4DLZA

H-ras set 2 ca(oac)2/dte, ordered off
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDEYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords GTPase HRas
publication title Shift in the Equilibrium between On and Off States of the Allosteric Switch in Ras-GppNHp Affected by Small Molecules and Bulk Solvent Composition.
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2012-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dlzA00
5TV2A 4URXR 3SFVA 4HI0E 1KOFA 2JJ8A 3K9HA 3CPEA 3ZQ6A 4KFRA 3WNDA 1S1MA 1OHHD 3GCGA 5LD2C 3ONWA 4R71A 2RGBA 3TR0A 4H1VA 1Q1ZA 5JS8A 1EESA 2GTPA 1U0HC 2ZE5A 4GMDA 1DVRA 5B64A 1RRFA 2GF9A 2GJ8A 2GK7A 3LAWA 1GILA 5HZKA 1XD2A 3V00A 1PUJA 3PQCA 1KDOA 5B58C 1CRQA 721PA 3FMFA 5J4LA 1DELA 2VP6A 4BZPA 3SR0A 1TEXA 1UM8A 2GJSA 1G7TA 4TLDA 5HTKA 2XEXA 3M6AA 1U2RA 5BYJA 2GK6A 3V9PA 4NYMR 5DHFA 2AWOA 3A1UA 4Q03A 3VQTA 3WMGA 2E1RA 1P3JA 1XTRA 3W6NA 4A8JC 1XB2A 2JLWA 3QIAA 3LNCA 1GWNA 3GJ3A 4URVR 2QUZA 1BYUA 2GBLA 2OBLA 4TLBA 4WW0A 2R8RA 1OXVA 1YR7A 1MABB 4BLQA 3KQHA 1FX0A 1S2MA 1GUAA 3QPUA 4BLTA 1JPJA 3AKCA 1A82A 3E5HA 5IRCD 3TQFA 2CK3D 1E4VA 1YZQA 1UF9A 1OH5A 3DM5A 5DIFA 5E95A 4LV8B 2QQEA 3LW8A 4TMXA 1X8KA 2OBNA 3TR5A 5FI1B 3SI7A 1TTTA 3NH6A 3Q5EA 2N46A 2V6IA 4WIAA 1D2MA 4DIDA 2GWHA 3U3RA 1NG9A 4LCBA 5KNDA 3CNNA 3KXLA 2WZQA 3OIWA 4AD8A 2IWRA 3EZFA 3K0FB 4Q18A 3PJRA 1TMKA 3I32A 1RRCA 1MRNA 3AVXA 5C46F 1QHYA 3U3MA 4M2LA 1NSFA 2ZI6A 5KDOA 3K70C 3D31A 2P6NA 3R7WA 2RGXA 1S9HA 3AQ4A 3LVQE 4JJZA 5CIWA 3KUDA 5EZ5A 3X1ZA 4CYMA 2ZE7A 2ZI9A 4M1TA 2O8BB 4Z54A 1ZIOA 2KSQA 2J1LA 1VG0B 2AWNA 3B1ZA 5CM8B 3RANA 3NKVA 2EW1A 5JZVA 1W48A 1LFDB 2ZSBA 1NNEA 1WP9A 2ERXA 5HPYB 1F3OA 1XD9A 1CKEA 2BBTA 2ZRIA 4Q7MB 1QVRA 2WBLC 