2AE2A

Tropinone reductase-ii complexed with nadp+ and pseudotropine
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
259
structure length
259
Chain Sequence
AGRWNLEGCTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKELNDCLTQWRSKGFKVEASVCDLSSRSERQELMNTVANHFHGKLNILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISSVSGALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLVEMTIQDPEQKENLNKLIDRCALRRMGEPKELAAMVAFLCFPAASYVTGQIIYVDGGLMANCGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PROTEIN (TROPINONE REDUCTASE-II)
publication title Structure of tropinone reductase-II complexed with NADP+ and pseudotropine at 1.9 A resolution: implication for stereospecific substrate binding and catalysis.
pubmed doi rcsb
source organism Datura stramonium
total genus 104
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 1.1.1.236: Tropinone reductase II.
pdb deposition date 1999-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ae2A00
3HNPA 4YB8A 3WBFA 4Q3NA 3MOIA 1ONPA 3Q2KA 3JQFC 5JY6A 1Q0QA 3AFMA 3MWEB 4NBVA 2RH8A 3JQ7A 1DLJA 3NX4A 4D3DA 3WR5A 1NQTA 5IZCC 3MTGA 3PHJA 4YAGA 4ZQEA 2EGHA 1UXIA 2DAPA 4BO0A 3DHYA 4JN6B 3TFOA 1UP7A 2QIOA 4ALNA 1ZJZA 3HHPA 2YQ5A 3R1IA 3ZNQA 3L6OO 4NJOA 5IF3A 3PIDA 3L4BC 3EVTA 1NFQA 2YDXA 3AI2A 1PJLA 4BQRA 3Q3CA 1DFIA 4YDRA 1J6UA 4ZHSA 2FPIA 1XIVA 3WNQA 3VTFA 1E1MA 1BRMA 2CVQA 5ENDA 3U4HA 4BV8A 5L3ZA 3PGXA 5A9SB 1PJBA 5HS4A 1EVYA 3GPDG 4AJ4A 2VHVA 1EVZA 1MG0A 4CMIA 3GLQA 3EGOA 1EQ2A 4QFCA 5CDUA 2IZ1A 4O6VA 2AQKA 5KKAA 4RF3A 1HT0A 4WKGA 4GPD1 4J2HA 3RC9A 2CDBA 1QXSA 1D8AA 1LBEA 4M87A 1I24A 3HJAA 1Y8QB 3HQ4O 4FC7A 1U2GA 2WE8A 1KVQA 3OIGA 4NMHA 1ZK3A 3T7EA 7MDHA 4XR9A 2JHGA 3IJPA 3DMYA 1GPJA 4IPTA 1P0CA 4QEDA 2IZ0A 1C1XB 2JJYA 3R0IA 1F12A 4Q3DA 3H3FA 1W6UA 4E21A 1ENPA 3M2TA 5JE8A 3WNVA 4BNNA 2PH5A 1DRUA 1YL5A 5JSFA 1U5AA 1WZIA 2YHIA 3KLMX 3H6KA 2D2IA 4MO2A 4A5OA 1DIRA 5F5LA 4MVJD 3ZH2A 4OKNA 4TRRA 1BTOA 1AXGA 2EJWA 3DBHA 4E5PA 2EKLA 2Q46A 5L9AA 5JC8A 5LC1A 1WAMA 3KO8A 5AXCA 2B36A 1CQJA 1JWBB 3CUKA 3OICA 5AOVA 3E8XA 1GZ4A 2PD6A 3QWFA 1HDCA 4YRBA 2UYYA 3W8DA 3OSUA 3M1LA 3PFFA 3H9GA 5FWNA 3EZYA 1B3BA 1EUCA 2PD3A 2A9FA 2BFOA 1KS9A 1E6UA 2ZTMA 2J6IA 3B70A 3QQPA 4LISA 1SMKA 1LDEA 2BKAA 5T57A 5LDHA 3HN2A 4GX1A 3AY3A 3TZKA 3WJ7A 4CV2A 3IP3A 5DDIP 1SB9A 5CG2A 4WCFA 1DRVA 3MTJA 4BGUA 2OP1A 4MINA 1YO6A 3ENKA 4QSMA 1P0FA 1EVIA 3VPGA 1M6HA 1MXHA 3Q9NA 1E0DA 1PZHA 3K6JA 3AUUA 5TX7A 5GZ6A 3AM5A 4AJPA 3WFJA 2PV7A 4J9VA 4FJ0A 5TSDA 1Q7CA 4ALJA 3L6EA 3B1KA 2NNLD 1F14A 1KYQA 1O5IA 2WSBA 1WLYA 1I33A 4HNHA 4ZJUA 5A9SA 1V3UA 1MA0A 1BSVA 1HYGA 2PR2A 1E3EA 4CLOA 3E6AA 1UAYA 5JPIA 4RCVA 3U3XA 4K28A 1Q7GA 3ROPA 3VVCA 1OBFO 1R4MB 3RC1A 3SJ7A 4DMMA 3AOGA 4AVYA 4PG7A 1CQIA 4N7RA 4DMLA 1XCBA 2IODA 2C7VA 4XA8A 3OJLA 2VRBA 3FTNA 5COBA 3GZNA 4HFJA 4J6FA 4BNVA 3CXRA 1DOHA 4PRLA 4EUEA 2QQ5A 4L75A 4AJIA 2ZTLA 1LLUA 2E82A 3NT4A 3F4BA 1K89A 1HDXA 1FDWA 3PYLA 1QR6A 1F17A 1UDAA 2X58A 2OFPA 2VHZA 4J1NA 5F5NA 2Y1EA 1P1HA 3PDUA 3QIVA 5JAZA 4R4JA 4YQYA 2WD7B 4ZQGA 5KWEA 2NVUB 3WQQA 1JTVA 3M6IA 5JXWA 4ZQHA 3ZWWA 1V3TA 4XYEA 4B3IA 2PZKA 3JQAA 5U1PA 4GBJA 4Q3EA 2O2YA 3SLKA 3D3WB 4HWKA 1TI7A 3VHRA 1BVRA 3U5TA 2AHRA 2TMGA 3QVXA 4AJ1A 4D3FA 4L0QA 8LDHA 3B20A 2Q4EA 1Y5MA 1ENOA 3CTMA 1NX6A 2CDCA 4BO9A 1PJCA 4TZTA 5FI5A 1PTJA 1PZEA 5A06A 1RM5A 5G2OA 2Y1DA 3T4XA 2X0JA 3I3OA 3NEPX 1PIWA 1LDBA 3ONDA 5TT1A 4JGBA 2BGKA 1I3LA 1PJSA 1P1KA 4TWRA 1JA9A 3NDJA 2X5JO 4EJMA 5DOZA 4AJNA 1QYDA 2HK9A 4FW8A 3UW3A 3JQBC 1HSOA 3DZHA 4OIMA 3PWSA 4XZ3A 4R5HA 4BB6A 4IDCA 2I5PO 4I9UA 2UUOA 4YJFA 4ALIA 5EL0A 2C0CA 1QV6A 1ZH8A 3GEGA 5KKCA 4I5EA 1F8GA 4CQMB 4F46A 5TC4A 3AOEC 4KWHA 3NT2A 4EBFA 4D3SA 1SEVA 1HE4A 2ILTA 1PZGA 1NWHA 1J0XO 2O2SA 1VL0A 4OSPA 4Y6SA 4BNLA 4NNJA 1N1EA 3G49A 4CUKA 3FD8A 4EI2A 3HB4X 3D1LA 1H9AA 4U6SA 3H9QA 1BW9B 2GO1A 1C1DB 3LZ6A 4ZRNA 1EBUA 2O3QA 3GUCA 4Z9XA 1PWZA 3LC2O 3QVSA 3OECA 3ASUA 1DIHA 1O89A 1Y6JA 1YQXA 4ZN6A 2NU8A 3RQSA 4NHEA 1LI4A 3HDYA 5TT0A 3HWRA 3WIEA 1DJQA 3GY0A 1NQOA 5L7WA 1NR1A 2HO5A 3PLNA 4E2YA 5CP8A 1LLQA 1AUPA 4GLLA 5FEUA 1HLPA 4LRSB 1Z6ZA 3GRPA 1P1FA 3UOGA 2NTNA 1XELA 1UAGA 1DC5A 3AUAA 3VPSA 5KJFA 4R54A 3LF1A 2X7HA 3ZV3A 4JXKA 2VQ3A 4BNXA 3HG7A 3NGXA 1N5DA 1W8DA 1L7DA 1A4IA 4Y6RA 3TQHA 1PGNA 5ITWA 1F06A 4O59O 3RJ5A 5THKA 4HUJA 5L95A 1WP4A 5KJCA 1LX6A 2FZEA 3NGLA 4RZIA 1SC6A 3GPIA 2X9VA 1P1RA 5JAQA 4M86A 2J3IA 3ZV5A 1W0CA 1WVGA 4MVJI 1PL7A 2WYWA 5FYDA 4CLRB 1DLIA 1N8KA 3VKVA 4PIVA 3QVOA 4JBGA 4E0BA 3GVPA 4RPKA 4RVHA 5T6BA 3D3WA 1E1KA 4F6LA 4NBUA 4CL3A 3BMOA 4LK3A 3LT4A 1U4SA 3DZFA 2X5KO 3VC7A 3F1KA 3JSAA 3GDFA 3UCXA 5MGBA 3GF4A 4DLLA 2Y0EA 3ZNPA 5IZCA 5BSFA 1IB6A 4E2WA 1MC5A 4AJEA 5COQA 4EEZA 3DHNA 1YBMA 2DU8A 4OAQA 1B8VA 2BI8A 3SC4A 2PZMA 1EQUA 1B8PA 1EUDA 4MPDA 2GN9A 3PEFA 3OJFA 1EFLA 3K30A 2EW8A 1X15A 3BYZA 3OJEA 4L74A 1PGOA 2I66A 2PA3A 3L4BA 1PJ4A 2HJRA 1E3SA 1GV1A 2BELA 1D3AA 2ZKLA 4CLEA 4E32A 1JLLA 4YT5A 1HYEA 4R51A 5TRTA 3ZV6A 4CQMA 3SX2A 3PLRA 3WG9A 3ANNA 2HJSA 1PU2A 4NFHA 5DP2A 1PL6A 4IINA 3JD3A 4KMSA 1DAOA 2ZYGA 3H2SA 1LEHA 4GMFA 1C0LA 1I0ZA 2DUWA 4JP2A 4OYRA 4ZRMA 1HDOA 