2AE2A

Tropinone reductase-ii complexed with nadp+ and pseudotropine
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
259
structure length
259
Chain Sequence
AGRWNLEGCTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKELNDCLTQWRSKGFKVEASVCDLSSRSERQELMNTVANHFHGKLNILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISSVSGALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLVEMTIQDPEQKENLNKLIDRCALRRMGEPKELAAMVAFLCFPAASYVTGQIIYVDGGLMANCGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TROPINONE REDUCTASE-II)
publication title Structure of tropinone reductase-II complexed with NADP+ and pseudotropine at 1.9 A resolution: implication for stereospecific substrate binding and catalysis.
pubmed doi rcsb
source organism Datura stramonium
molecule tags Oxidoreductase
total genus 104
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 1.1.1.236: Tropinone reductase II.
pdb deposition date 1999-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ae2A00
2DAPA 2E4AA 2P9GA 4JP3A 3BHMA 4WLFA 4BO0A 3KVOA 1PZEA 1RPNA 1K0UA 2WE7A 3PEFA 1H2BA 4K9DA 5IJZA 1HTBA 5JCJA 2YDYA 3QW2A 4UVIA 5A03A 1C1DA 3SBOA 1HRDA 5I9LA 2R6JA 4DWVA 1C0KA 5A05A 4GSKA 1E3IA 1ZMTA 6LDHA 2H63A 1XSEA 3DXFA 1E7QA 3RKUA 1DAPA 3QQPA 2YW9A 4K28A 4J4HA 4PZDA 1JLLA 5B37A 2WD8A 4L8VA 2NQ8A 1HT0A 1HSOA 4MO2A 2BFOA 4Q3NA 2ET6A 3EMKA 4J7UA 3SX2A 1T4DA 2AEFA 1NHGA 3OIFA 2WE8A 4GKVA 3ZWMA 1GAEO 4CLDA 5CAEA 3V8BA 3WWZA 1V3UA 4ZHSA 2D8AA 4M49A 4Q3CA 4DC0A 4FR5A 1OI7A 3WMXA 3L6OO 1MV8A 2O4UX 2VYND 4JN6B 3BHIA 2X0IA 4NR0A 1LSJA 2X5OA 1H2HA 5L95A 3EUWA 5KIAA 4DC1A 1PJSA 4BNFA 1VPDA 3W8EA 4BKPA 1ONNA 3DBRA 1F14A 1HDZA 3RC2A 1CQIA 1EK5A 5HWSA 2Q4BA 3K2EA 3HDYA 4O5OA 3VTZA 1BDBA 4ILKA 3VPSA 3V2GA 2FPPA 2Y66A 2UV8A 1K2WA 4UAGA 4EGFA 1V9LA 4NK4A 3KO8A 1HZZA 1P44A 2Y1EA 1CQJA 4RVHA 5DCUA 1AHHA 1R4NA 3BMCA 3DC2A 1GYRA 4U5QA 2PGDA 3D3EA 4M54A 3ZWNA 1KEUA 1W8DA 1H6BA 4UUMA 4CR7A 2NLOA 3JD4A 4GQAA 4CM5A 3MJSA 4QSMA 3DZGA 2B5WA 2RCYA 4BHTA 2G1UA 4ID9A 1PL7A 3OICA 2ZJ0A 1C0PA 3V1YA 3BHJA 4ZJUA 2FRDA 4L75A 1ISFA 1I2BA 2BHLA 3GFBA 3D5TA 4CUJA 2X9VA 4CL3A 3CKYA 3GN1A 2EXXA 1B26A 2EERA 2VUUA 2DT5A 1XQ1A 4KWHA 2DUUA 4W7IA 4PN3A 3IP3A 4WCDA 2EKPA 1JKJA 1Q1NA 2DBRA 2E37A 1PTJA 1D7OA 4R51A 4YB8A 3PFFA 4UVHA 3Q0EA 4FSHA 1VL8A 1BW9A 3DL2A 3HWRA 2O50A 3TF5A 1DHTA 3W6UA 1UXGA 4Y6SA 2C2YA 2IXAA 1V3VA 2EW2A 3ZU4A 3AUUA 4BGIA 4P4GA 1EUDA 1IB6A 1QV6A 2D4AA 1GUFA 3P5SA 2EV9A 2O48X 3WBBA 4NZ9A 1SB8A 1EDZA 3AOEC 3TZQA 3LC2O 3N7UA 4W7HA 4HFRA 1XDWA 2W2KA 1RKXA 4GX2A 4NBUA 3JQBC 3M2TA 1HYEA 3PWSA 4R16A 1HLPA 4LW8A 1CF2O 3PK0A 2PZMA 4E32A 2V6GA 1KY5A 2YDXA 1E1KA 3DR3A 1KC3A 4L4XA 3E5RA 2VHYA 4L4RA 3RU9A 2FMUA 3O8QB 3NEPX 4BB6A 1H94A 2UAGA 2Y93A 4KTTE 5G4KB 1V3TA 3ST7A 2GLXA 3MJ4A 4QECA 3QE3A 2FZWA 3P7MA 1WNTA 2I67A 2FPGA 1YWGO 3BTSA 1O94A 4RVFA 2Y1OA 3RKRA 3U09A 1JVBA 5EQFA 1HLDA 1QSGA 4U8GA 4UREA 1Z6ZA 1TT7A 2OP0A 2PA3A 4JBIA 3GK3A 2BKAA 1PZFA 5AXDA 5FWNA 1WZEA 1SZJG 1ZEJA 4BIIA 1MUUA 2AE2A 3ITDA 4WNIA 3VHRA 5COBA 3Q6IA 1P1HA 3D3WB 3RUCA 3WSVA 3TRIA 2ZTLA 4OMUA 4PRLA 3WGIA 2OP1A 2VTEA 1WPQA 4LMPA 5EQDA 4E2WA 1Y6JA 4MIEA 3WNQA 5CG2A 1UDAA 1J4AA 3TQHA 4A5OA 1VJ0A 1F8FA 4YT8A 1BXZA 1PX0A 2GZ2A 4HP8A 3FBTA 3E1KA 3K9QO 4GSLA 1FDUA 5KJCA 2DVMA 3BMQA 1T24A 1I2ZA 4NFHA 1YOVA 5F1OA 2VNAA 3JQFA 1KEPA 4FD3A 5BT9A 3ABIA 3IC5A 1MX3A 3DHYA 1ZXBA 2GN6A 2QYSA 1LDYA 4AG3A 1E3WA 3GEDA 2CVOA 1YL7A 1YKFA 5CG1A 5A3VA 3OQBA 2Q2QA 1Q7GA 1O95A 3WFJA 5A9RA 5IZCC 1LLDA 4WCFB 3K31A 4E5PA 5JCXA 2VWHA 3U4CA 4D7AA 4JJFA 2XXJA 1B8PA 4U0KA 4YACA 1VKOA 3TFQA 1DIAA 3PHLA 3RIHA 3A4VA 3FI9A 3GT0A 3MTJA 3P19A 3DBHA 3DO5A 3JQAD 5GZ3A 3I52A 1PL8A 5CDGA 2CVZA 5DOZA 1TXGA 1YJ8A 3FHLA 1KY4A 3JQ9C 5K6AC 2B35A 1IOLA 1GV1A 2Q49A 1JTVA 1Q0QA 5KJFA 3FD8A 3PWZA 5JMWA 4ZQHA 2EIHA 3V2HA 4R3WA 1I36A 5A5FA 5AXBA 1WDLA 3JD1A 1DHRA 3INRA 4IPTA 1YXMA 1NR1A 3ZWVA 4Y98A 4E13A 3D0OA 4ZGWA 1E1LA 4DBZA 3TZHA 3ICPA 4CM1A 2PGLA 4OH1A 3RUIA 3JQAA 1HE4A 2JD1A 1PJ4A 3R3SA 4R54A 3WB9A 1DLIA 2VHZA 3JQ8A 3A06A 1P0FA 3EW7A 2X0RA 4I5DA 3E03A 4AJJA 3LSYA 1CDOA 4PLWA 3ZN2A 5HTOA 1RM3A 2BFAA 3ADOA 2Q1TA 1XA0A 4GX5A 3RSHA 3DOJA 1EVJA 1WVGA 4YA6A 1I2CA 2H9IA 1DDOA 1HL3A 3MOIA 1VLLA 3PRJA 4NFSA 3Q2KA 1O8CA 3GRPA 1F06A 3W6ZA 4B3IA 1I3KA 1HETA 1GUYA 3JYLA 1LX6A 3RUFA 4IQ0A 1CJCA 3TZCA 3E9QA 4AJHA 2RIRA 4ND4A 4XR4A 5JW6A 3F1LA 5L7YA 1XHLA 2EKQA 2ILTA 3QSGA 4DUPA 3CZRA 3KEOA 1ISHA 4GGPA 3UCFA 2Y0CA 3DOOA 1VKNA 3A1NA 4ONEA 3RC7A 2FY8A 3WXBA 3EZLA 1UXKA 2Z1MA 1U4OA 1B15A 3D7LA 3NTOA 1P1FA 2NV6A 1QR6A 1IHYA 3JD0A 1Z82A 3EZYA 4IGFA 3GVHA 5FF9A 4M89A 3I9NA 2BF7A 3MJVA 4I1IA 1BVUA 2IZ0A 1IYZA 4ALMA 4XB1A 4C7KA 4CMCA 4RORA 2ZYDA 3WYEA 3BZUA 4ZQBA 2A35A 1DFIA 5ILGA 4IXWA 3AU9A 3CMMA 1A5ZA 5JMPA 1PR9A 3VAZA 1WLYA 4YVFA 5BNTA 4R5HA 1CRWG 2B4TO 5FEUA 4CQLB 1D1SA 2B36A 5C37A 2OBNA 1R0KA 1PIWA 4KUHA 3ZHZA 4RV9A 5IDWA 3PDUA 3KV3O 1EMDA 3L4BC 3NUGA 3BXXA 4FW8A 2X22A 4DMLA 1DLJA 3QJ5A 1NPYA 3DZJA 1RM4A 4FFMA 3OETA 2WEKA 2Y05A 5L40A 4Z0PA 4YPOA 2BGLA 4BKUA 2HJSA 4TRMA 2BFMA 4TRJA 3WGQA 5I7EA 5JPIA 2WM3A 3AY7A 2CNBA 3FTPA 3PLNA 4WECA 4J43A 4OSOA 2J3KA 