4RSGA

Neutron crystal structure of ras bound to the gtp analogue gppnhp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
166
structure length
162
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Neutron Crystal Structure of RAS GTPase Puts in Question the Protonation State of the GTP gamma-Phosphate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 55
structure length 162
sequence length 166
ec nomenclature
pdb deposition date 2014-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rsgA00
3OIYA 2QMOA 5JJKA 1KI9A 2EFCB 3SHWA 4EFLA 2N46A 1NVVR 2YVUA 3ZQJA 2E9SA 3TMKA 1E1RA 1YRAA 2CK3A 3QPVA 3DOFA 4F4CA 1R5NA 4IFBA 1X8KA 3ONWA 1KDOA 2QT0A 1MOZA 2WJIA 5TMPA 2HJVA 1D9ZA 4TTRA 1J8YF 4V0KA 3SFZA 1I4TD 4KBGA 2J45A 1ZU4A 1TF2A 2B7CA 1ZJ6A 3LD9A 3N5CA 3UK6A 4D25A 1E2NA 3K0FB 1DARA 5CK5A 5JS8A 1CEEA 2IYXA 3SR0A 5CK4A 3H4MA 4DSTA 3EZ2A 3BS4A 2ZU6A 2OT3B 1FTNA 1XU4A 3VU9A 3A1SA 4ACAA 3E2IA 3EPLA 2ZS7A 2GJSA 5C46F 4OK6A 2JLUA 3ZLJA 3W6PA 4MUAA 3WNCA 4A8JC 4KFTA 4L16A 1GRRA 4MYHA 5HPYB 5F9FA 3NC0C 4ZDWA 1PVOA 3Q9LA 1XB2A 3CH5A 3QKUA 3KQKA 1YZQA 1OB2A 4IRUB 1G8YA 4Q7MB 2HYDA 2ORIA 1YZGA 2GAOA 5JJIA 4I1UA 3MJHA 4N1AA 2AX4A 2BM1A 4HDCA 2ZS9A 3IO5A 4DSUA 3B6EA 5CJPA 1LF5A 1VCIA 2IUTA 2JJ1A 3NBFA 4NU0A 5HE9A 4BFYA 4C0QC 1L7VC 3AQ4A 3LBHA 4BQSA 2JLWA 4DLVA 5F9HA 1CR0A 2GILA 2Q3MA 1PV4A 5CYOA 3RS4A 2UZIR 4HLUC 2V6IA 1W4CA 3CONA 1NJGA 2A78A 1LNZA 1XF9A 3D31A 1U99A 5DYIA 2WWWA 3BFXA 1E4YA 4ZDKA 2J5XA 3GLFB 4KODA 3BH7A 3AVVA 4AYWA 2V3CC 1VG9B 3AUXA 4TT3A 1WBDA 1VKJA 2OBNA 3F3YA 2QAGC 4PQYA 1W7AA 4XWAA 2QL6A 1BMFD 1ETUA 1SHZA 2VRWA 2ANBA 5J40A 1XDBA 1RKBA 5JI2E 4TYPA 1CS4C 4Q9HA 4M0LA 4J0QA 3AKEA 4B34A 3GEHA 1G6HA 3NC1C 4Q02A 4QHYA 4Q1CA 5P21A 2ZI3A 1CU1A 2QQEA 4UNQA 2OESA 2C95A 5FL7A 1JR3E 4EJSC 1N6RA 5IDVA 2FSHA 2X1VA 4IOLA 2ZEJA 4XOIA 1XD8A 1CJMA 4B35A 1W48A 3AP2A 1FQJA 2H17A 3OEED 3VHLB 1AS2A 3W9YA 2D2EA 2I1VB 2LKCA 3RS3A 3O8BA 5SZIA 5FTLA 3PR1A 4TLEA 1G9XA 2UKDA 1R5OA 4Q4LA 4JL8A 4LHZA 2C99A 5KPJA 5JLJA 2GZHA 1Q1QA 3NDBB 1RVDA 2F3TA 2W6IA 4V03A 1W47A 1EWQA 1XMJA 2GETA 4Q1FA 2P2LA 3QKRB 1E2LA 3DO6A 2DBYA 2WWYA 5LD2B 4EIWA 2KE5A 1F3OA 1UEIA 2VHCA 3KTAA 4PC7A 2YOGA 4L4UA 3CB4A 4XD7D 2HDNB 1XJ0A 2PJZA 2DFKB 2ONKA 1HTWA 1NL3A 1N6KA 4LI0A 4DCTA 5L3RA 4DLXA 3RS0A 5IHPA 1KI2A 4D82A 1T6NA 4MRNA 1NKTA 4WZAE 2RB4A 5GADl 1EFRA 3K09C 5ELXA 3PUXA 1YZUA 2Y8EA 2XXAA 2H16A 2I4IA 1ZMXA 1YZNA 4G0NA 1KO8A 2C8VA 4PZLA 1XRJA 3H84A 2ZJZA 2GTPA 1VIAA 3VNUA 2VSOA 3B2EA 1DG1G 4EPTA 4US2R 3CF2A 3AGPA 4XSHA 2R62A 3HP1A 2RGEA 2O5VA 1R0ZA 3AM1A 1E2DA 2JDIA 4POAA 1NVWQ 3MSXA 521PA 3AVXA 1JXMA 2AD5A 2DWPA 4GNKA 3Q7PA 1H8HA 4PC6A 4BPBA 3AVUA 2V1XA 4GMXA 4NPHA 2D62A 4NONA 2JLVA 4R9UC 4TZ6A 1AGRA 4IKEA 5EP1A 4TL6A 2IUUA 4RCYA 4LSGA 4QGGA 1UKYA 1AKYA 3CO5A 4WW0A 1JXOA 5JECA 4MITA 4I1SA 1XEXA 3CW2A 3LV8A 2CE2X 2IEYA 3ZS9A 3AF4A 1M7HA 1NSTA 2ZM5A 4MA4A 3B78A 3ZVMA 1JNYA 1KZ7B 2IC5A 4M9XA 1KAGA 2REXB 4NYMR 4QBFA 4KYIB 3L8ZA 2D06A 3HR7A 4LWZA 1UM8A 2RGNA 1P73A 3ASZA 3FPAA 1RE0A 4B33A 3BE4A 5GJCA 4ZKEA 1E79A 4M1WA 4C30A 1T8TA 2NZ8A 3DPUA 4DC9A 2IS6A 1Z29A 1OXXK 2QSZA 2ZI6A 1E32A 3EX7C 1QHNA 1XPOA 4DCVA 1YR7A 1JALA 4XWOA 2R6FA 2G83A 1T5IA 2HV8A 3GJ7A 2FU5C 5FOUA 4LK2A 1E1QD 5FPHA 3HPQA 2ZRIA 4CEJB 2TMKA 4TLCA 4JVMA 4NCJA 1Z28A 4B2IA 4BZXA 1Z2AA 2IBMA 5L3SB 1GG2A 4TMXA 1LW7A 1P2UA 4QJ4A 2JJ2A 2WSMA 2R6GA 1E1RD 2HJGA 3CRMA 3NDPA 3C5CA 3KJGA 1O3YA 2BJVA 1ZD8A 2C98A 2VBCA 2ZYTX 4Y0AA 1JEEA 1D6JA 4HB4A 3AVOA 3MWYW 3P4YA 1PLKA 1FUKA 1AS3A 2Z4RA 4OI1A 4KV9A 3QXXA 1UAAA 4TYYA 1P2TA 4G5QA 2H1LA 2IF2A 4JVLA 1Z47A 3IHWA 1KK3A 2RGDA 3A58B 2RGBA 5FUYA 3ETLA 1E9AA 3PUVA 3ZD6A 1F60A 1XXHB 1HQCA 4B43A 1RYFA 3H1TA 1KK0A 1Q3TA 4URYR 2DCUA 1VIYA 3BB3A 3IQWA 2FZ4A 5K8TA 1AKEA 2YJTD 2GXQA 3BFKA 4LZZA 4QNRA 5E4FA 1UBGA 2FSFA 1XCPA 1P5ZB 4EUNA 3T61A 5FUVA 5GJBA 4JSTA 1LS6A 2VF8A 3QEJA 5K8IA 2ZAMA 4B6EA 4QRHA 1A2KC 4LRWA 5EP4A 3TW8B 3AGQA 3V00A 1AJEA 1S9HA 4F93B 1CLUA 2H18A 1II8A 4DLYA 1HQYE 3K70C 3X1XA 3SYLA 2AR7A 4LUCA 3BRWD 2J0UB 1WDTA 2Z0MA 3KFXA 2VHTA 4YMSA 1UADA 5AJXA 1W36D 2NZJA 2XZLA 2LWIA 4WXRA 5BW8A 3CPJB 2R8RA 4KFRA 1KGDA 3ZYCA 2EFHB 2QPTA 5AR1A 1SQ5A 2CCKA 2PT5A 5UKDA 1AGPA 1NMYA 1X8JA 1CP2A 4RFSA 5J4KA 2YHSA 4GBMA 3LLMA 4V0MA 5KDOA 3FMPB 5FL3A 5IT5A 3FB4A 2O0HA 3PEVA 4UNRA 4JVNA 1U8AA 4TT3D 4AWXA 2BKEA 3CPHA 4YDSA 2XTNA 1GOTA 3WHKA 4Q47A 3K0AB 4WIAA 2BBWA 1ZM7A 1CRQA 3CF0A 2QMUA 1JI0A 3A8TA 1FX0A 5FL7D 5AUNB 4F91B 4A6PA 1KDTA 1KMHA 2I3BA 3D3QA 4GP6A 4DIDA 1DE0A 1W44A 1ZYUA 2J9RA 3GQBA 4IDNA 4E22A 3A4NA 4EPYA 1KTVA 3HYRA 2OLKA 2G77B 3DL0A 2HLDA 4KYUA 5G41A 3U3KA 4TLBA 3CPEA 2W6ID 3IO3A 4HZUB 2E87A 2XITA 1EG7A 3M0EA 4PHHA 3RLFA 1XP8A 3HPRA 5L3QB 1Z07A 3NH9A 2O8EA 2VP0A 3RS7A 2JGNA 2CHQA 5SZKB 3IEUA 1RRFA 3DM5A 1B0UA 4P31A 3SE0A 4LYAA 4UJ3A 4ZO4A 1E9SA 1OFUX 1T5LA 2WWXA 2XOKA 4DXAA 1WCV1 1G5PA 4OHVA 1EFRD 2W58A 3HU3A 4TQAA 3GEEA 4DLWA 5JSZB 2AL7A 3O8RA 4ERNA 1VYTA 2ODWA 4Q4JA 3LQRA 4Q1BA 3N70A 4D2IA 5KPDA 4L9SA 1O87A 1SVIA 2FA9A 2IYZA 5EE0A 1VYVA 2ZE7A 5AUOB 2B92A 3GMTA 3U61B 4M1YA 3NIBA 