2AE2A

Tropinone reductase-ii complexed with nadp+ and pseudotropine
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
259
structure length
259
Chain Sequence
AGRWNLEGCTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKELNDCLTQWRSKGFKVEASVCDLSSRSERQELMNTVANHFHGKLNILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISSVSGALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLVEMTIQDPEQKENLNKLIDRCALRRMGEPKELAAMVAFLCFPAASYVTGQIIYVDGGLMANCGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of tropinone reductase-II complexed with NADP+ and pseudotropine at 1.9 A resolution: implication for stereospecific substrate binding and catalysis.
pubmed doi rcsb
source organism Datura stramonium
molecule tags Oxidoreductase
molecule keywords PROTEIN (TROPINONE REDUCTASE-II)
total genus 104
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 1.1.1.236: Tropinone reductase II.
pdb deposition date 1999-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ae2A00
5U9CA 5DP1A 5CDSA 1DXYA 2H9IA 1A72A 2GO1A 3E6AA 4KP7A 4R01A 1DO8A 3E82A 1SMKA 1E3JA 4I5DA 4J1TA 4BKUA 4IQ8A 4BQPA 2AEFA 3HZZA 3JQEA 4DYVA 4E2XA 2IZ1A 3G3EA 5DBIA 4TZKA 9LDBA 2TMGA 5F1PA 1GV0A 5TGDA 4XIJA 4CUKA 3HADA 3O4RA 1NHGA 4JQCA 2PNFA 4HFMA 4XCVA 3R1IA 5EQFA 5TJHA 2EIHA 1XA0A 2J5KA 4IMPA 2BGKA 4A27A 1DOHA 1UDCA 2RHCA 3GMSA 5HA5A 2HRBA 1WMAA 2ZTVA 1E3LA 1E77A 3RUHA 4B7UA 4AJ2A 3OECA 1PU2A 4ZGWA 1B8UA 3DZBA 4OMUA 2YFHA 3DB2A 3W4JA 4YQYA 2HMUA 2D4AA 1M6HA 2DBZA 3EGOA 4BGUA 1A7AA 3E8XA 4MVJF 1D4FA 3OFSA 1K0UA 2P68A 3H9EO 3ZW8A 3SLKA 4D42A 1Q1NA 3UXYA 1YXMA 2DM6A 4RQUA 4W9NA 4YT2A 3RKRA 1E7QA 3D3WB 1HYHA 3DMTA 4GAEA 3AWDA 3JQ7A 3JQCA 4R4JA 3K8ZA 1ID1A 3EC7A 3FI9A 1E7SA 3AOEA 3U9LA 4NPCA 1N7GA 1NAIA 3LQFA 1Q7GA 3DBLA 3PWZA 3WTBA 3ZWMA 4FS3A 5A04A 2O2SA 5F21A 4KUGA 8LDHA 1MX3A 2JFGA 1R4MA 4BMSA 3SX2A 2ZQYA 1ZO8A 2NADA 3ZU2A 4AL4A 4D45A 3OQ1A 3KHUA 1JQBA 4DRYA 1Y6JA 3FTPA 1C1DB 2VN8A 2AHRA 3C85A 4Y8VA 2Y05A 3OJLA 4BL5A 4PZEA 4G81A 3DHYA 3P7MA 3JQFC 3V2GA 2ZTUA 4NJMB 2FPIA 2VUSA 5I7FA 1DB3A 1PS9A 4XKJA 1YOVA 3NJ4A 4ZU3A 3HB5X 1UP6A 5I7SA 3PQFA 2J3JA 3C7DB 3L9XA 1QV7A 1T1SA 2A35A 3PHJA 1IB6A 1GYPA 3INTA 4FB5A 1ZZEA 1LX6A 4YAGA 1R66A 4Y67A 4FJ1A 3H9GA 2VOJA 4AJ4A 1PTJA 1RKXA 3GDGA 4GPD1 4FJ0A 4ESOA 2C2YA 1CRWG 3GOHA 4EITA 1T4BA 2B4RO 1QYXA 2YHIB 4NG5A 4PRKA 2JHGA 5IJZA 5JC8A 5JY1A 1ZEMA 1KETA 2Q1WA 5A9RA 1XLTA 3CINA 3ZV6A 4HWKA 4CM5A 1QYDA 3ZWVA 2PKRA 1X7GA 1ZNQO 4NI5A 2PLAA 2DT5A 3MJSA 1HTBA 2X5KO 3PFWO 3PJDA 3EW7A 4D3SA 1BRMA 3I9LA 4UVEA 4IJUA 4ONEA 1PZFA 3W6ZA 1J5PA 1KBZA 4WLEA 1B26A 3DBVO 3DTTA 1I10A 1A71A 1KC1A 4IDCA 4DQXA 4Q39A 1U8XX 3GA0A 2XOXA 1P1HA 1ULSA 3PDJA 3RBXA 3VPSA 5JDCA 4Z0PA 3GZ4A 4CLOA 4GLOA 4GMGA 3TF5A 2D8AA 1OC2A 3TSCA 4TQGA 5A9SA 5HTOA 1SOWA 4DWVA 3JD2A 5CDTA 1B8PA 2Q99A 3PHLA 1VKOA 1H94A 2SCUA 4FBGA 1IE3A 4R1UA 3WNVA 3IJRA 4WJZA 3SLGA 3RU7A 3VHRA 5IFLA 3DBRB 2ZTMA 1IHXA 1QG6A 5FWNA 1EFLA 4L76A 3OSUA 1ZMTA 1XU7A 1W0CA 1LDEA 1I2CA 3BMOA 2YFQA 3EVTA 3ZWXA 2VUUA 4TWRA 1DFIA 1ZFNA 4L74A 4CUJA 4IZHA 4EGFA 4KUEA 3F1KA 1ISGA 1YE3A 4FFRA 4OOFA 1OOEA 3VAZA 5IN4A 3VTZA 3KTDA 3WYCA 1C3VA 1SB8A 4H15A 1U8FO 1YVEI 4YT5A 1PQWA 3UAGA 4RPKA 2G5CA 1B3BA 3LLVA 4QX6A 3LC1O 7MDHA 5JYDA 2UVDA 3VZQA 1K89A 2FSVA 5H81A 1U3TA 1UDAA 1YGYA 4KZPA 1WP4A 1GEGA 3LT1A 4FCCA 4J6FA 1C1XB 4RORA 4DQUA 4E13A 4E21A 1XELA 1RWBA 3S8MA 1DBVO 2ZB7A 3JQBA 1E6UA 3GGPA 3NEPX 4AJNA 3UCEA 4NK5A 3RUEA 1WDMA 3FCOA 5THKA 5CPFA 1L1FA 3IS3A 2VOEA 4QUKA 1YDEA 3D1LA 5DP2A 1VLLA 1HSZA 1GR0A 1LC0A 5A5FA 4EW6A 3UF0A 1OI7A 1X0VA 4C7KA 4WCDA 4UEOA 2EJVA 4LVCA 5B4VA 5JBIA 3OJFA 3H4VA 2OMEA 3IAHA 1G0NA 4BIIA 4Q3NA 1GCOA 1M76A 4DMMA 3H8VA 3LYLA 3S2FA 1YKFA 2O48X 1O6ZA 5F1OA 1Z7EA 1E7YA 5T6BA 4DBVO 5CEFA 3JTMA 5HRUA 3DZFA 1IUKA 1T2AA 3WYBA 4CMKA 1XU9A 5FF9A 5BSEA 2OUIA 3JD0A 2BRUA 4BGIA 1YQDA 3I9MA 3V2HA 4J3FA 1C0PA 2D5AA 4WOKA 4GH5A 4KTTE 2V6BA 3D3EA 3HDYA 2O3RA 3AI1A 1BSVA 1C14A 4FOSA 5BNTA 2ZB3A 2OO5A 4BKPA 1NPTO 4UUNA 2IE0A 3DBHB 4JP3A 1RM5A 4MVJG 2YY7A 3NDRA 2BD0A 5TNXA 2Q1SA 3QA9A 4J9VA 2B37A 1ZSYA 2JD2A 3QW2A 4LK3A 4IMRA 3JYPA 4HY3A 1PJCA 1M75A 4TROA 5HBRA 1WAMA 2HQ1A 3D64A 1QMGA 5ITWA 1BXGB 4J0EA 3WWYA 1E3SA 2AXQA 3S1LA 3FF4A 2FP4A 1YL7A 2TMDA 3ST7A 1AHIA 4XQGA 2C2XA 3ZN2A 4XIYA 3GT0A 1MXHA 3BYZA 1HL3A 3VDQA 5I9LA 3VZSA 1F12A 3GEDA 4UULA 1LDGA 1KERA 1F06A 3U3XA 1ISHA 3KUXA 2W98A 3GGOA 1PZEA 3QHAA 4WEQA 4XGIA 3RJ5A 4LISA 3JQ9C 4IJVA 4EUFA 2IXBA 1KVRA 1DFHA 5U1PA 1PL6A 3G0OA 2GPTA 1PJSA 3WOHA 1N5DA 4LGVA 3NTQA 2NTJA 4K28A 4UUPA 3OH8A 3EY4A 5TF4A 3SVTA 2CDCA 3FR7A 4NU6A 2JL1A 1GD1O 4D0SA 3FTNA 5K6AC 5L45A 1DAPA 4J2OA 2QYTA 2C5AA 3CKYA 1B15A 1VJ1A 1D8AA 4JN6B 1GFSA 2DLDA 3CXRA 3H9QA 3JYQA 5TS3A 3WGZA 6LDHA 4YA6A 1DLIA 4GX2A 4E5KA 4CM7A 2NVBA 4AVYA 4FGWA 1QYCA 2R6JA 4Q3DA 3OJ0A 3RFXA 1K6JA 2OOSA 4MKRA 1B7GO 2YHIA 4DIBA 5H83A 1YS4A 1HDXA 4JBHA 1HYGA 3RQSA 4NR0A 1ZK2A 5IDQA 4EEXA 3NUGA 2IEDA 2WE7A 3ZV3A 1QYWA 5A1TA 2BI8A 4RZIA 3PFFA 2J3KA 2YDXA 2Z1MA 3PDUA 3GN2A 3ON5A 4IDEA 1E7MA 2QX7A 2J5RA 3QVSA 2NU6A 4UVGA 1HDZA 1HE3A 4NQZA 5G4LA 4DREA 4CM9A 1GCUA 1MB4A 2E82A 3QIVA 