1I32A 3H7AA 4LVUA 2DBZA 2HLPA 3ZCXA 4ND1A 3ZDFA 3ANLA 3L4BA 3MCVA 4TSKA 4JLWA 2UYYA 3VH2A 5EPOA 3RCBA 3ITKA 2CUKA 5CPBA 3WIEA 5JY1A 1DC5A 4R9RA 3IOYA 2DPGA 4NBWA 4CM4B 1J6UA 2JCXA 4Z9YA 1JAXA 5JDCA 5ENVA 5KVVA 2FR1A 3RUEA 1LNQA 3I3OA 3VH3A 4E12A 1LXCA 3E8XA 3ZWOA 3DZIA 4D46A 4JIGA 4L74A 3DMTA 3F47A 3VH1A 3VPGA 5IXSA 2GD1O 3W4IA 1LDEA 2P4QA 3H5RA 4XGKA 4XRGA 4O63O 1LJ8A 4YJDA 1DPGA 1G0OA 1QLJA 1OC4A 4TZTA 1E6UA 3NDJA 2NSDA 4J7XA 4E31A 3DAPA 2JD0A 3GDOA 4TVOA 3EHEA 1Z45A 1EBUA 4WK6A 1EFKA 1WP4A 2C0CA 1TT5A 3NTQA 4MP8A 4CR8A 2JAHA 2Q3EA 3AFNA 2OZPA 2VN8A 3BA1A 3CINA 3QRWA 3Q3CA 1M2WA 4W9NA 1E3JA 4PG5A 4CM9D 4P4NA 5CFZA 1P33A 3JYQA 4D0SA 3HN7A 3FNHA 3LYLA 4DIBA 2CZCA 3LF1A 1BRMA 2I5PO 5G0UA 2WYVA 1A7KA 3F3SA 1KYQA 3C3XA 4WOKA 1Y8RB 4C4OA 1QYDA 1EE9A 1XGKA 3ON5A 5GZ6A 2GCGA 3LK7A 5I9NA 5TLSA 4WLVA 1QXSA 3FRJA 2J5RA 3C8MA 1RM5A 2H1SA 4NPCA 4YJFB 1SCUA 4PG8A 3UGKA 1VE9A 1H6CA 2GDZA 5BNFA 3KLPX 4GWGA 5IFLA 1KEWA 1NQTA 4MVJI 4B4OA 4RVGA 1ZUD1 1AHIA 1XYGA 1YBMA 4CMIB 2VUTA 4XJTA 1T2AA 1FDTA 4CM9A 4E5KA 2YHUA 2O3RA 5F5NA 1E0DA 1JKIA 4XIJA 4IDDA 4JBHA 1AN9A 4J2HA 4QTZA 4AJIA 2EKLA 2DPHA 4NU5A 4B79A 4RDHA 2PLAA 1D1TA 4CMEC 3L6DA 3NAQA 3GMSA 3H8VA 1QP8A 2GRAA 3O8QA 4DYVA 4MKRA 1U1IA 2PNFA 3LC7O 3U4IA 2EJWA 4ROSA 3WNVA 3GG9A 1Z7BA 1P1IA 4Q39A 3F5QA 1EQ2A 5LC1A 2R00C 1GQQA 3DEYX 4M55A 2NADA 4M87A 1KVQA 1ADGA 1KVTA 4XD2A 1YDEA 2DTXA 4PLYA 4CMEA 2ZTMA 2XF8A 4B7XA 2JCVA 1ENYA 1U4SA 2PY6A 3S2EA 3G79A 3GGOA 3NJ8A 3PGJA 3TWOA 3VH4A 3AU8A 3D3WA 4YWJA 1NYTA 2HK7A 3NRCA 3H9UA 1EUZA 3D1LA 1SEPA 1SNYA 4CV2A 3IUSA 4QX6A 4OQZA 3AJRA 3IJRA 1O89A 4RDIA 3WWYA 1HYGA 2VCYA 4XYMA 5B4VA 4OKIA 1H6DA 4U6SA 3WGTA 1I30A 3Q11A 1WMBA 1GADO 3PHIA 3GNQA 1H5QA 3HQ4O 4YAKA 4E30A 4HUJA 5DN9A 2ZTVA 3STHA 4ESOA 4OHUA 3ZU3A 2VYVD 4XDZA 5L4LA 2A94A 3PZRA 1FDSA 5MDHA 1Y1PA 3H6KA 1Y7TA 5TIIA 5KVSA 1Z75A 1H9AA 2VT3A 4RO0A 4XIYA 3PVZA 4UUNA 3H2ZA 1G1AA 2RH4A 4ITUA 1WZIA 3UOGA 1PJTA 3I9LA 4MKZA 2O23A 5I9MA 3ONFA 4M86A 3K92A 4WCFA 3DQPA 2YFHA 4C7JA 1X1EA 4AJKA 5K9ZA 3R3JA 1JQBA 2HMVA 3VPHA 5L7WA 1AXEA 5I7FA 1I0ZA 3WQRA 4RJTA 3BTUA 4HFJA 1DXYA 1DJQA 2C20A 3DAFA 1ZSVA 5GY7A 4QQRA 4NBVA 1V35A 1NASA 3PI7A 4RF4A 5TNXA 3WGYA 5FFFA 3FNGA 2JL1A 4IIVA 3BTVA 4D3SA 1YL5A 3O9ZA 1A27A 1XEAA 1ENPA 1MXFA 2O3TA 3LT4A 4UVDA 5F1KA 3MZ0A 5C5IA 2AA3A 3N58A 4ZVVA 5JNLA 3DFZA 3ETEA 4NFYA 5G0WA 4FJ0A 3GZ4A 1BSVA 1E3LA 3I4CA 4G2NA 4FN4A 1E7MA 1PU2A 2PKRA 3M1LA 2GZ3A 1YS4A 4R1UA 4WJZA 3IUPA 4R5MA 2C07A 5A3JA 1VI2A 2H6EA 2PD4A 3FPLA 4UULA 4I5EA 3ZWCA 2O3QA 1J5PA 2WSBA 3DZHA 3TZKA 3QHAA 1X0VA 3NJ4A 3GVIA 3KEQA 1QYVA 3GUYA 3ZV6A 3QWHA 5U1PA 4GI2A 1OFGA 2Y1GA 3MTGA 3GY0A 1IZ9A 1R0LA 5A4DA 4J1QA 5B12A 5K0ZA 3H9JA 5DCWA 4UVGA 2W2LD 1JAYA 2E6UX 2OORA 2VTDA 3I4FA 3PHJA 1N9GA 3QLJA 3ROMA 4HXYA 3JQGB 3LLSA 3IL2A 4Y6RA 4BNJA 3WJAA 4XDYA 1Q0HA 2YYYA 5IAAA 4NJMB 5AXAA 4BO9A 2JAPA 5L4SA 4BO4A 2ZJ1A 2D59A 5ICMA 3WSWA 2GASA 1U3UA 3FN4A 3GN2A 4BO7A 4TROA 4E2ZA 1P1RA 3U62A 1NFFA 5A06A 1LQTA 4JXKA 4CMKA 3GF4A 1BWSA 1LC0A 4QFDA 4CQMA 1X14A 4B4VA 4CV0A 1IZ0A 4R41A 1HE3A 4AJEA 4FFLA 4LMRA 3FNFA 1QYXA 2QQ5A 1NVGA 4NQZA 1ADCA 2O3SA 3KETA 1K3TA 3R1IA 3P2OA 1XLTA 2W2LA 4PLFA 1LDNA 3SLKA 1P0CA 4GBJA 6ADHA 3G0OA 3KBOA 4CMJA 1B8VA 1B8UA 2AE1A 1RWBA 3VVBA 4CMGA 1NWHA 1NWCA 3IAHA 1R37A 4S1VA 5T5QA 4P22A 4RVUA 4CQLA 3B1JA 3GLQA 1HDGO 2XAAA 2BGMA 4CODB 3GC6A 4IZHA 4KTVE 4NBTA 1GZ6A 2EEZA 4CLRA 3OJFA 2QYTA 3VTFA 3H3FA 5KOIA 2Z1NA 1Q2XA 3OHSX 2C82A 4W82A 2VWQA 4XKJA 2AW5A 4ALKA 4OGWA 3L9XA 1Y5MA 2X9NA 2O2YA 1UH5A 4UEJA 2ZCUA 2WJPA 4BNGA 1LSOA 3U0BA 2W98A 1B3RA 3E48A 1QRRA 3I9JA 1SAYA 4PVDA 5I8ZA 2W4QA 2Q1WA 3WG9A 5DBIA 4KUGA 3U3XA 4B7UA 4OYRA 5L3ZA 4BKRA 2HRZA 5EERA 5ER6A 3K30A 3DZKA 4OM8A 5KJ1A 2EP7A 4J9VA 3QP9A 1DC4A 3ZU2A 2IODA 3ADPA 3AUAA 4Y9DA 1HZJA 2Q45A 4E5NA 3JQ7B 5IG2A 2RHCA 3IDSA 3F1KA 1PGOA 1XIVA 1B16A 4DLAA 1U8XX 2VYNA 4CM4A 1P77A 4QO7A 3HFGA 1GCUA 4YQYA 2E48A 3EC7A 3GAFA 4BOYA 2PR2A 5EIOA 1U8FO 4CMBA 4XB2A 2Y68A 4L76A 4MVJG 4WPGA 4GMGA 4A27A 3T7EA 1S7CA 1T25A 2VNSA 3Q1LA 3ULKA 1GYPA 2AG8A 2D2IA 1C3VA 4K26A 2CF5A 1UP6A 2EGGA 1GR0A 5JO0A 3ZU5A 1NVTA 1P74A 2BELA 1DJNA 2ZB4A 3RASA 1VSUA 1R12A 3BMOB 4CM8A 3CH6A 4Z9XA 3U9LA 4TQGA 1PQUA 1XKQA 1U3WA 1PWZA 1ZK3A 2P9CA 3FWZA 3OQ1A 2BH9A 1V8BA 4MJLA 1IUKA 4HADA 3W4KA 1WW8A 4J3FA 4L4SA 2J3IA 3DZFA 3PPIA 4ZQEA 4N54A 3ZHBA 4FFPA 4CLOB 4EUFA 4IDEA 2C5EA 1Y8RA 4E3ZA 1MFZA 1N92A 4IQ8A 3UXYA 4Z0TA 3TN7A 1ONOA 3OA0A 2QZ9A 4P38A 5GZ1A 4KMSA 4ZA2A 1VL6A 4DRYA 1ADFA 3OP4A 4PLHA 2QW8A 2O3UA 1FDVA 1ZH8A 1A4IA 1ULSA 1ZK1A 3MWDB 3PQEA 4MVJE 5TGDA 2EG9A 2P5UA 2QRJA 2ZQYA 3I9MA 3S55A 4CMIA 1Y9AA 4EW6A 2Y99A 4JP2A 4WUVA 2J5KA 3VZPA 2D5AA 4YJGB 3CZMA 2OL4A 3LT0A 2IEDA 1KERA 3JQFC 4FGWA 1AXGA 1UXIA 1YB1A 3T4XA 2NVUB 3H3JA 2JJYA 3GA0A 2NACA 3F4BA 4AJ1A 5CP8A 3GGPA 3HJAA 1T26A 2W90A 2C7VA 3ASUA 3B6ZA 1ZK0A 3AUSA 1YVEI 4NI5A 4YQZA 4KQWA 3BAZA 3H5NA 5G0VA 5BQFA 3QVSA 3BMNA 2QX7A 1E6WA 3HADA 4BUCA 1HDOA 4AJNA 3MJCA 1DEHA 3L77A 5HS6A 2DC1A 2I9PA 1BVRA 1JKFA 3MWEB 5TQVA 3GVPA 3RJ5A 4H15A 3UAGA 1D3AA 4I9HA 1F17A 4CMHA 1NFQA 4HY3A 4F6LA 1VM6A 5C7LO 3EAGA 3PDJA 1PWXA 2Q2VA 