1KO1A 4C0BA 3R9XA 3JZMA 2P6UA 4GZLA 1KJZA 5EP3A 2J7KA 1G1MA 4UXIA 4DLTA 4ZCIA 5DYGA 4FMCB 2JDID 2P65A 1TADA 3DMNA 4CW7A 4KLNA 4HLQB 4IFEA 4RZUA 4UNNA 2CHVA 4RY2A 4FMBB 4KAXA 5DGXA 4W9MC 3X1YA 4ILEA 1IJEA 4A2WA 1S3SA 2GCOB 5BYKA 1SXJE 4P32A 3SBDA 4Q1EA 2XGJA 5K8UA 2OFXA 4DHEA 4C2TA 4K46A 1T9HA 3OESA 3R7WA 2ZI5A 4AKEA 4FCWA 1GIAA 1ONBA 1TUIA 121PA 1UFQA 3ZZUA 3FHOA 1IQPA 5B2ZA 5KSOA 2IYQA 3ICQB 4OL0A 5DH9A 4M22A 3P20A 1OSNA 4OHWA 3ZS8A 2OG2A 1VHTA 2OAP1 2ZE6A 3TGPA 4YONB 1GILA 3L0OA 2FFQA 5FTNA 2GK6A 1G5TA 1JR6A 2IL1A 3VR6A 1R7RA 1XBTA 2ZR9A 2QBYA 1SXJB 4ZPXA 2WV9A 3QPWA 1NBME 1LB1B 1DAFA 1FQKA 1M74A 2F43A 5E95A 4RD0A 4S2EA 2F6RA 2AK3A 3WP1B 2OFWA 4HUQA 1QHHB 4KLZA 1AZSC 2J46A 4HB0A 4JYCA 1OH7A 1LY1A 2F7SA 5AUPB 4EQ6A 2PZFA 3EZ7A 2JJ2D 1CXZA 3PUYA 3WBJA 3CRW1 2C9CA 4G5SA 2HUPA 1TQ2A 3TSWA 4UJ5A 3R8FA 1QHGA 1E0JA 3W3AA 3W6NA 4HB2A 3PFIA 5FOTA 3NEYA 3N2IA 3UXMA 2ZSDA 1CF4A 1S0UA 3O8DA 3NWJA 4DIEA 2BM0A 2WKQA 2CVHA 3EASA 1GM5A 4PHGA 3OAAD 1M7BA 1R4AA 3KKMA 2RCNA 4YMVA 5DNYB 4Q01A 4XVQA 1W5SA 4JBYA 1YR9A 3A1WA 5CITA 2VQSA 4FWIB 1Z0DA 1IXZA 1SVLA 2PX0A 1NG9A 1KO5A 1Z6TA 2GEVA 4LGMA 1IN8A 4ZCLA 4QJ3A 1RZ3A 2QORA 1P6XA 3LDAA 4KFSA 4QBHA 1OXVA 4NH0A 3EPKA 2GZAA 4HDQB 1PUIA 3RRNA 1MR3F 1OXUA 3IUYA 1KI6B 2Q9CA 4B47A 5FOWA 5FBLB 3U3OA 5B64A 4M8NE 1S1CA 2ZRLA 4QNMA 4A82A 3FYHA 1E94E 2WWIA 4US0R 1Z5ZA 2KJQA 4IDQA 2BEKA 2GNOA 1IN4A 1H8EA 1E9BA 4IOMA 1W36C 3VTKA 4IDPA 1S4QA 1GDDA 4ARZA 621PA 3B82A 3VKWA 1Z63A 1Z0JA 1II9A 2DB3A 2W2XA 3JVVA 4O25A 3UANA 2G3YA 3IBGA 1Z0KA 4CEIB 4AC9A 4A0FA 1MKYA 2V7QA 1W1WA 5KTYA 5EUQB 4AI6A 3GJ8A 3GLGB 4C0KA 1VPLA 2IYSA 2ZTSA 3VR5A 1AZTA 2IEZA 1E2QA 2WIAA 4DLRA 4DB2A 2CDNA 2OAQ1 4PTLA 3KB2A 2IA5A 2FMXA 2PEZA 2QT1A 4TQUS 3TUJC 2A2ZA 1EXMA 3ADDA 3AP3A 1KOFA 1TF5A 4QL3A 1OH8A 4ZV4A 3MWKA 1KY3A 4C7OA 4LYJA 3QVVA 5J47A 2O52A 5J5CA 4XD7A 3BGWA 3V9PA 4QGAA 3THXA 5F98A 4B48A 3TSOA 4A2QA 1E4VA 3M1IA 4S35A 3U44A 2CL0X 2PEYA 4OQLA 4DCUA 4R7ZA 1NLYA 1QHSA 3X1ZA 1CR4A 4G01B 2PH1A 3UG6A 3PUZA 5GJWC 4Q4AA 2O8DA 2RGAA 2O8BA 3EPHA 1CIPA 5EE1A 4ZCMA 3BORA 3LH5A 4GSYA 1IONA 3P4XA 4B75A 2D7CA 3QIAA 2AHOA 4II7A 2F3RA 1ZM9A 2F9MA 2G0TA 5AJVB 2HCBA 2EWVA 3DMDA 3Q5EA 4KSBA 4Q4HA 1KNXA 2XOKD 1OYYA 2EWWA 3LLUA 3TBKA 4TLAA 2QUZA 1R8SA 3LX5A 4RD1A 3ND8A 4LJYA 1G3IA 5L8VA 3EPJA 1PLLA 1VG1A 3QQ5A 2ZJ2A 4Z8XA 3AF3A 4OQXA 2Z4SA 1ZVQA 6Q21A 3I73A 1Q0UA 3UG7A 4DB4A 2Q3FA 1MO6A 3BD9A 3IHLA 5CM8B 1WB9A 2QP3A 3I61A 1WXQA 1VTKA 1QF9A 4UNPA 3T12A 4Q5IA 3B1VA 2ZUDA 4RVCA 1TEVA 2V8OA 5B30A 2QQ0A 1IBRA 3CRVA 4MH0R 1UBEA 4BWYA 1GVNB 1OB5A 2BHRA 3K9HA 5A5GA 4EPWA 3QVUA 1ESMA 1VCNA 1XTSA 2IF0A 2Q9AA 3HDTA 2MSDB 3V4FA 2AWOA 1Q22A 4JLBA 3UWOA 3B9PA 1GL6A 1DVRA 2MMGA 1G3RA 1SKYE 1ZUHA 4F38A 1NMXA 1P60A 5DISB 2NOAA 2WPDA 3T1QA 3PG5A 3ZVLA 1Q1EA 2WKRA 2WSSD 1S2MA 1X8LA 4B3BA 2RGNC 2VHUA 3W8RA 3QXHA 1E1QA 1HURA 3U7GA 1KKMA 2ERXA 1RFLA 3AF1A 2ZXUA 2ZAOA 3P32A 2ATVA 1OH5A 3BOSA 4HDOB 4BLSA 1DO2A 3GLIA 1M6NA 1E96A 1ODFA 2ZQ5A 2GJ8A 2KB0A 4QC2A 2ZRHA 1JEDA 5EE3A 1J8MF 5DSZA 2ASEA 3QI2A 5IF9A 2ZJ5A 2YWEA 1XX6A 4MRSA 4A0RA 2ZRPA 2FFAA 3CWZA 3B5JA 5KO2A 4AIIA 5EZ5A 5C1BA 3THWB 2B8WA 4RKEA 1I2DA 1NLZA 4G1UC 1NIJA 1E0SA 2GJ9A 1Z83A 2H5EA 2RMKA 1F2UA 5DN6D 2CNWD 3ADKA 3Q85A 3R9WA 3FWYA 3ADBA 3NBYC 1P75A 1RYHA 4JKIA 1UEJA 1UJ2A 1HUQA 5D3MB 3B1WA 1NN1A 2ZREA 2D3WA 3QF4A 3LO5A 4G5OA 2QM8A 1G8PA 3VR2A 4K81B 1N6NA 2GEUA 1ZNZA 2IUSA 3SEAA 5AUQA 2VYFA 4B74A 1EX7A 4PAMA 5FUWA 2ZSEA 3EXAA 2DWOA 2VHQA 1KIMA 3Q5DA 1ZAKA 4MQBA 1NN0A 2YC4C 1AM4D 3GJ6A 1W2HA 5TARA 1XEWY 1XTRA 2W2TA 4M9SA 4C2UA 4HLCA 2ZJBA 3K0FA 5CLLA 1Z6GA 1DO0A 4R98A 4U02A 5F2EA 1I2MA 3C8UA 2O8CB 4TMZA 1ZM3A 1EWRA 2A3RA 2AWNA 4M4SA 5HE8A 2WJVA 2OXRA 3KX2A 2QGNA 3K8YA 3OIUA 2GK7A 4GFDA 1OFIA 1OXSC 1T0HB 5AWFC 1H8ED 3THOA 1EFTA 1R8QA 1P2VA 2D2FA 4B6FA 2FGKA 1E69A 1OF1A 1JQJC 1S9DA 3GJ0A 4DT1B 4L15A 2R65A 2WJGA 4DLZA 5B57C 3X1WA 4N0DA 4C0HA 4AYTA 4D0LB 4JJKA 3ADCA 2H92A 4TMTA 3EWAA 2V7QD 4EFMA 2QPOA 4ZIRB 1IN6A 2MSCB 2IS4A 1M1YE 3KUDA 2QU8A 4DDWA 3WXMA 3ZIAD 2FWRA 3HU1A 3A1UA 2ZROA 3RABA 5KYKA 3RSLA 1ZIPA 4D0NA 4ZKDA 1GL9B 4GT1A 2JA1A 4NBSA 1X3SA 1CKEA 4WA7A 5HZKA 2ZUBA 2BEJA 1KO7A 3GLFA 3U2QA 3C16C 4FMCF 3WHLA 4YC7A 1KK1A 4JLKA 4IXNA 4BEBA 1WMSA 2A5DA 4IEIA 2NMVA 1E9RA 4B3FX 1YVDA 5JWHA 2NO7A 1HY3A 2A5FA 1XCMA 4C0JA 4GPTA 1QVRA 2HYIC 2FOLA 1R0YA 1QBKC 2V55B 3OZXA 4RCZA 2V54A 2ZI4A 3EZ9A 2JASA 3W90A 1EX6A 1T0JB 3AEZA 1NF3A 2YINC 4HYYA 4AYXA 5TV2A 2ZRMA 1PZNA 3T1VA 2FZLA 2YOFA 3V4RA 2YWGA 3MMPA 4I81A 4TMWA 5DIFA 1FMJA 2C5LA 1XPUA 1QHYA 3QKRA 4EPRA 3VKHA 1BYIA 2QSYA 2G1KA 4IHQA 5L3VA 2VEDA 3BB1A 1NI3A 5EJEA 4PXAA 4U00A 3TNFA 4GRAA 3EA0A 2ZJ8A 4PPGA 1N25A 5GVSA 4PZZA 4B2LA 1QRAA 3I62A 1Z8FA 1NN3A 3I5XA 2BMJA 4PQRA 3QPUA 2IYWA 3WMEA 5JEEA 1MRNA 3L0SA 5BYJA 5TY0A 1G7CA 3QOFA 2VP4A 2GXUA 2BV3A 1I4DD 2PZEA 1OT3A 4TWZA 4PC3A 3WNBA 2DYKA 3TK1A 5H68A 1U8YA 2FSIA 2ZPTX 3A4LA 1G16A 3ZZ0A 3CNOA 2AK2A 3C41J 4NMMA 3W34A 4V0OA 5IRCD 3G82C 5G40A 3BBPA 2FDCA 1VG0B 4JT4A 4PX9A 2C9YA 2GF9A 3PENA 1HT2E 1NVXQ 1DAIA 1GRNA 2FV8A 3D8BA 3SDZA 2NQ2C 