2AE2A

Tropinone reductase-ii complexed with nadp+ and pseudotropine
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
259
structure length
259
Chain Sequence
b'AGRWNLEGCTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKELNDCLTQWRSKGFKVEASVCDLSSRSERQELMNTVANHFHGKLNILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISSVSGALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLVEMTIQDPEQKENLNKLIDRCALRRMGEPKELAAMVAFLCFPAASYVTGQIIYVDGGLMANCGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TROPINONE REDUCTASE-II)
molecule tags Oxidoreductase
source organism Datura stramonium
publication title Structure of tropinone reductase-II complexed with NADP+ and pseudotropine at 1.9 A resolution: implication for stereospecific substrate binding and catalysis.
pubmed doi rcsb
total genus 104
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 1.1.1.236: Tropinone reductase II.
pdb deposition date 1999-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ae2A00
2CVOA 3K6JA 5THQA 1X1EA 1WDMA 3JQAA 3PYLA 4Q3EA 5BNIA 4YJHA 1FDSA 2Y67A 1XEAA 4IQ8A 1NQTA 3RU7A 4MVJA 4WASA 4O6VA 3PTZA 2Y0DA 3U0BA 5H81A 2AQIA 3AU8A 1IYZA 4DIFA 4LRTB 5AQ1A 3O38A 3DZHA 3T7CA 2WYUA 3WQSB 2BI7A 3JYPA 1U4SA 5KJ1A 3BTOA 1UP6A 2AQKA 1H6CA 2FPIA 3C3XA 1B15A 2P9CA 2WM3A 2ZK7A 1T24A 1ZJZA 3WOHA 1WVGA 1IHYA 1TT7A 3DB2A 1HF3A 1PJ3A 5DNAA 3RJ9A 3DZGA 1GU7A 2PY6A 3VTZA 1DBVO 2FPPA 2RHCA 4BNNA 4XYEA 1NPTO 4XR4A 5JW6A 4ILKA 1E3JA 4R3WA 3SLGA 3BHIA 5HM8A 1XKQA 5KIAA 2GGSA 2Q2WA 3G79A 4MVJH 1KY5A 2JAPA 3ETDA 2VRCA 1WNTA 1IOLA 1E3WB 2DU8A 1LTHR 2WE7A 3R0IA 3U3XA 3RUCA 5IXYA 1P0CA 2B4QA 2J3KA 1NR7A 2Q1TA 4J7UA 4R1UA 5TNXA 2NVUB 3E8XA 1N7GA 3JQ8B 5BSGA 1UZLA 3W8FA 4WLUA 1ONNA 3VZPA 4YXFA 1N92A 1JVBA 3NDJA 1C1XA 4M55A 4RO0A 2GR9A 4Q3NA 2O3TA 4H15A 4NHEA 3WS7A 2AHRA 2C2YA 5K0ZA 3P2YA 3DAPA 5DZSA 5DOZA 1KYQA 1BHSA 2O23A 4ONEA 2RH8A 3OQBA 2G82A 3OIFA 4PG8A 3PJGA 3LF2A 5CHEA 3F5QA 2DBQA 3IL2A 3OJ0A 2R2GA 3ONDA 1UDBA 1M2WA 4QEDA 1EQUA 4J7CA 1QSGA 4HFRA 1RWBA 1V35A 1ONOA 4YAKA 1O8CA 4JK3A 4CMGA 1MV8A 4MPDA 5JDCC 4JJFA 2AXQA 1L7DA 1CIVA 3IJPA 2X0NA 3RIHA 3CINA 2QX7A 5IDYA 1U7HA 5A04A 1VSVA 2NVWA 3I52A 2CDCA 2ZJ0A 3JQ8A 4U7WA 4IQGA 1A7KA 2DFVA 5KJEA 5TS3A 1TI7A 2UVDA 4MKZA 1WZIA 3DBRA 3ZV4A 3ITDA 3JQFC 4TVBA 4TZKA 4OQZA 4BO0A 1NM5A 3PWZA 3NJ8A 1E3WA 2ZATA 3LLSA 4B7UA 4PLHA 2EF1A 4BGVA 4BGIA 3AOGA 5DP1A 3TN7A 2VCYA 2XXBA 1IL0A 3VC7A 1PGPA 1SPXA 2I3AA 5JDIC 2GUGA 4BGUA 1U3VA 4E5MA 3DEYX 4HP8A 5DBFA 2E4AA 1S6YA 5ER9A 3SC4A 3LF1A 1XSEA 3M1LA 1FJHA 2BGKA 1V0JA 1NP3A 1U8FO 5A5EA 2IEDA 5JCXA 3GNTA 3MJTA 4RVHA 4IY1A 5IDXA 3I9JA 1XWFA 2RH4A 1BXZA 3BMCA 3EDMA 4XDZA 1HE5A 4W7HA 4M1QA 1AHIA 4I9NA 1ISFA 4RV9A 1Y9AA 4J4TA 4E32A 1C3VA 5DCYA 1GADO 1LA2A 1Q7GA 5EJ2A 2GZ3A 2PKRA 3DO5A 1NVMB 4YT2A 1UR5A 1E1MA 1OFGA 5A9SA 1CWUA 1LUAA 3K31A 3K30A 1SNYA 4TVOA 4RQUA 2TMGA 2VTEA 4ND1A 1YGYA 2O2YA 4YJGB 3BTSA 3NRCA 2DTXA 1LQUA 1UXHA 4XYLA 1JAXA 4UEOA 3RUFA 4KWHA 4MKXA 4BGEA 1EVZA 1YKFA 2NSDA 1JWBB 4Q9NA 4AJJA 4EITA 3HDHA 1CERA 2X8LA 1XR3A 5LDGA 1AXGA 4NU6A 1A7AA 1PZGA 4BHTA 5FEUA 4UVHA 3AUSA 4RPHA 4PG7A 4NBWA 3JYQA 3T7EA 3H9JA 3FTPA 3FF4A 1XQ6A 2ZB3A 3PXXA 4E21A 3PIIA 4QXMA 1DAOA 3F46A 4TRMA 4XCVA 2PLAA 1R4NA 4WPGA 4CMIB 3GAFA 4BO2A 2VHYA 2B35A 4L0QA 4IJUA 4A03A 3OFSA 1VJ0A 5BT9A 4QX6A 3M2TA 2W2LD 3V2GA 2X5OA 3GZNA 1GD1O 4B8ZA 3UHAA 1A9YA 4CUKA 1JQBA 2CY0A 2VT3A 2DC1A 1GUYA 3GVCA 1NPDA 1HE3A 1U3WA 2R6JA 1T2EA 3AUTA 4B7CA 2WJPA 4WEQA 1BW9A 1W0CA 3K73O 1D3AA 1XU9A 3BYZA 2JFHA 1H9AA 1KVQA 1MB4A 1GTMA 2HMVA 2RIRA 1Z75A 3FWNA 1VPDA 4UVIA 3RC9A 3WX0A 1YRLA 4XB1A 3GNSA 2JAHA 3UCEA 1WZEA 4R1NA 5G0VA 3H3FA 5KVSA 2O48X 1T26A 4IS2A 3GQVA 3VVBA 4CR7A 1WAMA 2IZ0A 1X7GA 4PLYA 2D2IA 3ZWCA 3HDQA 4R1TA 3NGXA 3X2EA 3ZWBA 4WCDA 4K6CA 3AUUA 3OJEA 5LDHA 4UVDA 4FB5A 4E5KA 4W99A 1GEEA 3FNHA 3OA0A 1TA4A 4EW6A 1N9GA 4YCAA 1I2ZA 4BO3A 1YOVB 3V1UA 2VOEA 1RJWA 2A4KA 5HWSA 1RYDA 2OMEA 3D1LA 4GPD1 1O5IA 1N2SA 4J2OA 4BV9A 2P68A 1KEVA 1PU2A 2E49A 1PJQA 1N8KA 4TRRA 3QHAA 3GMDA 2ZJ1A 5HS6A 1BXGA 4ALJA 3STHA 4UULA 4XR9A 4XYGA 5KWEA 4HADA 1ZO8A 4RZIA 2UDPA 3ULKA 2AEFA 3PQEA 3Q9UA 1I3LA 4U6QA 3F4BA 2QW8A 1DAPA 3UW3A 3A4VA 3QP9A 2DT5A 4FJ0A 4BMVA 4CLRA 1VSUA 2B69A 4OIMA 2YJZA 4OSOA 2VRCD 1YQGA 3GDOA 4KZPA 3KV3O 3L9XA 5G2OA 1Z45A 3C7CB 2VZ8A 5ITVA 1Y8RB 4YPOA 5HTOA 1ZK1A 1XLTA 3LC7O 3KLMX 4J7XA 3LT4A 1R6DA 4GGOA 4HXYA 4PFJA 3RUIA 3FBGA 1OMOA 5A9TA 2B5WA 5JCJD 3GVIA 3PEFA 2CNBA 3ANMA 4D41A 2X6TA 3CUKA 3WG9A 3TZKA 1P45A 1Q0LA 3LLVA 4OKNA 1TEHA 5F5NA 3U49A 3EZYA 1BXGB 1NAHA 1E6UA 2QZZA 5EQDA 4M89A 1J6UA 4W82A 1RM3A 1U1IA 1HYEA 2DBVO 3UCXA 1SBYA 2X5JO 5F1PA 4C7KA 4PG4A 1G0NA 5TC4A 1IPEA 3JQ9C 1PJSA 3GLQA 4ND2A 1X7DA 4OO3A 4HFMA 4KTTE 3HE3A 1HDZA 1SCUA 1R4MB 4UUPA 2DLDA 3U4IA 2ZIZA 3HG7A 4GKVA 3I9MA 1P9LA 2JFFA 4II2A 3VH3A 4YT5A 4ZQGA 3DOOA 4OYRA 1UDCA 3DBHA 3OJOA 1YL7A 2HK7A 3H2ZA 4RVDA 3CTMA 1PGOA 2O50A 4FIZA 1X13A 2OHXA 1IB6A 1PZFA 3AUAA 2NTVA 3EW7A 1LSOA 1GV0A 5TJ9A 2E48A 2NU8A 3HB5X 4LRSB 1ISJA 4YACA 1R66A 4O1MA 4RL6A 2PZKA 1E0DA 1MFPA 1VJTA 4IJWA 2DTEA 1P1HA 3TNLA 4OXNA 2I99A 1U5CA 1P31A 3RFVA 