2E49A 3DBLB 4YJHB 4P8RA 5JC8A 3ONDA 1YBAA 2J6IA 1QYCA 1PEDA 3CIFA 5JC1A 1ISMA 2PZKA 3AK4A 5JY6A 1H93A 3KLMX 4LCEA 3V2UA 3UCXA 2HMWA 1JDJA 1KOLA 3KM0A 2AMFA 4ND5A 4CV3A 4NG5A 3RJ9A 4BNNA 4CM6A 4MVJP 3VDQA 3WDSA 5TF4A 1PGPA 2QRKA 5CPFA 2PFGA 1GTMA 1K6JA 2YY7A 2VHXA 3H5AA 3S8MA 4D43A 1UUFA 2AQKA 4PIVA 1KS9A 3DHEA 3G1UA 2X9GA 3WQQA 3MJTA 4LSMA 3HDHA 4TRNA 2UVDA 4PLPA 7MDHA 2X58A 4HNGA 3U4DA 1R66A 2CY0A 3C7DB 2XXBA 5C7OO 4GWKA 4YAGA 3JV7A 3RUDA 2V7PA 4WKGA 3H4VA 4GLOA 2ZCVA 3FSRA 3HNPA 4IDGA 3SEFA 1MP0A 1I3MA 4NBRA 3NKLA 4D42A 4I8XA 4CR6A 4XCVA 4YCAA 4DL9A 3ICCA 4DPMA 5COAA 1XCBA 1T4BA 2CVQA 3HHPA 5C3MA 5FI3A 2CFCA 2PZJA 4RPLA 4HX5A 2Y67A 3D64A 5F1PA 4XQGA 2IEBA 1FDWA 3ETDA 2VOEA 3LT1A 4YXFA 2EGHA 1NQ5A 3VKVA 2X6TA 3QVWA 4LVCA 1X7GA 3R6DA 2UDPA 2I66A 3E82A 4EJ0A 3OJOA 1R16A 1V0JA 5JAZA 1ML3A 5KKCA 2AG5A 5F3RA 4OAQA 5MGBA 5LDHA 1YQDA 4BNMA 3HG7A 1U5CA 4KZPA 2G82A 4RZIA 3UICA 2DBQA 3I9KA 4WLUA 4I5FA 1LLQA 1UP7A 3FBGA 3KYBA 2YFQA 3PXXA 1T1SA 4WLNA 3AUTA 4XYEA 3UH1A 1HYHA 2DBVO 4AJPA 3MOGA 2FWMX 1VRWA 2GR9A 2NNLD 1Q7BA 4DLBA 3KSDO 3EVNA 4BO1A 5G0SA 5IXYA 1MA0A 3GVCA 4FFRA 2V6MA 1H9BA 3HE3A 2PKQO 4NJOA 3K96A 3F9IA 1F0YA 4Z3DA 3RVDA 1E1MA 3N74A 4CPDA 5I7VA 2RBEA 4NJMA 1YRLA 3DAGA 2W8ZA 4BO6A 4FC6A 1NR7A 4OJNA 5JE8A 4QT0A 5TS3A 3VPFA 2X5KO 2YV2A 3AI2A 5TJHA 3GNTA 2FN7A 3PIDA 4MVJD 3QWAA 3ZNNA 3G17A 2AXQA 5DP1A 3ZWPA 4RPKA 4G5HA 1LTHR 3L4SO 1NXQA 1LRLA 4KP7A 3IKTA 5CHEA 4B8WA 1L7DA 2FR8A 3VC7A 3C85A 1YB4A 2B4QA 1BXKA 4AICA 5JDCC 1XU7A 1M76A 2WD7B 3CTMA 3OEWA 5ENDA 3D4NA 3PHHA 3DFUA 2NUAA 1NPTO 5CEFA 9LDTA 4D44A 5AXCA 4DYDA 3IJPA 5JDIA 1NQOA 3DMTC 2PK3A 1U3VA 2NM0A 5JBIA 1D4FA 3COSA 2WMDA 1MLDA 1GV0A 4O59O 1HF3A 1HWYA 2HKIA 4R4JA 4YAJA 3WGHA 4ALNA 5CEJA 3RC1A 4MVJA 1DRVA 4FPXA 4IJVA 5IN4A 4NNJA 2O7SA 1E7YA 3O38A 5EL0A 2WYUA 5TX7A 1UP4A 3GDFA 3ROPA 1SBYA 1C14A 3VZSA 4IDAA 4AJLA 3E9MA 1P31A 4E5MA 2CMDA 4W9NC 3WICA 1PZGA 3C24A 1KC1A 4QFCA 4JX8A 4JJGA 4B4UA 1DBVO 2NTNA 2VZ8A 1R4NB 4XA8A 1EE2A 4N5LA 5F5LA 1Y8QB 1EZ4A 3IS3A 3RUHA 1X7HA 4FOSA 3G1TA 4O6VA 4ND2A 2PD6A 1EVYA 4TWRA 1FJHA 4AJ4A 3LLVA 2O4CA 4NIMA 4BNXA 5IDQA 1NQAO 4XX0A 1LBEA 2O2SA 1CERA 1I3LA 3O03A 1IULA 2V65A 1PJ2A 1O0SA 3D5QA 4YYZA 1GUZA 3F46A 1P9LA 4XGNA 1YE3A 1IPEA 3JD3A 3Q9NA 2V6FA 1MG0A 2WDZA 3DMYA 2A9FA 1MXHA 1ENZA 4PZEA 1ZSYA 3EYWA 3S1LA 3WFIA 2PD3A 1K6IA 2I6TA 1LSSA 4J0FA 1YQGA 4LRSB 2P68A 3ANNA 2ZIZA 4G81A 5HA5A 1E7WA 4W6ZA 3AWDA 3TZ6A 3VVCA 1OOEA 1GPJA 1PGQA 5ER9A 3HDQA 3U5TA 3TPCA 5KVQA 3UFXA 1NVMB 4GVLA 3HDJA 4UEOA 3BMOA 4DTIA 3GPIA 3E6AA 4AVYA 3QWFA 2Y0EA 4DVJA 3JTMA 2CDAA 3C1OA 4FGSA 5DT9A 5L45A 2GN4A 1QG6A 1GQ2A 3ORFA 1LI4A 1JW9B 4BMSA 1PQPA 1DFGA 3UVEA 1HKUA 3QVTA 3DONA 2OGUA 1GL3A 2HDHA 1I01A 3TNLA 1DRWA 4BNTA 4CLOA 4BNHA 4XYLA 1E6EA 5L4NA 4K6CA 2HJRA 3SVTA 1P3DA 1M75A 4JQCA 4CL8A 3KXDA 1WMAA 4TMFA 1U3TA 1UDCA 2DKNA 3GR6A 1A4UA 4NU6A 4II2A 2BRUA 4PLZA 2AEMA 1UZNA 2X4GA 4MOWA 5HM8A 2QRLA 1ZBQA 4A73A 4GKBA 5G4KA 4R1SA 4WEOA 3OH8A 5EINA 2YV3A 1N1GA 2J8ZA 3WTBA 5AVOA 1ISIA 4F45A 3AM3A 4PLTA 1VL0A 4BNLA 3O4RA 3OF2A 1NFRA 5KJ6A 5KNLA 3AI1A 4CJXA 2IXBA 2UUPA 3VKUA 2NU6A 5L53A 1PZHA 4MKXA 4X54A 4YJGA 3SC6A 4XQCA 4U6QA 5T67A 4L0QA 4ZD6A 2P91A 1EUCA 1ULUA 5IN5A 1WDKA 4ZRNA 2NVUA 3QWBA 4IY1A 7ADHA 3PGXA 4RGBA 3TL3A 3WS7A 5L51A 1NBOA 3B20A 2Q1SA 4BV8A 1BMDA 3BMQB 2B69A 4LISA 2JCYA 3W1VA 4F46A 5JAIA 4WCFC 1DIRA 4XJSA 2NWQA 3K5PA 1HDYA 4D79A 1X0XA 3HB5X 1GEGA 1JA9A 3ONEA 3UW3A 3HUDA 1SMKA 2NU8A 1Z7EA 4YT5A 4OSPA 2C29D 3ZHXA 3PIIA 2BD0A 2OOSA 2Y0DA 4WASA 2VRCD 3OEYA 3EY4A 3GGGA 1W73A 5G2OA 1LU9A 1XWFA 3PQFA 2X7HA 2HAEA 3E5MA 3ZW9A 5DBFA 4YRDA 3DBHB 4Q9NA 4BVAA 4EEXA 4YJHA 3OSUA 3ZV3A 5FYDA 4IM7A 4Z9FA 3DTYA 4J6FA 4BMNA 1QMGA 2PWZA 4J1NA 3VZRA 4GX0A 3RWBA 2J3JA 5EN4A 3F6YA 4R9SA 4YAEA 3QY9A 5DNAA 4RF3A 3FTNA 3CE6A 4YAIA 2VYVA 3TSCA 4YT2A 3VZQA 4EZBA 1HDRA 2D1YA 2VRCA 4FFNA 1YGYA 3SJ7A 4NHEA 1DIBA 4DA9A 2PV7A 2HUNA 4PGFA 1A9YA 3ENNA 4E5YA 3OIDA 3ZNOA 5BNIA 4QUKA 2WYWA 3L07A 4RLSA 3EK2A 5A5EA 3OJEA 4I5GA 1C0IA 4PCVA 1E5LA 3T4EA 3KYDB 1ZK2A 1CETA 2AQIA 3F4LA 4WLEA 3V5NA 1KVUA 4IDBA 3UCEA 1F8GA 1LUAA 4FDAA 3S2FA 1JU9A 5IDXA 3ZZNA 5DDIP 3QIVA 5EMHA 1T2FA 2WTBA 4PG7A 1MFPA 3GZNB 1X15A 2FSVA 1EBFA 4S3MA 3JCZA 1YL6A 4MIOA 2Q4EA 3NGXA 1PJ3A 2ZB3A 3OMLA 5DULA 5U4QA 3GHHA 3GOHA 5GMOA 4RPJA 2E82A 2HMUA 5LCXA 1CWUA 4EUEA 1VSVA 1LDMA 3NDRA 3GG2A 5JSFA 3DDNA 5ADHA 2RH8A 4OXKA 1GQYA 3D4OA 3FNEA 1ZCJA 4OXYA 3X2EA 3Q2IA 1IY8A 1QLHA 3GH3A 2DUWA 3ZV5A 3K6JA 3KYCB 4JJIA 3C7AA 4EITA 1TEHA 4M1QA 1IL0A 2FPIA 4BO3A 2PTGA 2QIOA 5IDYA 1N5DA 2RHRA 4B4WA 3I9OA 3GMDA 3KSZO 1WDMA 3INGA 4D41A 3HSKA 2O7QA 3GEGA 3FR8A 3GEMA 3KZVA 1SPXA 1B14A 1ZJYA 5DOVA 5A02A 1DSSG 2BI7A 4FB5A 4BV9A 4J90A 2C59A 2NTJA 3QVOA 3OA2A 3RBXA 5JAQA 3NX4A 4CV1A 1ZIDA 4JBGA 1NX6A 4D45A 1VJ1A 3H2SA 3M1AA 2IYOA 2YQ5A 3LVFO 2X8LA 3NDIA 4I9NA 1LEHA 1E92A 1T1RA 2EF1A 2X23A 5KKAA 4CUKA 3UHAA 4YT4A 5L7TA 1R4MB 1F12A 3C1TA 1Q7CA 4IXTA 5C7IO 4D0RA 2DM6A 5ILOA 1MGOA 3VPXA 1QKIA 4ALLA 1RYDA 8ADHA 4A10A 4MVJH 4IS3A 2Z95A 1E1NA 1YDWA 1MC4A 4H7PA 4A2CA 4B7CA 2WD7A 1GDHA 5CDSA 1FXSA 2GGSA 3QV1A 3ROQA 1QV7A 