2AE2A

Tropinone reductase-ii complexed with nadp+ and pseudotropine
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
259
structure length
259
Chain Sequence
AGRWNLEGCTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKELNDCLTQWRSKGFKVEASVCDLSSRSERQELMNTVANHFHGKLNILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISSVSGALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLVEMTIQDPEQKENLNKLIDRCALRRMGEPKELAAMVAFLCFPAASYVTGQIIYVDGGLMANCGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TROPINONE REDUCTASE-II)
publication title Structure of tropinone reductase-II complexed with NADP+ and pseudotropine at 1.9 A resolution: implication for stereospecific substrate binding and catalysis.
pubmed doi rcsb
source organism Datura stramonium
molecule tags Oxidoreductase
total genus 104
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 1.1.1.236: Tropinone reductase II.
pdb deposition date 1999-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ae2A00
2IODA 4XIJA 3I9MA 1V3VA 2VYNA 4BKQA 2R00C 4AJOA 2C20A 3UCFA 4XR4A 2VRCA 4BO8A 1YKFA 2OXIA 4I8XA 4WGGA 4BNVA 5L51A 5G4KA 4D3FA 1N5DA 1I3NA 2GN9A 3C1TA 3HB4X 5H83A 5AXDA 2HSDA 3ZI0A 1O0SA 2NTNA 4PRKA 3E03A 5FF9A 1UXKA 1Y5MA 3C7CB 5JAIA 3S2FA 4XRGA 2QRJA 1MX3A 2B4QA 2NV6A 4RORA 3OH8A 3BMNA 3EMKA 4N54A 3K73O 4PN3A 4LCEA 1PS9A 3H9GA 3V1TC 3B70A 1LU9A 4YJFA 4RZHA 3FNFA 2Q49A 3MJSA 1SCUA 2VHWA 3DHEA 3ZWBA 1YL6A 5FI5A 4ID9A 1NX6A 3GHYA 1SNYA 3ZWYA 1UH5A 3DZFA 5I7SA 1W0CA 1NQOA 1Y8RA 1A27A 2CDAA 2GPTA 4RVFA 4YT5A 4CQLB 5C3MA 1UJMA 1HDRA 4H3VA 1B2LA 3TPCA 3VH3A 4QECA 3VZPA 1UP7A 2PFGA 1E3WB 4ZD6A 3FBTA 2EEZA 2P5UA 5IXSA 2UUPA 1Y1PA 3MWDB 1YBMA 4NR0A 2X9GA 4EJMA 2D59A 4BQPA 5F5LA 1I32A 1LXCA 2QRKA 1YB4A 3Q11A 3L6DA 3RCBA 4DLAA 2D0IA 3FR8A 3NKLA 2ZK7A 5DNAA 4MKZA 4MVJM 1SAYA 3ZU2A 2O3UA 1LDMA 4TQGA 2GZ1A 4NFSA 2R6JA 4YRDA 1IZ0A 4CQMA 5JNLA 1NR7A 3KBOA 2GGSA 1Y5RA 3BMQB 4LMRA 3TRIA 3IL2A 3LZ6A 1NNUA 4OOFA 3AUAA 3PJGA 5A9RA 5H82A 4AJ1A 2GN4A 2Y1DA 1J4AA 2B0JA 1Y9AA 2DKNA 4Z9YA 3S8MA 5KJ6A 2IXBA 1TT5B 2IXAA 3OA0A 5CDUA 4WE3A 1E7SA 1YOVA 3C1OA 1O95A 4L4XA 1T2FA 5JAZA 4NBVA 4JP3A 1Q7BA 5L3ZA 1PJLA 3JYLA 3PDJA 2O2YA 1FDUA 3DXFA 4BKUA 4II2A 1ZK0A 2PTGA 3UN1A 2NM0A 3DZKA 5A02A 1ZH8A 4HBGA 2FP4A 4YT2A 4FSHA 2FPIA 5CDTA 3UGKA 4JP2A 1SPXA 4CV1A 3PQDA 2C7GA 3FTNA 3P5SA 4B8WA 5EQFA 2HK7A 3TFQA 4DXHA 1E77A 4PLYA 1R4MA 3HUDA 1ISMA 1C0LA 2Q1UA 4K28A 1H93A 3SJ7A 4F46A 1YL7A 1O6ZA 2Z1MA 1WMAA 3GEMA 4XYGA 3WYEA 4DIFA 3VZQA 3OFSA 3GT0A 3I23A 3A1NA 1ZCJA 1C0KA 4TROA 2WE8A 4K1LA 1MB4A 2ZTVA 1CQJA 5JAQA 4NFHA 4NZ9A 3PIIA 4PG5A 1GL3A 3GOHA 3OQ6A 4Q3EA 3PPIA 3I1JA 5KVCA 4BHTA 4B7UA 1SBYA 2HJSA 1E5QA 1AGNA 1JAYA 1GPJA 1SZJG 2YQ4A 4GH5A 4Z0TA 4BNTA 4BS9A 1TLTA 4MJLA 1I8TA 1ULSA 1Q0LA 3F47A 1P31A 2RH8A 2O23A 4FGWA 2EW8A 5C37A 4A27A 5HM8A 3E9QA 1SMKA 3K92A 4R9SA 3SEFA 4BV8A 3EZYA 3RFXA 1HDOA 1Y8RB 3GNQA 4ILKA 1XR3A 2H1SA 2O48X 3F4LA 4CL3A 1EZ4A 5ES3A 1B0AA 1ZIDA 3R0IA 1U5AA 2JCXA 1Z73A 1LDNA 2VT2A 1DC3A 2FRDA 1Q7CA 3GRPA 1EVZA 5KVVA 1HZJA 3PJEA 5JDIA 4JCOA 1KERA 1B14A 2C2XA 1K6IA 3KYDA 4WECA 3BHMA 1Z7BA 1IPEA 1R16A 1U8XX 2Y68A 4KUGA 3I52A 4A5OA 4DGSA 4E5NA 1U28A 1PJBA 3JD3A 1OC2A 2X9NA 1PJ2A 4XYEA 1UDAA 1O94A 4IDGA 3D4NA 3NTQA 1ID1A 2E48A 1P1FA 3I5MA 3LSYA 4NQZA 4XYBA 3MCVA 2DC1A 3NEPX 4CQMB 3WQRA 1P1HA 1X0XA 1T2CA 5T57A 1EK6A 5KOIA 2PA3A 4D45A 2C5EA 1TI7A 2Q4BA 3I4CA 4TRNA 2P2SA 5ADHA 2FHSA 4E2WA 3GZNB 5I7FA 1DOHA 1PQPA 1DFHA 3DR3A 4DWVA 1LEHA 1RYEA 4NU6A 1P33A 1G0NA 2AQIA 1BXGB 1PEDA 3GMSA 4AVYA 3EC7A 3LK7A 2HRZA 3OBBA 1UXGA 4IDAA 4GVLA 1A4UA 1P9LA 5KCZA 1P0FA 2BGLA 2PH5A 1IL0A 4OSOA 4IQGA 3AK4A 4BL5A 1XHLA 2AQHA 4DLLA 1KEWA 3B20A 3W1VA 4DLBA 1C1XB 4FB5A 4ZQHA 4IBOA 4KQXA 1KVSA 2E49A 3AM5A 3INRA 4FBGA 4YRAA 4OIMA 2PZJA 3FHLA 3GG9A 1ZUD1 4UVHA 4FJ0A 4IM7A 1TB4A 5B4VA 1I5RA 4YRBA 1EFLA 2B4TO 2PR2A 4IDDA 1JTVA 2P91A 5I9MA 4E31A 4G81A 3F5SA 1O5IA 3GDFA 4NG5A 5I9NA 4IMRA 1PJQA 5L53A 4GVXA 4BIIA 5JAMA 5JDCA 4YB8A 4E5PA 2Y93A 5DP1A 2HMWA 2NLOA 2HCTA 2DTEA 1Q1NA 2JHGA 3V5NA 3HNPA 3H9JA 3RUFA 3K6JA 3JSAA 1N7HA 3V8BA 1P1IA 3H7AA 2CDBA 2EKPA 3JCZA 4HFMA 4WCFC 1PJSA 4I5DA 2FOIA 2IEBA 1HYHA 4JGBA 4ONEA 3JQFA 1EBUA 2DBZA 3E48A 3AOEC 1A7KA 1E3SA 3CPSA 3SLKA 1DO8A 5JC8A 2Y1CA 2VTDA 1KY4A 1E1MA 3K30A 3ORFA 2Q46A 3WBFA 4A10A 5JY1A 1VRWA 4K9DA 3FNEA 4B4VA 3TFOA 3G49A 5HBRA 3QIVA 5L4NA 4FFMA 4DC0A 3VH4A 3A28A 4E21A 5BSFA 5KJCA 3GQVA 4PLWA 5BSHA 4JK3A 3LF1A 3VZSA 4WEQA 3R3SA 3QVTA 2OMEA 3ZWCA 3H5RA 4ZQEA 5B4TA 4L8VA 3VPFA 4IPTA 5G0TA 4AJNA 5JCJD 4N5LA 1EUCA 2XOXA 4TZKA 3IUPA 5JSFA 4J4TA 5IDXA 1GCUA 1GAEO 3L0DA 3K8ZA 3KOUA 3L07A 4TZTA 4ZGWA 5B12A 4AJHA 4GGOA 3DTTA 1U3VA 3TDKA 2EV9A 4NNJA 1N2SA 1X7HA 1XYGA 5C5IA 4OAQA 1LX6A 1E92A 3V2UA 1BMDA 3JQEA 3T7EA 3DZJA 1CF2O 1PGPA 2J3IA 5BR7A 2NU8A 3U4CA 1UUFA 4URFA 4BQRA 5A04A 1QLHA 3NYWA 2UDPA 4OM8A 4RLHA 1MC5A 2X0IA 4UUMA 3FF4A 4OGWA 4W99A 5CP8A 3SBOA 2O3SA 3JQBA 4CLHA 1GYPA 2I3GA 3OQ1A 4MDHA 3ROQA 3AUTA 3TZQA 4M8SA 3CMCO 5G4LA 5K9ZA 4PCVA 3O8QB 2ZB7A 1XSEA 1NTOA 4CUJA 4MINA 3IDSA 1HYEA 1P44A 4D46A 3NDRA 4L4SA 4NBTA 5IXYA 1PGQA 2OHXA 3GAZA 