4RSGA

Neutron crystal structure of ras bound to the gtp analogue gppnhp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
166
structure length
162
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords GTPase HRas
publication title Neutron Crystal Structure of RAS GTPase Puts in Question the Protonation State of the GTP gamma-Phosphate.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 162
sequence length 166
ec nomenclature
pdb deposition date 2014-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rsgA00
4OHWA 4QHYA 4BASA 2QZ4A 4D4LA 2J0QA 1C1YA 4A6PA 4OQFA 1NVXQ 4US2R 2QG6A 2VP2A 1LS6A 3D7MA 2J59A 3KTAB 1AJEA 3W3AA 3RAPR 5KSOA 1IY2A 1SVMA 3C14C 1Q57A 4Q1AA 3LQQA 1E2NA 4JBWA 3I3SR 4D80A 4E5UA 4LPSA 1BMFA 4DCTA 2GJAA 2ZUDA 3H84A 1WB9A 1P3JA 1G8PA 2WSSD 1N6KA 1T3LA 1W4CA 1WDTA 2EFDB 1N6OA 1ZU5A 4UXHA 3ND9A 1XRJA 2SHKA 1MO4A 1FP6A 2EFCB 4M0LA 2O8DB 4Q47A 3VQTA 4BZXA 1JPJA 4LV6A 1OPXA 4GL2A 1CLUA 1M8PA 1UEJA 3WP0A 3VNVA 1G19A 1JR6A 4IW3B 3VR5A 5JZVA 1XWIA 3MAAC 2ODNA 5JI3E 1A5TA 1YR7A 3ECCA 1GKYA 1US8A 4MKFA 1G6OA 2QE7A 5KDDA 1CP2A 2OSBA 4JBYA 1FQKA 1Z6GA 2MSDB 4KFRA 4KFTA 4MKHA 1KO1A 4PR0A 4UJ3A 1GVNB 3KTAA 1ZD9A 3DOEA 4P31A 1E1RA 1YRAA 2FA9A 2Z43A 2ZSDA 1GTVA 4ITRC 5AJYA 3KQUA 2R6FA 3AF4A 3MJHA 1K5GA 2DR3A 3W5JA 2PX0A 1Z8FA 1F2TB 2B8TA 1G5TA 4FMBB 4JL8A 1QRAA 4DLSA 4BWYA 2ZQ5A 1XTKA 4DIEA 5AJVB 1CRQA 2DCUA 2GEDA 2IXFA 4DB2A 1TQDA 1DADA 3LDAA 3UPUA 2OBMA 2Z83A 4PZYA 2B7CA 3CUEF 3SE0A 2PT5A 5FPHA 5TMPA 1M2OB 3MD0A 4M1SA 4PQRA 4B3DA 4EQ6B 2QPOA 1I4DD 2ZRNA 4LX0A 4CW7A 4TLCA 4ZPXA 3KKPA 3WBKA 1E2PA 1RVDA 4KV9A 4LK2A 1COWA 4Q19A 2EWWA 1CS4C 4B3GA 1W2GA 1N6NA 4D26A 3GFPA 2EQBA 2R6DA 1K5DA 2FPLA 4MGZR 5BYKA 2NOAA 2CDNA 2P5SA 3CIOA 2GJKA 2EWVA 5FBRB 2RGNA 5LD2C 3ZH9B 4WW0A 1E9CA 1G6HA 4JSYA 3T1VA 5J5CA 4QOSA 3B13B 1XCPA 2BJWA 2H57A 4NBSA 3CZPA 2VO1A 2Q9CA 4QXAA 1XP8A 4B75A 1U81A 2JDID 1E32A 1PLJA 2A5YB 1HQCA 4TSFD 1GNQA 2PZEA 2HF8A 2HCJB 2IUUA 3PITA 4HLCA 4MRNA 3QKUA 4Q9KA 3RC8A 4LJ5A 2YZ2A 3B1ZA 4EQ6A 2OHFA 3RSOA 3NG1A 1TNDA 3BFXA 5TDHA 3BORA 3A1WA 3CR8A 3L8YA 1GSIA 4QJ3A 1S3SA 3V4RA 1HV8A 2WWFA 4J0QA 1WXQA 5B58C 4HUQA 1DAIA 2IYUA 4M9QA 2GAOA 4QBFA 5EE9A 1TU3A 1EFCA 221PA 4KU4A 4DRZA 2V4ZA 4MITA 1GL9B 4FCVA 2X19A 4O25A 2CK3A 4O0MA 4Q5IA 2JEOA 4QNRA 2OG2A 2EFGA 4DDUA 3U6BA 1IXSB 5CJPA 1L4YA 2BMEA 4AURA 1R8SA 2UZIR 4DB4A 2QPAA 3QIAA 3EX7C 1R5NA 3LXXA 2IYYA 4F38A 2Z4SA 4L9WA 1ZNZA 3MWYW 4P33A 2ZXUA 1W4AA 5EP1A 2WBLC 1W7AA 4KBGA 2IS1A 3OIWA 4HZUA 4P32A 1OIXA 2GHIA 3D3QA 4LBYA 1Q3TA 1GG2A 2CCGA 5HCNA 3UKDA 3P4YA 1E99A 2Q3HA 3W6NA 2IW3A 3NDBB 1AS0A 4XOIA 3BAFA 4H1VA 4KFUA 4LCBA 3I61A 3X1XA 3EPLA 4Q4JB 4LJYA 4W5WA 3BOSA 4MKGA 4IJMA 3SHWA 5HCIA 5TY0A 2OT3B 3SEAA 3D6TB 2J0UA 3OZXA 3Q3JB 1A2BA 2V8OA 1Z29A 4DWJA 3RRYA 2FSFA 4O2LA 2ZSFA 4Q02A 4B3FX 1XJ0A 2YWHA 1CJMA 4JLNA 4Q9LA 3TK1A 4G5QA 1MO5A 1XZPA 5AJXA 1D8TA 4MH0R 1YE8A 1YZTA 3AUYA 1XF9A 1Z0KA 2OCPA 3TQCA 2IS6A 3CPHA 1UM8A 5DLQC 5F2EA 2IXEA 2ZJ2A 4F4CA 4HZIA 4A0HA 2ZR7A 1QZXA 2IYXA 3D31A 5EXTA 5JFGA 3EASA 2KSQA 4KCGA 2O8BB 3T5GA 1X3SA 3EWSA 1PLLA 2O8FB 1RJ9A 1SGWA 1YKSA 4PAQA 4Q9IA 2QBYB 2WJJA 1UADA 2JLRA 1T3SA 4RZ3A 521PA 2WSSA 2ZJAA 3HJNA 4LHVA 2QSYA 1NI3A 1PV4A 2FSHA 1Z83A 1IN4A 3SYLA 1CULC 3UANA 3U3JA 5LPNA 2KJQA 3ZD7A 3PUZA 5IDVA 2NQ2C 1G5PA 1U9IC 3ETLA 2JLWA 4NL4H 4AC9A 1ZNWA 1ZM2A 1P61B 1MKYA 2GXQA 2A5GA 4YONB 2FZ4A 4Q1CA 3KZ1E 4M1TA 2IYWA 3BB3A 4JYCA 3ND8A 3FFAA 1E2MA 1SXJB 3NDPA 4LBZA 1UKVY 3GFTA 1JEDA 1T4GA 1FZQA 1XBTA 2HEIA 4KSBA 5K8LA 2YNMA 5L3QB 1S96A 4WA7A 1J2JA 3PENA 2O8FA 2WV9A 2QBYA 1RYHA 3IO3A 2W6JD 1N5KA 3DMDA 3TUZC 3KFVA 2ATXA 3GFOA 1NMXA 2OV2A 3K0AB 5EUMA 2DYKA 4KVAA 3AP2A 1OFIA 2G1KA 4DLZA 1ZW6A 1HA3A 4HLDA 1Q44A 1L7VC 2EYQA 2XAUA 4TMXA 4M1WA 1RIFA 1GAJA 3NC0C 3QF4B 1XXHE 1DG1G 3M0EA 1OIWA 4LJ4A 3EZFA 3A4MA 3TKLA 1PVOA 3UG7A 1VTKA 1AQUA 1DAGA 4IEIA 3NBFA 1D2EA 4OQNA 3GJ0A 1FUUA 4A2QA 4Q00A 4RD1A 1G4UR 5FPKA 3DM9B 2WOJA 2IS2A 2DWQA 5E95A 4X8OA 1HUQA 2HT6A 5HPYB 1NNEA 2B6HA 2NO6A 2VP6A 2QAGB 2AKAB 1SKYE 1J8YF 1GP2A 1X8LA 1XMVA 3D8BA 3TJZA 1MO6A 5L3QA 4Q4AB 2CL6X 2QQ0A 3CF2A 2IYTA 1J7KA 1OV4A 2ZUCA 1D6JA 3K0EA 3RSLA 2NO9A 3LLMA 3O8BA 2FPMA 1D9ZA 1OKKD 2EU8A 2JDIA 2QGZA 3KDSE 3PIRA 3ZZUA 4JYBA 1OXXK 4TSFA 3BGWA 4PC7A 4NU0A 5CDFA 1KO4A 2W2VA 2IEYA 3UG6A 1G20E 2O0JA 4WIAA 2WPDD 2FMXA 2DBYA 1YJ5A 3FMOB 3C4JA 4LY6A 4G5GA 4JBXA 3PQCA 2GZDA 1DG3A 5C46F 1NY5A 4JL5A 1G1MA 4PFSA 3X1ZA 2XOKD 3LVRE 3QKTA 3CX8A 3ZYCA 2R9VA 1ZVQA 1UKYA 3T35A 2VP9A 2QAGA 1XCMA 4OI2A 5G40A 2V54A 1N3BA 2BIFA 3ZS8A 2QM8A 3LNCA 3A36A 4H1UA 4ARZA 1C9KA 2GWHA 2IUTA 2ZRDA 4BFZA 4B3BA 4L4UA 1NL3A 3CZQA 1CJUC 3T1QA 3WMFA 1E0SA 2QMUA 4L5BA 1CXZA 3HP1A 3AV0B 3K8YA 4O2RA 3B5JA 4WZ6A 4ZKEA 2IYLD 4JS0A 4YLGA 1Z63A 1AGPA 1FL9A 5SZKB 5L8VA 5HZHA 3TQFA 1U2RA 2E1RA 5FH9A 3PR1A 4LBVA 2FGJA 2IL1A 4IRUB 1E2QA 2R6AA 4LV5B 5GADl 3PUYA 4RCZA 2CJWA 2ZJZA 2ERXA 1GDDA 3FE2A 4JLOA 1UBCA 5KSPA 2BCGY 1II8B 3EARA 4QJ5A 4A15A 1AZTA 5JJKA 1AN0A 3X1YA 3VR4A 2ZANA 4B3XA 1P75A 4DLTA 2AD5A 2RGBA 2CLCX 4UQOA 5GJBA 4IDQA 5IF9A 4M53A 