1AUPA 2GCGA 1WWKA 3KBOA 5L51A 4J4HA 4WUVA 4B3HA 4XRRA 3WTCA 4ALJA 1EBUA 2C5EA 4R68A 2BFPA 1JKFA 2PD4A 1E3IA 4BNKA 1C0LA 1KVUA 3V1TC 5DBGA 3VPHA 1V6AA 7ADHA 3A14A 3EUWA 2P4QA 3QJ5A 4GVXA 5T57A 3W4KA 1QP8A 3K92A 1MC4A 4DXHA 4E2YA 3H5AA 5A9SB 4QO7A 5BR7A 3DONA 3B20A 4CLEA 5KVQA 4H3VA 3ZWOA 4M1QA 3GZNB 1ZK3A 2J8ZA 4MJLA 3S2EA 4FFOA 4YXFA 4Y98A 4RQTA 2OGUA 3UCXA 1JDJA 3S2GA 5JO0A 5KOIA 3AFMA 4F45A 4PG4A 2CUKA 2ZYDA 2GLXA 3B1JA 2XPCA 2X9VA 1ZSNA 2GERA 4XR4A 4I5FA 4R3NA 3E5MA 3OJOA 1TLTA 5IZCC 3AJRA 3AU8A 3HFSA 5JMPA 4WLVA 4DL9A 3I9KA 4HNGA 4XGKA 3E5RA 5I7EA 3AUAA 4N54A 1Q0LA 3ZNOA 3NT2A 1Z75A 4IXWA 5IDXA 1VM6A 3IP3A 5EQDA 1QSGA 4CM6A 1B8VA 2VYVD 4GLLA 5A4DA 1HDYA 4N18A 3X2EA 1LI4A 3L0DA 5G0TA 1JAXA 4B4UA 1UH5A 3SJUA 3ORFA 1N92A 3C1OA 3HHPA 1OBFO 3DMTC 1JWBB 1L7DA 3MOGA 4L9RA 3T4XA 4BKQA 4XYGA 6ADHA 1NR7A 3VH2A 1ZKMA 2YYYA 3JSAA 3LVFO 1FDTA 4S3MA 4C4OA 3JQDA 4IS2A 4YQZA 2O50A 1KVSA 2NACA 1RYDA 3F1LA 4RVGA 2ZCVA 2GZ3A 4TKLA 4IDFA 4WLNA 4J2HA 1QR6A 4CODB 4FC7A 4OM8A 3WSWA 1LSSA 3BIOA 1PL7A 2YJZA 2X22A 2P5YA 3WGOA 2C7GA 2PGLA 3QRWA 1L7EA 1RPNA 2PGJA 1EFKA 4CMEC 2HMVA 2GR9A 3EK2A 3WB9A 1H0KA 4R16A 1R6DA 4II3A 3RSHA 1E92A 2D59A 4PLYA 2EKQA 1HKUA 4CMEA 3NTOA 1NTOA 2AEJA 2CVQA 4UAGA 2DPGA 2I9PA 3ROMA 4UEKA 4J1QA 1KOLA 3QQPA 4CUZA 1Y8RA 3GNQA 3CTMA 2XAAA 2C20A 4RPHA 3RCBA 1R4MB 4WK6A 1LBEA 4ID9A 1GADO 4UVIA 1NQTA 2OORA 1PJ3A 3PWKA 1JAYA 1EDZA 1NR1A 3L4BA 3RROA 4BO9A 4ZQBA 5F1KA 5AYVA 1WW8A 3H6KA 3GAFA 4IDDA 3ETDA 3LT4A 4EUEA 3D5QA 4YCAA 4OGWA 4U5QA 2EKLA 1UAYA 1KY4A 1LNQA 4BNLA 1M67A 5JCJA 4CM8A 4D43A 1I3KA 2VT3A 2D2IA 5JS6A 1R4NB 4JP2A 2Z95A 3QVTA 4KUHA 3EAGA 4BGVA 2B5VA 1LRLA 4L4SA 4TRRA 4ZQFA 1ENOA 4ND3A 4Z0HO 3WDSA 4RF4A 1FDUA 1I36A 3TJRA 3AUSA 4WPGA 2AQHA 2FSSA 2NM0A 4QTZA 3TQHA 4B3JA 2DAPA 4E5NA 2VHZA 1WDKA 4GX5A 3K96A 3C24A 3NTRA 4J90A 4TMFA 3OETA 2X58A 4NIMA 4BUCA 2JCXA 4P8RA 3GVCA 2X9NA 2A92A 4R1SA 1HETA 1A5ZA 3I3OA 4TZTA 4I1IA 5DT9A 4ALNA 2B0JA 3O8QB 1O5IA 3N74A 1Y5RA 1XEAA 2PZJA 4PLCA 4WE3A 3ENNA 1I24A 4D44A 3L6DA 5A3JA 4UVDA 3GNTA 2D3TA 1EUZA 4PVCA 1NFRA 2HMWA 3PLRA 2VTEA 5B1YA 3GFBA 1ZJYA 4P22A 2VZ9A 5AVOA 1FJHA 4LVUA 4MKXA 4Y9DA 3JYOA 4BNYA 4G5HA 4GKVA 4I8XA 4PG7A 1YO6A 1BG6A 1LDMA 3PZRA 3BMQA 4R3WA 5EESA 3PYXA 4R5HA 5T5QA 1A7KA 3V1UA 4YT4A 4J1NA 4P4GA 2BFMA 1SAYA 2IODA 2D1YA 3PJEA 5G0SA 3DAPA 3QY9A 4I9NA 1W4ZA 4H7PA 2NU9A 2Y0CA 4QSMA 1OFGA 4BNHA 4QEDA 2PTGA 5I8ZA 1U7TA 2Y93A 5TRTA 1R0KA 4BNJA 3OHSX 1EE9A 4W7IA 4TSKA 4B4OA 1UXHA 1NQOA 3F4LA 4KMSA 1GL3A 2H5LA 2AW5A 2X6TA 1CQIA 1R16A 2X23A 4W99A 2ZYGA 1JLLA 3LF1A 3ZHBA 1EVIA 1ORRA 3OF2A 2ET6A 2DBRA 4RZHA 3COSA 1C1XA 4TVBA 4BKOA 5KJEA 3DZHA 3L77A 3PP8A 2G1UA 1SNYA 4D0RA 3KSDO 2LDBA 5THQA 1DRUA 3T7EA 3WWZA 3UHAA 1WPQA 3D4NA 1LLQA 4U6SA 4PZDA 5CEEA 3CE6A 2AE2A 1QKIA 3Q0EA 1AN9A 4BMVA 5LDHA 1ULUA 5HS4A 1RM3A 3HJAA 1Q0QA 4FOOA 4J16A 5IXYA 4MVJM 2GNAA 2YV1A 3CZMA 3MEQA 3W8FA 1NQ5A 1MC5A 2DPHA 2XXJA 4JNKA 3DO5A 3AY6A 2VRBA 1HWYA 3CMMA 3PGXA 4D3FA 1DAOA 4B8ZA 3ZZNA 3FN4A 4YRDA 3CZRA 1YB1A 1UUFA 3PYLA 3KZVA 1J0XO 4EDFA 2W2KB 4I9HA 4OJNA 2I99A 4B8WA 3GR6A 4DTIA 1SC6A 4A0SA 5KIAA 4IGEA 1OAAA 1SB9A 3BMNB 3OIFA 4ZA2A 3V2UA 3F6YA 4MOWA 4XB1A 3H9UA 4E32A 2P9CA 1EQUA 1UZMA 3Q3CA 4E5MA 1NHWA 5IDWA 3O8QA 4CV3A 4IM7A 2CY0A 2YW9A 3UW3A 4J49A 3PRJA 4WASA 1NWCA 3GNSA 2AG5A 3F5SA 3GPDG 3PHGA 5A05A 1KVTA 3CMCO 4J7UA 5EINA 5JO9A 1NP3A 3AOGA 3MWEB 4YVFA 4CLOB 4QT0A 2NNLD 3RUFA 2UDPA 3LF2A 1LSUA 3WR5A 2FN7A 5I9NA 4E30A 4UEJA 5G0WA 2E48A 4FC6A 4XEHA 5IZCA 1EE2A 1PGJA 3ONFA 3WFIA 4MVJD 1XSEA 4PN3A 4DLAA 4CV2A 1K3TA 5F5LA 1DFGA 4ZVVA 4TVOA 2IYPA 2WJPA 3GDOA 1XKQA 3NDIA 4BGEA 3B70A 4FD3A 2I3GA 2C54A 3OQ6A 4NMHA 2CF5A 1DC4A 5L40A 2VWHA 4BO5A 2O23A 4CMHA 4QECA 4CQMB 4BO3A 1U2GA 2H6EA 4U8GA 3P2YA 4W6ZA 3ZWAA 3INGA 2FWMX 3FNFA 1IOLA 5A3VA 1ZXBA 4PG6A 4BO0A 4E3ZA 3F46A 1T25A 1O95A 4MIEA 3IOYA 2AMFA 2PD6A 4BO6A 3AY7A 4GSKA 4W9NC 2NWQA 2DUWA 1D3AA 2VWPA 1Z6ZA 5KKAA 2QIOA 1PS0A 2PR2A 3GGGA 1T26A 1JWAB 1H9AA 4XD2A 3JQAD 5CDYA 1VKNA 5L4NA 3FNHA 4XJSA 3AK4A 4BB5A 4BNFA 2IZ0A 2QYSA 4TRNA 2X5JO 3GDFA 3VKVA 2X5OA 3KSZO 4CM9D 2G76A 5K9ZA 2W4QA 1Y8QA 2C59A 1ZH8A 2X7HA 4BO8A 4ILKA 3ADOA 2V65A 3ANNA 2QRKA 4TRJA 2VYVA 1LEHA 1GQYA 4BNZA 3PI7A 5DF1A 4K6CA 1PSDA 3CUKA 1I0ZA 1UDBA 2GASA 2HCTA 3DZGA 4CMBA 4YR9A 1ONPA 3OIDA 4CQLB 4AJLA 3W8DA 4ROSA 3ANMA 4KWIA 5JAMA 1N1GA 1BVRA 3M2PA 1QYVA 2ZIZA 2GF2A 2BGMA 2O4UX 3FWNA 2Y67A 4XQ9A 4HFRA 3VZPA 2FRDA 3HN7A 3OA0A 2GN9A 3PYMA 2Q3EA 5G0UA 4YACA 4YPOA 4ND5A 1PJ4A 1CERA 4E0BA 2VNSA 2O7QA 3DOCA 1DDOA 4B7XA 2JD1A 1PQPA 1VSVA 4NK4A 5FYDA 5G0VA 5CP8A 4CJXA 4WEOA 1I2BA 3SBOA 1BXZA 5JAIA 2NUAA 3RBZA 4MO2A 3UFXA 4ZQEA 4BNWA 2DTXA 3FBTA 1PGOA 1WZIA 5JCJD 2HK8A 1H6AA 2GYYA 2CF6A 3NGXA 2Y1CA 1K6IA 1N8KA 3T4EA 2R2GA 4CR7A 1ZK0A 1I3LA 4OSOA 3DHEA 1QORA 3C7CB 5CFZA 1P1KA 4AJ1A 3IUSA 1EDOA 3TZ6A 3O03A 2J3HA 1D7OA 4YJGB 1OMOA 1DC3A 3MJVA 1SEVA 3IKTA 1LRJA 1T2CA 1WNTA 4HKTA 5DCUA 1NVMB 3RAJA 3RJ9A 4U0JA 2Y1GA 4LSWA 2O3UA 2G82A 3GZNA 4K26A 4KQWA 2A9FA 1UP4A 1NPYA 1CQJA 2JHFA 4GBJA 4KTVE 5L4SA 1GY8A 3NT5A 4RCVA 3LDHA 3P5SA 5ICMA 2PV7A 1PJBA 4X54A 3KEQA 3OP4A 5IXSA 