3PDJA 3JYNA 4AVYA 4F46A 1JAYA 1EE2A 1IE3A 4GSKA 3IOYA 1V3VA 3JD4A 3D64A 1E7WA 4J0FA 1R12A 4I5DA 1AHHA 4WCFA 3E9MA 3FPCA 3WNQA 4HUJA 4W6ZA 3PGXA 4OM8A 4FQ8A 3H6KA 1O95A 5L53A 3KRTA 1LEHA 2WE8A 3E82A 3WMWA 1B8UA 3FCOA 4EJ0A 4J1NA 2GPTA 1RKXA 3WSWA 1EMDA 3B6ZA 2BGMA 3RC1A 1PQPA 1P3DA 1GQ2A 2VZ9A 4RLHA 3DBLA 3G3EA 3G1UA 3GHHA 4LW8A 2P4QA 4U6SA 5DP2A 2Y93A 1QORA 3ZWNA 1RM0A 1BGVA 3GGGA 4YA6A 3I6IA 3D7LA 3QWHA 3FNEA 5JO9A 1ISIA 5KVQA 3VPSA 3OP4A 1KBZA 1VRWA 4PVDA 3ZU4A 1BG6A 2B4TO 5HA5A 5A06A 3JQAB 3INTA 1V3UA 3Q6IA 4JBGA 1YQXA 3BHJA 1DDOA 4KDFA 2AE1A 1DHRA 3DBLB 1NWHA 2YHIB 3H4VA 3F1KA 5GMOA 3V8BA 3COSA 4F3YA 2WEKA 4LK3A 3T4XA 1I24A 5ILGA 3VAZA 3WTBA 2BFMA 1B2LA 4BMSA 4YRBA 5L40A 1ZK3A 2C29D 2V65A 3JQGA 5G4KA 4YRDA 3GN1A 4AJ2A 1LQTA 3FNGA 3MTJA 4EYEA 3ZHXA 1Y5MA 4CM3A 3RASA 4MVJE 1P1KA 1LDBA 2C54A 1ENYA 2SCUA 4ZU3A 4DMMA 4WLFA 4UREA 3KYBA 1GDHA 3CMMA 3L0DA 4PLCA 2G76A 5JFOA 3N58A 3TZCA 1M75A 4MKRA 4BKRA 4GL4A 3AM5A 2ZB8A 3R3SA 5T64A 3JV7A 1HKUA 4P4GA 2W2KA 3CPSA 4W9NA 5TIIA 1T1SA 5ES3A 4RORA 2BHLA 4OMUA 5CPBA 3GG2A 3O4RA 2ZTLA 3H3JA 2YHIA 4CQLB 1H6DA 3EMKA 3PLNA 4ZRMA 1Q1NA 4OJNA 4CLDA 3NUGA 4D3SA 4OH1A 4IS3A 1HDYA 1UXJA 2GO1A 3QQPA 4QSMA 1J0XO 4DA9A 3KVOA 1E6EA 4O5OA 4YJDA 4EEZA 4MIYA 2HLPA 4CV3A 2XXJA 1O94A 4UUNA 5DULA 3VOSA 1MG5A 2IRWA 4P38A 5CP8A 1DIHA 3AI3A 4IDGA 4PLGA 4JGBA 1P1IA 3BMQA 1VJ1A 3IMFA 2HQ1A 1MXHA 2PGLA 3NGLA 1T2FA 3SLKA 3RC7A 4YAEA 2VN8A 3W1VA 2C5AA 4D0RA 3Q0EA 2POQX 1YB1A 4BKOA 2WWRA 3DOJA 4XYMA 3G17A 1OOEA 1WDKA 1O89A 1MLDA 1GPDG 1L7EA 2YQ4A 4CQMA 3WQRA 3VZQA 4CM6A 3L4BC 3KLPX 3JQDA 2GN4A 4BNMA 1F06A 5CDSA 3DMTA 1PTJA 1U5AA 2ZQYA 4ZHSA 4IGFA 4ZQEA 2YFHA 1G1AA 2TMDA 5JAIA 1F12A 1GR0A 2GF2A 3HUDA 1A5ZA 3BMOA 1W6UA 2HMSA 4BNKA 1H5QA 2CD9A 3KB6A 1PEDA 1ADGA 1GUZA 1HSZA 2Y1CA 3WBFA 3JQCA 4O63O 1Q7CA 5BR7A 2W98A 2QYTA 1I3KA 2VNSA 1QV7A 1UP4A 1CQIA 3RUAA 1D1TA 4JP3A 3GRKA 1KEPA 2AQHA 2Z95A 5JPIA 5T6BA 2Y1DA 1VL6A 5JCJA 4ESOA 2VWGA 3KEQA 4E33A 4D3DA 4TKLA 2XAAA 3NJ4A 1Y6JA 4G2NA 4A2CA 4BNVA 2CSUA 2PK3A 1WWKA 2FWMX 5L3ZA 4TMFA 3GN2A 5G0TA 3OEWA 1BVUA 1ARZA 2PZJA 4D43A 5JYDA 4RPGA 4WLNA 3ZGYA 4AJ1A 2PR2A 3C7DB 3EVTA 3V1YA 4GX2A 2JCXA 8ADHA 3PVZA 4M86A 1Y7TA 4RDHA 3PHLA 5TSDA 2XF8A 3ZHZA 4RF3A 5DN9A 4PZCA 3HN2A 1PJCA 4FGSA 4YBZA 2OFPA 3FHLA 4W4TA 5A05A 4YAIA 4NZ9A 1HEUA 1R15A 4RCVA 1LSUA 1HE4A 4CM8A 3Q9NA 5JC8A 1U8XX 3CIFA 4CL8A 3IP1A 1B7GO 4KUHA 4JQCA 1PQWA 2BLLA 3F1LA 1F14A 2HKIA 4NFHA 3E5RA 4HNGA 2OUIA 3Q1LA 1FDUA 4B3IA 4CV2A 1H2BA 5I8WA 4RVFA 1DHTA 1FF9A 4RPJA 1KOLA 5JO0A 4WEOA 2V6BA 4BNLA 4Y6SA 5LC1A 2I65A 3KSUA 3TL2A 4R9RA 3WTCA 1LRJA 2QQ5A 5I9LA 4GH5A 1KVTA 1SZJG 3I6QA 2X7HA 3DMTC 1H94A 3ASUA 3TJRA 1GV1A 2WMDA 5CDGA 3PYXA 4NIMA 3ZNOA 4DIOA 2ILTA 4BNJA 1KC3A 4BNGA 2NM0A 3AY3A 5BQFA 4PVCA 2HMTA 3JD1A 1P74A 1QLHA 1U28A 1HZJA 4RQTA 1LLQA 2VHZA 1XDWA 3NX4A 3P7MA 4IDEA 5KCZA 1NQ5A 3DBVO 3I3OA 3GVHA 1PJBA 4EBFA 1SB9A 3D4PA 5COQA 2AEMA 2D5AA 3R1IA 4NH4A 1B8VA 5DCWA 1KETA 1MG0A 2DKNA 1I33A 3EK2A 4ALIA 5CAEA 5EERA 4MP3A 1YB5A 4GWKA 3GK3A 1NPYA 4AL4A 5A03A 2OBYA 1GCOA 4CLOB 2YYYA 4E4YA 5T5QA 2J6IA 2BGLA 3WYEA 1EUDA 3OEYA 4O0LA 5C5IA 3RI3A 1ZFNA 2IZZA 4FN4A 5C37A 1S7CA 4NBTA 4YB8A 1NXQA 3JSAA 3QWAA 3WYBA 4W9NC 4Z9FA 2UYYA 3GUYA 1CEQA 1I36A 4PN3A 5ADHA 1NHGA 3A9WA 4GX5A 1VI2A 3ZNNA 2VWHA 1EVJA 5KNLA 3MWEB 4BIIA 2QRJA 4GLLA 5G0SA 4BO9A 4BO5A 5JYEA 3F9IA 4N7RA 3U09A 1ZJYA 2PV7A 3ENNA 5F1OA 3OH8A 2D1YA 2X4GA 4OSPA 3ENKA 3QVOA 1XCBA 1P1JA 7ADHA 3O8QA 1VKOA 4BUCA 1TLTA 5JDCA 4LVCA 3TZ6A 1ENOA 2Y1FA 3JQBA 3E5MA 1B3RA 4A5OA 4YWJA 3HWRA 5I8ZA 5GZ1A 5JAZA 1PS8A 2EV9A 5JY1A 2BFOA 4PLWA 4ROSA 4UUMA 1NYTA 1U2GA 3H8VA 1LDMA 2FN7A 4GVXA 3AM3A 3ITKA 1MC4A 4AJNA 4BL5A 4DUPA 3UCFA 3ST7A 4RGBA 3VVCA 2OORA 1V3TA 4IZIA 3TDKA 2O7SA 1YQDA 2R00A 2NU9A 1XG5A 4I5GA 3MCVA 2JD1A 3GGPA 4J1QA 3BTUA 1EBUA 3HDYA 2B4RO 4IDBA 3H5AA 3VHRA 3EAGA 1IHXA 1HL3A 2VYND 4XZ3A 3AY6A 1UXIA 2NU7A 3JYLA 1E7YA 5G4LA 3P2OA 5BSFA 2GRAA 3D4NA 4DYDA 3DZBA 3MWDB 2EKLA 1IUKA 3QIVA 1LBEA 3I5MA 5CG1A 3QA9A 3DAGA 7MDHA 3OF2A 2QRKA 4EUFA 4WOJA 4KWIA 1Q7BA 2BELA 4XEHA 3S2IA 4FBGA 1GZ4A 4R69A 3AU9A 3ORFA 4WECA 1M6HA 1P0FA 2YFQA 2HMWA 3VKUA 3V2HA 5A4DA 5IXSA 3X2FA 3MOGA 4BO1A 3TF5A 4U8GA 1A27A 4YVFA 1DRUA 1YO6A 4GVLA 4NBVA 5HBRA 3SBOA 3DDNA 5CDYA 2Q46A 4IPTA 2AA3A 1YBMA 1D1SA 4WLOA 1EEHA 1SB8A 1HDOA 1ONPA 3H5RA 2FY8A 1PGNA 1MA0A 4OOEA 2LDBA 1U3TA 2EWMA 5AOVA 1E1LA 4NQZA 4PZEA 4GAEA 4KTVE 1K2WA 4OAQA 1JLLA 3OM9A 2O3RA 1YE3A 3PYMA 1LNQA 3KEOA 3IC5A 5I9NA 6ADHA 1BSVA 4CV0A 4E13A 3CXRA 2P2SA 4IINA 3H9EO 2ZTMA 2NV6A 5JBIA 2RAFA 2WD8A 2C7GA 1DIAA 1W8DA 1JN0A 1Y5RA 2YV1A 2VQ3A 4XQGA 3JCZA 4IIUA 4JBIA 4J91A 4NBRA 5KTKA 1TB4A 2CF5A 3AFNA 3PI7A 3HJAA 3AOEA 4DIBA 1ISHA 1NR1A 4FR5A 4J1SA 1UDAA 3SJUA 1NNUA 3QV1A 5G0WA 5TT1A 4GX0A 2GN8A 3WGHA 3S2EA 3EZLA 3FR8A 2D0IA 4HWKA 2FSVA 3EYWA 1JKFA 5L4LA 3WICA 1PS0A 3MJSA 3PJFA 2IXBA 4Y9DA 5EQFA 4BKUA 1T25A 2O3UA 3DFUA 4BNYA 3F47A 3ICPA 3FI9A 4GLOA 1ZW1A 3ZHYA 4AJKA 2H6EA 2IYPA 3EUWA 4I08A 5MDHA 3ZI0A 3RQSA 4B7XA 3VDQA 1DPGA 1WP4A 4AJPA 4BNFA 1DC3A 3DZKA 3O26A 4NU5A 4CMJA 3HADA 2QG4A 5IN5A 3SXPA 4ND3A 1SOVA 