3ADPA 3SLGA 3EUWA 2BGMA 4R5MA 3WYBA 2IYOA 5K0ZA 2YQ5A 1JLLA 4XJTA 1T1RA 4BMVA 3FRJA 1A4IA 4CV3A 1N1EA 4GL4A 4KMSA 2FWMX 3LVFO 3IOYA 4DUPA 4ZU3A 2QX7A 4F6CA 1O8CA 4BMNA 3WYCA 3NV9A 4FJ1A 2ILTA 3N74A 3V2HA 4HY3A 4JBGA 2OORA 3E6AA 3UXYA 3TNLA 3KB6A 1JKFA 1CEQA 1R15A 2OBNA 4L9RA 3K96A 4ZRMA 5F1OA 1PS8A 4R69A 3PQFA 1ULUA 3ASUA 3ENNA 4Z9FA 1M76A 2Y1GA 2D5CA 3DFUA 4GBJA 1KEVA 3NJ4A 2NVUB 4KWIA 1VJTA 3S2IA 3PJDA 2X0RA 4Q3AA 3O4RA 1PQWA 1C1DB 2G82A 5EIOA 4O6VA 4IUYA 4EW6A 1QYVA 3DBLB 1SO8A 4CLRB 2CFCA 2YHUA 3LC2O 3DAGA 2O3QA 3M1AA 1Y8QB 1AE1A 4MO2A 3G17A 3GK3A 2AEFA 3NAQA 2EHDA 1V3UA 1GADO 2PGDA 5JPIA 3ANMA 3PHHA 1YDWA 4I9NA 4ND4A 3JQ9C 1WXDA 2DAPA 3H9EO 3K9QO 3P2YA 3RC7A 5AQ1A 2AEJA 2DTDA 3WWZA 2X22A 5T67A 5KVSA 1BW9A 5G0VA 3VZRA 5IZCA 4A0SA 5COBA 2WM3A 4YAGA 2ZQYA 3KV3O 2OFPA 4NK5A 3L6EA 4AJ2A 1EQUA 4BO2A 1B8UA 4CLXA 2GN8A 3LT4A 5IN4A 1HE5A 1DIRA 1JQBA 4DRYA 2OUIA 1PZFA 1T4BA 4E13A 3UICA 1G1AA 2Y1FA 3QWFA 4EUEA 3OICA 4R68A 4IGFA 3WB9A 4NBUA 1NPTO 4EJ0A 3IJRA 3EVNA 4GPD1 1E1NA 3L9WA 1H6CA 1DEHA 4E5MA 2P4QA 1KC1A 3PYMA 3JQDA 1FDVA 1ENYA 1V0JA 1ZNQO 1LA2A 2DLDA 5FFFA 3QVSA 1U4OA 1JA9A 3UKOA 2Q3EA 2CVQA 2JD2A 5T64A 1R0SA 1K0UA 2OGUA 2NSDA 3KYCB 3CZRA 4J4BA 3JQ6A 4OKNA 5TT0A 2OO5A 3NDJA 3ZWPA 2HK8A 3GGPA 3OSUA 3RASA 1E3IA 1XCBA 4O63O 4R1UA 1K3TA 3QVXA 3MOGA 4W7IA 2Z95A 4WASA 5EESA 1OMOA 4OHUA 1PGOA 2EW2A 3C24A 2AQ8A 1I2CA 3PWKA 4W9NA 3TF5A 1DHTA 4YWJA 3BXXA 4YAEA 3PK0A 3HADA 1MG5A 1E3EA 4PRLA 2DVMA 3ZWXA 1I0ZA 4MVJF 4RQUA 2B37A 1WMBA 2VYVA 3Q2IA 1HDZA 2Y67A 5HA5A 3Q0EA 3RWBA 1LRLA 3JV7A 4DPMA 1MC4A 3ETEA 2WJPA 3VDRA 4J1TA 1DXYA 2YHIB 4GSLA 2AG8A 2H6EA 2WSBA 4WPGA 3GFGA 3JQAA 4DYVA 3WGOA 1ISIA 4Y6PA 1VSUA 1V8BA 4N5MA 4FGSA 1GPDG 2OBYA 4LN1A 1IHXA 1YL5A 2EGHA 3RC9A 1UZLA 4J43A 3UFXA 5I8WA 5B37A 3RUDA 4I5GA 4CMEA 2JL1A 4J3FA 1HDCA 1WNTA 3HDYA 4PVCA 3GVPA 4DL9A 4BNIA 3GHHA 4J1NA 4CMJA 2QIOA 1U2DA 4D43A 4JJGA 4PG8A 2RHRA 4RZIA 4XB2A 2WYVA 3QA9A 2JJYA 3VH1A 3CUKA 3GG2A 4XRRA 1O89A 1FDWA 2ZYAA 1CERA 1PX0A 2NQTA 3GDOA 2AE1A 1QRRA 1NR1A 2J3KA 2VUSA 1XDWA 1XWFA 2PD4A 1Z75A 1ISJA 5IAAA 1UAYA 4XEHA 5IDWA 5TLSA 5T8KA 4E30A 5BNIA 3EK2A 3HWRA 3NT4A 1H6DA 3JQGA 3L4BC 4QFCA 1ZSNA 5K6AA 2JHFA 4BNYA 1PSDA 2O3TA 2X86A 2D3TA 4AJLA 1EVYA 1Y9EA 1ARZA 5CPFA 4DYDA 2V6MA 3W8FA 1BSVA 2DTXA 4HWKA 4LGVA 2FZWA 4HV4A 3ZWWA 4WNIA 4JBHA 2BD0A 1NWHA 3LT0A 1E7YA 3PYXA 4IZIA 3RUIA 3LT2A 4LVCA 2VYND 3SXPA 3VPXA 2Q1WA 3MZ0A 2D4AA 2VRCD 2P9CA 4QO7A 1CQIA 4WLUA 3ETDA 2AG5A 1L1FA 5JDIC 3OA2A 2BLLA 2JD1A 1YB5A 4YAIA 1EQ2A 4XQGA 4IXTA 2PGJA 1BDBA 4L75A 4AJEA 3OJ0A 2D2IA 1NBOA 4QTZA 2DM6A 1Q2XA 1LRKA 2YV3A 4YJHA 3RU7A 2Y66A 4E2XA 1LDYA 4FR5A 3VPGA 1DFIA 5EN4A 5I9LA 4BNNA 1MGOA 3PI7A 4D7AA 2ZTMA 3EVTA 3N7UA 3ST7A 3ICPA 2PD6A 4QSMA 3RUEA 2UYYA 2CNBA 2VHYA 4ALMA 3M1LA 3LC1O 3U4HA 1KBZA 4ROSA 1K6JA 1U5CA 4BNMA 1Z82A 4KP7A 4E33A 3HHPA 2Z5LA 3OHSX 1LBEA 1FMCA 4KTVE 3OECA 5L40A 1UXIA 4J7UA 1H94A 1U3TA 3PDUA 1CWUA 5A06A 3PIDA 4MKRA 2NU9A 2PY6A 3TL2A 1E6UA 1ZK1A 3Q1LA 3FNGA 3JQAB 4M89A 3DQPA 5AOVA 3OP4A 4F3YA 1CRWG 3GZ4A 4PLFA 2J3JA 1EVJA 1Z74A 2PZLA 2YDYA 3F9IA 3BTVA 3VPSA 3ZHXA 4DPLA 4NH4A 2C2YA 5A3JA 4GMFA 3C7DB 1VL8A 2IZZA 2Q99A 1F0YA 3CZMA 1PL6A 4YR9A 3PLNA 3V2GA 1PS0A 4BNFA 3IQDB 5I7VA 4FDAA 4CQMD 4O59O 2W2KB 4YTEA 1ZEMA 1LDEA 1I3KA 5B4UA 1H9AA 1KETA 4MVJA 4DA9A 4TWRA 3A06A 1BWSA 2HUNA 3LDHA 3U0BA 5JDCC 3GLQA 5B1YA 1X0VA 5JC1A 1E6WA 1IPFA 1U4SA 4CLEA 1QV6A 3PHIA 3TZKA 4NIMA 5F1PA 5DCWA 4UVEA 1HXHA 2EGGA 3FNHA 3CXRA 4J91A 1HSOA 5HWSA 4Z3KA 2D1YA 3FCOA 1SC6A 3MJ4A 1MUUA 4Y8VA 4IIVA 2VOEA 3AU9A 2Q50A 1GZ6A 2AE2A 2HJRA 4IXWA 1H6BA 2W4QA 1WVGA 3LF2A 4Z0PA 2ZQZA 3ZH2A 4CM4B 4A26A 3G79A 2RCYA 4HX5A 4RF5A 4AJIA 1YS4A 3B1FA 4PG4A 1UXJA 1EMDA 1ZJZA 4XDYA 3TSCA 4RF2A 3PQEA 4X54A 1ZZEA 3P2OA 4JXKA 3RUHA 1PJTA 4C7KA 3UOGA 1OAAA 5EERA 1GY8A 3WLFA 5HRUA 3FBGA 1DIGA 1D1TA 1ISFA 1VLLA 4BO6A 4MVJE 3I9NA 1EEHA 4XWYA 3EHEA 2NADA 2GNAA 1PWXA 1I10A 3E82A 5F5NA 3IC5A 3VOSA 1KIFA 1KOLA 4HNGA 4DREA 5ITWA 5T5QA 2V7PA 4W6ZA 3S2GA 1A7AA 4ALJA 3QWHA 5ENDA 3ZWAA 1ENOA 4OQYA 4R3WA 1ONNA 2NQ8A 4E2YA 2C5AA 1TXGA 1JWAB 2SCUA 2OZPA 1VL0A 5G4KB 4B4UA 4ZN6A 5JS6A 3ROMA 2ZCUA 4N5NA 3VTZA 4CM6A 1ZKMA 1CYDA 5A05A 2FPGA 1IUKA 2NTVA 4II3A 2ET6A 4I08A 1P1RA 1P74A 4PLHA 2PH3A 2I67A 4LSWA 1LNQA 4CPDA 1ZJYA 2JCVA 1E7WA 3BMNB 3JYQA 2FZEA 2NNLD 2OP1A 1QLJA 2DU8A 4TRRA 4FJ2A 1P0CA 3DHNA 3SC4A 4FPXA 1XU9A 3TJRA 3DBRA 4IY1A 3WLEA 1HLPA 1DC6A 2G17A 5L45A 2X8LA 4YJFB 5L95A 5DULA 2I5PO 4OYRA 1D4FA 2Z1NA 3QRWA 3RBZA 2F00A 1E0DA 5KTKA 3D5TA 1NAIA 2NU7A 3JQBC 3RKUA 4CLOA 2Y99A 3VTFA 1BRMA 3DMYA 1LUAA 4PLCA 1WPQA 1GV0A 5ER6A 1WP4A 3AJRA 3DL2A 3EAGA 1D7OA 3H65A 3QP9A 4G2NA 3VHRA 5KIAA 5L9AA 3HN2A 1ZSYA 3UVEA 4R9RA 4P22A 4NMHA 4Z0HO 4D3DA 3KHUA 4GWKA 5JY6A 1IB6A 2HLPA 2BELA 1PGNA 4RPJA 2O2SA 1PL8A 3ONEA 1YJQA 4HADA 1XQ6A 3CEAA 1NAHA 3JQCA 4IDEA 2DUWA 4GI2A 4M1QA 2LDXA 2ZJ0A 4BNUA 1N9GA 2VZ8A 3GEDA 3PFFA 1OC4A 4O5OA 4XIYA 1C3VA 1ISHA 1HEUA 3H3FA 3HZZA 3SC6A 2HMTA 1T24A 4MKXA 3ANNA 1YJ8A 4DMMA 1LJ8A 1NHWA 2I66A 3GA0A 3JTMA 5JXWA 1YH3A 5CG1A 3WDSA 1U3UA 2CY0A 1WW8A 2DFDA 1Q0QA 8ADHA 1C0IA 3AUUA 1NASA 