4CV0A 2DTDA 1H2BA 3C8MA 4ND2A 4YB8A 1R15A 4BHTA 3NT4A 2Q45A 3TWOA 5G2OA 4TRMA 4Q9NA 3ITKA 4RF2A 1ZUD1 1G0OA 5T67A 1DIGA 1SZJG 3UUWA 3OBBA 1YJQA 1T1RA 3DC2A 5IDYA 3GLQA 4ALIA 2Q46A 2NU7A 4EJ6A 3KYCA 2VYND 2YDYA 3JQBC 3ZHYA 4BVAA 2AA3A 3ZWWA 3PQEA 2R00C 3OICA 4AJEA 4L0QA 4U0KA 1EVJA 1PZHA 1Z74A 3EHEA 1F14A 4NBVA 4GVLA 4E31A 2Y66A 3K30A 1VJ0A 2Q50A 3V8BA 3KETA 4K1LA 4ZRNA 4WLUA 1R12A 5EN4A 1I32A 1WXDA 4RDIA 2C7VA 3Q9NA 3TL2A 4L73A 3WICA 3G17A 3I23A 1VRWA 4S1VA 1V8BA 4R41A 1P0CA 1CIVA 2RH8A 4MPDA 5COAA 3HB4X 1XCBA 3F9IA 3DOJA 1GPJA 4UUOA 4L75A 1H2HA 2I3AA 4M8SA 5CG2A 4IJKA 1VPDA 1X1TA 4RJTA 1V3VA 1ADCA 3KOUA 3LT2A 1U4SA 3RKUA 5B37A 3KYDA 3FSRA 2VRCA 5FI3A 3GVHA 2OHXA 3OIGA 1C0KA 4OOEA 3CPSA 1D1TA 4CQLA 1YBMA 1O0SA 3K9QO 5CAEA 3PVZA 2VWGA 1V0JA 4FQ8A 2I76A 3C3XA 2NQTA 4H16A 4J4TA 3EZLA 5FFFA 4U7WA 5BSGA 1PIWA 3LLSA 3WGYA 1NNUA 4XGNA 2JFHA 3BTUA 3ZH2A 3W1VA 2JFFA 4IDGA 4OL9A 2DKNA 1Y9EA 2Y0DA 2YV3A 4AJIA 3AUTA 3I4CA 4IQGA 4CLHA 4GGPA 3W8EA 5C7IO 4NBWA 4L4RA 5T8KC 5L7WA 3U49A 1ONOA 3DTYA 3ADPA 3W6UA 4PG8A 3JYLA 3R3JA 1NX6A 3WGHA 5BSHA 2V6GA 3U4CA 3WBFA 2EW8A 2JCVA 3T7CA 4AICA 5BQFA 2PH3A 1BW9B 1E1KA 3MZ0A 3L4BC 1ADGA 1MP0A 1KYQA 1PJQA 3EMKA 2Y0EA 1KS9A 3DQPA 5C37A 4BNTA 3RASA 2FPPA 4JK3A 2B69A 2EXXA 4J7XA 4NJOA 3TZKA 5GMOA 2WSBA 2FR8A 2YHUA 4XZ3A 4PGFA 5CG1A 1EK5A 4N5LA 3AUUA 1CDOA 3O9ZA 3WGTA 5A02A 4IS3A 3FNEA 4HV4A 1TB4A 1AXEA 5GY7A 3ETEA 4XR9A 3VZRA 2QZZA 4FJ2A 5JPIA 1HLPA 5LC1A 2VHVA 3RUCA 1EUDA 4KOAA 5DULA 1DIBA 1E6WA 3K73O 2VT2A 1JA9A 3NYWA 3WGGA 1PWXA 2I67A 4A26A 4WCFB 4Q3EA 2ZJ1A 2X1HA 3QWAA 3VPGA 3WLEA 4QFDA 4BV8A 4EZBA 3PGJA 2ZB8A 3K31A 3JCZA 4YRAA 3O26A 3RC1A 3A4VA 2WD8A 3TNLA 3GUYA 2HAEA 3EDMA 3G49A 3UVEA 9LDTA 5JSFA 3MJ4A 1RM0A 3AM4A 5COQA 1MV8A 3VH4A 1NVTA 4YJDA 1H9BA 4BO2A 3JD3A 1PR3A 5JYEA 4URFA 3WXBA 3U5TA 3VH1A 2F00A 2VTDA 1X15A 1XIVA 1UXGA 1M2WA 5CDUA 1ZIDA 1KEPA 4BNVA 3QLJA 4HXYA 3AI3A 3PHHA 3H7AA 3ABIA 4DPMA 2PK3A 1PQUA 3VC7A 4DGSA 2C29D 3H3JA 3MOIA 3WQRA 4NDNE 2NSDA 2EEZA 5MDHA 3HUDA 4D7AA 2I66A 1P9LA 1MGOA 3HE3A 3GG9A 4HFJA 3R6DA 4RO0A 2NU8A 1K6XA 3ASUA 4JXKA 3ROQA 2WEKA 2YUTA 2DQ4A 3PEFA 4DLLA 3NAQA 3CEAA 2Q1TA 3G1UA 4EJMA 1D1SA 2ZTLA 3I83A 4I9UA 2ZB4A 3DAFA 4IZIA 4ZD6A 2EG9A 1U1IA 1I3MA 4EI2A 1AGNA 3PIDA 4UVHA 1ZSVA 4YWJA 1DEHA 3A28A 1SPXA 3DBRA 3WJ7A 3ZV5A 4D46A 4NFHA 4DIOA 4AJPA 1Y81A 1VL8A 3KO8A 1SEPA 1GQQA 4LCJA 4QFCA 5K6AA 2BHLA 1YWGO 4GKBA 5DZSA 2GUGA 4WCFA 4FFPA 3RFTA 2WDZA 4E2ZA 1A9YA 4A73A 2LDXA 1WMBA 4YBZA 4DIFA 1DSSG 2VWQA 3H3FA 5IF3A 5TQVA 3GRKA 2RAFA 4EBFA 3JQ8B 4CV1A 3S2IA 3TN7A 1E5QA 4QO8A 1YB4A 2O7SA 3I5MA 4HX5A 4OIMA 5ILOA 2E49A 2GRAA 1A4UA 3UCFA 1IZ0A 2JKVA 3E18A 3WNQA 1EBFA 2O3JA 2X86A 2A4KA 2HU2A 1LLCA 4YAJA 3WBBA 1YQXA 3F3SA 8ADHA 3Q9UA 1JW9B 4RVHA 3KYCB 5KNLA 5DCWA 1QRRA 3I6QA 3OEYA 3PQDA 4PLVA 1E7RA 3ZU5A 4BNNA 4OXNA 3GRPA 3F5QA 2IZZA 1YJ8A 1FF9A 2BMAA 2FR1A 1KEVA 3G1TA 4MINA 3D4PA 3KEOA 2DBVO 3U4IA 4JGBA 3FBGA 1CYDA 2AQIA 2GD1O 4OXKA 4CLXA 3ZWCA 3HFGA 2JJYA 2VHYA 1U2DA 3DL2A 1P1IA 1AXGA 3ZDFA 2NVWA 4CMIB 2PY6A 5JDCC 2DVMA 3CIFA 4ITUA 5FI5A 3HN2A 1UXIA 4DBZA 2JCYA 4J9UE 4DLBA 1CWUA 2OZPA 1VJTA 3U4HA 4W4TA 2Q2WA 1SCUA 2W90A 1JKIA 1UZLA 1MFPA 4A2CA 4KDFA 4CM4B 4E4YA 4JBGA 4P4NA 3ASVA 1Q0HA 1ADFA 1ISFA 5MGBA 4BO7A 3E9NA 3VH3A 3GH3A 1T2DA 4CLRA 1XQ1A 2GN8A 3RIHA 5KWEA 2XF8A 4Z0TA 1FDWA 4NBTA 1SBYA 3V1YA 5A9TA 4Q3BA 1NYTA 1RYEA 3SXPA 2CDBA 3ICPA 1QLJA 4BS9A 1C1DA 3GN1A 3IMFA 4NBUA 1LUAA 2WD7B 4PLWA 1FDVA 3DMYA 3KB6A 2RHRA 1U4OA 2Y68A 4LCEA 4JLWA 3X2FA 1GUYA 2HK7A 3PJGA 2RIRA 2HMTA 2HLPA 4M49A 1NBOA 1ONNA 5I7VA 1U5CA 3QWHA 4OSPA 5L53A 3DBLB 3RD5A 1EZ4A 1KEUA 5CHEA 1H93A 1Y8RB 1E1NA 4NNJA 4Y6SA 1P74A 4R54A 2DFVA 4CMJA 3B1FA 3KM0A 3MJEA 3BA1A 4G2NA 1YOVB 5L4LA 4Y6PA 4B3IA 3INRA 1P45A 4NJMA 2IDZA 1KEWA 2OBNA 2QZ9A 3E03A 3PLNA 3LC2O 3SC6A 1GZ3A 3HNPA 3KSUA 1WDLA 2HUNA 3I6IA 1MG0A 3V5NA 4AJHA 4IJWA 5JY6A 4ZJUA 2EJWA 2BKAA 2GZ1A 1Y8QB 4BNUA 1OC4A 2FOIA 1ISJA 3HDQA 4O5OA 5KJFA 3L07A 3ITDA 4MIYA 2NTNA 3GQVA 4K6FA 2DC1A 3AOEC 4DPLA 1GUFA 1HLDA 3RC9A 2HMSA 2POQX 1E5LA 3Q1LA 4HFNA 1BMDA 3PXXA 1BDBA 1YQGA 4GL4A 1VSUA 4XQEA 4FIZA 4RVFA 1P77A 2CNBA 4QXMA 5ES3A 3WMWA 5DOZA 4YAIA 3JQ7B 3MWDB 2HKIA 4HNHA 1O9BA 1V35A 5AQ1A 3LC7O 3KLMX 4EUHA 1GPDG 3STHA 1Z7BA 3LU1A 1EK6A 4YYZA 2YQ4A 1T24A 1GEEA 4Y6RA 3FHLA 4JJFA 2E4AA 2W2LD 1Q2XA 1U28A 2B83A 3WIEA 3M2TA 2Q4BA 4YRBA 3HG7A 5A06A 2DU8A 4JBIA 4OQYA 4BQRA 3QV1A 1F0YA 1NQAO 2R00A 1IY8A 4FFLA 3FD8A 1HDGO 2YV2A 3TOZA 1UAGA 3KXDA 3U4DA 5ADHA 2X0RA 4MVJP 4NFYA 5DN9A 1I30A 3GF4A 3D4OA 3FWZA 3CSDA 5C3MA 5JNLA 3L6EA 4NHEA 2PA3A 4Q3AA 5JLAA 5L95A 1TI7A 2ZK7A 3IKVA 2AE1A 1PJ2A 2WM3A 1T2EA 4O1MA 4PZCA 2Q4EA 1YDWA 4RPGA 1B14A 4LRSB 4LW8A 5B12A 4BNMA 3MCVA 1I01A 2UAGA 2EHDA 1AE1A 4IXTA 2VRCD 1PWZA 1QLHA 5EL0A 3DEYX 3RVDA 4M55A 3NDJA 4RVDA 3GVPA 4BMNA 2B4QA 1ZK1A 3VPXA 1P44A 1XR3A 2IXAA 1KVQA 1HXHA 3H9JA 4WKGA 4HP8A 4PLGA 3AFNA 1GZ4A 4A7PA 1YB5A 5CPBA 2O2YA 3ZCXA 2E6UX 3H2SA 3WQSB 5EIOA 5KVCA 3NV9A 3RFVA 4XRGA 4RLHA 2H63A 4RDHA 3WJAA 4GMFA 4NH4A 4F6LA 2GN6A 3DDNA 1X7HA 1BGVA 4MP3A 3VTFA 3IP1A 5JXWA 4MP6A 1O8CA 4I5EA 5DBFA 3D5TA 