2YUTA 3IKVA 4RPJA 1PJ3A 4EJ0A 5T67A 4W99A 3MCVA 3OEYA 4CM6A 3WX0A 1VLLA 3DOJA 4WLFA 2R00A 3FR7A 1CERA 1Y9EA 1LQUA 1ZXLA 3PQFA 5L4LA 3RROA 3PP8A 2HK8A 3E9QA 4OQZA 3WGOA 1BDMA 2OMEA 3IL2A 3G1TA 3PWKA 1OC4A 5AQ1A 1UXKA 1NPYA 2C82A 1DJNA 4YJGB 3WMWA 4CMBA 1Q7BA 1X7GA 4YACA 1E77A 2HMUA 1XA0A 1RM3A 2FR1A 1DC4A 1ARZA 2Q99A 2ZYDA 3ENNA 3ZWYA 1YE3A 5ICSA 4ROSA 2GPTA 5JDIA 2CZCA 4PZDA 1H2HA 4TZKA 5JO9A 1WMBA 4CLRA 4IDDA 1A27A 3LT0A 1IY8A 3KSDO 1LDYA 3GH3A 4NPCA 2HMWA 3GG9A 5G0UA 4BO2A 4ALMA 4CM7A 4DA9A 2O3UA 1R37A 1X7HA 3OBBA 4FBGA 5C5IA 4JJGA 4BO3A 5IG2A 1EK5A 3F3SA 4RQUA 2WDZA 3RASA 4NU6A 4YWJA 3UVEA 1ZFNA 4IQ0A 1ISMA 2HUNA 1TVEA 3NUGA 4K9DA 1OFGA 1YBAA 2GN8A 4KUHA 1E3WA 1Z73A 1WNTA 3U09A 5A4DA 3OH8A 3FWZA 1SOVA 4RZHA 1XDWA 3E5RA 3GMDA 1OC2A 4N54A 5ES3A 1C3VA 1WXDA 3KEOA 1GCOA 4EYEA 4IZHA 1JAXA 4QECA 4KTTE 4PFJA 1GQ2A 4WCFC 2P91A 1PJ2A 3GNTA 1NHWA 4IDEA 4R16A 4ZQBA 2G0TA 4NBWA 4P4LA 5L4SA 4QUKA 2P68A 4CQLB 1GAEO 1PGPA 5JS6A 3RUCA 1E6EA 1P1JA 4WLEA 1LQTA 2VWHA 4M89A 1VJTA 2EKQA 4F45A 1TEHA 2W4QA 1PJTA 4J16A 4J4TA 1E3IA 5DP1A 1YQDA 4A26A 4D7AA 3LQFA 4K1LA 5IN5A 1YDWA 1U5CA 1XEAA 1NPTO 3S2FA 3DC2A 1RYEA 3IS3A 1Y81A 2C7GA 2EP5A 5KTKA 2FPPA 4R5MA 2I67A 2B5VA 3LK7A 3MJ4A 3OP4A 5HM8A 4JP3A 5A5FA 1ZMOA 4CODB 1WWKA 3W8FA 1JKFA 3I83A 3S2GA 4GL4A 4KOAA 4ZD6A 4FB5A 2HKIA 5HWSA 4J0EA 4BMVA 4E2XA 1S6YA 1U3VA 4P38A 1T4BA 2JD1A 2IYPA 3BHIA 4BKPA 3KXDA 3KZVA 4YXFA 4DQVA 4YJGA 1O94A 1GZ3A 5FI3A 1NNUA 1SO8A 1DEHA 5HS6A 4CLHA 4BNWA 1VI2A 4TRNA 1A7AA 3A06A 2Z95A 4PG5A 5JCJA 5IXSA 1FK8A 2VHYA 2Z5LA 4WK6A 4CM5A 1E1NA 4JIGA 1BVUA 2BFMA 1QP8A 4CR6A 1EDZA 2DTEA 2C54A 1QLHA 1FF9A 1YL7A 5HRUA 1H94A 1CRWG 3RUFA 4R1UA 4UVHA 4BNJA 5KVSA 3TFQA 3Q6IA 1K6XA 1I2CA 3H5RA 1GQQA 3JCZA 1P3DA 3RKUA 3UGKA 4AICA 2NM0A 4HBGA 1QYVA 3H4VA 5C7LO 1KBZA 5H83A 3C7CB 3FSRA 5TGDA 3QW2A 1CEQA 1KY5A 2C2XA 2GR9A 2ZK7A 1XWFA 1YGYA 1X13A 3BAZA 3JQBA 2NVBA 3A4VA 3WYEA 4CV1A 3KSUA 4YT2A 3QWAA 1IZ0A 1K3TA 4QO8A 5C7IO 1B2LA 4ZGWA 1HL3A 1H6AA 4MP8A 4Q39A 3O26A 1B14A 3QVWA 1FDTA 3TN7A 4JNKA 5JYDA 3DBLB 2HLPA 2GUGA 4ND5A 2DC1A 3INGA 2BI7A 3AOEA 3U49A 2Q1UA 4WGGA 4DREA 1LSOA 3OQBA 4CQLA 3TF5A 2AG5A 4NU5A 4PLTA 4XGKA 1R0KA 2WWRA 1BG6A 1ZEMA 5TJ9A 3KYCB 3ZGYA 3ZZNA 3R3JA 2JCXA 4CL8A 4HV4A 4CM8B 4WLVA 3F47A 5CEEA 3KTDA 3ABIA 2R6JA 1GPDG 4HY3A 3H5NA 3RD5A 2OBYA 3GQVA 3RFXA 2JCVA 2O3RA 3KYDA 1LRLA 3L07A 1UXHA 5KVQA 2O7QA 3DAPA 3AWDA 4YT4A 1H9BA 4PVCA 3DBRB 3BXXA 3KHUA 3X2FA 2BHLA 1GR0A 3KOUA 4CMHA 4NJMB 5A9TA 2DUUA 2X0RA 2GLXA 2AMFA 3BMQB 3PGJA 1N7GA 5EPOA 3WBBA 4AJKA 1NFFA 3AK4A 2W2LD 2B4QA 3NDRA 3O4RA 4BO5A 4RF4A 4IBOA 2BFAA 1U28A 4FS3A 2LDXA 3HB5X 2J5KA 2I99A 5U4QA 1NVTA 2FWMX 3IOYA 3VTZA 3DO5A 3HADA 5CDYA 3GDGA 4GWGA 1OOEA 1EVJA 2ET6A 4L76A 2P9EA 4E3ZA 5B4VA 4FOOA 2X22A 1NR7A 5KCZA 1ZK1A 3TZHA 1U2DA 3ANLA 4IJKA 3V1TC 3GGOA 3UFXA 5BSHA 4WNCA 4DRYA 2Y67A 1LRJA 1LJ8A 1MX3A 2I76A 2WJPA 2ZQYA 3WWYA 1DFGA 3DZKA 1XR3A 1A5ZA 1NQ5A 4N5NA 3CSDA 5ILGA 2BMAA 4D41A 2A92A 4IJVA 5JDCA 1HLDA 1DHRA 3PYXA 4FFNA 4BUCA 2GF2A 3CINA 4KWIA 1GU7A 3E03A 3GMSA 2D59A 5DOVA 2BGMA 3TOZA 3FF4A 4PLPA 4GVXA 3RAJA 4OMUA 4NK5A 3JQ9C 1KEWA 3DBVO 4ZVVA 2OBNA 1ZSNA 1VKOA 2J3JA 4MVJH 1U4OA 4PLYA 3WICA 4MKRA 4UUMA 1T2DA 2DLDA 4BNUA 2WM3A 6LDHA 3S2IA 3RBVA 4AL4A 3UICA 1PQUA 4WLNA 4AG3A 4NR0A 1YVEI 3FTPA 3CMCO 3DBLA 5DF1A 3WGGA 3Q2IA 1ONOA 4J9UE 3HFSA 1NAIA 3DHEA 2JL1A 1AGNA 4IIUA 1ISHA 1ZW1A 2NVWA 3SVTA 1DXYA 4Q3AA 1RM0A 3GHYA 3ULKA 1MV8A 4BO1A 5B4TA 2PGDA 4RLSA 1ORRA 4XDYA 3ZNNA 1M75A 2W8ZA 3G79A 5BR7A 3KYCA 4L4XA 5CG1A 3Q9UA 5AXAA 5CHEA 3VPFA 5JLAA 3Q11A 4G65A 4BVAA 3PPIA 5KNLA 3CMMA 3D5QA 1IL0A 4LVUA 3ZWNA 5JNLA 4KDEA 1RPNA 4IQGA 4XJTA 5C3MA 2V6MA 1TT7A 4LW8A 1G6KA 3DBRA 4XYGA 5TNXA 3I23A 1GL3A 4D43A 3WGIA 1QV7A 3WYBA 4BQPA 2Z1MA 1R6DA 4FOSA 4RPLA 1D4FA 2X9GA 3DZGA 2R00C 4KUGA 4Z0HO 3IC5A 4PLZA 1HYHA 3JD0A 3FHLA 1GFSA 4O63O 3MJSA 3WOHA 1X7DA 1YRLA 3CE6A 2X0IA 4J91A 4Z6KA 3LDHA 3E5MA 4AJJA 1I2BA 2VWQA 3JQAD 3DZBA 3N58A 3C24A 2CD9A 4IY1A 3I9OA 4FFPA 3WMXA 3A9WA 4J1TA 4IUYA 4N5LA 3K9QO 4XD2A 2C5EA 4I5FA 5A5EA 3B1FA 3N74A 2OHXA 4A73A 2VN8A 2YZ7A 5JDIC 2X5OA 3WYCA 4XRGA 1DC3A 3UCEA 2YQ4A 3IAHA 3ZU4A 1GEGA 3L77A 2Q4BA 4MVJF 5COAA 3OFSA 1HZJA 1X1TA 5KJEA 3NTRA 1BXGB 3JTMA 3ZI0A 2P4HX 2H9IA 5HA5A 4J90A 2G82A 2YW9A 3GEDA 2OXIA 5B37A 3G17A 1NTOA 2GZ2A 4XB1A 1WZEA 3GAFA 3ZWAA 1SOWA 2IZZA 1O6ZA 3KYBA 2GZ1A 3JQGB 4LGVA 4B4VA 4B8WA 4FIZA 4DC1A 1C14A 4F3YA 3RI3A 1KEVA 1M6WA 1TT5B 1UZNA 3VZQA 1B7GO 4BKOA 4RDHA 1ZMTA 1CWUA 1T2EA 2E6UX 3TRIA 3BHMA 5BT9A 2HRZA 3BTOA 2PZLA 3C85A 3N7UA 4MJLA 3F4LA 3AY7A 3U0BA 5I7VA 4IS3A 1YOVB 4Z3KA 1H2BA 3ADPA 1VRWA 4A27A 4WLOA 1NHGA 1D7OA 1ID1A 2W2KB 2G76A 4GGPA 1V3VA 4DQXA 2VZ9A 5F3RA 3DEYX 2NV6A 1LRKA 4QO7A 4UVDA 3WQSB 4B3JA 4J7XA 1J49A 4XYBA 5IN4A 4II3A 2WMDA 4LMRA 5IDQA 2PGJA 2WYVA 3WLEA 1TA4A 2IEBA 4BL5A 4BB5A 3QHAA 1PEDA 2HMVA 1EMDA 1Y8QA 3GVXA 1IZ9A 4G81A 3JYOA 3ZWPA 3E48A 5KOIA 3OQ6A 4H15A 2H6EA 5THQA 1HSZA 3O03A 2AA3A 2P9GA 1CF2O 4LCEA 1A7KA 3HDQA 1AE1A 1C1XA 8ADHA 5BSEA 3P2YA 1ISGA 4XWYA 2EEZA 2NTJA 3P5SA 4FCCA 2VRCA 4JJIA 1VSVA 3CIFA 5DBFA 2VZ8A 5IDYA 1LSJA 