3TAHA 4GNKA 3UMSA 2BBTA 4C0LA 1OT3A 4QG7A 2PLFA 3IHWA 5CB6A 4GSYA 4NCHA 1NVUQ 3M1IA 5AJZA 1PLKA 3W9YA 4D4KA 3L82B 1G7SA 5DSZA 3N2EA 2GAAA 2QMHA 1NKTA 2YHSA 3MWLA 3N5CA 4OK6A 1J90A 4DEYA 2FEOA 3U3RA 3BJIC 2PCLA 1ZNYA 3EC2A 4PC1A 3QXCA 1S8FA 2G9NA 421PA 1GRNA 1SHZA 4EPTA 2F1RA 2VYFA 1OXUA 1V43A 1FOEB 2C77A 3GLGE 3H1TA 5BN4A 3MFYA 1CF4A 1II8A 2G88A 3ADDA 4QHTA 3EZ6A 2Q3FA 2F1JA 4LZZA 5B64A 4PXAA 4ZV4A 4WZAE 4TMKA 3U3MA 5JCZA 1U98A 1J8MF 5J47A 4TYPA 3TW8B 4GOJA 4TLBA 1TU4A 5HR5A 1W0JD 5C2JB 1VDZA 2JGNA 4Q4HB 1P60A 3KX2A 4HAVA 1WCV1 5FBWB 4DHEA 1P5ZB 3IEVA 2D3WA 3PEYA 4JJZA 5BQ5A 1YR9A 3CBQA 3TSOA 3LH5A 2ZJYA 4DCNA 4M1MA 1IXZA 3GP8A 2JLVA 1VCIA 2ZRJA 2RGEA 2ZRBA 5TARA 4A8JC 2ZTSA 3RWOA 3ASZA 3IIMA 5KHOC 3RS7A 2RGGA 5EUQB 2AL7A 2IK8A 3RS0A 1R10A 2JLUA 2VPPA 4F4JA 5CITA 4EJSB 1LW7A 1U8ZA 2AR7A 5BW8A 4D81A 1KI2A 1LS1A 2VSXA 3REFA 2J87A 4JLJA 5JECA 2REOA 4RZXA 1G41A 2LWIA 1DVRA 1CR4A 3VR1A 2FE4A 2W6JA 1VMAA 2BWJA 2B8WA 1Q20A 2UKDA 3BRWD 4GP7A 3QSYA 3QKSA 2FFQA 2ONKA 3T1OA 2DFNA 2ZRMA 3PEWA 1D5CA 1ZRHA 3I32A 3PG5A 3TE6A 5JWRA 3QXHA 2WKPA 3HWSA 3ZIAD 2WVJA 3KXIA 1G4AE 1X86B 2GDJA 1E3MA 1E4YA 2I1VB 5HKKD 2X2EA 3BERA 1QVAA 3GEEA 1WF3A 1RW4A 4M22A 3DVLA 2J5XA 4A1FA 1NN1A 3UIEA 2WSMA 4HB0A 5FUXA 3O8RA 1KNXA 1QHSA 5A5GA 1WP9A 2C99A 3AF0A 2VEDA 2ZR0A 3BWDD 4TL9A 3EG5A 4MUBA 1D9XA 4TZ6A 2D7CA 3ADCA 4JLPA 1G291 2CHQA 1TL7C 3PEVA 2VQSA 3RS2A 4XWKA 3KUDA 3KXKA 3AP3A 2WKQA 3NVAA 1J70A 4Z51A 1OKKA 1CRPA 2B92A 5BXQC 3E70C 2EVWX 4D25A 1JJVA 4TL6A 5CK4A 1ZUHA 1MRNA 5UKDA 3LLUA 4PQFA 2PL3A 4KI0A 3E2IA 4YDHB 3SJAA 1LF0A 2IYVA 1KIMA 2WPDA 3DZDA 3EIHA 3W8RA 3QKRB 4C9BA 3RNLA 2QRZA 1DO2A 4LYAA 1YZLA 1NN3A 1IY0A 1JPNA 2XOKA 3B7GA 2CE7A 2XTNA 3CNNA 1NVVQ 4LGMA 5EP2A 1TAGA 3FHTA 4ESVA 5FOWA 4YMSA 5LB2A 3W8NA 2GCOA 4FMCB 4HLUA 4K46A 4EUNA 2JLSA 1OYWA 5DISB 2C96A 4R2HA 4JIMA 3IPYA 1SVSA 1ZCAA 2W2TA 5CJ2A 4O3MA 2G0NA 4IOMA 1IN8A 3IDQA 3SBEA 4HB4A 1YRBA 4TT3D 3GEHA 4KODA 1KI6A 3LV8A 4FMCF 1TQ4A 3RWMB 4RSGA 3KQKA 2IUSA 2WICA 4CVNA 2QM7A 4TYNA 3QKRA 5B2ZA 4KYUA 3THOA 4URXR 1MR3F 1UKZA 2DFKB 1E2HA 2Q3MA 2WJVA 2OFOA 5TB5A 2YOHA 3K0CC 3WYAA 1DTSA 1NMYA 3WY9A 2P5TB 1XD2B 1YVDA 3L0IB 2CEAA 4ACBA 3SOPA 3X1DA 2ZYUX 1G3RA 5JS8A 3GJXC 5EE3A 4TMVA 1XX6A 5CLQA 2NG1A 1ZMXA 4YQFA 1I2DA 1T0HB 1TEVA 2YYZA 1HY3A 4IOJA 5G3YA 2CNWD 2WWHA 4GDFA 1FPMA 1G8HA 1N6IA 4A0RA 3KKQA 4OI1A 1ZIPA 3WP1B 4RFVA 1P9RA 4QKQA 1XMIA 5FUWA 5GVSA 5JWOA 4IFEA 1W4BA 1AGRA 4AI6A 2XXAA 4YMWA 2NGRA 4OKSA 3SU8A 1ZM4A 2PX3A 1R7RA 4XTRA 3TGPA 2F1IA 3VX3A 3LBIA 3TIFA 3GCGA 2HCBA 1IN7A 1EFUA 2EYUA 3CF0A 3B85A 3AM1A 3FMPB 3QXJA 3W3ZB 1OYYA 3KL4A 3VR3A 5LB4A 1E2LA 1AK2A 1XD2A 4PO8A 1MABB 2A2ZA 2ZSBA 4JVLA 3I8XA 3NHBA 4D0LB 1NLYA 1SKQA 5EE0A 4IDNA 2Z4RA 3LX8A 5IHPA 1RC8A 1G18A 4ZDKA 3VFDA 1FTNA 2ORIA 3WXMA 4C0AC 1S0UA 2GCNA 4DT1B 2ZVPX 3CKLA 3MUFA 1SVLA 3GJ3A 3CX6A 4ZCLA 3LRPA 1US8B 3FKSD 4D82A 1G21E 1JQLB 3G0HA 4TYYA 4BGDA 2QUZA 5FUVA 2RHDA 1U0JA 4P4TA 1KMHA 1P4SA 3LBNA 3NXSA 3AGPA 3OAAD 3AKYA 1Q22A 1S9DA 3VKGA 1GOTA 1T91A 3SJCA 4BLSA 4BZPA 1ZBDA 2G83A 3B6EA 1OLOA 2OAP1 2PJRA 3R7WA 4G5SA 1SQ5A 2OCYC 3KJGA 4HDQB 4DIDA 1MABA 2VHQA 4LV8B 1HTWA 3HDTA 3ZD6A 1NKSA 2WJGA 3HYTA 1EESA 3CRRA 2P6RA 3EPHA 5KPDA 1GRQA 3HU2A 1YQTA 4FWTA 2GCPA 1M7BA 1W49A 1IXRC 1QBKC 2GNOA 2PH1A 3B9QA 1HE8B 3K0FA 5KO2A 1NIPA 4M8NE 1GM5A 2QL6A 1KK3A 4HATA 4DSOA 4KLNA 4DT1A 4BPBA 3KQLA 1UKEA 1AKYA 3K1JA 5EP4A 3HU3A 1R0ZA 4C30A 1GL6A 2QAJA 4CYMA 3T61A 3NC1C 4A6XA 4B47A 5JI2E 3ZIAA 3U7HB 5HKKA 1TQ2A 2ZUBA 1QHYA 1W4RA 3MRSA 4ILEA 2QGNA 3MWKA 2XB4A 5D3MA 1XXHB 4Z1MD 1F5NA 4AG5A 2A9KA 2L0XA 2XNDD 4FCTA 1U8AA 3K09C 3GLHE 4JT2A 4NYIQ 5E4FA 2HXSA 1NY6A 2GBLC 2KBEA 3L2OB 3PXGA 4BFWA 4Q9JA 4A0FA 2ZAMA 4NCKA 1Z2CA 5DI3B 3GLIE 2IS4A 3KQHA 2Q0HA 2OBLA 2PZGA 2G1JA 2JIZD 5FOVA 1D2MA 3R9IA 4YMTA 2R62A 1PUJA 2ZRIA 1EFRD 4RCYA 2YOFA 4ZKDA 4URUR 5G41A 1SKYB 2A5FA 4UXIA 4PC3A 4EPXA 3R9XA 1R4AA 1NMZA 1IOZA 2ZRPA 1F2UB 1N5LA 1R2QA 3B2EA 1DS6A 2N1BA 3RC3A 5K8TA 3J81k 2JLXA 2JA1A 3F0TA 4MYHA 3FVQA 2XEXA 4QGAA 4Q7LA 4HUQB 4V0NA 5F3WB 3L0OA 5CIQA 1WRBA 2P3SA 4AKHA 3GJ6A 4DDTA 4Q1DA 3PUVA 1XXHA 4I1OA 1ZU4A 3K9HA 4FIDA 4BEJA 4M9ZA 1CJVC 4B48A 2BMJA 2WZQA 2ZS7A 3SI7A 3ZGXA 3TBKA 3RRZA 5DI3A 2IYZA 3NH9A 1W5TA 2JJ8A 3QY0A 3NBXX 1OXTA 3ZZTA 4WXRA 1UDWA 1FMJA 1KSHA 3E1SA 4HZUB 5CM8B 1E4VA 4HYYA 2IT1A 3B1YA 4C4PA 3SFVA 1OFHA 1F2UA 5JRJA 4TT3A 2J46A 2ZREA 1YZGA 4EPWA 2IF0A 3M4YA 3AVPA 1RPZA 2XJ4A 3HU1A 2MSEB 3VU9B 2R65A 4PQYA 3UXMA 1Z47A 1OFUX 2GJSA 3CH5A 3QG1A 4HI0E 4OHYA 4QM6A 1G3IA 1JB1A 3Q7QA 3MG9A 1KI7A 2G3YA 4KBFA 2C5LA 1OFTA 2WWXA 5FOUA 1E0AA 2J0UB 1DPFA 1QG2A 2FWRA 2VA8A 1E0KA 2ZRHA 3NEYA 4IKEA 3LD9A 1IN6A 1KI8A 4P3YA 5FPTA 2O8CB 1U8YA 2VP4A 3OF5A 3SHFA 4ZDJA 1N25A 3NH6A 2FOLA 2XX3A 3QF7A 3QPVA 2ZYWX 4V0ME 2CNWA 2GXSA 4UKDA 3DPUA 3AVQA 4Q1FA 5F98A 3UK6A 1Z5ZA 1MO3A 1Z0DA 2XZPA 3B78A 1E2DA 4CEIB 2AN9A 4C0JA 1P9NA 2W0SA 3CRMA 3NTUA 3LA6A 2DPXA 2OCBA 4XWAA 1YR6A 2F9MA 4TMZA 2F43B 5BWMA 3GJ7A 1SXJC 2ZS9A 3VU9A 2HT1A 2WM9B 3AP1A 1WMSA 1OE0A 2ORWA 1RJ9B 3W34A 1MH1A 1EX7A 3RVBA 3AVUA 