4MP3A 3WJ7A 2JFGA 4K6FA 2QG4A 4LRTB 1TI7A 1GFSA 2VRBA 4QO8A 3PWKA 1AUPA 2I76A 3S2GA 4TZKA 1C0LA 3NT5A 2G0TA 4RPHA 3BTOA 1WAMA 4KDFA 2TMDA 1PGJA 1XU9A 5A9SB 5IF3A 2X1HA 3AI3A 4A03A 4B8ZA 4BMVA 4URFA 2LDXA 4GAEA 4OXNA 5TJ9A 3JYNA 4E2XA 2BI8A 4KOAA 4WLOA 2OUIA 2PGJA 1ZZEA 4MINA 3PP8A 1MB4A 4AL4A 1E3EA 2J3HA 3OFSA 3SLGA 5G0TA 3PYLA 5AOVA 3TDKA 1GZ4A 1P1JA 5THQA 1UR5A 4R3NA 2C2XA 2HK8A 1AGNA 3I6QA 1IE3A 1Y5RA 1KETA 1Y8QA 3A14A 3I1JA 4KUEA 4RZHA 3NT4A 4BNYA 1TT5B 1LDGA 2GUGA 4IUYA 4R68A 2G76A 2O3JA 3ENKA 5ITWA 2YZ7A 2I3GA 4EI2A 1SC6A 1KEVA 2ZK7A 3V1UA 1H0KA 3ZWXA 1C1XB 4B3HA 4J49A 4OOEA 3WGZA 3FPCA 2ZQZA 3RFVA 3U49A 5DP2A 3TOZA 3NV9A 4WEQA 1UXHA 4EJ6A 4H16A 4YR9A 1VJTA 5JXWA 2OO5A 3KOUA 1WXDA 3W4JA 4PFJA 3P2YA 1OAAA 3C7CB 3FCOA 2CSUA 3H65A 1DAOA 4BNWA 1PJCA 1P1KA 3WLEA 4EYEA 2X0NA 1KIFA 3ZH2A 2X5JO 2ZYGA 2I65A 5H83A 1ZXLA 2YV1A 2GNAA 5JYDA 1ISGA 3VDRA 3OIGA 1IHXA 2Y1DA 1U2GA 4HV4A 1Y81A 1H6AA 3FF4A 2QZZA 3KB6A 4YJFA 1V6AA 3RAJA 1P45A 5L9AA 1B2LA 5BSFA 3JQEA 3HB4X 3LU1A 3I5MA 4CM7A 2NQTA 1ONPA 2FP4A 2VWPA 3OJ0A 3AFMA 2EW8A 1Z73A 3H9QA 1BG6A 4Q3DA 5HS4A 3GFGA 1GEEA 2VOJA 3UF0A 4CLHA 3ASVA 4RQTA 1ZEMA 1ZKMA 3JYPA 2OXIA 1GPDG 2JHFA 2Z5LA 2J5QA 2DFDA 4MVJM 4LK3A 4MIYA 3K73O 1ZNQO 3AOEA 2X0JA 5TC4A 1E5QA 2DTDA 1DFHA 3QWIA 5TT0A 3JQBA 4HKTA 1N8KA 1T2CA 3AOGA 2AQHA 4OKNA 5ES3A 2NVWA 4KWIA 4Z3KA 4R1TA 1K6XA 4ZRMA 4WNCA 5B4UA 3C1AA 2GYYA 2IE0A 2HSDA 2ZATA 1PSDA 1KBZA 2VHVA 3D4PA 3PJEA 3ETGA 1ZJZA 4CUZA 4P4LA 1T2EA 3LT2A 4I08A 1YONA 1ENOA 1XELA 2R2GA 3AY6A 3I6IA 4FJ2A 5KCZA 3R0IA 1U28A 2PZLA 4XQEA 3JQCA 3UUWA 5T64A 4RVSA 2EHDA 2VQ3A 3GRKA 3O26A 5H81A 5LDGA 1RJWA 4GLLA 1B3BA 3OBBA 4GGOA 4O1MA 4BL5A 3G49A 1NTOA 3H9EO 3I83A 3S2IA 2ZTUA 4E4YA 5BR7A 1U7HA 2I3AA 5ITVA 1ADBA 2OFPA 4ALJA 5T6BA 5U9CA 1SOWA 3LQFA 4UUPA 1RYEA 5BSHA 3PLRA 2B83A 4M8SA 4AFNA 1A7AA 1DRUA 4UEKA 3TJRA 1SOVA 1PS0A 4NH4A 4ZQGA 1LLUA 1SO8A 1U5AA 4CLEA 1BDMA 1LC3A 3PJFA 2VHWA 4NDNE 3RROA 4A0SA 4Q3AA 1LSUA 2BGKA 3SJUA 3UKOA 4BNKA 1X7DA 4UUOA 2Y1CA 4EDFA 2LDBA 1HEUA 1PS9A 4RVDA 1OBFO 4BB5A 1PJLA 2Q50A 4BO5A 2A92A 1O9BA 3WX0A 1GZ3A 1LA2A 2DLDA 2GN8A 3K8ZA 1J0XO 3GNSA 1TVEA 4Y8VA 1FF9A 3LF2A 4BQPA 1K89A 4XZ3A 2VUSA 2P5YA 4PG4A 5KJEA 3F5SA 1IPFA 1R0SA 4GPD1 1X13A 3E18A 5IZCA 1AE1A 3CXRA 5TT1A 2YHIB 3CSDA 4BNUA 2GO1A 4IDCA 4TKMA 2HO5A 3EGOA 2YQ4A 4MVJF 3WYCA 4E33A 4WE3A 4MP6A 4PLGA 3WIDA 5KVCA 3RC9A 1UDBA 4OO3A 1YJQA 4DIFA 1ID1A 3IMFA 4YDRA 2GN9A 1N1EA 1EVIA 1HDCA 1GCOA 3RU7A 3JQ9A 5K6AA 4BGEA 1CEQA 3RFTA 4GVXA 4FQ8A 2DU8A 5JS6A 1JN0A 2I99A 1JVSA 1J49A 2BLLA 3T7CA 1GU7A 3RFXA 1PL6A 5TRTA 3JYOA 4FBGA 3ROKA 1NM5A 2A4KA 3L6EA 5CDYA 1S6YA 3KYDA 3DZBA 1LRJA 3ZWYA 1W6UA 1BXGB 5JAMA 4F6CA 9LDBA 2PKQP 1N7GA 2BMAA 4KQXA 2NTVA 1N9GB 1FMCA 2SCUA 3SXPA 1RM0A 1TA4A 3GZNA 4BNZA 4BQRA 5EESA 3GPDG 4IJWA 5BSGA 1I33A 1I3NA 1R6DA 1C1DB 1R15A 4J4TA 5KTKA 1BHSA 1PJBA 4IINA 2Q2WA 1DO8A 5THKA 2AHRA 3JQGA 4J7CA 3KSUA 4II3A 3X2FA 1XR3A 2XPCA 4XYBA 2ZB7A 1L1FA 1PR3A 3DBVO 3WBFA 4INAA 3PZBA 4D3FA 4D3DA 2CDBA 4CQMB 2JKVA 4W99A 1M6WA 4O0LA 1CYDA 4RPGA 1NPDA 5ICSA 4IS2A 3KYCA 5JDIC 1BGVA 1A72A 3KTDA 1DC3A 4IMPA 4DPKA 2B4RO 1UXJA 3HZZA 4J4BA 1VC2A 4PG6A 4KDEA 2HQ1A 2IZ1A 4JGBA 3RQSA 3NGLA 2ZB8A 4BS9A 3L9WA 4BKOA 4I9UA 3ZGYA 2GPTA 4TRRA 5JYEA 1G0NA 1ISJA 1B0AA 1PS8A 4QXMA 1LQUA 4R69A 3RD5A 3CUKA 4J9UE 3PTZA 4CMAA 1WWKA 2GF2A 3LDHA 4IGEA 5EJ2A 2OMEA 1HSZA 4F3YA 3FR7A 2H5LA 4N5NA 3DTTA 4CLRB 5BSEA 4A7PA 3OECA 4EUHA 3NYWA 2YUTA 1CIVA 1U2DA 2GZ1A 1YB5A 1LDBA 4YTEA 4UVEA 3WYBA 3H9GA 3PQDA 3IKVA 4DLLA 4JNKA 1HE2A 3DBRB 4H3VA 3PFWO 1R4MA 1HXHA 3GUCA 1ZK4A 1DOHA 1E7RA 3FWNA 4N18A 4J1SA 5CDUA 3GVXA 2QHXA 5T57A 2FZEA 3ZWWA 3KHUA 1UZMA 4N5MA 2IYPA 4E6PA 4FOOA 5IZ4A 3V1TC 3PYMA 5HBRA 2G5CA 4XWYA 2B0JA 2IDZA 3TFOA 3BMCB 3OM9A 4J91A 1TB4A 4JK3A 4LN1A 1E7SA 1MG5A 3LZ6A 4B3JA 5I7SA 1D8AA 4RQUA 4TKLA 5JLAA 3RUAA 4LGVA 1B7GO 5CEEA 3WR5A 3MJEA 1LRKA 4K1LA 1SB9A 1ZSNA 1YBVA 5A9SA 3TOXA 5G4LA 3ZI0A 3K2BA 1X1TA 3JQ7A 1W0CA 4XQ9A 4ZN6A 2FHSA 5A9TA 3M6IA 4R1NA 4BGVA 2PH5A 4YEDA 1NHWA 4BNIA 1O5IA 2DTEA 4PLVA 4OQYA 4LCJA 3AY3A 3I23A 1EEHA 3ZNPA 2DQ4A 3Q9UA 4ZU3A 2FSSA 4JROA 1I10A 4CM8B 2NVBA 1ORRA 1BW9B 4E2YA 4IDFA 4OL9A 3INTA 5DCYA 1ARZA 1M66A 2CDCA 1SEVA 2YJZA 3GDGA 4DQUA 1JWAB 1Z74A 1GYQA 3PYXA 3JD2A 2ZYAA 1EQUA 4A26A 1HE5A 1NAHA 1C1XA 1QYWA 2X86A 5A04A 4GMFA 4HWKA 3L0DA 4DPLA 1EVZA 4IJUA 1UZLA 1MC5A 2W2KB 2TMGA 4XYGA 3B70A 1ZW1A 3PJGA 3NTRA 3EVTA 5AQ1A 4N7RA 3AM4A 4PZCA 4BNVA 3GAZA 2P9EA 4HNHA 4PVCA 1ZMOA 4PRKA 5H82A 5B1YA 4XRRA 3AM5A 2POQX 2OHXA 1YH3A 4PLCA 3WMWA 3B1KA 3BYZA 4DBVO 4LSWA 3NT2A 1I8TA 3ZHYA 2B37A 2HMSA 4Q3EA 8LDHA 2CD9A 3A9WA 1I24A 3SC4A 1UAGA 1EDOA 3U4HA 1EK6A 2VZ0A 3B1FA 1NNUA 2Q1UA 4AJ2A 4RF5A 4NMHA 4J1TA 4EEZA 2OBYA 4OIMA 4IJKA 4W4TA 1KVRA 3ZWAA 4RCVA 1DB3A 3ZW8A 3EDMA 2D3TA 3JQDA 1HDXA 1OZAA 4ZQFA 3VOSA 2PH3A 1GY8A 4IBOA 1Y9EA 3QA9A 4YRBA 2FR0A 2GERA 4IQGA 1U7TA 1T2DA 2NU7A 3CPSA 4U0JA 4EBFA 4ALIA 2HU2A 1ZFNA 2V6BA 4L9RA 1UJMA 2IZZA 4RF2A 4XGIA 2JD2A 3GHYA 4WGGA 3E9NA 1OC2A 4XEHA 1Q0LA 3MEQA 4DXHA 1BTOA 4ND3A 3DOCA 4FFOA 4ZICA 3DHNA 2F1KA 1L7EA 3KRTA 5B4TA 1DC6A 4E21A 2F00A 