5GZ6A 1G0OA 1IHYA 1RM5A 1DLIA 1GEEA 3I9KA 4R1NA 5ILOA 1F12A 2NUAA 5TJHA 3MJCA 1YOVB 3PJFA 4WKGA 3HFGA 4D41A 2QQ5A 1DIHA 1E3LA 3KRTA 4JJFA 1P1KA 2JFGA 2J5QA 4FFRA 4NFYA 2AXQA 5JLAA 2BI8A 3WFIA 4GLLA 3SX2A 1E3JA 3KSUA 4YVFA 4D3SA 1TA4A 1X7DA 2V65A 3BTSA 1SEPA 3M6IA 4MOWA 1Z7EA 3H5AA 3L9XA 2J8ZA 4ALLA 4MIOA 5L4SA 1RM3A 5THQA 1U3WA 4XJSA 2NVBA 3OIFA 1UXHA 3C1AA 3VVCA 2JFHA 4LVUA 4D0SA 2WD7A 2J5RA 4CM7A 1R4MB 2WEKA 4ALKA 2RHCA 3TZCA 3AY6A 4UUPA 1EUZA 1GZ4A 5FYDA 5C7OO 2B36A 2DBRA 1PJ4A 4XGIA 4ZQGA 1UP4A 1HTBA 5IZCC 3ZNNA 3IS3A 4FCCA 2ZYGA 1U9JA 2GDZA 3T7CA 4CM8B 4CMKA 2I76A 1LLCA 2X5JO 4E5KA 4UULA 1OOEA 3QWBA 1HF3A 4BO7A 1O9BA 1RKXA 1MXHA 3DBRB 1GYRA 1B3RA 4CR7A 4BNHA 1X15A 1K5HA 3IKVA 3K2EA 4QT0A 5U4QA 1KVQA 1QYDA 3GVXA 5U1PA 1E5LA 2VT3A 4OXYA 1BXKA 1UP6A 5FEUA 4NJMA 5JCXA 2YJZA 5CAEA 2EWMA 3WBBA 4CLOB 4YBZA 2AQKA 4P38A 3L6OO 5AVOA 1L7DA 1QR6A 1R37A 5IJZA 9LDTA 1U7HA 1BXZA 1NVTA 1NM5A 4BVAA 4YYZA 4KOAA 1JU9A 4D42A 4PLZA 4Q39A 1OI7A 3DFZA 4LCJA 3GGOA 3DEYX 4L74A 4HNHA 1LSOA 1ZMTA 3KYDB 3W8EA 1SOVA 2POQX 3VKUA 5THKA 1KVUA 3MWEB 4CM9A 3WSWA 3KLPX 1M6HA 1PZHA 3BIOA 3DOOA 3HJAA 2HQ1A 1I3MA 2I6TA 4W9NC 2Y1EA 1AXEA 5IN5A 2ZB3A 1AHIA 3TQHA 3AY3A 2VZ0A 4FFNA 2RAFA 3D3WA 1QKIA 4IQ8A 3ANLA 2PK3A 4CMCA 3U9LA 1JKIA 3DOJA 4L76A 3WQSB 2W98A 3INGA 2FN7A 1V6AA 3OIGA 3JYNA 4GKVA 2OL4A 5CEFA 6LDHA 3H2SA 4WNCA 4BO0A 4WLEA 2VUTA 5EL0A 2ZYDA 4H7PA 4CL8A 1XA0A 2HKIA 3KTDA 4CMBA 4Z6KA 1L7EA 4OJNA 3DBVO 3F1KA 3ON5A 4A7PA 3F1LA 4Z3DA 1NFRA 1HETA 2WDZA 2Y05A 3A4VA 3GGGA 4GMGA 4RVSA 4CMEC 2A94A 2Q4EA 5KJ1A 4XDZA 2VHVA 4DVJA 4AL4A 3NRCA 4BKOA 3EY4A 4B3HA 1S7CA 4YT8A 1YQXA 4FN4A 4S3MA 3QW2A 3HE3A 4R01A 1XELA 5AXBA 1EBFA 4WOKA 4DPKA 2UAGA 4FFPA 2FR1A 4JIGA 2QHXA 3PHLA 3ZWOA 2TMDA 4UREA 4CM1A 8LDHA 4KTTE 3BMCA 3WGGA 2NVWA 3CIFA 3AM4A 4LRSB 4YAKA 5T8KC 2W2LA 1KYQA 4PGFA 4XCVA 1E7QA 4C4OA 1KC3A 3G1UA 2DT5A 5K6AC 3BA1A 1GQ2A 3U09A 3AWDA 3QWAA 3TZ6A 1FF9A 2RIRA 4RPKA 3AI1A 1NQAO 1XGKA 1B7GO 1OFGA 3LQFA 1HWYA 2X58A 5DDIP 4ZICA 4B8ZA 4B4WA 2YYYA 1V9LA 5TNXA 3TWOA 2O4CA 2G0TA 4YJGA 3BMOA 2BFOA 3JYPA 4GX2A 4JN6B 2Y1OA 3FTPA 4D0RA 1WDMA 1OZAA 3VKVA 5A4DA 1MFZA 2B69A 3QVWA 3L4SO 3EYWA 4E12A 1UDCA 5EJ2A 2CD9A 1DIAA 1C0PA 3ONDA 5G0UA 3GFBA 4R51A 2VRBA 3ZGYA 2YFHA 1WLYA 1TT7A 2QZZA 4W7HA 3RI3A 4C7JA 1Z6ZA 5JMWA 3M2PA 4NU5A 3WXBA 4E6PA 2QZ9A 1ZK2A 3OJOA 1X1TA 5TJ9A 4D44A 2X9VA 3HQ4O 4CMIA 4U0KA 5C7IO 2ZTLA 3D0OA 3KZVA 1BVRA 3FPCA 4AJPA 2I99A 5BSEA 1I36A 1E1LA 2BKAA 1B16A 1K2WA 4GGPA 3IP1A 3I3OA 1TEHA 3E8XA 4Q3BA 4R4JA 1HE3A 2FSVA 1ZVMA 2H5LA 3JD0A 1DLJA 1MXFA 4YT4A 1RPNA 3I9JA 2ZCVA 4TRJA 1XU7A 5LC1A 3BTUA 4J16A 1VI2A 5LCXA 3KSZO 4DQUA 1VJ0A 5GZ1A 4MVJG 1LQUA 4GSKA 3R6DA 4P4NA 5DZSA 1BDMA 4NK4A 5F3RA 4GX0A 1ADFA 1FDTA 1ZSVA 4LISA 3NTOA 4RCVA 1X13A 2A35A 2WE7A 2WMDA 3ZWMA 1LRJA 2AMFA 2X0NA 4U8GA 4RL6A 1SOWA 1JVSA 1QV7A 3OF2A 1QYWA 2I65A 3JQ7A 3JQ8A 5DF1A 3BZUA 4ND1A 3WGTA 3PTZA 1HZZA 4MPDA 2IE0A 1GUZA 3GUYA 3WTCA 1ORRA 2VYVD 1HSZA 2ZIZA 1HDYA 4NJOA 4RDHA 4XA8A 5G0SA 3DBHA 4GX1A 4DC1A 4MIEA 3NT5A 3U3XA 1DJQA 5BNTA 4LK3A 3RKRA 3GVIA 2C7VA 2VWPA 3BMCB 4U6QA 3VH2A 1WWKA 2NTJA 1GFSA 1T2DA 1NFQA 4WCFA 5H81A 4ALIA 5U9CA 4M86A 3EW7A 4E3ZA 3JQAD 1R4NA 1YGYA 5G0WA 4R5HA 3I6QA 1W6UA 3INTA 1D3AA 4BNWA 4EZBA 1NVGA 4FFOA 1JVBA 5TQVA 2J6IA 5A9SA 4BGEA 3Q9UA 1UAGA 2PKQP 3MJTA 4XD2A 5HTOA 4B4OA 4DMLA 2IZ1A 3AFMA 1PU2A 2PZMA 3OJEA 2H63A 3LYLA 2LDBA 1PTJA 4NBRA 1W4ZA 3B6ZA 1GV1A 2CDCA 3T4EA 4CUZA 1PQUA 2GLXA 4Y6RA 1Q0HA 1A5ZA 3WIEA 2AW5A 4ITUA 3WIDA 3H4VA 3M2TA 2GUGA 5MGBA 1PWZA 3HSKA 3RAJA 1IY8A 3ROKA 1XKQA 4XX0A 1I01A 4RPHA 1B15A 5ICSA 1M67A 1QMGA 2VNAA 4Z9XA 4YJDA 1T25A 4QO8A 4R16A 4EGFA 1PZGA 5CFZA 1V35A 4BGUA 5KKAA 1KS9A 4J0EA 4UUNA 3ZNQA 3KYBA 3W4IA 2JAHA 4J49A 3FWNA 4B3IA 3DAPA 2EIHA 3GVCA 3ITKA 4TVBA 1ISGA 4J4HA 1VJ1A 3PYLA 4L4RA 4G65A 4INAA 2YY7A 4UUOA 1YE3A 5DCYA 3CSDA 1QYCA 3ZNPA 4HFRA 2C0CA 1BW9B 3JD4A 4IJKA 4PZEA 4Y98A 3ONFA 4KWHA 4Q3NA 2BF7A 2ZJ1A 2Q1SA 3DWFA 2VHXA 2DBQA 5CPBA 4J9VA 4CQLA 4CJXA 4CUKA 1NPDA 2YV2A 3KVOA 1LLUA 1UR5A 2QYSA 1NQTA 4E32A 3UUWA 3C85A 3AW9A 2HDHA 1I33A 4EEZA 1E3WA 4KZPA 1GUYA 2UVDA 1P1JA 3IMFA 2BGKA 3BYZA 4BKPA 1D1SA 1LC3A 3NT2A 5JYEA 2GD1O 3CTMA 2B5WA 2NU6A 3RUCA 1DPGA 1GDHA 3PXXA 1YQGA 4NHEA 1CDOA 3JQ7B 3X2FA 2E4AA 3PLRA 2X4GA 3AUSA 5CHEA 4KDFA 1E6EA 1KEUA 2G5CA 2QYTA 2WWRA 3W4JA 4HFNA 3KEOA 4W4TA 5KKCA 9LDBA 3DBHB 4OMUA 5IZ4A 3BMQA 4ZA2A 2YFQA 4GKBA 3PVZA 3P19A 4J9UE 3OETA 1HDXA 2BHLA 3U4IA 4R54A 3F6YA 3GN2A 3H6KA 4I1IA 5I7EA 1TT5A 1WAMA 4J1QA 2FR0A 3I4FA 3WS7A 3NGLA 3AI3A 1MP0A 1N8KA 2AA3A 3QVOA 3U5TA 4QQRA 5A3VA 1NVMB 1MV8A 3S1LA 3UAGA 4OSPA 1DSSG 4HP8A 3H2ZA 4GWGA 4YQYA 3WGZA 3QLJA 4FC6A 1F8FA 5KVQA 1NPYA 1RM4A 2P9EA 4U7WA 1PL7A 5JO9A 3RSHA 1X1EA 3D4PA 2DFVA 4M87A 3H8VA 4IQ0A 3LLVA 3RC1A 3BAZA 3R1IA 5COAA 2GN6A 2IZ0A 4CODB 3LLSA 4RJTA 3W6ZA 5DCUA 5JO0A 4MVJD 4BMSA 3RUAA 3I83A 1GTMA 1WZIA 4U5QA 3ZZNA 1BG6A 3COSA 3JQ9A 4EEXA 4JROA 5TF4A 1H0KA 1PGJA 2X7HA 2GYYA 3EGOA 2IYPA 4UVGA 1AHHA 1D8AA 1HLDA 2A92A 1U7TA 4YXFA 5AXAA 4OL9A 3QSGA 4GX5A 3CE6A 3JD1A 5A9TA 2QG4A 3DONA 1K89A 2XAAA 4FOSA 3RBXA 3WMWA 4GAEA 