1YL6A 3RC7A 4I08A 5BSFA 1ZK4A 2PKQP 4J0FA 3UGKA 5TLSA 1DJNA 1E7WA 2NLOA 3JQAB 2AQ8A 1GV1A 1UXJA 4CLRB 1CETA 3ICCA 4WGGA 4B7CA 1TXGA 1OZAA 2X0JA 4DYDA 3GG2A 1IPFA 3L4SO 3VOSA 4B4VA 3DFUA 2PZMA 5KKCA 4CM4A 1LDNA 2FPGA 2HO5A 1DC6A 3JQGB 4YJHA 1JU9A 1UZNA 2JAHA 2ZJ0A 3GY0A 3GK3A 1Z45A 1VL0A 4WOJA 5G4KB 4BB6A 5J23A 2WYWA 3I9NA 5JDIC 2UV8A 2Q2VA 1LSJA 2FZWA 1HSOA 1B3RA 4N5MA 3QWBA 5GZ6A 1ENYA 4AG3A 5KCZA 1TT5B 2ZCUA 4PG5A 1F17A 5I9MA 1EEHA 2HJSA 3JYNA 3H5NA 4ALLA 1O89A 1B0AA 2V6FA 4Z9FA 3ANLA 1ENPA 3BAZA 4RVSA 2J6IA 4LRTB 2F1KA 3BMNA 1W8DA 5TT1A 1ISIA 4O6VA 4ZQHA 2WE8A 2OXIA 1ZEJA 3UOGA 3SEFA 1LXCA 3A1NA 4YJFA 4R69A 2VYNA 1H6CA 4BNXA 3BTVA 4DA9A 3K2EA 5BNFA 1QV6A 3M1AA 2O3QA 5F5NA 5ER9A 1PL8A 5TSDA 4LMPA 4RL6A 3K2BA 5TX7A 4L8VA 2P91A 3RUIA 1ML3A 1FDSA 3I4FA 3NGLA 3PHIA 3ROPA 2FMUA 3ZV4A 1XGKA 3B1KA 4C7JA 3MJCA 1GZ6A 3P2OA 2QRLA 4CLDA 1ZBQA 1R37A 2VUTA 4XYBA 3TOXA 2Y1DA 4MVJI 2QG4A 1LDBA 1M6WA 1Q7BA 4O59O 2PWZA 2W8ZA 1VC2A 1MLDA 1GTMA 3FPLA 2BFAA 4UUMA 2O3SA 4GWKA 3I9JA 5F3RA 3ROKA 3U09A 1LQUA 1I33A 2EP5A 4W7HA 5C5IA 3JQAA 4IIVA 3QP9A 3TRIA 1LJ8A 3L6OO 4HUJA 3ZHXA 3VVBA 1JTVA 1ADBA 1IYZA 2YQ5A 1CF2O 1BW9A 3BTOA 2J5QA 3QVOA 3IDSA 2PKQO 2VZ8A 4ZHSA 3FRJA 4ZICA 3TPCA 5AXDA 1DIRA 3MTGA 3UKOA 3RI3A 1FXSA 1NXQA 1HDOA 2EP7A 3IUPA 1NPDA 2EERA 4RVUA 3PIIA 4WLOA 2P5UA 1BHSA 4ZQGA 1E1LA 4IIUA 3Q6IA 2JD0A 1DRWA 1MA0A 3NX4A 1MUUA 1JKJA 3GC6A 1ENZA 4L4XA 1U3VA 4MIOA 4Z9XA 5KJ1A 4MVJE 4TKMA 3WGIA 3GVIA 2Q1UA 4R1TA 4DVJA 3TZQA 3WLFA 3IC5A 1UJMA 1CJCA 3ZWNA 3MJTA 3F4BA 4JIGA 4W82A 1UXKA 4Z3KA 1S6YA 4E5PA 1DRVA 1YH3A 1IULA 3BMOB 2EV9A 4WECA 3H5RA 4J43A 3UN1A 3JQFA 5EERA 2UUOA 2FR0A 2B5WA 3KYDB 4XX0A 4F46A 2WYUA 1P1RA 3BHJA 2Q49A 1K2WA 2YZ7A 1H5QA 1X13A 4JJIA 4U6QA 3AU9A 2HJRA 2EKPA 2IEBA 2UYYA 4JCOA 1EVYA 4LMRA 5ICSA 3DR3A 2DUUA 3RUDA 2BLLA 2BI7A 3P19A 1DPGA 4Z9YA 4HBGA 1X7DA 3A9WA 1E6EA 2EF1A 4E6PA 1YBAA 1B2LA 3VVCA 4I5GA 4G65A 5IZ4A 1P31A 4PLTA 5JCXA 4KQXA 4ZRMA 1N9GB 5I8WA 4YAEA 4OH1A 1U3UA 3JQ6A 1Q7CA 2B35A 1BTOA 3QVWA 4XQCA 1LC3A 1PGPA 1SO8A 4CM8B 2VHWA 1HZJA 3R3SA 4IUYA 3HDHA 2Z5LA 1DJQA 3OJEA 1QXSA 1H6BA 1R0LA 2GGSA 3BZUA 4AJJA 4FN4A 1ZCJA 3SJ7A 4OQZA 1ZJZA 4MKZA 4J1SA 2RCYA 3Q11A 4R51A 4YAKA 2PZKA 5KJ6A 1EUCA 3UH1A 1TT7A 4OHUA 1HYEA 1EQ2A 5C7OO 4MVJA 5HWSA 3U62A 5EPOA 2CVOA 3G79A 1AHHA 2I6TA 4BV9A 1N7HA 5JAQA 3GAZA 4BNIA 1YRLA 1FMCA 1NAHA 4YEDA 1N1EA 3Q2IA 1MFZA 1PJTA 4J91A 3BHIA 1Y1PA 3R0IA 2P2SA 1HE5A 1U3WA 2AEMA 2GZ2A 3ETGA 3OMLA 3VDRA 4AFNA 1A27A 1I2ZA 1N2SA 2VQ3A 3ZWPA 2FHSA 1NM5A 4CPDA 4PLPA 4R9RA 2QRJA 4YJGA 4XYMA 3ENKA 4EEZA 1PGNA 4IQ0A 5TC4A 2C07A 1Z73A 2CVZA 3ZGYA 2DFDA 4ND1A 2CZCA 1B16A 1XHLA 2OFPA 3NRCA 2OL4A 3EZYA 3ZW9A 3M1LA 4OXYA 4CM3A 2WYVA 4BNGA 1PX0A 4XB2A 4D41A 4IY1A 4WNCA 4FFMA 5KJCA 2P4HX 5L7YA 1WZEA 3OM9A 4IINA 3H65A 3K5PA 4KWHA 4M87A 5GZ3A 1FK8A 4CR6A 1HZZA 4CR8A 3JD4A 2QQ5A 3GHHA 4N5NA 1F8FA 4P38A 1ARZA 1BXKA 2CMDA 3I1JA 3I52A 5ENDA 4B4WA 1A4IA 4EJ0A 4E12A 3UICA 4J7CA 3ONEA 3HSKA 4NU5A 1G1AA 2AG8A 1GU7A 1S7CA 2NV6A 5K0ZA 4Q3CA 1XWFA 2WD7A 5L9AA 1CEQA 4YT8A 3HWRA 4IDBA 3SC4A 2HSDA 4A10A 1T2FA 4M54A 1LQTA 2NTVA 1XYGA 4WNIA 3DAGA 4E33A 5JE8A 5C7LO 2OBYA 2HK9A 3W4IA 2B4TO 5KVSA 4AJKA 1UP7A 3WX0A 3TZCA 1I3NA 3RBVA 2EGGA 2Y1FA 2A94A 2CFCA 5ER6A 4Z6KA 2PD3A 2OP0A 3E48A 5JDIA 4OKNA 2X8LA 2PH5A 3C1TA 4NFSA 1JVBA 4BO1A 3D0OA 2ILTA 2VZ0A 4Z3DA 5L7TA 3PZBA 3PPIA 4J4BA 1KY5A 4RLSA 3TFOA 2P9GA 1TVEA 3AM5A 4XJTA 1DIAA 4CMIA 1NASA 4PLFA 1MG5A 5JAZA 1ZVMA 2V6MA 4AJOA 1RM4A 2WMDA 1VE9A 4DQVA 3FNGA 4GX0A 1PJLA 3KV3O 1GUZA 5KTKA 4A5OA 3QWIA 3QSGA 3E9QA 3CH6A 3FR8A 5B4UA 2VNAA 1RJWA 2XXBA 1X0XA 4RV9A 4WCFC 2HRZA 5T8KA 2P9EA 4OO3A 1E3EA 1LLDA 1A9ZA 4M89A 4D79A 1HT0A 3DFZA 2ZATA 2BH9A 1I8TA 3F47A 1Y9AA 3AW9A 5JC1A 5HS6A 3WMXA 1NFFA 3QE3A 3WG9A 1V9LA 5LDGA 1WLYA 4KDEA 1XG5A 5ILGA 2BELA 2GSDA 2NQ8A 3Q2KA 4CL8A 5JMWA 3ZU4A 1X14A 1PR9A 1N9GA 3DOOA 2J3IA 1HDCA 2H1SA 4DC1A 2AQKA 3WFJA 2X0IA 3DZJA 2PFGA 3C7AA 4ALMA 4ZN6A 3JQ8A 2QHXA 2RBEA 3IL2A 4PVDA 1R0SA 1P1JA 3LSYA 2WTBA 4PCVA 1K5HA 1LA2A 1V3TA 5TIIA 4O0LA 3GFGA 4RPLA 1JVSA 3DZKA 2GN4A 1ZXLA 3PK0A 1VL6A 5EJ2A 3WIDA 1O94A 1P1FA 3GUCA 3WQQA 1E3WB 4R1NA 1V3UA 1ZMOA 4F6CA 5GZ1A 3IIEA 2X0NA 4FFNA 4XYEA 4OKIA 3KYBA 3ZNPA 4RF3A 3BMCB 2VCYA 1Y5MA 2B36A 4XDZA 5DCYA 4FDAA 1EVZA 5JFOA 1LU9A 1MXFA 3JQ9A 4P4LA 3JV7A 5TT0A 1J4AA 3I9OA 4PLHA 4BO4A 1HE4A 2RH4A 3ZNNA 3RWBA 4MDHA 4R5MA 3KLPX 4FGSA 3PTZA 5DOVA 3N7UA 1LRKA 4B79A 1BWSA 3MTJA 1ZW1A 5IG2A 4E5YA 1NVGA 2O3TA 3AY3A 5COBA 3NJ8A 1IL0A 3ZHZA 4CMCA 1HE2A 3BXXA 1WVGA 2IRWA 3GPIA 1HRDA 3O38A 3GVXA 3N58A 3QWFA 3OA2A 4JJGA 1W73A 4GQAA 1J49A 1GYRA 4LN1A 2I5PO 4A03A 1KIFA 1F8GA 1J6UA 2BGLA 4R9SA 1XDWA 1LSOA 1XQ6A 2Y1OA 4NZ9A 3TFQA 1BXGA 3TDKA 5ENVA 1IPEA 1KC3A 3EYWA 1GDHA 4QQRA 3ZNQA 1M66A 5IAAA 1SOVA 5CDGA 5FEUA 2V7PA 4XDYA 4CQMA 5ITVA 4K9DA 4EYEA 3WS7A 5BT9A 2EWMA 1HEUA 1PEDA 3DBHA 1DIHA 4FR5A 2E37A 2X4GA 1DHRA 2Y1EA 2UUPA 4N7RA 3AM3A 1LDYA 4CMAA 5EMHA 4BOYA 3E1KA 5A5EA 4E2WA 5B4TA 3QVXA 1BVUA 4PRLA 3FPCA 4GGOA 2ZYAA 2PZLA 4LSMA 3AI2A 1PS8A 2ZQZA 1TT5A 2D5CA 4IGFA 3U0BA 1GQ2A 4HADA 3DWFA 3IJPA 2NVUB 2CD9A 4DPKA 3EVNA 