3SVTA 1OAAA 3ZWAA 1B26A 5ICSA 5DDIP 3QVWA 3OICA 3V5NA 1AE1A 1YDEA 3ANNA 5B1YA 3E9NA 1G6KA 2OO5A 1KIFA 3K92A 4RF2A 2BRUA 4U0JA 1LX6A 3PJEA 1E3IA 2PKQP 2QHXA 3OIDA 1JKJA 8LDHA 2C0CA 3GF4A 1HE2A 4CMKA 4FD3A 4FGWA 4IDDA 3PZRA 1WLYA 1XA0A 2OL4A 1EFKA 4WE3A 4Y67A 3H9UA 4CR6A 5L4NA 2Q99A 3GZNB 5EMHA 3ZNQA 4HY3A 2J5RA 4LVUA 4MVJF 2QZ9A 1JWAB 1H6BA 3QVSA 4A26A 2AEJA 2HJRA 3ZW8A 2G1UA 2EGGA 4BKPA 1ZBQA 3DZFA 4AJ4A 1OC4A 5A5FA 2UUPA 3AI1A 1HSOA 4CQMD 4PLPA 1EK6A 3CSDA 3MTGA 5HS4A 5K6AA 2X9GA 3VPGA 4H7PA 2OBNA 4GBJA 4YJFA 4IBOA 1BXKA 3RUDA 3GMSA 2YDYA 1I10A 4LN1A 1LSSA 4IMRA 2Q45A 1ENPA 1GFSA 1YONA 1JU9A 3ZDFA 2GASA 3GHYA 1QG6A 2VYVD 4NR0A 3OECA 1DSSG 2GZ2A 1JTVA 2HJSA 1EUZA 1ORRA 4OKIA 1NAIA 1FK8A 2OGUA 5ER6A 3NT5A 4FOOA 3S2FA 3LT0A 4C4OA 4XQ9A 4CM9A 1YOVA 2NACA 4L75A 4KP7A 1LRLA 2Q50A 1RYEA 4LSWA 3JQEA 4WUVA 4LMPA 3MJVA 4PZDA 2NNLD 2AQ8A 4R01A 5EESA 5EIOA 2EP5A 2DM6A 2JD2A 5C3MA 3HZZA 2Y0CA 4B4UA 3D5TA 2YW9A 1JDJA 4L4RA 2GLXA 4FFPA 2VTDA 4A27A 1PS9A 2DUWA 2PH3A 1XQ1A 4QT0A 4CM1A 2VUUA 4J90A 2R00C 4YJHB 4YAGA 1M6WA 3DZJA 1MFZA 3MJEA 1E3EA 1SC6A 3CZRA 3HSKA 2DQ4A 4JXKA 1NX6A 1DRVA 4QTZA 4L4XA 3RAJA 1LXCA 4FPXA 4XIJA 3BMNA 3Q3CA 2RCYA 2GSDA 1I3NA 3ZWPA 1ZH8A 3JQGB 4TZTA 2HUNA 4BO4A 1Z82A 1PGQA 4RVUA 2PWZA 2WDZA 3OA2A 1V8BA 1UJMA 2EGHA 1N1EA 4EEXA 1AUPA 2Q49A 1LJ8A 4ZQFA 4DBVO 1PL8A 4II3A 1EVIA 3W6UA 4YRAA 3PWSA 2EKPA 4IUYA 1AGNA 1I8TA 3AY7A 3OJLA 1F8FA 4Z9XA 3OBBA 4FC7A 1UXKA 3GGOA 3I4CA 2Q4BA 2OXIA 1IY8A 2Z1NA 4DWVA 5IG2A 3NTQA 3ZWMA 4BNWA 5AXBA 4NJMA 1DC5A 4DYVA 1I32A 5CFZA 1E77A 2H1SA 5FFFA 1JA9A 4IGEA 4TKMA 1XHLA 3GEGA 4ZD6A 4CPDA 4ZICA 1YBVA 4OOFA 3L4BA 1YS4A 1RPNA 1K6XA 2UUOA 2WYWA 5JMPA 1U7TA 1LLCA 3EGOA 2FRDA 4GX1A 4XD2A 2IXAA 1GQQA 4LCEA 4TWRA 1LLUA 2NLOA 3B70A 1H0KA 3WLEA 1QYCA 3LT1A 5L7YA 4M87A 4CM7A 4HNHA 3GDFA 1GYQA 2DUUA 4H3VA 4ID9A 3WFIA 4WOKA 4AG3A 5CDTA 3DC2A 5EL0A 3RBXA 4DC1A 3S1LA 1LC3A 3ZNPA 2ZB7A 4B4VA 2F1KA 3DFZA 2DPGA 4BNHA 4GWGA 2Q1UA 4E2YA 4J43A 3R6DA 1ISMA 4ZJUA 4CQLA 2HSDA 3A1NA 4D46A 1K89A 5CEFA 2IE0A 3AJRA 2NVUA 4CQMB 4WKGA 3DHEA 3JQ6A 2W90A 3MZ0A 3TWOA 3HFSA 4IDAA 2ET6A 2EG9A 3GEMA 3PHJA 5IAAA 4E2ZA 5K9ZA 1A4IA 2FMUA 1YL5A 1BTOA 2HO5A 2J3IA 2ZTUA 3LSYA 3NDRA 1F17A 2H9IA 1A9ZA 1HZZA 3K5PA 4R51A 1DC4A 2NVBA 2ZCUA 3WGGA 3KBOA 1KVRA 5H83A 2QRLA 5ICMA 1F0YA 2VHXA 1T4DA 2CMDA 3DMYA 1HYHA 1NQOA 2JHFA 2NWQA 3SEFA 3MJCA 5CDUA 4XJSA 4N5NA 3FD8A 2ZYDA 4IQ0A 3TZQA 1Y8QA 3ZWXA 5ENVA 2FZEA 1W4ZA 4DLBA 5TF4A 1NFFA 1B14A 1B0AA 3FR7A 3NTOA 3TZHA 1JKIA 4E31A 4XX0A 1GQYA 3OSUA 2JJYA 3RFXA 4A73A 3BMOB 3RKRA 3UGKA 4LISA 3E48A 2DVMA 2EERA 1U9JA 3WWYA 4P8RA 3GEDA 3PHGA 3RUEA 3GDGA 1I5RA 3QW2A 3NKLA 5TJHA 2CVQA 1X1TA 1FDWA 1CRWG 1ZKMA 2V7PA 4CM8B 1CYDA 5AVOA 1BDMA 3UH1A 1X0VA 2NTNA 4UAGA 3RD5A 4R54A 1HDRA 2X9NA 5L45A 3K2BA 4L4SA 5G0UA 4L74A 2E6UX 4OXYA 4ALLA 1SOWA 2FR1A 1P33A 4XIYA 5ILOA 5L4SA 2OP0A 4RPKA 1DIRA 4IDCA 4M8SA 1W73A 2Y68A 2EHDA 1MC5A 4YJGA 1YBAA 4CV1A 3CZMA 3WSVA 1A71A 1P77A 5GZ6A 2X0IA 4KQXA 3WDSA 1ZMTA 2GCGA 4CLOA 2FZWA 1V6AA 4I5EA 3JD0A 3DBRB 1K5HA 4TRNA 1NQAO 3FWZA 5T67A 1K3TA 3LU1A 3U4DA 4INAA 3O8QB 4IIVA 1EDOA 4BO8A 4GGPA 3DHNA 4G81A 4PLVA 2P9GA 1ZXLA 4DPKA 9LDTA 1GYPA 1R0SA 3CKYA 4AJOA 3S2GA 5B4VA 2VUSA 2I67A 3LZ6A 2UV8A 3UICA 1E1KA 2P91A 5L51A 4RF4A 4MP8A 4KDEA 2Q2VA 4EJ6A 5JAQA 3TSCA 2C82A 1ZEJA 2WTBA 3EVNA 3VKVA 2EW8A 3NYWA 2HK9A 2C59A 4Z3DA 1YJQA 5FWNA 1NVTA 3AWDA 3S55A 2B83A 3TL3A 3QWFA 4FS3A 2X0JA 3DXFA 5JSFA 1AN9A 4YT4A 2E37A 4Q3AA 4J6FA 4PG6A 3RSHA 1O0SA 1KY4A 3VDRA 3U5TA 3WGIA 1EUCA 3U9LA 3GVPA 5BNTA 2H5LA 2ZTVA 3TOZA 4FJ1A 4WLVA 1WXDA 3D3EA 2EEZA 1BRMA 3F5SA 1I2CA 4CMCA 4XGKA 1HRDA 4MVJP 2JCYA 5TT0A 2PZLA 3WXBA 1Z6ZA 3JQ7B 2ZQZA 5DT9A 4I1IA 4ND5A 3H9QA 1N9GB 2P5UA 3I9KA 4YAJA 5IZCC 4FJ2A 1B16A 3W6ZA 1HXHA 5IDQA 3L6DA 4CM4B 1GAEO 3UN1A 4BO7A 3ZWWA 3WR5A 4DBZA 3AW9A 4EDFA 2GZ1A 3HHPA 4B8WA 5JMWA 2D4AA 4XKJA 4N54A 5FI3A 3TQHA 3G1TA 1HYGA 2AE2A 2GYYA 3OHSX 2I3GA 2Y66A 5AXCA 5FYDA 4URFA 3SX2A 1I3MA 4HFNA 4BS9A 5EN4A 4ZGWA 4DMLA 1DRWA 2HCTA 3RBVA 1J5PA 2WD7B 1GEGA 1NHWA 2HRZA 2OOSA 2OZPA 4NDNE 4Z6KA 3FRJA 4KQWA 4D79A 3QVXA 3JQ7A 2Q1WA 3Q2KA 1U4OA 1VL8A 4OL9A 2EW2A 4RLSA 1EK5A 4R41A 5JLAA 3T4EA 1O9BA 2YHUA 4W7IA 2J5QA 1BVRA 1DC6A 4R16A 3MEQA 1QV6A 1QYWA 3V1TC 1TXGA 2Z5LA 4ZA2A 4EJMA 2EKQA 1ADBA 1SMKA 2JL1A 4AJEA 4CMIA 4FFRA 3DOCA 3GZ4A 3W4JA 1PIWA 5ITWA 3VPXA 4BKQA 3CMCO 4JLWA 1DLJA 1P44A 4RPLA 4AFNA 2GN6A 1KC1A 1AXEA 1QYVA 3D3WA 3UVEA 2EJWA 5EPOA 3GFBA 2X1HA 5DBIA 5JXWA 3PJDA 4MIOA 1PR9A 4D44A 3IDSA 4CUZA 4CR8A 4PG5A 1ZIDA 3ANLA 3WLFA 1WW8A 2EIHA 3PFWO 4FFLA 4ALKA 3OETA 4ZN6A 5JE8A 1E7QA 1BMDA 2A92A 1OC2A 1PJ4A 2VHWA 4NJOA 3GRPA 4YQYA 4U0KA 5DCUA 1LC0A 5CG2A 1H9BA 1ZCJA 2JHGA 1H2HA 2C20A 2B0JA 2PH5A 4R4JA 1M76A 1FDVA 3U4HA 3D3WB 1ZXBA 3HB4X 1UAGA 3D0OA 5FI5A 4L73A 2B5VA 1YVEI 4ZVVA 4BOYA 5JY6A 5COAA 4B4OA 2AG8A 2I6TA 2O3QA 4RF5A 5GY7A 4TSKA 5TQVA 4P4NA 2H63A 4XWYA 2GDZA 4RVGA 3W8DA 1DIBA 4QUKA 4B3HA 1SEPA 3UXYA 2Q4EA 3LQFA 4E2XA 4UVGA 5JNLA 5KKAA 2RHRA 3DR3A 2O3SA 2Q2QA 4S3MA 3C7AA 4DLAA 3GUCA 3ZU2A 2CUKA 2V6FA 3EC7A 1WPQA 4MDHA 3WQQA 1ISGA 1LDGA 3JQBC 1TVEA 1RM4A 