3ZN2A 5DT9A 2J5RA 1R15A 3W4IA 1Y7TA 3LC7O 4MVJG 3H3JA 4FJ2A 2CNBA 5F21A 1A72A 2NU6A 2Y0CA 2YV2A 3RVDA 3RC7A 2DTXA 3OIFA 4E5KA 5IZ4A 1G0OA 1K6JA 3GVCA 3C7AA 4J1SA 2DM6A 4MVJE 5JAIA 2EP7A 3JD1A 3U4DA 3BMCB 2D1YA 3RC2A 3DAGA 2Y1CA 3PRJA 3CEAA 4WASA 4CM3A 1C0IA 4UEKA 5CAEA 4XQCA 2P5UA 4CMCA 3ST7A 3VH2A 1I32A 3O8QB 3CZMA 1M67A 2IXBA 5TQVA 4DQUA 4FGSA 2EF1A 2FP4A 1JKIA 1KC1A 1RJWA 4X54A 3GN1A 1ADBA 3KRTA 1Z75A 2VZ0A 3C7DB 4JQCA 1RKXA 4MVJA 4YEDA 4D79A 1IHXA 5EINA 4KP7A 4PZCA 2P4QA 2D5CA 5IDXA 1IULA 1YQGA 4FJ1A 1HTBA 4YVFA 2BD0A 3ETDA 3I6QA 3ZCXA 2TMDA 1ZNQO 2X23A 4MVJM 1P9LA 2IEDA 1K6IA 2HU2A 5DN9A 1NBOA 5A05A 1FDUA 1X0XA 3ICPA 2VT2A 3AU8A 4R3NA 4WEOA 4YAJA 5A04A 1LLCA 2Q3EA 4JK3A 2ZTUA 2W2KA 5AXDA 3GNSA 2ZCUA 2EG9A 3EHEA 3HZZA 1P77A 4A03A 5A1TA 1EBFA 3GRKA 3I6IA 2QW8A 4DIBA 4K6FA 4I9NA 5KVCA 1R4MA 5H82A 1B3RA 4LVCA 4G2NA 2FOIA 3ETEA 1UJMA 2WYUA 3PHHA 3H9UA 4Z3DA 4BO4A 2HK7A 3GVIA 1NVGA 3OETA 4LRTB 4BO8A 4DPKA 5ADHA 1U7TA 1MXFA 4M55A 3OJOA 2OZPA 3DTYA 5AVOA 4IDFA 1LDNA 3GHHA 1FJHA 2VYVD 1ZO8A 3GC6A 4IXTA 2WD7A 4E5NA 1YB1A 4UAGA 1LU9A 2GASA 2NVUA 3BIOA 3GN2A 2VNAA 2Q2VA 4FFOA 4B8ZA 4Z0TA 3D7LA 4BKQA 4PG8A 1AN9A 1IE3A 2PK3A 1XG5A 5MDHA 1GTMA 4PG6A 3RFTA 5I8WA 4KTVE 2CMDA 1AHIA 3ZNOA 1B8UA 3RIHA 3GUYA 3ZDFA 2IXAA 4D46A 3I4CA 3U4CA 4BV9A 4H3VA 1PQWA 3IMFA 2NTVA 5L7TA 2ZYAA 2P5YA 4IGEA 3O8QA 5CEFA 4DPMA 2GN4A 2JKVA 4BNMA 2J8ZA 3JQ9A 1DC6A 1XYGA 5JDCC 1HXHA 5A02A 3WXBA 3DZIA 4GWKA 3I5MA 3TOXA 3DTTA 1S7CA 5F1KA 3ITDA 4PCVA 4CMEA 4J3FA 1HDRA 2Q2WA 1BWSA 1WDKA 2Q45A 3OIDA 3AM3A 3TZQA 2NACA 1L7EA 3SC6A 4WUVA 3ON5A 1NP3A 5T5QA 2PWZA 4RDIA 1M2WA 1QYXA 1BMDA 1V9LA 3RUEA 1PJQA 1E7WA 3WGZA 2EERA 4FSHA 4JCOA 2YFQA 3GEMA 3RJ9A 2I9PA 4GAEA 2YDYA 2X0NA 4MP3A 1U1IA 5I9MA 1FDSA 4S3MA 3GAZA 3AFNA 5ITVA 4YRAA 1Z45A 4FGWA 4HFNA 4D45A 2X9NA 1BW9A 3PIIA 1C1DA 3O9ZA 4XIYA 3W4JA 2FHSA 3V1UA 1W73A 5JY1A 4QT0A 3VVBA 4O0LA 3DXFA 1HDYA 1QG6A 1D1SA 4IXWA 3TL3A 3EW7A 3C1TA 4CLDA 4RF5A 2QRKA 4WCDA 2I3AA 3V1YA 3ONEA 1GUFA 4CPDA 4QFDA 3AJRA 4TQGA 3A14A 5DCYA 3G3EA 3IJRA 1KOLA 4BGEA 3AU9A 4E12A 3GT0A 3H2ZA 4D0RA 2AE1A 2PLAA 3DWFA 5IJZA 1P31A 1KVTA 4TROA 3D4OA 2Q1WA 2DQ4A 5JCJD 3ZHYA 3BA1A 5LDGA 2CF6A 4CJXA 2SCUA 4OH1A 4MDHA 4J49A 3GFGA 4L4SA 4YJHB 4K26A 2H63A 1LNQA 1GY8A 3QSGA 1SB8A 3D0OA 4NDNE 1LC0A 4H7PA 3PQDA 3PVZA 4E2ZA 5B12A 4BNFA 3L9XA 1YKFA 1R66A 4ZQFA 1ZK2A 3E18A 4XQ9A 3WGQA 1K5HA 1SCUA 4IM7A 3JQEA 2C20A 3IUPA 3W6ZA 1Q0LA 1Q0HA 5CFZA 2VTDA 1KY4A 2GD1O 4HX5A 1KC3A 3BHJA 1DSSG 3ZU5A 3R6DA 1F0YA 4E31A 3WSVA 2H5LA 3LLVA 1GEEA 2NADA 1Q2XA 2GSDA 2EKPA 3PQEA 5JAMA 1XKQA 3ANMA 4DXHA 4D44A 1KVUA 4P8RA 3EK2A 5K6AC 4RL6A 4FR5A 2ZCVA 1PQPA 4DBZA 3S1LA 2NQ8A 2Q1SA 1I5RA 1Y8RB 2O3JA 1AHHA 3ZWXA 2VOJA 2B0JA 1YH3A 4PLVA 4U0KA 5JMPA 4WLUA 3HSKA 2XF8A 5H81A 3ZW9A 4R1SA 3EAGA 1LA2A 4MOWA 3DMTC 2ZATA 4RVSA 5KJ1A 4GKBA 2YV3A 4PZEA 1DFHA 4XYMA 4BGIA 1TLTA 2XPCA 3PI7A 3GNQA 3K2EA 1N9GB 4R01A 1ADFA 3ADOA 2E48A 4CMAA 3VH1A 3PTZA 3KM0A 2Q1TA 4W82A 3FNEA 3P7MA 2QZ9A 3TZ6A 2FSVA 1NM5A 3D4NA 1DPGA 4NK4A 1KEUA 1AXEA 2OOSA 3W8EA 3IDSA 2ZQZA 1PS8A 2PKRA 3ORFA 5GZ1A 4TVBA 2J3KA 5L45A 4OXKA 3M1AA 3PJDA 3F5QA 4RPGA 2BGLA 5I7FA 4HNGA 5K0ZA 1GQYA 3JQDA 3BMNB 5A3VA 2CUKA 4JJFA 3E9MA 1A71A 4YQZA 5EN4A 3I9NA 4K6CA 3IIEA 4ESOA 2C5AA 4GLOA 5CDTA 2OL4A 1O8CA 2DBQA 4EJ6A 3LC1O 4YBZA 4CV3A 1QYWA 3SLGA 1GV0A 4NBRA 3PFWO 4RV9A 5KJ6A 1V8BA 1UH5A 4P4NA 4U5QA 5T8KC 3FR8A 5CEJA 4MIYA 3WSWA 2VUTA 3F6YA 1JVBA 2VUSA 3FBTA 2VTEA 4CM9A 4UREA 1G1AA 2XOXA 1QYCA 4YR9A 3B6ZA 3ZU2A 4EGFA 1IPEA 4Y8VA 1ISJA 3BTVA 2PKQO 1E3LA 4IDBA 3E82A 1FXSA 4NZ9A 4WOKA 4QXMA 4C7KA 5L51A 1HE3A 4JLWA 1PWXA 2GERA 3M2PA 3MJEA 3PHLA 4GX2A 1MGOA 2GNAA 3QV1A 4ND4A 1KERA 2P2SA 3RWBA 3IP1A 1YXMA 5ENVA 4FFLA 4CM1A 1CDOA 3I9JA 3DFZA 5EESA 4INAA 2NUAA 1LLDA 4RORA 3D3EA 3EY4A 2CDAA 4NFSA 3WGYA 4DPLA 1J5PA 1ZSVA 3PHGA 1XLTA 1H6DA 4IZIA 4E4YA 3QVTA 4TKMA 1E7RA 4IGFA 1T2AA 4RVFA 3FNGA 3RU9A 1U8FO 1DHTA 2UV8A 1Y8RA 1R4NB 3L0DA 2AE2A 1XU7A 1A9YA 2D4AA 4S1VA 2Q2QA 5BQFA 4B7XA 1MB4A 1BDBA 3GZ4A 1ENYA 3QJ5A 5TS3A 2QYTA 4YRDA 3JQ7B 2GCGA 4NH4A 3BZUA 1GYQA 4UEOA 4R68A 5L40A 1BGVA 2PZJA 4GVLA 3WGHA 4E30A 4UVIA 1NXQA 3QA9A 1N9GA 4U8GA 3I9LA 2ZB8A 1QKIA 5DNAA 1LSSA 4WOJA 2CVOA 5C37A 3OHSX 1R0SA 4JROA 4XIJA 5CPBA 1A4UA 2VHXA 1R16A 4MIOA 1HDGO 1GCUA 3GFBA 3PZBA 5DBIA 2VYNA 3MZ0A 1E92A 2AEFA 5GY7A 4BNKA 2CF5A 3OF2A 2O3TA 5DCWA 4YAEA 3X2EA 4HFRA 2V6FA 1UR5A 2CSUA 1Z7BA 1NPDA 2DBZA 2V6BA 3F46A 2ZB4A 3F5SA 2DBRA 2PKQP 3A28A 4CMIB 2RHRA 2WEKA 3AI1A 2H1SA 1Q1NA 4Y98A 4IJWA 3Q0EA 4OM8A 4IJUA 4Q9NA 4RQTA 2O48X 2FR8A 2EV9A 2Y0DA 3H65A 3LU1A 3PHIA 1E7YA 3K92A 1VM6A 2JD2A 2EW2A 3HN7A 2Q49A 1T4DA 3LVFO 3WFIA 1QORA 4BNIA 3EUWA 4OHUA 5EQFA 3KEQA 1PX0A 3HE3A 2HAEA 3MJTA 4OJNA 3WS7A 1YB5A 2VWPA 4GSKA 3FWNA 3DOCA 3HDJA 1E6WA 2AEJA 2AXQA 1GYPA 5G4KB 4QQRA 3RUAA 2DTDA 4XRRA 4XEHA 2YHIB 4DVJA 5K9ZA 1LSUA 2QRJA 1E5LA 3LSYA 5T64A 4OXYA 2RIRA 3VAZA 5JW6A 3GA0A 1JWAB 1ADGA 4CM4B 4B7UA 3QWBA 1F8FA 3STHA 4J4HA 4E5YA 4DTIA 3SBOA 3RUIA 1DIGA 3NTQA 5GMOA 1L1FA 1N7HA 3TSCA 5A9RA 3VPXA 1JW9B 4CMEC 1J4AA 1ENZA 3VH3A 4TRJA 2ZIZA 1R4NA 2VT3A 1E3JA 