA 4LISA 2OGZA 5G1NA 3CX6A 1V5EA 1XI2A 2RARA 4A0GA 4EI7A 3L9XA 4EFDA 4PM4A 4BN4A 3AKCA 4P4TA 3EG5A 3MHPA 1Z62A 2OD2A 4RJKA 3QV2A 1SWWA 5BSEA 1ZH2A 3Q8WA 1K89A 4RK1A 2A35A 4RK5A 5LN1A 4B4OA 1L7BA 1YR6A 2HHLA 1USWA 4DJDC 1RTTA 4BGDA 2X3YA 1YONA 1UPBA 4OREX 5A3RA 4ZYZA 1RYNA 5AXDA 3FPEA 5AVYA 3VAZA 2YX1A 1MTZA 1N2GA 1OA1A 3BFPA 5TQ2A 4DYVA 1WCV1 1P1HA 3X1YA 2JAXA 4TLAA 4M46A 4WFQA 1IUOA 5I7HA 1ZG3A 2PLAA 3FCYA 1E3EA 3ZD8A 3ZHTA 4LE1A 1MB0A 2YWDA 1A88A 4X65B 1WD7A 5C7IO 4JVSB 1YR1A 7ABPA 3KYCA 4DA9A 1XT6A 4XFJA 3O21A 4E4TA 3HJAA 5CW1A 3R7SA 1IEWA 4DB4A 1A8SA 2GCOB 2Q2QA 3ZLVA 2F67A 1VA5A 4IR7A 1BX0A 1DXOA 1QRRA 2UZIR 2WZCA 3ETCA 3NIBA 3BD6A 1XCOA 3IHTA 4JJAA 4R69A 2PU5A 2FEWB 3CJQA 3WJ2A 4BP9A 3FNHA 1IUPA 1BD4A 1NE7A 1PWZA 3UMRA 4D0RA 8AT1A 4RTKA 3O74A 1G38A 5GJBA 4IAOA 1U2DC 4RO0A 5AW8A 1UBLS 4RU1A 3IUNA 2M6SA 1DUIA 1YKGA 4BQRA 2P0AA 1FS6A 4TM8A 3IAM1 3WIBA 4B4WA 5K99A 4MPJA 3LOQA 1ORWA 4G5XA 5DI3B 1XZEA 4QAQA 1W2HA 3SQXA 3DNFA 4O2AA 1EXNA 3C6KA 1N6RA 4KIUA 4NE2A 3WGHA 2GD0A 2WTMA 5BWNA 3C3CA 3H2YA 1EUZA 2LIPA 2FFHA 2RGWA 4QELA 4JUFA 1O7JA 1XRJA 4GPTA 2CXXA 4JB3A 2W93A 3OSUA 2VCYA 3PFNA 4BEVA 2ECKA 3NAQA 4IYRA 1HURA 2R97A 1Y82A 5DRYA 1Y6JA 1YR2A 5JO9A 4EX7A 1T3LA 3RC7A 4X45A 3ZV7A 4M1QA 4MYCA 1W88A 2HMUA 2HJVA 3SDZA 2GJSA 2J5RA 3HYSA 4HHEA 3T34A 1QLWA 4NEHB 1SELA 4N65A 1GNTA 2QXYA 2PJZA 4Z0HO 1VBKA 2RHTA 1RI3A 4LX0A 1YA8A 3BPSA 1Z33A 3UIEA 4A7PA 1O6FA 5HEKA 1IU9A 3QHQA 3OM8A 3THXB 5J2TA 1N77A 2XJ4A 1S1CA 1XZQA 2P9HA 3AHEA 1BE1A 4G0WA 3MNFA 4MLZA 2NXJA 2DBYA 1XRLA 2DBRA 1YXMA 1ZLYA 1CY1A 2IKQA 3B9PA 1QWSA 4QLBA 1E2KA 1ZJZA 3ORQA 1HWYA 4YP6A 2JIPA 2F8LA 1ZQ9A 3R0JA 3EEQA 4RF3A 1OX6A 1YU6A 3BGDA 2OCBA 2VP5A 1FYXA 3QPDA 4RVUA 3RRBA 1KPIA 2JGNA 2KJQA 4EFKA 5IJ9A 3EZGA 1KF0A 4BLVA 4BLSA 1RMYA 1Y1SA 1C3JA 4I81A 1PFGA 3HVRA 1CQXA 3RFUA 4CM8B 4MIKA 4LXUA 5ECWA 4M8KA 2XMCA 3NOOA 1ZY2A 4QOHA 2ZYSA 4JZYA 1BMFD 1ZWLA 2COEA 2DUMA 3EF3A 4N41A 3B2NA 1DU4A 1NASA 2WYHA 2OHXA 1C3EA 2JGAA 3O0TA 4EUEA 3C1OA 3WB2A 5L7TA 5I45A 4RY0A 5JE8A 1FTWA 3K2EA 5DV9A 4MIEA 4BNWA 2ZULA 3E8MA 4ZCTA 1P73A 2V3WA 2YIDA 4JP2A 1XFDA 4P82A 1K0FA 4AY6A 1WZNA 4F9EA 1IOLA 1HUQA 3IKJA 3IUMA 5ALHA 1UL1X 5C8YA 4RH3A 3P1JA 4A3SA 3P20A 2BV3A 4H4EA 5TPZD 4GM4A 3RS8A 3CF0A 2AL7A 2HSEA 2XCIA 2GEFA 1NN1A 2FG7C 3GV0A 4IIYA 5F76A 4A16A 1R0YA 4XB6B 1GEGA 2RGXA 1QYVA 4MQ6A 2ZSKA 4KMSA 1JPVA 3GLIA 1OZAA 1QKKA 1F17A 3GH1A 4OM7A 4EIWA 5AOVA 1ISGA 4ZC8A 4HJXA 4Z3DA 3DA8A 4UQPA 1XD2A 1UBEA 1LVUA 4KRYA 2CLOB 3QKUA 4TLCA 5C7YA 2AOTA 3RHTA 1Y34E 1Z0AA 2VPXA 1JEAA 3DZIA 3UCFA 3LXUX 1FFEA 2EATA 3CN7A 4W8GA 2GEDA 1G8YA 1YJ8A 2FK7A 3EMVA 4C5AA 1J00A 1RC1A 2CKDA 4DLTA 5K3SA 3KPVA 4YR9A 1YDWA 3HI6A 1E62A 1VLMA 1KY4A 3UJ3X 2B1IA 1QC5A 1K6EA 1ZHHA