3OESA 4G3XA 1AA9A 2ZSAA 1AQYA 4JVSB 1F6BA 4JLMA 3VNUA 2W0MA 1QDEA 5FPSA 3X1WA 2PEZA 4WXPA 2G77B 3QE0A 4XD7D 5EP3A 4EAQA 3GLGB 4EPYA 2QP4A 3H2YA 4A92A 2O0HA 2CVFA 2BM1A 5FOSA 1RE0A 1C4OA 1S1CA 5GJVC 4BFXA 2BMFA 4EFMA 4KITB 1KTVA 1KI4A 4BUJA 2CE2X 2CXXA 1GRRA 3GD7A 1PZNA 4BZQA 4C0BA 3FKSA 4IVQA 5AR1A 1E9AA 4PSKA 4CEIA 2ERYA 4PC6A 4HB2A 4TZ0A 4US1R 3AH8A 2F43A 1G64A 3JVUA 1QHHB 3OAAA 1HT1E 2QQEA 5DGXA 2BDTA 3E5HA 5FTNA 1NBME 3F3YA 3RS3A 4B2IA 4CEJA 2RGDA 4CEHB 3K9NA 4PSAA 1L4UA 4NHOA 3LFUA 1XEWX 2ZRFA 1G17A 2ASEA 1K6MA 3HPRA 4PZZA 1N2CE 3KB1A 3K9GA 2P2LA 1KI3A 3AUXA 2W6ID 4NDZA 2FPKA 1R8QA 4UXJA 1EG7A 4HAUA 3R20A 3GLGA 2X1VA 4DSTA 3Q5EA 3ZVLA 4FCWA 4L9SA 2OEPA 1UF9A 2ZE5A 4HAYA 4RD0A 3U3OA 1KY2A 5E7JA 3DO6A 2D4HA 1KAGA 4GZLA 1JJ7A 3IHLA 4URYR 1FQJA 1NP6A 1G9XA 2VSFA 5DN6D 1Z07A 1VYVA 5C4MA 5KPJA 3AKCA 1QHHA 1IQPA 3A4NA 2YOGA 1Z0AA 3U60B 1VPLA 2WIAA 4Z1MA 1T9HA 2XNDA 1KK1A 3FPAA 2D7DA 4CEHA 1GKIA 1NSFA 2IWHA 5AUQA 1E2GA 3RRMA 4F93B 1H8HD 2C8VA 3A8TA 4U7DA 8OHMA 2BV3A 2OFWA 3KKOA 3WRXC 2IYSA 2EW1A 1KZ7B 1UBGA 2D2EA 2ZI9A 4JMPA 1PUIA 4MRPA 2JIZA 3KJHA 1NN5A 4Z8XA 4OBEA 4R9UC 1EFRA 4NCIA 1QF9A 4PO9A 2ZU6A 3ADBA 4DLXA 3THYB 4B43A 1XZQA 4QL3A 4A2WA 4ERNA 4PX9A 1R0XA 1SVKA 4ZCMA 5M04A 1AKEA 3Q9LA 3S1AB 3FYHA 1A4RA 4P4UA 2KWIA 5EJEA 3LQRA 1CR0A 2ANCA 4F4IA 4TMTA 1ZUIA 1IJEA 1HYQA 1NG1A 2C9CA 1AS2A 1II9A 5H68A 3F5FA 4F92B 1KSGA 2B7BA 4ARZB 2Y8EA 5FBLB 3H4MA 1ZD1A 2BM0A 2NPIA 4TTPA 5AK0A 2LKCA 2FJUA 2HYIC 2JASA 2WWWA 3GEIA 4JSTA 5J4LA 4ON9A 4PHTA 3PUWA 2FNAA 1FW6A 3AGQA 1VHLA 1DARA 2HLDD 1NG9A 2OXRA 2GXUA 4LHYA 4DC9A 1G7CA 1VHTA 3THYA 2DY1A 2ZEJA 4ZDWA 1TF2A 2CJWB 2ZIAA 2HXYA 2OM2A 1N6RA 2PCJA 2QI9C 4BE7B 3S1AA 3B9PA 3WNDA 2DFLA 4IFBA 1R6BX 3X2SA 4IDHA 2YWFA 1ONBA 5H1YA 1JEEA 2C03A 1IAQA 1Z0IA 3CO5A 2FEMA 4ZI2A 1GUAA 1LV7A 1P62B 1QHNA 4NPHA 4AKIA 1II0A 4NMMA 3NWJA 3CWQA 2FH5B 1G5RA 1Q21A 3BH0A 3VAAA 2BCJQ 2W00A 3SBDA 1BOFA 1UBFA 1N6LA 4LJAA 4LOAA 3FTQA 5L3VA 1OSNA 3K53A 1G8YA 3I1FA 4YMVA 4B73A 4OHXA 1EK0A 4F91B 1IHUA 4U5XA 5FFMA 4V0KA 5KDOA 2VSOA 1Q1QA 3K9LA 4RJLA 1SHKA 2C2HA 1E2FA 3AVOA 2YVUA 4C0SA 2NO0A 3U7GA 1Z6TA 5EE5B 3SS8A 2IYRA 1XTJA 4GZMA 2BKEA 1LTQA 3IPXA 3SJBA 2ZI5A 5JJIA 1CR2A 1OJLA 2VTKA 4EJSC 4LJ7A 4WBSA 5JBQA 1Z6YA 2MMCA 4QFMA 2IC5A 2UZ3A 5H70A 5CYOA 2O5VA 1U9IA 1XD9A 1P9WA 3MGCA 4MGKR 4KHZA 3SYKA 621PA 5F9HA 1VIYA 5CYPA 2AWNA 1G16A 2KBFA 1O87A 1M1YE 2RHMA 2ZRCA 1Z08A 3FFBA 4I4LA 1XNJA 2GEUA 4XD7A 5KU1A 4LYFA 4DLWA 2O52A 4B6EA 1JNYA 4A4DA 1DE0A 4C0HA 4C0KA 1JAIA 5AUPB 3NKVA 4WOPA 1GITA 4QC2A 1N0WA 1KDPA 4V0OA 1ZUNB 1IJFA 1KSJA 3IIJA 4H9GA 4EKDA 4OL0A 1Q3HA 3IGFA 1I4TD 3MWJA 3QENA 2QT0A 3RDPA 2J7PD 4RD2A 2C04A 2FSGA 5C18A 2GTPA 2AKYA 1JAHA 1W36C 4D6PA 4IOLA 1Q1ZA 3Q7PA 1UDXA 3L43A 3QPWA 1RZ3A 1XJQA 2OFXA 3P27A 4MRSA 1TUIA 2WWYA 3UMFA 2GETA 4PZLA 3QKSB 4Q21A 4W5HA 5FPYA 2D2FA 1GIAA 1TF5A 2W6IA 2OESA 3A6PC 1L2TA 1P2TA 4D0GA 1NRJB 4KLZA 3KJIA 3VTKA 1XU4A 1VIAA 4FN5A 5FOTA 4Q01A 2LCFA 3IBGA 3EIQA 4OI0A 3K70C 3R8FA 3ONWA 1AIPA 4OK3A 1E69A 1VCMA 1W5SA 2ZJBA 3PVSA 2ZJ8A 4HB3A 1T5IA 5FL3A 3OEHD 3EIEA 4BRUA 2VP0A 4CT5A 4PPFA 2XGJA 4UNQA 3AF1A 1W0KD 3PJRA 3OEED 1FX0A 1QHXA 2Z0MA 1CTQA 2R2AA 3LWNA 4BRWA 1F60A 3T5DA 4E03A 1TQ6A 2OBNA 1AM4D 4XIGS 4AYTA 5KNBA 1H8HA 3BXZA 4UNPA 6Q21A 3U3KA 2RGXA 1FNNA 2PEYA 3QVUA 4OK5A 3SN6A 1KYIA 1NBMD 4X8HA 4AK9A 1BIFA 4HEJA 3ZVMA 2CHVA 3GLHB 4XSHA 2ZE6A 1B0UA 1OH7A 1Z6AA 1M6NA 1ZM7A 5DH9A 1LFDB 2ZPTX 4B3CA 3GLIB 1VG0B 3P32A 2HYDA 1ZINA 1OF1A 4JLKA 5HTKA 4HLQB 5EXXA 1SXJE 4N0DA 5K8IA 1G7TA 4DXAA 3BH7A 1CBUA 3GJ8A 4MGIR 2GCOB 1EGAA 2HJGA 2VLIA 5EZ5A 3FWYA 2R6CA 4M2LA 1E9DA 5H8WA 5C1BA 5CM9C 1WBBA 1ZJ6A 4TL7A 4TYQA 5J4YA 3THWA 4NP6A 2I4IA 2D62A 2QT1A 1JXMA 1YZQA 1Q0UA 2X77A 1FNMA 4LJ8A 1T6NA 1ESMA 2OAQ1 5KSZA 1Z2AA 4G01B 4EFLA 1KI6B 5JRZA 5JHGB 3B8HA 1ZM3A 3P1JA 5DHAA 2HLDA 4LPKA 2HJVA 3GLHA 4G1UC 1NF3A 4NYJQ 2YC2C 4R2IA 1KO8A 4DKXA 3ZQJA 2WIBA 5IRCD 1PJRA 2F7SA 2GZHA 2MSCB 5FL7D 1R5OA 3GLIA 1M34E 2FV8A 4JLVA 4TLEA 2XTMA 3SNHA 4LUCA 4WAUA 4DJTA 3WNBA 4B44A 3RS5A 1VYUA 3ADKA 3RYTC 2ORVA 1U0HC 1OH8A 4TTQA 3KB2A 5HZKA 1P72A 2QENA 3A1SA 3U7EB 3QOFA 4QGGA 3SJZA 821PA 1MV5A 3AEZA 4A8JB 2F1HA 2KI5A 4NYMQ 1DOAA 3DZ8A 5DO9A 3KJEA 1ZC3A 5BYJA 5E3HA 4BFVA 4I1SA 4C0QC 1R5BA 1U94A 1CJTC 4URZR 2AHOA 4RD4A 5G3ZA 2XXAB 5DYIA 3I5XA 3CB4A 3KKMA 4Q7MB 3P20A 2BBWA 4DSUA 1B23P 3JZMA 2A3RA 1G8FA 1TEXA 2OLJA 3AVWA 4YMUA 4AYXA 1AZSC 3T06B 2NZJA 4WVFA 2BKUA 4RKEA 2V55B 1YZKA 2F3RA 3OE7D 3DM5A 3AVXA 2O8EA 2ZRLA 1KDTA 3WMEA 4OJKA 3SR0A 3WNCA 5AUOB 3QEJA 4A8JA 1P73A 4PHGA 2FU5C 1KKMA 1CJKC 1RRCA 2OILA 1MT0A 1R0WA 4G5OA 3ZS9A 2OO7A 3EA0A 4XVRA 1KI9A 1FFHA 1UAAA 1NSTA 2GKSA 4QJ4A 4Q4LA 5FTLA 1VKJA 3EW9A 4Q1BA 3CW2A 1E9SA 1WQ1R 5KDLA 1Y63A 1KMHB 2QMOA 2YWGA 2A5DA 3QI2A 4E07A 2GESA 1E2KA 1WE2A 2ZE8A 5A0FA 5J4VA 3R8CA 3T1TA 3BC1A 3REGA 2ZR9A 1A7JA 3R7WB 1T8TA 2PLRA 4V0MA 1QHGA 2GJ9A 2VHJA 2CHGA 3VR6A 2J7PA 1SULA 1E94E 1I4LD 1Z22A 4EPVA 1H8ED 1MOZA 1XMJA 3QG5A 4CF7A 1KO7A 3MJRA 1KJYA 2RB4A 3K0FB 2FFAA 1IM2A 2OUKA 1W0JA 4FINA 3DDCA 3WYGA 