1T2FA 1I8TA 1VKNA 4ND3A 1JU9A 3UXYA 2QG4A 2B4TO 1T1SA 1Z74A 3V2GA 4BKUA 1X14A 1N1GA 2HRBA 4P22A 4Y6PA 3F9IA 4ND1A 1HRDA 3KLPX 4ZICA 4WNIA 4B3HA 3WLFA 2DT5A 2IE0A 5JFOA 3EC7A 1UZMA 2QHXA 2Z1NA 4WJZA 4HFMA 1UZLA 4GH5A 4WCFB 3T4EA 1QMGA 3DZJA 3GR6A 3PWZA 1HZZA 4P4GA 5FFFA 4CM8A 5AXBA 2W90A 1E7MA 3D64A 9LDBA 4UVGA 4LSWA 4I5DA 1ZK4A 2Y93A 4M49A 1HKUA 2PH3A 4LCJA 3RUDA 1IYZA 2DKNA 4WECA 3ZHBA 5G4LA 2I3GA 2UUPA 1D1TA 4NJMA 4TRMA 1U7HA 1UDBA 4ONEA 3BMQA 2VRCD 3W1VA 4IIVA 2RAFA 5I9NA 4B79A 2QX7A 2X4GA 2V7PA 1IUKA 4CLOB 3FBGA 3GG2A 2GYYA 5EJ2A 3O38A 4XR4A 2PY6A 3COSA 3AI3A 3SEFA 4B7CA 4FDAA 1RYDA 1ZBQA 4DIFA 4KZPA 4W9NC 2FPGA 3HDHA 3ITKA 4YPOA 4ILKA 4B4OA 3MWDB 4IDGA 3GZNB 4OOEA 1P44A 4R1NA 1YL6A 3PJGA 4MIEA 2BLLA 2NU9A 2ZJ0A 4KUEA 3JQCA 2HMTA 2FN7A 4TKLA 1VE9A 1XGKA 4GSLA 3WWZA 3UN1A 3P19A 3I9KA 5G4KA 2PNFA 2W2LA 1H6CA 3DONA 1U3WA 2AQHA 4DYVA 5K6AA 5A3JA 3ICCA 5GZ3A 3VOSA 4HKTA 1Z7EA 1O9BA 1XU9A 1ZEJA 1H0KA 4CM4A 4RVGA 3RKRA 4A0SA 1K2WA 3JQAB 4XGNA 3S55A 4GGOA 4YA6A 4CMJA 3W6UA 4JX8A 2DBVO 3V5NA 5I8ZA 6ADHA 1ZJYA 4H16A 3DMTA 1HETA 3TL2A 4Y67A 2E4AA 4XB2A 1H93A 5G0SA 4BNTA 4XQEA 5ILOA 4BNGA 2PTGA 4UUOA 1BXZA 1ZZEA 1QRRA 1SPXA 1T25A 1Z82A 4WE3A 4EZBA 4KQXA 5TIIA 3NJ8A 2UDPA 5C7OO 1O95A 2FY8A 3I1JA 1U3TA 4BO7A 2B5WA 4FN4A 4N5MA 1LDGA 1R12A 3LT2A 4J7CA 1XQ1A 4UEJA 4OO3A 4YJFB 3NTOA 1P45A 2Y66A 3ROMA 1JKJA 1ZVMA 4U0JA 3ETGA 1RWBA 2AQIA 1NYTA 3A1NA 1EE9A 2D0IA 4YAIA 3VZRA 4NI5A 3PDJA 2NWQA 2O3SA 4A2CA 4BO6A 4PLHA 3DQPA 4UUPA 2GGSA 5T8KA 1C0KA 3AW9A 4CR7A 4D0SA 2DFDA 2IYOA 3D4PA 3OMLA 4HXYA 4BIIA 4EW6A 2YFHA 4J43A 1PZFA 4G5HA 3ROKA 2DFVA 4GQAA 3WGTA 3UAGA 1MFPA 1O0SA 3EVNA 4YT8A 1KETA 5IXYA 3VDQA 1PR9A 1EUZA 3EDMA 4DYDA 5IDWA 1WDLA 1K0UA 4Z9YA 1MG5A 1LC3A 4PLGA 4CUJA 4DWVA 3NAQA 1UXGA 4CUZA 3DB2A 4LMPA 3ZU3A 4W7HA 5FF9A 4XYLA 4J1QA 5EERA 3QWIA 3ONFA 1UP6A 1PSDA 2VCYA 1MUUA 4A7PA 2PGLA 3IKTA 1DIAA 1ULUA 1I01A 4OXNA 1U3UA 2OUIA 1YB4A 2YY7A 2ZTVA 1BXGA 1VJ0A 4M1QA 4MVJP 1PGJA 4E5MA 1MLDA 4IS2A 3UKOA 1I2ZA 1DAPA 2C59A 3MJVA 1ZUD1 5TF4A 4FD3A 3UHAA 4XDZA 1SAYA 1VC2A 3H5AA 4UVEA 3KETA 3GOHA 3ZV4A 3JQGA 2F00A 9LDTA 2YHUA 4OGWA 1TXGA 3BMOB 1ZKMA 4OL9A 4W6ZA 4CQMD 1PS9A 1SZJG 3LLSA 4BS9A 1TT5A 1GD1O 4DL9A 4DUPA 5L53A 3KVOA 2JFFA 4LN1A 3JQ8B 3VKUA 1KVSA 4RLHA 3DR3A 5G0WA 2D5AA 3VH4A 3IQDB 3DFUA 1YOVA 1UXJA 3VZSA 4CMGA 3MOGA 2B83A 5B1YA 3L6DA 3C1OA 5G0VA 1XQ6A 1X1EA 4MP6A 4HP8A 4XX0A 1BHSA 1WPQA 1B16A 2EWMA 4DC0A 1SBYA 4ALLA 5EQDA 2EJVA 3H9JA 3L4SO 2GZ3A 2E49A 4PLFA 3F1LA 4AJHA 3JYQA 3NRCA 5A03A 3UF0A 4BNYA 2B35A 4GX5A 3KUXA 1V6AA 2JAPA 2ZB7A 1UDCA 1P1IA 1WW8A 3I9MA 4PLWA 4CLXA 1I10A 2E37A 4J0FA 2Y1FA 4R3WA 3RCBA 1P74A 3OA0A 4ALKA 4PG4A 2WD8A 3GGGA 5HTOA 2O4CA 3INTA 1E1LA 4AJOA 2PFGA 3ZHZA 3NT5A 2C29D 4YAKA 2HMSA 4IMPA 2Y1OA 3JV7A 1OI7A 1NASA 5ER9A 4OKIA 2JHFA 1ONNA 4BMSA 3TWOA 3RUHA 3WTCA 4ID9A 2I65A 3JQ6A 5JBIA 4Q3BA 3HUDA 4WEQA 3QRWA 2AEMA 4I08A 1JVSA 5BNTA 1OZAA 4R9RA 3BMCA 2VUUA 5JCXA 2A4KA 1PS0A 1IOLA 5JMWA 2XXBA 1ADCA 1FMCA 4ITUA 2GN6A 4I5GA 4IDAA 2CY0A 4OOFA 4E13A 3FN4A 4L9RA 2XXJA 4EEXA 1LUAA 3KB6A 4MKXA 1EZ4A 4QTZA 3C3XA 4N18A 2FRDA 4URFA 4KQWA 1KEPA 4AFNA 4XQGA 3WDSA 4YYZA 2NQTA 4I9HA 3JQFA 1OAAA 3ZWVA 3ZW8A 3QE3A 2QZZA 3QY9A 1QLJA 4PRKA 2C2YA 2EHDA 5U9CA 4J7UA 1NAHA 2GDZA 3WQRA 3E9NA 3JQ8A 1GZ6A 3AM4A 4PLCA 4JBHA 4RVUA 3UH1A 1E3WB 2LDBA 1ISFA 4YCAA 1DRWA 1KIFA 3OJ0A 1XSEA 3FPCA 3ROQA 3OQ1A 1I3MA 3W4KA 3G1UA 4GX0A 4W4TA 4BNHA 3C1AA 4EITA 1T24A 3TJRA 1GADO 1U9JA 4DGSA 1UUFA 1YBVA 4B4WA 5BNIA 3FNHA 2D3TA 1BXKA 4C4OA 3DL2A 4R69A 4Z0PA 2G17A 2VWGA 4Q3CA 5ER6A 3RFVA 2BFPA 3D5TA 1JDJA 3BTSA 3U9LA 1H5QA 1MFZA 1MC4A 2B4RO 1UP4A 2OO5A 1GUYA 4CMKA 4CV0A 1ZK0A 2G5CA 1C0PA 4CM9D 3C8MA 4EDFA 5LCXA 2VOEA 4AJ2A 1N2SA 2O7SA 4IMRA 5DULA 5AYVA 3ZWCA 3I52A 5BNFA 4ZU3A 3K96A 3U4IA 4PVDA 2B69A 1T26A 1XHLA 2HDHA 1M76A 3KV3O 4BKRA 4W9NA 2PD4A 2FR0A 4EUFA 3K8ZA 1YONA 3TPCA 4BGVA 5TJHA 4F6CA 1ZXBA 2EXXA 3NKLA 3PJFA 5L4NA 3EMKA 1V0JA 3ZWMA 2AQ8A 5IFLA 3NDIA 1KVRA 4M54A 1B0AA 3SJUA 3KSZO 2J3HA 3FPLA 7ADHA 4RJTA 2V65A 3KBOA 1LXCA 2DPGA 3GDOA 3OM9A 1YWGO 3PXXA 4U6QA 3PZRA 2O23A 3RBZA 1GYRA 4NQZA 3DAFA 4C7JA 1HWYA 1Y5RA 4WPGA 2O50A 1LDMA 1PR3A 3MEQA 4J2OA 1JAYA 2RCYA 3MJCA 3CPSA 1FDVA 3FCOA 2Y68A 1NVMB 2Y05A 4IQ8A 4NIMA 2X6TA 3S8MA 1WDMA 2O4UX 2A94A 1NWCA 2Q50A 2DPHA 2XAAA 1P33A 2VYVA 4NG5A 2YV1A 3GK3A 2WE7A 3BTUA 3QWHA 4ND2A 2FSSA 4BOYA 1N92A 1YS4A 4DBVO 1H6BA 4I8XA 2C07A 2FZWA 4PGFA 3QP9A 5HBRA 3EYWA 4BMNA 2IRWA 3TNLA 2R2GA 3INRA 2I6TA 4YTEA 4GI2A 5JO0A 4BNZA 1DIBA 2YYYA 3K73O 1DB3A 3OA2A 1Y1PA 5JYEA 4FFRA 1SEPA 2BRUA 2VYND 2NLOA 2NSDA 3ASVA 4II2A 4W7IA 4XKJA 3ZWOA 4RVDA 4JBIA 4NBTA 1EE2A 4FC6A 2JAHA 3G0OA 3NV9A 4MKZA 1I30A 1DO8A 2OGUA 4UUNA 4L4RA 3HFGA 4RO0A 1M66A 4O5OA 3K2BA 2BF7A 3CH6A 1PL8A 4LSMA 2CFCA 3JD2A 2ZJ1A 4R1TA 5CDSA 4RGBA 3V2HA 2EIHA 2UAGA 5F1PA 3RSHA 4KDFA 4TMFA 2BH9A 3KYDB 1I36A 3UCFA 2OORA 3LYLA 3WTBA 1HEUA 1W4ZA 1T2CA 2AG8A 1PGQA 3NJ4A 1U8XX 1OMOA 4UULA 4XCVA 3PYMA 1B26A 4YJHA 4R41A 3LF2A 3CKYA 1VSUA 1CYDA 4ZA2A 4DLAA 5G0TA 2JFGA 1V35A 5BSGA 3I4FA 3AUTA 1JQBA 3ZHXA 5KVVA 1DDOA 5CDGA 1CJCA 1JN0A 5ICMA 