3CW2A 1G17A 4KV9A 1SGWA 4LHYA 4MGKR 3WP1B 2F6RA 2XXAA 3ZZ0A 1JPNA 4RD0A 2ZAOA 3UKDA 1E0AA 4JLVA 5EP1A 4BFSA 1AK2A 2RGAA 2ODNA 3GLHB 3K70B 4PHFA 3TQCA 3MRSA 1FUUA 2H18A 1Z8FA 3AVQA 1KNQA 4QG7A 5FOTA 2BCJQ 1R0ZA 1HQCA 1G3MA 4WXPA 5FPKA 1BH2A 2EYQA 3WRXC 4TWZA 1JXMA 2O8DB 2OCAA 3KXKA 3RWMB 4DJTA 2VSOA 4XJXA 2EFCB 1TADA 2DB3A 2AHOA 5FUXA 1W2HA 3SYKA 4IEEA 5JRJA 3VAAA 1N6HA 3CZQA 4CW7A 1NVWQ 3VFDA 2FE4A 5BN3A 1TUEA 1SHZA 3K0AA 2I1VB 5C2JB 4OHVA 4KYIB 3QPWA 1N6NA 1R0XA 1RIFA 3BFKA 3ICEA 4FCTA 4Q4HA 4QHTA 4R2HA 5JI3E 2D74A 3QKRB 4QFMA 1JECA 2ZAMA 1HE1C 1UBGA 3F0TA 3ASYA 1DO2A 3EG5A 1NRJB 2QP9X 1J2JA 2HT6A 2BBOA 4JVNA 5DISB 4AWXA 2LWIA 4IJMA 4DBLC 4M9QA 4MRRA 1FP6A 1M2OB 3NHAA 5FOWA 3LDAA 3T15A 3WMEA 2OCPA 3OEHD 3U44A 4C7OA 3GLGA 2KE5A 2WWFA 2IA5A 4PO9A 3KUCA 2QNRA 1E2IA 3I61A 1VECA 1P9RA 1J70A 4DCNA 2J46A 4ZI3A 2BWJA 2ZRHA 2YV5A 2ZRJA 1QG2A 4X8OA 2P3SA 4Y0VA 4X8MA 1G8FA 4C4PA 2FWRA 2W6JD 1OF1A 3A37A 1CTQA 3IGFA 4FMCB 4Q1FA 1OKKD 3EC1A 3MWKA 1KK1A 4QGHA 4B71A 2JLXA 5KUTA 1YZLA 5CB6A 3DZ8A 2A3RA 5FOUA 5KYKA 3SC3A 2JLSA 3WP0A 2HXSA 2B6HA 2YC4C 3O8BA 1ONBA 1NMYA 3OEHA 1LVGA 3PG5A 4FMCF 4IFEA 3AVPA 1IAQA 3C41J 2FEOA 4PC3A 4RFVA 4C0HA 1ZCBA 1ZRHA 2BV3A 1KZGB 1VG1A 3ADBA 2XITA 2PCLA 2XNSA 2B8TA 4HB0A 3AKEA 4P0TA 2OCBA 4HYYA 2N42A 3U4QB 3T34A 3ZJYA 4UNSA 2WWXA 3BFXA 1IY2A 3LBIA 3Q3JB 2ZJAA 1ZM7A 2W6JA 3JZAA 3GP8A 1OKKA 1BO6A 1W4BA 1AS2A 2AR7A 5JEDA 3MFYA 3VU9B 1W5SA 2SHKA 4Z1MD 4W7SA 3OHMA 1PVOA 1D2EA 2VEDA 4YMWA 1KSJA 1Z6XA 2QTVB 3LY5A 5BWMA 2IC5A 1Z3IX 1XXHA 1W1WA 2OXCA 1KK0A 4FWIB 1II8A 4LC0A 2ZIAA 1L4UA 1KMQA 4V0NA 5FFMA 4AG5A 1OSNA 3KKPA 1G3IA 4DLRA 3NXSA 5AJWA 4YDSA 3FMOB 2G77B 2RGCA 4QM6A 4NPHA 5L3QA 4GL2A 2ZREA 3BB1A 1NMXA 2IYVA 1KSHA 