2JCSA 2LKDA 4E09A 2JJ1D 2Q9BA 3CLVA 4LHXA 4TTRA 1EXMA 3VKHA 2ZRAA 4S2EA 4W5JA 2JJ2D 1VG9B 2I1QA 1DEKA 1X1RA 2H92A 4UNSA 4QBHA 2BVNA 5FUYA 3B1XA 5J40A 1E2IA 4AWXA 4PTLA 4RD6A 1X6VA 3AF2A 2P67A 4AG6A 2QRNA 4Q1EA 5D3MB 2FFBA 1ETUA 2BC9A 2GEVA 2OCAA 1E98A 2ZU0C 2JLZA 3GLFE 3OEHA 4MGYR 1K8RA 4ZI3A 5FI1B 1DAKA 4JJKA 3WRYC 4W7SA 4Y0VA 2ANBA 1NJGA 1TX4B 2V7QD 1U0LA 1W0KA 2D74A 4TL8A 3OEEA 1JR3E 3TR5A 2GK7A 5FBVB 2ZROA 3ICQB 3SYNA 5EZ6B 2CVHA 4LYJA 4HAXA 2QP3A 4KSCA 2Q21A 2QU8A 2WAYA 2PMDA 1NBMA 2H7VA 4D2IA 4XTCS 4DLVA 3ZLJA 2RMKA 2FFHA 2R44A 4LC1A 4LYHA 1N6HA 2XZOA 3T34A 1KK2A 1VG1A 4TN1A 3BE4A 4DDWA 3I92A 2QP9X 2ODEA 5SZJA 5L3SB 2DWPA 4RY2A 3LVQE 2GJ8A 4K81B 3CM0A 1DELA 2FGKA 2HV8A 3AVTA 2QTHA 3C8UA 2Q9AA 2AX4A 2QTVB 1KDRA 4YC7A 2ONJA 1XPOA 1XDBA 2KB0A 4AY2A 5G53C 4F7WA 4Q66C 4GOKA 2WKRA 4DCVA 4EPRA 1T0JB 2FDCA 5JWHA 4B35A 2AFIE 3TUIC 3FKQA 4YDSA 4TYWA 3K0CA 1X8KA 1D2NA 2ZITA 1F3OA 3RLFA 4M1OA 2CLDX 4B2LA 2IBMA 3HYRA 3KUCA 4XWOA 4GRAA 5E7IA 4C2UA 2AXPA 2R8RA 2FSIA 3NHAA 1Q1BA 2FF7A 2WJYA 1G3UA 3TLXA 3LW8A 5EE1A 2W2XA 1KMQA 2Z6VA 3C41J 5FL7A 2O8DA 5L3SA 2GF0A 1RYFA 4OI4A 3TVDA 5JJLA 3V00A 2V1XA 3CWZA 1VCNA 2IYQA 4S35A 2ZS8A 1UEIA 1UPTA 2VF7A 1WBDA 2ODWA 4OQLA 2WWGA 4B71A 3VHLB 3PCRB 2AD1A 4WZBE 3Q5DA 5KOYA 4JKYA 3AVVA 5E7MA 1SXJD 1N5JA 2IXGA 2ZSEA 4U02A 4IHQA 3ZZ0A 3IILA 1ESNA 1OB2A 4UJ5A 2XSZD 3T12A 3GQBA 1EFTA 4JLBA 3FOZA 1F2TA 1HH4A 1XJCA 1Z28A 2RCNA 2W83A 3CNOA 5CLLA 5FI0B 4LHZA 2DWOA 1RRFA 4PPNA 2N46A 1UJ2A 4V0LA 3GJ4A 1BS1A 4QNMA 5D3QA 1SVIA 3BIFA 4DBLC 1DAFA 4LJ6A 5ANRB 2VIIA 3CX7A 4BECA 2AFHE 3BBPA 1EX6A 1M7HA 3QPUA 3EXAA 5GJCA 4L15A 3OE7A 3NEJA 3TUJC 1S1MA 3HR7A 5B57C 4V03A 3FMFA 3ZQ6A 1W46A 2B21A 3A4LA 4KAXA 4LDJA 3BS4A 5FR2A 3EAQA 2BMDA 4ZO4A 3TH5A 4E22A 2OZEA 4MYCA 5AJWA 4QRHA 4IDPA 1ZAKA 3ICEA 3Q72A 2Z5FA 2JATA 3LAWA 3O8DA 4B33A 1KI1A 1N0UA 4IEEA 4A9AA 4PHFA 4OHZA 1XEWY 2QROA 1LY1A 2QORA 2ZVQX 4G0NA 5K8UA 1RRPA 3CH4B 3U2QA 4LBWA 4PSVA 5FOXA 4CEJB 1XTSA 3P26A 4R71A 4TWZA 3Q8XB 3IO5A 1N5IA 3IBYA 4B76A 2N42A 2JLQA 1H8EA 2ZRKA 4URWR 3TVTA 1SVWA 1VG8A 2AXNA 5LDDC 3TRFA 3QJYA 1NN0A 1XB2A 1Z3IX 3BB1A 1KO5A 4XH9B 5DI9A 4Z8YA 3HPQA 5LD2B 4ABYA 2A78A 2XNSA 2JJ1A 4NONA 3CRVA 5ELXA 3K09A 3O47A 1KY3A 1EWRA 2GBLA 2VP5A 1JQJC 2JJ2A 3C7KA 5JS7A 3DKVA 5EXSA 2RGAA 2WAXA 2G6BA 4TQUS 5JLJA 4OHVA 4BLRA 1M7GA 4I1VA 4KFSA 2QAGC 3PEUA 4R7ZA 4BEBA 4IXMA 3I8SA 1E6CA 1I2MA 1RRGA 3DHWC 3AKEA 4IDOA 2JAQA 3DL0A 4DUGD 4ZDIA 1GILA 2VH5R 3QXXA 4Q18A 1XMSA 5DYGA 3RANA 2VL7A 4OQXA 2DB3A 1KK0A 1TADA 1HT2E 1IN5A 2AK2A 2A5JA 2O8CA 2V7QA 3CF6R 1L8QA 3U5ZB 3IQXA 4QBIA 4HDOB 4NKRA 1E79D 4EDHA 4GT1A 2NIPA 1P7CA 1GL7A 2J41A 3QQ5A 1E9RA 1GFIA 4NYJR 3UMRA 3U44B 4GP6A 4Q4JA 1DAHA 2BOVA 3LO5A 4QHSA 4OYHA 3WHLA 3FHOA 1VECA 3WMGA 2J1LA 1ZC4A 1E2JA 2YJTD 4GBMA 1NVVR 5KYKA 1OXVA 4B34A 3U4QB 1S9HA 4LSGA 4MA4A 1IY1A 2QNRA 3OHMA 4RKFA 3THXB 3MMPA 5EXPA 4KJZA 2KE5A 3BD9A 2MMGA 5SZHB 5L3RA 1VYTA 4NYMR 1GKUB 2UVQA 1ZM9A 3F8TA 4YXWD 3QNUA 2BBSA 2DHRA 4JT4A 1E9BA 3NIBA 4TQAA 2ECKA 3UATA 2WJHA 1NVWQ 4RFSB 3CRQA 2VRWA 4AD8A 4DZZA 5KNDA 4CRWB 2ZI3A 2HUPA 3O8CA 3FMIA 2CL7X 1XTIA 2O8BA 3U44A 2FG5A 3AKDA 3W90A 4CDGA 3UWOA 2VHTA 1TMKA 3JVVA 1HQYE 3RHFA 4RD3A 4TQ9A 4D4JA 3IUYA 1JR3D 1DAEA 2AK3A 2C78A 1NLFA 3OFND 4BLOA 4EIWA 3U6KA 2YINC 2NTYC 3SFZA 3U4QA 5C4GB 3CPEA 2ZE7A 3N2IA 4M1YA 5FTJA 1XTQA 2ZETA 4EFNA 3THXA 5TXGA 2H5EA 3GPLA 3FHCB 1QVRA 1U90A 4Q03A 2WWIA 4AYWA 3EA5A 4JL6A 3TNFA 1DAMA 3MSXA 5EQTA 4KVGA 1KJWA 4MDEA 1CR1A 2NZ8A 4X8LA 1N0VC 4RFSA 4FI3C 3EC1A 2J3EA 2K5UA 4JVMA 1ZYUA 3QBTA 1SXJA 4BFYA 1OW3B 2P0EA 2NO7A 3I72A 2VHUA 1XEXB 1UFQA 2VF8A 2YWEA 3VX4A 5IT5A 2IF2A 5JCPA 1HEIA 2XSZA 4BLQA 1KDOA 2IHBA 4PPGA 3WYFA 4D4MA 3PFIA 3BFVA 2FN4A 4BFSA 4DVGA 5F9FA 1GZSA 1H65A 3ZVRA 1XCGB 4D0NA 3K0AA 4I1UA 2WOOA 4DLYA 1EWQA 2H17A 4MRRA 3A1UA 2HF9A 4R98A 5IK2D 2J0SA 4L8GA 3CONA 2ZI7A 3QF4A 3N70A 4G5RA 2H8KA 2F3TA 3TSZA 4AKEA 2P6NA 3M6AA 4MQBA 1T3HA 1T8UA 3CNLA 5FBQB 3P4XA 3RS4A 4JKIA 4Q7KA 1YZUA 1Z6XA 1Z0FA 1S2MA 2CCKA 4M1KA 2QTFA 2QMEA 3GMTA 4C3ZA 1M74A 1OH6A 2ZM5A 1J99A 1E96A 3C15C 2XB2A 4DLUA 1W36D 1ODFA 1QHIA 2GILA 1XEXA 4BFTA 3OIVA 1JALA 4Q4AA 4HDCA 1U99A 4A0GA 5B30A 2A7QA 4N1AA 2E87A 3BFKA 1FP7A 4ASUD 4URVR 2C9OA 3QBVA 1KJZA 1E9FA 1A2KC 4A2PA 1Q12A 4FW9A 3CRW1 1OHHD 4FXPA 2CLSA 2IEZA 3OIUA 1OXSC 3EPJA 2XJ9A 3K70D 2WMNB 3A1TA 5DHFA 2OLKA 4PAOA 5KUTA 2QSZA 1KZGB 1W1WA 4ACAA 2WMOB 1Z0JA 4PANA 1BH2A 1E1QD 5AUNB 3R9WA 1JBKA 5LBIA 2F55A 3LW7A 4UNRA 4M4SA 1FUKA 1OIVA 2AWOA 1LNZA 1TPZA 1TF7A 5CB8A 3IKJA 5TV2A 2GXAA 4PAMA 3U7FB 2VBCA 2ZYTX 3H0KA 3L0PA 4LRWA 3ZDQA 4GPTA 1KNQA 4TMWA 4CT4B 3C5HA 5JMTA 4DEXA 1GNRA 2V3CC 2V6JA 4P4SB 3OIYA 5DNYB 1GWNA 4NYIR 4X8MA 3L0SA 3B1WA 2V1UA 2VHCA 2GZAA 5A4JA 3TMKA 3AVYA 3C5CA 3LBHA 1BYUA 2I3BA 3VKWA 2NMVA 2RAPA 4XVQA 4HLUC 1Y3AA 3A37A 1CKEA 1FX0B 2C9YA 2EFHB 4PC2A 1OB5A 4DSNA 1T5LA 4KXFB 2YKGA 2O0KA 1LVGA 4DUGA 1JXOA 4BLTA 2BEJA 5TVKA 2YV5A 3FDIA 4KO8A 1E2EA 2OE2A 3DMNA 1SVOA 4HUTA 3EWAA 1KHTA 2WHXA 2X2FA 2ZI6A 3QEOA 1O3YA 5J4HA 2GF9A 2XZLA 1E79A 4OQMA 3GLFB 2WTUA 