4OHUA 4B4WA 2EP7A 3QRWA 4FOSA 1T2AA 3DTYA 4BO6A 4BNUA 4YEDA 2OP1A 1QKIA 3C1OA 3QWBA 1QYDA 4Q3DA 3GPIA 4TROA 3H2SA 2QYSA 3JD3A 2B36A 2X9VA 2NQTA 3KOUA 5F3RA 3LVFO 5KKCA 2AMFA 4BVAA 4CLHA 3B1KA 1UH5A 2FHSA 1EFLA 1Y8RA 1KERA 4IM7A 3W8EA 1C0LA 3B1JA 3UUWA 4R1SA 3WWZA 4HX5A 2PA3A 3HDJA 4XRRA 1J4AA 2I76A 3S8MA 1KVUA 1TT5B 4F6LA 4JBHA 5B37A 1EDZA 1IZ9A 2PZMA 4FFMA 4HFJA 4DPLA 1T2CA 2O2SA 3H7AA 2GN9A 1HT0A 1Q0HA 4MJLA 3K2EA 2P5YA 2Y99A 4KUGA 4WCFC 5BSHA 3QE3A 1QMGA 3GY0A 1VM6A 3WGZA 3BIOA 1T4BA 2X5KO 3O9ZA 4M54A 3ZU5A 5A3VA 3G0OA 4NNJA 3WBBA 5C7LO 4CMEA 2J8ZA 1R16A 4BQPA 5I7EA 3TRIA 1VLLA 4YDRA 4AJIA 2G17A 3UF0A 2FR8A 3HN7A 4NMHA 1CETA 5IZ4A 1QLJA 4PLTA 5ENDA 4BNTA 1EVYA 1K6IA 2JCVA 1IULA 1H93A 2EXXA 5L9AA 5U4QA 5L95A 1JVSA 3ZV5A 4P22A 5GZ3A 1PZEA 4L76A 4MVJG 3N74A 1YH3A 2P9EA 3L6OO 4IZHA 4YJFB 1OI7A 4Q39A 3PRJA 3BMQB 1ZK0A 3KYCA 3NV9A 1E92A 4MVJI 3RUHA 5IZCA 2GERA 3TPCA 4EZBA 4PLFA 3PGJA 2BMAA 3IAHA 4IMPA 4NJMB 2G0TA 1D7OA 3KYDA 4UEJA 2DTDA 1C14A 2AW5A 1HLPA 4YQZA 1ZK4A 1KEUA 4DVJA 2GNAA 2BD0A 2VWQA 2YDXA 1DO8A 4J2HA 3QWIA 3ICCA 4Y8VA 3AK4A 4GQAA 4M49A 4E2WA 5IF3A 1K6JA 5F21A 2FSSA 3I9OA 4E30A 4PCVA 2D59A 3PQDA 2BI8A 2ZYAA 3N7UA 3F4LA 1Z7EA 4N18A 4WCFB 5KJ6A 3BTVA 3JQAD 3NT4A 1QP8A 4ZQBA 2FPGA 2Y1EA 4GKBA 4Q3CA 1UP7A 3B20A 4F45A 1E7MA 4JJGA 4RDIA 2DBZA 3PFFA 3TOXA 3M2PA 3A28A 2DAPA 1H6AA 3E9QA 2C07A 3INRA 4NI5A 2PGJA 3C1AA 4WNIA 4ZQHA 4MOWA 1DFGA 1UAYA 2Y1GA 3GOHA 1N5DA 2FOIA 5K6AC 1LU9A 3BMNB 3P19A 1ZVMA 4L9RA 1ZMOA 3HNPA 5TLSA 5THKA 4DREA 4XGNA 1X7HA 3AI2A 1V9LA 4XYBA 2JKVA 4IJKA 1UZNA 3SJ7A 4CJXA 1LRKA 2D3TA 3BZUA 4CL3A 4FSHA 5JS6A 1PSDA 2PD6A 5B12A 3OJFA 3VZRA 4E0BA 4G65A 1YL6A 3O03A 4O59O 3LC2O 1HDGO 1X15A 2F00A 3ZWVA 4D45A 1C0PA 3I9LA 3KYDB 1NFQA 1U2DA 1E1NA 3JYOA 3AFMA 3KHUA 2VT2A 1DEHA 3E1KA 3QLJA 2PD3A 1UXGA 2W8ZA 3WMXA 4XQEA 4E6PA 1ZUD1 5MGBA 1SEVA 3JQ9A 2J5KA 1E3SA 3P5SA 3KZVA 1VC2A 4XA8A 4JJIA 4DXHA 3CE6A 2GD1O 2NU6A 1C1DB 4UEKA 1PJLA 4NPCA 5C7OO 2FP4A 2IODA 3OQ1A 2PTGA 3LDHA 1D4FA 2JFGA 4BB6A 2D5CA 3UOGA 1FMCA 3I9NA 2W2LA 1PJ2A 3W4IA 1MP0A 1BW9B 3LK7A 1CF2O 4IXWA 5U9CA 1B8PA 3WGYA 3GVXA 1Y8QB 3SC6A 3WGQA 5JDIA 2HRBA 1EZ4A 1ENZA 3PZBA 4E3ZA 1NASA 3ZCXA 1M66A 1E5LA 2V6MA 1C1DA 1HWYA 2BH9A 2PD4A 1I2BA 4B3JA 1ZEMA 1U3UA 4NK4A 5B4UA 3C24A 4E5PA 4YTEA 1OZAA 2ZKLA 5A3JA 4LMRA 4R5MA 4J0EA 4BNXA 4TRJA 4CLRB 2X58A 5I9MA 3ROQA 3GR6A 1MXFA 4WJZA 3IUPA 1OBFO 5FF9A 3ROMA 2BFAA 1Z73A 4X54A 4JNKA 3ZN2A 3OIGA 1XU7A 4E5YA 5I7FA 3C85A 2VOJA 5B4TA 4DL9A 2P4HX 3UKOA 2ZYGA 4YR9A 1LDYA 5T57A 3WB9A 3RVDA 4F6CA 5BSEA 2VYNA 5TRTA 3Q2IA 1ULSA 4R3NA 4DLLA 1T2DA 3ZWYA 1KVSA 4CODB 3IUSA 5CEEA 2IDZA 3BXXA 5U1PA 2HU2A 1PGJA 1YXMA 3B1FA 3D5QA 3FTNA 1N7HA 2A9FA 3CH6A 3ZU3A 4HV4A 3LT2A 3VZSA 1LLDA 4ZRNA 2I9PA 1KS9A 1WMAA 1HDXA 3E6AA 4CM4A 3ON5A 3FNFA 1ADCA 2ZCVA 4GSLA 4FFNA 3ZV3A 4DRYA 2VRBA 2QIOA 3QSGA 5IJZA 3GG9A 1Z74A 4QQRA 4J9VA 3KXDA 1P1FA 3I83A 2C7VA 3MOIA 2CDAA 4BQRA 1ID1A 2FR0A 1LI4A 4R9SA 2VWPA 1SO8A 2VZ0A 1YDWA 2VUTA 2EJVA 3C8MA 3PP8A 1DB3A 5IFLA 3GC6A 1F8GA 3JTMA 3I4FA 4QECA 3D4OA 2PNFA 4ND4A 1YB4A 3A06A 3BHMA 3IIEA 4QO8A 4E12A 4Z0HO 2HMUA 3L4SO 3ZZNA 1ADFA 4K28A 4PIVA 1E6WA 3KTDA 2UAGA 2HDHA 4EUHA 3K96A 3FPLA 3IP3A 4DQXA 3NAQA 4PGFA 4Z9YA 3RWBA 1HDCA 3UAGA 6LDHA 3ETGA 2VYVA 1KEWA 4YYZA 4MP6A 3ZWOA 3MJ4A 3BMCB 3KO8A 3A14A 3L77A 1SAYA 2NQ8A 2WSBA 2YY7A 4JN6B 3ZH2A 3ZW9A 4H16A 5KVVA 1EE9A 4TQGA 4CM9D 4CMAA 5KVCA 2CF6A 5DBGA 2O4UX 1DLIA 3GAZA 2E82A 2BFPA 2XOXA 3PPIA 1X14A 4NBUA 1GZ6A 4N5LA 1IZ0A 1PJTA 1EQ2A 3R3JA 1N1GA 1DXYA 1R4NB 3F3SA 4IDFA 4I8XA 5DF1A 2B37A 5EINA 3WGOA 1E3LA 5TGDA 4WLEA 4WGGA 3KUXA 3FN4A 3WJAA 4DTIA 3VPHA 1QRRA 1T1RA 2Y1OA 1PWZA 3ABIA 3HFGA 3VH1A 3ASVA 4JX8A 1B3BA 1DIGA 4J16A 2PFGA 1XELA 4AJLA 3CEAA 3I23A 4MVJD 4J3FA 1PQUA 3UFXA 2NTJA 5COBA 5IDWA 3GNQA 4BNZA 1DJQA 3K9QO 5BNFA 3RJ5A 3INGA 3M1AA 4DPMA 1DFIA 1GL3A 3M6IA 3H65A 1E7RA 3GH3A 4KUEA 3KSZO 3ONFA 2IEBA 4WK6A 3WFJA 1ZSYA 2CDBA 3OQ6A 4J1TA 1YJ8A 4DQUA 4A0SA 2Q1SA 2WD7A 2CVZA 3ONEA 1HTBA 3H5NA 1NBOA 3PK0A 1ZNQO 2WYVA 3IKTA 2D8AA 1NWCA 1NVGA 3PHIA 5A9RA 5G4KB 3EHEA 2PGDA 2J3JA 1VL0A 3PLRA 4DGSA 4CMBA 4DC0A 2X0RA 3WGTA 1PWXA 4XB2A 4HKTA 4XGIA 5LCXA 3DAFA 3JQFA 2HK8A 1LDEA 1Z7BA 4Y6RA 3WJ7A 2I5PO 1CJCA 4E5NA 3VTFA 3NDIA 4IJVA 3FSRA 4LGVA 2X23A 1CQJA 4JROA 1FXSA 2DPHA 2I66A 1IPFA 3RU9A 4BMNA 2BKAA 2W2KB 4D0SA 4Q3BA 3DWFA 1GZ3A 1P1RA 3EY4A 1I30A 1QXSA 4NFYA 2HAEA 4D3FA 3QY9A 4KOAA 5T8KC 3L6EA 4Y6PA 5C7IO 2C2XA 2NUAA 3ROPA 4FCCA 4CLXA 3RFTA 1J49A 4K6FA 4LCJA 4CUJA 3IJRA 3L9WA 4R5HA 1MGOA 2A94A 4XDYA 2BF7A 1O6ZA 2YUTA 3DZIA 1YWGO 2AG5A 3PHHA 2Z1MA 5I7SA 4N5MA 3FBTA 4R68A 1MUUA 4RZHA 4DQVA 3WYCA 1A72A 2X86A 3OMLA 4UVEA 3PWKA 2X22A 1Y81A 1DFHA 1R37A 3L07A 1M67A 3ETEA 4EUEA 3RKUA 1QR6A 4MIEA 3BAZA 4L8VA 3VPFA 1R0LA 2O7QA 3JD2A 5L7TA 2PKQO 4OQYA 2NADA 3K8ZA 4AICA 1LSJA 3AM4A 5CEJA 5DOVA 4NK5A 1HETA 1K0UA 4K9DA 5T8KA 5CPFA 4B79A 3GT0A 1Y9EA 4BNIA 5AXDA 1XYGA 4D7AA 2Y05A 5F1KA 2JD0A 4ALMA 4YT8A 4QFCA 1WDLA 3ROKA 3RBZA 3DTTA 4GMGA 3QJ5A 4U5QA 1WMBA 3E03A 3WNVA 3U4CA 1E5QA 2LDXA 3ADOA 2IZ1A 3KYCB 3LC1O 3WIDA 2VHVA 1HLDA 1PL6A 2VNAA 1RM5A 3QVTA 