1GVNB 1COWA 5DGXA 4B35A 4ZV4A 2Q3HA 1R5BA 1XBTA 4Z1MA 5EXSA 2A5YB 2VP4A 1LW7A 1G21E 3OIUA 121PA 3K1JA 1Z63A 4PZZA 1DAHA 3THXB 2ZRBA 3K0CC 1Z07A 1D9ZA 3B82A 1YRBA 2WWIA 1N6OA 4W9MC 4MDEA 2RAPA 4LJ4A 4CEJA 4R98A 1M8PA 1UEJA 3AVTA 1GL6A 1IJEA 4C0KA 4XWAA 4C0LA 1J99A 3GLHE 4PQYA 2PLFA 3RS7A 4CVNA 1E4YA 3VR4A 1N6KA 4JZKA 2FU5C 2WICA 1P7CA 1WA5A 1DAEA 5JJLA 1NLYA 2H17A 4AKEA 4RFSA 4DT1B 2QSZA 1S8FA 4URWR 2CL6X 5EQTA 4DLYA 1R5NA 1VG9B 4IDOA 1CS4C 2P6UA 2R65A 3ZVMA 4DB2A 2GZDA 5DYGA 2NO0A 3TUIC 3CX7A 5FR1A 3KB1A 2C95A 1YRAA 2TMKA 3L0IB 3MCAA 1W2GA 3BIFA 3VMFA 4JYCA 3ND9A 4BE7B 1M7BA 3CO5A 1E2LA 1E2PA 5F98A 2BMEA 3GFTA 2GCOA 2AKYA 3QKUA 4Q9JA 5KDDA 5DSZA 3A1SA 1Z5ZA 1GRRA 2YVUA 3IILA 4LBWA 3EAQA 3NIBA 4Q1AA 3CR7A 3B60A 4Q01A 4YDHB 4CDGA 3PFIA 5F9FA 2CHQA 4KSCA 3A36A 1KI6A 1DTSA 2ZJOA 3LQQA 3U7GA 2W0MA 2OZEA 1G64A 1JQLB 3P26A 4QGGA 5DE3A 2XZLA 1EFUA 2FG5A 4II7A 1A7JA 1N6RA 4M21A 4N0EA 2ZRLA 3CNLA 2CHVA 2F3RA 2RKOA 1FOEB 4IVRA 4RY2A 3TSZA 3C16C 4PTLA 4BFUA 1II9A 4RZ3A 3AVOA 4ESHA 2ZRFA 1E9DA 3GLIA 2Z43A 1NIJA 2Q3MA 4CEIB 3IQXA 3ZVRA 3BC1A 2MSCB 3RSOA 1OV4A 3ECCA 3WY9A 221PA 3NDBB 4KBFA 3WBKA 2WHXA 2WSSD 4YMVA 2NZ8A 1W5TA 2ATXA 2P2LA 2GXAA 2NO7A 3LA6A 1EK0A 2G0TA 2QMHA 3AP3A 4JYBA 3CRMA 2WM9B 4A82A 2QN6A 3VKHA 2NPIA 4V0LA 3SHWA 3AF4A 4M53A 3GD7A 2IXGA 3PITA 4RD3A 5IT5A 5KPJA 5J4KA 4ZDWA 1DARA 4JBWA 3SBEA 3F5FA 1N3BA 2BJWA 4OI0A 2HF9A 3SFZA 1AZTA 3L2OB 4A0HA 1EG7A 4C9BA 2HDNB 2WSSA 4F93B 1GSIA 1SVMA 3AVVA 2AL7A 3CBQA 1TU4A 3A4LA 3RS3A 4A6XA 4ZPXA 4GFDA 1L8QA 1LF0A 4DVGA 1ZD1A 3MGCA 3NBFA 3LX5A 3Q8XB 4FD2A 3V4RA 2XTMA 3KJGA 5L3SB 3LXXA 5L3RA 2G1JA 2PT7A 3ETLA 1E98A 2I4IA 2F7SA 3L0OA 4PC2A 4AYXA 3X1XA 1W46A 4MUBA 3VR6A 4E07A 5ELXA 4AI6A 2NO6A 