2EGGA 2VNSA 4Y9DA 2HQ1A 4QX6A 1SNYA 1QSGA 2AW5A 4B4UA 3RBXA 4J4BA 1MP0A 1B15A 1NQAO 5B4UA 2X86A 2Y1GA 1EFKA 3H7AA 2RBEA 2HSDA 1EK6A 1HF3A 3UUWA 2RHCA 4DIOA 3K31A 5DBGA 2IDZA 4FFMA 3K5PA 5IAAA 5L7YA 1ISIA 3E1KA 2J5QA 2JFHA 1ML3A 3IUSA 4L8VA 4PN3A 1YDEA 2UVDA 2HCTA 2JCYA 1G0NA 4R9SA 3FNFA 3H8VA 5TLSA 2RH4A 3GVHA 2D8AA 3T7CA 1E7QA 3FI9A 3NYWA 4O1MA 4NFYA 2JD0A 4EUHA 1VL8A 3V8BA 3B1JA 4U7WA 1VPDA 5DZSA 4BHTA 3JD4A 1HDZA 5I7SA 4GMGA 3LT1A 3R3SA 4FPXA 2POQX 3EZLA 1E7SA 1ZSYA 2G1UA 3AUSA 3DOOA 1A9ZA 4TVOA 3TZCA 1R0LA 1VJ1A 2QYSA 4AJLA 4FQ8A 4CR8A 3H9EO 2Y99A 1X0VA 1YJ8A 2P9CA 2CVZA 2X1HA 3DDNA 3PK0A 3JYNA 5I7EA 4E33A 2NU7A 3BMNA 5DCUA 4E6PA 3PJEA 5I9LA 3CZRA 1HE5A 1CIVA 4M8SA 1IHYA 2YJZA 1T1RA 4YJDA 1CETA 3TDKA 3L9WA 4DLBA 3Q1LA 3VPHA 1EDOA 4RPHA 1I3KA 2WTBA 2X8LA 3OEWA 3WIDA 1I3NA 5JC1A 3JYPA 1Y9AA 1GDHA 5J23A 4OQYA 3VDRA 4RF2A 1RM4A 2OP0A 1GUZA 5CPFA 1ZIDA 3JYLA 2F1KA 4L73A 4GKVA 3U62A 2DVMA 1TB4A 1ULSA 1NFRA 3GGPA 3SXPA 1EEHA 2ZB3A 1ZCJA 4D42A 3WJAA 2V6GA 2VHWA 1YJQA 3ZWBA 3S2EA 3V2UA 3P2OA 2W98A 4I1IA 4OSOA 3QLJA 1IPFA 1E5QA 2QRLA 5F1OA 3DBHB 1DBVO 4TSKA 3FRJA 4XJSA 4Z9FA 3WB9A 1WMAA 3AY6A 5KIAA 3RU7A 1VL6A 5EMHA 2GRAA 2B37A 4HADA 1LTHR 4XGIA 2A35A 5EIOA 1HE2A 4A10A 2FMUA 3VZPA
chains in the Genus database with same CATH superfamily
3F49S 2EU8A 4QXRA 3VKWA 3AL3A 4C4ZA 1I9CA 2JIZA 1G18A 4TM8A 4D74A 2R5FA 2PE5A 5AKZA 4F2GA 3Q8KA 1OFIA 2YFYA 5FBHA 3LPCA 3QF4A 4EUSA 2VAWA 4FTWA 4NBVA 5K8VA 1DLJA 3AR8A 3PJRA 3P9CA 2QL6A 3GUUA 4TV9F 5CNIA 3MTGA 3QVVA 4HXFB 4U3JA 1E98A 4I50F 2OHOA 3GLHB 3OE7A 4GNKA 4LOIA 1R0ZA 1UXIA 1YTUA 1KDOA 4MYTA 3KAQA 2FLWA 5FTLA 5FADA 4JN6B 4MRSA 4GDFA 2QIOA 2X6QA 3JARA 4WKNA 4ALNA 1P8JA 3CHYA 3R1IA 4JOBA 3L6OO 3UFBA 5IF3A 3PIDA 3AIKA 3LBAA 3Q12A 1MPXA 3CZQA 4TV9B 4U63A 2X2EA 3EVTA 5HGJA 4ER7A 4P5PA 3FTEA 4I50B 4HWPA 1DFIA 1EE1A 1J6UA 2XMSA 1JIIA 3G6KA 1XIVA 3H1GA 4ROTA 4YDRA 1GUBA 4OFZA 3L1IA 4Y9RA 1E1MA 1BRMA 2FKAA 4BV8A 3T7AA 1WHSA 2YR0A 1HPLA 3T3GA 1R9NA 1K68A 2Z43A 3FJYA 2AF3C 1HFEL 4FE7A 1L4LA 2J0EA 5C1BA 2WSYB 3CZ9A 3V48A 1KK0A 1Z7GA 1EVZA 3ZX5A 3K1JA 2XGGA 3H8SA 3LBHA 1U2QA 1YDMA 4O6VA 1GGHA 1TECE 3RVOA 3S2UA 4FB4A 5CDHA 5KKAA 4BWVA 5LSAA 1FRQA 1U2ZA 5HM6A 2ZJFA 4GPD1 1XNRB 2XLBA 3A2KA 1YZNA 1S3SA 1QXSA 1DBRA 1LBEA 4UDYX 1Y8QB 1CW2B 4K05A 3CZAA 1GFWA 1YRHA 4I1OA 4QUAA 3X43A 1A8SA 2O8BB 2C92A 3VTKA 3TLZA 4RW0A 3TTVA 3W2TA 4TXLA 3S68A 3OCUA 4W7SA 1NJ5A 2AMLA 5D85A 5TEVA 1FMJA 4KXYA 2Q9BA 1EGQA 4CG1A 1QJ4A 5DI9A 2HDWA 3TW4A 2HMAA 2X8AA 3L4JA 2YZNA 4MR8A 4ZEWA 1C1XB 1PZXA 4N76A 2XE7A 1P60A 2HDOA 4ILEA 1WD7A 4GWLA 3WDLA 3NYQA 4HLCA 4Y2JA 4DJFC 4MGZR 4CZ2A 4Q1DA 5EUQB 2E5FA 1MB9A 1YL5A 3RB8A 1U5AA 1WZIA 1KH3A 1YBFA 2VS1A 3KLMX 3UJNA 4DXAA 4S0XA 4POOA 2FMKA 1DIRA 3GT7A 1RMTA 3IQGX 5F5LA 4E09A 1WXIA 5F35A 4NOKA 3BH6A 2OOKA 2Q46A 3NHZA 1V8PA 4F56A 2W43A 2RIPA 3D6JA 5DASA 4EGQA 3K0HA 1YUNA 4WK2B 5BR4A 5FT9A 2VF5X 3L02A 1CQJA 1JWBB 3VQTA 3D0KA 5I51A 1PSZA 3L0YA 2OECA 4O33A 5CAEB 2EL7A 1UPXA 2J48A 3TMYA 5JJ5A 1QB8A 2MMGA 4D82A 2H11A 2IXTA 3QE9Y 4DNFA 3PFFA 2GRJA 1WM1A 3LCUA 3H9GA 5GM2A 3UBTA 4R83A 3EZYA 1B3BA 2CFRA 4ZT4A 2BFOA 4MS1A 4E07A 3VU3A 1E6UA 4QGSA 5IXSA 3KOMA 1KNXA 1KFBB 5B53A 2J6IA 1UDRA 2FUCA 3QQPA 4NENB 4D8WA 2Z9CA 2HYIC 2HHAA 1K8QA 2J9FB 3EBOA 3AVOA 4IEEA 2CMFA 4HGQA 5J2UF 1XQVA 3IP3A 4FEYA 5DDIP 1SB9A 5EWMB 3B6MA 3MTJA 5FBRB 2IBMA 1NXXA 3P32A 2FFQA 3TQTA 2Z9DA 2F8SA 4I6GA 2XB4A 1YO6A 3I72A 5KYXA 4QSMA 3VPGA 2QP4A 4U8HA 1USKA 1WV0A 1AV7A 4C0WA 4M6WB 1MXHA 1D6SA 2VNIA 3D5EA 3Q9NA 4NCIA 1Y1KE 4HAVA 1CF4A 1Z0DA 4RA9A 3RYIB 3AM5A 4X63A 3OY7A 5J2UB 3WFJA 4CNQA 3O1HB 5E6SA 2VL7A 5BN4B 1NE2A 4CCYA 1Q7CA 1SCJA 4TLEA 1WTCA 2WICA 3B1KA 1ODTC 3L6EA 4MCIA 1XWIA 1F14A 2WSBA 4D9FA 3IP8A 1YCDA 1I33A 1P9RA 2ZFUA 4MQ6A 4S1OA 1XMOB 2DECA 2JLVA 2C95A 5F52A 3AKCA 3D2AA 5DE3A 1J8VA 3DVAA 3OX4A 1JU3A 1NURA 1BSVA 2GT1A 1HYGA 2G9UA 2VTVA 3UJBA 5I4BA 2QZSA 1D2AA 2M9MA 4UE2A 4EFLA 1BCRB 4YP7A 3VVCA 2FK7A 2IYNA 3RC1A 3IRUA 5JJCA 3GLIB 1CQIA 2XTJA 3K1AB 4DMLA 3T41A 1S3FA 1T34A 2FN4A 4LBVA 5J59A 1U0SY 3LKDA 3UWPA 3FTNA 3ERCA 1JG3A 4RY9A 5FBLB 4YCBA 2WY2D 1R27A 1WW2A 1DOHA 4WCVA 4BMOB 3LBFA 3EAQA 3C43A 1VMAA 5JAOA 4EUEA 4L75A 4AJIA 1F2TA 3B1VA 3E2MA 4LFAB 3QA3E 4HK4A 2ZTLA 2I6SA 4WN9A 2P67A 4HLDA 3PYLA 1F0KA 2LXNA 3M9WA 1TE2A 1F17A 3KKKA 2PMDA 2OFPA 4J1NA 4JBNA 1H2ZA 1NVVQ 3AB3A 4TT3A 1QNLA 1Y4SA 1M1ZA 3B3AA 5JAZA 5LQDA 4BJ5A 2WD7B 4JKIA 4WBSA 5A4KA 4ZQGA 3A10A 2HWKA 5EPUA 4KFCA 4ZQHA 2GHTA 4DCSA 4ETIA 2C5HA 1E9FA 4R1MA 4B3IA 4JB8A 1LPOA 5JYCA 3JQAA 4DUYB 4GBJA 4Q3EA 2BFCA 1U0GA 2O2YA 3MS4A 4M7WA 4TL7A 4XD7D 3PS9A 3VHRA 4I14A 2AHRA 1EM8A 1PFUA 1WUTA 2VP9A 5BWNA 4PXYA 1ZU5A 4HS9A 1WXXA 2CDCA 3F5DA 3LFTA 2NV2B 1AURA 1E1CB 1CPYA 4KQEA 1OXBB 1RLIA 4L28A 4BO9A 1AIPA 5AQEA 5FI5A 4JSTA 4BRWA 3TW0A 1RM5A 4RYLA 1T4CB 3IQHX 1UMBA 4YYEA 3D0QA 3I3OA 3NEPX 1LDBA 5GJWC 3FPKA 2DUMA 4RD6A 2B4KA 3PC8C 3NDJA 3PT9A 4QHSA 3DE0X 1UKAA 1OI4A 4PSDA 4FW8A 2HK9A 3RH0A 6GPBA 3PWSA 5DM70 2C9MA 2BFNA 2HX1A 1YB7A 4NYMR 4TLLB 4V3BA 4YJFA 5EP3A 3ILSA 2C0CA 4GZ6A 4PYQA 5T4BA 1HUQA 4IF6A 1LBIA 1KXJA 1KAMA 4BB0A 2W6ZA 