1XCGB 3KDSE 2FEOA 2PMKA 2YC2C 3SNHA 2BC9A 2A30A 4KSCA 3QBTA 3CM0A 5EE5B 2BCGY 3H2YA 2AN9A 2WPDD 1KSGA 4JLJA 3S1AB 1MH1A 4TYQA 4LHYA 3G5UA 1YZTA 4GI7A 4NYIQ 3KFVA 3QKSB 4PSAA 1Z0IA 2JLRA 4G5RA 4URUR 4PAOA 4TMKA 3T1OA 1IXSB 2DFNA 3UMSA 1XD2B 2P5TB 3IIKA 1FNNA 5CJ2A 3CNLA 1FMLA 4FWTA 4TZ0A 4A6XA 2SHKA 3F8TA 4BFXA 3BAFA 1E9FA 4RZ3A 1TQ6A 4NKRA 2JLQA 2ZE5A 4PHTA 5CB6A 2GWHA 1RIFA 4A8JB 2W6JA 3W5JA 4E09A 3H86A 3I92A 3TQCA 1UKEA 3RNLA 2C03A 3U7HB 2QA5A 2YWHA 1MRSA 3CF6R 4CVNA 1E9EA 2Z5FA 4MKFA 2KBFA 3OAAA 1TAGA 5JCPA 3IKJA 1SHKA 2VSXA 4OHYA 1DEKA 1N5LA 2ZI7A 1TL7C 3TR5A 1P4SA 2G6BA 4IXMA 4MRPA 2FFBA 3HU2A 4AD8A 4CEJA 4PFSA 4DRZA 3UWKA 3KXLA 5L3SA 2EU8A 4FXPA 4V0ME 4WOPA 4BFVA 3C7KA 3ZVRA 1DAMA 1DS6A 3LAWA 3RS5A 4BLPA 3C15C 5HCNA 5FBWB 4LJ6A 1M7GA 4IOKA 4EKDA 3REFA 5J4VA 4A92A 1A4RA 2A5JA 1FUUA 4CZ2A 2QAGB 4OQNA 1FP7A 1YJ5A 4A1FA 3U4QB 2YWFA 1E2HA 3OIVA 1E2PA 4Q7LA 2XNDA 1BS1A 4KVGA 4HAWA 5JFGA 1W0JA 1XXHA 4E07A 3IBYA 1KMQA 1K5GA 4JVSB 4EJSB 1GL7A 2OXCA 4PPNA 1UDXA 5KOYA 1IM2A 3VR1A 4W5WA 3FOZA 3PJRA 4JBXA 1D2MA 4B32A 2LCFA 1NJFA 3RS2A 1ZC4A 3GFTA 2CCGA 4QXAA 5E7IA 5SZHB 2X19A 1DBSA 3U7FB 1KY2A 2VL7A 5CDFA 4PHFA 4B73A 3TAHA 5SZJA 3FVQA 1KMHB 2YNMA 4QM7A 2R6AA 1GKIA 3THYA 2HXSA 3VFDA 1VCOA 5A4JA 2J0UA 2P67A 1IHUA 4P4SB 5J4HA 3KQHA 3ECCA 4D4MA 1CJKC 1KDPA 2ZITA 3BK7A 3DDCA 3QE0A 3OE7A 5KHOC 3QG1A 3QXSA 3KXKA 4LBVA 2O8FB 2CHGA 4QBGB 4Q19A 3B9QA 2NIPA 1JPNA 1EESA 4AURA 2VP6A 1Q20A 2VH5R 1SULA 4QBIA 4A4DA 3EW9A 3TH5A 3VHXA 5LDDC 1F2TB 1Z0FA 1UF9A 2WHXA 3E5HA 3I3SR 1PLJA 5F3WB 1RC8A 4CEHB 2WKPA 1X1SA 1U8ZA 2VSFA 1OKKA 4X8HA 3KJIA 4F92B 2EFGA 4LX0A 3VX3A 1W2GA 2WOJA 1YHNA 4R71A 2IHBA 3K0AA 4AKGA 2GKSA 4KO8A 3QSYA 2AFIE 2JAQA 2EYQA 3W8NA 1G41A 1OPXA 1NIPA 5KUTA 2EW1A 1EK0A 1QZXA 4B2PA 3PQCA 4HATA 1N0WA 1ZNYA 2OM2A 4TYNA 4Z1MD 2OHFA 2QTHA 2JJ8A 3CKLA 3SQWA 1KZGB 4Q7JB 5BQ5A 4LC1A 4RFVA 3AF0A 1IN7A 5FPSA 2HT1A 2A9KA 2GVZC 4H9GA 1Z22A 1S1MA 4Q21A 1TMKA 1YRBA 1D2NA 4HZUA 1K8RA 2CVFA 1MO5A 2GF0A 4WAUA 3C5HA 1KSHA 1VMAA 1JQLB 2BKUA 3EIEA 5L3QA 4UNSA 2VP5A 4DCNA 1KNQA 3LX8A 4M1TA 5FTKA 3RVBA 1CBUA 4FW9A 4CGZA 1XMSA 2DY1A 3KQUA 1E9CA 4LJAA 1HEIA 3IPYA 2IXGA 5HTKA 4CDGA 3KJEA 2CJWB 3AVTA 1C1YA 5DLQC 3SJCA 1E9DA 2EVWX 4RZXA 2NPFA 3WYAA 3OEHA 4G5GA 5JSZA 1U81A 2GAAA 5DI9A 2IX3A 1W0KA 2L0XA 2WAXA 4A15A 3TVDA 3IIMA 2OEPA 2BWJA 4OK5A 4TL9A 5EXSA 4BZQA 3LQQA 5FOSA 2ODNA 1G7RA 1MO4A 1RW4A 2OSBA 3GJ3A 1US8B 3FTQA 1CTQA 1EFCA 2Z6VA 2WSSA 4LHWA 3E70C 1GZSA 2VO1A 4HAUA 4TTPA 4DCSA 1OJLA 1II0A 2A5YB 2P3SA 3PXGA 2RHMA 1RPZA 3SC3A 2UZ3A 2IWHA 2BMFA 4MYUA 3AKCA 2ZYUX 4GOXA 5JCZA 3QG5A 1IOZA 5JEDA 3OIWA 3TJZA 3K9GA 2CBZA 3FMIA 4Q9KA 4NCIA 4R2HA 3CR8A 3LXXA 1J70A 3PVSA 3GP8A 3RRZA 2ATXA 4P4TA 2OE2A 3KKPA 4M2LA 2QTFA 1NLFA 1P72A 4P4UA 3RANA 4D4KA 3K9LA 4URWR 2JIZA 4AG6A 5BN3A 4YXWA 2ECKA 4DSOA 1Z6AA 5DN6A 2W6JD 2CNWA 2YYZA 4BZPA 1IJFA 4URVR 3CRQA 4LBYA 1SZPA 5DI3A 4BFSA 1P9WA 1T4GA 2WIBA 2PCJA 4RD6A 1XNJA 2OCBA 2QG6A 1N6LA 3K70B 2XJ9A 1CJUC 1ELOA 4OHZA 4PANA 3C4JA 1RJ9A 1LVGA 3WMGA 2IS2A 1AA9A 1BKDR 1OLOA 2YOHA 1ZBDA 2I1QA 2CMKA 1HA3A 1QHHA 2FFHA 2ZR7A 1DOAA 1N5JA 2E1RA 2WWGA 1GITA 4JS0A 3NG1A 3U6BA 4CT4B 2O0JA 1KJYA 3LVRE 1E2MA 4NYIR 3RWOA 2XZPA 2JATA 3A37A 4DBLC 1BIFA 5JS7A 4OI0A 2VHJA 1WA5A 2WICA 3O47A 4OJQA 3TAUA 2BMDA 2AXNA 3LA6A 1VCMA 4ZI2A 2ZETA 2H8KA 4OHXA 3SJBA 2QN6A 5JHHB 2BBOA 4CRWB 5BN5A 2DFLA 4CYMA 1WP9A 2FPMA 4DDUA 1TNDA 4MKGA 4ARZB 2OBLA 2V6JA 4DUGA 3ZJYA 4IW3B 4PZYA 1LF0A 2XNDD 2Q0HA 1DAEA 1QHXA 1W0JD 5TDHA 2WWHA 1SVWA 3B1YA 421PA 5HCIA 4ITRC 1KO4A 4RJLA 8OHMA 1Z06A 4PSKA 2FN4A 2X8AA 4PC2A 3QY0A 4PPFA 1V5WA 2C2HA 2REBA 4M1OA 4HAVA 4DEYA 1GNPA 3IIJA 3GLHA 2QMEA 1T3HA 4AKHA 3BB4A 3AVQA 3SYNA 1S96A 1A5TA 2AKAB 5FFMA 2IYVA 4EPXA 2EFDB 2QTVB 1KI6A 4NCHA 3ZIAA 4G3XA 1D9XA 1NVUQ 1DAGA 4DZZA 4KFUA 4CIDA 2J0SA 1U9IA 1XJCA 5JWRA 2ZVPX 4I99A 2WOOA 2CEAA 4X8MA 1TTTA 2G0NA 1WQ1R 3AKDA 4N0EA 4QOSA 2FNAA 5JBQA 1E99A 3OE7D 1YU9A 3SU8A 1T3SA 5FBQB 2HT6A 3MWJA 4JLVA 2RGXA 4XJXA 3RDPA 3UMFA 4Q00A 2O8DB 1Z3IX 4I1VA 4A2PA 3SN6A 4CEIA 1E2IA 2F1IA 2C9OA 3EC1A 5FR2A 4P0TA 2VA8A 5H8WA 1QDEA 3BJIC 2JEOA 4DVGA 2QNRA 2F1HA 5FH9A 2IYYA 3U60B 4OKSA 3GLGA 2PMDA 3PCRB 2C77A 5LB2A 2CL6X 4ABYA 2BJWA 1OKKD 1UKVY 2N1BA 4RZ2A 4DDVA 3GD7A 4LYFA 1W49A 3KKOA 4XTRA 4DSNA 4IDHA 1KHTA 1NP6A 1HT1E 1CJVC 1MABB 4C0LA 4ESVA 2KI5A 2CLCX 1Q21A 3BXZA 1FFHA 3VKGA 2RH5A 3VNVA 4DLSA 3ZD7A 1G4UR 3QUSA 1E98A 2FH5B 4JL6A 1VYUA 3A1TA 3PEWA 3LNCA 4QGFA 4XVRA 2Q9BA 1EGAA 4JLAA 3BH0A 3FE2A 1IY1A 3B13B 3A6PC 1E3MA 1FW6A 4FCTA 2GVDC 3T15A 4BFWA 3KXIA 5CB8A 1XD9A 3FHCB 5FPYA 1L4UA 3R20A 1NMZA 1R5BA 5KSZA 2ZIAA 4H1VA 5LD2C 4LJ5A 2ZYWX 3CBQA 3W6OA 3GLIE 5FOVA 2J1LA 2VP2A 3B60A 1CJTC 1NG1A 2HCJB 4I4LA 1HH4A 2J87A 4D81A 4QM6A 3DZDA 4F7WA 5BN4A 2WMNB 3QJYA 4NDZA 3RRMA 2ZE8A 1RRCA 1G8GA 3LVQE 5IK2A 1FP6A 2BVNA 2P6RA 1HV8A 3OEHD 3T34A 4PO9A 4HAXA 5JI3E 5M04A 2QAJA 3JVUA 1W0KD 5HKKA 4LDJA 3MG9A 4PPQA 4BLOA 3KZ1E 2J3EA 1K5DA 3QENA 4MYTA 1J99A 2ZU0C 1G4AE 2H57A 2XJ4A 3RSOA 2FGJA 2GXSA 2HXYA 1XEWX 4LV5B 2CL7X 1Q44A 2DR3A 