1M6HA 3BMNB 5T8KC 3RI3A 1U9JA 4R01A 1YOVB 2BFPA 3KUXA 5CDTA 3QVXA 2C5AA 1I5RA 1PQWA 3W8DA 3ZNQA 4Q3BA 3HFSA 4FS3A 1E3WB 1N2SA 2DFVA 3OJLA 2JFFA 2HK9A 5A1TA 2AQ8A 3UN1A 1XG5A 4Y67A 3CMCO 2C7GA 1NAIA 4MDHA 2AEJA 1OMOA 4Y6PA 4DIOA 5HRUA 4JCOA 3JQ6A 3IQDB 4J16A 2R00A 4XR9A 1XQ6A 4GX1A 2VWGA 4FIZA 1NP3A 5T8KA 3WGGA 3M2PA 4HBGA 3ZWBA 4DMMA 4G65A 3DBLA 5COQA 4DREA 2UUOA 3IIEA 1E3SA 3TL2A 4CLXA 1KVSA 2HRBA 4DGSA 3JSAA 2HCTA 2Q99A 3WOHA 1EFLA 2FOIA 4IIUA 3W8FA 3RBVA 2EJVA 2HMTA 2Y1FA 1K5HA 3WLFA 1ZVMA 2C54A 4AJOA 4YRAA 1LLCA 2EWMA 4HFMA 5F21A 1QORA 4OOFA 2NU9A 1FK8A 1PGNA 4L73A 4FJ1A 2B5VA 2RAFA 3IP1A 1G6KA 2P2SA 3BIOA 4Z6KA 5FI5A 4RLHA 2EP5A 2IRWA 2D5CA 1M67A 2G17A 3ANMA 4MPDA 3JQAB 1ZO8A 1W4ZA 3HN2A 3JQ8B 4NK5A 2JFHA 1GD1O 3G3EA 4CM3A 2XOXA 4BGUA 4RL6A 2VT2A 3DWFA 4J0EA 5J23A 4IZIA 4GL4A 2YHIA 2GSDA 5DZSA 4EJMA 5JO9A 1E77A 4Z0HO 2WWRA 4BKQA 3OQ6A 1YO6A 2VZ9A 4DQVA 2CF6A 1DIHA 5KWEA 1UAYA 5JCJD 3RBZA 3AW9A 2D0IA 3CEAA 2P4HX 3PHGA 1JWBB 5AYVA 4U7WA 4YBZA 4E0BA 3WGOA 4QEDA 4BO2A 1PJQA 3A28A 5DF1A 1O6ZA 3ZV4A 5I8WA 4CQMD 1N7HA 2Q46A 1DIGA 3DB2A 4TVBA 3WQSB 4IMRA 4DQXA 4FC7A 1TLTA 4FCCA 5JFOA 4WOJA 5DBGA 4HFNA 3LC1O 3PJDA 4J2OA 1BXGA 2ZKLA 2JHGA 1A71A 1A9ZA 5TSDA 3WTCA 4BO8A 1YQXA 4GH5A 3GQVA
chains in the Genus database with same CATH superfamily
1RQLA 1LI5A 1H66A 1YDMA 2DAPA 1SUEA 3OP1A 4JP3A 4OHMA 7YASA 2IGBA 4WLFA 3ZDRA 1PVDA 3KVOA 5D87A 5LQMA 1PZEA 4C04A 2C9BA 3PEFA 4ZCSA 5B55A 2AN5A 1JG2A 3UNXA 2YDYA 3QFCA 4ABYA 2OXRA 1HRDA 2AW3A 1C0KA 1VXRA 3QLEA 4HWGA 1VECA 1E3IA 2EZUA 4MB2A 6LDHA 5K03A 2BSAA 2VG8A 1IDN1 1KIAA 1T3SA 2FSHA 3HCCA 2R1TA 5JATA 1CUWA 5JJKA 1TUEA 3ODPA 4ZYXA 1E7QA 1QDUA 3QIAA 1JR4A 2C5SA 2QG6A 4MUAA 4XDHA 3RKUA 5IJ0B 3IIJA 5HKAA 2IYNA 3TQRA 1V9SA 3CM0A 3OQIB 1FS4A 2L18A 2ENWA 2WD8A 4CFSA 2PANA 1HT0A 3H4IA 3R5HA 4NV3A 4UFOA 2BFOA 3KHSA 3E84A 4GC5A 1XN1A 3QLTA 3KJEA 4KCGA 4URWR 5JSQA 2ATIA 2R96A 3HP4A 2IUFA 2BEKA 4W7SA 3V8BA 3GLHE 3RM3A 2V74B 4CU2A 5B3AA 3E4CA 4YX9A 1HFKA 3HRKA 2I8CA 4ZYYA 1UJNA 4D8UA 2PSHA 3T38A 1Q1QA 4ZGGA 4JN6B 3ENQA 1FQKA 4G09A 2YUIA 3KXLA 3WSTA 5L95A 1CS0B 3EUWA 3LUHA 2DECA 4KBFA 4JAVC 4WW0A 5KIAA 4BNFA 2Y6UA 4RA6A 3ZE6A 4AMZA 3GW8A 3OPVA 4RELA 2O0KA 3GAAA 3L1IA 3DBRA 4F06A 2X8JB 4BVJA 1LK0A 3HUEA 2I1LA 2QL5A 4KXMA 4AUNA 4Q9IA 2VSYA 3UJHA 1S2IA 3BWMA 4QBFA 1ODJA 3BQMB 4NCNA 3RVPA 3K2EA 4RNDB 1F6BA 2FRDC 2QL7A 3AHDA 1MOQA 1KNQA 2N1MA 1XD2B 1E5VA 1BDBA 2J9GA 1QOZA 2JCGA 3PCRB 4DSTA 5DN6D 2ZAIA 3O9MA 4EGFA 1V9LA 4NP6A 2IXTA 4I6JA 5AJWA 3TTVA 1R4NA 3I8XA 4U63A 3M3HA 4KO1S 5KO2A 2G04A 3TAUA 3DC2A 1MCZA 3ZWNA 4M54A 3DKRA 1CZOA 3T5MA 5C8XA 1BMTA 2HZBA 1FRZA 1KEUA 2I4MA 2OGSA 3I01A 2JAWA 4IRUB 4UUMA 2WFAA 2NLOA 3RS5A 4R05A 3EA4A 1UOQA 2W6JD 1USWA 4QSMA 2Z57A 2B5WA 4RV4A 2G1UA 4ID9A 3SDZA 1PL7A 2H4HA 2ZJ0A 1AKRA 2IF0A 3DC7A 4O4IB 1FFYA 3TQFA 2FLKA 3GO4A 1FSZA 4NYIQ 2BHLA 3JVEA 3GFBA 4ZOLF 5HIJA 4PX9A 5BQ5A 3AIKA 1E4OA 2X9VA 4IV5A 4CL3A 1DAGA 3F3MA 3UT5A 4BLRA 1PE0A 2C95A 1DTWB 1B26A 1N7JA 3BKWA 2DT5A 3CURA 1XQ1A 4L08A 4EELA 1PT7A 2DUUA 4LF4B 1Q16A 1YIOA 2J7PA 4BN4A 1EG2A 2QX8A 1RSZA 3IP3A 2DFPA 1KQGA 2EKPA 1EDBA 2NX2A 4BMCA 3PFFA 4WJKB 4EGAA 3Q0EA 4ETNA 3DLBA 1BW9A 1G5QA 3HWRA 4R9NA 2DEUA 1FSGA 1GUAA 2J31A 3BXPA 1A95A 2GX6A 2XKAA 4KXXA 1MC8A 1OILA 4BQFA 1N0IA 1UXGA 4RTLA 4Y6SA 2IXAA 1T8WA 4NABA 3ZU4A 4C06A 3CV3A 1OTYA 4RMIA 4YS6A 4TXNA 4GI1A 3SE7A 4P4GA 1JU4A 2D4AA 4A2PA 4F0JA 3LH5A 2EV9A 4M3NA 4I55A 1DO0A 1SB8A 1DQZA 3AOEC 3TZQA 3V34A 1TVKB 4RZQA 1Z06A 2ZSEA 1XDWA 3REOA 4UNIA 3RSSA 1T5IA 1LF0A 4URUR 4UXIA 2Y71A 3PWSA 5BUQA 2B1RA 1R9GA 3GZTB 1R4ZA 2RHWA 5J2UA 1A1VA 3QFTA 1TGYA 3B6IA 3UMSA 4HXEB 4AKEA 5JPCA 1KC3A 1L9XA 5KSOA 3W5JA 3E5RA 5IW8A 3G9XA 4X45A 4KVFA 3RU9A 1EP9A 3RVSA 3GBSA 2F55A 1GG8A 4YJ3F 1CUDA 4BB6A 2JEOA 1F8YA 2IYTA 3TNJA 2HA2A 1JQEA 3NETA 5ALMA 1CG6A 1CUCA 4KTTE 5CCBA 1V3TA 2HRRA 2OMKA 3HCPA 1IHDA 2AX3A 1AZSC 3C5EA 3RC3A 2I67A 3OM0A 1XOIA 1PR6A 2Y1OA 3TW4A 2RDMA 3ILYA 4Y7CA 2W4MA 1QSGA 5EQFA 3U09A 3SP1A 1BEUB 4ED9A 4F9TA 2BKAA 2Z83A 3QKUA 1PZFA 3PUVA 1RWKA 1R8SA 4JVSB 3PVCA 2G7ZA 1CUUA 3GPCA 4WNIA 4Y9TA 4CIDA 3VHRA 4FUTA 1P1HA 1VFPA 4FS8A 3LP8A 4KQ2A 1IXRC 4X7RA 4JHXA 3NHAA 4O4JF 3AV0B 2JGEA 3CLKA 3D0RA 3WSVA 2ZTLA 2ZSUA 3GLGB 4MRMA 4FYHA 2BEUA 1WPQA 3ML1A 4Y7DA 4KMMA 2CMKA 3IA2A 4HLDA 4E2WA 5JTTA 621PA 1FS5A 5CG2A 3P4XA 1J4AA 1Z4NA 2ID7A 5GJVC 2YJGA 4GZLA 3SS8A 2WM8A 1C41A 3TLMA 4XCQA 2CT8A 3V48A 1NVEA 4HQNA 4RKQA 1EZZA 3FBTA 4TXHA 2ZROA 1V8DA 4M38A 1QHXA 4F72A 1WZNA 3OC6A 1C9JA 3K9QO 1V26A 2JGJA 3RSQA 1H8HD 2DVMA 3HEBA 4AZTA 5KJCA 1CRPA 3BMQA 1T24A 2YWEA 1OY1A 4HHEA 2O2JA 2VNAA 3IC5A 3VV2A 4D3YA 1P9NA 2ZPAA 2X2OA 3QVGA 5CNMA 3TKLA 3DHYA 4X41A 1QX3A 2GN6A 2IYRA 4GP9A 4CF6A 5IABA 2AKEA 4GI3A 3DM9B 3NANA 3RS8A 3KC2A 4LECA 2PXCA 1Q7RA 2OK8A 5JHHB 1CVLA 2AFIE 3NBAA 3EAQA 4GE3A 3LFUA 3OQBA 4R7ZA 4AWBA 5BN5B 4DV1B 5A9RA 5IZCC 3D3NA 3RFUA 3LX5A 3U56A 4W6QA 4Q7MB 3VA7A 1ILEA 4MV8A 4BUZA 2IWRA 2ODEA 4D7AA 3OIWA 4MPPA 4FNOA 1L3BA 4MAMA 1CTQA 3U2QA 1F2UA 4U0KA 4JLOA 3AERB 3ME5A 1R74A 2M6SA 2HQSA 3PHLA 3A4VA 3RIHA 1QE3A 3MTJA 3QVJA 2FH5B 1EWVA 3LUBA 3JQAD 