5CDGA 4MVJI 3WGHA 1NHGA 5T6BA 4E2ZA 3NTRA 5MDHA 3RC2A 3OMLA 5DOZA 4YPOA 3PP8A 4OXNA 1GD1O 1DC4A 4ALNA 2C82A 2IRWA 3PWZA 3ZU5A 4BNXA 4IJWA 4RPLA 3C7AA 1YONA 1JAXA 3MTGA 3S55A 4CLDA 3JQGB 1LDBA 2FPPA 3HDJA 3AM3A 1YBAA 1QSGA 4TRMA 4BO9A 1M6WA 4D79A 5CG2A 4OH1A 1JN0A 3GEGA 4KUEA 3V1UA 1NXQA 1PJCA 3BHJA 1LSUA 1M66A 3GR6A 3JQFC 5TT1A 3OQBA 4LRTB 3SVTA 1B8VA 4QX6A 3WNQA 1I2BA 4UAGA 1CIVA 2Q1TA 2D5AA 3IKTA 4N18A 4DBZA 4WOJA 2Q2QA 4BO4A 3A9WA 3GF4A 5A5EA 1F17A 3D7LA 3CMMA 3IIEA 4P4LA 1C14A 1H2BA 3GMDA 1BVUA 4ND2A 4BO1A 3DMTA 4PZCA 1J6UA 5CEEA 4E0BA 4F45A 1J5PA 4J2OA 4P4GA 3GZNA 3U4DA 2ZTUA 4Q9NA 4YJHB 2ZKLA 1KVTA 1BXGA 2D8AA 2DBVO 1LSSA 1R66A 4OQZA 4YACA 5GZ3A 3EZLA 5IFLA 1U8FO 5IDQA 5FWNA 3P7MA 2VCYA 4RVUA 1HDGO 3ZCXA 5TIIA 3I6IA 1PR3A 4L73A 1DRWA 3PFWO 2YW9A 1ZXBA 1HYGA 1C1XA 1I30A 2GCGA 3LU1A 2O4UX 4CMGA 1PR9A 2J3HA 2YZ7A 4B7XA 1MFPA 4RDIA 4CV2A 4O1MA 2WD8A 3RQSA 4XKJA 4DQVA 3ZHYA 1ML3A 1MA0A 3E5MA 1F06A 4G5HA 1VKOA 1YBVA 5COQA 3CINA 4WK6A 3WNVA 4IS2A 3DZHA 5J23A 1KEPA 3ETGA 5DN9A 5CDYA 1H2HA 4WUVA 3DB2A 1P77A 1I3LA 2P5YA 2V6GA 3DO5A 1E1KA 4HXYA 1JDJA 3HFSA 3O03A 3OM9A 3PZBA 2ZATA 3H9UA 3ICCA 3L77A 5JYDA 3B1JA 5TRTA 1VE9A 4BV9A 1R12A 4IZHA 2JKVA 1ZFNA 4XGKA 1W73A 2GZ2A 2WYWA 2HMUA 4FOOA 5DBIA 3L4BA 3PEFA 4Q3CA 4W82A 1E7MA 4J7XA 4BNJA 2CZCA 3DC2A 3FPLA 3KM0A 4BNLA 2X5KO 4RLSA 4YQZA 1VL6A 5JFOA 5A5FA 2UUOA 4YA6A 1WDKA 4EUHA 2VWHA 1EDOA 4JQCA 4IGEA 4XQCA 5FI3A 3OEWA 4NI5A 1DHRA 2JAPA 1GR0A 4LW8A 3CH6A 2HO5A 4BKRA 4WEOA 4E4YA 3F3SA 1YO6A 4CM8A 3ULKA 2C07A 3OEYA 1QORA 4NPCA 4RF4A 2AHRA 1P45A 1LTHR 3Q9NA 5BSGA 1GQQA 3GNTA 4J1SA 2O7QA 1OBFO 1Y81A 1U2GA 4M54A 2B4RO 3RBVA 2B5VA 4PZDA 4A73A 3HDHA 1VSVA 3O9ZA 1DAPA 3WQQA 4TVOA 4Y6SA 1FJHA 1HRDA 2GZ3A 3RD5A 1XG5A 5EQDA 3SJUA 3IUSA 3N58A 1HE2A 4ND3A 4BUCA 4XB1A 2CUKA 1I24A 2R00A 5EINA 4E5YA 4H15A 1BGVA 4HUJA 1ZXLA 3BHIA 3I9OA 5BNFA 4ZHSA 3HB5X 2CVZA 3WX0A 2X5OA 4WJZA 2OOSA 3FD8A 4I5EA 5DOVA 3GUCA 3NJ8A 4MVJH 2WTBA 5HS4A 3WICA 3DDNA 4IIUA 5C7LO 1IULA 1A9ZA 3D4OA 3GN1A 4OOEA 2EP7A 4XYMA 3WMXA 2B83A 2YUTA 4KUHA 4Y9DA 2O7SA 5GMOA 3ASVA 4WLOA 2X1HA 4FFLA 4JX8A 4CMHA 2IDZA 2IEDA 5BT9A 5EPOA 3RVDA 1ZO8A 3ITDA 2BRUA 5LDGA 3VAZA 4RV9A 4JNKA 1XLTA 4WLNA 1EK5A 2BMAA 2VUUA 4QUKA 5KWEA 4Y67A 4ZQBA 3MEQA 1ZK3A 3IJPA 3QHAA 1CETA 2ZB4A 2HAEA 4EDFA 5JE8A 4R1SA 4XYLA 2HRBA 3T4XA 4I9HA 3IAHA 4JJIA 4ZJUA 3RIHA 3KLMX 5IDYA 3O8QA 2YDXA 3AY7A 3F46A 3JYOA 5CEJA 3HG7A 5LDHA 5I8ZA 2VTEA 4CM9D 1ZBQA 3ZW9A 2TMGA 2JD0A 1T26A 4J6FA 1QG6A 4FD3A 4H16A 1GZ3A 1JKJA 2BFMA 3HN7A 1B8PA 2VOJA 4EYEA 3QQPA 4DTIA 3GC6A 1IE3A 3WOHA 3UCEA 4S1VA 5F21A 1YQDA 4PVDA 1PZEA 5L4LA 3K2BA 2E82A 3B1KA 4BNZA 1GCOA 1YDEA 1R0LA 2V6BA 3D5QA 3KEQA 4YCAA 3KUXA 3GY0A 3EDMA 1J0XO 1N9GB 3ABIA 2R2GA 4UEKA 5AYVA 5TC4A 5TSDA 4ESOA 6ADHA 3WGYA 1X7GA 3ZU4A 3PRJA 4DIBA 2ZB8A 4BGIA 3QE3A 4K6CA 1AXGA 3ZV3A 4CR8A 2NVUA 1EDZA 1QYXA 1GUFA 2HMVA 2NACA 2PNFA 1H5QA 4JLWA 3PWSA 4L0QA 1C1DA 4MVJP 1U1IA 4EITA 3RROA 3DBLA 2A4KA 2C29D 4IDBA 4CLRA 1RJWA 3GNSA 3G0OA 1IZ9A 4UEJA 3PGXA 2Y0DA 4J2HA 1Y8QA 4PG7A 1T4DA 2EP5A 2GR9A 4DIOA 5ENVA 5DP2A 2VN8A 2I9PA 2C59A 1ZMOA 3RJ5A 2E6UX 1N92A 2X6TA 3V1YA 5IG2A 1W8DA 1LLQA 4PIVA 3ZWNA 3GPDG 3TOXA 5G2OA 3AFNA 3NX4A 1DC5A 2DQ4A 3C8MA 3Q2KA 1LQTA 2BI7A 2W2LD 5DBGA 3W8DA 1H9BA 1G6KA 3UCXA 2CVOA 7ADHA 1EUDA 2WD7B 2PKQO 4PLTA 4B79A 1NQ5A 5L7TA 1Q7GA 1DIBA 4IINA 3QY9A 3GH3A 3BTOA 2RBEA 3WFJA 4R3NA 1WZEA 2CF5A 2EG9A 4RGBA 4TKMA 5JCJA 3ZU3A 3ZW8A 5KJFA 4TSKA 3ZHBA 4OO3A 2FMUA 3ZV5A 3H3JA 4O0LA 2C54A 2O3JA 1A72A 4K6FA 4RF3A 1UDBA 1ADCA 1FDSA 4CM5A 4YEDA 1NFFA 2J5KA 1IOLA 3G3EA 1B26A 1F8GA 1HE4A 4YDRA 3F5QA 2GF2A 1VKNA 3WG9A 4LMPA 1NWCA 4OXKA 5F1KA 2VHZA 3STHA 3ZHZA 2I3AA 3KYCA 1GYQA 1CJCA 3QWIA 4BNKA 3W6UA 2P9GA 1J49A 1K6XA 5ITVA 2YV1A 2EERA 2P4HX 4NJMB 4IJVA 1EE9A 3GPIA 3Q3CA 2HMSA 3I9LA 4R1TA 3MOIA 4MP3A 3ZDFA 3WGIA 3E5RA 3ROPA 1YB1A 3OJFA 4A03A 3DZIA 5TS3A 1GQYA 3FI9A 5KJEA 4AJKA 3D3EA 4BO3A 4RPGA 2GSDA 4PFJA 2Y0CA 1Y7TA 1SB9A 1LLDA 5ER9A 3D1LA 1ADGA 1JWBB 4RVGA 2PZKA 5GY7A 3OIDA 4AJJA 4HKTA 2FSSA 2QW8A 1HKUA 2EJVA 2EKQA 2HU2A 3FSRA 4B3JA 3GRKA 5IF3A 4AICA 2PWZA 2YHIA 4GQAA 3RFTA 1QP8A 4IJUA 2DPHA 3KSDO 1GEGA 4IDCA 4IDFA 2WYUA 3DTYA 1MG0A 1NYTA 4PLVA 4F6LA 3NDIA 4M55A 2Y0EA 5DBFA 2QRLA 2VQ3A 3D3WB 1A9YA 3JD2A 1PJ3A 2A9FA 3ZWVA 4N7RA 2FY8A 3WJ7A 3DOCA 1DFGA 1EE2A 3TZHA 1LDGA 1LI4A 1SB8A 1Y6JA 3LT1A 3MTJA 3A14A 5L7WA 4I9UA 3W4KA 2X23A 2G1UA 3TOZA 3Q6IA 1DBVO 1LC0A 1BHSA 4IMPA 2JCYA 3VDQA 2EXXA 1M75A 4Q3DA 2HK9A 2PV7A 3VVBA 2GERA 2VWQA 2PLAA 2X0JA 2Q45A 2XXBA 3E9MA 3NGXA 3H5NA 1YXMA 4A2CA 2BH9A 1NP3A 4HFJA 2E37A 4M49A 5HS6A 4WLFA 4QFDA 5A03A 2GRAA 1XQ1A 4U6SA 4XGNA 3E9NA 3ENKA 4RVDA 3R3JA 4B7CA 1HT0A 1DB3A 3ADOA 4DBVO 3DHYA 3F4BA 3DZGA 4IS3A 4PLGA 3UH1A 4UVIA 3QV1A 4ZRNA 4ZVVA 3X2EA 4RQTA 4QEDA 3VC7A 5JMPA 1M2WA 2F1KA 1BTOA 3AU8A 4BB5A 3E18A 4BOYA 3UW3A 5DT9A 3ZNOA 4EJ6A 2W8ZA 4XZ3A 4EBFA 4I5FA 3H9QA 1VPDA 3GAFA 4K26A 4PG6A 2NWQA 3OJLA 3WWYA 4BNGA 1DAOA 2CMDA 2XPCA 2V6FA 5JW6A 1GU7A 3AOEA 4PLPA 4RVHA 1VC2A 4WCDA 3GVHA 1EFKA 2H9IA 3NUGA 2BFPA 4J90A 5L7YA 4LSMA 4EI2A 3UHAA 1KVRA 3ZV4A 4AFNA 3HDQA 3WSVA 