4IPTA 2C82A 3GEMA 2Z1NA 3B6ZA 1Z82A 3M6IA 4PFJA 2NVUA 1T4DA 1G6KA 1NFQA 3GEGA 4CM1A 5A03A 5AXBA 2QW8A 2CSUA 1YL5A 2Y99A 3JQGA 4YJHB 5U4QA 3RUAA 3HQ4O 1C0IA 4FW8A 3KRTA 3DXFA 4FPXA 3S55A 3ULKA 1H6DA 3PWSA 4XYLA 1NWHA 1PZGA 3DZIA 4YJFB 5L3ZA 1JN0A 1Y7TA 1DC5A 3KVOA 5DDIP 4II2A 5DNAA 3ONDA 2W2KA 1U9JA 1E0DA 3LZ6A 4GX1A 4JX8A 1YBVA 2IYOA 4ALKA 2HDHA 4IDAA 3ZWBA 4RF5A 4RGBA 3BHMA 4M86A 4DMLA 1DHTA 4CQMD 3JD1A 5H82A 2ZKLA 2JAPA 1DLJA 3IQDB 4GWGA 2PGDA 1HF3A 2G17A 4WLFA 4UREA 2GDZA 5AXCA 4BKRA 5AXAA 1TEHA 2FY8A 2VHXA 2X9GA 5LCXA 1VI2A 4IBOA 4FSHA 3ZWYA 2WWRA 3LK7A 5HM8A 5IN5A 3NKLA 3A06A 4D3DA 1LTHR 1W6UA 4ND4A 2C0CA 4OYRA 1U7HA 3GHYA 3WYEA 4DC0A 5KVVA 5G4KA 1IHYA 3ZU3A 3TL3A 4F3YA 1ISMA 3WSVA 2BFOA 4DUPA 4YDRA 2DTEA 3BTSA 4CL3A 4GSLA 3LT0A 1P3DA 3E9MA 4O63O 4XWYA 3L9WA 4JROA 1GYQA 2Q2QA 4XA8A 1IZ9A 1TA4A 3RC2A 1R4NA 2W2LA 3OQBA 1HDRA 3H2ZA 3GMDA 1I5RA 4YTEA 3C1AA 3BMCA 4MVJH 3RU9A 4GI2A 5JW6A 3K6JA 3WGQA 1UR5A 4CMGA 1BDMA 1E1MA 2O4CA 1E3WA 2G0TA 3OEWA 3TZHA 3VPFA 3HDJA 5CEJA 2DBQA 5TJ9A 5T64A 4RPJA 4INAA 1P0FA 3VKUA 3ZI0A 4PIVA 5AOVA 2I65A 4MP8A 3BMQB 3D7LA 1EMDA 1YONA 2EW2A 1GAEO 2CDAA 2FZEA 1U5AA 1PGQA 4OAQA 4PLZA 3DHNA 4NBRA 1P33A 2BF7A 2OP1A 2D0IA 5BNIA 2EGHA 1X1EA 3PJFA 1LLUA 3D3WA
chains in the Genus database with same CATH superfamily
4TZ0A 3CNQS 5U9CA 1F5SA 1KU6A 1AMNA 4L8YA 3K72B 4KC0A 2IEAA 1PBNA 4WY2A 4F0JA 3JQEA 3TD6A 3UA3A 2IZ1A 3VQTA 1SXHA 4OQPA 2REXB 4MDFA 3JYHA 5NLLA 4Z4EA 1D04A 5E7MA 4TSFD 5TGDA 2NGRA 4NMMA 1IB0A 4MV1A 5DXAA 821PA 5BSMA 1XRMA 4JYBA 4DXAA 1SXJD 2ZPUA 3M49A 1G21E 5LQAA 5EQFA 4DR2B 3FDXA 2WG1A 3DEHA 5KHLB 1AK9A 4ZVUA 3AJAA 4IMPA 2X0DA 4KVFA 4C08A 1DOHA 1UDCA 2AVNA 2H1FA 3QLUA 4NEGA 5HA5A 2DQKA 3KD3A 4W1QA 1Q50A 1E3LA 1Z34A 3D7SA 3KDSE 3NDPA 4ND8B 4WNYA 4B7UA 4AJ2A 3MBOA 1N57A 4OMUA 2G1KA 1L9KA 4E7OA 5JASA 4EPWA 3AUYA 4L5IA 2E18A 1G7SA 4KAAA 4KMRA 1NI3A 3SI7A 4AUNA 2IU4A 2JFYA 3DE0X 5H80A 1M6HA 5B7GA 1A7AA 5AFSA 5H02A 3F5MA 1RRMA 3OFSA 2YYAA 2F64A 2FZ5A 3LW7A 1C7JA 4J16C 5AOCA 3PENA 5HCIA 3T1QA 1MJGA 3R0ZA 1A9XB 1MOZA 3RVKA 1LPOA 5JTUA 2WJAA 3M1YA 3UXYA 2FJPA 2IDJA 1XMQB 3OCJA 3AWDA 4AWXA 3JQ7A 3MWDA 3JQCA 4TWZA 1UEXC 2ZYHA 2V3CC 1IXZA 1ECFA 3K8ZA 2XDWA 5EZQA 1G3IA 3EOBI 6GPBA 3N5CA 1JFFB 1TYEB 1O96A 2OFXA 2QN3A 4N0QA 5DMXA 2G5PA 2OQVA 3LQFA 3LECA 3NTUA 3OPYA 3OOSA 3V7WA 1DEOA 4RL4A 1YR9A 4FS3A 4I99A 3T1NA 1P9NA 3NVDA 3WAGA 1KJIA 2RB4A 4MMZB 1MX3A 2JFGA 1QDEA 4EVRA 1AQ6A 1QGED 1TCUA 1PQ4A 5B2ZA 5B2FA 1K6MA 3THSA 1BYIA 3CLKA 5K3AA 1TYZA 3OQ1A 4JCCA 2W43A 5KAMA 1N1MA 4RPCA 3ZE9A 5LU8A 3TR5A 1U98A 1PUIA 1Y6JA 2YMLA 1IOZA 3AVPA 4FUTA 3H11B 4P0PB 2VN8A 3C85A 4Q7LA 3S29A 2JI7A 2Y05A 3U2QA 2DR3A 4C89A 3W05A 1CJVC 2G88A 1JG3A 1BD4A 4EX7A 4QDJA 4TYQA 3P27A 5DGTA 3RS7A 4PHGA 4REQA 4EHDA 5JATA 3ZZTA 2LP4Y 2VUSA 1VPTA 3HU1A 4MS4A 4X6UA 4F72A 2CV2A 3PJRA 1OIWA 2A4MA 5TXGA 5CA0B 4K2HA 1PS9A 2Z6VA 3I92A 3KYIB 4UTRA 1TJNA 4XKJA 1ORWA 5GWXA 2ECQA 2R84A 3NJ4A 3CPEA 5ESRA 6REQB 1PK8A 1LBHA 2OYCA 1CUXA 5I7SA 2Q6OA 1Z18A 2NPOA 2WG0A 4M3NA 3C7DB 3L9XA 3RSZA 3RWMB 2JLYA 3WO1A 3VYRB 2LZ0A 1GYPA 2VAXA 3QPUA 1ZZEA 1LX6A 5CVEA 5DM0A 4YAGA 4ZCMA 1XWWA 5CK4A 4WK0B 2YZNA 3D6NB 4M7OA 4AJ4A 4Y9TA 5LOVB 4BRSA 2BHSA 3I8SA 4E7PA 4GPD1 1YACA 4F11A 4X8MA 3OLWA 4AIIA 4N5IX 4KGXA 1N75A 2C2YA 3HCAA 1Z25A 3OCCA 4G5GA 2HMYB 4IDOA 2QLTA 2BGNA 2V7QA 2YHIB 4OMFG 4DC9A 5IJ9B 5IJZA 5JY1A 1RZ3A 1ISPA 1XDGA 2O2GA 3CEHA 4NCHA 5HRAA 4QDXA 4BFYA 3CINA 4LJRA 1TVKA 1DQRA 1EZZA 3AR5A 5IAEA 2PKRA 4NAHA 4JJ4A 3RTBA 3FYUC 4BVHA 4FI3F 2BHTA 3PPVA 1AN0A 5C1IA 1WDWB 2AJCA 3UC9A 2GD0A 1CQXA 2L18A 1GRVA 4RMGA 3RSFA 4P80A 1U2ZA 2GPAA 2X5KO 3AHHA 3HYRA 4ZCLA 4D3SA 5DIFA 1ZUNA 3FPSA 3I9LA 5KOHB 1U2SA 4B83A 3FHCB 5A5VA 2H16A 1M8GA 1J5PA 1Z6XA 1L5NA 1HNNA 3UAWA 4FMDF 4WLEA 1DCTA 3UWOA 1W0JA 3CLTC 5DHAA 3ND5A 1UBSB 3UB3A 1J2UA 3E5HA 2R8ZA 1G5TA 3URKA 2XOXA 4CG1A 1P1HA 1FRZA 2VKTA 5CVTA 1YBHA 3GT7A 2QORA 3RBXA 5LBIA 4D9NA 4HYYA 2JH9A 1JXAA 1JLMA 2VSXA 3F96A 5JDCA 4LF4B 1M74A 4Z0PA 4AY5A 1XAIA 4RGQA 4HATA 3SYTA 4EVSA 1EP9A 3TF5A 2D8AA 1CS0B 1OI2A 3QVLA 2AN1A 3A6LA 4URWR 5HTOA 2UVQA 3ZGXA 1B8PA 3O8DA 2Q99A 2DBYA 3PHLA 5FAXA 3T12A 3VHXB 2PUHA 2W4MA 2C4WA 3H13A 1D1QA 1BHO1 3BFXA 4R1UA 1QJ4A 3R9KA 2B98A 4D9GA 5IFLA 3CB2A 3QPVA 1XDZA 3JWHA 3OSUA 1F5NA 1W0CA 1I2CA 1JE0A 4XVUA 5FWXB 3EVTA 1NT4A 1M6NA 2VUUA 3L0CA 4L74A 4MDYA 4TWRA 3I09A 1JXOA 4D82A 4EQ6B 1ULTA 4KUEA 4AZ3A 2FKNA 3F1KA 1M8FA 3AESB 4KRXA 4OOFA 3GEIA 5DTIA 2RBGA 4H3HB 3VAZA 3I0ZA 5BNWA 4V0NA 4V0ME 3DT8A 3KTDA 1SB8A 3F6EX 2O6LA 4YT5A 2FW7A 1V5GA 1P5JA 3UXEA 1Z7GA 1ZU4A 2H31A 1XZDA 3IDAA 1WXXA 1W46A 1IEWA 1KI9A 2V4UA 4QX6A 2X9LA 2ACKA 3NC1C 5KNBH 2EIXA 4QQFA 2RGNA 4Y6QA 5AUQA 4ECEA 1LW6E 2HA7A 1U3TA 2WB4A 3OMWA 1T9DA 4KZPA 3DWEX 5FUQA 1WP4A 4DCNA 1PI3A 3MMPA 2J3LA 1PNOA 3LT1A 5IKXA 3NFRA 4B3CA 4WADA 3MB8A 4DQUA 3T9FA 3H86A 1I7SB 5TMPA 1RLJA 2X19A 4YRMA 4E21A 5ALXA 1J97A 1DBVO 1LTKA 2Q8NA 4EZIA 2IDKA 2NPFA 3L2OB 3PF9A 4CKYA 2OAP1 3OZIA 2ZREA 4NK5A 4Y1RA 4DCVA 3LXMA 4UOQA 5EKDA 5JNUA 1NOKA 1XN1A 2HTEA 4BVKA 1L1FA 3WE7A 4BEVA 4DXDA 1PFUA 4JI2B 3IO3A 1HSZA 1NRIA 4NE7A 1GR0A 