1RAEA 1RW4A 2RGAA 4ZXFA 4XM0A 4ASUD 1M2HA 2H2FA 3AR7A 5DOZA 5CDGA 2JJ8A 4RY2A 3ZJ4A 1TXGA 4Y2GA 4TWAA 1EQAA 2ODBA 1K86A 1APBA 1H8HA 4MSUA 3TKAA 1ZUNB 5K6AC 4UOEA 2JLZA 1IOLA 3SYNA 3A6HA 2I34A 1IU9A 1MQ8B 4WCVA 5EKSA 3WKDA 4DSUA 3GJRA 2MHCA 3OE7D 3RR2A 1GGVA 2EIHA 4LOAA 1NM5C 4D25A 4R3WA 1D2RA 2XCLA 1I36A 3SMQA 3EGCA 5TY0A 5FNVF 2XCRB 3A58B 4A0HA 4IHQA 5CNIA 1VGRA 1WDLA 3MD0A 4Q24A 3ESZA 3VDXA 4WVFA 4RD1A 2IYEA 2OCAA 4GR4A 4Z7QB 5K99A 1YXMA 2HM7A 4JA0A 4ZYTA 4JQYA 1XNRB 5LWQA 2VF8A 2JLCA 5UKDA 1E1LA 2AD1A 3I09A 6PFKA 4FT4A 1ADJA 4HWSA 5E3JA 1KYWA 2DPLA 1G8FA 1YS2X 2QRNA 3FMFA 5FIUA 1NVXQ 2PQ6A 4TTTS 4OK6A 3BCUA 1RPJA 3JQAA 3R3SA 3OTQA 1CZLA 2VHZA 5DSZA 3FYUB 4EB8A 1P0FA 1EFPA 3ZC3A 4YUWA 3E03A 4AJJA 5LQCA 4B3BA 3QPVA 2GD6A 4QLOA 1TQDA 4FZVA 1VJRA 3S5JA 2V4UA 1JG7A 3X1ZA 1RABA 2G5TA 2OQ2A 3B48A 4X8OA 1ONBA 5D6NA 5AHWA 4YA6A 3PPYA 3SVLA 4HB4A 3NM6B 1A8SA 2V6JA 1XA3A 3A6ZA 3AFIA 3KB8A 2A5YB 3MOIA 4P4SB 2CJWB 4XSHA 5G40A 5LIRA 3Q2KA 1X2BA 2YX1A 1R18A 4TN5A 3FDXA 2ZYUX 2O0LA 4RJKA 4DDKA 3A05A 2OBBA 4DCNA 4CW7A 3NW9A 5AW5A 1I1QB 2ACKA 1Z34A 2VDWA 1CJCA 3E23A 4ZC8A 3RUFA 5IKEA 2FMTA 1HQYE 4G63A 3ZI7A 3E9QA 4BIMA 4GOKA 2XEDA 4XR4A 1H5UA 5J9FA 5L7YA 2ILTA 3QSGA 4M9XA 5JADA 4U7PB 1XMPA 3KEOA 1EBBA 3EISA 2QTHA 5A62A 1DWPA 4GGPA 2Y0CA 2ZAGA 3TXAA 1XP8A 2CHUA 3OQJA 2W5UA 1VKNA 2OXTA 3ZCQA 4ONEA 3IKLA 3OU6A 4DCUA 1ZX1A 1UXOA 5C8YA 4AKIA 1UXKA 1KR5A 4C0XA 5BO5A 1B15A 3NIBA 1Q91A 2NV6A 3A6LA 2MJLA 2JEYA 2YFKA 4UASA 4I1IA 4B3GA 1IYZA 2JGDB 3EY9A 2YRXA 1FDIA 3ANTA 4CMCA 2ZYDA 4YIHA 2FJUA 2WHQA 5J4LA 2PFKA 4JC0A 2GK3A 1NKSA 4C6HA 3AU9A 4HRYA 1JA1A 4ZT3A 4ZTZB 3EQ8A 4GFDA 3VAZA 1TEXA 3QELB 2PXAA 5AW2A 4R5HA 4TMYA 5IT9A 1KMIY 5FEUA 2OLKA 1D1SA 3CUEF 2B36A 4QHYA 5CLIA 3K70C 4LX8A 3MBIA 1T1GA 3SQOA 3NXKA 4TOIA 3ZHZA 2QROA 3PNOA 3LO8A 3R3UA 2HPAA 1G1MA 2F2TA 2QRVB 4XVCA 2JZOA 3DEAA 3HZOA 3VX3A 5KX5A 1YKSA 3ESQA 3L4BC 5BSRA 5KOJB 4FW8A 2G72A 2QDXA 2X22A 3HEAA 5L40A 1KDYA 4AX8A 4G26A 3OETA 1YCDA 1Q14A 4KHPB 3LOPA 3GRZA 2D1QA 1KH3A 1QFXA 4M1MA 1PWHA 1A9QA 2O52A 2W43A 4FONA 4HDKA 4C22A 4ZO8A 5FOSA 3MWGA 4ZOEA 5I7EA 3GLIE 2O8BB 4LHVA 3AY7A 1XQ9A 4NF2A 3UG6A 2P3OA 1R2QA 1E9RA 4WECA 5JFTA 1SCQA 2WJVA 4OSOA 4AO8A 1I32A 4E08A 3H7AA 4MV7A 4NAHA 2GRJA 4AUMA 3GWGA 4E11A 2FLVA 1LF5A 3H2YA 5E6SB 5EP3A 2PU5A 1IUOA 3R3XA 1A2QA 3A32A 1R6XA 1RNLA 2R6R1 3GGJA 4ZQIA 3WIEA 2DPGA 4R83A 4DAOA 4NBWA 1XQYA 1VZ3A 4HQRA 1MOSA 5JDCA 1JAXA 3SDSA 3VR3D 3MC1A 5CBPA 4EA6A 4ARBA 1M6VA 1XKXA 2FR1A 3EZXA 3KTOA 2VZEA 2VXOA 5TPZA 3VH3A 4AX4A 2FK8A 2UVPA 3ZWOA 4GOOD 4E12A 5FDFA 3FW1A 2ZJZA 4JIGA 4UE3S 4Y0AA 4HYEA 1MHTA 4L74A 3VNBA 2BEVA 3UYKA 1XTSA 1QANA 5B1HA 3TKYA 4BFXA 4ZJYA 2VTBB 4TTQA 4XGKA 4M0UA 4L4UA 1R0WA 3K9WA 2FMXA 4TWJA 4C43A 1G0OA 2V1UA 3VSBA 5JH7A 1OC4A 2C31A 5D7BA 1JBQA 1OYVA 1E6UA 2NSDA 2GESA 4OI2A 3IBGA 2JD0A 2A0XA 5HHTA 2I7VA 1TNDA 1U02A 4I99A 1RAIA 5CIWA 3F5FA 4WK6A 2AYYA 5HOEA 1DINA 4TV8A 5EJAA 4CR8A 4C6TA 4BC1A 2I6UA 2CLSA 2JAHA 3UM9A 4IEFB 1GZDA 3DGFC 2NZ2A 2VN8A 2YWRA 3BA1A 5AIAA 1C3EA 4YP6A 3SI7A 3HU1A 4W9NA 3AP3A 2ADMA 4PG5A 5K0LA 5KYGA 2FW1A 2GJSA 1P33A 2IYVA 3JYQA 4GT1A 4UZFA 3C6BA 4WUTA 4XWAA 3FNHA 1L5KA 1R9MA 4J75A 4BX0A 1SUCA 2PVCA 5KI6A 1KEEA 1XRQA 3KDSE 1A7KA 3IAFA 1DXQA 4FHFA 4NYMR 1C9MA 1DXHA 2A9VA 1DJOA 2H9YA 1DDGA 3C3XA 4PC7A 1Y8RB 3C3MA 1U0HC 1UIRA 1U1EA 3R8CA 1NSTA 3I12A 4KRXA 5GZ6A 5SY4A 3NHZA 2P9TA 3LK7A 1DCKA 4I4TA 5I9NA 3FDZA 3T3IA 1BN6A 1QXSA 3HR4A 4BNYA 3BZWA 3RSCA 2IP2A 3U26A 1YFLA 4N76A 1OW3B 5DMXA 1HYQA 4NPCA 4PG8A 2ZUDA 3UGKA 4IXNA 3PRYA 4BJ3A 1H6CA 1W59A 1UOOA 2ETXA 5E6UB 5LPNA 4GWGA 3RS7A 3DKPA 3ERCA 2Y0PA 2WPNA 1JZSA 5JD3A 4G56A 1YBMA 1XTRA 3OZBA 4L7VA 4ZO7A 3VGJA 4CMIB 4RBNA 5G41A 4X66B 2PT9A 2PT7A 3IR5A 1W36C 4G37A 4QGGA 4E5KA 5F5NA 3OKAA 1E0DA 3UK2A 3DD1A 1ECJA 2FGJA 2J08A 2UZ1A 4BJ6A 1PCXA 4IDDA 1DQSA 4JBHA 4UHKA 3NNSA 2VH5R 3EQ7A 4J2HA 4E5DA 5DNVA 1S02A 4N3NA 1FZQA 1H2ZA 2EKDA 2OCDA 2HHJA 3FVQA 3TINA 3DKKA 1B42A 3VR1A 2QZ4A 1RE1A 4RTOA 4A0FA 4CKBB 3BAFA 2WM9B 1WXGA 3GMSA 5L6MB 2PLNA 3FBWA 3U4IA 3LC7O 3QF4B 5IU6A 1Z36A 5EJ6A 2JLQA 1G59A 3FPKA 3EGDB 1FNCA 1MJHA 2CXOA 4JOCA 4UKDA 4F3CA 2IEGA 2D5IA 1USGA 1NW3A 2R00C 2R7NA 2NADA 3DEYX 1Z8DA 2AMVA 3LKVA 2TRSB 1KVTA 1CJBA 2QE6A 1VL1A 4KQFA 1A5BB 3QEMA 1YDEA 2XA2A 4HPWA 4PLYA 3T1TA 1DU4A 1SHKA 4QVIA 2I4LA 3O94A 2ZDQA 4MTCA 4CKYA 1E2KA 2Y4NA 3DG9A 4M21A 3S2EA 3NJ8A 1HQDA 3KOMA 4CFZA 2GTIA 3MUNA 4N6GA 2VPYA 4ER3A 2HSWA 5DI9A 3W7AA 3CCFA 5P8WA 2V0NA 1SEPA 2AMYA 3IE0A 4GIBA 1JIXA 2H4JA 4L28A 4M8LA 4OQZA 5GOZA 4PYJA 3IJRA 2DJIA 1D6NA 1WW3A 4JJ8A 4OUDA 2ZKIA 4NMXB 4QE3A 3VTAA 2WINI 4E7OA 2FZKA 2VCYA 4NZPA 1D5WA 2ZI7A 1RQ2A 5I45A 2G83A 1QHFA 1WVMA 3PHIA 4GXQA 4PS0A 1YT5A 4YAKA 1V48A 2XUZA 1WCIA 4ESOA 3KPJA 3ZU3A 3RYTC 5A3RA 2VJMA 4RNCA 3B7WA 3NBMA 1GT6A 1FDSA 2EATA 1Y1PA 2NXWA 3RIXA 3IUEA 3AFGA 1SELA 4RO0A 1RQNA 1NUQA 4A0RA 4EA8A 2QGFA 5SZHB 4JKYA 5IT0A 1PJTA 3MAAC 2E2WA 2OV4A 2B1IA 3DQPA 3D7RA 3ZX5A 1X1EA 4AJKA 1H1TA 4UTNA 2I78A 2P4UA 2QJTA 1JQBA 2WWWA 3KDAA 3R3JA 4UM9B 3TIVA 3T5PA 3LW7A 5KOHB 1W0JD 2BM1A 1I0ZA 3V7UA 5DXAA 2P11A 5BXYA 2QSYA 1DJQA 4F5EA 