5A1TA 3MJEA 4NDNE 2EJWA 2AEMA 4KDEA 3AI2A 1N1GA 4BO5A 2O3RA 4YJGB 3BMOB 4NBWA 4MP6A 5EMHA 2CF6A 1PIWA 1I2ZA 1SEVA 4J0FA 2EKLA 3K31A 3QJ5A 3AOGA 4RO0A 1T2AA 2UV8A 1ONOA 3K5PA 3WTBA 1ONPA 2Q2WA 4YAJA 3DMTC 5KNLA 2P68A 1X14A 3KO8A 2PGLA 2RH4A 3WR5A 4BGVA 1TVEA 3FR7A 1DRUA 4P8RA 3FN4A 4FC7A 1RM0A 4KQWA 2EF1A 3ZV6A 1AN9A 1VM6A 2CSUA 1YRLA 4TKLA 3D64A 1E7RA 5BQFA 4CMIB 3FWZA 3G1TA 4AG3A 4MP8A 1AUPA 2BFAA 3U62A 3E1KA 1KY5A 1YWGO 3O38A 5ILGA 4BB6A 4FS3A 1HL3A 1P3DA 2GASA 5TGDA 1UZMA 4CR6A 4QXMA 2XF8A 1IYZA 4FQ8A 2PKRA 3DZBA 1JW9B 2GO1A 2DUUA 1H6AA 3WGQA 3U49A 1Z45A 4CM3A 3RJ9A 2W2KA 3TL3A 3PHGA 3IP3A 4DQXA 2B35A 4TMFA 3PZRA 5ICMA 4WLVA 1FXSA 2G76A 4R41A 2O50A 1ADBA 5JBIA 1XEAA 4ZQFA 1FK8A 3KXDA 1S6YA 2DPGA 4J7CA 5TX7A 2JFFA 7MDHA 2W90A 1YVEI 3DAFA 4ND5A 3JQ8B 3O26A 4FW8A 4OKIA 4XQ9A 2Q2VA 3LC7O 4EUFA 3PHJA 1RWBA 4JBIA 4CMAA 3RU9A 3KETA 3MJVA 4U0JA 3C3XA 3GDGA 2VNSA 3ZN2A 1R6DA 1T2EA 4UVDA 2FR8A 3S2EA 1RYDA 3UF0A 1R0KA 3PGJA 4GLOA 1ENZA 1B3BA 2PD3A 2XXJA 4CM4A 4WCFB 1MLDA 1DJNA 1ZW1A 1ENPA 2OP0A 4XR9A 4FIZA 1R4NB 4CV0A 1LSJA 3WJAA 1QXSA 1EVIA 2VWGA 3RFVA 1ZK4A 3CKYA 5A9SB 1T1SA 1UZNA 1F14A 1DDOA 1ZEJA 3TN7A 3VPHA 1XIVA 1DRVA 2VZ9A 5CDSA 1N7GA 5AXCA 1WDLA 1V3TA 1A71A 4UEOA 4XQEA 4AJ4A 4MIYA
chains in the Genus database with same CATH superfamily
2ZM6B 1GPUA 1V3VA 1KP3A 3TCNA 2VYNA 1T8TA 2JVIA 4H27A 5BMVF 2C20A 4K40A 4AURA 2VRCA 4NSNA 3TE6A 3B12A 3PDIB 3W2EA 2OXIA 4BO8A 4I8XA 4IIEA 5G4KA 4D3FA 3FNBA 2VUIB 5LL6P 1UT5A 3OAAA 3C1TA 3HB4X 3PRKE 1B6TA 4IAOA 5H83A 3ZI0A 1KAEA 1O0SA 1ABFA 1PBNA 1PK9A 3N0XA 4ZT2A 4DMGA 2AR0A 1IY2A 3C7CB 4GRDA 2NYUA 1WKCA 2O1EA 1K5DA 1DXQA 2NV6A 4HNUA 2YVAA 1XTUA 4EW1A 5C4IA 3N7AA 4RORA 1DT3A 2L18A 3OH8A 3PXCX 4NE2A 2OA0A 3K9GA 1WBJB 1AQUA 1X39A 3EWAA 3AR4A 3HM2A 3W1WA 1Q57A 3IQZA 3WGJA 1CUGA 4X44A 5F2KA 3ZY3A 2ATEA 1YVDA 1JEJA 4DNOA 3A9SA 1T35A 4YMIA 4OHFA 1KDZA 3DHEA 3DR5A 3KTFA 2B0CA 3P0EA 1WLSA 1V39A 2JFWA 2A5JA 5AJVB 3ZWYA 4CG3A 2EHJA 3DZFA 3PUKA 4JNCA 4Q4JA 1W0CA 5FORA 1L8LA 2GPTA 4CQLB 2PANA 3B1VA 3P9QA 3Q3HA 4JOBA 3RWOA 1TYCA 1UJMA 1HDRA 5H1YA 3MT0A 3VH3A 1RU3A 2C9ZA 2FRXA 2ZS9A 4H4CA 3QPDA 3EW9A 4YGYA 2H52A 3SHOA 1OHHD 2VAMA 3TLEA 3QKTA 5HZHA 2B9EA 3J7AC 1NNEA 3PC7A 5GOTA 3HXQA 3ICQB 3R3VA 4Q15A 16PKA 4N3CA 4CG1A 4TT3A 3SPXA 3AG6A 3MWDB 1YBMA 4QYTA 1ZOSA 2WWIA 2IVFA 2EFGA 4PS0A 3RM3A 1REQB 1OQAA 3CGGA 2H4HA 2R5FA 3JARA 2APJA 2WIGA 1ZN2A 3CRNA 2NU6B 2BSAA 4I46A 3RCBA 4LC0A 3FR8A 4Q16A 1FP2A 2CXHA 2ZK7A 4R1PA 3ECAA 3ZU2A 1R9JA 1EFCA 2P2LA 3NLLA 5EHNA 4KYTA 1U2EA 4Q4AA 4N40A 2R6JA 2WSMA 2YRFA 2ZSDA 1IVSA 2XQGA 1IZ0A 4O2AF 2XUPA 2VYFA 4AZSA 1N2CA 1VP9A 2EYQA 3BMQB 3V1KA 2V8OA 1JPNA 1U1CA 2BP7A 2C5LA 5A9RA 1UBHS 2GN4A 4DMUB 2GXSA 2YMPA 2CJWB 2VDPB 3U3DA 2R6DA 1RXVA 3T1HB 4HRAA 1J4AA 2H3HA 3U37A 3AJDA 3OA0A 1YK0A 3UGQA 2FX5A 2V7EA 4AN4A 3ESAA 4QU8A 3ANTA 5FUQA 3W5BA 1YOVA 1O95A 4L4XA 1TJ4A 1ZQ9A 4PQFA 3ROTA 4POAA 5EAIA 1UFKA 3RV3A 1T8YA 3PT9A 4TMZA 1PJLA 3PDJA 4BMCA 3IHKA 5C1OA 2DB3A 3NBUA 1SHUX 4II2A 1ZM2A 2PTGA 3VSBA 3DZKA 2X5XA 1ZH8A 3BRWA 4A0QA 1G38A 4HBGA 9GPBA 4FUQA 2FP4A 4Q05A 4ABYA 2WLSA 2J6HA 3O8RA 4KDRA 2V7TA 1RLIA 1GA6A 4BZXA 5LP6F 1I7PA 2VKTA 2FPIA 3HJCA 3JVEA 4DLSA 5CDTA 5IT5A 4JP2A 4KYUA 4RIEA 3PQDA 2C7GA 3P5SA 4B8WA 4KVZA 3VC3A 1OT3A 3D7RA 3PITA 1FRZA 2PJUA 5EXTA 2OO7A 4DXHA 3PC2A 1DJMA 3ZY2A 1QTIA 4XM2A 4PSUA 1OV6A 4M7WA 1YS1X 5B2FA 1E99A 1H93A 2WNSA 3RSGA 4F46A 4GP6A 3UAZA 4TXMA 2A5DA 1ZP6A 2VLIA 4FWTA 3OE1A 4CU2A 3OFSA 2FEWB 1JSLA 5CLQA 1N2CE 2ZWPA 5SV2A 3L8ZA 1Z22A 3OX4A 1CQJA 3I6BA 3CKKA 3N1UA 4G26A 5JAQA 4V24A 4LV8B 4RIHA 4BMZA 4YO8A 2Q8PA 2YVKA 3PIIA 3GOHA 1EWRA 3PPIA 4AM8A 2HPVA 1CUJA 5KVCA 1N4DA 2GTHA 1E5QA 4G1FA 4DUGD 1GPJA 1HQKA 4FSXA 4RFLA 5IAJA 2F4VB 1TLTA 1NMSA 2AVDA 2GKSA 2JRCA 3EB9A 4X1YB 4UCFA 4WVLA 1VLJA 4CCSA 1RLTA 3L02A 1RQGA 4A27A 1RRPA 4JXZA 1QGAA 5ALPA 3E9QA 3IEMA 3WA6A 4R9SA 3SEFA 4BV8A 1ISPA 1BJKA 1TO2E 2QM3A 4AN1A 4QYMA 3RFXA 2H2IA 1YKGA 5DEOA 1ZD4A 1XR3A 2H1SA 1XJQA 1PYDA 1B0AA 2WVGA 2PIAA 4KBYA 1XTKA 3NHAA 4ISCA 4U02A 3QXCA 1ZIDA 4WVFA 4YDHB 5FCDA 3LE8A 4GPZA 3U40A 1MC8A 2QQFA 3P2MA 2ZSKA 3MBOA 3CWCA 3KVVA 1HZJA 4PCAA 2R8XA 1J8DA 1KI8A 4CTJA 5BWLA 5LDHA 1TYBE 5F9HA 2QVXX 1Y3IA 1K6IA 1XT6A 3AEUB 4JEIA 3VR5D 1JEQB 3NCHA 2QRQA 1P73A 1MB2A 1Z7BA 1IPEA 2ECKA 3MWEA 4W1RA 2Y68A 1G3UA 2P69A 4E5NA 4MW9A 1PJBA 4CI9A 4ZVSA 1PJ2A 1POWA 3L6CA 3C87A 4MW2A 1YZKA 3RS3A 1ID1A 1A4RA 1LFAA 5ARDA 3KHTA 1PVDA 3RU2A 3LSYA 2P3OA 3AY0A 4B31A 4BFWA 4URVR 4XYBA 4RTQA 1NRWA 1Y1RA 3A2MA 4TKZA 1T2CA 4BVGA 4RIFA 4KSCA 4I36A 3C15C 3C45A 4JX9A 5D3MA 1K5PA 3DOIA 1TI7A 1QTNA 3DUFB 1UBLS 2P2SA 4K81B 4TRNA 4RTRA 1FPMA 1QOPB 3FDIA 3HUFA 4DWVA 2HNBA 1RYEA 1AVTA 1G0NA 1OFIA 2Y1XA 1VCIA 2AFVA 2X40A 3F0TA 3LK7A 4JGIA 4FE3A 1CNEA 4MI3A 3WV4A 4YUWA 2I8AA 1I1OA 3QEMB 1A4UA 1P9LA 1A95A 3BJZA 5LQRA 1R5OA 2P75A 3BCUA 2EBWA 1JI0A 3HGQA 3LHIA 4UXIA 4YXWD 1UC5B 2KLHA 4DLLA 3O1JC 1AK9A 1SCIA 1KJNA 2WQ6A 4ZVNA 3I2FA 3B20A 1C1XB 4W8OA 5ED0A 3A6PC 4TLBA 3N2KB 2AOVA 3U7QA 3O92A 3NHZA 1KVSA 5LYJB 3KSBC 4DY4A 3AM5A 2WWVD 3W5CA 2PZJA 3FHLA 2CLEB 4O4LA 2C4VA 3WAJA 4YRBA 3A37A 