1UFQA 2YWHA 3EW9A 4LSGA 2V8OA 3B5JA 3D6TB 4PAQA 5AJYA 1OB5A 3IDQA 1RZ3A 4QNRA 3PV0A 5FI0B 2QBYA 3BAFA 1XX6A 4A4DA 2Z4RA 1OFHA 2FZLA 1G5TA 4DDUA 2WOOA 4JKYA 2YWEA 4ZCLA 3B13B 4LK2A 3BRWD 1ZBDA 1AS3A 2D62A 4BZXA 1KI7A 4EJSC 1JB1A 4DLTA 3NG1A 1P61B 3F8TA 2C9YA 3OZXA 4JT4A 3QXSA 1KDPA 2BMFA 1U9IA 4OQNA 1KZ7B 4TTPA 1GM5A 1KKMA 4TZ6A 3P4XA 3EC2A 1M7GA 1GOTA 2EQBA 2FFBA 5EUQB 1KO7A 4LRWA 1AM4D 2CE7A 4I1VA 1ZM2A 2PZEA 2IW3A 5HKKD 3U60B 3QF4A 4B3GA 3RRYA 2YYZA 3DMNA 4LYHA 1BMFD 1N5IA 1G3UA 4EJSB 4HDQB 4ASUD 2QMEA 4Q1CA 2BBWA 4RD2A 1T9HA 3CWQA 3FE2A 4ABYA 1A4RA 1T0JB 4V02A 4DKXA 1N5KA 4MH0R 3GJ6A 2XJ9A 2C77A 3TE6A 2CL7X 3BJIC 2JASA 4OHWA 1E2FA 3KFXA 4LJAA 3S1AB 1BS1A 4P32A 2FSIA 2VBCA 1RRPA 421PA 3QBVA 2DFKB 4PANA 1KHTA 3VTKA 3BH7A 1UPTA 2IXEA 4KFTA 5F2EA 1GL7A 5HKKA 2OM2A 2O8FA 1ZIPA 3B78A 5DI3B 4GP6A 1KMHA 3B9QA 4TLCA 3FKQA 3CRVA 3D7MA 1BMFA 1W49A 2JIZA 1CULC 2V4ZA 3QBTA 5A0FA 5JJKA 1R2QA 2JLUA 4ASUA 3K53A 5CDFE 2NO9A 1E1QA 2W2TA 4TL7A 4C3ZA 1DE0A 2C2HA 1Q44A 3N2IA 4AY2A 2ZS8A 1ZU4A 1ZC3A 2WWHA 3DEFA 2V3CC 4A0GA 2V9PA 2DHRA 1UBEA 5G53C 4AC9A 3CZPA 4TMWA 4RSGA 5BQ5A 2G6BA 2ZSDA 4X8HA 2VSFA 3ZGXA 4BRWA 4LYJA 3PUWA 1Z0JA 3AP1A 4Y0AA 2R62A 4N1AA 3K09C 2F43A 4QOSA 2G9NA 4P4TA 3ICQB 5UKDA 1E99A 1KI9A 1IOZA 5EE5B 4DLSA 4W5WA 1RJ9A 4Q5IA 4IKEA 3RNLA 2ASEA 3HYTA 3TW8B 2F1JA 3EA5A 5LBIA 4KCGA 5FBVB 2JLQA 4B75A 3B1XA 4TT3A 4OHZA 2IS1A 821PA 2QM7A 1VMAA 2Q9BA 5KO2A 3QSYA 2QAJA 1EX6A 4LYAA 1XEFA 2CJWA 3RRNA 3ADCA 4EQ6A 3K9LA 1R10A 3BORA 3I3SR 1DS6A 5BW8A 3QI2A 1XEWY 4D26A 2MMCA 4TTRA 2BEKA 2NO1A 1HE8B 1F2UA 2KBEA 2VP5A 2WIAA 3QKSB 3W5IA 1ELOA 4LBZA 1GRQA 3NTUA 1G8PA 5FL3A 4A92A 1R8QA 3C5HA 1NVVQ 1NBME 1R8SA 4V03A 3AM1A 1KTVA 4A2WA 4DDTA 4A2QA 1CR1A 2C04A 