4GZ5A 4IXMA 5I47A 3LLCA 3UF0A 1OI7A 1XNHA 4TLLB 1W29A 1I1HA 2ZP1A 4W5TA 1P1BA 2CXUA 3PFNA 2XMRA 3CGWA 2XRMA 5B4VA 1ML4A 1NZDA 4G9BA 5C5CA 1L7OA 4C30A 1XMVA 3RS0A 4CIWA 1M76A 3H8VA 3LYLA 4JVSB 5DX1A 1AURA 4CYMA 1JG6A 3JTMA 1T2AA 4WDRA 5C32A 5FF9A 4DQDA 5FBKA 4BLQA 3JD0A 4JI8B 3OZCA 2BRUA 4BGIA 4AI6A 1WSWA 1WF3A 2PKXA 2YYSA 1VHJA 3I9MA 1CC1S 3L8EA 2P3LA 1GKIA 4KTTE 5B30A 3D3EA 1WSBA 2RFLA 3JALA 1DBWA 3OZWA 4O4IF 4Y0AA 1BSVA 5CT5A 5DM2A 2PMKA 1UBOS 4NYIQ 1NPTO 3MYRA 4H7HA 2IE0A 3V3TA 3WA6A 4JP3A 4JBLA 1RM5A 1DCFA 2YY7A 3N6VA 4YUVA 3FUUA 3EPLA 4JKYA 1XA4A 3Q5DA 2Q1SA 3WI7A 5IBPA 2P77A 3SJAA 4L78A 2EDCA 3O75A 4IMRA 1XEFA 2FUG1 3INNA 1Y3HA 2I7XA 3JYPA 3WLHA 1OWPA 5HBRA 5IHXA 4CKBA 2XCRB 1E2DA 4IXDA 3QE9Y 3D64A 1XT6A 4AS1A 3U37A 3TINA 3V46A 2GEBA 1L8AA 4G9EA 4OP1A 2Z6AA 1M1UA 1YU9A 3LSTA 4GRIA 2Y76A 1E3SA 4B6QA 1WBJB 2QAIA 4LC1A 1YL7A 3HBFA 4JGGA 3FTDA 5JXHA 1OA1A 2YHAA 3IPCA 1QGDA 4JT9A 4JV5B 3GT0A 3BWXA 2XYQA 3BYZA 2UXCB 3CLUC 3B9RA 2C2OA 3Q7TA 4TL9A 5I9LA 4HNUA 2ZIFA 4UULA 1VIAA 2C9CA 2OHOA 3PS9A 4CIVA 4UFPA 1O08A 1WMSA 5C31A 2QQ0A 1QH1B 5DASA 1BOOA 3U3XA 4D96A 2QB5A 2RAVA 3BJIC 3KUXA 3R0JA 3RO7A 5LYJF 5F73A 4WEQA 1UJCA 3KU1A 1RPJA 2GHTA 3JQ9C 3R3WA 2H2DA 4MRAA 3BH7A 4F9GA 3DFIA 4KIUA 2PL1A 1KVRA 5EP4A 3SQNA 4H6XA 2GFIA 1UMKA 1ATZA 4LYYA 1A95A 4IRUB 3WOHA 5JZMA 1C9DB 1USWA 2CHEA 2FOXA 3DT6A 3UT6A 5E4TA 4UUPA 1OI4A 4Z7NB 2OOKA 3T15A 1SKQA 3EY4A 5CCBA 4QRHA 3K0SA 2CDCA 3FR7A 3MD9A 1ESNA 1GD1O 1BX0A 5L45A 2XXAB 4FFBA 1DAPA 1WUJS 3CKYA 4UNQA 1YRWA 5HR5A 1D8AA 3ETNA 2DLDA 3V3KA 5TS3A 2QTCA 4M9SA 4EYOA 4H6WA 3ZWQA 1DLIA 4CM7A 2GESA 4FGWA 4ZVRA 1PDWA 1VPVA 2J5BA 5FA6A 4Q3DA 3OJ0A 5IC6A 1G3QA 2TRSB 1K6JA 1K8XB 2EJTA 4JXJA 1B7GO 5JJ5A 1B6TA 2HQRA 1Q0UA 2WIGA 5C1BA 4JBHA 1R74A 4GI5A 1IHUA 3IDFA 2IVFA 3BFKA 1Z5PA 4EEXA 5AM3A 1EFHA 2ZTHA 2E4ZA 1KYVA 2VXYA 3ZLUA 2J3KA 1BRTA 2IZ7A 2J6BA 3DUFA 3H97A 1TJ4A 3SKYA 1E7MA 2RK4A 1VBFA 2H7VA 1KSFX 3IR7A 1P5FA 3TEMA 3TQQA 3OOYA 4NABA 2JAOA 3KWJA 4DNQA 2VPIA 2QPAA 1N7JA 5C80A 4CM9A 1TAHA 1PG5A 2RKOA 3E3AA 3W5CA 4KN9S 4EFMA 4EQ6A 5L51A 5EJ7A 2M2IA 2VK4A 2OHJA 2WNSA 5MN6A 2Q4OA 1Y4ZA 5DLQC 1R0YA 4BNKA 4O4LA 1KJZA 4K0RA 3V4RA 2GO7A 1K68A 1I6LA 1R5JA 2BEVB 4BZZA 3SICE 3QJ5A 3W4KA 4MROA 3T3NA 1SXIA 2AZTA 2IYSA 3IJ5A 1MC4A 4DXHA 1E2NA 1WX1A 1XALA 3DSRA 3GJ8A 2BONA 1K2VN 4S05A 1KO4A 3DONA 3DV2A 4CLEA 4KE7A 5DGHA 5BR7A 1CQJB 3N28A 2ZE7A 4J75A 1URPA 4PYKA 3U81A 4MJLA 1ZK3A 1ZGBA 3S2EA 2WNHA 4FFOA 5L8VA 1GRRA 4WXMA 5JO0A 2DQYA 3IT1A 3MYYA 3S81A 2A84A 2QS9A 3ORSA 1PFVA 1HE8B 3QYJA 3PPXA 3UYKA 4FE4A 1C9YA 4HS9A 4RJLA 2CUKA 1QF6A 3ICWA 1X9IA 3B1JA 1KYWA 1NUQA 3TQFA 1MAWA 3DPSA 3DG9A 3VU9A 4MRPA 4XR4A 4EI8A 3QX9A 1USVA 3FKSD 5CXSA 3NRJA 1TLTA 3WGJA 2GI4A 5CXUA 2BE7A 3AU8A 4UE2A 1YB7A 4E94A 2EX0A 3ZI0A 3GLGA 2GEDA 2NZJA 3PHCA 4OHXA 3M83A 2GBLA 4ZDJA 1VM6A 2QTNA 1UFQA 5F5XA 3PQ7A 1LH0A 1NNI1 1QSGA 2EJBA 3M6WA 4HB0A 1HQCA 4WZAB 4GLLA 3COZA 1TUEA 4N18A 1EKXA 4CTOA 3L0DA 3QE0A 3GLUA 1JAXA 2WA1A 4B4UA 3GIWA 2PGOA 3ORFA 3C1OA 3SJUA 3UM9A 2VS1A 4ER5A 4XVCA 2BE9A 3H2HA 1EXVA 3DMTC 4FD2A 4D2IA 1KPGA 3BXOA 2IIPA 3CS3A 1S8AA 3T5DA 2CT8A 5LBTA 4M6WA 4U7TB 1EGQA 1FMJA 1TLFA 5J4LA 4OHMA 2O8CA 1ZKMA 2YYYA 3JSAA 1E1YA 1IY0A 2JJQA 2N9UA 2E5LB 3NJRA 5EUQB 3GFSA 4XIGS 1TIKA 4G1VA 4AECA 4IS2A 2GHQA 1NLYA 2DB3A 3F1LA 3QLUC 1XEXB 2GZ3A 3FNQA 4H6VA 4IDFA 4J2HA 4TKLA 1BMFD 1JI0A 4G0ZA 4FC7A 4WLNA 5BORA 5E8RA 1Y82A 5EQJB 2CLFB 3NB0A 1NU6A 1OE0A 3L6UA 3ADDA 4WOBA 3L7MA 4UOEA 4HDNB 2H08A 4L6CA 1NVUQ 4CMEC 4KWEA 1C8BA 3CZQA 2F43B 2FPIB 1RYNA 1VJRA 2OB2A 5CYOA 1R6DA 5M3BA 1UOOA 2E4VA 3DLHA 2G5TA 3LK6A 5ALQA 4KBGA 2D59A 4N8EA 3F73A 4KREA 3U13A 3NBYC 4G5QA 4WKBA 5EWLA 5IBCA 3NTOA 2F90A 1IK4A 2IKSA 1NTOA 1R2QA 3AWIA 2AEJA 3NATA 2NUAB 4ENQA 1R18A 1TMKA 2DPGA 3MRSA 4W5JA 1I7NA 4RGYA 3EF0A 5F98A 1Y3BE 1KMQA 3QQPA 3TTVA 4CUZA 3U56A 3A3YA 4OF4A 2X13A 3EEIA 5E6UA 2Q29A 2XAAA 3IERA 3KSRA 3EXFB 3WBJA 2V7BA 3AGQA 1NQTA 2ZIWB 4HWOA 3ELDA 2IU6A 4DV7B 3TLBA 1PJ3A 1ZM4A 4RJIA 1EDZA 3RROA 3OPXA 1DBQA 2PV0A 3MQFA 3H6KA 4C07A 4W5OA 3FYTA 3O90A 2AWNA 1U3CA 5IAOA 3D5QA 3STYA 5BN4A 2P4EA 4LYAA 3UQYS 4ZEXA 4DDTA 4WMLA 3K0CA 4U5QA 1Z7WA 1UAYA 2WT4A 1QB7A 2Q8QA 2WYIA 3H1TA 4DFDA 3M5CA 5EEHA 2RHGB 4TSRA 4AT1A 1NN5A 1NKVA 1G19A 4UXHA 1HKHA 4OGGA 2VDUE 1RBZA 3WHLA 2B5VA 1J5XA 1ENOA 3EUAA 2B2NA 4ND3A 1XQ9A 1E8MA 4AG6A 4P53A 1FDUA 1I36A 1CG6A 1V6CA 2H4JA 3BXGA 4K6OA 4OQDA 3G23A 3AUSA 1XN4A 3DGFC 3OWXA 2AQHA 3ZTWA 4PO3X 4QTZA 3B13B 2NZWA 4O33A 3KUKA 4WUTA 4Y2TA 2XMDA 4YLEA 3CNLA 4B3JA 1U9IA 5EE5B 5IVKA 2XR1A 3ESYA 1SBIA 2VHZA 2WSSA 1NJ5A 1BNCA 2JASA 1XMIA 4GX5A 5SZIA 4CFSA 5FRDA 2OAEA 3FTEA 3NTRA 1Y89A 4J90A 3R44A 4NIMA 2X58A 4TMFA 3EGCA 4U3JA 5HKAA 2XMPA 3ZI7A 3OTOB 2FP4B 3IKJA 4M0EA 4LGCA 1ECJA 4QODA 1RRVA 4NU8X 4IH9A 3I3OA 3HEAA 1NIPA 3HXLA 3F5DA 4I1IA 4ALNA 2B0JA 1CD5A 3O8QB 1VLMA 2IITA 4FYWA 4N7BA 3ZGOA 4DTCA 1KBQA 3ZCVA 2PQMA 2PZJA 4KPUB 1JRLA 4PGGA 1AGRA 3L6DA 4MWDA 4EB3A 5A3JA 1CY2A 4ISCA 5DB4A 3WXMA 3KL2A 1EB9A 1L4YA 1NFRA 4YGYA 4YFVA 5DI3B 1DQPA 1KK1A 1PO7A 3LTEA 4MR8A 3VVMA 4EB0A 4MO9A 1J25A 5B1YA 5F9FA 2WHPB 5AW6A 4P22A 