2R6GA 1HE1C 1HURA 1E0JA 3VHXA 1CEEA 1AS3A 5SZIA 1ZCBA 2C95A 2J0VA 3ASYA 3CR7A 3G82C 4RZUA 4P4SA 5DIFA 5J4KA 4U00A 4II7A 4NH0A 4DCSA 2H1LA 1YHNA 3V4FA 3TAUA 4PHHA 5DN6A 4US0R 1P6XA 2QEQA 4W9MC 3FGNA 4LHWA 4ZIRB 3A1VA 1G7RA 1QG4A 1SZPA 3CPJB 3TSWA 3BK7A 4JLDA 1GNPA 4N0EA 4CZ2A 2XTZA 2W58A 3THWB 1DO0A 3WHKA 4Q48A 4P0TA 4V02A 4Q9HA 4YXWA 2QPTA 2BHRA 2P65A 4NCJA 4MDFA 1BMFD 1G3MA 2WJIA 4JLAA 3C16C 2RKOA 4A82A 1X8JA 1CIPA 1ZD8A 2ZJ5A 2EFEB 4LWZA 4KYIB 1KKLA 1IONA 3RRNA 2PMKA 2BEKA 2IX3A 2CMKA 4MYUA 3GLFA 1YU9A 4BFUA 4HAZA 3I5YA 2J7KA 3B82A 3L8ZA 2ZRGA 2C98A 5JEDA 2E9SA 5KNCA 1FTSA 1JECA 2NO1A 2ODBA 1JR3A 3OFNA 3W6OA 4C7OB 4Q4HA 4FWIB 2Q6TA 4TLDA 5BN5A 3PUXA 2JLYA 4L16A 5KSYA 4ZIRA 4BLPA 1W44A 2GA8A 2QE7D 1ELOA 3H86A 4PO1A 5CIWA 3NBYC 3I73A 4XJXA 1DBSA 3UWKA 4RVCA 1E1RD 4NZYA 5DE3A 2RH5A 4GMXA 2IHYA 2J45A 1XD8A 2X8AA 3IQWA 3MCAA 5CDFE 3SZRA 1UBEA 1WA5A 5P21A 1KAOA 1S3GA 3AQ4A 1X1SA 3TR0A 4EJSA 1ZP6A 2H18A 3KXLA 2A30A 3HR8A 3LY5A 5HE9A 4NTZA 1W36B 1V5WA 1NJFA 2FZLA 4GFDA 2H16A 4RZ2A 2TMKA 2QN6A 3QUSA 4LJ9A 3DKPA 2GVZC 4MYTA 1Z06A 1LF5A 4DLRA 4Z54A 3KKNA 4HAWA 4MRVA 3B60A 3ZVNA 5FTKA 2REBA 1NIJA 4Y0AA 4C7OA 4C2TA 1XEFA 2ZAOA 2O8EB 4TLAA 2QA5A 3IIKA 4XVUA 5IK2A 1COWD 3BH6A 1F48A 4POAA 3RABA 3W6PA 4NCNA 1BO6A 1LB1B 2GRJA 4UNNA 3SC3A 4M21A 4OJQA 1VCOA 2IWRA 5GVRA 3K70B 1FMLA 1R0YA 4XSGA 2F6RA 1W2HA 3EZ2A 4B6FA 3JZAA 4N3NA 2OXCA 3I4LA 4GMDA 5HE8A 4M9XA 4CGZA 3TW4A 2PT7A 5FR1A 3V9PA 4JVNA 5BN3A 3QVVA 2REXB 1JI0A 4IOKA 4I99A 1KOFA 4HSEA 4K8OA 3QXSA 2XITA 4ESHA 1W47A 2NPFA 1G3QA 3AF3A 1IBRA 2RGCA 3B1VA 4ASUA 4GOXA 2HDNB 5CK5A 2IA5A 3Q85A 4B74A 1RFLA 2CBZA 1Q1EA 721PA 5KTYA 4A36A 1XFAA 1OHHA 2J9RA 4M9SA 4CIDA 2BBOA 3NBZC 4BQSA 3PV0A 2PZFA 3BB4A 3FB4A 4IVRA 1P2UA 2D06A 4PPQA 3LXRA 1G8GA 1P2VA 4LC0A 3G5UA 2ZJOA 2CK3D 4ZCIA 3VR2A 1A1VA 3EZ7A 5GJWC 3IEUA 1E1QA 1ANKA 3GJ5A 4MUAA 4Q7JB 1BKDR 2V9PA 2CL0X 121PA 4QGHA 3WBJA 4B2PA 3MLEA 4DDVA 2CCJA 4IVPA 2BJVA 3W5IA 3SQWA 2RGNC 4QM7A 1TUEA 2F9LA 4DCUA 2YC4C 1XTRA 2FX3A 2P6UA 3ZJYA 3SQXA 3T15A 5JSZB 3A58B 1NLZA 2DFTA 2G0TA 4FMDB 4JZKA 3KQNA 3KFXA 1N6PA 1XPUA 3DEFA 1MRSA 1P2SA 1YR8A 4IXNA 4AIIA 5FTMA 5AWFC 3I62A 2PBRA 3EPKA 1YZNA 4GI7A 3EZ9A 1KSFX 1S4QA 4LI0A 1E9EA 4B32A 2V6IA 3U61B 4I81A 4AKGA 4FMDF 4QGFA 3K0SA 5JEEA 1OH5A 3LX5A 3SDZA 1ZIOA 1W48A 4FD2A 1BYIA 1EFHA 2GK6A 2ATVA 1TTTA 3DOFA 1KGDA 2PJZA 2ZYVX 4NE2A 4QBGB 2GVDC 2QY9A 1A82A 3AB3A 1RKBA 4MKIA 5JHHB 3VMFA 1CU1A 1ZNXA 1XPRA 2ZI4A 5JSZA
chains in the Genus database with same CATH superfamily
3T4UA 2VJKA 2QZ4A 1KAEA 1OX4B 3PVZA 4Q12A 5BWBA 1U3DA 2HPVA 3RVBA 4F7DA 5K51A 4CV1A 4OQFA 3H3JA 4US2R 1OXBB 2H11A 3MUEA 3ICVA 1X7GA 3AU9A 3WGZA 3GUCA 4L28A 1I3OA 2FEKA 2J59A 1AJEA 3W3AA 4JAVC 3UGJA 3RAPR 1SVMA 4MMZB 2MT9A 2X9VA 4Q1AA 5A9TA 3DWEX 1KYTA 4JBWA 4LRXA 3BXGA 1BMFA 4LPSA 3QFFA 1WB9A 1P5JA 1QWOA 1T3LA 1Q16A 2Q5QA 1WDTA 2X86A 4GW3A 3OZDA 1N6OA 2R8YA 4HMPA 3UV6A 1CUSA 4RIEA 3ND9A 1K75A 1RWBA 1XRJA 5EHXA 2O5CA 2PL1A 2WJPA 3RYFA 2B61A 2EFCB 5BY2A 2I6QA 1EP2B 1OPXA 2TSYB 3RIYA 2C2MA 1FSSA 1JDBC 1G19A 2O2JA 2UVPB 2Y4OA 1JR6A 4IW3B 3VR5A 4AXXA 3UC9A 1XWIA 1UWLA 4NH4A 1PEYA 3AM5A 3MT9A 1YR7A 4JGBA 2QW0X 1BN6A 3ECCA 3P9SA 1F5SA 1G6OA 1EWVA 2B99A 5KDDA 5DCLA 1CP2A 2OSBA 1Z5GA 4MVJI 5L4LA 1VE7A 3PC8C 3I2KA 3DAOA 2A1TR 5MDHA 2C31A 2Y71A 1XPRA 3DOEA 2EW2A 1MEOA 3NBKA 3ZJUA 2ZSDA 1GTVA 2R87A 3PC4A 5HIMA 1K66A 1K9VF 1K5GA 2DR3A 1DRVA 3NJ4A 1MGPA 2PX0A 4DZRA 4AJPA 1SCIA 1PGJA 2B8TA 2JI4A 2K2QB 2NV2B 3U56A 2P4UA 4FHEA 4FMBB 3ESBA 1Q17A 2VYCA 3AESB 3HWX1 4D9GA 2Z4TA 1EVIA 3O7MA 3PICA 4UUBA 4WKNA 2WYVA 3WQHA 3STYA 1ZWLA 2IXFA 4XB1A 1DADA 3LDAA 2X0DA 3UZUA 3UPUA 4IUDS 1C3JA 3LLSA 4MPPA 4OGKA 5CEJA 1M2NA 1V45E 4JU8A 3SE0A 2GVNA 3T8YA 2PT5A 3TD2A 1OWLA 3GRAA 5EN4A 3MD0A 5JXIA 4ZYTA 1D8AA 1I4DD 2WU1A 1XQWA 5ALNA 4D9EA 4CW7A 2I8LA 4MLPA 4ZPXA 1RVDA 1T1SA 4KV9A 2C4TA 4L22A 1H3EA 1C41A 1W2GA 4Z7JA 4TS1A 1W1IA 3K2QA 4RV4A 3TZ6A 2HSGA 2RH8A 1UPBA 2ZTVA 1PQ4A 1JDZA 1KVQA 4MGZR 1A9QA 2NOAA 2ALJA 2P5SA 3VYTB 3WWDA 5B6IA 1PZEA 2O1WA 1VE1A 4BP8A 5LD2C 1TA4A 4WW0A 2NNLD 4MKXA 2P6OA 3HJCA 3KM0A 4JSYA 5ESRA 2X3UA 1NLUA 3C8HA 1CY8A 1XCPA 3BE8A 4RL4A 1ZVKA 2VTEA 3GPBA 4UCWA 2FTKE 3OQIA 2HU2A 4NBSA 1H1LB 1N4AA 4BFCA 3S29A 3ZHCA 2Q9CA 1SU4A 4QOIA 2FFJA 3AESA 1ILWA 2CXTA 2NUTB 3H16A 4EL5A 2I4MA 2OXEA 3R3HA 4DLNA 4ZVTA 1PLJA 4EJFA 4G1EB 4R7GA 2PMCA 2PZEA 5JD5A 5IM4A 1RI2A 4EGFA 3KHKA 1MHTA 5K05A 3SHOA 4J2TA 4MRNA 1HDCA 3QKUA 1KQNA 5EKXA 2V7VA 3HJUA 3VV2A 1VB3A 1V9CA 2H3EA 3NG1A 2J5QA 5BSWA 1CD5A 1WXHA 2YS7A 3L8YA 3OQBA 3UGQA 2A6PA 4P38A 5AMXA 3RIEA 1GSIA 2BMVA 3GRUA 1S3SA 4RA9B 1PG2A 2WWFA 4J0QA 1WXQA 4ZYVA 4HUQA 2V0NA 2BEWA 1L7XA 4FBMA 3GZ4A 4M9QA 5FO1A 4KU4A 1NXOA 3JQAB 1B74A 4R2LA 1BX1A 2WP0A 3BXPA 1RCFA 2PR2A 3ZHUA 1VB5A 3F46A 4Q5IA 3PA6A 5BPFA 3R0JA 5A4IS 5JSHA 3BWYA 3G0CA 5EZYB 1IXSB 1H1LA 4RUKA 2Z6QA 3SIXA 4EBBA 1CZKA 3OE1A 4BMNA 1EP3B 3NYWA 2NUTA 3WRYA 4AURA 2Q0QA 3HKEB 4NCAA 3I5MA 3PGLA 1U2ZA 1JB9A 1FDRA 2ETXA 2RH9B 1LJLA 1UBLS 3I45A 4JC0A 3S2GA 4MV3A 1QQ5A 5CW1A 3L40A 2CFRA 2I7VA 1CK4A 