2QQ0A 5AUQA 1DAFA 2GVDC 1KJWA 3L82B 3PIRA 4EPYA 2HT1A 2GVZC 4J0QA 2DY1A 3QY0A 1K6MA 1UEIA 2R44A 2R6DA 5CLLA 2CEAA 4BRUA 3AB3A 1XMSA 2VLIA 2DR3A 4XTRA 4KBGA 5JECA 1E79D 1Z6AA 3KDSE 3AGPA 1ZW6A 1MKYA 2ANCA 1NVUQ 1GNRA 3BERA 2E9SA 1OH7A 3PEWA 4BLPA 3W9YA 1W7AA 4B2PA 4GZMA 4NTZA 3Q5DA 1IN5A 3GJ0A 4PXAA 2FX3A 3I4LA 1NVXQ 4TMVA 4Q4AA 4YLGA 3RWOA 4B48A 2B8WA 2GCPA 3OEEA 4V0MA 5B57C 2IYQA 1XD2B 3I72A 3N5CA 3RC3A 2E87A 2YOGA 3T1QA 1NKSA 2WTUA 2GBLC 1JR3D 2VHTA 1Z29A 4MYCA 4YMSA 1G6OA 1DAGA 1YE8A 3WMFA 4NE2A 4JLBA 1E79A 2J3EA 3EPJA 5CK4A 3GFOA 3IPYA 1NLFA 3P27A 2O8EA 1NN3A 2J7PD 2OLJA 1JI0A 4M1KA 2O8CB 1XD8A 4WBSA 4CEHA 1M7HA 2EVWX 2WMOB 2V7QA 2PCJA 2BCGY 4QNMA 1E0JA 4G5OA 5DH9A 1GG2A 4JL6A 1NMZA 2RGEA 4PSKA 3ZDQA 2OT3B 5FBQB 5KU1A 2QGNA 2QAGA 5GVSA 4TLAA 3SU8A 1YR9A 2AD1A 2WKPA 3IIJA 1JR3A 1A1VA 4Q19A 2BKEA 1VIYA 2NG1A 2NTYC 4AKGA 1IY1A 3SNHA 3GLFB 3DOEA 4NCIA 1JAIA 4EFLA 1IN4A 1UJ2A 4KHZA 5CYOA 3THYA 4KLZA 3R9WA 1GNQA 3OF5A 4Q1DA 3T61A 2J7PA 1LS6A 4NCNA 4TMZA 2BIFA 1N5LA 3TSOA 2IEZA 1NY6A 3WXMA 3Q7PA 4BLOA 4D0NA 1UDXA 1U99A 1VTKA 1TF7A 2QPTA 4LJ7A 2ONJA 4EPVA 5JEEA 3MWJA 4XWKA 5LD2B 3OE7D 1E2KA 2EFGA 2RGNA 3B1VA 5JWOA 2C99A 1OW3B 1YZNA 2H1LA 4G5GA 4LYFA 2Z4SA 4ON9A 5DHAA 3WRYC 4TYNA 2NZJA 3P20A 4PQFA 4IDHA 2QY9A 5KTYA 3K0SA 1E2MA 2WJJA 3TRFA 3B1WA 3NC1C 3PEUA 1X8LA 5EP4A 4XVRA 1WQ1R 4KVAA 2DWPA 1X6VA 2QT1A 4UNPA 2CDNA 3CH5A 3BK7A 4NCHA 1FW6A 2H92A 2C8VA 2ZRCA 1W0JD 1EGAA 5FL7D 2FA9A 1RVDA 5HZHA 2P6RA 3PUZA 2ZRMA 1SKQA 4IXMA 3SYLA 3QENA 2O52A 1P75A 5JLJA 3HJNA 1F2TA 2OSBA 4JLDA 3B7GA 4L4UA 1IXZA 4GOKA 3SS8A 3TAHA 3OE7A 2YWFA 5C1BA 2Q0HA 2F9LA 4A8JB 1U81A 1PZNA 3PXGA 4CT4B 2FPKA 3QF7A 4PC7A 2W58A 1XTJA 4JSTA 1PUIA 3AH8A 4DUGD 3EA0A 3UXMA 