1L1FA 1C1XB 3VH4A 4XQCA 4HBGA 4GMFA 4IXTA 4PLZA 4RVSA 9LDBA 3DBHB 1GPJA 5A1TA 4MVJM 2XPCA 4WNCA 3HQ4O 4Z0PA 2O4CA 1R0KA 3LYLA 1PX0A 3ZHBA 1PR3A 1NTOA 2G5CA 4RJTA 1DOHA 1ML3A 4PRLA 4K26A 3NT2A 3AOEC 3W4KA 5JC1A 5KJFA 1GY8A 1Q0QA 3IKVA 1BWSA 1G0OA 3DL2A 4AJHA 4ITUA 4MO2A 5J23A 3C1TA 4XJTA 3KSDO 5A02A 2RBEA 2CFCA 1VE9A 1JW9B 3PQFA 4JP2A 2CZCA 4Z0TA 3TFQA 1GUFA 1ZZEA 4FFOA 4NG5A 4CLEA 1MX3A 3I1JA 1Y1PA 5KJCA 4CMEC 4OGWA 4I5FA 3IS3A 3NTRA 2YZ7A 4JIGA 1ZSNA 1XIVA 1FDTA 4J4HA 4Y98A 5F5LA 4FDAA 1DJNA 1X0XA 2W4QA 1I0ZA 5HRUA 4FW8A 3VH2A 4GI2A 1ULUA 1QYXA 3G49A 3GFGA 3BA1A 1R4MA 1ZSVA 5AYVA 5TX7A 4P4LA 4QFDA 4A10A 4EGFA 4FC6A 3DHYA 4BB5A 2DFDA 5IN4A 1I01A 5H82A 4BV8A 4S1VA 3RROA 4C7JA 1NFRA 1UZMA 3NEPX 3Q11A 2C5EA 3F6YA 4UUOA 5I7VA 1PZHA 4EI2A 4MINA 3E18A 2IYOA 4I9HA 1CDOA 4JCOA 4A7PA 2A35A 2Q3EA 3IQDB 3DQPA 1PL7A 4K1LA 4CM5A 1VKNA 3KM0A 4QO7A 3PIDA 2J3HA 4J9UE 2Y0EA 3H9GA 1UUFA 3RC2A 4CMHA 2DBRA 3V2UA 3ADPA 5L7WA 3GA0A 2ZB4A 3GPDG 2V6GA 3U62A 3ZV6A 5JAMA 4OXKA 1A4UA 4XRGA 1ZK2A 4G5HA 2O3JA 2YQ5A 5AXAA 3RCBA 1EBFA 1D8AA 1E7SA 4LSMA 4Z3KA 1C0IA 4D42A 1GCUA 1BDBA 3PDUA 3KETA 3TFOA 2YV3A 4J4BA 5KOIA 1LDNA 3WIEA 1GYRA 3DONA 1TT5A 4J49A 4NFSA 1C0KA 4PRKA 1Q2XA 1XGKA 4ALNA 5A9SB 4KMSA 2YV2A 4I9UA
chains in the Genus database with same CATH superfamily
4JU8A 2BJWA 4LJ9A 1C9DB 1JXAA 3PTAA 3CLTC 1P9OA 4G5XA 1L7BA 4HSEA 4Q3EA 4YJHA 4EMSA 4OB7A 1Q6ZA 3RU7A 1Q3KA 4HDQB 1T6NA 3NNNA 4WASA 3W2HA 1S8FA 1I5EA 3AVPA 3NBAA 4GEGA 1UPAA 3U0BA 5B36A 2AQIA 5BQXA 4PS1A 5EE1A 3DLCA 3TYXA 5CCXA 4JEUA 3UJ8A 4HS4A 4P58A 4N65A 4XUEA 1QHHA 4QG3A 1QQ6A 1RQPA 3ABZA 3LYAA 3NAGA 4FHDA 4TMZA 3VR2D 2XZDA 1TIKA 2BI7A 4BECA 2XSZD 1ZIYA 1OHHA 4RE5A 3UWPA 1RJEA 3PUHA 1RQ2A 3EYAA 5KJ1A 4RTOA 2FPIA 3JW8A 3WZLA 4CIXA 1B15A 1XMVA 1E2JA 1KJNA 1LPNA 2P9CA 2ZK7A 1KDVA 4AUMA 2GZSA 2RK4A 3FLBA 5ARCA 3I62A 1HF3A 2D62A 1GU7A 2PY6A 3GEBA 3VTZA 1DBVO 3CEJA 2DY0A 4DJTA 5MF6A 5A71A 1MABA 2KJQA 3DNMA 4L78A 4ZZ3A 1EX6A 1L5SA 1EB8A 5JW6A 3FF1A 3X1KA 1E5VA 2GAAA 3GQBA 2AD5A 4ILKA 4NVRA 4R2HA 4Y2GA 2CFIA 1Q0UA 3IVXA 1A1VA 3BIFA 1NBEA 2GGSA 3KOXA 3W5AA 4YUYA 4GYYA 1EWYA 3ZEIA 1KY5A 2VP5A 1IOLA 1E3WB 1OREA 3R0IA 2BP7B 4K2HA 3ROZA 3X3HA 4UPEA 4ZI2A 5LOVA 4G4GA 3KPVA 5IP5A 2NV2B 1DG1G 1MTOA 3E1GA 4J7UA 1AKMA 3ND7A 4DLPA 5HIMA 1J33A 1WXFA 1OF1A 3IVMA 2DQSA 3FH0A 3T1VA 4ER0A 1HNZB 3AX6A 1Q2UA 5MHTA 5EZSA 2OHIA 3RLIA 1GILA 1ONNA 1JB1A 1SH7A 3IT3A 2Z83A 3BPSA 1N92A 1W48A 4RLQA 4M55A 5GIOE 4RO0A 3K8OE 5IWAB 4H15A 2FMIA 4NHEA 1WW3A 2AHRA 5EGNA 5JISA 2Q6OA 2O23A 3OQBA 2YFYA 2G82A 3GIDA 3QNMA 3EGIA 1CY4A 5PNTA 1W46A 4F8YA 3IL2A 3ONDA 3TB6A 1M2EA 1JWLA 1UBTS 1D07A 4GP6A 4QEDA 1YDGA 3F78A 2HX1A 3W3AD 3WDKA 3QU5A 2QEQA 4DV3B 1V35A 3ZCRA 1VXOA 3C16C 1MIOA 2G5PA 5ALPA 3OIUA 2DP4E 1JQKA 3IVRA 4I3HA 2PUHA 1ODCA 1ECCA 1OWLA 1CR2A 2VJMB 5JDCC 1H0SA 4JJFA 2MJLA 3INNA 2AXQA 2JCBA 4KYUA 2Q7XA 2X0NA 2HFKA 1CY7A 3CINA 3MFQA 4R1PA 4WCVA 3RIHA 4KB5A 4KHZA 5KDDA 1PR5A 3T3MB 1H1LA 3HU2A 5I8PA 5BV1A 2I03A 2X1MA 3BDAA 2ZJ0A 3QFCA 4LXYA 4GOOD 5KJEA 3D6JA 4M0FA 1N8SA 3WGNA 2UVDA 4MKZA 3B3QA 1NY5A 3LAWA 2OD7A 4PO3X 4UE6A 3BWYA 4YV1A 4MPTA 1PI3A 3GJZA 3NWOA 1ECBA 5E6SB 3U3ZA 1OAOA 3NHZA 2ZBEA 1ZCAA 2A88A 2G9VA 1F9AA 4YCBA 4BX9A 1QCDA 3IAFA 2QT1A 1NM5A 2NPOA 3Q5EA 4OQXA 3ZE6A 1SQ6A 2I55A 3NUZA 1AZSC 4Z1MA 2ZATA 3DOFA 4Y9SA 4G37A 4YCDA 1RAHA 2JJ8A 4BGVA 1QIEA 1CP3A 3RFVA 4J0JA 4YMVA 1LW6E 3O91A 2QJWA 1PGPA 2W6OA 2FP4B 4P3OA 2BY4A 1SPXA 1XA4A 1XP8A 1F0KA 1MAUA 4GP7A 5ICFA 5C0OE 5KDLA 4NPHA 4HP8A 4RVCA 2F7SA 3FVTA 5KYUA 2B2NA 3PBKA 1SG6A 4R0VA 1FJHA 2BGKA 2H17A 2FN8A 3LX5A 4H7EA 5G41A 2HGZA 5JZ9A 3DD5A 3OX3A 1U2QA 4R1LA 4DJDC 3C6YA 2NX2A 4WXEA 3C7TA 1F8UA 1NBMA 1ZVJA 1J1IA 4YROA 4XWOA 5IDXA 1MH9A 4R05A 3OLXA 4OGKA 1M5RA 3MAJA 2ZYWX 1FX0B 4HUQB 1BXZA 2QTTA 3C39A 2ZUEA 2VDVE 2YHAA 4ACAA 4C4SA 3DMFA 1R5BA 2QL6A 4I9NA 3B6KA 3FZYA 4YUVA 3DE2X 4EKEA 4H18A 4RV9A 2HHAA 4AZSA 1RWMA 3QF4B 3QXJA 2I1WA 4G3XA 4J4TA 1E1CA 1HYBA 4E32A 3K0KA 1VHDA 4F97A 4DIMA 3ZBTA 2JRLA 2GJ9A 2FCAA 3DO5A 1K9SA 2DJIA 4YT2A 2J41A 2JH9A 1H4TA 5C1OA 1AK1A 1OFTA 1O6GA 2XWSA 5KMGA 3KSAC 2XUFA 2VA8A 4B74A 4G5YA 4JYBA 4P7GA 3NRCA 2DTXA 3FCSB 3TIFA 1LQUA 4KLCA 3UKDA 5H68A 3J81A 3W1WA 3OE5A 4G8BA 3RUFA 4KWHA 4MKXA 3K16A 2GM4A 3UKJA 1ECJA 4AJJA 4C43A 4DMCA 3W5CA 1XR3A 3NKFA 4MV3A 4ZEWA 4Z7NB 2UZ1B 5GJWC 2PUDA 3OQIB 1K7XB 3GZTB 3O8BA 3P0IA 5FEUA 3AF3A 4O4LF 1T2NA 3L43A 4NBWA 5JEDA 3VX3A 2I1VB 3H9JA 1XQ6A 5BRJA 2HRRA 1Z6GA 2LRHA 2FX3A 4LJRA 1DVRA 4E21A 1U8YA 5KYYA 4QXMA 1DAOA 2OMKA 4TRMA 4XCVA 2OORC 4WPGA 5TGZA 4BO2A 1Y9JA 1XJ5A 4IH9A 1FNMA 4LDZA 2VHYA 4B9EA 2NU6B 2EQAA 4ZT5A 4IJUA 3QVGB 3OAAA 3QX3A 3MWDA 1ZUHA 3F9CA 5BT9A 1U2GC 1THMA 3M2TA 3NBZC 4K87A 3V2GA 2X5OA 3GZNA 2WSYB 4YYEA 1FFXA 4Y2QA 3AV0B 5EFZA 3NANA 2DPMA 5FYQA 4L85A 2P7HA 2UZ1A 3M82A 2VT3A 5KI6A 4QGHA 3FBWA 2DC1A 4AXXA 1NVBA 2I34A 3OZWA 3WP0A 5SZKB 2PS1A 3AUTA 2V58A 3ODPA 1PJRA 2VA9A 2WNHA 3M3PA 2RI6A 2NZWA 3K73O 5FNVA 1MO3A 2WSIA 3BYZA 4HDRB 4X66B 1O95C 1MB4A 3AZQA 4PZUA 4X84A 4RA6A 1RWWA 4OU5A 3LQ4A 1BRTA 1QH8B 5CH3A 3FOEC 3RC9A 4MA4A 1YRLA 5HDBB 2QTGA 5IW8A 2QZPA 