1DX9A 2PR2A 2B4TO 3VX4A 2C8JA 1Q2UA 2VJAA 1JTVA 2P91A 2A0WA 3IGFA 3E9CA 3R3UA 3BFXA 4BYGA 1ZUWA 3BGWA 1SU7A 2OB2A 1DV2A 2GEJA 3GDFA 1WPXA 3HWWA 1PJQA 4TLLB 3TVTA 3NDPA 5L53A 4IRXA 3OJCA 1QFZA 3B52X 3BFVA 5E7JA 1OXBB 1NSYA 3EHDA 4MI6A 4P5DA 5HJ7A 2HMWA 4D8UA 4QOHA 4YAWA 2E4VA 3AP1A 4IGKA 2HCTA 4KAXA 5AM0A 5E3IA 1UMDB 4JEUA 2GZMA 1IZ7A 4B45A 3B82A 1T4MA 4JS0A 1RC8A 2XZLA 2HRCA 1UKZA 2YYSA 3H9JA 2ODBA 3LGAA 4UNIA 2X0DA 1KKUA 2RGNA 4WY8A 3RUFA 2FEPA 4Q4CA 3V8BA 2EKPA 3VPSA 2DEUA 1BMTA 2VAXA 1UFQA 4JYAB 4PX2A 4URYR 3ROGA 2O14A 4YV7A 3JQFA 3JASA 1NN1A 3FROA 3AOEC 3D6TB 4UNQA 3CPSA 3SLKA 5JC8A 1DO0A 2G4VA 3NOVA 2P6MA 4MULA 3MCZA 3S5JA 5IT0A 2VSNA 3WBFA 2CL0X 3D1VA 5EUQB 2OPBA 4WA7A 5IT4A 2QX6A 4EPTA 4KGXA 1ZI6A 2C03A 5HBRA 1E63A 3GFOA 3ZOZA 4LRUA 3ZCUA 1NW6A 2EX4A 4DC0A 4L78A 3SF8B 4TV9F 1SXJD 4HTFA 5B1DA 3LK6A 1DEXA 2BR4A 3JATA 3NHBA 4E21A 2HJ9A 3GQVA 4Q66C 3UJ3X 4JK3A 4A3SA 3R3SA 2Z9BA 4OXQA 1CUEA 4L5JA 2J67A 4KR9A 2OMEA 4J29A 2HYDA 4L8VA 2WJ6A 4IPTA 1Y9ZA 1SQ0A 3JR3A 2WFLB 1WZ2A 1HURA 3Q3IA 3AYXB 4TZKA 2EZTA 1Q6ZA 3IUPA 2XT9A 2LXNA 2BTQA 3FW1A 2I22A 4J4TA 4DLYA 3D0KA 4LCBA 1CSEE 4ZMRA 1VE5A 1GAEO 3G88A 5M29A 3U7RA 5BN5A 4C3UA 1IAVA 2C2KA 3K8ZA 4ZGWA 2QLJA 1NVDA 4A8JC 4KQ2A 4G0NA 2EV9A 2G1AA 1FRVA 3HCBA 5KOJA 1OZGA 1XYGA 2J30A 3ED1A 5C5IA 4P7BA 4V1CA 1OFUX 3V2UA 1ULTA 1BMDA 2J3DA 2ZPTX 3CH7A 2YVUA 3QNUA 4C06A 4C4PA 4LF4B 2HL6A 2J3IA 2OZVA 2ZAIA 5ALUA 1OU0A 2WILA 1JFLA 4XM1A 5FADA 3U5ZB 4BMYA 1H4TA 3QEOA 1O7JA 2VJKA 3WGVA 1CKEA 5EE1A 3I2GA 2GF0A 4MVXA 1ECLA 4BQRA 5A04A 3JVVA 2DKFA 2XRZA 3HMKA 1J0BA 3NYWA 4RLHA 4CTNA 2O2EA 2C9YA 4W99A 5GWXA 3SBOA 2HT6A 1AV7A 4ESEA 2O5VA 4WZ6A 1GYPA 1ZX1A 3EF0A 2QTHA 3UT6A 1NVVQ 3AUTA 3TZQA 4RY0A 1XJCA 4L5YA 5K9ZA 4A4DA 1JDSA 1EQAA 2X6RA 3O8QB 1XSEA 5JV5A 2ZRDA 2IP4A 1A8UA 4CUJA 2CXTA 4R8LA 1XXLA 1RVDA 3V1MA 3LI2A 4MDYA 5EG5A 2CNDA 2MTBA 3DV0B 3OIUA 1RBQA 5B6IA 2D62A 5HJ5A 4FHEA 1WZUA 4E09A 1YHNA 1PWYE 3GAZA 4K2HA 4LJLA 4WXHA 1BHJA 4UHDA 3MWFA 1JKJB 2XLBA 2XUDA 4ZO9A 2OV8A 3LFTA 3V7YA 1PD1A 1D5CA 2IUEA 3KELA 3GJXC 2Z5VA 3E70C 4R5MA 3WYBA 5BW5A 1T1JA 1G2QA 2GFQA 1T5TA 4OP1A 4XJTA 3C98A 3TDNA 3KP1A 3ENWA 3NATA 3VR5H 2B5OA 3PDCA 4FFDA 5GGXA 1DQZA 3R5XA 2I4MA 2IIPA 3LVFO 3WMEA 3W34A 3FWKA 4DUPA 3BGIA 1AZWA 1O8CA 1A9OA 3CVJA 4UBJA 4BMNA 4A5SA 3CIOA 4FJ1A 4IVPA 4IIDA 3F5FA 5A0VA 1O4VA 1S1MA 4OCZA 3V2HA 3QKIA 3UXMA 3C1UA 3KLBA 4QHTA 4KGZA 1M34B 5DCLA 1ZAKA 3OWXA 5IC5A 2Q3LA 3AHCA 4OI2A 4YAUA 2R6ZA 3KB6A 3RTDA 3TEFA 3WL5A 4A91A 1U5BB 2NAPA 3DVAA 3FUVA 3TGLA 4CGYA 1CZHA 1PS8A 1ULUA 4IHAA 3U7FB 1SKQA 4D97A 3E9EA 3VUEA 1KDOA 3DFUA 2OKCA 3WBKA 3A9RA 3F4KA 3PJDA 1SVNA 1T34A 1C1DB 2LBPA 3P0HA 4HATA 4IUYA 2PKXA 3DBLB 5KB3A 4Q4HB 2FDCA 3NHPA 2R5WA 4XLTA 1Z2PX 3IP5A 3OCXA 5J2TF 2H57A 3OEED 2XWQA 4EL5A 3NAQA 1VE1A 1V3UA 4C3VA 1MMFB 3KKZA 1IRXA 3GJZA 3C39A 4ND4A 2XE4A 3CN7A 1WQ4A 1ABEA 3H9EO 4NEGA 1CY0A 1QQBA 2R8EA 2AEJA 3IV6A 3LQKA 1RACA 1L7RA 3R20A 4MS4A 5JMTA 3IDFA 3GLIB 2C3YA 5K3CA 5JJLA 4UOQA 3AUFA 1WKBA 1BW9A 3LW7A 1IOVA 5JWOA 3QE0A 3E1GA 3WGLA 3T9EA 2ZQYA 1T2VA 1HI9A 3NXSA 1XTIA 2BOVA 2GHIA 1QO9A 1EQUA 4IGIA 4NK5A 2D4HA 2ODNA 3MC1A 4CLXA 4EG5A 3ZS9A 4UC0A 3HJGA 2W9XA 3TLBA 5IN4A 4N12A 1DIRA 1M1ZA 2C8KA 3NBFA 4BTEA 5ALTA 1JQBA 2CLDX 4IJMA 2IY7A 4M4SA 4HWPA 1D5WA 4DV3B 5ALNA 4F4JA 3H0EA 1GARA 4I4TB 3UHOA 3CX6A 2NU8B 3SSNA 4E13A 5HKOA 3HO1A 4HD8A 4IGFA 3WB9A 4CG0A 3UAVA 3V3KA 3CM0A 3L79A 1X1CA 4QBIA 3WO1A 4EJ0A 3EVNA 3VPAA 3EFHA 5JRDS 3ELWA 3AM1A 3M6LA 1H6CA 4E5MA 2W6QA 4BDTA 3I09A 3ELDA 3TE7A 2G8LA 4P3NA 5LSAA 5D84A 4FWIB 3K6KA 1GXSA 3OIYA 1ORWA 2DLDA 3LX5A 1Z06A 4RE5A 1F7VA 3HCOA 1U4OA 1CEEA 1G9SA 4JLBA 4CIBA 2Q3EA 2VA8A 2CVQA 2JD2A 1SRQA 1SG0A 4IFBA 5HVNA 3M8KA 4YP5A 1R0SA 4G8CA 3DMHA 4BY9E 3OC0A 4GR5A 3L92A 3RRBA 2OGUA 1L4GA 4MNTA 1JGTA 4IP0A 2JAOA 4PQRA 4F91B 5IYZB 1Y7PA 3CZRA 4OKNA 4EYOA 4TS9A 3OSUA 5BV1A 3RASA 1XCBA 4KW7A 4R1UA 4ZARA 1D4AA 3QVXA 1O96A 1RQXA 3MOGA 3MIZA 5FTMA 3IDQA 3UMRA 3CVVA 1PGOA 4PFQA 3C24A 5DLPA 2IOFA 2AQ8A 2FCAA 2JK1A 1ZHHA 1R27A 4WK0B 1I2CA 3ICOA 1C4KA 2OK7A 3ZGOA 3IIJA 2FV8A 4W9NA 4YRIA 1ODIA 4UPEA 1H1LA 3R6GA 3W9YA 2QENA 1B0PA 1MTOA 1X1QA 2JI8A 5FA8A 1VMEA 3O47A 3CC8A 4M8NE 2WJGA 4BZZA 4JYCA 2WV7A 5HA5A 1OV4A 1JTFA 1H2XA 5ICEA 4TT8A 3U44B 3RWBA 1LRLA 4DPMA 1MC4A 3JSXA 4Y2VA 4ZREA 1W59A 5J4VA 1DXYA 2PZFA 2YHIB 4GSLA 2P11A 3LGXA 3I4LA 3AXTA 3LDFA 3OQIA 4MTCA 2I9KA 1BDHA 5KTRA 3HYLA 4ETNA 4MV1A 5HZKA 1KP2A 1T5BA 2JIRA 2IPOA 2ISCA 3FIUA 4P3XA 3ZEAA 1Z34A 2YWFA 3MK31 1AQ6A 1RQ7A 2RKWA 4XGRA 3HYRA 1V8BA 5L3RA 3BIFA 3EC1A 3IRUA 1E2BA 4FGSA 1GPDG 2OBYA 1AKVA 4PSVA 3SKYA 1YL5A 5ALEA 5I8WA 3S81A 1NIPA 4CMEA 3D4IA 4J3FA 1G8GA 3HDYA 4BNIA 2NO4A 1UBUS 4HWTA 4K03A 3UMYA 2Q07A 4L8FA 4J1NA 1HG1A 4CMJA 4JJGA 5KSYA 1VBKA 5CIQA 4XB2A 2NYAA 1XN4A 2IS4A 1ZW6A 3USCS 3GG2A 2I6SA 3IDAA 4NOKA 1O89A 4UTZA 4R8KA 2ZYAA 4QKQA 1YKSA 1CERA 1NBMA 3GZTB 2GM9A 1OZFA 1V7ZA 1I9CA 2RAVA 4NABA 4Q00A 3RK1A 1E0SA 1KMHB 2AKAB 3B36A 3DJYA 5A62A 3KZ1E 1C5KA 2ZI5A 1XDWA 1XWFA 2O1SA 3I2HA 3AL2A 4L5BA 4OLHA 4HQRA 3UJ9A 1Z75A 1ISJA 2E5LB 2FLVA 2IEIA 1TPYA 2DZDA 4XEHA 4NRDA 1G20A 5A3QA 