3ICEA 4KU4A 3TUIC 1Y3AA 3KUCA 3WP0A 4KVAA 1KI7A 1RRPA 5G3ZA 2OBMA 4HLDA 4HUTA 4Q66C 4MGIR 2FPLA 3SYKA 3GCGA 2X2FA 4LJ9A 1XTIA 821PA 3LFUA 1CULC 2QENA 1D2EA 2HEIA 3FDIA 3G0HA 1AQYA 3DKVA 2XSZA 5DE3A 1TUEA 4ZI3A 4JSYA 4BASA 1SKYB 4Q9JA 4BRWA 1F2UB 4B76A 5GVRA 4WBSA 4Q03A 3RC8A 1G64A 3BFVA 1KI8A 3QBVA 3TKLA 2JIZD 2CLSA 3ZZTA 2P5SA 2Z43A 1BH2A 4YXWD 2Z83A 3VU9B 4LPSA 3B85A 4PO8A 1YQTA 2ORWA 3WYFA 2BDTA 1QVAA 3QF4B 1CR1A 4BFTA 4BLRA 4JMPA 4MKHA 4DJTA 4TSFA 1HYQA 2BMEA 2WZQA 1OH6A 2RAPA 1P9RA 2QE7A 1Q3HA 4C4PA 3IQXA 4JYBA 2VTKA 1SXJD 4X8OA 3WRXC 3NEJA 3B7GA 2IW3A 2FX3A 4LHVA 2OLJA 4P33A 3VR3A 2J0QA 2XNSA 1E6CA 3HJNA 3CWQA 1G3QA 1MT0A 1XZPA 2B7BA 3VX4A 1GUAA 3GJXC 4QJ5A 2J0VA 1E0KA 2J7PA 3ZDQA 2H7VA 4JL5A 3TUZC 3THWA 1W36B 1D8TA 4BLTA 3IEVA 3VQTA 3L82B 4FN5A 3BERA 4GP7A 3D7MA 3NHBA 4DKXA 2NO0A 5LBIA 2V1UA 2KWIA 2WJJA 2BBTA 5CM9C 3DM9B 3RRYA 1XMIA 5D3MA 1Y63A 1FOEB 2ZVQX 3GLFE 3FFAA 3QXJA 1SVOA 3WNDA 3FKSA 5LB4A 4M53A 3MRSA 3K70D 5FTMA 1NBMD 4DUGD 2ANCA 4FMDF 2QP9X 1MO3A 2QRNA 4GOKA 2NTYC 3QF7A 3EZFA 1WF3A 4NL4H 1DELA 4R2IA 1UPTA 5CIQA 2ZS8A 4M1MA 4MYCA 4HB3A 2K5UA 4DEXA 1YZLA 2GHIA 5FOXA 2XB2A 1G8HA 4MUBA 4OYHA 1ZRHA 4IEEA 3U5ZB 2FE4A 5FBVB 1MV5A 2B8TA 2ZRNA 3R8CA 1HE1C 2ZJOA 5TXGA 2ZRJA 1EFHA 4IDOA 4N3NA 4IVRA 2O8CA 5G3YA 2DFTA 4BEJA 4ACBA 3TVTA 3DVLA 3I32A 1U90A 1ZD1A 3U3JA 1T8UA 1BYUA 1M8PA 1WE2A 3KB1A 2WJYA 3KTAB 3B1XA 4B3XA 1P3JA 5JHGB 3RAPR 5C18A 2GDJA 2A7QA 3B8HA 4PC1A 4DT1A 1X1RA 5EUMA 2FJUA 2PL3A 1KI4A 2C04A 2XXAB 1G3UA 4O2LA 3MUFA 3QEOA 5JMTA 3BH6A 2QROA 3WY9A 4D80A 1R6BX 4ZIRA 4DWJA 3GJ4A 2NGRA 2F9LA 3IPXA 2XTMA 4Z1MA 3O8CA 2C96A 1XTQA 2G9NA 5HZHA 721PA 2GBLA 4PO1A 1N0VC 4JT2A 5EXPA 3MWLA 2GJAA 2W2VA 1JB1A 4EDHA 3RC3A 3IILA 3NTUA 1XEFA 1GFIA 4CT5A 1OXTA 2OZEA 3GJ5A 3WRYC 4OBEA 1N2CE 3K1JA 4V02A 1G291 1BOFA 2BIFA 5CLQA 5H1YA 3ZVNA 1A7JA 2WBLC 1XEXB 1XZQA 3KJHA 1T3LA 1JR3A 2NG1A 3EZ6A 1NY6A 5AJZA 4GL2A 1FL9A 3A1VA 1SGWA 1E2KA 1NN5A 1JECA 4A36A 3I4LA 3BWDD 3SJAA 1KK2A 1P2SA 3EC2A 3CX8A 1TX4B 1Z0AA 2QEQA 3AVPA 1N6HA 4JIMA 4OI4A 1S8FA 3EIQA 3RYTC 1GSIA 3TRFA 1R0XA 1AN0A 1J7KA 3T06B 5JJLA 2B21A 4NYJQ 4LY6A 2VLIA 4OI2A 1AS0A 4ASUA 2GXAA 2PJRA 3FMFA 1VG8A 2N42A 1GNQA 5DHAA 3CX6A 1W4AA 5TB5A 3K0CA 5IK2D 3WYGA 4FD2A 3SQXA 3TE6A 5HKKD 1IY2A 4BECA 1N3BA 4FINA 4AK9A 3TSZA 2MSEB 1COWA 2YZ2A 4ZDIA 2B6HA 3LXRA 2O0KA 1KI3A 3ZQ6A 4ESHA 3PEYA 2ODEA 5GJVC 4FI3C 4O2RA 1NKSA 2YV5A 1DADA 3WMFA 5B58C 1NNEA 5FI1B 1NSFA 3A4MA 4MGKR 5C4GB 2GESA 1ZU5A 2PLRA 4BUJA 4MDFA 4E03A 1E2EA 4WXPA 1FTSA 2EQBA 1TF7A 2XSZD 4BLQA 4JLNA 3VMFA 4RD3A 3PIRA 1G18A 2XAUA 3OHMA 3DEFA 1XXHE 4LJ7A 1TQDA 3T1TA 3S1AA 2JLZA 4BFUA 1KKLA 2AXPA 3KKQA 1P9NA 4LV8B 2QY9A 3QKSA 2QPAA 3CUEF 2NO1A 1J2JA 2CK3D 1W4RA 3T5GA 5HR5A 3CZPA 4GDFA 1DPFA 1XD2A 3AUYA 3I72A 2GZDA 4TSFD 2C78A 3PITA 1A2BA 2QE7D 3AF2A 3NXSA 4KITB 5CDFE 3GEIA 4YLGA 3QXCA 1II8B 2F1JA 1SXJC 4HSEA 3SOPA 2RGGA 4A8JA 2ZSBA 2GCPA 3A36A 4OQMA 4EFNA 3NKVA 1U0LA 3HWSA 1OE0A 2W0MA 2X77A 2QM7A 1XTJA 1BO6A 4QG7A 3FKQA 5A0FA 5J4LA 4URXR 5KNDA 2J7PD 5EE9A 2X2EA 1U0HC 1E2FA 2F1RA 5TVKA 2OUKA 1OV4A 3J81k 4JBWA 4TN1A 2J41A 4W7SA 1DAKA 4YMUA 3D6TB 2ORVA 1N5KA 1KAOA 2WM9B 1ZD9A 4IVQA 5KDDA 3NBXX 2R2AA 2ZI9A 3L8YA 4P3YA 4RFSB 2PBRA 4Q1AA 3R9IA 1SKQA 3Q8XB 4HLUA 4KCGA 1KI1A 4LCBA 2ONJA 3FKSD 4M9ZA 2GJKA 2IYUA 3PEUA 3X2SA 1YE8A 3U6KA 2ODBA 4ON9A 3CLVA 3CIOA 1UDWA 1ZM2A 4RKFA 3THYB 3L43A 1ESNA 3LW7A 5D3QA 3SS8A 2ZJYA 2JJ1D 4XWKA 2NO6A 3LBIA 1FX0B 2RHDA 5KSPA 4W5HA 1YZKA 2QAGA 3U4QA 4UXHA 5CYPA 1M2OB 1S3GA 2DPXA 2OO7A 3FFBA 5JRZA 1ZNWA 3IGFA 2XEXA 1R0WA 4B3CA 4EJSA 2WAYA 1P61B 4OQFA 2IYLD 5C4MA 3AV0B 4A9AA 1TU4A 1L8QA 4LYHA 3L2OB 4WZ6A 3BIFA 4LC0A 5EZ6B 2FF7A 1U9IC 1OIWA 2O8EB 4KXFB 3I8SA 4XH9B 1C9KA 1M34E 2BBSA 2GRJA 4Q48A 2IWRA 4XTCS 3MJRA 2WMOB 1G8FA 3L0IB 4FIDA 2CLDX 1SVSA 4FMDB 1ZCAA 2ZR0A 1IN5A 4Q9IA 3I5YA 2PLFA 5BWMA 2OCYC 1QG2A 2R9VA 1ZNXA 2ZRFA 4NHOA 2OV2A 2D74A 1U94A 1PUJA 2VP9A 2VPPA 2PX3A 1N6PA 2QGZA 2ZRCA 4LJ4A 4P4SA 4Q4JB 1ZC3A 3Q7QA 1RRGA 2QI9C 3RWMB 1KSFX 4TTQA 2O8FA 3KKNA 4I1OA 3CZQA 2D7DA 3DKPA 1H65A 3FGNA 3K09A 4U5XA 3UKDA 2FSGA 3JZAA 4B44A 1GNRA 3TR0A 2NO9A 2JLYA 5JZVA 4KI0A 2ERYA 1F2TA 4GZMA 3AVYA 1YR8A 3FHTA 5EP2A 4YMTA 1JAHA 3BC1A 1KDRA 3K0SA 1XFAA 4CEHA 1L4YA 2W0SA 3K53A 1TPZA 4C9BA 5KNBA 4LBWA 4LV6A 2G1JA 2IK8A 5AK0A 4MDEA 3CRRA 1N6IA 1UBFA 1OHHA 4QHSA 2IXFA 5FPKA 4JZKA 4L9WA 1OFHA 2WVJA 5DHFA 4YQFA 1I4LD 1JR3D 4Z54A 3IDQA 1KYIA 4KHZA 1IY0A 1KSJA 4UXJA 1P62B 3R7WB 2ZSAA 1T91A 3P27A 2AFHE 1G3MA 4JLOA 3TLXA 3UATA 1NVVQ 3UMRA 3U3MA 3H0KA 5ANRB 2IXEA 2AD1A 2D4HA 4MRVA 3SZRA 1W4BA 4C0SA 1OIXA 2P6NA 4Y0VA 1WRBA 1FZQA 4PAQA 4V0LA 1H8HD 1F6BA 3TQFA 4ASUD 2REOA 1FPMA 2LKDA 1ANKA 2WWFA 3NBZC 4W5JA 2QBYB 4IJMA 2G88A 5C2JB 3CH4B 1ZINA 4TLDA 3EAQA 2CJWA 2F43B 2PCLA 2XZOA 4HAYA 4TYWA 4PR0A 4BGDA 4LPKA 1E2JA 3M6AA 4WVFA 5CIWA 1G19A 2GCOA 3OFNA 1COWD 5EQTA 3W5IA 5FUXA 2EYUA 4HUQB 4M21A 2OILA 4YDHB 4TL7A 1UBCA 4O0MA 3X1DA 1KJWA 4XIGS 3VAAA 4EQ6B 1XPRA 1HE8B 1W5TA 2VF7A 4Q9LA 3DHWC 1ZUNB 1LS1A 1VHLA 1G5RA 1ZIOA 2VIIA 1TU3A 3PV0A 1P7CA 