1TNDA 1U98A 1G41A 2IYTA 3HU3A 1NP6A 4TYQA 5FL7A 1W0JA 2D7DA 2OAQ1 3PENA 4XVQA 1VDZA 1EFTA 1E2QA 5FUYA 4Q4JA 4ZI2A 3QG1A 2MSEB 2FJUA 4QHSA 4HUQA 4GI7A 4POAA 4TSFD 2ZROA 2PT5A 1W0KD 1KO1A 2D3WA 2IYYA 1ANKA 1YHNA 3KFVA 3IBGA 3R8FA 2V6JA 5J4VA 3AGQA 1AKEA 1G9XA 2J0QA 4KFSA 1FMLA 1QHXA 2AN9A 4LWZA 4R9UC 3T12A 3SJCA 1P4SA 1UBCA 1KY2A 3NC0C 3ZS9A 1G5PA 4L5BA 3TNFA 1RYFA 4TL9A 5CYPA 1E9SA 5SZHB 4OQMA 4DUGA 3W34A 1L4YA 2J0SA 2AFIE 4JBYA 1H65A 1S4QA 2LCFA 2UZIR 2XNDD 5TVKA 4NYJR 3SDZA 2NMVA 1U8YA 4PAOA 1C4OA 4B44A 4WOPA 2DFLA 5TARA 1EFCA 5DYIA 1DO0A 3HWSA 2Q21A 1YZKA 3FFAA 3K0AB 1AKYA 4TSFA 1RC8A 1W0KA 3CPJB 5EP2A 3RS0A 3IPXA 3NBZC 3TAUA 3F3YA 4JLOA 4ZCMA 2REBA 2VYFA 1GKIA 1FNNA 4OK6A 1XTQA 3VHLB 3MG9A 1ZCAA 1G20E 1CJVC 1E94E 1LS1A 2FMXA 2QTFA 3HR8A 3KXIA 1E9EA 4LI0A 5HCIA 3LBNA 2IBMA 3Q72A 1NIPA 4AYTA 5CITA 1OXTA 2MSDB 1CP2A 4HLUA 4CZ2A 1N6IA 4B3BA 2CNWD 2XNDA 3J81k 1LB1B 5AK0A 4PZYA 5H70A 2CBZA 3GLGB 1CJUC 2UKDA 3U44B 3AF1A 3W90A 3TGPA 3RYTC 3ZIAD 4HZUA 1AA9A 2PEYA 4HAVA 2ZVQX 4P3YA 4QJ4A 1JJVA 1FPMA 3O8CA 3VR3A 1QHIA 2CLDX 4F91B 1US8A 1W36D 1CBUA 4HB3A 2ZJ2A 4OKSA 2GJAA 2HEIA 1YU9A 2J9RA 2IYXA 2IT1A 3D3QA 4TYYA 5E7IA 3B8HA 1ZNZA 1XTKA 1E69A 1ESNA 4TMTA 4S35A 3I73A 4KVGA 3M4YA 4IVQA 4NZYA 1NSTA 4EPTA 3A1VA 3IKJA 1UKZA 4MITA 3H1TA 2FOLA 2CNWA 5AR1A 4XTCS 1NN5A 2LKDA 4LBYA 3SQWA 3NBXX 4IOKA 3ZIAA 3U5ZB 4ZIRA 5K8UA 3CWZA 2VA8A 3EX7C 3GLFE 4B33A 2ZPTX 1GKUB 2GILA 3CX8A 3KTAA 3MMPA 4U02A 1W4AA 4S2EA 4DEYA 5ANRB 3H84A 1U94A 4AK9A 2CCJA 2QROA 1R5OA 1K5GA 4LZZA 1S96A 3IO5A 3RDPA 4URUR 2CVFA 3GJ8A 3RLFA 4A1FA 2OUKA 2HJGA 3K9GA 1XXHB 2J5XA 2JDID 4DRZA 3THWB 3CPHA 1II8B 4QL3A 3A1TA 1MO3A 4FCWA 1CJKC 3HYRA 1AZSC 1X8JA 1S3SA 3RRZA 4BWYA 4DXAA 5FUVA 2BM1A 