1NXPA 3A3KA 5T8KA 1X80A 3QPUA 2BZ0A 1XVUA 5BNIA 3EK2A 1ZWLA 4Q6BA 4PQGA 1H6DA 3L4BC 3WGMA 4YCBA 2XVMA 4I3HA 2Z2KA 1P8JA 1PSDA 3BE8A 1Y0BA 2Q3HA 3WLAA 2D3TA 2I7CA 5KC8A 1UOPA 4MARA 5D8DA 2VKQA 4YX9A 1ARZA 1O87A 2WHEA 3IMKA 5JS8A 2R1VB 4YGXB 3EEFA 3WZ2A 1VGVA 2QAGA 5JVDF 1H65A 2Q0XA 5KWIA 4JBHA 5DGTA 2BD0A 4F2PA 4HPJB 1NWHA 2HEIA 3LT0A 4U9HS 1Z6TA 3AF3A 4IZIA 4ZI2A 3IPXA 4YRCA 2RARA 2YUIA 1T2UA 2JGDA 3BF7A 3RUIA 3RS2A 3TLZA 4C3ZA 1TK2A 5L3SA 3PFKA 3OT1B 2AYYA 1JEDA 2XNKA 3TLGB 2R1ZA 4GC5A 4J6EA 4S1TA 4UTNA 1NLMA 5A3SA 2NSJA 3DVQX 3P9NA 3NBAA 3X1XA 2BLLA 1E69A 2P27A 1TZMA 3BE4A 2G0AA 1KGDA 4R2MA 2E1PA 4YAIA 5D5PA 1NBME 1OX4B 4IXTA 4RU1A 2PGJA 3A4TA 1V96A 4FOLA 2QN2A 4L75A 4AJEA 1QGED 1AQJA 3S2YA 3VBCA 1U28C 2DR2A 2DM6A 3F6CA 1E6KA 4YCCA 1RJDA 3WL8A 1VTKA 2DFNA 2XNDD 3RVRA 2UZ1A 3NAMA 7GPBA 1G20E 1VG1A 3IPAA 3N07A 2Q5OA 2ZTMA 3EVTA 2IT1A 2OCGA 3CNHA 3ST7A 4V0OA 3Q85A 4B2YA 2PD6A 3DZ8A 2QQ0A 4QSMA 4JENA 2CNBA 4ALMA 1Z0FA 1XZBA 1W9MA 3BDAA 2XGOA 3D81A 2VDRB 4OI4A 4DFDA 5LKAA 3UWMA 1Y5LA 4BNMA 4ENVA 3KTAB 4KP7A 4E33A 2C7OA 1XTBA 2H7VA 5FR2A 4DR6B 1VDZA 3OECA 5L40A 1UXIA 1Z0ZA 1U3TA 1H94A 1QGUB 1CWUA 1RBYA 1YCFA 3MQ4A 3PDUA 4HAWA 2NSYA 4WHMA 3F3KA 5BYJA 5M3BA 4N47A 3UV7A 3KPYA 3L8EA 3DYIA 2ZDQA 1VBFA 3ODGA 3NOQA 3DQPA 3NTXA 3OP4A 5A0TA 1CRWG 2BRUC 2AC2A 3K0FB 1P6UA 1NXVA 3F9IA 3SZUA 3X0DA 3DEZA 3EQ8A 2FMIA 4IVQA 4WAUA 5DNEA 4DPLA 2X8AA 3E0QA 4GI5A 4GMFA 6NULA 2AUMA 3C41J 1L4LA 2PS9A 3C7DB 3UFXB 4CI0B 3VR3A 4MWBA 2PAAA 1N5MA 1PL6A 2RHWA 1RPAA 3PLNA 4YR9A 1H0RA 1K6EA 4PZPA 3H7IA 1CUWA 4Q21A 3ZR4B 2QP3A 3GA7A 5ICFA 2OB1A 4DLWA 4EG0A 2HA4A 1JVNA 1Z0AA 3OPYI 5CXXA 4CQMD 2TSYB 4LYAA 4YTEA 1CW2B 6YASA 3TR6A 1Z28A 4JP8A 3RSZA 1DKLA 4XUGB 1H9AA 1XD2A 5JH7F 4DADA 4TWRA 5FBWB 4P0PB 2WB4A 3KDSE 4A0GA 2CD7A 2HUNA 3LDHA 4QM6A 5JDCC 5F23A 3JXEA 2GX6A 4QBFA 1U4SA 1CUYA 4LBWA 1S8AA 3PHIA 3O6VA 1HV8A 4H17A 1YA6A 3QENA 4R7ZA 4G41A 4LY0A 2HREA 3WVNA 3AB7A 4MRMB 4QL3A 4N9QA 4NPAA 1U1FA 3Q8WA 1G5PA 4YYEA 3V4ZA 4J91A 5K1ZA 3I64A 4Z3KA 1SC6A 1Y3AA 2VH2A 2Y8EA 1WSWA 1AKRA 2NYRA 1MUUA 4H4EA 3ZJYA 1XD9A 5KTPA 1UQRA 3HU2A 2ZYTX 1G21A 2Q50A 2QLNA 4HQKA 3UWKA 2JARA 4TS4A 4IXWA 1ECPA 3FLMA 4EYKA 4YRZA 5CB4B 3I1IA 1QS0B 1NMYA 5LMCA 1BU5A 4LF8B 3LF2A 1KF0A 2FZCA 4TSFD 2NW6A 3SC2B 3CG0A 3SIRA 4G1VA 2YXDA 4TOIA 1HMYA 1IIRA 2AG0A 1X8JA 3ZH2A 3SEZA 4CM4B 5GONF 1NE2A 3F7TA 1KO8A 4HX5A 5I45A 4YCJA 4C7XA 3DAOA 3PHCA 1BVYF 1CU1A 1YNOA 4XFKA 4D02A 2FW6A 5H4GA 5JAUA 1E9AA 2YZ2A 3D6AA 3RKSA 3PQEA 4I3FA 3HY3A 1ZZEA 4JXKA 2CUTA 1PJTA 4G24A 1X6VA 3TIGA 4EVRA 3C6KA 4WIAA 4EIWA 5HRUA 5DB4A 1CUZA 1D1TA 4D6YA 1VLLA 3V8PA 4KG7A 5MF6A 5DM2A 1XNJA 4XWYA 5D2CA 5IKOA 3UJHA 2GNAA 1O0BA 1LQ2A 2QB5A 5JZVA 4WQMA 4PC7A 5CVVA 2ODTX 2OVFA 4JD5A 4JUCA 4X91A 4ZAWA 2GZSA 5F5NA 3T3GA 2Q2NA 3AF5A 4D9GA 5ITWA 2C83A 3BIXA 1UDRA 1QG0A 3PXUA 4LZWA 3KQLA 5IH3A 4XTRA 4W6ZA 3S2GA 4ALJA 1R8XA 4B40A 1Y8ZA 3OBIA 3P0IA 5ENDA 4R2IA 4OQYA 5FOUA 3L93A 3MFQA 4DZTA 1K88A 4UTPA 4E2YA 2AKEA 4TL9A 1TXGA 2SCUA 1URPA 5AVXA 4RACA 3ZHUA 3WP0A 1XP8A 3OURA 1G5HA 1NW3A 1L3IA 4BEVA 4UHHA 1G21E 4MWOA 3ROMA 3RS9A 1Z8NA 5JS6A 5FO0A 3VKFA 2ECOA 2RJOA 2RHHA 4BIMA 2QM7A 2FJPA 2FPGA 2P0AA 2Y4NA 4II3A 1NKVA 4R2WA 1PFKA 2VSYA 2XJ9A 1P1RA 1P74A 1HUQA 1LK0A 1WUHS 1UZUA 3EF1A 4PLHA 3W5DA 3EZXA 3FA2A 4PEVA 2I67A 2OQ2A 3DMGA 1LNQA 1SU8A 4OPMA 2UYGA 3QPBA 1QPBA 1ZJYA 5AK3A 1PW5A 5JNTA 4MWGA 2NU9B 2CKMA 2DU8A 4QFBA 1ULAA 2HRRA 3RF7A 3DCYA 3JZDA 3SC4A 1TK3A 1XU9A 4N49A 4HT3B 1E1RA 3DBRA 4KLZA 3DYVA 5BW8A 1GZUA 1SCKA 2XVZA 1IN7A 3FRIA 3SHWA 5KYTA 2X8LA 2Z4SA 4YJFB 3EOBI 1D4FA 2Z1NA 3QRWA 2F00A 4P81A 3HU1A 3E15A 1XZDA 4QXOA 4XASA 5K8IA 3BB1A 3IQHX 4NCBA 2CB0A 1J33A 1O94D 2V58A 3G68A 4ZIRA 3CSUA 1G18A 1BQEA 5C35A 3NIBA 4ASUA 1ZRMA 1H42A 3VTFA 2B8NA 5JEDA 1GNTA 2ZBUA 1W5BA 5ER6A 1ILEA 3BF8A 1WP4A 3BRCA 1D7OA 1OFTA 3EGDB 4MUHA 5L9AA 4V03A 3HN2A 4PHGA 2ECFA 1YU9A 2BT4A 1EUQA 1PV1A 1PVVA 2CZGA 4X8MA 4Z8XA 4NMHA 4Z0HO 5T4HA 4D3DA 3KHUA 4N39A 2HLPA 4YUVA 2BELA 4Y0AA 4TLMB 3E5HA 3L8DA 2O2SA 1N2OA 4HB4A 1L4UA 4R0MA 5K3SA 2TYSB 3JQCA 4G67A 3ZVKA 3IAM6 3EFBA 2ORIA 2LDXA 4LE1A 1OH7A 2ZWMA 4DWWA 2VZ8A 1TC1A 1G2IA 3GEDA 3UAXA 4OKIA 3SC3A 3GXOA 5HW0A 3J7TA 4XIYA 1DQPA 1PJRA 2YWHA 4KRXA 1ISHA 1YQUA 4WBNF 5BQ3A 3HY4A 3QBTA 1A5TA 3HZZA 1CVLA 2M1ZA 4PGAA 2IPXA 2A9QA 5IPFA 4MR8A 2C5FA 1GCAA 4HWRA 3ANNA 4KBFA 1OI3A 1LJ8A 3JTMA 2I66A 1RYNA 4HS9A 1EP2B 3GQBB 2RH5A 1W46A 4Y6OA 5FOTA 2QE7D 3E3LA 4MRPA 5CG1A 2O8CB 1SWWA 1EX6A 1WUJS 4WTOA 5YASA 1Q0QA 5TF0A 1GNVA 3AUUA 4E6EA 1RWKA 2OORC 2GPJA 1G0OA 2BJVA 2PJDA 1DLIA 1GEEA 1NKSA 4R1NA 3OX2A 3VJKA 4CKBA 1LPPA 3T9BA 3IT0A 4WNYA 4AX8A 1EFRD 3HFGA 4M99A 4ZV9A 4D41A 4M36A 4DSOA 4EHNA 3EXHC 2I62A 1P1KA 3QXSA 5GADl 3R7SA 1JIUA 1COZA 3G82C 5CM8B 4NX2A 5C51B 1Q1QA 4TTAA 1CRZA 4ON9A 3UZUA 1V43A 2XRMA 4C1BA 3DVSX 1K27A 4U63A 4HB3A 3OZFA 2UUAB 2HHJA 2F3TA 5A4AA 4MOWA 4ZYLA 4CIAA 3B8EA 3CF6R 3IUYA 4WD3A 2H1RA 2I4IA 3JALA 1ZGJA 4BQQA 3GWGA 3DS8A 4G84A 1UXHA 4D0SA 1QFYA 5DWDA 1CUBA 1T3LA 2J5RA 2J9ZB 2WD7A 4CM7A 4ISBA 1DWPA 3TLMA 2X3YA 1USVA 2RHCA 4WNAB 1F0PA 1FUUA 4UUPA 1X7YA 2GESA 5FYDA 