1US8A 5E7MA 2P0EA 1E79D 2QP4A 5KDLA 1D5CA 2OCAA 4E5UA 5BXQC 4JKYA 5DI3B 3ASYA 1J90A 4JLMA 4NCKA 2DWQA 3P1JA 3LWNA 3FMOB 4HEJA 4QFMA 1G21E 1ZP6A 4OK3A 1NY5A 1AQUA 3SFVA 2KSQA 4NYJR 5JWOA 1Q12A 1RJ9B 1JJ7A 3B1ZA 4M1KA 5FR1A 2ZJAA 4H1UA 1SXJA 2OFOA 1DTSA 2W00A 1LTQA 1CR2A 1GKUB 3F5FA 4BRUA 4DDTA 4NP6A 3T35A 5J4YA 2UVQA 1PJRA 3TW4A 2QRZA 3Q3JB 1OIVA 5FTJA 2XX3A 4YMWA 2ZRGA 4AKIA 2QMHA 4RD2A 4CF7A 3GLHE 4XVUA 1ZW6A 5E3HA 3NVAA 4EAQA 1LFDB 2F55A 1SVMA 2V4ZA 3DZ8A 2R44A 3L0PA 5KU1A 5E7JA 4WZBE 1EFUA 3SBEA 3GFOA 4NCNA 1Z6YA 3NHAA 4PQFA 4NZYA 4A0HA 2JLXA 4MRRA 3KQNA 3Q72A 1AIPA 3I1FA 4OJKA 3WBKA 1NBMA 5KNCA 4F4JA 1K6MA 2RKOA 1JPJA 3I8XA 3UIEA 2AKYA 1X6VA 2NPIA 2CE7A 1ZUIA 5DO9A 3CR7A 3GLHB 3AP1A 3EIHA 3E1SA 3N2EA 4BE7B 3SHFA 3NH6A 3LBNA 2HF8A 2MMCA 3GLGE 3MGCA 1IXRC 4LOAA 4HI0E 4MGYR 4URZR 1G7TA 3KQLA 2BOVA 2ZRBA 5H70A 4ZDJA 1C4OA 1YKSA 2RGCA 3SJZA 4RD4A 1R10A 1ZM4A 1WBBA 3RHFA 5FPTA 4QKQA 3OF5A 1E2GA 4O3MA 4AG5A 4MKIA 3K9NA 2A5GA 2ZANA 3MLEA 1TQ4A 4Z8YA 1GTVA 1UKZA 1Z2CA 2XB4A 4C7OB 4JJZA 3ZH9B 3LY5A 4MGZR 1BMFA 3P26A 4K8OA 3THXB 1G7SA 4LJ8A 2YKGA 3U44B 1GRQA 1Q1ZA 4Q1DA 3QNUA 3PUWA 3M4YA 4Q4AB 1N0UA 1G6OA 1XWIA 2O8BB 3OEEA 4M9QA 4NE2A 1R2QA 3C14C 1YR6A 3K0EA 2Q3HA 3U7EB 1DAHA 1VDZA 1ZCBA 3EG5A 1U98A 4U7DA 5K8LA 3GFPA 3W3ZB 1QHIA 2ZUCA 5FI0B 4Q4HB 2JLSA 3ND9A 2KBEA 1A82A 3VR4A 1SVKA 5EXXA 5FBRB 1N5IA 3ZGXA 2PT7A 3MAAC 1GP2A 1OW3B 4LBZA 4UQOA 2Q6TA 3CNNA 2IT1A 3HR8A 4NTZA 4UKDA 5LPNA 3LW8A 1TEXA 1U2RA 3EA5A 1JJVA 1L2TA 2HLDD 2FPKA 3DOEA 3MD0A 2ZRDA 4B3GA 4JLPA 2IS1A 1JAIA 4NYMQ 2ZRKA 1FNMA 5JRJA 4Z51A 1F5NA 2WTUA 1OYWA 1XMVA 2CXXA 4GMDA 3SI7A 3REGA 2GBLC 3AB3A 4F4IA 3F0TA 3LRPA 5G53C 2FG5A 2IHYA 4D6PA 1Q57A 4LHXA 4RSGA 2V9PA 4D4LA 1GWNA 1U0JA 3HYTA 2OCPA 1B23P 5AJYA 2FEMA 1OHHD 5EXTA 4X8LA 4BFZA 4DLUA 1CRPA 1MABA 3U3RA 3KL4A 5KSYA 4V0NA 2IYTA 2PZGA 2IYRA 4KBFA 3QKTA 4L8GA 2XTZA 1G20E 1XJQA 4HZIA 4TL8A 4L5BA 2W83A 4KJZA 4B3DA 2CCJA 4Q7KA 2BCJQ 3EWSA 1A1VA 4JLDA 1Z08A 3UPUA 3MCAA 2QZ4A 1XTKA 1GKYA 2DHRA 5AJWA 2GA8A 4US1R 3GPLA 2R6DA 4XSGA 2Q21A 4GOJA 3AH8A 1N6OA 3CX7A 4C0AC 3EARA 1GAJA 1Z6XA 3K0CC 2R6CA 4PSVA 3GLIB 4D4JA 2WJHA 4C3ZA 1NRJB 2ZRAA 4B71A 2GEDA 3AKYA 4QGHA 2ZSFA 4TMVA 221PA 1Q1BA 4D26A 4A0GA 4M1SA 2JCSA 1JBKA 1DG3A 1W46A 1X86B 1V43A 2EFEB 2GCNA 2HF9A 2ZYVX 3OFND 4FCVA 4EPVA 2J59A 1LV7A 1E0AA 4IVPA 4TQ9A 1IAQA 4IOJA 3TIFA 4Q18A 4D0GA 1OFTA 3MFYA 3T5DA 4HAZA 1VECA 1F48A 4AY2A 1AK2A 1QG4A 3AVWA 1G17A 4QHTA
chains in the Genus database with same CATH superfamily
1BFUA 3ETJA 1IZ7A 1NXVA 3OWHA 5I51A 3IELA 3DULA 1KI9A 4QULA 3SHWA 4EFLA 1DJLA 2X1HA 4IJWA 3OU2A 2D1QA 4QDZA 4YCJA 1I01A 3HZRA 4EHLA 4CIYA 3UB3A 1J1UA 5JJIA 3AILA 3GG9A 3TMKA 4AN0A 1E1RA 1FRQA 3S5JA 1E3EA 4WXEA 4F4CA 5IVPA 4TV8F 3C5VA 3ONWA 1KDOA 5EC8A 2R60A 4JK3A 4PX3A 2Q3LA 1FS6A 3C1AA 1D9ZA 1PFQA 3L5KA 5CB0A 4EP1A 2G08A 4J16C 4KBGA 1GA4A 1ULUA 4ZP1A 4DL9A 3QVMA 1Q19A 2B7CA 2IYNA 3LK6A 4M83A 2V45A 4Q6WA 4RFLA 4Y1GA 3UK6A 4CKWB 1EUYA 4D25A 1WSWA 3OKFA 3IEKA 4MZDA 1VPDA 5CK5A 4EF5A 1QH9A 1Q77A 1Y4AE 2JD0A 2OZVA 3BQMB 4JI6B 4BFCA 3IBFA 4UDNA 5FYDA 4AXBA 1KYYA 2V6GA 3MWGA 4P84A 1QYIA 1F6DA 5CK4A 3TOVA 3VTZA 2JEYA 3LQ1A 4EUFA 5LOVA 2XRZA 3BS4A 3JATB 4AUMA 1BMQA 2AGVA 2OT3B 3E5RA 3Q1KA 4HRYA 3SX4A 4ACAA 3HO1A 1RFGE 3IKTA 1ZJYA 3KSDO 2YMMA 2GJSA 4JBLA 3RSCA 5J2TA 2P11A 4OHKA 3ZLJA 5COQA 4MUAA 2EBUA 2EGUA 4A8JC 3GPCA 3CSSA 1XA3A 3RK1A 1C5KA 1FUEA 5HPYB 5H9WA 4MP6A 2ZSJA 4ZDWA 3L07A 3Q40A 2CUKA 3Q9LA 1O0CA 2BGIA 4WFJA 3QKUA 1OB2A 1HDOA 1C30A 2HSJA 2BFDB 5ALMA 3H9BA 2GAOA 4CLOB 6AT1A 1I7SB 1FJGB 2AX4A 1NAIA 4HDCA 3AESA 1U8CB 3B6EA 3ZJVA 1LF5A 5ICSA 1JTEA 2G5PA 2OSVA 1KF0A 2JLWA 1Q7EA 1TVKB 5JSFA 4YJGB 2GILA 1D7OA 2GERA 2Q3MA 1RHQA 1PV4A 2ID7A 2YQZA 4U5QA 4YALA 1CQXA 4IJ5A 3OZEA 3TR6A 5FNZA 1W5FA 4MUKA 3AOGA 5AW4A 2W22A 3CONA 1NJGA 5KNDH 1DRVA 4DIUA 1N1GA 4TS1A 4IIGA 3KAJA 6YASA 1E5LA 1PYDA 1GDTA 4P2BA 3D31A 1JEQA 1IUNA 2NU6A 1C1XB 2Q4OA 2I4TA 3BFXA 3LC2O 4MR9A 4R2WA 1A7AA 3IBTA 3BH7A 4XI9A 3AVVA 1P1KA 4KSYA 2V3CC 2VSQA 4PZ0A 4TT3A 4RTKA 2H0AA 2OBNA 2OD9A 3F3YA 4UOEA 4AMGA 1W7AA 3M33A 1X70A 3UKOA 3VZPA 2ANBA 3CTPA 4LOKA 1PGNA 5JYCA 1T4MA 4TYPA 1CS4C 1BKYA 1QIEA 1XLUA 3AKEA 3K8OE 3NC1C 4HNGA 4KIUA 3RC1A 4Q1CA 5P21A 1CIJA 2ZI3A 4I9NA 2CLFB 4N0MA 3ZW8A 5CVTA 4G0WA 3FUTA 4KGZA 3IR5A 5ICEA 2NUPB 3V7YA 1EFVB 4ZCTA 5D6NA 5LN1A 4XOIA 4RIFA 1DHRA 1EBUA 1W48A 3VMMA 3HHEA 1BDBA 4KFCA 3C6ZA 3VHLB 3FPLA 3M7IA 1TTQB 3AY7A 3W9YA 2D2EA 1VL2A 5SZIA 3MJVA 3PF8A 1G9XA 5CXXA 3T5AA 2GI4A 3DMGA 4LHZA 2C99A 4D96A 2XDQB 3CLKA 1Q1QA 4EGCB 1PJZA 1RVDA 1Y3BE 2SKDA 1W47A 1EVEA 4FNMA 8ATCA 2GETA 5E6UA 3TLKA 3QKRB 2FRDA 1YJQA 2Z8ZA 3HZZA 4RMGA 2HEGA 4YHHB 4XE5A 3WWCA 3GJTA 1WVMA 1XU7A 1ZN2A 2PUVA 4EIWA 3KTAA 4BC0A 3F7TA 4L4UA 4XD7D 2HDNB 5C8YB 1UMCB 1XJ0A 4A8PA 2ONKA 1VJ0A 3E5MA 4LI0A 4XWGA 4ZXFA 1YCHA 1IPHA 4KUHA 5IHPA 3HEMA 2HHHB 1KI2A 4XIYA 1T6NA 4WZAE 2OAEA 3R7NA 3FVRA 1EFRA 1KJNA 3K09C 4DTCA 5I7UA 4EG0A 5CXSA 1YZUA 1UP4A 2D0DA 2BZSA 2I4IA 3O92A 5JFTA 3U7IA 4EQZA 1V35A 3O9MA 5DB4A 4Z2AA 4GX0A 2VSOA 3FDFA 