1DEKA 2WWXA 3W9SA 3CX8A 4M1WA 3H3FA 5G0VA 2XH8A 4BCDA 1CV2A 5KVSA 3PE4A 2AR0A 4LBYA 4O4HA 2R8YA 2PGXA 2X77A 3AONB 3GQVA 3QY0A 5AKZA 1WAMA 2IZ0A 2EKZA 2LCFA 2RCNA 3EXIB 3RV4A 1KH2A 1LS6A 2G1JA 1EG2A 2AH5A 1M8FA 2ILVA 1QHSA 3KQUA 2J0UA 2DF8A 3JZDA 2Z5VA 1IG3A 1GVHA 3HN6A 2OCBA 3JARB 3A4LA 1GEEA 2CLSA 3O3OB 2W22A 3OZIA 4PZPA 4MZDA 4BATA 5L3QB 4W8HA 1I2ZA 4BO3A 4DTCA 2Z9CA 2GD6A 1RYDA 2OMEA 1JV2B 3D1LA 4F21A 1O5IA 1N2SA 3HCDA 3QU9A 1R5NA 2P68A 4PCUA 1KEVA 4BV9A 4R8KA 5KSOA 1XEWX 2VCEA 4QHTA 4V1CI 1RXYA 2ZJ1A 2OBFA 4OI4A 1E5DA 2VNKA 2NO1A 4PN7A 2F1IA 4JA2A 4NQRA 3HR4A 4Q3OA 1KMQA 5ESXA 3STHA 1V5WA 2HF7A 5KWEA 4HADA 1PRYA 5LNK1 5TEWA 1FSSA 3WLLA 3RSOA 2Q8PA 3N5KA 3Q9UA 4U6QA 4WIAA 2FFHA 1N3YA 1AKQA 2QW8A 1DAPA 1TM4E 4UUAA 2CD7A 3CLRD 5K0FA 1YJCA 3A4VA 5KYXB 3K20A 3ZQ6A 2DT5A 1FDOA 1N6HA 5E1MA 4CLRA 3HBAA 2OCIA 2YVLA 4OSOA 1XZDA 5TMPA 4QU0A 4PQYA 1MD9A 3L9XA 4Y6GB 3D31A 2IS2A 4HWGA 4O4LB 1Y8RB 4YPOA 1F2TA 1XLTA 2PLRA 3LC7O 1E3TA 1D2MA 2FFAA 5IYZF 3SHVA 1SXGA 1MW9X 4F9GA 3K1JA 5BSKA 4IYRA 1MIHA 1C1YA 1MNAA 4L08A 2HA5A 4LC0A 3SI7A 3W05A 4DVGA 4IRUB 4MUYA 3K1YA 4PXYA 3RUIA 3TINA 1ECGA 3FPAA 1U04A 3GVIA 3PEFA 3FDXA 3ANMA 4A91A 4KR0A 1OAKA 1HFEL 5KTTA 3TZKA 1IOWA 3A6KA 3WQHA 4EG7A 3M9XA 2A0YA 3QMMA 3BSWA 4HZUB 1V96A 1FQWA 1NAHA 3PUWA 4RADA 3PE3A 2QZZA 1J07A 2P9FA 1J6UA 1V8PA 4B9AA 1E2QA 2YZNA 2YOHA 3COYA 4KW7A 1HYEA 1PFGA 4FQ5A 4PX5A 3UCXA 1RVV1 3VPAA 2HLNA 1C50A 4FFBB 1IJFA 1BQ4A 2O7NA 3DMPA 2EIXA 5TC4A 5KAMA 4DCCA 3QELA 1QZUA 2K2QB 1SCDA 3PX3A 2QJRA 1C9NA 1QZXA 1D03A 3FVWA 1U8TA 4PWZA 3U4IA 1A2QA 3B9BA 3VAYA 4AECA 3AUKA 3O92A 3HG7A 1KGSA 1Z2OX 3I9MA 4II2A 2JFFA 3OBIA 5JWHA 3ZXIA 1ANKA 2X8BA 2Z2IA 3A0RB 3RLFA 4Z1OA 3RYIA 1JSLA 4JWTA 4IIDA 2IWHA 5AW7A 3I5XA 3GFOA 4EHFA 3DBHA 3QPWA 3EDRA 3OJOA 4A16A 4CIYA 3H2ZA 3U6BA 3CTMA 2JJ1D 1L4MA 1V4VA 4YX9A 3G59A 1NLFA 3AUAA 2NTVA 2ONCA 3H2BA 2E48A 4IICA 4HB2A 2O5RA 1NW7A 1SZDA 3BD6A 1W85A 3G2KA 4Z4EA 4DR6B 2QVCA 5F3WB 1ISJA 4PAQA 1EAYA 1QVWA 1X80B 1OZGA 2CJWA 2ZE7A 5EIAA 4JI6B 4WXRA 3DEKA 2VK8A 1KKUA 4A9AA 2PZKA 1PT6A 2NO7A 2K7ZA 3ILXA 5AK0A 3W3AH 3V3KA 4DXDA 4BASA 5K8JB 2FA9A 1A4XA 2C2MA 2I3ZA 4BX8A 3PEVA 1P31A 3DP9A 5AMXA 2QORA 4Y2SA 2I6GA 2WI8A 3P9IA 4F46A 2WJ3A 1GN9A 2IP4A 2D00A 4PQEA 5A7GA 1Y3CE 2WVAA 4MQBA 1WXWA 3D64A 1RR6A 1E7WA 1Z56C 2GVNA 4LSZA 4WCFA 3ZW7A 2RHDA 4C76A 1ZGCA 2F67A 3OIWA 4HUJA 4FQ8A 2CHGA 4DLNA 1AC5A 1J2YA 3KRTA 2WJJA 1FFXB 2H8KA 2Q4DA 4BMYA 5K6TA 3E82A 3WMWA 3LRTA 2Y9MB 4YRRA 3PFNA 1PFKA 2GPTA 4JV5B 3WSWA 4BJ5A 3N2LA 2B98A 3UBMA 4E5SA 3FPBA 3L7AA 4ZAZA 5C4GB 4HB3A 3JWGA 4G9BA 2VZ9A 4J2TA 1PG0A 3DBLA 5K3DA 4H6VA 3GHHA 1OWMA 2O2ZA 1L4BA 3TSWA 4LW8A 2IZOA 3FTDA 3HVRA 1A9TA 3CVOA 1UEJA 2BISA 3KQTA 3MQ4A 2PUCA 4QM6A 3T8YA 3GCWA 2W6NA 5FP0A 4YA6A 2BEVA 4UJ5A 1ZWKA 3D7LA 3TD9A 5JO9A 1K9VF 2V98A 3OP4A 2CXRA 1CZKA 5TQ0A 1DJOA 4GIBA 5CW1A 3FWKA 5A06A 3JQAB 5CA1A 3INTA 4OX9Y 1V3UA 3Q6IA 2GZDA 1EK1A 1G64A 1U5BB 3BWMA 3I0ZA 4I1VA 5FBWB 5LB4A 3F7MA 2QBYB 3U7HB 3DBLB 4NZPA 1NWHA 5DHPA 2YHIB 3H4VA 1LVHA 4U4AA 1Y3AA 1TLLA 2NXNA 1TUGA 2PZEA 1NRXA 3AEQA 2WEKA 3G2HA 3MT8A 1Q0SA 3LSTA 3N8NA 4UDXX 4F96A 3VAZA 3WYGA 1Y3DE 3IUJA 4PHTA 1GAXA 4YRBA 2PWBA 3W3AA 3ZGVA 5KTOA 5L40A 2V65A 3A2NA 4CU5A 3JQGA 5G4KA 3C3WA 4RTKA 3FNGA 1QAOA 3MTJA 1WDWB 1Y5MA 3DD1A 2WT4A 5C8YA 3ZHXA 4JX9A 4ANFA 4UPDA 3U44A 2OPHA 1U9ZA 4R8MA 2C96A 3QUAA 4D57A 1XMPA 3MG9A 4TQUS 1U8UA 1XTSA 1GDHA 1YRYE 2WOJA 3HJTA 1U99A 2Z2XA 3LFUA 3N58A 4RFVA 4XJVA 4GKJB 2G6TA 4MKRA 3LY8A 4B32A 3IQIX 1Z6QA 2FEAA 2ARKA 1E9DA 5ED0A 3UUGA 2ZB8A 4EYGA 5T64A 3JV7A 3PNBA 2W2KA 1ZBDA 4UM7A 5HKLA 1P6QA 5TIIA 2PSFA 4N8DA 4R40A 3SYTA 3X1JA 4RORA 4F6RA 5D84A 1SBQA 3DT6A 3PNYA 1YZVA 3C6QA 4QM7A 1WEHA 1JHRA 4ND7A 4UXHA 2AF3C 3H5OA 3ENWA 3HKBB 3PLNA 4YRIA 1QWOA 3BIWA 1CC1S 1P5RA 1Q7TA 2R1TB 3NKVA 3NWEA 5DEIA 4B6OA 2VP2A 3I72A 3VPDA 3OKPA 4OH1A 5I3ZA 3HJUA 3EGWA 2OBLA 1NLYA 4JQZA 1UXJA 3TLGA 1SC1A 2XQJA 4P33A 2I62A 4NABA 2PR7A 5FOQA 4D9JA 4CV3A 2QRZA 2W0SA 3P9KA 2XVXA 4UUNA 4ZYTA 4GDMA 1MG5A 4P38A 4GICA 5CP8A 3RHTA 1Y9ZA 2OFWA 5HYVA 3AI3A 3BULA 4PLGA 4UNIA 2XNJA 5IWCA 4JP8A 3MUOA 1VJ1A 2VLIA 1GKIA 3NGLA 4HAOA 3PG5A 1OPXA 2HIMA 1PHRA 1T2FA 2KS6A 3AJ8A 1ULAA 4FN5A 3SLKA 4YAEA 3T0GA 3SYMA 1DKUA 5AKYA 3W1VA 3IDFA 4D0RA 5AW8A 5HZGA 2W2VA 1OI2A 1Z4QA 1OLXB 1YB1A 4QG7A 2WWRA 3B3JA 3DOJA 3GFPA 4RD2A 5JG7A 3G17A 5DNYB 3MC1A 1MLDA 2YQ4A 4LV6A 3VZQA 2WWYA 3Q3VA 3L4BC 4EO7A 5LP1A 4EG6A 3KLPX 2GN4A 3NTUA 4C1BA 2M6RA 5CDSA 1V2GA 2QSYA 1PTJA 5I4IA 1U5AA 4ZHSA 2QE7A 4OQFA 4QU5A 3SDSA 4BLQA 1KMHB 1RWVA 2TMDA 4RJIA 2Z08A 1G5FA 2GF2A 3QITA 1C9MA 3QPBA 2XB9A 3ORYA 4OBEA 2BKUA 1C4XA 1A5ZA 2W8BB 3BMOA 4QOJA 1NMSA 2VTVA 2AZTA 1ETHA 1PEDA 3OJWA 4OHOA 2B25A 4F3KA 1GUZA 3L7YA 1HSZA 2P3LA 4EMTA 5BR7A 2W98A 2QYTA 1NYRA 4EWLA 1BWQA 3RUAA 1P2FA 1A8PA 5T6BA 3SSNA 4AN1A 4BFYA 3IURA 1P19A 4W5WA 4G07A 3KEQA 4UZSA 3TLMA 4JLOA 3HPRA 2DHCA 4MICA 3NJ4A 4JFRA 3AVUA 1Y6JA 5KSYA 1PTJC 4G2NA 2A86A 3GBSA 5LDDC 1EJ6A 2C7PA 1D2CA 5AKGA 4EHDA 5L3ZA 4BFZA 4CBVA 4PQGA 5G0TA 4DNOA 2KM1A 3QX9A 3WKBA 3ZLVA 3HPQA 4YUWA 3D8SA 2VQFB 2R97A 3ZGYA 4AJ1A 2PR2A 1ORHA 3EVTA 