2EFYA 3Q7QA 5JHGB 1VCOA 5AVOA 4H1WA 3LOQA 1XPOA 3P4YA 4JMPA 4MKXA 4YUYA 4B6EA 1X2BA 4GKVA 4OBWA 4PG7A 4Q66C 1JDBC 3GLFE 1IU9A 4MR9B 1BG6A 1TYCA 2PGNA 4H35A 2QBYB 1LDMA 2J9RA 5BSUA 1LX7A 1RC1A 1RHRA 4FKMA 3TLKA 4RMHA 1Q21A 3UOWA 1D6SA 1S96A 1DKQA 2JVJA 4RZSA 3U1VA 3VPCA 1CZNA 4EL5A 2OGSA 5CDHA 5JNTA 4DCMA 1T9GR 4J1NA 4LNUB 1OA0A 1WOYA 2BFMA 2J4CA 4L9SA 1Q12A 2V7TA 3PDIB 3VZDA 3NKFA 5IWCA 1U3FA 1YR7A 3DAPA 2VTBA 1RBMA 2MU1A 4GP7A 4H7PA 2Y0CA 4GYWA 1OFGA 3X43A 1OBCA 1XQVA 3BFJA 5FI0B 1FXWF 1MIOA 2BDUA 4Q21A 2G36A 3KQPA 1H1DA 3GL9A 1JLSA 1SK8A 2WP8J 3OHSX 2ZS9A 4P5PA 3LY5A 1D7AA 1GN8A 2XUJA 2Z8ZA 5FNZA 4B6SA 3BH0A 5M7EA 3KDAA 1H3FA 4TSKA 1UXHA 1NQOA 3E61A 4ZALA 2FEOA 5JIBA 1GL3A 4ODIA 1N0WA 1YQWA 1W47A 2DHEA 3QUQA 3QZUA 4FMBB 1XX6A 2PIDA 2X23A 3M6UA 3PX3A 3TLGA 3B60A 3QOWA 4CW7A 2C0QA 3A3NA 1GQSA 2Q6VA 3LF1A 1ORRA 4GMXA 4LHEA 1CKEA 4ON9A 3RC3A 3S28A 2P2GA 1G64A 1C1XA 2JJ8A 4PAOA 4BKOA 4DB4A 1U9ZA 3L77A 3LHFA 3REGA 3V9AA 1RXYA 3LX6A 4BFLA 1VBMA 1RKQA 1QIDA 1IXKA 3KSDO 1JB9A 3L18A 4RHEA 2V7XA 4DE5A 1V6SA 3IEKA 4F38A 4HUQB 3DV9A 3WNDA 3UHAA 3D4NA 4FYXA 4U6SA 1O8BA 4ENPA 1D03A 4FLEA 2K4MA 1SFRA 4BASA 5JARA 2OMKA 1UF9A 1ULUA 3HJAA 3RUPA 4J16A 4GSYA 3V1NA 4MVJM 2GNAA 1L7VC 1VRCA 2I6GA 3DVLA 5CU7A 2WUEA 3CBGA 4BZXA 5JQGF 1IRXA 4CIDA 4K40A 3DO5A 2H4YA 3P9CA 3I2IA 4R81A 1QQAA 3KWMA 3RT9A 1W19A 4DS3A 2HLDA 1C9KA 1ZY2A 2GPBA 2YIMA 3FN4A 3ZZNA 4X66B 4MYSA 4JWTA 1U6JA 1YB1A 3PYLA 3KZVA 4NS1A 3WWDA 2OZEA 5JADA 5FOXA 2JW5A 4I9HA 4OJNA 3AFGA 3AM1A 3GR6A 2EBHX 3KQWA 1W36D 1A96A 3G0HA 2X5XA 1E1RA 3KIPA 1U7XA 5IAJA 1SC6A 3E0XA 1OYWA 2DWPA 2GEVA 4X71A 5KIAA 2VDOB 4IGEA 3V2UA 3KT8A 2OCYC 4DLKA 5IANA 1F20A 1QHGA 2TECE 2Q7XA 4P2BA 4ZKEA 4ZTZB 2ORED 2CB9A 2XUHA 3AB7A 4JEUA 4CV3A 2CCKA 1I5EA 2J33A 1NVEA 2BCJQ 3AHCA 2GAOA 2OCIA 4J49A 3UW3A 3ZCUA 2JGAA 1GZUA 2WJZB 1D2GA 1M1NB 1GGJA 1QKKA 2IYYA 3IRVA 1N5KA 5DM70 4RCYA 2IHUA 4FSDA 4J7UA 4KN8A 3ZGVA 4S35A 1WD5A 4QJ5A 5JAHA 2K6GA 3AOGA 4LZAA 1D2HA 1C81A 2NNLD 1JPNA 3QI2A 2UDPA 2COKA 1P5RA 1LSUA 1Y48E 3ICOA 4KOEC 3RUFA 4CE6A 1FS6A 1V16B 4J0QA 5U4XA 2QGFA 2V4MA 3S5UA 2PDAA 4CEJB 1M0WA 1DWUA 2CCJA 2ZAIA 3IBGA 1KL7A 4IX1A 3VZRA 1TKAA 2QJOA 5IZCA 2P6PA 4HN2A 1Q19A 1YCHA 3EFOA 4II7A 4D9CA 5G3ZA 3WFIA 3DYIA 1U0NA 4PN3A 4DLAA 4BUJA 1DFGA 1M34A 3EG9A 3VC1A 5IK2D 3V7YA 1RMTA 2PM8A 2D2XA 5TQ0A 1YDFA 4IKPA 3B70A 1ZI8A 2ZPAA 4RETA 3HBLA 4MUAA 3U31A 4OQNA 4NMHA 4PHCA 4MYRA 4F93B 2QD5A 1FL9A 3HXQA 4G4JA 2VWHA 4BO5A 2FE4A 4YAKA 2WICA 3DE2X 3KAPA 1NRJB 2BW0A 2H6EA 4O2BA 1GARA 2H1CA 1ACJA 5DTMA 1ZA2A 3L8GA 4X9XA 1N2EA 1YQQA 1ZXBA 4YCMA 1CZHA 3B1YA 1D2AA 1O95A 3CM0A 3IOYA 1MNAA 4JC4A 1TQDA 1VSBA 4LHXA 3HVHA 3ZQUA 1FVHA 4BO6A 4JXZA 4HPWA 1C30B 4A5SA 1RJ9B 3HJTA 3QPBA 2QIOA 4FSXA 2PR2A 3GGGA 3DQQA 1FX0B 5CDYA 3WLIA 1HFWA 4FEGA 5AM5A 3H1PA 2AXPA 6NULA 5KU7A 1W4AA 2AI1A 4XJSA 4IEFB 4UEQA 4ZI7F 2CNWD 2IZ0A 2QYSA 1AGYA 3EH2A 3GW8A 2F8MA 3GDFA 3HA5A 2X5OA 4CM9D 2B9VA 2XWBF 1RDFA 1XEWX 4KQ6A 3H2GA 4DUYB 1G4HA 3I05A 4MZXA 2WAAA 4I4IA 2PN1A 2X7HA 4OEHA 5C9ZA 3SZLA 2VJMB 4PYMA 3E9DA 1QIJA 5KTMA 2VYVA 2Z8YA 4M0UA 3VYTB 2FZLA 2VP0A 5DF1A 3GBVA 4K6CA 4QDTA 3GUHA 4K9LA 2PS9A 2WZBA 1I0ZA 1E66A 1IXYA 2GASA 5CH5A 1QGZA 2HLHA 4CMBA 3SQDA 2V9PA 4CQLB 5CIYA 5CB4F 1DTSA 3FUWA 2ZUBA 1TF5A 1TCAA 3W8DA 1M0SA 1N1GA 2CLCX 1VJDA 5FBRB 2P4UA 4F5DA 3TDNA 4CCWA 2ZIZA 5EP2A 1ORDA 4RFSA 3KCNA 2Y67A 1E1CB 2JFWA 2ZBDA 3H18A 1K75A 4MNTA 4BB0A 5HX7A 3RODA 1C50A 3HN7A 3A9RA 1B42A 2DLCX 1SA0B 3NAMA 3QLTA 2HK6A 1YCFA 2YBEA 3R6TA 4F4HA 5G0UA 4ND5A 1PJ4A 1V8FA 4E0BA 5LOVF 1UKAA 2IPXA 2WM8A 1KGSA 4ZCPA 4TN1A 5IARA 2O1WA 2JD1A 5FPTA 1PQPA 2UZ1B 4NK4A 3D3JA 4YRZA 1QTIA 3AO0B 5FYDA 1RFGE 2IEIA 3SC3A 4M9XA 3L0SA 2X2EA 3ABZA 3E5NA 4X1YA 1DT3A 1JDUA 2FPRA 1T36B 2GB4A 3LBNA 4ZQEA 5E38A 2HR1A 4KO3S 3FBTA 3LKZA 2F1JA 5JCJD 2QLJA 2FW0A 2NSYA 1M0EA 1K1EA 1N8KA 1IN8A 1Z5OA 1Q7EA 3IQXA 1W59A 4CR7A 4TTJA 3AFHA 1T34A 3NHBA 5AO9A 2ZYSA 3DHEA 3ELYA 2QP9X 3ILSA 3Q6MA 1CQZA 3A2LA 2I4RA 4TL6A 4UBOA 1KI7A 5FPPA 3M4ZA 1RVV1 3D31A 3O8LA 4TM8A 4EEKA 4PQYA 1TW2A 4RD4A 1G20E 2QX6A 5D5HA 3BD8A 2KSQA 3IVXA 3O03A 1D7OA 2BFFA 4N03A 4YJGB 1DC3A 4D9BA 1XJCA 3N2LA 5BY2A 1BE6A 4HKTA 3MCUA 1JHUA 1KJWA 1LKZA 2XZDA 2R9VA 1ABFA 1NVMB 1PKXA 3BL5A 5BRJA 3RAJA 4NYIR 1CX9B 4OMDA 1IZYA 3UJPA 5I7HA 4ZI5A 1SHTX 3AR8A 3D6HA 3W5HA 4H31A 1M2EA 1KI6A 5K0LA 1WPGA 4KLZA 3CZPA 1NPYA 2JHFA 3L5OA 4GBJA 3TLYA 5L4SA 5MF6A 2L2QA 3WLTA 4DADA 1KZ7B 2FWIA 2BSAA 4TSFA 1YRQA 1XD2B 3IRUA 3LDHA 2HHLA 1W5EA 3P5SA 4M0CA 5ESDA 2PV7A 2G3YA 2PMDA 2H1VA 1QGYA 4ZU1X 4F1JA 1YUNA 1NYQA 4CV0A 1VYTA 2V55B 1FYFA 2PPVA 2RGAA 3ZOZA 2CNDA 3TWOA 3ABSB 1US8A 3SJBA 3N0TA 4KITB 2G72A 3ITKA 2IUUA 4XH9B 1CUEA 1Y8AA 2QTZA 1SZJG 1XZFA 2VP9A 3DZDA 2WPNA 3EZ2A 4H1HA 5JHHB 3B5EA 5IDYA 3GLQA 1Y6QA 4ZRDA 5J9FA 5C51B 1SXPA 1M2GA 2NU7A 2Q46A 2JLRA 3GLGB 2DPMA 4IAOA 5EE3A 1DADA 2IYXA 3EF1A 3JQBC 1T9BA 2AA3A 4IRXA 3T3IA 3ZWWA 3LCUA 1ZD5A 3ND8A 1R8JA 3K20A 3ZBUA 1EVJA 1PZHA 1Z74A 3PWTA 4NBVA 4QNMA 3SHOA 2ZBEA 2Y66A 3RIGA 3UQZA 3UWPA 3W3AD 3CUYA 2W6IA 4RCZA 4WOCA 1IN5A 3TLJA 2HADA 1ZNZA 4DV6B 5EN4A 1I32A 2IYWA 4ABTA 