3PA6A 5D6OA 1DG1G 3TQHA 4PCLA 2NADA 4D3ZA 3LPLA 4HMQA 4US2R 4ZYWA 1XDZA 4XSHA 4YJ2B 3A32A 3F9RA 3A2MA 5IFKA 3DE0X 1QZ3A 2PUFA 1E2DA 1NVWQ 2YIDA 2NXEA 4GNKA 4KAFA 5WRFA 3IJ5A 1U0TA 1X7XA 2PGOA 2HQ1A 2XT6A 3RVJA 2D62A 2JLVA 4TTJA 4R9UC 1BJKA 4KE9A 5AHXA 2PGDA 5D5PA 5EP1A 3EEOA 2GA9A 1UKYA 4I4TF 4WW0A 1IOWA 4A6EA 1JXOA 4I5GA 3OBBA 4I1SA 4UREA 5JECA 3LV8A 4OHFA 3E7WA 4MQEA 2CFSA 2G5CA 5DMXA 3M89A 2JFZA 5INTA 4CQNA 3ZI4A 3WGTA 5HXAA 1OZ0A 4QFDA 2G70A 1E1MA 1LPBB 1M7HA 1NSTA 1ZIDA 4IZHA 4KXWA 4MA4A 5FP0A 3AR2A 4CL0A 2FP4A 2N1MA 3AQIA 3IEMA 4B3SB 1KAGA 2BL4A 2JFQA 2REXB 3M6MD 1IJKA 1O58A 4HVCA 2FPXA 5L7WA 3V34A 2ZVJA 1GTG1 1ZOLA 4HXYA 1ZWKA 1T3TA 4BX9A 4P5DA 3TKAA 2X4DA 5GPBA 1NXSA 2WWTA 3Q7SA 1IQRA 1P73A 4LZPA 1RE0A 5D51S 3G8CA 1Q3KA 4AX4A 4HKTA 4M1WA 2HDOA 2QDKA 1T8TA 3HO8A 5AI6A 5LCXA 4ZHQB 2IS6A 3QXGA 3MMZA 1I4OA 1I7LA 1L5MA 3I5MA 5KTOA 1FDTA 2R1VB 2V0GA 3C2QA 1KBQA 2PAAA 1MZPA 1I3OA 3D64A 2FXIA 4C07A 1JALA 3OZCA 5AHKA 4P53A 4HXGA 3WL6A 4UCWA 1FBTA 4MAAA 4G8CA 4MQ5A 1T0BA 3GJ7A 3SAJA 4KUGA 4O4JA 3HPQA 2ZRIA 4W5NA 2UYYA 4TLCA 4NCJA 4B2IA 3KEMA 1JIVA 5IXYA 1PIWA 1GG2A 5U4QA 1LW7A 1JSZA 4NS1A 2X4IA 2R6GA 4E88A 1ZGZA 2HJGA 4JI0B 1ORHA 3GJQA 3HFJA 4N5NA 4Y0AA 2G72A 2WTNA 1J2UA 1J8FA 1Q0QA 3EJWA 1G38A 2HSGA 1AS3A 3NETA 5GINE 1NTOA 4MIYA 1F9AA 2ZUFA 3P2IA 3GRKA 4W5QA 1DAPA 2Y4NA 5DV9A 4TYYA 1P2TA 1I2CA 1ZCJA 2WM3A 2IF2A 2Y27A 4G09A 1J0DA 3A58B 1OTXA 4U2CA 2RGBA 2GRAA 5BV1A 4JCOA 3ETLA 1XWFA 3ZD6A 3PUVA 1PJ3A 3R6GA 1HQCA 1KK0A 1R6UA 2DCUA 4BCBA 3LMKA 2HI0A 3QUCA 2FZ4A 3BXPA 5CX4A 2YJTD 2GXQA 2BGMA 4G37A 4MCAA 3ZZ1A 1FVOA 3QIVA 5E4FA 2CV2A 1ES9A 1QFJA 2K2QB 4OLBA 1XRSB 1RYEA 2W6MA 4J1QA 1E59A 1EPUA 3ESYA 1RLMA 5KWEA 1SU4A 4E70A 4NBVA 5AKYA 2VF8A 4QTUB 4DRXB 4B6EA 4JBIA 3JALB 3R9KA 5KQMA 1YVRA 4LRWA 5EP4A 3V00A 5KYTA 1LTKA 1AJEA 1TGYA 2H18A 4X63A 2EEPA 3P9CA 3I45A 3X1XA 4BVJA 1VRVA 2AR7A 3WIOA 3G2HA 3USES 4LUCA 4B46A 1DWPA 3WLLA 1WMDA 4ZK6A 3QVXA 3RODA 2B36A 1JG1A 2NZJA 2VP3A 4E5SA 5AW1A 1DIRA 3MWDA 4PRLA 1MG0A 1X7YA 4JNCA 2W48A 2Q2VA 2CCKA 2PT5A 2YFKA 3CIFA 3G3EA 2VDNB 2R6ZA 3UQYS 3UWSA 4ENPA 2XNJA 3ZWMA 4QTZA 5ALUA 4EY4A 3WHPA 5GV8A 4F0JA 3LLMA 4TM8A 4V0MA 1Y1KE 4AROA 2COUA 1M10A 3ML1A 5HZMA 1R88A 3FB4A 3AB7A 3X3HA 4JVNA 3S2GA 1U8AA 3K4HA 4O2AA 3TJMA 1SUIA 4G97A 4GEKA 5HDQA 1Y3FE 2X0RA 4EKIA 2O3RA 1GOTA 1SQ0A 4B6JA 5LA6A 3K0AB 3STXA 4XASA 4RVDA 3QFHA 3K1AA 1PEKE 3KOYA 1BZYA 4GP6A 1Z16A 2IUEA 3D3QA 4FE7A 3GLRA 4RPLA 3RSZA 4A16A 2Q6VA 1RI5A 2DM6A 3BXHA 3GQBA 4IDNA 4QUHA 5B1HA 3TIGA 4E22A 1KTVA 1XXLA 3FTNA 3K9BA 2BI8A 5ENDA 4OAQA 5B55A 1Y4SA 4TTAA 2Z95A 3NWEA 5HFJA 3SHOA 2HLDA 4H3SA 1ZXXA 2ATIA 3HJBA 4AAYA 4G86A 1TB4A 3CPEA 4TLBA 2AQ8A 2W6ID 2HMAA 3MW8A 4B0OA 2YFQA 1PS0A 3QY9A 1G60A 1Z88A 1GQYA 1A0OA 1ULSA 2E87A 2WJPA 3ECAA 4UZFA 4ZCQA 1RJDA 1EG7A 5EZYB 1JJBA 3F6YA 3HPRA 4R83A 4C2BA 4FCCA 1JFRA 2FEKA 5B1DA 3R3WA 4E51A 1D3AA 4F3TA 2OV3A 2CHQA 5IFLA 4QYSA 1UZAA 3TQRA 1RRFA 3DM5A 5FTWA 1NUQA 2G9ZA 3CNBA 3SE0A 3P2JA 4LYAA 4ZO4A 1OFUX 2XOKA 4CMIB 3HL4A 1GNVA 1W85A 3H1PA 3O94A 4GSKA 3PWSA 4QT0A 4I2VA 4LMAA 1PRYA 2OYSA 4GOMD 4DLWA 5JSZB 1PT9A 2BH9A 3OE5A 3DDSA 4Q4JA 5KPDA 1GAWA 3FB1A 4D2IA 2RHCA 1K7EB 3BE8A 4W1QA 1SVIA 2FA9A 4LX8A 3A7DA 1JSLA 2OBYA 1QK4A 2W6ZA 2ZE7A 3S44A 4C14A 5AUOB 4MIOA 3UPTA 4G84A 4M1YA 1B8UA 1ZVJA 1NP3A 1KO1A 3ENZA 3R9XA 3L40A 2HV9A 5EP3A 2J7KA 5ALSA 4ZCIA 1VGQA 3FETA 3LZ6A 3DF9A 3QPCA 1RIIA 1BGWA 2P65A 1GGMA 4JC5A 2FPRA 4O2BB 4FLFA 1FU8A 2P68A 4BNGA 4HLQB 4RZUA 2YW9A 3UFXA 4DDHA 4YJDA 1BX1A 1TYEB 1RCTE 1V1RA 4RY2A 5DIZA 2CT8A 4WEQA 3AUSA 3F1LA 3LDGA 5IZCA 4Y9TA 4W9MC 4ILEA 2O7SA 3NHJA 5DGHA 4A2WA 4AZ3A 3OT5A 5H3CA 1SXJE 1T3ZA 1WMBA 4A91A 3LP5A 2AFIA 3AFOA 3UENA 4Q1EA 3DBLA 1L4KA 2HLPA 3GAMA 1G6KA 2P9FA 3V4VB 3ZEIA 3RTGA 1H6CA 3UMYA 3AIOA 1E5QA 1C81A 2OFXA 2PGJA 4K46A 5ESWA 4C2TA 1T9HA 1JE0A 3B1JA 3R7WA 5KKNB 1ZN8A 2JHGA 2FK7A 2Q1TA 1DRJA 2FX5A 1TUIA 1E92A 4YCSA 3CT4A 3FHOA 5TPZD 1ZD3A 3NHZA 1Q92A 1RTTA 2H5IA 1IQPA 2VG8A 5REQA 1L3BA 3F6CA 1A1SA 4QEDA 4OHWA 3RJZA 2AZ4A 4XEUA 2OAP1 3SXUB 3ZWNA 5KNBH 2UV8A 5DM60 2ASVA 1E6LA 2FFQA 3CZRA 3HCEA 3IRUA 4ZQIA 4E14A 2Q6KA 3H2HA 1JR6A 2IL1A 2YWCA 1AVTA 5ES4B 3O83A 3L1HA 3VR6A 4H6WA 1IY8A 1JJFA 1WMFA 4RXMA 3RVSA 1RBQA 3TQSA 1Y6FA 2QBYA 1SCUB 1TM5E 2PUHA 4CG0A 3EULA 3ESAA 3HMKA 2WV9A 3QPWA 4N9WA 1LB1B 2B69A 5ALZA 3BGSA 5E95A 3U7QB 4KR3A 4S2EA 3BWEA 1U7WA 2F6RA 1SUEA 2AK3A 3GVPA 2J3QA 1R4MB 1QMGA 2WTAA 2CMHA 1J2RA 1O95A 4R8MA 1AZSC 2AOTB 4X24A 2C3UA 3EXFA 3FF4A 3LY9A 5DX1A 1DO8A 2PZFA 3EZ7A 1G0NA 5AW2A 3ZVKA 3PUYA 3C3BA 2VAPA 1RWQA 4IHKA 1WPRA 1ZUNA 2C9CA 3R3HA 4RBNA 3WDSA 4EJMA 4PS0A 5AKEA 3AZOA 1WB5A 4UJ5A 5BVGA 2XT0A 3GLTA 1EJ2A 3W3AA 5T4HA 3F4BA 3ZK8A 1AMNA 5ALQA 1O08A 3EAGA 1JTFA 3R6DA 3A31A 4LMBA 3UXMA 4FK8A 3DA8A 2WABA 2JBWA 5BN5B 1G21B 2CVHA 1YHYA 3L4SO 1H05A 4DZTA 1V0JA 3KKMA 4F2WA 1GLVA 4YMVA 1FPQA 4HH0A 1HQKA 4K03A 4JBYA 3O8QA 1JWBB 2W6QA 1Z0DA 4NMHA 4YAWA 1J9ZA 1K97A 4FKZA 1SVLA 5GIPE 5ELLA 2E4XA 1QIJA 3FBGA 4U7GA 5DCYA 3BBLA 5ALFA 3ZCUA 3F6EX 1NG9A 1G66A 1FTGA 4PYOA 4I1RA 3UB2A 