4CZ2A 3QTLA 2JCXA 4NV3A 1KXZA 2EGUA 1YBFA 3ICQB 4M86A 4P32A 3SKYA 4BXOB 1Y7TA 4RDHA 1LK7A 3DE6X 3R09A 1IN5A 2XF8A 3I9FA 4I9FA 3W9YA 2R8XA 3ZHZA 2AFRA 3U4QB 2GK7A 4FGSA 4YBZA 5TMDA 4IOLA 2GPBA 2Q3LA 5F9HA 1UMBA 3FHLA 2A9OA 1TU4A 3P32A 3OLVA 2GCNA 2EBWA 3N0XA 4U6NA 1RYFA 5AJUA 4W8OA 3EVDA 4CCAA 4LGMA 2PCLA 3IHWA 4WFKA 4MUJA 5KQSA 1H8EA 4NJEB 4PV7A 2V7TA 1V7QA 3LNTA 4X7MA 4B0PA 1XI2A 1FRZA 2ACVA 2VH5R 4HYTA 2JG3A 4O2BA 4EHAA 5BUZA 4COKA 1N9ZA 4TYMA 4LFBB 2X4IA 3A0UA 1Y6ZA 3E5RA 3WHKA 4PYRA 3Q1LA 4MS1B 2HJ9A 3ZEAA 3KC2A 1EVKA 4WESA 3EZNA 3AZOA 5JO0A 1BJTA 1W5AA 2ZWPA 4XM1A 1TL7C 4Y6SA 4WZBE 1CU1A 4DM7A 3FYUA 3DGEC 5LC1A 1DTWB 3TR5A 2I65A 1PNTA 1DEXA 1UWCA 1FUUA 3KSUA 4R9RA 5HCNA 3TL2A 3L8GA 4DLUA 5F12A 1F1JA 1M34B 1XQ9A 4FXPA 4GH5A 1SZJG 5I9LA 3OQNA 2IIQA 3DMTC 3OQIA 1J39A 3E7DA 2XUOA 3MWFA 2I2WA 3TZLA 4B6SA 2ODWA 1MORA 3ASUA 5ICEA 3DE3X 1VMKA 2A67A 4PYQA 2IIPA 3G8YA 4V3BA 1L4NA 4DIOA 4EGSA 1EWKA 1NATA 4BNJA 1E2UA 3FKJA 2HCRA 3VR5A 1LX7A 1SBHA 2HMTA 1XX6A 1P74A 3THXB 3RTAA 2EJTA 5JRZA 2R4TA 2W6PA 1UEXC 4MQMA 4K86A 2AC2A 1YB7A 1ZD1A 2GZHA 2X4DA 3ZDZB 3GCGA 3NX4A 3P7MA 3AO0B 2C9DA 4XVQA 3DLTA 5HXAA 1X6VA 3VV3A 3I3OA 3W6OA 1G8GA 3GVHA 5JAHA 5JPDA 4IV0A 3KBBA 3U3JA 1OASA 4FI3C 1PFWA 3A4MA 1V9SA 2AEMA 1RLUA 2XRFA 3EAQA 3NYRA 4OD0A 3G0DA 3R1IA 3K1ZA 2F9FA 5HF5A 5BSMA 3E3LA 4NH4A 1T2VA 2VS1A 2YJGA 2R7LA 4RLFA 1FNNA 1WKCA 3EK2A 1FB5A 4KN5A 5DCWA 5BO5A 3TRJA 4UUBA 4BMCA 4PPQA 2BGUA 4AMGA 5HNKA 3C45A 3CY6A 3P52A 4WN9A 4HDRA 4QE3A 4RESA 2M1XA 3THRA 3T3GA 2F3RA 5A03A 4CLOB 3NM5A 3HHEA 1M34A 5TR9A 4TL7A 3UC9A 1EUDA 1GL6A 1Y4AE 2GETA 3F3KA 3OEYA 4O0LA 3T5DA 1WOMA 5C51B 2VXBA 3L46A 1R4AA 2PQ2A 3ETJA 4YWHA 1KH3A 4K0RA 1OBHA 1X7YB 1L8XA 2J3QA 3NVKI 1Z4OA 5CHYA 4W9NC 1GAJA 2FE1A 5D3ZA 4Z9FA 1DTEA 3NR2A 4JENA 2MMCA 4PR0A 3FE2A 5FTKA 2FLKA 2XVMA 5ADHA 3G2IA 1IM2A 1XLTC 2CB0A 3ZNNA 4WZBA 1VP9A 4FNGA 5KNLA 2EOAA 3LY7A 4H59A 5CGZA 3WK6A 2QRJA 4B34A 4G1VA 3O2QB 2F48A 1PG2A 3JQPA 3F9IA 4E94A 1DEAA 1CFZA 3USES 4AWXA 1ORTA 4DV6B 1IQ0A 5BYKA 2OHFA 3U16A 2X4GA 4OSPA 4PHFA 3WZMA 3BFPA 4EPVA 3HJNA 4EZEA 1P1JA 2WA1A 1QIKA 1PT7A 1R3DA 2Q5HA 3BZWA 7ADHA 2F90A 4A8TA 1TAUA 2Y4OA 1PF7E 1U9IC 2R1VB 4BVGA 1KH1A 4JAVC 4RSHA 3T7DA 4LVCA 5FPYA 4J3NA 1RLMA 4PGGA 1EXNA 1VMDA 2PKCA 3STTA 4EY4A 4IIEA 2Y1FA 4YIHA 5K8LA 3A1DA 1GA6A 1B3RA 2G09A 3FM9A 3ORRA 4IHKA 2D7JA 1YHYA 4LHEA 4Q16A 3HWRA 1B1AA 1HH4A 4UAVA 5GZ1A 4JBLA 1K06A 1EGAA 2EV9A 5EVCA 1J5XA 5K7SA 4LNUA 4P0PB 3CCFA 1LDMA 4DUPA 3I2FA 4AJNA 5F2EA 1MTZA 1N9KA 3V4PB 3FX2A 3ST7A 3N53A 4DRXA 4RGBA 4RK6A 3VVCA 1G8FA 3TZBA 1RC0A 3ZE0B 4P36A 1RE1A 4OJMX 3RSGA 1LPSA 3ER9A 1JR6A 3GJXC 3TDKA 5KYWB 3ESZA 1UJNA 2HV8A 1XHEA 2MMGA 2V7QD 2VFAA 4J1QA 1EBUA 3HDYA 3PGMA 2FMKA 4R7TA 3VHRA 1F51E 2QVGA 1IHXA 2P0YA 4XZ3A 3ZXSA 1XZFA 2QXTA 4P7BA 3DOEA 5IBPA 3VTKA 3VSDA 5CM8B 3ZOKA 1E9RA 1KQGA 2HZ7A 5B3KA 3REGA 5IBRA 3CF4G 3Q87B 1U2SA 3TKAA 3A4NA 1WB4A 4MV0A 3DZBA 1OBCA 2F55A 1E8DA 4B3CA 2O14A 2SKCA 1S2NA 2JIPA 2GJ8A 3E35A 3M6UA 3QIVA 7MDHA 3OF2A 1D9XA 2QRKA 4YO8A 3DQZA 1WHSB 4ZAVA 1Q7BA 4F8EA 1N78A 4MUEA 2GCOA 3LUCA 5LP6F 2VJPA 2IW1A 3MWJA 4L9AA 1NW4A 3ORFA 2CKDA 5IBCA 4Y1GA 2XMBA 2J3EA 3NZEA 1JLHA 1P0FA 2HMWA 3PKJA 1HRKA 2GK3A 2WT8A 4OCZA 4QASA 4U8GA 3X2FA 4EW2A 5BPHA 3LD9A 4YVFA 3R9XA 1KTVA 3OHPA 5IDVA 4NBVA 4QRDA 1F8YA 1WKBA 3DTVD 3IBCA 4IPTA 2AA3A 2I2AA 1AKNA 2YL2A 4MJ7A 3TEFA 4IJQA 1ID8A 1EEHA 1SB8A 3AEZA 4IDPA 2FY8A 1USGA 1UWLA 5JROA 4RFLA 4OOEA 5AOVA 2EWMA 3ZX4A 1RQLA 3KL4A 3AYXB 4GAEA 2WP0A 1G3QA 1CTQA 1XMJA 3BVPA 3Q8KA 1SUSA 4PHHA 4RK4A 3VNSA 2IS1A 2GKSA 4NCJA 4KK3A 3LBHA 4U2EA 1SCJA 3I1YA 9GPBA 4CV0A 2DKOA 1KU6A 1S0UA 4ROTA 2QJTA 1GG8A 2PRZA 1W29A 2X1VA 1SZPA 4N3GA 3EGXB 1OZFA 2P2SA 4ARVA 3CNOA 1UBHS 1I14A 3H9EO 3NWPA 1ZNZA 4TGLA 5AW3A 3MJHA 1NUSA 2IH5A 3ZLJA 1V6SA 2C7GA 3NLLA 1LV7A 2W7TA 3PT5A 4INJA 3UJ3X 4E09A 1A2KC 3HGQA 4XQGA 5E3JA 1AGPA 1RBZA 5BORA 4IIUA 5AI0A 3U19A 4NBRA 2B0CA 2ZRMA 4L5BA 2OYRA 1EK2A 5BR1A 3P4XA 1ISHA 2IXGA 3PFCA 1OYVA 1CDEA 2YRXA 4J1SA 4BN0A 3RTDA 3H1EA 3DULA 2I4NA 2VXYA 3A6DA 5LB2A 1VG0B 3AP1A 4F5ZA 3CJTA 3QV1A 1TKCA 1WW2A 5TT1A 4GX0A 2GN8A 1YVPA 1RQGA 3EZLA 1ZX1A 4PSUA 1NJ5A 5HUJA 2IHNA 3EYWA 1H0RA 4HLUA 1TYZA 2QW0X 1GQOA 4FKMA 3CX4A 1L7VC 3ESXA 3M5CA 4E51A 1T25A 4MQUA 4GLOA 4AJKA 2IYPA 2ZRHA 3U60B 2APJA 2EQ5A 4P6VF 1K5DA 3MTDA 3ZI0A 2EFJA 2XX3A 4U2GA 4ABYA 4BZPA 1KK0A 3H19A 1QK3A 3NO4A 4RVOA 5LSAA 1CF9A 4NU5A 2C4NA 1GXSA 3KQMA 4NP6A 1T1IA 3CE9A 2LZ0A 4ND3A 1SOVA 3BH6A 2G70A 1B26A 5DDIP 2YKGA 3V5NA 1Q15A 4KRYA 4UEWA 3E9NA 3DAYA 3I9V6 4AYXA 2OUKA 2VTKA 2HQBA 3A4TA 3K92A 5JVDB 1LCIA 3WB2A 3QKSB 4JC8A 5BY2A 3I05A 1K5GA 1MX9A 5JBNA 1JKJA 3ZE2B 8LDHA 4L1KA 3BOSA 4X20A 1ESEA 2CCGA 3ZH9B 3TNFA 3QNUA 4WE3A 2BFDA 4Y67A 3TZEA 4W9RA 1NN5A 1CB7A 3B8EA 4E22A 1U7WA 2ZIXA 2RGCA 2Q99A 3PFIA 3GZNB 2ZSKA 3BGIA 4TZ6A 2Q9CA 5KYVA 3HDGA 1L7MA 2QZ9A 1EG7A 4B6GA 3EFOA 3IHKA 4CI9A 1G7SA 2Z04A 3TTYA 5FUXA 3OE7D 1C4KA 3ILSA 1O97C 3IB3A 5DFAA 3TTXA 1JZTA 2J9FB 1L5VA 1E2IA 1X77A 2Q5EA 2QDKA 2YWJA 3DWEX 3AVTA 3LA6A 4HDCA 1S3GA 2P9QA 3CSDA 3MTGA 4RPCA 5DM70 2BM1A 1J7KA 4GRDA 3R75A 3FUTA 