3EFHA 3K92A 3UUGA 2X7JA 2NM0A 3OCCA 3WLLA 4L27A 4EK9A 2IS1A 3OIWA 4HZUA 2WW8A 5COQA 4HDSA 2W4MA 2H6EA 2PSFA 4QOEA 3D3QA 4LBYA 5LCXA 4RIIA 3UKDA 1AQJA 2J3QA 1E99A 4N6NA 2Q3HA 2B2CA 2Y0EA 3U39A 3NDBB 4OKNA 4FK8A 2UZ0A 3MVEA 4RA9A 4XOIA 1E1YA 2BTOA 3G2QA 1ISRA 4LCBA 5CB4B 3I61A 3EPLA 4MJXA 3ROMA 2DQYA 3UNXA 4Q4JB 3EDYA 3JQAA 2QDKA 2VK4A 3H5OA 3LKDA 3CVYA 4M9RA 1T9BA 3OQPA 3SHWA 5DYTA 1QYIA 1EXDA 1C9DB 3T5BA 4GL4A 4X1YB 3I39X 5EZYA 2YRXA 3ZV6A 3UN1A 4K9MA 3BSYA 2EP8A 2J0UA 1GCUA 1AGYA 3CZ5A 2TMYA 1Z29A 4MO2A 2AG8A 4TUYF 3T7EA 3PHCA 1F06A 5LM3A 1MW9X 3EW7A 1PW5A 1DDIA 2FSFA 4HQKA 4IR7A 2CNNA 3R7AA 3F4LA 3CZRA 1XJ0A 2YWHA 4JLNA 4Q9LA 2JBAB 4DDHA 4G5QA 1QORA 2ETVA 3VVBA 3N6RA 1IFXA 1EK6A 1F7UA 1XF9A 3E9DA 2HLHA 2WG0A 3N1UA 3TQCA 1FMTA 4MICA 1Z5OA 2OBXA 3IAM6 5EWJB 5F2EA 4RHYA 2FQQA 2IXEA 2L17A 1O6ZA 3IR5A 1Y4ZA 3RAJA 4MAMA 3SLKA 4D8VA 2YIMA 4F4CA 2O5RA 4A0HA 1QZXA 1YBFA 3D31A 1E6MA 5EXTA 3EASA 1EHYA 1CEXA 2KSQA 5CB4A 5IUNC 3K1TA 1X3SA 2WDPA 3IDFA 5FYDA 2COUA 1CDOA 2QBYB 1SIUA 1Q7GA 1A2QA 2Z2XA 4PAQA 2WJJA 3UHFA 2WJZB 3D4PA 4CKBA 3V1LA 2B36A 4RZ3A 4X1YA 2ZJAA 4LHVA 2QSYA 3ZVKA 1NI3A 4A2CA 1R15A 3UM9A 4ND7A 3FOFC 3TZHA 5KHLB 3PUJA 4DMMA 1LNSA 3H2SA 4MUXA 1ECPA 1FNDA 1YI1A 2FSSA 5EKTA 3WIEA 5LPNA 2AGVA 3WYBA 5EJ6A 3UKJA 4D9IA 3BD8A 2JBAA 5IDVA 1QQ6A 2NQ2C 4FFNA 1U9IC 4PZ0A 3VZPA 1XGKA 3AR5A 3EOAI 2QAIA 2W7TA 4ZICA 2JAHA 3TZBA 4QULA 1ZY2A 4Q1CA 5ICEA 1UR5A 4PRYA 4M1TA 4EM6A 2ECPA 4FLEA 4G8CA 3LXUX 4F06A 2OSVA 1YBMA 4JYCA 3WLEA 3FFAA 1TVKB 4IYJA 3OP4A 3SXJA 3BRSA 3NDPA 1UKVY 3VDRA 3ZE0B 1GTMA 3SBOA 4KSBA 4N82A 4J8PA 5K8LA 5CNMA 9ATCA 3R7FA 4MVJF 5L3QB 4HP8A 2OD2A 4WA7A 2VRBA 2WV9A 2QBYA 4NY1A 4HQLA 2W6JD 3TUZC 4RGQA 2EZUA 1KF0A 2GPYA 4JK3A 1GQSA 1P1KA 3MMZA 5EIWA 2OV2A 3VHQA 4NK4A 4BUZA 3AP2A 1OFIA 3ES9A 3HN2A 2OCGA 4LI3X 5A1TA 1XZDA 3D7RA 4KO3S 1TZKA 4WOCA 3SZGA 4EY3A 1XCLA 3QRWA 1ENOA 1RIFA 4M1WA 2ZB4A 4BE4A 1X2EA 1NQWA 1JZTA 1DG1G 3EZFA 1K1EA 2BFCB 4MYDA 4WLFA 1VE5A 3F9CA 4H7IA 3T5PA 4IEIA 1WMAA 2YWCA 1U1GA 4OQNA 4RD1A 2H52A 4B3SB 4E94A 2DWQA 4X8OA 2P6PA 3NKFA 2DE0X 1HUQA 1NNEA 1TVKA 2B6HA 4YASA 1HBJA 1J8YF 3P0EA 4RTRA 3TJZA 2CUNA 3ESYA 5DTJA 5L3QA 4UEWA 9ABPA 3JD4A 3CF2A 1WUIS 3F74A 2ZUCA 2IZZA 3K0EA 3RSLA 3BUSA 3EOZA 3KT8A 2FPMA 5REQA 1D9ZA 1OKKD 1EGVB 3GK3A 3K31A 3O2QB 1V37A 3OJ0A 4O5OA 2Z8YA 5GIPE 5J2TB 1OXXK 1NW6A 5KWEA 4J2HA 4J29A 1U2GC 3IX7A 3TGLA 1ULHA 4PC7A 4NU0A 1ITZA 3LQ4A 4FDTA 1XKTA 1JSZA 1GPKA 1Z34A 2QRQA 1GPDG 1IHPA 1SZDA 4AKTA 1OI7A 4COOA 4YRMA 5A02A 5GZ1A 1OV6A 3X43A 5C46F 3QWIA 4JL5A 1G1MA 3LECA 1C0PA 1RZUA 1CQIA 1YD7A 2XOKD 3AI3A 3UJBA 3X1ZA 3QKTA 3L4KA 3PDIA 4RF5A 4DV2B 4HN9A 4IIXA 1ZVQA 1PQYA 4M0DA 1NT2A 3GVHA 1L9XA 2NU7B 1RDFA 1KOJA 3INGA 4HGQA 1N3BA 1H6DA 3LNCA 4JCOA 3GFQA 3OCWA 2O9JA 2A67A 5K3SA 4ARZA 1XIVA 1LBIA 3B3GA 2BDUA 2YMLA 4YRSA 4JI4B 5U1PA 5I7EA 3OPYA 2DVMA 4BFZA 4B3BA 3BTVA 4GD3Q 1NL3A 2D1QA 1CJUC 3CS3A 3MOSA 1CUJA 4FPXA 5A6SB 5HRCA 4L5BA 4P93A 1CXZA 4O2RA 3AV0B 4YPOA 4ZKEA 2WUGA 5J2TA 2IYLD 4JS0A 5LXTA 4J7XA 2IIPA 1FL9A 5L8VA 1A4XA 2CLOB 2PWZA 2PD4A 2IL1A 3EQ7A 4IRUB 2OGTA 4LV5B 3QM1A 2DLCX 2K7ZA 5EHIA 1EJBA 4DQVA 4B80A 4JODA 3FE2A 2M6RA 2G4LA 3EARA 1YK0A 2H85A 1CS0A 1UZUA 3N2NA 3OT4A 4A15A 5JAMA 2F8SA 3NFRA 2ZBPA 4D43A 4AWAA 4B3XA 1P75A 4DLTA 2NU7A 3VHXB 1O2DA 1CY2A 4MVJH 4X7PA 2GBIA 5IF9A 1I7SB 3UMSA 2PWYA 4MW0A 1WB5A 1HFKA 3AJEA 3LCJA 1P4JA 3IHWA 4BN5A 2ZTMA 5A5GA 5E4YA 3C45A 4GSYA 3SQDA 2R751 3ETGA 3L82B 4OUDB 5EEGA 5DSZA 5A6SA 1JU9A 4ZHQF 4DREA 1TQ8A 3TTTA 3RYCA 1J90A 3KQMA 3RJ9A 5A0VA 2FEOA 4QDZA 4MGHA 5DHTA 3U3RA 4DA4A 4JI2B 4KREA 1OGYA 1CP3A 1P5HA 3KTOA 4OPMA 1R4NB 1FSGA 1S8FA 2ACKA 3QXCA 3V8MA 2G9NA 421PA 1SHZA 1WULS 3HXTA 4QUJA 2F1RA 2XHZA 1YH3A 3A32A 1N0IA 3I2YX 1DZ3A 1R8JA 3AINA 3H1TA 3HRIA 5IBQA 1FMCA 2J0EA 2YJ3A 4IJUA 4LKOA 3W1WA 1YJBA 4ZT2A 4DG5A 4EW2A 1O94C 1XE3A 1ZZGA 3CPSA 4MWCA 3V6LA 3AJRA 1NDQA 2A33A 3DF7A 1ZIXA 4DSAA 1WOYA 2B1GA 1SUIA 3DP7A 4F71A 3HRKA 2IDMA 2VTDA 4TYPA 2IFTA 3QVXA 1G38A 5D6OA 2BFFB 4N39A 10MHA 1SB9A 3VPHA 2NW6A 3V7WA 1W0JD 1Z88A 3C85A 5C2JB 3QUBA 2EJTA 3EEQA 3QMWA 1EG2A 3UUFA 3GDHA 3VSEA 2WQ7A 3KX2A 4HAVA 1FBNA 3G7UA 2HMUA 2O1EA 2D3WA 3P0RA 1MZVA 4JJEA 4JJZA 4CL8A 1TKRA 1UPUA 4GM4A 1U1FA 4JJ6A 3DFZA 4B7AA 4EHJA 4Q3DA 2JHAA 3Q8KA 2JIMA 3HNOA 1Y7LA 2EHJA 2NTJA 1VIVA 2HZBA 1IXZA 4ZVQA 4EF5A 3C1AA 3I64A 4Z7QB 1PFGA 3GP8A 3L8EA 5TARA 3Q41A 4YROA 1R4NA 7MDHA 1X0XA 2D1TA 1JFRA 4K9PA 4JJ4A 4NLLA 2FWIA 3S99A 2RGGA 5LQJA 4EX6A 2IK8A 2XCOA 5COBA 5JE8A 5U4QA 4LOHA 3R74A 3EIFA 3RS0A 3SHQA 5DBGA 3ABIA 3UW3A 1FFAA 3JTEA 2CXRA 2EQ5A 3WC4A 4EELA 2ENUA 4EJSB 3RAFC 2FKAA 2P3QA 2X0FA 1A7KA 4D81A 2VSXA 3EXFB 4I8XA 5KCZA 1FIUA 3KCNA 5KKAA 3CUWA 1JDPA 5JECA 2REOA 4JJIA 5H9WA 3DULA 4OM8A 4WN3A 2LWIA 3L04A 3P0FA 4Q3CA 3VR1A 3KLMX 2W6JA 1HYHA 1GPYA 2BWJA 3G0BA 3QITA 4FU0A 4RFSA 4ODIA 2IHUA 1Q20A 5IULC 1VPEA 4GP7A 3PFNA 4DMRA 2G5GX 1FQWA 4YRTA 2QTWB 2FFQA 1JZQA 5J2UF 4R83A 5EJAA 4YCMA 3BMXA 3LG2A 3S55A 1TE2A 3IOBA 1D5CA 3I32A 1PR5A 1ZESA 2LP4Y 3BEOA 2B83A 3K1AA 1T6YA 2EKQA 3PG5A 4GKAA 4O2AF 