1NZDA 1KEEB 1AKRA 2JH9A 1OXVA 4L3WA 3LF2A 5KJFA 1KRWA 2ZM6B 3WWDA 3GF4A 2QF7A 2XWSA 1NF8A 1FVHA 4ENRA 2GZAA 4HDQB 1FDUA 2YZNA 4KXXA 4OA8A 1VMIA 5DTIA 3QJ5A 1OXUA 1VIVA 1KI6B 5F1KA 4CTMA 3ZWWA 4ZK2A 4Z6KA 5T5QA 4H1TA 1IM5A 5C4IA 3F47A 4GYJA 3PHLA 3Q12A 4M8NE 4QNMA 5JAHA 1Y1SA 3FYHA 4FYXA 3U0BA 4CJXA 1Z7GA 2AEEA 2PKXA 4K6OA 3CVXA 2L2QA 5LC1A 4JI8B 3M5PA 1AQLA 1E9BA 3VYRB 4BU1A 3A4VA 5C8YF 3I2IA 2JAPA 4IIEA 1CY8A 3B3FA 2VHZA 2WB4A 2OUIA 3ORRA 1YZHA 3DNMA 621PA 4E15A 4I46A 4EB6A 1S8OA 4R31A 4AKSA 4FGSA 3CVOA 4FFBB 4DG9A 1Z63A 1NBAA 1RWOA 1Q74A 1EUZA 3DZBA 4XRRA 1QYWA 3OMWA 3ZHBA 1Z0KA 4CEIB 5SICE 1GPWB 4AC9A 1X9GA 3A1DA 1MKYA 5KTYA 1PTJA 1JVNA 4XGRA 3WADA 5L6LB 1OLUA 2EBWA 1Q0ZA 3GFQA 2IYSA 3Q1LA 4PX2A 3CO0S 4F86A 3HBAA 1RXSA 2A9RA 2VDKB 4GM0A 4OBWA 4DB2A 2OAQ1 4R51A 1ILWA 3UCEA 3RG2A 2H00A 1NF2A 4TQGA 4N0QA 3GUHA 4D6XA 4E12A 4RTLA 1BQ4A 1VA4A 2PEZA 3CLSC 3D6MA 2RKWA 4TQUS 4UTZA 3NQ41 4L02A 2Y2VA 3CTMA 4QL3A 5DNAA 3PQ7A 3H2ZA 4AIRA 1LTHR 2JPDA 4JU9A 1KY3A 1BSVA 4CI0B 5BWNA 5H4GA 1X2BA 1LI5A 4TWIA 5J5CA 1MFZA 5J47A 4XD7A 3BGWA 2GS9A 4OIFA 1FA9A 1CETA 1HZZC 1M8JA 3PGXA 4W1PA 3V7FA 4B48A 5IWAB 4A2QA 2HBYA 4DA4A 1E4VA 1V7CA 2QV0A 3M1IA 4YI3A 5G4KA 1PZMA 1WY5A 3U44A 4NXMB 1BCSB 1HLDA 2CL0X 4DCUA 2E55A 4OQLA 4QRIA 3PU6A 1NLYA 3SIPA 2Q99A 1CR4A 4QELA 2WINI 3D6JA 3ZWCA 5FBKA 1QSGA 1Y6JA 3KLMX 1TTHA 3M6WA 5K4AA 1XHLA 3QEBZ 2O8BA 2LRHA 1UXHA 3EPHA 3LH5A 5E4JA 4G0UA 4CLRB 2OORA 1VLMA 4JX9A 3RVRA 3WYCA 4B75A 3BGVA 4HDMA 2O2SA 2Q3BA 1WTAA 3KPJA 2WNHA 2X6QA 4Y98A 3DBHA 1ZM9A 5DP1A 4FNGA 4A6DA 3ZW7A 2H52A 4MS4B 3O6VA 3O4IA 3HNPA 3UJNA 2EWWA 3ZNQA 3VDXA 1YU6A 3TLZA 2YWDA 3LX5A 2XYGA 1QHEA 5ECGC 1EG2A 4AVYA 1C8VB 3EEQA 3CS3A 2IIVA 1QS0B 4AB1A 2ZDQA 2BR5A 2ZJ2A 2QLFA 4I19A 3FZEA 3UXHA 3UJ3X 3N9IA 4K28A 1NVEA 2ZG6A 3BF7A 3DGFC 4M36A 3UG7A 1B42A 5DXFA 4U7WA 1UIMA 4HXFB 2BMVA 1RLUA 3NYRA 5B12A 1U7OA 3B36A 1HYGA 3CA8A 4WRRA 3BPSA 2QP3A 3IOCA 2YMPA 3INGA 3L7KA 3VV2A 4CM4A 3GGSA 1CZHA 2X5XA 4N47A 3ZHCA 4ER7A 3T3OA 5IBQA 1C2TA 1QZZA 4MS3B 3PYLA 3EDQA 4B3JA 1TEVA 2V8OA 4NECA 5B30A 2QQ0A 1IBRA 2VUIB 4DXDA 3IALA 1AKUA 1F8YA 2WIGA 1YULA 4K9LA 4MAMA 4ESOA 1UBEA 2G04A 1P80A 2GZRA 4RSRA 1OB5A 3SFTA 3K9HA 4X94A 1LJLA 4EA8A 3OPYA 1KYWA 5ENZA 5JZ9A 5K05A 5BW5A 1SZJG 5DYTA 3HDTA 2Q9AA 1KR5A 2HGSA 4LDPA 4PXYA 4DM3A 4FNAA 1ZW1A 3UWOA 2WHPB 3S99A 1DVRA 1SKYE 3VHRA 4F38A 3DO8A 1K1EA 1P60A 3SYMA 4OJMX 2ZAGA 2WPDA 2RG1A 2ETVA 3WGJA 1Q1GA 2WSSD 3OZVA 4ER6A 2PSDA 1JFFA 3C6XA 3I39X 4MV3A 4UTOA 3RC2A 2JH8A 1DXQA 3N39C 3OICA 1ABBA 2SBTA 1WXHA 1LJUA 1N8NA 1OFVA 1SCDA 1UZNA 1ID1A 2AOVA 5GOTA 4YRIA 1MW9X 1Q17A 3AF1A 4NZPA 2ZXUA 1XZHA 3GEBA 1YVEI 3KU1A 2OYRA 2REQA 1UXGA 4BLSA 4DCPA 1NDQA 3CUWA 5KIAA 1QV7A 3ABSB 1ODFA 1E96A 3H04A 1U3DA 2GJ8A 2ZQ5A 2ZRHA 1JEDA 5JY1A 1K3UB 2DC1A 2ZWVA 2A14A 4IWNA 1J8MF 1DX4A 2P30A 2Z8YM 1PHRA 2YWEA 3I0MA 2QVYX 1E8MA 1W88A 2ZRPA 4A0RA 3B5JA 5KO2A 4AIIA 1DQRA 2B8WA 4UAGA 3O8OA 3A05A 4RKEA 1L7PA 1MNAA 1PQYA 1NIJA 4FSXA 4G1UC 3GZTB 2VJAA 3BWBA 3PRJA 5JDCA 4RVNA 5FV4A 1SU8A 2V0CA 3J7TA 3ADKA 3OZFA 3LPAA 4D8TA 3UTCA 2GYWA 3FWYA 4X1YA 1TM1E 3UAOA 2BM9A 3PYXA 4RY8A 5EMKA 3WKAA 1HUQA 1W93A 1ENYA 4IIFA 4Q3EA 2D3WA 1FDOA 3BSFA 1T8YA 4K81B 1N6NA 1JFLA 1GPLA 2ICAA 4L4RA 1WXEA 3M4JA 4DNOA 1RWNA 2W11A 5AUQA 2VYFA 4BO5A 4P98A 2X9VA 5FUWA 4LZLA 5K3BA 2DWOA 4M1EA 2XOXA 3Q5DA 3A9CA 4OHOA 1Z2EA 1NBHA 4HWOA 1FB5A 5ALWA 2YC4C 2ZIVB 2X40A 3DAYA 4ZJUA 2ZGVA 4X66B 4NOKA 4Z4GA 1TJNA 1JDTA 1EP1B 5DDIP 3N58A 1CG6A 5CLLA 3K0FA 4ZREA 4FQ7A 4INJA 4QYIA 1IUKA 3E9ZA 4JOCA 1ZVMA 3DT9A 3RYFA 3KHTA 1DO0A 2CLMB 4MJ7A 2H29A 4ARBA 3AZQA 3WYNA 3C8UA 1JEQB 3EEBA 2WDPA 1EXNA 1DB3A 1ODIA 2B4QA 5HE8A 3WK7A 4GGOA 3FIJA 4OLHA 1QTRA 3RYIB 2HBQA 3S2UA 1QTQA 5EMJA 1RI4A 1RPAA 1XELA 4UBMA 4PIVA 3KV3O 2G9RA 3Q7EA 4NJMB 3OT1A 4D43A 4FW8A 5ADHA 4Z7JA 1Y8CA 1OFIA 1OXSC 3R0JA 5EZYF 3UY4A 3F9CA 1NQXA 3GZJA 1H8ED 1EFTA 2B4AA 1R18A 1WNFA 4B6FA 4EKNB 3S2ZA 5KTNA 1JBEA 4IXDA 1S9DA 2P3QA 2PGLA 4LYYA 4QPJC 4ZPJA 4BMZA 4D8XA 5JXIA 3FWHA 3GJ0A 4V0SA 4DT1B 4MRMA 4YRRA 5JH7A 1SHLA 2NX2A 3KJZA 1BA3A 1K7FB 4RDCA 1BEEA 1IK4A 2AG1A 2G5TA 1AQ6A 2Q4EA 3BHIA 4N0DA 4DJFC 4D0LB 3PKJA 1ML3A 5COBA 1K5PA 2R5NA 2VRNA 2Y1WA 4MICA 3EWAA 4EFMA 3T9DA 2QPOA 4ZIRB 1IN6A 2H7YA 2JGFA 3BFJA 3OQOA 2G28A 5JS1A 2AW5A 1PVDA 3OLZA 4PG7A 7GPBA 3QE2A 3JYOA 3K2IA 3VR5D 5J2UA 4B3RB 2FQXA 3RABA 5KYKA 3RSLA 1V3UA 2G9VA 4BNIA 5T8KC 5J58A 1PV2A 1CKEA 4WJKB 2ZUBA 2Z6UA 1V26A 3U2QA 5JR3A 4FI3F 4YC7A 4JLKA 4O2BF 3P9PA 4BEBA 3RBZA 2A5DA 3M9WA 2NMVA 2OHGA 5TPWA 3FAKA 1XGKA 2Z2YA 1QO7A 3F5SA 4JNKA 4CMKA 1MT3A 1QNFA 1OBOA 2A5FA 1RMTA 5HF8A 2EL7A 2HYIC 3WRWA 3X43A 2XH8A 5E0OA 2Y1OA 3KUUA 4R2JA 3OZXA 2HK8A 5DBEX 2OYCA 2V54A 1M2FA 4XDYA 3S7TA 4JXXA 3EZ9A 3E8XA 1EX6A 1T0IA 3INNA 3IQIX 5ERXA 4HN9A 5AXAA 3ZH2A 3QU2A 3ZHXA 4YYZA 1UXOA 1D03A 1V6SA 3AJDA 4IJ6A 2Q4DA 1NF3A 4N5MA 1N7JA 2R85A 4X93A 1NW5A 5BSUA 2C2XA 2JCBA 2QRVB 3RYHB 3QVLA 3T1VA 3V4RA 1J0XO 2O2IA 4LCEA 2YWGA 4FP9A 1L1FA 4ADSG 4B80A 1FDSA 5DIFA 1FMJA 2C5LA 3HDYA 4DJDC 5JQGF 1Z4OA 4JAVC 1O0BA 5AJHA 