1D9ZA 4L07A 2QM3A 4CQMB 3U3JA 4R8KA 4YP0A 4TZ6A 5TC4A 3IAEA 3IVMA 2IWHA 3CRQA 4KK3A 4DQ0A 2BM8A 1MO5A 1PSWA 1SEVA 1AB6A 1XF9A 3C4QA 4HLQB 4E46A 3NNDA 1NWHA 2XQKA 3LE8A 4XIFA 4CUKA 2GPSA 4NFLA 4YRCA 1NRJB 1QG0A 3FD8A 3N8GA 3TLJA 4EI2A 4Z7OB 4HLUC 3HB4X 5HP4A 4FOLA 2E4UA 4HDNB 4ENQA 3A25A 3D1LA 1NJSA 4M9ZA 4U6SA 3H9QA 4NZMA 2GO1A 1C1DB 1QGZA 2QE7A 2Y77A 3B1WA 3LZ6A 1EBUA 3GUCA 2FTKE 4LHSA 4RZSA 5DHQA 2CCGA 3W05A 4BECA 3LD9A 2OVFA 5D5QA 5FKJA 3VHQA 3ASUA 3P9PA 1BN6A 1DIHA 2C8LA 5DCLA 3WJ1A 1Z0SA 2NU8A 2MOKA 3WKEA 4ETMA 1T5IA 1A8IA 1E2BA 4YFYA 2QSZA 1DJQA 3GY0A 1NQOA 2FW8A 2P2CA 1NR1A 2HO5A 4URWR 2I7XA 2PX5A 3AY0A 3FPAA 2PS9A 2Z0MA 1Z6ZA 5J5VA 3GJ5A 2J32A 2NTNA 5CXSA 1VBMA 3VPSA 4R54A 2X7HA 4ZOCA 3I61A 1RS0A 1MAHA 4JXKA 2A9QA 3BXZA 4HEJA 1N5DA 1A4IA 4FMDF 4GFDA 4F8YA 4KFUA 1TAGA 4UNNA 2CDNA 2DJ5A 4IOLA 4RCZA 5AM1A 2I4TA 1WP4A 5L95A 1ISSA 4DA7A 3CRW1 3NGLA 4RZIA 2OPBA 3GPIA 1LY1A 3PKZA 4MQUA 3WO0A 1P1RA 4L8FA 4C7VA 4NP6A 1QFMA 4WXEA 1M54A 3RIGA 2N9UA 3OF3A 1GTG1 4MVJI 3A1WA 3ZD7A 1GNPA 2YHAA 1VL2A 4TTIA 1DLIA 3SF8B 2VBGA 4FMDB 5IUJC 4OGGA 1CP2A 1VE1A 1KYIA 1GXSB 4A9AA 1MT0A 1SC1A 3T99A 5KINB 2IEGA 3D3WA 1E1KA 1TW3A 3FWYA 4LY3A 4L1KA 2R84A 3HBLA 2PMEA 3CRVA 1IFXA 1XRMA 4LK3A 3UMBA 3QYPA 4RU1A 3RAFC 3OLVA 3WP1B 2Q0QA 4AO6A 5MGBA 3KT0A 4DLLA 5D1NA 2GCEA 1XZMA 3CVJA 4DM4A 1MC5A 3IBGA 3UAWA 1BFKA 2JJMA 1IQPA 4EEZA 3B9PA 3VBEA 2DU8A 3LYAA 3M6VA 3SC4A 1EDDA 3GJTA 3K0AA 4MPDA 1C7RA 4TWBA 4E7OA 3KZXA 4P84A 1JQLB 4YQEA 2PS1A 3IAXA 4B6SA 1S5PA 1K75A 1T36A 2P2LA 1XPJA 2XCLA 2ODWA 2I62A 2JLCA 5B1HA 3NW9A 5WRFA 2HJRA 4PFSA 5AUPB 2H1LA 1B93A 3MJHA 2IH4A 1RRMA 2PCJA 3BFXA 1D3AA 1O4WA 2D13A 1Z3IX 4QTUB 2A0FA 4EA8A 4DJEC 5EE3A 4N8SA 4CLEA 4F3TA 3K3PA 5EQTA 4F8EA 1QUFA 4C5BA 3FGPA 4YT5A 1KZ6A 3OT1A 3TYXA 4R51A 3BN3A 3B2QA 1SUBA 2QLTA 4HDKB 3NHBA 1AUVA 5CT9A 1J23A 2W6ID 3ANNA 3URKA 3ZQJA 1ZM9A 4F4CA 4LC0A 4MARA 3SQWA 1G8AA 5F9HA 1DU4A 4IINA 1IN6A 4KMSA 1UBLS 2ZITA 4ENTA 5EXEA 3BRQA 5MF6A 5J4VA 2VA9A 4Y6QA 4ZO8A 1ZMRA 2WF8A 3PRYA 4RVOA 4AB1A 1T3HA 4DILA 5HKAA 3COJA 2IYFA 2PLWA 3IE0A 4MV4A 3MRSA 3RTGA 2FPPB 4L8WB 3U31A 1YFJA 3D2CA 3EVZA 1NVBA 2WU1A 3VDMA 3FIJA 4LQLA 4JLNA 1VLLA 4WLFA 3LHFA 4QG7A 2JGRA 5BR8B 2MU1A 1OLUB 3FTQA 3CNEA 2H1HA 3FR7A 5L3QA 1LQUA 1ZXLA 2H92A 2Y2UA 3A1VA 3PP8A 2HK8A 1EUQA 4H7KA 2ERCA 4OQZA 3A0UA 3T3EA 3ONVA 2IK8A 3WGOA 2PH7A 5DGCA 5KEIA 3B3JA 2AK3A 3DF7A 4FHCA 3W1WA 1R50A 2FWPA 4RYDA 3SFTA 4B46A 1ZGAA 3PWKA 4TSFD 4DCPA 1OXKB 2WWVD 3FPSA 1NPYA 5ALUA 5A5VA 1P9WA 1DJNA 4JJ4A 2JFUA 5EQJB 3VKHA 2W8BA 1SA0B 1X7GA 3EIWA 1W5EA 4Z2AA 4JAVC 4PPYA 1OI3A 5T3YA 3C3MA 1IY1A 2FR1A 3HVIA 1VA4A 3CUEF 3LL4A 3ENNA 1NLMA 1YFLA 4MB6A 2PKXA 2WUGA 2FEAA 4ZCQA 5EIXA 1Q84A 4QELA 4ROSA 4QZVA 3KQOA 3ROZA 2VDUE 4RX1A 3ISTA 4B9AA 2G0AA 4PZDA 4UBOA 2E1RA 5DXJA 4IDDA 5JH7F 1VHQA 1VIAA 2HIHA 4FYHA 2IYRA 1L3BA 2GILA 3LT0A 3E05A 5EG5A 4W5JA 3TNFA 2H7XA 3W5SA 5LN1A 1CY4A 1S8AA 3CN9A 1RVDA 4LHYA 4M36A 4NPCA 4U7TB 5TMEA 1NU6A 4BO2A 3EZ9A 3R2JA 1G20A 4CM7A 4DLZA 5BUQA 3TL6A 4FBGA 1YVUA 2VT6A 4FCTA 3RBAA 3C3KA 1SBIA 4BO3A 1H69A 2QUIA 5HIAA 3CLKA 4GS5A 4MAFA 3RK0A 1ZFNA 3UT0A 5JH7B 3U3ZA 1IONA 2HUNA 1TVEA 4LV8B 4K9DA 4KUHA 3QNMA 1V7ZA 4RHCA 1AF4A 4MA4A 1PFYA 3HA7A 5A4DA 3FWZA 2F3PA 2SKDA 1TM1E 4N01A 4RY8A 3SC3A 4M7OA 4X3OA 5IM5A 1ELOA 3WNDA 1FDOA 4EYEA 4H9GA 4H2DA 2O8VA 1GCOA 3WYFA 1P2FA 2WD9A 3LSTA 1CYEA 3O0DA 4QECA 3H16A 4ZREA 3W04A 4QKQA 1YQEA 4HGPA 4LKOA 4QHTA 2ZDHA 4HTFA 3DE4X 1OX4A 1JEQB 4A16A 1E58A 3GROA 3TSWA 3QFFA 3OSZA 4MRNA 3I6YA 1V5FA 2QTMA 1MX9A 1P1JA 3OKFA 3FPGA 4LXGA 1YA4A 3LPAA 5DXAA 1LQTA 5LA6A 3BIFA 4EKGA 3D2LA 4IWYA 4Q16A 3FYCA 3SHOA 4RKYA 5ETJA 4TMTA 4ATNA 3B7GA 5ES4B 5KYKA 4F45A 4NXNB 1FW6A 1XCJA 2A57A 4KMRA 4GL2A 3SCZA 1YQDA 3U3OA 5IXYA 1Z35A 1X1QA 2I2BA 5IN5A 5KI6A 1Z12A 1U5CA 2IYLD 4YRTA 1XEAA 2I4OA 3S2FA 3ZIAD 2QL5A 2E1PA 3HSYA 4MKIA 5IXJA 2H8KA 3R5JA 2EAUA 3RV3A 2DH6A 5E7QA 3U40A 4XVUA 3S99A 2Z5GA 1WMFA 4GOXA 3CKMA 3MJ4A 3LK7A 3OP4A 5BYJA 4QU9A 3M0EA 2DQSA 1QCZA 3I83A 1I4EB 1O97C 5HVNA 3U60B 1OV4A 3EUEA 1QVAA 1KAGA 1T8RA 1QIJA 4MQLA 4D98A 2GXQA 2AG0A 1JQEA 2ZWIA 4E2XA 4BMVA 1I6MA 3UA3A 4EVQA 4C0QC 1QTQA 2IIPA 5ICGA 2WZQA 3BHIA 3ICVA 5AICA 3GZJA 2JVIA 2WSIA 1P1CA 1U7WA 2R8PA 5LWQA 4YJGA 5AHRA 2B9EA 4MGYR 4U9UA 4X94A 5FI3A 1SO8A 2Z09A 4EY4A 4QGFA 2IELA 4CLHA 6REQB 5ED4A 5U4XA 2Z95A 3DE2X 5JCJA 3K0CC 4WK6A 2RGXA 1TF7A 2P0EA 3UFXB 1W36B 2JIZD 4K9OA 5AWFC 5GONA 4YIHA 1CEYA 3C3PA 4YP9A 1QP8A 2Z8ZA 4CR6A 5H8WA 2YS7A 2QJFA 4IKEA 3WK7A 2Q3FA 3B8HA 2H4WA 2IYUA 2WWIA 3UMGA 2OCDA 4KJXA 1UT6A 3FCYA 3MYYA 2Q29A 3TNDA 3T5AA 4R1UA 4MUYA 2IV7A 3HXMA 4MVYA 1FBTA 3P20A 5FUYA 1T0UA 3Q6IA 3OE7D 4YCMA 2PGAA 3L7CA 1I4LD 1GKKA 2DKOA 1AK9A 3RKUA 2QL9A 3G68A 3OPXA 5SYNA 4NHOA 3WYGA 5CJ2A 1IEXA 1QYVA 1SXJC 2XRYA 1EX7A 1TO1E 3PC8A 1LTKA 5C7LO 1CJBA 5H83A 3TOSA 3C7CB 4AMBA 3SQDA 3QW2A 3HC7A 4HBZA 2QU7A 2GR9A 4DRXB 1U98A 1X13A 4KQ9A 3B38A 1RBMA 3KSUA 4V39A 1MQ8B 5AW0A 3DE6X 4NAVA 3BL8A 5AK6A 1HL3A 2QORA 4I1SA 4MP8A 1DCKA 1EFUA 1YR3A 1B14A 3QVWA 4Q39A 4Z86A 4PSCA 1R5OA 1FDTA 3A9SA 1UMKA 3I53A 3TN7A 1RYNA 2HLPA 4C07A 1PYDA 