4OYRA 5SV2A 1GY8A 2AI1A 2WKPA 3HWSA 2WVJA 1U3CA 1X86B 2GDJA 4EECA 1V5IA 2C2OA 2I1VB 4KQ6A 4TVBA 2HV9A 2OCLA 4D3SA 4N5NA 3BERA 1SCBA 2XE7A 4RXMA 3GEEA 1HI9A 5A7FA 1SZCA 3JQBA 3DVLA 2J5XA 4MP6A 3RS9A 3O6VA 4EI9A 4HB0A 5DTQA 3UVEA 4R1TA 3WWCA 2RHTA 1RCTE 3F7NA 4BQEA 2NYAA 2C99A 3URMA 2G7MC 2QNBA 3EXFA 3V7UA 4LXGA 3EG5A 4FOOA 3NC4A 1D9XA 1MB2A 4RQUA 2O19A 3U7JA 5L51A 1G291 2VJPA 1QAQA 1UAGA 3IQZA 3OTIA 4I0WB 2EIXA 4XWKA 1QDLB 4XUCA 2GPNA 1RMYA 3KUDA 2II6A 3KXKA 3ORHA 5JZBA 2LNDA 2DY0A 1LEHA 1OKKA 5C35A 2IP1A 2ZR8A 4XGRA 5JO0A 2EVWX 4S3MA 1UXKA 5CK4A 1Q7TA 1ZUHA 1MRNA 3PPIA 5UKDA 1KBQA 4I50B 2C88A 3A9CA 3NTQA 2NP6A 1ZDMA 4FJ1A 4ZPJA 3E2IA 4YDHB 1LF0A 1UFRA 3Q87B 1MVNA 3W8RA 2B8EA 2OD9A 3N8KA 2QRZA 5ETJA 3RNLA 1ND6A 2HB6A 3AW8A 3NHUA 5AVKA 3G9ZA 1NN3A 5D5QA 2XOKA 4WWHA 1GTJ1 2CNLA 2XTNA 1NVVQ 2Q5CA 3FHTA 4GWKA 3ANNA 1JBQA 3W8NA 2R6HA 4JI5B 5A2GA 4FMCB 4HLUA 4M88A 3AOGA 4KQFA 4EITA 2JLSA 3KEOA 2FZWA 3S2IA 2GM3A 4WEQA 4DMCA 3RJMA 4KN9S 1SVSA 4J4HA 1REQA 4DRYA 4JITA 1ZCAA 2R2GA 1N2ZA 5BMOA 4GS5A 1QYRA 1HNXB 3K4QA 4OJNA 3FPFA 1LSJA 4QXOA 4XFKA 3WGIA 4WJLA 5IANA 4HB4A 4V2IA 5FWAA 5IVIA 1ZX1A 2IVFA 3E5MA 4NWIA 4H3VA 3RBZA 1FFDA 4TT3D 4KODA 5DPMA 5K0LA 3RWMB 1M2KA 3C3DA 3MWEB 4I50A 2C42A 3P9IA 4YRNA 4NAHA 5KYXB 5C5EA 2WICA 4G1BA 2QM7A 1THGA 5FFNA 1WXIA 3V4ZA 4Z4IA 1ZW1A 3IP3A 2DHEA 4YAJA 3THOA 1GGEA 4AIRA 3W9SA 5HWSA 1I13A 2O3QA 4RVGA 3DVAB 4OEHA 5K3FB 1YAHA 3WYAA 2DQSA 4DM4A 2C1XA 3ZY6A 1HZZA 4LF7B 4K6OA 4AJ1A 4DYVA 2BM9A 1JQKA 3DBHA 1SUDA 2M32A 2CEAA 1BW9A 1GG5A 3DW1X 4CG3A 3H8WA 5JS8A 3GJXC 3JASA 4HQRA 1SCJA 4CIWA 1U7ZA 3AHCA 1VI2A 5C8ZA 1W34A 2QIOA 2M9MA 5SYMA 2PSJA 1T0HB 2YYZA 1M6EX 3HBNA 1HL3A 3JAWA 3OO0A 2OV3A 2Q1WA 2CNWD 4ZO9A 5C8DA 5IF3A 1PJ4A 4DLKA 1QJ4A 3PPYA 1N6IA 4YK7A 4ZJZA 1ZIPA 1AHPA 1AKUA 4DMGA 4FYVA 5GVSA 5DT9A 2NSDA 4IFEA 1DXOA 1AGRA 1U8CB 4AI6A 2XXAA 3MWEA 4YMWA 1KMIY 3N0VA 5AQ1A 3MW8A 3SU8A 1ZM4A 2BAGA 2PX3A 3FCUB 5KAPA 4XTRA 5KYXA 3TGPA 1RE1A 1JNXX 3HJRA 2CVZA 3TIFA 1ESZA 3UJCA 4YRFA 2FRDC 1IN7A 1V95A 2SKCA 3NEAA 4R2KA 3FMPB 3OPXA 3QXJA 3UFBA 4FD3A 1TFUA 3BWBA 3ZW8A 1IZ0A 5LB4A 5C7OO 1NQAO 4Q3LA 4PO8A 3WWPA 2VNHA 2QYTA 1WL8A 5JT1A 4EFKA 4KXMA 5H7XA 5A62A 1U8FO 1QIIA 4IDNA 3LX8A 2ZXFA 3E8SA 1G18A 2AG1A 2AUNA 2EX0A 4G0OA 4JUAA 3WE7A 1FTNA 3WXMA 4Q9DA 2QYSA 3BMQB 3NAGA 4C0AC 4ABTA 1S0UA 2GN1A 1O4VA 2GCNA 3KAPA 1T29A 4WOJA 4XQ9A 3UWMA 4DT1B 2VAXA 4AG3A 4DILA 2WLTA 1SVLA 2ZUSA 3CX6A 1TM7E 3GJ3A 2I3GA 3FKSD 1CY1A 1N2OA 4TYYA 1L5KA 2INGX 3A26A 4XZ3A 2RHDA 1X14A 3NHYA 1RYBA 2HIAA 2YJ5A 3SZLA 1GRVA 1P4SA 2YYSA 3IAEA 1M66A 3NXSA 1FZTA 2JAXA 5HOEA 3AGPA 3OAAD 3AKYA 3DHVA 2AHRA 1Q22A 3IYLW 1ONOA 1PT6A 3DCNA 1HNNA 3D3WB 3RB8A 3SJCA 4WUVA 2OBYA 3EOBI 5IDYA 3ENNA 1OLOA 3STWA 1UWVA 1AUOA 1KYYA 2Z5LA 5CIYA 3IL2A 4CIYA 4G5SA 2PJRA 3WZLA 4DIDA 3HXLA 2BUAA 1HTWA 2QJWA 4AS3A 3LM8A 4K88A 3CCFA 1LVUA 2W4IA 2VN8A 2YV1A 3M81A 5EZQA 3QTLA 1EESA 3QELB 4B7XA 3WLPA 4BYMA 2P6RA 3GP3A 1PZXA 2GCPA 2GNOA 1W49A 3HCAA 1SOWA 4YP1A 1HE8B 4U9UA 3V80A 3BMQA 3BHJA 1U7TA 5KO2A 1SKMA 1NIPA 1GM5A 4DSOA 1KEKA 3DLCA 4DT1A 1SUCA 3RSGA 3EZGA 1AKYA 1U7WA 1UT6A 3AOEA 2YHBA 3NWBA 2BGJA 1BWSA 1SKBA 2W2QA 3EGOA 3HBFA 1YDMA 1J24A 4IKPA 1YTLA 1GRCA 2RHWA 3EC7A 3TL6A 5IDXA 1OAOA 4JT8A 4YRAA 2H2HA 2JD1A 2ZWOA 4CQNA 5ECWA 1PE0A 1NI5A 2X5OA 2YTZA 1CUVA 2C5HA 3GLQA 3MRSA 4IX1A 4K1LA 5HG0A 3MWKA 4X45A 3D3WA 4OFXA 1CNEA 3VYRB 4CMIB 3L5KA 2CD9A 1L3IA 2Y0PA 4P0QB 4F6RB 5I9NA 2OENG 3GLHE 5E4FA 1O57A 2HXSA 1NY6A 3L2OB 4BFWA 2YVLA 4UATA 4Q9JA 3UAYA 2D5BA 3RUIA 4UHEA 4NCKA 4IF6A 1Z2CA 4NENB 1XZ8A 2G9QA 2H29A 3QELA 2Q0HA 2PZGA 4PGMA 1ZL2A 5ESWA 3M5DA 4ZAVA 5DHPA 1WW8A 2P8JA 2R62A 3HEAA 4XA8A 2ZRIA 3ZIDA 2I2AA 2OXTA 4S1NA 4IRXA 3FVRA 1MX1A 4UXIA 1V16B 2I7CA 4DTIA 1RIIA 2QX7A 1IOZA 4TMYA 5LC1A 3B2EA 3DT8A 5LP6B 2I7XA 4F04A 2JLXA 2NLOA 3G17A 1ZZEA 4I08A 4MLCA 4RPJA 2WB4A 3A31A 5BP7A 1B15A 2NXJA 2ST1A 2XEXA 4QGAA 4R1NA 4S1TA 5CIQA 2P3SA 3OLWA 5CVJA 1RAFA 5H83A 5HTOA 1Q7RA 2O05A 2Q5EA 2ZAGA 3D3JA 3OJFA 4IIBA 2DR0A 3HFRA 3P9PA 4P4NA 4I1OA 4Q1VA 5I4CA 5DNEA 1WXWA 3EGXA 4NV3A 1P81A 1E62A 3KOWA 1KQFA 2ZS7A 2DXIA 2V0GA 3TBKA 2CUZA 4RK5A 3RRZA 3PR2B 1DWPA 1MV8A 4A0SA 4K05A 1H2FA 1PZMA 2H9AA 2JEZA 2OB2A 3V1NA 2IY8A 3E1SA 5DLPA 4ALNA 4BRZA 3ADPA 3UAVA 1N36B 4AJEA 1RXVA 4HDAA 2IT1A 1KQ3A 1V16A 2ONZA 4KAJA 3EBLA 5IZCA 4JP2A 4BFLA 4G8JA 3URKA 3ZG6A 4NBNA 4TT3A 2J46A 1T0BA 1YZGA 4RH0A 1ZSVA 3P7MA 3WLKX 3ECAA 4HNHA 1PEAA 4DRXB 4N0QA 4K26A 1BEEA 3HU1A 5H4GA 1ZOIA 4PQYA 2O7SA 2WE8A 5FAXA 4F1WA 4RDXA 4OO3A 4HI0E 1JFFA 3U3ZA 2FUKA 1EU1A 1JB1A 1PTKA 2Z3WA 3Q7QA 1IBCA 4U8HA 2VHEA 5IFLA 3GNSA 3OHSX 3FSJX 1QG2A 2VA8A 2QZZA 4RK0A 1OYVA 1E0KA 3PNYA 4YP6A 3R75A 3LD9A 2WHEA 2JIBA 2I65A 3V4LA 1KH2A 1AKRA 1RXSA 1XMXA 2XX3A 3RLIA 1APBA 1NOJA 3QPVA 4NZNA 3TW0A 4KG7A 2RK3A 2CNWA 2GXSA 1I32A 4UDXX 4BNMA 3CW8X 5C31A 4M86A 4QDKA 2JB9A 4Q1FA 5I9IA 1PQWA 3CLRC 2QR5A 3UK6A 2I5PO 3IH5A 4ERXA 1L5RA 3KVYA 5ALSA 1JG7A 1C7IA 1KBOA 1VLHA 2A0KA 4ARBA 4C05A 3MELA 1UL1X 4W8GA 5EHGA 2HIMA 2DPXA 2OCBA 2WG1A 1YR6A 2Z56A 3N53A 5H9VA 2D2IA 