3WGLA 1AQJA 4IH4A 3IMGA 4L73A 3GLHA 4BAGA 4S1VA 4IIJF 3SYMA 4IIJA 1V8BA 1U28C 1N2CA 4R41A 5BR4A 3MS4A 3SD7A 2C8LA 4ZI7A 1WXIA 1RI4A 3M5WA 2ID4A 4L75A 1NUAA 3UC5A 1SRRA 3QEMA 4MV3A 3X2SA 3HUEA 3LUDA 3MT0A 4DR7B 4COOA 1QAMA 3VO2A 1ADCA 2MMCA 2B7LA 4LWZA 4H27A 1U02A 3MRVA 5F9MA 4TTIA 4ZIRB 3C4VA 2OHXA 3GVHA 1U11A 1D1TA 3SBXA 4CQLA 1X1CA 2R1TB 3ZC3A 2FW1A 1CZUA 2IYRA 1RJEA 3Q40A 3PGVA 4G63A 4B75A 4H16A 1WA5A 4J4TA 5FFFA 4EJSB 5JXIA 3WGYA 4B8YA 1W1WA 4O8ZA 2PG3A 5IAGA 1A76A 2VHTA 3TLEA 1Z2PX 5LP6B 1PR2A 3U1TA 2HCRA 1RI2A 3EPPA 3H0CA 2DZDA 2UZIR 2AMVA 1RACA 1D4AA 4BX9A 5I6DA 2DKNA 1MTZA 2IGTA 4GZLA 1FUIA 3FFTA 3JZFA 4YAFA 1VMKA 2A58A 2W6JA 2OC4A 3L7DA 3K4HA 3NORA 4L0MA 3W8EA 2LGJA 3CNBA 1RAHA 5C7IO 3C5HA 4B2IA 3NYIA 1IQUA 1KMCA 1QVAA 3AR2A 2A9OA 1EDDA 3W6UA 3WAKA 3KQVA 4JA2A 1QIEA 1X1RA 1CDZA 2ZRPA 3N59A 3PG5A 3R3JA 3GQBB 3M70A 4ER6A 2V6GA 3QX3A 3T38A 3U4CA 5ALWA 2EW8A 1DMRA 1FRQA 4KQHA 4XUCA 4OI1A 5HQ3B 3MZ0A 2I29A 2I4NA 2ZJ3A 3WJ2A 3Q8LA 1PJQA 3EMKA 4MITA 1K3FA 3BXHA 3Q41A 4EG6A 4QUEA 2E89A 2O2JA 4G0VA 2EXXA 2PCJA 4GYJA 3U5TA 3G82C 3FWHA 2YHUA 2G4VA 1YB2A 3TQSA 2Q3BA 1DQZA 3BF7A 1Y4AE 1TRHA 2WLSA 3AUUA 4GC5A 4UUQA 1ZGAA 3FNEA 5CVVA 5FTNA 5GY7A 1AXEA 1F1JA 2BHRA 1OXUA 4YWHA 3FMFA 3R4CA 5KTOA 3FRIA 3PBKA 2Z98A 4MW4A 4WKPA 1K5DA 3GFVA 3AG5A 2XKBA 5JPIA 2FOLA 1FMLA 1APBA 1T4GA 1U7OA 3RUCA 3AZQA 4NCBA 3JWEA 4DBLC 1H69A 2PT7A 5CVDA 3KE8A 1XQWA 1W0JD 2BIFA 3DVAB 5F1YA 2CD7A 4XW2A 1JA9A 2QEQA 2WAXA 3GJQA 3ZDBA 1EG7A 1PWXA 2I67A 3G2PA 3UWDA 3A1CA 4BTVA 4LY6A 4W1RA 4Q3EA 3OLCX 5JRJA 5EHQA 5TS2A 1PWHA 5K8IA 2XCIA 5ALKA 1SBHA 2GZMA 3RR2A 2ZJ1A 2X1HA 3QWAA 3MQ4A 5FA5A 1XVVA 4CIYA 3WLEA 4EZBA 1DQYA 3KUDA 4I0WB 2AXNA 2RJNA 3O26A 4MVYA 1D2NA 4DKXA 5JWOA 5HILA 3BCRA 5G3YA 1TZBA 5EIXA 3WKEA 3R41A 2HAEA 3EDMA 3G49A 3RK4A 3UVEA 6Q21A 2QKYA 3A9TA 1Z2NX 2CN1A 3MJ4A 2HF9A 4UHCA 5JSFA 2HWWA 1RM0A 3CW2A 1P0PA 2DQZA 1P7PA 3A6HA 3QBTA 1V7ZA 1YZNA 2A67A 4PWYA 4QJ4A 5COQA 1MV8A 4ZK2A 3LW8A 4AQDA 5K0JA 2GYVA 1FTSA 1BCRB 4HVLA 4Z1OA 3MPOA 3WXBA 3VH1A 2J0UA 2QRZA 1Q77A 3Q3JB 5CJ2A 3PC8A 3KR1A 3MTQA 2IPLA 4OATA 1ODJA 2ZSUA 1XK6A 2R96A 3PXEA 4LY0A 3WFZA 1KEPA 3RRJA 3S3TA 2J41A 4JI0B 4P3XA 3AI3A 4DPMA 3QVGB 1XVLA 5FUYA 1PQUA 1M2VA 1MX5A 3I5UA 5DHSA 3H3JA 2VHUA 4DGSA 4P84A 4Q00A 1MJHA 1OFHA 1RD4A 3VR6D 4DRXB 2RI0A 4AC9A 3A0RB 2FH5B 4YRFA 2IV3A 1W581 3CVYA 1ADYA 3WK4A 4D7AA 4DSZA 3CLRD 3SE0A 1S4MA 2EBUA 4KK4A 1E2BA 1MX1A 1MGOA 3HE3A 5AM2A 1SBZA 3ASUA 3D6MA 2WEKA 2YUTA 2DQ4A 3PEFA 3HPQA 4DJEC 1H2RS 5BSKA 3BZWA 1X3SA 1SVMA 3D3NA 4QUGA 3ER9A 1PJ8A 1CQIB 2ZTLA 3I83A 5EIBC 2ZB4A 3DAFA 2R4UA 1AGPA 4ZD6A 5JYBA 5ALEA 5LQJA 1AGNA 1CUBA 4TV9A 4RD6A 4RXMA 3OLQA 4Y9SA 3NHKA 3HGMA 3PGKA 5KQMA 4DIOA 3KO8A 1Q91A 4X61A 3P9XA 3O3CA 4C0BA 3K3PA 3KXPA 4QFCA 3H2JA 4GKBA 3NETA 3DDZX 1PV2A 5TF0A 4E4TA 5JCZA 1U8EA 2DT8A 3MJHA 4MW9A 2HQOA 4PS0A 1A9YA 4DIFA 5DYTA 1JNXX 2PZFA 3H3FA 1XZKA 5IF3A 3RYIA 4WVLA 1Y7LA 3GRKA 4MYHA 4LJ5A 2YJGA 4P36A 4ZDKA 1QHHA 2Q62A 4CV1A 4QU0A 3CONA 1LGYA 5DV9A 2PGXA 4KFRA 4QA9A 1YB4A 2O7SA 2BGUA 4HX5A 3SZGA 1TUBB 2ZS7A 3E18A 1ZNWA 1GSIA 2W6QA 4PPFA 1J8QA 4MGKR 3UUEA 8OHMA 4E1BA 1EBFA 5BR1A 1QHYA 4DA4A 2A4KA 1LK0A 2HU2A 3HMKA 2FPPB 4H0FA 1YQXA 1PEYA 8ADHA 2COEA 3IAS6 3Q9UA 3SFTA 2WU8A 3LPLA 4M1SA 2PZAA 2PS3A 3I6QA 5JAUA 1JV2B 3JRWA 5BSTA 1XRSB 1ZRMA 2FZGA 5TMBA 1OKKA 4OXNA 3GRPA 3OWHA 1C3LA 1NLFA 2BEKA 4JEIA 4G0UA 1DL5A 4PYIA 4TL8A 2BMAA 4DDVA 1T6NA 5FUWA 3EPHA 4RY8A 2YNMD 4MINA 2DBVO 2GJKA 4PANA 1CF4A 2RD2A 3U4IA 2OGZA 2VLIA 5I4KA 4NYJQ 2GD1O 4FZJA 4JNCA 4RVCA 3VKGA 5ALDA 4CEIA 1JSRA 1XBTA 3VFDA 3T06B 1E2MA 4G07A 4EY8A 5AW4A 1U2DA 1H2WA 2VDMB 2OD9A 3DL2A 2NSHA 4GYYA 4URUR 5CUQA 1YZLA 4Z2AA 5E4JA 3OSZA 1H2EA 1WR8A 2DRIA 2VF7A 4UD2A 2JCYA 4J9UE 4TZ6A 1CWUA 2XWSA 5K0ZA 1Y6FA 2GEFA 2QMYA 3SX0A 2C83A 4W4TA 2Q2WA 3KVRA 5LJIA 1G1MA 1LB1B 1V26A 1JKIA 2VP6A 1UZLA 3EQZA 5B53A 4A2CA 4KDFA 5JSUA 4CM4B 4MCJA 4P4NA 1E3DA 2ETVA 1Q0HA 3M4XA 1ISFA 3L7YA 1TJ5A 5EWMB 2K7FA 5MGBA 1ZM9A 1T2DA 1VHWA 3A2NA 4CLRA 3FX2A 1NMSA 3AR6A 4YALA 5KWEA 2JC3A 3EA0A 4CCYA 5DNYB 2Q4TA 5C8DA 1JP7A 1JYFA 4MHTA 3OESA 3KZOA 5A9TA 1N2IA 4ZMBA 1Z13A 2NW6A 2CDBA 1D6MA 3GN1A 1GNLA 3IMFA 1JIJA 1TTHA 2NYVA 1DC8A 1AKQA 3QPCA 1VLZA 5E3IA 1TU3A 3IMEA 1KI2A 3NHUA 1MB2A 4LCEA 1Z4NA 1CJSA 1H66A 2HK7A 3SDBA 3IO5A 1BS1A 1VB3A 1N32B 4B7AA 3B1XA 1UADA 3IIJA 5IKPA 1MH1A 2HMTA 4M49A 1CVIA 3H0EA 4OI4A 1NBOA 4Q12A 1G5QA 1A8IA 1M0TA 1OHHA 3QWHA 2ZT5A 3OZ7A 2VAWA 2P1DA 2JFPA 2I03A 2OCGA 2XE6A 3C48A 3MSXA 3RD5A 3ZI4A 5L53A 3Q12A 1KEUA 2M98A 2WFMA 3WL3A 2YS6A 4ENVA 3KU4A 4M1KA 6AT1A 2CLEB 2OCXA 1SU6A 2O8EA 4Y6SA 1P74A 3WMGA 4RJJA 4CMJA 3RTGA 2QN9A 3IQWA 5E4FA 5EWLB 5LQCA 5K0NA 4AQYB 5L4LA 2WU3A 3THWA 4B3IA 2I4MA 4S12A 4IV0A 4CU2A 1SG0A 2IYAA 4HQLA 4NJMA 1KEWA 2OBNA 3E03A 4CXMA 1DELA 3SC6A 1M1YE 3KSUA 3I6IA 4C6TA 4W7SA 4AJHA 4PTLA 2VTVA 4HHEA 1N7IA 3HA7A 2C9YA 4Z86A 2J32A 2FOIA 1QVWA 1ISJA 1QQ7A 3HDQA 4G0YA 2WD9A 1CY0A 4O5OA 2FMHA 2IQ5A 3L07A 1CVLA 3GLRA 3GUUA 4Y7DA 2IPAB 5GJCA 2FETA 3BCUA 2PNJA 2JFVA 2PSSA 1Y3DE 3GP5A 4R40A 5CLQA 3IULA 1AVTA 4N4AA 4UFOA 3QF7A 1AH2A 1N9KA 3IYLW 3P2IA