4I14A 2NMVA 4BP3A 2BEWA 4DLZA 4QQRA 3W77A 1D6MA 1V7CA 3E05A 1ULHA 4BFUA 7REQB 5FFFA 4YCLA 2OBXA 1YULA 1JIVA 1TRHA 2VAWA 3LWNA 4LOIA 5ITZB 2QTVB 4F6RB 2O3TA 1QC5A 4UAJA 1ORVA 4OQQA 3B51X 1O0CA 5C5IA 3MCAA 1XQXA 4MWDA 4ZVVA 4A8PA 1GGKA 5AVUA 4NFYA 2J9XB 3SU8A 3DMDA 2J5XA 3NHWA 3HDGA 4PGMA 3VHXB 1GO2A 1VPEA 4FN4A 2NZWA 1JR2A 2O7RA 4LA4A 2C9YA 3G0HA 4QQ8A 4PTZA 1T91A 3IQZA 2ZRKA 2VJKA 3N0WA 3A9UA 2PKYX 2PKRA 4UBMA 4R1UA 1YS4A 2W2QA 3RF7A 1UODA 3HVKA 3T52A 4R5MA 5A3JA 3GPLA 4Z3OA 1G5RA 2H6EA 4W9RA 4Z4EA 1MIOA 2F48A 3NFRA 4GI7A 4ZVOA 4Z9BA 3TZKA 3BBLA 4OXQA 1GCGA 1EH5A 1A2BA 2OM2A 2VPIA 4NAVA 2JA2A 3V1MA 5IARA 2GBFA 3H2JA 5FEMA 2L2QA 5U1PA 5KQRA 4GI2A 4ARIA 3EGXA 3IPXA 3C3PA 3ZLVA 1L5OA 4N3GA 5DCWA 3OJWA 3ADDA 3ZS9A 4FSXA 4JASB 4HXYA 1FXUA 3PNMA 4D80A 2BFCA 4IFIA 2YYYA 4JUBA 1UBNA 4G0QA 3TDMA 3AHCA 3GWZA 1ZITA 5AXAA 1HOXA 1ZRHA 3PFHA 2X0EA 4F1JA 3LWDA 4HYYA 2LGJA 3TXXA 4P3NA 2PJRA 1ZOIA 5LYJF 2GASA 3FN4A 2WK1A 3GN2A 4JI7B 3L1UA 3ZCPA 3B9RA 1YJCA 2PVSA 4ADSG 2BGUA 5BN4B 4Y2XA 4RTRA 4DG9A 4JXKA 4L7QA 3EIUA 2Q6OA 4QFDA 5ULLA 1TVMA 1X14A 2X13A 4RANA 4B4VA 1ID8A 5JNWA 3BH6A 4R41A 4K0KB 2Z3ZA 2XMPA 2IGTA 2QQ5A 5JQGF 1WBDA 5H4HA 2X9QA 2V7GA 2O3SA 3NVAA 3I2KA 1PUIA 3WLRA 4W1RA 2R66A 4L2IA 3SLKA 3BM5A 1NQXA 1K92A 3OVMA 1P0CA 3QX7A 4EY3A 3LTEA 6ADHA 3KBOA 1OWLA 1V8FA 1B8VA 4NVRA 1VKZA 3UWMA 2AE1A 3LDFA 2DFNA 3Q15C 4R0NA 2OCKA 2QMQA 3ZPXA 4CMGA 1EUQA 4MWCA 2PX6A 2QP4A 5T5QA 4EW3A 1ESDA 4RVUA 4EJSB 4CQLA 2BL4A 5LP6B 3KZNA 2H92A 4MA4A 4OFBA 4V2IA 5CDFA 1M0EA 1HDGO 4GMXA 4B2IA 2XAAA 4KMOA 4AXXA 2GAOA 1P29A 1JFFA 4IZHA 3QVMA 4X1YA 2BGWA 4NBTA 1GZ6A 2EEZA 1SXJB 3OJFA 2E18A 1N6KA 2IYAA 1RXCA 2SHKA 2ZR0A 1FFXA 3HBFA 1SH7A 4JGGA 3F71A 2P1ZA 4K6GA 3OE4A 5BY2A 2C82A 1L5YA 2F9FA 3LQ1A 4U6NA 2Q6TA 1VE5A 4OGWA 1T36B 3L9XA 1GSAA 1PEAA 1Q15A 1RCUA 1YQWA 2FWIA 1Y5MA 1U0FA 4LNAA 4WN9B 2O2YA 4C2AA 1T9AA 1CUIA 3FKSA 5AW4A 3CVJA 1ZD5A 1B3RA 1U6JA 4EG6A 1TGVA 2ZT6A 3WG9A 1CP3A 2Q1WA 3U3XA 4B7UA 4OYRA 3PX3A 4M7PA 2C3UA 4KB5A 1ZKDA 2YICA 3D8BA 1ZXXA 5EERA 5BQPA 2E5FA 3AEYA 1GPH1 5KJ1A 1WUKS 4J9VA 2I80A 3NBYC 4BFVA 2DCMA 5EXPA 2HCBA 4Y9DA 4B6GA 2C57A 1NUHA 1Z5ZA 2Q45A 2QN2A 3AIMA 5KNDD 3JQ7B 1F9EA 3HJCA 2JATA 2QMEA 1MT3A 1ODIA 3F1KA 1PGOA 1SVWA 4P98A 1B16A 3G0IA 4AMUA 1K6MA 4MDEA 5F3WB 1P77A 1KAGA 5F33A 4G0WA 3HFGA 3C48A 4MRPA 5I9IA 4YQYA 4EKIA 2E48A 3EC7A 1ES9A 2P35A 4WFJA 2RHMA 3SJZA 2E0IA 3EEQA 4GZ3A 5IEJA 4L76A 4MVJG 4WPGA 5AK4A 4YREA 4GMGA 4EJFA 3MNFA 3MIIA 4ZPXA 2W2XA 1XLVA 1EVKA 1YHZA 3INYA 1QQBA 1RRKA 3N87A 5DHTA 2V5VA 1X9GA 2Q9UA 2D0PB 1ODSA 3C6ZA 3KFVA 5A4MS 3MYRA 2AOWA 3R7AA 4IRMA 1WY5A 1UCFA 3RH0A 1DG9A 1P74A 2B6HA 1DJNA 1J25A 2ZB4A 1BJRE 3K5HA 4W8GA 2WYHA 3EWNA 1RHKA 1PL0A 3NNDA 3BMOB 2ZSJA 2ZUTA 4P4UA 5KNDA 4QWWA 2DE0X 4JLAA 4RXTA 4D8VA 5LKRA 4TQGA 1PQUA 3SC2A 4X1IB 1CT9A 5EQJB 4QAJA 1DBQA 2FTKE 2Q0HA 1ZK3A 3DZ8A 3EMVA 3FWZA 1I4DD 2EFEB 3BWYA 4JA2A 1AURA 1U2QA 2J1LA 1XTTA 1ZOPA 3W4KA 1ZP6A 2J3IA 1BA2A 3OE5A 3M81A 1M1YE 1N3BA 3PPIA 2F1HA 4GD3Q 4N54A 5L3QA 4EUFA 2BGJA 2P6MA 4IDEA 3AVQA 2W2VA 5AKXA 1YVPA 3IMEA 4LJ9A 1GKUB 1QV9A 5IVIA 1NA5A 4ACAA 5CFQA 1Z29A 3DDCA 3IEVA 3S40A 3TOSA 4AURA 5ISMA 1WXQA 1D7AA 2WZBA 1ONOA 3MAJA 2EW1A 1TMYA 1W5SA 2QZ9A 2YQZA 4JB0A 4DRYA 1ADFA 3MSXA 3ZK7A 1E18A 5K09A 2VKQA 1QQAA 4PLHA 1A5SB 4N9WA 5DE3A 1EWRA 5CH5A 2ZT5A 3AG6A 3KHTA 2P27A 3QNWA 4WBNF 3TD6A 2L69A 4BAZA 2VAXA 4ZI7A 4JSRA 3PQEA 2X6RA 4MVJE 4DMLA 221PA 1EK1A 2B8JA 4NV0A 1CD5A 4B6PA 1VQ1A 1QHNA 1OA0A 4IXDA 4BFCA 3IH5A 4WUVA 1RYBA 1QB8A 2J5KA 2XRFA 3A1UA 4ZOQI 3BJEA 3T1QA 4B3FX 1U0TA 3K9FC 2D5AA 1NMZA 2Q0XA 1IEVA 2FW6A 3WAGA 3RT1A 1GGJA 1I1OA 2DCUA 3MMZA 5ESXA 1L1QA 1HBJA 4FGWA 4HQOA 4I50A 5FADA 1UXIA 2NVUB 4UOZA 3HDTA 2XGMA 3MGCA 4BV3A 5DM0A 3GA0A 2NACA 3F4BA 5LZ5A 2JHCA 1BX3A 1L5MA 1G9SA 3HJAA 3SXUA 2FZCA 3ZE7A 1O95C 3JATA 1CZUA 1ECPA 1ZK0A 2HEGA 1S4MA 4Y1GA 1W2WB 2RB4A 2F8MA 3I5UA 4NI5A 4YQZA 4EPYA 3E3NA 5L3SA 5ED0A 3HU5A 3WIVA 1LK7A 3HUUA 3MJFA 3H5NA 4LY0A 2VYFA 4GS5A 2NU8B 3ZUPA 4H7KA 3IEMA 1JEQB 5A7HA 5J3JA 1XXHA 3L77A 2DC1A 3JWPA 2HGZA 1CK4A 2ZUSA 3AX6A 3HXLA 2CE7A 5KINB 4BUJA 2FFAA 5TQVA 5EUMA 3UAGA 1Z4QA 2IY7A 2C3PA 3NC1C 4HMPA 1F17A 3NPAA 3TYXA 5CLFA 1XZEA 4CKWA 3OEHA 1Q7EA 1MORA 4FGLA 1CF9A 1XTPA 3WHKA 3ZQ6A 4DLTA 2C8KA 2OFWA 3EAGA 3G5TA 3SHVA 3PDJA 3JRNA 4FI3F 4OB8A 3SHFA 3O8DA 4MW7A 1Y9JA 1U94A 1XKTA 2E49A 3DBLB 3FGNA 3T41A 2VQDA 2YHAA 4N4AA 1QZXA 1PD1A 1QYCA 1TRKA 1VA4A 1L9KA 3CIFA 1ISMA 2PZKA 3CUVA 4KDCA 4U4AA 3OTOB 1Q0PA 4LCEA 4FYJA 3ID6C 5GADl 4XASA 3KM0A 1ZNXA 3LHSA 3O4HA 3NP7A 4KO8A 4ND5A 4CV3A 1H2WA 1Z9BA 3KUUA 1RLTA 2H0AA 4CM6A 2XX3A 4MVJP 2DX7A 2GXQA 4HH4A 4OFZA 5A4AA 5CPFA 4V1CI 4LIPD 3W5VA 5HIAA 2CMGA 4MCJA 4UPEA 5KU1A 2G63A 5TMEA 4D43A 1TZBA 1UUFA 5EKDA 3O2SB 2ATXA 2QL9A 4PIVA 3UXHA 1WB9A 1BWPA 1GLGA 2GJKA 5JXIA 3WQQA 3T5GA 1U90A 2BFFB 1VCMA 3GI1A 4S24A 3HDHA 4WT7A 4AG6A 2G06A 4HNGA 2MMCA 5KYYA 1XN4A 3E61A 3EMBA 4JGIA 4QXAA 5C7OO 1PHPA 1TW3A 1YR8A 3S2UA 1G5IA 4PN3A 2J41A 2P2CA 1GGNA 2I03A 2V7PA 3RBAA 3RUDA 2O5EA 3FSRA 2Z5VA 3GLHA 3P4UA 4KREA 5ETJA 5K2MA 5GWXA 3ER6A 4WOCA 3W79A 2XQIA 2DLCX 3A6EA 