2GMWA 4A1OA 3AF6A 3GJ7A 2ZS9A 4XGKA 2P9GA 4OQ4A 4GPBA 1GPH1 3A2NA 2OV6A 3I1JA 4MSUA 4AUKA 1RJ9B 3N8IA 3DDWA 1SBNE 4P98A 4XW2A 3P96A 3GWZA 4MPTA 4MRMB 1F0YA 1VL0A 1SC4A 3FVTA 3I04A 3P97A 2ZSAA 4IIUA 5AKZA 4YWHA 3KR2A 3TE7A 4EQ6B 5KYWA 4FR2A 2ZWAA 3IFSA 2C61A 2Z1MA 4CIAA 3A28A 1OI2A 3HDGA 5FPSA 1M54A 1ADCA 4PZUA 4WXPA 1ZFNA 3WGKA 1CW2B 2BZ0A 4LTDA 4XD7D 4EMSA 3GLGB 2W70A 1XMPA 2GFIA 2OCIA 3Q6MA 4EPYA 3EBPA 3OLQA 3L1HA 5AVSA 4HWRA 1UXIA 8ABPA 1S8OA 1C4OA 1S1CA 4RVOA 4LYDA 2BMFA 4EFMA 2C5EA 2NXNA 3ENWA 1TOAA 1KTVA 3HDYA 1DV2A 3VDMA 4BUJA 2AF4C 2CE2X 2CXXA 3MQ2A 4G4JA 1PZNA 4HTAA 2IZOA 5TGZA 3FKSA 1S2OA 3MMNA 2L42A 3ANYB 2WF8A 3PC2A 4FN4A 4IVQA 1M8GA 1PSDA 2ERYA 2QJRA 3A3NA 3PXBA 2VCHA 4PC6A 4PSKA 1AHIA 1Y33E 3ZHVA 2NT4A 4UCFA 2J5KA 3TMYA 1IM8A 1JDTA 3M4JA 4AS2A 4BQPA 3BMCA 3JVUA 1M1YA 3OAAA 5T7BA 2GBFA 3KIPA 1GL3A 1QFYA 3BVPA 5FTNA 1V2HE 1DU4A 3RS3A 3S2EA 1SB8A 4RETA 3K9NA 5BYAA 1PUXA 3COWA 4ADSG 1XEWX 4DQXA 4JXZA 4EARA 1K6MA 1E7RA 3M9XA 1N2CE 3AO0B 3D9QX 2P2LA 4IINA 3IDZA 3IODA 1KI3A 4I55F 4QU0A 2EERA 3UJAA 4UXJA 3DXFA 4LJLA 4HAUA 3GLGA 2WEKA 4M1ZA 3BWVA 4HYTA 3CIFA 3Q5EA 2QZPA 4L9SA 3JS5A 1UF9A 2ZE5A 3U3OA 2FOXA 4RD0A 3W7BA 3WNVA 4DR2B 1KY2A 5E7JA 2ZZNA 2GFQA 1QK3A 2D4HA 3ZCUA 4R6XA 3SAJA 1KAGA 1JDSA 1JJ7A 1KH3A 3MSCA 1WJGA 4IV5A 1G66A 1UJMA 4PR3A 4URYR 1FQJA 3GT0A 2A9PA 3V3TA 3OWOA 3TIXB 3OOYA 5FTWA 2VSFA 1L4GA 1XRRA 2W8BA 2O3TA 4LWPA 1KU0A 4L7QA 3E9YA 5KPJA 2HBRA 3AKCA 2OBBA 1IQPA 1ESEA 1G60A 3BTOA 2C1ZA 3LT4A 4GPD1 4ESEA 1GG9A 2VWHA 2PAAA 3EDOA 4OAOA 3LDUA 5FQNA 4RQTA 1GKIA 5JD4A 1NSFA 2P78A 1E2GA 4F93B 1Y3IA 5DJ5A 1NHWA 4UDOA 3S7TA 8OHMA 5ADHA 3EEIA 2AZDA 3WRXC 2IYSA 3E27A 5KIAA 4F3YA 2GEJA 4JMPA 3W0LB 1L5WA 4HDKB 4E2WA 2YJ6A 3F4BA 4NF2A 5EYPB 2OWEA 2ZG6A 2CT8A 5KQLA 1NRXA 2FPWA 4DTCA 3OIDA 2ZU6A 2HRDA 1SXQA 4QTUB 3HKBB 3PL5A 1OQAA 4V1CI 3THYB 1UXJA 1XZQA 5AQEA 1KEZA 1R0XA 1P3Y1 4QELA 2WU4A 5L45A 2O8VA 4M0UA 5BOSB 1JHQA 2XZTA 3R5FA 1YRLA 4ZOCA 1KS9A 1J1IA 3LZCA 4JYPA 3S1AB 5BN1A 1WMDA 3G0DA 4E11A 3ZDCA 1JR4A 1HDIA 3LQRA 4CF6A 1AUQA 3CYFA 4EHHA 4DEVA 3HSSA 3HJAA 4TMTA 4ZRNA 5BSMA 3TOCA 2RI1A 3KQQA 3S6JA 3SKYA 1E7YA 1AS2A 4F92B 1UCFA 5H68A 1C9JA 2YBDA 3NUZA 4JVOA 4B3JA 5JOQA 4TTPA 3A4IA 2D2XA 5AK0A 1LGYA 1YKFA 4W6QA 4KPUA 4LTMA 4MS1B 4OYLA 5CLHA 4QT0A 4JSTA 2WK1A 1L1RA 5J4LA 1GU7A 1Y6JA 4ON9A 4PHTA 4L08A 3PQ7A 4BO7A 4XWYA 1H5NA 4WCFC 2OXRA 4BNZA 5EYPA 5A3VA 3NAZA 1G2PA 3V8NA 1G7CA 1G63A 2IY9A 4I8IA 4BNVA 3RFCA 2QVYX 5TLSA 5EKDA 3THYA 1W35A 1TF2A 4ZDWA 3D6UA 5HS6A 2ZIAA 5IT4A 1PEDA 5JISA 5I45A 1IBMB 3NANA 2C9MA 4EEKA 2QI9C 2A1TS 1YCHA 3FOBA 4MB6A 3S1AA 3S40A 1N8SA 3B9PA 4NAVA 3WNDA 4KGDA 3X0DA 5ALXA 1B6SA 1CNFA 3F98A 1NPTO 5K1ZA 3UCFA 2XMBA 1T5DX 2YWFA 4C43A 5CBPB 2BFBB 1IAQA 2OZLA 2FR0A 1HO3A 1I9CA 4AP6A 4ZI2A 4HH4A 1U2DA 1Y9ZA 1RQNA 4NMMA 4WY5A 4AN0A 1F20A 3E7DA 1T24A 3SBDA 1VOTA 2HHLA 4F3TA 3RIGA 4K8RB 2H8GA 1YQWA 2B4QA 1NF2A 2QLMA 4LFCB 1PR0A 2MYNA 2FKNA 2WYWA 3K53A 4LRSB 2HL6A 3SM3A 4PZDA 5AI8A 4F91B 4MWTA 1FNBA 3TD9A 1NC3A 3BA1A 5FFMA 3TRJA 2FG7C 2VSOA 5DGDA 5JTTA 3FPGA 3K9LA 5IJZA 2PKXA 4ND6A 1RXCA 2AN5A 3BDAA 4R8SA 4D44A 3AVOA 4C0SA 3PFKA 4CIXA 2XCIA 3SS8A 1SM4A 1M2EA 1U80A 1XTJA 2Q6LA 3DAHA 1WDWB 1MFPA 3EGEA 4GZMA 1AC5A 1P7VA 4L9RA 4NBKA 4NS1A 2XOEA 3DFKA 4UHBA 3RTGA 2ZI5A 1VIDA 1RYMA 1C30A 3W6UA 1EB9A 4TPKA 5C51B 4LJ7A 1WETA 5JBQA 4YT5A 5CBPA 1C1XB 1B73A 3HCCA 1FFBA 3WHIA 3GJTA 1CETA 3V6MA 4ZVKA 1DQNA 1PDVA 2JLBA 3MGCA 3ZC3A 5BSVA 2W93A 3WLRA 2ID7A 4GX0A 2CV0A 621PA 3HCEA 1VIYA 1JIIA 3DHYA 5JCOC 2AWNA 1QFXA 1ZA1A 1O87A 1M1YE 2RHMA 4F8EA 3ZWDA 2P9FA 4I4LA 2GEUA 4XD7A 1A77A 1N2XA 1TM2A 5AOCA 5E0OA 3C7DB 2ZDHA 4TT8A 2VJNA 2J48A 3ROPA 4LDNA 4BQOA 4C0HA 1UBTS 2YHIA 1AUVA 3CZ4A 3TNJA 3GIWA 3IA7A 3RKRA 5AI4A 3C48A 4U3JA 2IOFA 3Q15C 1KDPA 3BGDA 3OC6A 5SICE 3CFYA 4H9GA 5KQGA 4FI3F 1WPRA 2VF4X 2CD7A 1KAHA 2FXVA 7REQA 5JPIA 1R27A 1I4TD 4DLLA 3RDPA 4X97A 1QHFA 2XY4A 3OCUA 3ASUA 2PK3A 4RD2A 3AW9A 4ALJA 4C3UA 4RVNA 2AKYA 1C1XA 2HA2A 3KDPA 4PSUA 1G21B 2EHDA 1UDXA 3P27A 3HR4A 4IMPA 5HP4A 1TUIA 3IURA 3NB0A 1EK1A 1JIUA 3HQ4O 1EVJA 3WWOA 4CCYB 1IJBA 3A6PC 4KXNA 1YDEA 3OMLA 3V2UA 3MCWA 2CMHA 4J07A 4KLZA 3VTKA 3KV1A 3L6RA 1WNFA 2FSPA 3WLOA 2WD7B 1QIKA 4DN6A 3C3AA 3FSEA 4JLWA 4JLSA 4G97A 2BFMA 1T6ZA 4KQ2A 3ROGA 2EBFX 3M2PA 1UPXA 1S5PA 4BMCA 5KTKA 3O2NA 1AA6A 5JSYA 2SICE 1B8PA 2EKLA 1XELA 3F4KA 1W5SA 4NCXA 1WPXA 2RAVA 3PVSA 2RHLA 3DE3X 3T7TA 4K28A 4N7JA 5FL3A 5TGTA 3OEHD 1P33A 4BRUA 3CRZA 2JGRA 3DH0A 2GPBA 3VI4B 4C0BA 1W581 3UOAB 3AF1A 3OEED 3WGNA 2Z0MA 4NBUA 3U62A 5AKYA 4X1IA 2VQDA 4E03A 1TQ6A 1JA1A 1AM4D 1XZBA 2OBNA 3UXYA 3N59A 3A6FA 4AYTA 5MGBA 5TC4A 1CCWA 3VDNB 1ISHA 3VR4H 3OD5A 4IDDA 4CCYA 3PNMA 4GPZA 4PHCA 1B0PA 1ZR2A 1KYIA 4X8HA 1BIFA 4KN5A 3E61A 3RSCA 2VZLA 5DOZA 5E0KB 4DCCA 1FQOA 2ZE6A 3D8NA 4MVJE 5L3ZA 1XZJA 3P5BA 4PU0A 5BMVA 5ICGA 2PUWA 4BBPA 2AMYA 1EFKA 1ZM7A 1LK0A 3ZK7A 7ABPA 3H04A 4Z6KA 1HQKA 4V3BA 1J20A 1JJBA 4IUYA 1QH9A 4I9HA 1P0MA 4JV5B 1JQAA 1ACJA 2QWXA 3M1YA 4GZ6A 1AV7A 2R5NA 3DTYA 3PZBA 4HLQB 5HF8A 3UB4A 5JR3A 1G7TA 1FTWA