4A15A 4HGQA 1Y3HA 4A0GA 1J1ZA 1CIJA 1GNPA 3OUTA 4M83A 5LMZA 4H7PA 4LWOA 2HFJA 3RUDA 1XZMA 2ODQA 1DCFA 2YJ4A 4OUDB 1Y98A 1ENPA 2VDNB 1GFSA 2INGX 3PQ2A 4LVNA 3STYA 2YV4A 2ECFA 1H05A 1TEXA 2EX4A 3LJKA 4L5YA 3WGJA 3ZDFA 4D9FA 2PUAA 5BSUA 1JDVA 5LZ5A 2VYVD 4NR0A 3M5WA 2FPSA 1P7VA 4EA6A 1JTVA 1MOQA 2FN3A 4UTOA 1ZY2A 4CDGA 2CE2X 1ORRA 5CH8A 1NAIA 4J8PA 4WFQA 3TIIA 1UPCA 1NE2A 4L8LA 5BR4A 2NVOA 3FCCA 4OIFA 3U7FB 4B1FA 2O0HA 2NACA 4L75A 1VE1A 1BMTA 1NW6A 1C7EA 621PA 1VMIA 1RYEA 4LSWA 2YXNA 1S3FA 7ABPA 3FKSD 5FULA 3ND5A 4MAAA 4PZDA 4MUGA 4C4ZA 1M1XB 1G6Q1 1EJBA 4U7PB 5EESA 5I9IA 2EP5A 2P79A 1JPVA 1DBSA 2IJGX 2QU8A 3EIFA 2YW9A 4OHYA 1V8DA 4FFPA 1CQWA 4A27A 5K20A 4GBED 1Z5UA 4DSZA 2PH3A 2Q4OA 2FSHA 3EPLA 4J90A 5HK9A 2O2EA 3UMMA 1CUAA 1HDIA 4TTIA 2P5SA 2B3TA 3ESDA 2TYSB 2CLMB 2IUUA 1OVGA 4K8OA 1IVNA 5CT9A 5LIRA 2XQIA 1M2FA 1U31A 2DQ4A 4QDKA 4EP1A 2A3NA 2HO4A 3BFJA 4MV8A 2PPVA 3CTPA 3TVTA 1IDN1 4YMWA 3QZUA 5TPWB 3TW6A 3FGPA 3N6VA 2P90A 3KVNA 3OPVA 3Q3CA 1AF4A 4B73A 1SCUB 5KNCD 1I3NA 4HG2A 3DKKA 1GGHA 1NKVA 2ZVQX 1FFGA 2C5GA 3RFUA 2XB4A 3OA2A 1V8BA 3HUTA 5AI4A 1B76A 1KFEB 2C4HA 1E6CA 1AUPA 4ZU1X 3AV3A 4R0MA 2JFNA 3Q3JB 5I45A 1EVIA 4IDQA 5IH3A 2UUCB 1G20E 3M6FA 4L6IA 4J0KA 2PMDA 1V37A 5LMUB 4IUYA 4U7JA 1AGNA 1HFKA 1VYUA 4NE2A 5I01A 1CKEA 2D1SA 2G07A 2IDMA 1OYYA 2K4MA 3OJLA 4IX1A 4XJXA 3QPDA 3LHSA 5EP3A 2V0GA 1W4LA 4HRXA 4I1YA 4MCHA 5CX1B 3ZDEA 2I80A 4TV9F 2PL5A 3I1FA 3NTQA 3ZWMA 4DWVA 4WFIA 5AW4A 5K0EA 5EKDA 4DYVA 4G01B 2AOTA 2H1SA 5A0FA 1EWRA 4AU1A 1JFFB 3GEGA 4BVJA 4P3PA 3C4QA 4F38A 1XAJA 5IBQA 4D26A 4F3NA 1YS4A 4IXNA 1A69A 1Y3FE 1RPNA 5EJEA 1YB6A 1MRSA 3HJBA 4QC2A 4IW3B 4BC1A 4LGCA 2CJXA 4GX1A 4IILA 1A9QA 4XD2A 2JRCA 4DLXA 1YR9A 5AW2A 4AN4A 3SX0A 1G5QA 5D7BA 1H0KA 5FFNA 4M87A 1E4OA 4C9BA 4TYYA 4NF2A 4UMFA 1HQCA 4WOKA 1DIOB 1ZIOA 1VKRA 2CBZA 4AQYB 2F3QA 5C1IA 4AG3A 3DMHA 5UKDA 5CDTA 4S1PA 5EL0A 1QU2A 3S1LA 2PMKA 5CVDA 2C3UA 4M9CA 3TLEA 1PYGA 5IT0A 2DPGA 2Q1UA 2RJNA 2Z2YA 1Z3CA 4Q9JA 3R6DA 2GARA 1WXEA 4F86A 1ISMA 4WBNB 1VQ1A 4CQLA 1PD1A 2FZVA 5GVRA 4D46A 3BMXA 5CEFA 4HX9A 3MSXA 3ZZ1A 4WKGA 4JASB 5DGXA 5EJ5A 1Y9DA 3TWOA 1WETA 3KZCA 1BCRB 5LYJF 3WAKA 2XB2A 2IBMA 5J2TF 3WYNA 1CY8A 2Z2ZA 3GEMA 1X42A 1GKKA 4MS1A 1X7ZA 2ZR0A 5MFZA 5IAAA 4TKUB 5CXQA 4E2ZA 5K9ZA 2L82A 1A4IA 3UYKA 3NVDA 1U7OA 5L3SA 2FMUA 2HO5A 5LZ9A 1GO2A 1N6RA 5JJKA 4GXNA 1EFCA 4OH7A 2BBSA 1NDUA 3HH8A 3FLMA 3R5TA 1NZFA 2O0KA 2NVBA 3BB1A 4TT8A 2PMCA 2HSZA 2TECE 3EF1A 5H83A 2VJOA 5EKUA 3LKZA 1FVOA 2ADFA 4NCKA 4B85A 3NWJA 2QRLA 1Z0DA 4BE7B 4JIMA 1T4DA 2NT3A 3A05A 3DMYA 5EA2A 1A5AB 1X1QA 4KNYA 2W11A 1BFDA 2J45A 2CEKA 5EWJA 4ARAA 4UM9D 2IEZA 1FVXA 5E9WA 1FRNA 1QFJA 2IYNA 3M5PA 1Y8QA 2WF8A 2AJBA 1QIHA 3CR8A 2QGFA 5JAUA 4KXNA 1I4LD 3G7SA 1G60A 1K97A 2JI7A 1JKIA 1UWKA 4B84A 1GQYA 3LWZA 4TL6A 4JL5A 3AEUA 3W9UA 4ENTA 3MVEA 4JA0A 4I6JA 4WOPA 2OG1A 4LISA 3AEXA 2ZYTX 3VNVA 1K66A 1UDRA 1U9JA 2DSNA 3WWYA 2HA7A 2VPQA 4HVCA 1RYYA 4EAQA 5C53B 3PHGA 5H4HA 1YS6A 1UFQA 1E0JA 2I7VA 1NNLA 3GJ0A 4HPJB 3TIVA 2FWBA 5C8ZA 1IPHA 5FUMA 3UGJA 2W48A 1T5OA 1TK9A 1VXRA 2ZUBA 4BLPA 4KXVA 1FDWA 2FFQA 2FG7C 1CUVA 1WD7A 2V7PA 1CYDA 821PA 1BDMA 4KE9A 1A77A 1GPUA 1KPGA 2NTNA 5HF8A 1KZ7B 3WRXA 3ESQA 4R54A 4F8JA 5LQJA 2R48A 1PWYE 5K0LA 3IQGX 4L74A 4Q9IA 1R0RE 2NO9A 4FNOA 5HIAA 2FR1A 1CCWA 5FIUA 1BGXT 4HGPA 1DWOA 1XKTA 2ZCJA 4EHIA 1AQIA 3LO8A 5F9FA 4BVHA 1DIRA 5C8YB 4C04A 5LQMA 3H1GA 4LDAA 1MC5A 2XCQA 3K9GA 1F6DA 3H2KA 4TTVA 4UHHA 1OSNA 3WLRA 4LJ7A 3WSVA 2VH1A 1A71A 2GEJA 1VJ5A 2QSJA 1SC4A 4ZU6X 3UMFA 2AD1A 2FEPA 2V5AA 3WDSA 1IONA 1JPNA 3SKXA 4BAZA 2GCGA 4CLOA 2NQ2C 3LHIA 4M1OA 5BMVF 2C0QA 1XAGA 3A1FA 4MR7A 2QQGA 1CUEA 4EJSA 3TQIA 2ZQ5A 2YUIA 5GM1A 2PX8A 1HLGA 4QBKA 3FMIA 2G6BA 4HL6A 3DHNA 5TY0A 4G81A 1DG9A 4O08A 4QIHA 3PC8A 4RD6A 5IKXA 1KQOA 2H18A 4AQDA 1KQ3A 2LNDA 9LDTA 2YYSA 1R0SA 1E98A 1QVRA 4F92B 3BSFA 3OWXA 3QFHA 3NV7A 2VUSA 3LZ6A 5BQ5A 3QI7A 5BVGA 3EGEA 4YP1A 2AJDA 1WR8A 3AKEA 2QP4A 4RF4A 5M3BA 1JIVA 1QAQA 1Y89A 1VPLA 2HWXA 1T8UA 1O54A 4US0R 2NAPA 1ZEJA 3AUXA 1DQPA 3MF4A 4HK4A 1T4GA 2A3RA 2EW8A 5JLJA 2NZVG 3F4KA 1CS0A 2D0PB 3QUCA 4Q34A 1PLKA 2LPMA 1AS0A 1J2TA 1P17A 4QOIA 1WZUA 2I87A 1NVTA 3AWDA 4HDSA 4OGGA 3RYFB 1APBA 3WLPA 2X0JA 1OUMA 1G7TA 3DXFA 4HVAA 3KXPA 2E37A 2WLTA 1TMGE 4PG6A 2YXPX 2ECKA 3O1IC 2XE4A 5CFRA 5BSTA 4YNBA 2I4LA 4F3RA 3U5TA 1RCTE 1Y80A 2QVYX 4WQMA 3WGIA 1Z63A 3GVPA 1YQWA 3ZTYA 2RI0A 4MV1A 5J63A 1U0TA 3C8UA 3BRSA 4F2DA 2NO0A 2EEZA 3EBLA 2CLHB 1C9KA 2PKEA 1RADA 1BD4A 2R5FA 3BGWA 4CMCA 1YZKA 4MVJP 1CRPA 1O2DA 3JQ7B 3UOWA 2C92A 2ZBPA 1OQAA 3EG9A 3CNBA 4FE4A 5LYJA 2A7XA 4BE4A 4BBAA 2A7QA 2PG3A 3I42A 4RAOA 4YAOA 4YAJA 3SYKA 2AYXA 1RAEA 3R20A 3W6ZA 4AKGA 4PAOA 1V47A 1HXHA 3CRZA 5FJJA 1V5GA 3SQLA 5JZSA 5JD3A 3UWOA 4PC6A 3AF6A 3BWCA 3ZCTA 4DW8A 4ZJYA 3S2UA 3UTDA 3A2LA 4MI9A 3ZWWA 1YVDA 1ODSA 1WV0A 4HNQA 5ADWA 5FL7D 3M6WA 1UAAA 3TLCA 4B44A 2II6A 1JLKA 3DV9A 3HHPA 5IC5A 1M1NA 3GEPA 1IUPA 3M3HA 4B8WA 1CLEA 1ZLXA 4XKJA 3RH0A 1OFIA 3A8TA 2D5IA 3E7WA 5IF9A 4MHTA 2GYYA 3DM5A 3GJ5A 1SD1A 1B0ZA 2WJ4A 3IEMA 4D4GA 4KO4S 1R0YA 1UFRA 3U56A 3HI6A 5IX8A 4TSFA 1EIWA 2IE8A 1Z16A