1D2EA 2UXDB 2PKEA 5EFOA 5DGHA 3C5WP 3ENQA 3FTEA 5BSUA 3LAWA 1UP4A 5IZCC 3RGWS 1MPXA 3UA3A 4F5YA 4REQB 1UM9B 1GTG1 2CJXA 1V25A 1P5JA 1GRNA 2W6ID 3FLEA 3OY7A 4FQ5A 4FR2A 4JJ6A 4YPVA 4EWLA 4LYEA 1LLCA 3FZYA 1CVRA 1VRCA 3DYBA 3T61A 4UULA 1OPRA 1VPTA 1OOEA 2W2NA 2V55B 1O9BA 1RKXA 3LWBA 3FCCA 3CUTA 3LUPA 2QOEA 1MXHA 3AQ4A 5AK4A 5IFKA 1JQKA 5FBQB 3QMWA 3VR4A 5KYWA 1K5HA 2QVLA 2F3PA 4E4YA 5U4QA 5F64A 2NX2A 3ILVA 4OXYA 1LPOA 2O7NA 3ZZUA 2QLMA 2XA1A 4RGYA 3GCDA 3QY0A 2F7SA 2I8LA 4EFLA 5FEUA 3L0YA 2YJZA 3SYTA 2EWMA 4EY8A 5CAEA 3UGTA 2AQKA 4DRXA 2XMDA 2IGTA 1QR6A 3TLJA 5IJZA 2DUNA 4X1OA 3A9TA 1CRQA 3FAKA 3LRPA 4B3CA 2PRSA 4JLPA 4OTZA 3QOWA 5BMVB 1WEHA 2E4YA 1S2NA 1MDBA 2IYWA 2LNDA 1PJAA 3GGOA 4LCJA 3DEYX 1FS6A 2OGWA 1CV2A 3EODA 2P78A 1AHPA 3ZD7A 1FJGB 2YASA 2HIGA 4JR2A 1RRVA 3O0DA 1OLUA 2POQX 3KPJA 5TY0A 3VKUA 1KVUA 1LBSA 2FLWA 4K9NA 4CM9A 1D8TA 1PZHA 3DOOA 3BIOA 3OE4A 2XT0A 4IG9A 2H08A 2HQ1A 2JVJA 3GEHA 4TTRA 5EE0A 2HMYB 4CETA 2DFTA 2WUEA 4EFMA 4FYHA 2JI4A 4WFJA 5IABA 2HJVA 1RHQA 4LHZA 1AXEA 1S3SA 2IIQA 4Y0NA 4KQFA 5IT9A 3KD3A 5JISA 2Y3IA 3IMCA 2JB9A 3BL8A 4POOA 2BZSA 4JJKA 4N5HX 3CLKA 1C50A 4MLCA 4D4LA 2ZW9A 2B61A 2BEWB 3BWBA 4N03A 4Z49A 1T13A 3FCSB 4IEEA 5GM1A 1JKIA 3DOJA 3EA5A 3FHJA 3U9LA 3DOFA 1Q15A 3WQSB 3IURA 3NHKA 3DTVD 1V6AA 3K09A 4FLFA 4X00A 3OIGA 3RYFA 4ZK6A 2OL4A 3VPDA 3VDXA 1YQWA 2DY0A 3BWDD 4KQEA 4D6XA 1LNSA 2DCMA 1QX3A 2TRSB 3BH7A 2BSXA 2PGIA 4O2BA 2NUAB 4KAJA 3RJTA 4BO0A 5EL0A 1MAWA 1UK8A 2ZSBA 1DEOA 3WJ1A 3I5AA 3X43A 1QQTA 3EZFA 1ZOPA 4CL8A 5IC6A 3FPBA 3NHSA 5TMPA 1C3EA 1NP7A 2OHGA 4LRWA 1X7ZB 4EY5A 3L7LA 4JJ4A 3QUSA 1YJ5A 2HH9A 5FOSA 3TG8A 3GRYA 1CY4A 3DZCA 4A7PA 4PYIA 1SBNE 1HETA 1GNQA 2DGDA 2WDZA 3HCAA 1LF0A 3A4VA 1E1CB 3GGGA 1XV5A 3V2IA 4A1OA 2VDUE 4GPEA 3HA3A 1WBDA 4DVJA 4G4SO 2YWCA 4CE6A 4UZEA 1VCHA 3K20A 2A9JA 2GJAA 1VBMA 4XM0A 2PGOA 5CFRA 1T5SA 5E1DA 4Q1VA 3G9ZA 3V80A 5JJKA 4LPSA 4R01A 1L5VA 1XELA 4DSNA 3PS9A 2HU8A 1CR6A 4WOKA 3OCYA 3GA5A 4KFRA 5K20A 2H59A 1EK0A 1MTZA 2G36A 3JQQA 1WW3A 3MSCA 5SYNA 3RIMA 2HCFA 2IYLD 2XWSA 4JIGA 4K6HA 4O2AB 2X5NA 2FUEA 4IHJF 1XLUA 4UREA 1AMUA 3RSSA 1ESNA 5KMGB 4QTYA 1EXDA 3T3MB 5E4FA 2YN2A 2NVWA 1N6KA 4US1R 4V02A 2YBEA 5I9TA 3RLFA 1LZLA 2V03A 3KKPA 4G0OA 2VDWB 3AM4A 4LRSB 3RB8A 1KI1A 4QJ3A 3T3NA 2W2LA 3LX4A 5LQNA 3MW8A 4XCVA 4F56A 2H7XA 2Q4TA 4S05A 1GQ2A 3O4FA 3AWDA 4J0GA 1FF9A 3R5KA 2P30A 1G64A 1EK1A 5CVCA 3ERCA 2IOQA 1NQAO 2VDJA 4Z4IA 3AKEA 4H0NA 2X8WA 3OQJA 4DLXA 2XECA 4JYPA 5DYGA 1HWYA 1QAOA 2ZI4A 4FONA 5DHQA 4ZICA 5LP6B 1JFTA 2JLAA 4M1OA 4B4WA 2WU1A 4QPNA 3WLSA 3HB9A 3OQPA 5EPEA 3I5YA 1ZR2A 1YASA 3BXOA 3NIWA 3QFTA 3KL4A 5C7YA 1Z2NX 3BMOA 1OGYA 3BN3A 3EISA 1T29A 1CZKA 3OTQA 4JN6B 1E4YA 5AW6A 4MPRA 4X6YA 1KY2A 1H0SA 5FWYA 1PJZA 5IUJC 1NRXA 4ZTBA 1ODSA 2JJMA 2QX9A 3EYWA 2CXUA 1TIPA 1P62B 1H3NA 4U4AA 2RFLA 2ZWAA 3UMJA 3ONDA 4L2IA 2H4YA 3IO3A 3OEHA 5HOQA 1MAUA 3TOCA 2QZZA 2CLSA 3MYYA 1E3TA 4GLJA 4MS3B 4O4IA 1Z6ZA 4Q1AA 3ZLVA 4C7JA 5L6MB 1ESZA 2UZ0A 1AS2A 2BHSA 2XODA 5B7GA 1BKSB 1ZJJA 3U7IA 3OJOA 1Z5VA 1FSZA 1KI4A 1L7PA 1X1TA 2XMBA 4D44A 3EGXA 3R7WB 2VPYA 1NJFA 4RTJA 1ZOIA 5BW6B 3R9WA 3KZVA 4C6RA 3FPCA 3X1KA 1DTWB 1EUCB 2JGNA 3AR3A 4CG2A 2BEKA 1NG1A 2I99A 1AQIA 3KQVA 4ZEWA 5KU7A 1E1LA 1WY5A 4GGPA 3I3OA 2W71A 1TEHA 2GAOA 1BZYA 3D2BA 2UYCA 2O8EA 1RYYA 2FSVA 3BE6A 3FY4A 3HRHA 2H5LA 3KVRA 4ENQA 2QVBA 4FP9A 4TMKA 3D6VA 1WULS 3OJWA 4TRJA 4HR7A 5C0OE 2GBIA 1UADA 3ZE8A 3P45A 4KPFC 5JAPA 1R8JA 2BGRA 1VJ0A 4OB7A 2Q5HA 1KQFA 3OM8A 3A27A 4I55F 5DZSA 1BDMA 4NK4A 5F3RA 4Z7QB 1JLSA 2PX8A 4GX0A 3C3EA 4EJSB 4UHBA 4EKEA 4WZBA 3BT7A 1X13A 3L4KA 2A35A 4X1KB 2WMDA 3ZWMA 2XUGA 3FGNA 2HQBA 4IIYA 3BZWA 1WXHA 1SOWA 1JVSA 4OXXA 4RL6A 5EE9A 3OF2A 3USES 4TKUB 1T8UA 3DTVB 3GUZA 1GPBA 3JQ8A 3NNSA 5DF1A 2DOKA 3PEUA 4P4SA 1CC1S 3PTZA 1DBWA 1UBJS 4C43A 2ZIZA 4NJOA 1HDYA 4GBMA 4RDHA 1ID8A 3NWJA 3QLUC 2ZTSA 3B6JA 2GZRA 4LK3A 5E6SB 4OV6B 4G63A 2BUCA 1SCAA 1RLOA 2WUVA 4BWGA 3I04A 4X6LA 1DCFA 3BWVA 3H5WA 3ZLTA 1T2DA 3EFEA 1SOAA 1ZGHA 4KQKA 4PR3A 2DYKA 4M86A 3FWHA 1IG3A 3OZUA 2G0NA 5E95A 3EW7A 3JVIA 3S29A 3DGFC 1PFUA 1H4SA 2I2WA 4EFDA 1KMQA 1R4NA 5G0WA 3HWSA 4LBYA 3I6QA 4PM4A 4EZBA 3IXMA 1GKUB 3WLLA 2J0SA 1JVBA 4KR2A 1FUIA 2QMZA 4IDOA 5BUCA 1AURA 1C4OA 2ZSAA 1NUQA 2PUFA 4XOIA 1I6LA 5C1DA 2B8JA 2EL9A 2ZPAA 3M6XA 3PGA1 4WZBE 3KPUA 2GCEA 4NBRA 4A2QA 4GKAA 3B6ZA 5FBRB 3SQMA 2FPWA 3QFRA 3T4EA 3I9FA 4HEQA 4ID3A 4F6RA 3CVYA 3TXXA 1TO6A 1Q11A 4MKHA 3PE3A 3ZDEA 3IAEA 2BFDB 1NSTA 3WIDA 3FUCA 2GUGA 4RYDA 4KHZA 1XTQA 1FU8A 1PWZA 1RAAA 1QWOA 4KXLA 4WSOA 3OCVA 3TM5A 1I01A 3R41A 2VNAA 1H85A 2GJ8A 1XPOA 3WLPA 4D2IA 4EMBA 5GIPE 1GZ5A 3BVPA 5CFZA 3V00A 3GRUA 4BGUA 1Z5NA 4XPZA 3N2EA 1KS9A 4BKMA 1WB9A 1JMKC 4Z7NB 3D0QA 3ACDA 1VHWA 1T0PA 3CQ9A 3FWNA 5D6OA 5REQB 1N6PA 5I9SA 4HNRA 1YACA 3HHEA 1QQAA 1Q7EA 5EYPA 3EXEB 3DDOA 1RW4A 4INAA 1B4DA 5DCYA 3LQYA 4C5BA 2IYQA 2VA9A 4B6GA 4U2CA 2I4NA 5DM4A 4V3CA 4YJ3F 2IY8A 2C0CA 3H4MA 3K0BA 1L5LA 4KAFA 3FPHA 2QS9A 4Q3NA 3LC0A 1F2TA 2LIVA 2MHCA 4R0VA 4UCXA 3WISA 4PGGA 1N9KA 1U2PA 2D7CA 1EUYA 1YAJA 1E6LA 2GTPA 3T54A 2H16A 5DTRA 1M1UA 2DBQA 3W7AA 4J9VA 2PRKA 5B3LA