2VF8A 4ND5A 3VTZA 2BI7A 2HL6A 3RYHB 1Q91A 4CDGA 1H22A 5C8YA 4WGGA 1JEYB 721PA 2GNOA 3IERA 3PFBA 3TF5A 3FKQA 1BDHA 1QP7A 4QPCA 2WKQA 4KIWA 4NU5A 4XGKA 5IT9A 4V0SA 2VAXA 1BG6A 1ZEMA 2OO7A 3ZGYA 1X1CA 2AOVA 2VP3A 3H8JA 1TA0A 2QTTA 2YIJA 3ORHA 3WL5A 3WLJA 4CM8B 4HV4A 5C7YA 1ID8A 1NJ1A 5HX7A 2EWVA 3ABIA 4HYQA 4GM4A 4LZLA 3BCRA 4DNOA 1JAZA 3NBAA 1ABBA 4N9QA 1QQ6A 1JDVA 3RFXA 3ZZ1A 3HDGA 2JZNA 2XB6A 3NGMA 2OBLA 1LRLA 1UXHA 5KVQA 3QEKA 1QH8B 3U4QA 1C0EA 1X1DA 5E3IA 3WWEA 1TCUA 2P9YA 3GDWA 3ZCUA 1ZI6A 3LT5A 3UXHA 2AMJA 4IMJB 3E9DA 1WG8A 3WBBA 3QMVA 5EPOA 2CKDA 1DQSA 4Y1RA 2W2LD 3DV0B 1Z4MA 3NDRA 4FDUA 1T2VA 2P4SA 3X1KA 3ZU6A 1HT3A 2BP7B 1XZFA 3FZYA 1YCHA 2LCFA 3OTWA 3IOCA 1N3BA 2LDXA 3HB5X 2AFIE 4FYKA 4D9MA 2I99A 3D3QA 2VR1A 4OLHA 4QYTA 2H16A 2RAUA 3FOCA 3H1FA 1F5SA 5GV8A 2WLTA 2BBSA 3HADA 1WKVA 2EDAA 3RNLA 1IXKA 4TV8A 4RXTA 1QAQA 2HI0A 4RKFA 4Y3UA 2H0RA 2P9EA 4L76A 5DMXA 5B4VA 1ZUNB 3NVDA 1NR7A 4JITA 1X70A 4BJ6A 5KWIA 4IJKA 2NU9B 2P90A 1JBKA 3T3IA 4GSYA 2GFHA 3D54D 1MX3A 3CT6A 3WWYA 4CGYA 2O8DB 1G8GA 4B2IA 1OWLA 3A1SA 3CSDA 5ILGA 2IHYA 2AFIA 2WUEA 4LRQA 4AUNA 5JCPA 2MINA 4HGRA 2P0AA 4MA5A 4D41A 3VJMA 2A92A 3ZEIA 3NANA 4LGCA 5JDCA 1Q5PA 1UJ6A 2C00A 2JAQA 5FPPA 5A0FA 4BUCA 1RE0A 4KWIA 3E03A 2V0GA 4JU9A 2D59A 1KI7A 4MLPA 5FWYB 5B1IA 1RBZA 3EMBA 4GVXA 2NZJA 4MMXB 3L7JA 3LM8A 5CVUA 4NVRA 3RRYA 4KR0A 1PV2A 5FTWA 4WJKB 1E4EA 1WUIS 3ZHSA 5FCDA 3LL7A 1Q1EA 3L05A 2G63A 1AGRA 3OZVA 4MKRA 4UUMA 5AJUA 2WM3A 5JD4A 1N34B 3SHWA 4GXRA 4P3OA 3FSJX 4F21A 5JEDA 3KYIB 5J9FA 3I30X 1P6UA 1GKYA 2HTFA 1RAIA 1Z5VA 3IT3A 1Q0UA 3F90A 2W2XA 4LMAA 1DAFA 5DF1A 3WLQA 1U1GA 2V58A 4J9UE 4ZTZB 1J0EA 1G41A 2PBLA 2JL1A 1Z25A 2QTCA 3L0PA 2TRSB 3MWLA 5BWMA 4FMCF 2PQ2A 2GBCA 2VNKA 2WAYA 1MV8A 3J81A 3AEQA 5JR3A 2VEOA 5B4TA 4C29A 4QFBA 1D2RA 2XCUA 4RXUA 4EYSA 4IDOA 5CG1A 3VR2A 1DOAA 1PFWA 2XR1A 1UJ4A 4Q9AA 3S1AB 1VECA 5AXAA 2GUWA 2WW8A 4H1WA 1R74A 2PJDA 3PD7A 5C0OE 5DNEA 1U0FA 3U1TA 3WV5A 1IK6A 2V5VA 5JLAA 2UKDA 3Q11A 3AIOA 3EA5A 4G65A 4FMCB 3ZX4A 4LWPA 1LKZA 2BZ0A 3CMMA 1N5MA 1Y63A 4S1TA 5FOXA 5MN5A 1FVOA 3D3KA 2HA6A 5KNCA 1RPNA 4XJTA 1CUFA 1IBLB 1YR2A 5EMKA 4TL6A 3EQ9A 4HWSA 3SLRA 3V4OA 3ENQA 5BV8A 3BWBA 2FFAA 3PICA 3M34A 3VX3A 4EX6A 5G1NA 4D43A 2Q3BA 1QV7A 2Q07A 3CV3A 3WYBA 1FRFS 4FOSA 2VVTA 1OYVA 4IFBA 3DZGA 2X9GA 4AU1A 4EYGA 3K53A 1V25A 4PC1A 5EP4A 3ZK7A 3TBHA 5HUQA 3IC5A 5A0VA 2G7ZA 1W47A 4EATA 3KIPA 3M3DA 3FHLA 3WGUA 521PA 4PPQA 3VPDA 5ICFA 3MJSA 3EQ2A 2HSEA 4K46A 1X7DA 5EMJA 4AZ3B 1XHEA 1SU8A 3LDHA 2G6BA 2XECA 1G55A 1AY0A 2ECPA 3DZBA 3JQAD 1W59A 3N58A 4ZZ1A 3E2IA 4XUGB 1DZIA 4L0DA 4E51A 3AF2A 4QVIA 1JIKA 3A9WA 3D1VA 2FXVA 4LF7B 4I5FA 5A5EA 5KBYA 3ZVKA 3MHTA 1A2OA 1JSCA 1NULA 1RWMA 3PQ2A 5L6MB 4D1YA 3R6LA 1H1DA 1YRBA 1GRVA 1EUYA 4A73A 1E1QA 3GLHE 2JF0A 3ZPXA 2IHNA 3IB3A 4ARVA 1B1CA 1EFVB 3I8OA 2QSYA 1KDVA 1DC3A 2A9KA 4ZOEA 5D84A 1NN3A 1A50B 2A4MA 1GEGA 1FYWA 1C8LA 2QQGA 1OBCA 2WJVA 5COAA 3Q8WA 1JNXX 1HZJA 3V4ZA 1YDFA 5KJEA 3BX1A 1E9EA 4Z4CA 3T9EA 1SELA 3VNAA 1XKLA 3JRNA 3GEDA 5IWCA 1NTOA 2GZ2A 4GMHA 1QWOA 1E9RA 2Q8QA 2OKGA 2MDTA 3OCVA 3SE0A 1WZEA 3SIPA 3I1FA 1ZM4A 4RD2A 3TLAA 4NZZA 1SOWA 1P2TA 2IZZA 4JBXA 2GVNA 3GIWA 3HO8A 3GLHA 2HA4A 3JQGB 4LGVA 4UUBA 4B4VA 4AN1A 4B8WA 1M7HA 4BWYA 2PRSA 4MUBA 3W1EA 4DC1A 2DY1A 4F3YA 2DLCX 3O3NB 2AN5A 2O5VA 4I3HA 3RI3A 4KQJA 1TT5B 1Y7LA 3AHDA 3Q8XB 1UQRA 3QNUA 1B7GO 4TTQA 3VMFA 1NDUA 1GPKA 5IJWA 1HQCA 2P79A 4TV9A 3KPUA 4ZALA 3N7UA 2O52A 3IR5A 4MJLA 2A14A 4RKWA 4OHYA 3F4LA 3U0BA 4EB3A 1YOVB 3ZQ4A 4MICA 2DFPA 2QE7D 3ZE7A 4FM9A 3Q41A 5EZQA 3TQQA 1TJPB 1NHGA 1EZZA 2ACEA 3JU3A 1GHTA 4PTYA 5IJ0B 1QONA 2J1LA 3N2GB 1LV7A 1QB7A 3PE4A 3O4JA 2VZ9A 1JXMA 2BMWA 4PCAA 4BLPA 4EG6A 2RHDA 4B3JA 3WQSB 1JWLA 1JE0A 2AXNA 1J49A 4J7XA 1H5UA 5IN4A 2OCYC 3FLEA 1GDTA 4DDWA 3WLEA 5FBWB 5CFQA 1M2OB 1TA4A 3QKWA 4UPDA 1RLUA 3QHAA 3N9IA 1Z17A 1EMDA 3RFCA 1BKDR 2GRUA 1Y8QA 2GPWA 4G9EA 4BQIA 2ZSEA 3IUEA 2XITA 4IILA 3DYVA 3ZWPA 4C14A 2O8BA 1M8KA 1T9ZA 2NTEA 1SUSA 3C6QA 3C7KA 1L4UA 3OQ6A 4FKMA 4PO1A 2P9GA 5HF8A 3BKXA 2ZSFA 3ZGXA 3HDQA 1MJHA 2FMXA 4ZZ0A 2G9QA 2HJHA 4AY3A 2RGRA 5GWXA 2CNOA 2AJCA 1C1XA 2FPSA 5BSEA 4XWYA 3GU3A 2L0XA 3FDZA 2VRCA 4JJIA 3FNBA 1ACLA 1VSVA 3UGJA 3RADC 3BB1A 3LMKA 1NJFA 1OZGA 1ZNYA 1JHDA 1XTJA 5KTYA 1XRLA 2REQA 3FLMA 3M7IA 5DT9A 1H3EA 1JG4A 4UPVA 4AY2A 1RXCA 4D3ZA 3H3JA 3OIUA 5FPTA 3TNJA 3ISVA 4FJ2A 1OE0A 2VSYA 4TMYA 1ZCZA 4WDRA 5F21A 4RTPA 3M81A 5IZ4A 4X6XA 3RC7A 3WMGA 5H70A 4EPRA 1MW8X 1K6JA 3BEOA 4PV7A 3K6KA 1UIRA 4J1SA 4MVJE 1JFSA 4L4YA 2PUEA 3BMCB 2D1YA 1UMDB 2DG2A 1Z47A 2X40A 1U3FA 4LDZA 1XE3A 2PRIA 4UMDA 2XT9A 2CLIB 2GVZC 4QPDA 2C2MA 3TTXA 1J0BA 3WXMA 1FS6A 4UTPA 1C0IA 2O2HA 3X44A 4QOSA 5CAEA 1Q0SA 5EY5B 4CMCA 1FYEA 4HWRA 3VH2A 2BKUA 3LZCA 1T3ZA 2AOTB 5AI6A 2IXBA 4C78A 2FPRA 2EF1A 4KG7A 3NU1A 3V8QA 1KC1A 3KXLA 1N2CB 3PDCA 2H3HA 4LZPA 4FZ5A 3V34A 1BU8A 2KLHA 2UZ3A 1AM4D 4MKGA 3ZBUA 2PUGA 1NI3A 3ED5A 4P33A 4HAUA 3U17A 2O0MA 1C9DB 3VJKA 4AUEA 1DV2A 2J9XB 2F9FA 3LCJA 4HDSB 2C2HA 4HHEA 1QUEA 3CCFA 4MVJA 1M7GA 5EINA 2ICAA 1C9EA 1ODKA 3G2NA 4DCJA 5EJ8A 3JVEA 2AYXA 3PFHA 2B8NA 1QWSA 4PYRA 4FJ1A 1HTBA 