1Z0IA 4OL0A 3RVMA 3QJYA 3THXA 4XCVA 3R20A 4YCAA 3BB4A 3ICCA 5AMXA 5COAA 2QLBA 1T4BA 4ZOCA 5FI3A 4WD3A 4F3NA 4PGAA 2ZRQA 3BA6A 2PZJA 3MQFA 3S81A 4HX5A 3TPFA 2FQQA 2Y67A 1KYXA 2J3QA 3D64A 4UBIA 2A88A 4QULA 1OLSB 3PNKA 5C34B 1G18A 1US8A 1OCEA 3RYIB 3U4QA 2BGIA 4YWHA 2LPMA 3LT1A 1HURA 4B2LA 3OLXA 3DDSA 4YRQA 1NQ5A 4Z4GA 4RU1A 5AW1A 4ARCA 4INJA 3O3CA 4ZVTA 3ANXA 4RK7A 1Z88A 1IG0A 3G02A 2AK3A 1F2DA 1QQTA 2I66A 1OQAA 2WHPB 4EJ0A 4L9SA 2F62A 4W5JA 3G0BA 4FI3C 5SV2A 1J0EA 3B3GA 4ENWA 4YCSA 4WA8A 2WA2A 1ML3A 5KKCA 2V45A 2I6SA 3R0VA 5LDHA 5MGBA 3W3ZB 1ZL2A 5CDHA 3HG7A 1SZDA 2XKKA 1QF7A 2Q21A 3FPBA 3M1IA 1LWNA 4R8KA 2XDQB 4RZIA 3TD2A 3HGQA 2FPIB 1RYYA 2C5HA 2A0FA 2JGFA 2B98A 4WLUA 1UWKA 1J39A 3TE6A 2JLWA 2C2GA 4XYEA 3AUTA 4FOTA 2C5LA 3UJPA 3FAZA 3MOGA 3GB9A 3T1VA 2FWMX 1C80A 2NNLD 4HWPA 2C8VA 4GBGA 2H2IA 2OD2A 3DLIA 3KPWA 3MBKA 2P1DA 3OE1A 2H1OA 1UJ4A 2PN1A 3PXUA 4LF9B 1Z0SA 1ZU5A 2BFBB 5G0SA 5IXYA 1MA0A 2ZBUA 1A96A 1PP4A 2V6MA 3HE3A 3DW3X 1DKMA 4DUYB 2WSIA 3DCIA 2D62A 4K3UA 1XD9A 1KO5A 4XFDA 3O8RA 2B6NA 3RAPR 5AKHA 3CWZA 1FBTA 2R1UA 2BE9A 3K6KA 3L8GA 4QT0A 3H8WA 4Y1RA 1S01A 2W6CX 2H4YA 1OU4A 2ZW9A 3ABOB 3D4LA 4N0MA 2FN7A 2H8GA 3PIDA 3QWAA 2IXDA 2REBA 4LXGA 5DP1A 3ZWPA 2ZANA 3UY4A 3ELDA 4YCBA 1GDTA 5SZJA 2BKVA 4URHA 3TD9A 4B6OA 1B76A 1NXQA 3DDWA 4PHHA 1LRLA 4UBKA 3Q1KA 3T06B 1XPRA 3JALA 3R09A 1BKYA 3BXEA 3C3DA 4HPJB 4QBGB 5A6SA 4F21A 4OATA 4MK4A 2R60A 2CV1A 4MITA 1ZN2A 3SICE 2WD7B 4XUDA 2FVYA 2QTGA 3O6VA 3ZW7A 5IYZB 3D4NA 3PHHA 3DFUA 3G8CA 2J33A 4DNOA 1IN5A 3L01A 4R3UC 1P2TA 4GEKA 4K8RB 4D44A 3D6JA 1YZKA 4PPNA 3IJPA 2PUFA 5HMLA 2HRCA 2HWYA 1M5UA 1JIUA 2NM0A 2PGXA 1KY2A 3GJ6A 2J0EA 3TW0A 3DDHA 2WMDA 1NGSA 2PR7A 3L8CA 1MLDA 4TLCA 1IVYA 1KSHA 1GV0A 1LJLA 2OHIA 3K1AA 5JD4A 1AO0A 4YI3A 4O59O 3RE1A 3EHDA 2H52A 3FUTA 1HF3A 2HKIA 3N2NA 3TX6A 1Z6TA 3WGHA 3DT6A 2EOAA 3OAAD 4QWMA 2CNKA 2XVYA 1P73A 1L5NA 1SXPA 1SIWA 4WESA 1AZLA 3D2BA 3NHLA 3CB4A 3O38A 2YOFA 2NVOA 4BMYA 3QQ5A 1B00A 4ZMBA 1KZGB 3QMMA 4IDAA 2BN4A 4AJLA 2V96A 2W2OA 1P31A 4E5MA 4E51A 1C30B 3QENA 4PSUA 4K05A 3A4LA 1Z18A 2NU9B 3M4ZA 1RWOA 1BX1A 4JX8A 4QFCA 1DBVO 2NTNA 1R4NB 2EKBA 5F2OA 1EE2A 2P69A 4N5LA 3TAXA 4OLHA 1EZ4A 4E1VA 4FOSA 1L7MA 3ABQB 3IBSA 5TGZA 5EQTA 5FOWA 4UMEA 1AU9A 2C7QA 3ZD6A 3BRWA 3STYA 4Q34A 1PYGA 1A50B 1GPAA 4NG4A 1KFEB 2HF8A 4BFZA 3CRMA 4AJ4A 3V6LA 5IDQA 3O47A 1GNSA 5BWOA 4MEBA 4DV7B 3O03A 1LVUA 3AB8A 3DHVA 3MIZA 1A7UA 3Q8MA 1Q3HA 2V65A 3N6VA 1O0SA 4YYZA 1GUZA 2GARA 2BBWA 1IPEA 2FWBA 1EP2B 3T5TA 3DOIA 3SNKA 3IP8A 3SQXA 4EARA 4YR7A 4YUVA 2WDZA 3VU0A 1G6OA 3LPDA 2LP4Y 3OTWA 4DNQA 3L40A 1PD0A 2ZWVA 5T6MA 3DKIA 4HDOB 1ENZA 1RKQA 1I1NA 2I3DA 4PZEA 3WFIA 1FYWA 4ZZ3A 2PD3A 1K6IA 1P2BA 2AFIA 1PFKA 2I6TA 2RGNA 5HOQA 2P6RA 1LSSA 1XEWX 4FEAA 4M2LA 1Q0ZA 1GA1A 5HA5A 5F2EA 3IAXA 5BW6B 1E7WA 1OV4A 2R7MA 4W6ZA 4DGQA 4CE6A 4PS1A 4N39A 5H02A 3VV3A 1NVMB 1MABA 4PO1A 2WYIA 1T1EA 1LKZA 1R7RA 3EH1A 1KAHA 4X97A 2WSMA 1ZJ5A 4HZUA 3UJ8A 5EJ4A 1JBKA 1UPTA 2YN2A 3MRTA 1RHQA 2C4MA 1N32B 3JTMA 2CDAA 4BXOB 4EWLA 3NTLA 5DT9A 3KJIA 1NU8A 2DETA 3M6VA 1QG6A 3WGUA 4PO8A 1I51A 3I6BA 4PX5A 3K16A 2D4HA 5H68A 3TQCA 1PQPA 1ST2A 2ZJAA 3MUEA 3MW8A 5J2UB 3DONA 1KH1A 2MSDB 4NQRA 1NF3A 1GL3A 2HDHA 3TNLA 2RGGA 3S4YA 2EHJA 3VYTB 4Q21A 3D1JA 3EJ6A 1X7YB 1X3LA 4CLOA 2OB2A 4XYLA 3DULA 2QUKA 4JKIA 2IPLA 2HJRA 5C81A 3WFZA 1T9GS 3I32A 1WMAA 1FNBA 5AW0A 4N0DA 3OPNA 5A5GA 5FOUA 3UENA 4OX9Y 2WUVA 1N0HA 1TZ2A 4G4JA 4YP0A 4D4KA 4MS3A 1YR3A 4DQLA 1V71A 2C0QA 4MOWA 1P0IA 3ACDA 1OUMA 1PR2A 1Z2AA 2J87A 1T5HX 3M3PA 3FYCA 1ZBQA 5HVNA 5G4KA 3PC8A 4RV5A 5LJLA 2QVLA 4G2TA 1OIVA 4RZXA 1Z13A 2J8ZA 4M0CA 3KOWA 1OI2A 3UMFA 1FTYA 1VLMA 4ME6A 5DX8A 4BNLA 1F4VA 5J1TB 5EMNA 1QH1A 1VB5A 2IHYA 3PFKA 1AQUA 2UUPA 1Z37A 2BMVA 2KB0A 3T9BA 4JJKA 4NCKA 3ZHSA 5L53A 4KXWA 4OQEA 2PQMA 1XZQA 1R0XA 2BAGA 4PFSA 1XTKA 3HVIA 4ZD6A 3VC2A 3K9BA 1ULUA 2YOGA 1J99A 4K9QA 1OWNA 2WAMA 2WIBA 5AI0A 4R40A 1ND5A 5E9QA 1XF1A 2FMFA 2Z56A 1EFAA 5JMTA 1UOPA 3PGXA 3W5DA 3TL3A 4NOLA 1DARA 4LXHA 1IIBA 2QP3A 1NBOA 2ZIGA 3A0RB 1J20A 3LHIA 1UWCA 4TLAA 2Q1SA 4BV8A 2IK8A 3UT0A 2I2WA 1L7OA 2B69A 3BMQB 4Z5XA 5FD8A 4URYR 1UJCA 4DEVA 3RTGA 1DIRA 4EFNA 2NWQA 1ZHHA 5K8LA 1HDYA 1CUBA 3ZTTA 1ZVVA 1LK5A 1X0XA 3HB5X 1YU9A 2YW2A 2HUPA 1GEGA 5FPPA 3REFA 1NXSA 3U39A 1X80A 3UW3A 3ZGOA 1KMMA 4E70A 1N8NA 1R3UA 2X2EA 4B6FA 4G1VA 3RK1A 5JT1A 4RKFA 4HD8A 5BOVA 3WDKA 2C29D 1IOVA 1EIZA 2RHDA 2PZ8A 2B8EA 1KSGA 1EDEA 2H1HA 3FPGA 2DULA 2Z5GA 4IQ4A 2YCBA 3KUCA 1YRQA 4AU1A 3PQFA 2X7HA 1F2UB 1SU4A 4AKHA 1WHSB 2IXEA 3ORYA 3FI0A 4MVXA 4BFWA 3E5MA 2O1EA 1H2XA 3BDIA 3LY5A 5HF9A 2AT1A 3ZW9A 4UNPA 3DSRA 4Q9NA 1ZU4A 2H5EA 1W85A 3OSUA 4C7MA 4I5IA 1ISSA 1FFGA 4IM7A 4DMUB 5GONA 2A3RA 1K75A 4J1NA 1CUZA 5B5SA 2BCGY 3ZKWB 3RWBA 4NHOA 1MENA 5KVCA 2XZLA 2V97A 3F6YA 2R7KA 4H4DA 1P7ZA 1R8YA 1WU7A 1Z08A 2TSYB 3R7WB 2W6QA 2WV7A 1ADYA 3PICA 3QY9A 1E9CA 3KBBA 1FP1D 2FEOA 2X6QA 2IJGX 3FTNA 3CE6A 4DCJA 4B3MB 4X7MA 1C50A 4PYRA 4XOIA 4IMIB 2PBZA 2QNRA 1ZCZA 1VBKA 2VYVA 3SEAA 3TSCA 1M0SA 3VC1A 3MFYA 3A0UA 2HY7A 3BRCA 4MROA 1BN7A 1HDRA 1NXXA 1U80A 2TS1A 1FFWA 3ONWA 4L72A 4NATA 5KYWB 4CQNA