1W1UA 1YD7A 3BD8A 3SQDA 1YIOA 1MEEA 4LVNA 4QLAA 1P6QA 3DD1A 1M1NB 3EA0A 4C6TA 2Y66A 3BK1A 3DBIA 3NVMB 4HAOA 2X7JA 4PPGA 4CT0A 4OLAA 1NNUA 5ICGA 3OU6A 1U7DA 2HADA 5THXA 3KAPA 2A67A 3I5XA 1PFUA 2I62A 3PS9A 1JYSA 1S2NA 4PNHA 2IYWA 1F4VA 5HNKA 4D57A 1QP7A 3FPSA 5TY0A 2WYIA 4JI1B 3L06A 2PSHA 2VP4A 3ZJ4A 1YMVA 2BV3A 2Q1SA 1DKMA 1OMOA 4PC3A 1GA6A 2CMDA 3LCCA 4LXQA 3S81A 5JNLA 1PS8A 4E3ZA 1IB0A 3OP4A 4IWYA 1HYHA 3ZV7A 4NMMA 3G82C 5G40A 3MIZA 2IU4A 2HK7A 3N6XA 3R7LA 4WL0A 1UMDB 3I3OA 2A1IA 4XX0A 3D8BA 1QPZA 4E11A 2NQ2C 4FYYA 5DLYA 4EGJA 3KDSE 2FEOA 1MB2A 1PYOA 3AEKA 4R40A 2NZ2A 4K87A 1N2CA 4L8WB 5BRNA 3C3WA 3LM8A 1NUTA 4HQ6A 1PFYA 2Z3ZA 4X3OA 1MC1A 3DL2A 3H2YA 5CAEA 4O4JB 1PWXA 1RXYA 3RASA 5TJ9A 2VDLB 3GP5A 1NVTA 1QOZA 3KB6A 4LDAA 1EDBA 5DLPA 1GTSA 3G5UA 3UMMA 3RAFC 2E4VA 4LNUA 1QP4A 4MHOA 1Y7TA 1Z0IA 5F33A 5CLHA 1XZEA 1HDEA 4PAOA 1LLFA 1N8SA 2VJOA 3H11A 3WL3A 5TC4A 3UMSA 3I23A 2E89A 2P5TB 3FCOA 2OO5A 5AJTA 4FWTA 3F8TA 1E3SA 3NNNA 4RZ3A 3OZTA 4NKRA 3HA7A 2ZE5A 3P2YA 3QOWA 5IEJA 5KVAA 2GWHA 5BV8A 1RIFA 4KPUA 1X2EA 2UUCB 4UUQA 5LQAA 1Z5GA 3EIUA 5CA0A 3TQCA 4B83A 3RNLA 2C03A 3U7HB 2CJFA 2QA5A 3VPGA 2HWYA 5EG5A 1JHQA 1MRSA 3HTXA 1F6WA 1T10A 4DE5A 4Y9DA 1QV9A 4F97A 2NSDA 2VPQA 4BVBA 1C3OB 5JCPA 2OPHA 1SHKA 2QXUA 5BV2P 4XGQA 1CUIA 1XR3A 4PGAA 4ZODA 5CW2A 3WAGA 4RGYA 2HY7A 2ZI7A 4LECA 3U7RA 1AG9A 2VH2A 4MRPA 1HGXA 3ZY5A 2FFBA 2CHFA 3HU2A 2NVUB 4LF5B 4F84A 1QFMA 1LK0A 4F8EA 2M1XA 5L3SA 1HTTA 1MUUA 2GAFA 2ATEA 3IT3A 4YT2A 4NLLA 1OAOC 2QMZA 3DOUA 3CLRC 5AM4A 2FJ0A 2WWVD 2NO5A 3ZVRA 3LAWA 3C7DB 3K6JA 4WVLA 1N3LA 4KIJA 3GRPA 4N49A 2I3DA 1BE8A 2B4RO 4G0YA 3HRIA 4IOKA 4OM8A 3DZIA 3QPDA 4D8UA 1YRLA 2WJWA 3EMBA 3G0GA 3IP5A 4YTEA 3RROA 1IFXA 1HF3A 1MVOA 1UZMA 1FUUA 3QMWA 4K0KB 5B6IA 2QAGB 3D6NB 3OX3A 1VHDA 1FP7A 1I13A 3MWDB 4UOQA 4XARA 3G02A 4A1FA 1KS2A 2YWFA 3HYNA 3UTDA 1H1LB 3OIVA 3V80A 4Q7LA 1X7YB 3AY6A 1BS1A 4MO9A 3KZKA 4GECA 2NWQA 4KRXA 1KAQA 2WIDA 1XXHA 4E07A 3D4IA 2GPSA 4EVIA 4HVLA 2Z8XA 4D8WA 4JVSB 2ZJ3A 4W63A 1JP7A 1JHRA 4ZRMA 1TA4A 4N39A 2I3ZA 3VR1A 3K6KA 3AYXB 3PJRA 2B5VA 2Q1YA 4R69A 1NJFA 4JLWA 1SG6A 4BX2A 4ALIA 2BTEA 3FTEA 1M1UA 1VQ1A 2O5RA 2PUTA 4B4DA 2Y0EA 3JSXA 3ZR4B 2JKYA 4N3CA 1CSEE 1JHXA 2VL7A 4LJSA 5LA6B 3ZBUA 5KCZA 4DF3A 1P0IA 2AKEA 1R3UA 3GOHA 1BROA 4H18A 5ICMA 5JPDA 4CKCA 2XEDA 5BSKA 5F77A 2R6AA 3IVGA 3DVAA 2HU7A 3CSUA 2HXSA 3GQBB 4HWRA 4ZVLA 1V3TA 4P4SB 4Y2GA 1V8DA 4ZJYA 3EXIA 5DWQA 1CJKC 3B38A 3DDCA 5FBHA 4D4MA 1PUXA 2LW7A 3QE0A 3ZBQA 4DCCA 4ER3A 1NM5C 1B6RA 2QRMA 4EO4A 2XXJA 1NPDA 1SPXA 2WJ3A 1IMJA 2WFAA 1AHHA 5LWHA 4F8JA 2Q50A 5C7YA 2DSNA 1Q20A 3IBCA 4MVJD 3T7JA 1SULA 4QBIA 3WSVA 4QOGA 4BVEA 1XLTA 3H83A 3Q6IA 1F2TB 1XQVA 2CZGA 4PLFA 1PZXA 1T9DA 1BHJA 3OX4A 1JHMA 4Z4HA 2PLAA 1GPYA 3G7SA 1KMMA 1OKKA 3TYXA 1UP7A 3KJIA 1GSOA 1W85B 2CF5A 1O96A 1VL6A 1E62A 2BDEA 2QTBA 1X14A 2GKSA 4KO8A 1WWKA 3M5CA 4OP2A 4E1BA 4FFDA 2ZIFA 3GDGA 3SC2B 3ZIUA 5EQDA 3RK0A 5JAPA 4HATA 1ST2A 1ISFA 4Z1MD 1E3JA 2JJ8A 3GJYA 4LJLA 4FEYA 5C8VA 1EVZA 2QZ9A 4RDHA 5MN4A 3Q11A 1IN7A 4J76A 1QLHA 2PIDA 2AZMA 2VQ3A 3F7NA 1YB4A 2VFAA 3ROPA 5BQOA 1S1MA 4Q21A 4ZU6X 4I2NA 1AHNA 1D2NA 2Q27A 1K8RA 1BQ3A 1PJAA 1EK5A 4YJ3B 3C5HA 3IEXA 3ILSA 2J33A 3GT7A 3TD6A 3NHLA 5L3QA 4UNSA 2Y1KA 4DCNA 1KNQA 1AKTA 3DGEC 3LX8A 3RJ5A 1EHYA 1IIBA 1NXPA 1XMSA 4KNWA 1ZJJA 1LRLA 2FW7A 1GPH1 3BICA 1H6BA 4Q93A 1C1YA 4RPIA 5DLQC 2INGX 4PWYA 5FBZA 2C4UA 3IP7A 4AZWA 1U1IA 3EQ6A 2FN3A 4QOJA 4RZXA 3TX6A 3WYAA 3OEHA 3GUVA 2P4UA 2C8LA 3AR8A 1U81A 4G5GA 2GAAA 3BWMA 3MGBA 4BJ6A 1W0KA 2L0XA 3RFTA 3IIMA 2OEPA 4OK5A 4BZQA 4CIVA 4NE7A 5EGSA 5GZ1A 4KVZA 1VE5A 3LQQA 5LOVF 4GICA 2ODNA 5L6MB 1RW4A 2I2AA 2OSBA 4PG5A 1Y1LA 3FTQA 1QONA 3SY8A 3V46A 5KTKA 2WSSA 3BMNB 3AY0A 4DCSA 4IQ4A 3UQZA 3NVKI 1OJLA 5HGJA 3NWOA 2WPNA 1OGYA 2EQ5A 2P3SA 3GWZA 4IS2A 2HBRA 1VL0A 2Z09A 5AKGA 4DLKA 5BR8B 1RPZA 2CNLA 2PTHA 4MUJA 4NX2A 1EM6A 5FD8A 3L92A 4LWOA 4UM5A 4PNPA 3FGPA 4I5FA 3WZLA 5CVVA 4GOXA 1C80A 5JCZA 2WD7B 5LVAA 1IOZA 1GQSA 1VHJA 3I37X 4RJJA 3UHAA 5JEDA 1DBRA 3Q87B 1Y7PA 2RIRA 4Q4HA 3PGLA 2TMGA 4HNHA 2VJYA 4R54A 5DMHA 3FMIA 1Z17A 2AZTA 4BAUA 4CN8A 4QVIA 4R2HA 3CR8A 3GFFA 5I7VA 2C7QA 2FPPB 1J70A 3DTNA 1RM3A 1ZXBA 3K1YA 3LXXA 3PVSA 4D99A 2OE2A 2J3IA 3C97A 4M2LA 1M0TA 5ISMA 1QKKA 1P72A 1ZIYA 4N6NA 1TT7A 4AM8A 3EISA 1M8FA 5CFMA 2WLTA 3CN9A 4XJVA 5SYNA 3JWEA 1XE3A 4DSOA 4GXQA 1ZLXA 1DAOA 3FVVA 4GBED 5HVNA 1AHPA 2R68A 1I1QB 1NU8A 3PL5A 4QICA 5ICCA 1SOMA 1IJFA 4URVR 3IV6A 1E3IA 4LGCA 4YRGA 2JEZA 5DI3A 1FJ2A 1P9WA 3PA8A 1QLJA 5EXDA 1AO3A 5LP6A 2OCBA 3A28A 3O8QB 3S0JA 1YUBA 4UMDA 3HNRA 2YDXA 2ZWOA 4WN9B 3B51X 2AE1A 3N0RA 4PBSA 3M5WA 2XF2A 4WK4B 1ZJ4A 3R3UA 1CJUC 3JQFC 3L7MA 3WMGA 4LN1A 4BO2A 1RJ9A 1U65A 5LYJA 4G4IA 1AA9A 2YMLA 5FWDA 3VSAA 3Q2OA 3RUHA 5JVDB 1QHHA 1G59A 1IBKB 1A04A 4DC1A 4F9TA 1DEOA 1J24A 3ACDA 3HJGA 3HUUA 4JUFA 4W9NA 3KZCA 1NT4A 2HA6A 1OD6A 2QLBA 3PQ5A 3U6BA 4I4CA 4UBJA 4D74A 2PKRA 1QYDA 3CCFA 2CD7A 3GROA 3S8MA 3RWOA 3UJPA 2JATA 4ARSA 4DBLC 5DM2A 1P31A 5B2FA 2DAPA 5JS7A 2PUCA 4C7MA 4PZEA 4CHGA 2WICA 3T3PB 2RJNA 3IVXA 4OJQA