4CKCB 2BD0A 3DVQX 1YZVA 2Z2XA 4NG4A 4M6WA 5EP2A 3GLIE 4YJHA 4RFSB 2B25A 3MFQA 1GGJA 4YH1A 4NBLA 2IEDA 4JZKA 2HU2A 3RYIA 2D00A 1NBOA 5J2UA 2Q1XA 3ICPA 3AUKA 3MGBA 2VT2A 3AU8A 1EINA 3PX3A 4D8TA 5LOVF 4JVLA 1I7SB 5EJAA 1FSPA 5AVTA 3QFSA 1IK4A 1XZDA 3MQ4A 1AC5A 1AHNA 1GA1A 1QAMA 1ZD8A 2AB0A 4KBYA 3MUNA 1KR2A 3B9BA 1NJ2A 2KLBA 1X74A 5EYPB 2XOKA 3HEAA 2G9ZA 3HZZA 4MW1A 5HGXA 4YJ2F 4C3UA 1Z6TA 5A1TA 3C3BA 1BCRA 4NS4A 5AKYA 3RTBA 4AWXA 2HA7A 2YXDA 4CCWA 5KVCA 1H8EA 5E7JA 5JBQA 2PZ8A 4DVGA 1ICEA 3ZJTA 1XXHB 3GLIA 3GBPA 3K1AA 4AULA 1XZEA 4Q1CA 1BN7A 2NZWA 1SXIA 1X2EA 3DV2A 4OXRA 3PUKA 1X8XA 3ZCRA 1VMDA 1Z8FA 3NBKA 4GU5A 1X1AA 1TQDA 3SJZA 5I5EA 4YJ2B 1E60A 1NVGA 4DPKA 1U7TA 5ALTA 5THXA 1N4AA 3QY0A 2IUFA 2PH1A 2OZPA 4K81B 2X13A 4IDFA 1ZONA 3HFRA 4L16A 1ZRHA 2ECFA 3LV8A 4CIXA 5D8DA 4RS4A 2XBMA 2VYVD 2IU0A 2QT0A 4DLYA 1ZO8A 1JKXA 1IRXA 1YJCA 4K0KB 8ABPA 1GA6A 1X9IA 2WD7A 2WWYA 4NX2A 4E5NA 3MT7A 2QYHA 3IEXA 4C9BA 5J3JA 5EMNA 1XNGA 3D6VA 3D7LA 4L8LA 3R7WB 4NDAA 3F8SA 1IE3A 2JH3A 5IKMA 2JGLA 1OWMA 5BPFA 5MDHA 4U2GA 4ND8A 5I8WA 1SZPA 1BHJA 1YJXA 1GILA 1U2DC 5KTOA 4KTVE 3ZDCA 3F98A 1W36C 2IP4A 1B8UA 1ABEA 1CVRA 2XLCA 3MPUA 4KO2S 3ZDFA 4DSNA 4X7PA 2YMLA 3QU7A 4KN6A 3V33A 1EWYA 4DA0A 1MOSA 1S2OA 4DSOA 5H02A 4PO8A 4YAOA 4HS4A 1E1CA 5L7TA 1G63A 3O8QA 5ALVA 3VNSA 3EG5A 2GN4A 3H4TA 4BNMA 2I3DA 3M83A 3WXBA 1NBHA 4DR2B 2JRLA 4UTRA 3K0FA 3OPYB 2ZRMA 4ZO4A 2PL3A 3BE5A 1HDRA 1HURA 2P78A 1BWSA 4MJ3A 2AR9A 1XNJA 3WKAA 5F7OA 2NACA 1RHMA 4P4TA 5KPDA 2AZXA 4HGYA 4WUVA 5ECYA 4D56A 4YJ3F 4LOLA 4IGAA 1Q12A 4O5AA 4OQDA 4Q3OA 4AECA 2QT1A 4B83A 2EKDA 5T5QA 2V7WA 4MQBA 4TTVA 3RUEA 4BATA 1DX4A 1QBKC 4YO8A 4QATA 3LIIA 2E55A 4P4SB 2IUTA 2WP0A 2ZDGA 5AKEA 1PVVA 4QUIA 3GEMA 2ADFA 3AFIA 4FZJA 4HH3C 1S02A 4N3CA 1GL7A 1U1IA 1UK6A 4YJ3B 1QGED 1YUMA 3GAZA 4W5WA 4CQJA 3FYSA 5FNZA 4HDNA 1W2GA 3VU9A 5KU7A 3L79A 3KVNA 2OAEA 3P2KA 3KQYA 2A9VA 3E22A 1C1DA 3D2BA 4C2TA 3ZHVA 2IPOA 2FHSA 1RT9A 1E18A 1W73A 4QT0A 3DXFA 1IVYA 3S44A 1YA6A 1BQEA 3I01A 4I2NA 3V1YA 4EW1A 1SVMA 1F4PA 1QC5A 4TQGA 3A14A 4CN8A 3G3EA 3E8SA 1NJ8A 5BMVF 3QOFA 1YB2A 2Q6LA 4D0RA 1PFVA 2PLAA 1R0WA 1UMCB 2JGDA 3NASA 4P7JA 2JEOA 3NIBA 3TECE 4YRJA 2Q1WA 5EI5A 1YS7A 2G88A 2CXUA 2PKWA 5HRAA 1CKEA 5JCJD 2Z5VA 3SKYA 2N75A 5A3RA 2AXPA 3DL4A 4R05A 2BR4A 1DC8A 2JCSA 4MDHA 2C9BA 3H5TA 4OH1A 3PEUA 4BTVA 5BMVB 5KB3A 2BEVB 5IH3A 3R3XA 1RLTA 3IXQA 1WZNA 3IPRA 1GY8A 2NYVA 4XOUA 4JQSA 4O29A 5KYWB 2D6FA 1C7ZA 4H7PA 3DGFC 4RZUA 5IU6A 3SSNA 4BNFA 2EP8A 4EJFA 1OYYA 1F9AA 4UAVA 1MHPA 4XQ9A 2RGUA 4ZV4A 4AY5A 3R40A 3SF8A 4EY8A 2B2CA 3KSRA 2XW6A 3ECSA 1GXSA 3SNKA 4RJJA 1JHPA 5CLHA 1TYCA 3NWBA 4EEKA 2ODAA 4PHHA 3CX3A 4R1QA 4E31A 1LF0A 4JLPA 4Z49A 2FZKA 1B6TA 1SUPA 1UPAA 4NECA 3C3JA 1K7FB 4GQBA 4X65B 4UAUA 2D0PB 2F1OA 3DMFA 4H4CA 1FCJA 4YECA 2C1EA 2DQKA 3PVCA 4WY5A 1KVUA 3EK2A 3N0TA 4AG6A 4RL6A 3UB3A 5KOYA 2PSEA 4LYGA 4EOGA 3RAEC 1S3GA 3SJAA 1PQPA 1XYVA 4OJYA 4DBZA 4K6HA 1CTQA 1BCSB 1UM8A 2Q1SA 1Y8RB 4PX5A 3SDSA 4PQYA 1AHHA 3TNYA 1ZWLA 2IJGX 3E2PA 4MQFA 4QULA 3HSKA 4RXMA 4QPNA 4Q93A 5CX1B 4BPRA 3R4VA 4ZCPA 1Z28A 3MPOA 4ZAYA 2XDWA 1F0NA 3VU8A 1W0JA 3OLCX 2YV3A 3KOZA 3Q7EA 1Z39A 4KNYA 2X0KA 4PGGA 4XYMA 1CBUA 5F5XA 2RKOA 4IHJF 4FX5A 4UMFA 3TXXA 3G5LA 4LYAA 4E70A 3K2EA 2XZDA 5K0CA 1L7VC 5E1BA 2B1JA 1KQGA 4G5FA 1KKLA 3FYHA 3KOWA 3RIXA 2QRNA 3AERB 1OROA 3P7MA 4B3MB 2V7VA 3QE0A 4MLDA 4QL3A 3IUBA 4LRUA 4J2TA 4XARA 4DOMA 1YK1A 3JVVA 1MEJA 4CGZA 1TUGA 2WTNA 4IHJB 1AXEA 1ZINA 1NNLA 2OOSA 5JJIA 2ZQZA 1GGNA 1PS8A 2YVAA 3ORFA 4OTZA 4TVBA 5GZ1A 3BL6A 4MI6A 4PWZA 2HD4A 4Q47A 2GARA 3M1AA 4RPGA 4NCAA 4BX2A 5ADWA 2CUNA 2C7QA 1JILA 1Q50A 4ZT5A 3OPMA 4K6CA 2IU4A 2FWIA 4V24A 3MGGA 2O19A 4GLOA 1NVEA 5BN1A 1O8CA 2BUAA 3LC1O 2P6MA 3EQ6A 4X8HA 3EF1A 5DGHA 5KTSA 1E6CA 5KJ6A 1ACJA 4U5QA 5EE0A 2COEA 2Q1YA 4MIYA 3WSWA 3CC8A 2OILA 2HHHB 3EX7C 4HQ6A 1OILA 4EIWA 2QRZA 4F60A 1PVDA 2VUSA 3DNPA 4P93A 3RM3A 4JQOA 2PL9A 4KPFC 2BTEA 1SA0A 2BCEA 2FJ0A 2VP5A 3ZU2A 3P94A 3ZY5A 2K5UA 4O8ZA 2PKQO 3E82A 1JBEA 3L7KA 3OFJA 4HAXA 4WOKA 1AQNA 3B13B 2GERA 2YRFA 3M2PA 3O2QB 2IYXA 1C9JA 4X95A 1JEOA 3CKKA 4IVNA 3ZDQA 3H5VA 4BRSA 2EQBA 3S27A 5BT8A 2QAGB 3RWBA 1E2PA 4D26A 1SRRA 3PNYA 1JMKC 4CM1A 1CDOA 4LWQA 1FRNA 4P3PA 2NUAA 4FKBA 4RORA 1XAIA 5ARDA 5FV4A 1KR5A 1WQ4A 3VHXB 4LFBB 2CDAA 1D0VA 3OIWA 4FEGA 4H7IA 1QDUA 2ZSBA 1OPRA 4MWZA 1VHLA 4Q9JA 4DG8A 1H2AS 4E4YA 2YVLA 2O20A 4TKMA 3WHIA 3AF1A 1E7RA 3GJRA 3CUSA 2O7NA 4H6XA 3RU9A 1V2GA 2X2OA 1G66A 4G1BA 1U8FO 1GPH1 3E58A 3L0DA 3K0KA 4F38A 4PICA 2WJHA 2H4YA 5KSWB 2FZVA 3HCPA 4O2LA 4B7XA 4ZCIA 5IULC 1BDBA 1K6MA 1XLVA 1Z2EA 3GZ4A 3VR2D 3GD5A 3QJ5A 5K5EA 5KNBA 2C3MA 4KRXA 2OY0A 2WTMA 3BZUA 1E4VA 1T9DA 4I2VA 1ZD9A 3D31A 1BGVA 4UEOA 4PF1A 4EFKA 3MXTA 1NXQA 2EARA 1N9GA 4U8GA 3UWMA 3CUUA 4MV1A 4B76A 4KQFA 4Z8XA 4P0PB 3O7MA 3OQIA 2ORWA 3FPJA 4JP1A 4UM9B 5C37A 4MUHA 1JDSA 2OD9A 2QN6A 4Z8YA 5D5PA 2X3YA 4QJIA 3HUUA 3NV7A 3CCBA 3Q6MA 5JHGB 1ORHA 1XRSB 1FL9A 4E5UA 1RYFA 1NG1A 4OV6B 3A4YA 1OYWA 2JG3A 4M2LA 1F2VA 4FYPA 5GY7A 5AUQA 3TZBA 3OF2A 1ZLYA 1EVEA 3ZLBA 4YAEA 3B5JA 3A32A 2L2QA 2EJCA 3HBMA 1U5BB 4XCXA 5HFNA 2CSUA