1WDTA 4NCKA 1GIAA 2NGRA 3VR2A 3DHWC 3RABA 2WAYA 4K81B 4URYR 2B92A 2F9MA 4G01B 1OFUX 4D2IA 2MMGA 1KK2A 5G3YA 4NP6A 3RHFA 5FPHA 3VHXA 2OV2A 5BYKA 4MKFA 4C0QC 3QPVA 4OK5A 3I8XA 4D4LA 2VHQA 3KQLA 4PC1A 3TMKA 4TLEA 1COWD 3QKRA 3QOFA 2CCKA 4WZBE 2ZYTX 3RC8A 2JDIA 3A1WA 3GJXC 3HR7A 1IONA 2DCUA 3UG7A 2HLDD 3LBHA 2N1BA 4CF7A 4CEJB 1DEKA 3AKDA 4MGIR 4ACAA 3EZ9A 5EXPA 4D25A 3BD9A 2VH5R 2QE7D 1NL3A 5FTJA 5KSYA 5E3HA 3G82C 3RSLA 4XIGS 2R6AA 2ZRAA 3CKLA 2BOVA 3FTQA 3TBKA 1GDDA 2HCJB 2GXSA 1RYHA 1E0KA 2B7BA 4RFSB 1P72A 2AFHE 4TN1A 3TUJC 2VO1A 4UKDA 4A2PA 4DDVA 4C30A 4QJ5A 3AVUA 3ZQJA 5HE8A 1Y63A 2FFAA 2ZEJA 1NLZA 2FSHA 3R9IA 4DLUA 1XTSA 4PSAA 2HLDA 2EFDB 5L8VA 2QA5A 4AG6A 3R9XA 2EWVA 4G1UC 4UNNA 2QE7A 4DCTA 3MAAC 2C9OA 3D8BA 2QRZA 2GCOB 5HE9A 3BWDD 1T3LA 1X1SA 2G1KA 3FFBA 4LHXA 2HYIC 3X1YA 3DDCA 1OH8A 1P2UA 4JLPA 2NIPA 1HT1E 3EZ7A 4LHZA 4BASA 1V43A 4TL6A 3U4QA 4GT1A 4Q9HA 4H9GA 1KI6B 1FQKA 5H1YA 4MUAA 1KYIA 4IEIA 1LNZA 4NCJA 3K8YA 4P4UA 4P4SB 4WA7A 3MSXA 5JFGA 4F4IA 1QBKC 1ZUHA 2ZI7A 1H8EA 1SXJD 1X86B 1J90A 4XD7D 2GEDA 2HXYA 3DL0A 1Y3AA 2QENA 2C9CA 4OJKA 1IY0A 1XMJA 4IDPA 4JT2A 2IHYA 1FMJA 1N5JA 4JSYA 1G3QA 5JCPA 1T8UA 3BFVA 3EWAA 3GLIB 2QPOA 3GLGE 4JL5A 1EX7A 2QM8A 2KBFA 1IN7A 2WJYA 4PR0A 2ZQ5A 2QMOA 1E9FA 4EFMA 2ZS9A 4C2TA 1T6NA 2GZAA 5LB4A 1N0VC 4ZCIA 3ZD7A 2R9VA 3UPUA 1DPFA 4MGZR 4Q9LA 2ONKA 2VHUA 2AD5A 5FPSA 1OPXA 1SXJA 3ZZUA 4BFWA 4XD7A 2IYZA 1H8HD 1N25A 1IHUA 1T3SA 3LH5A 4D4MA 1QF9A 1QHHB 5J4HA 4O0MA 4YQFA 2AXNA 1CJTC 3O47A 1UKYA 1WRBA 2ZSFA 3Q85A 5FTKA 4RCZA 3UG6A 5LPNA 2VQSA 2Z5FA 3B2EA 2WJIA 1W47A 1ZAKA 2R6CA 3DM9B 1E2HA 1NKTA 2HUPA 2ZI5A 4HAWA 2Z6VA 4IHQA 5G3ZA 2OFWA 2ZI4A 3CUEF 3K0EA 3QEJA 5EXXA 3SJZA 2ZSEA 2QI9C 4LJ8A 3H0KA 2JLVA 4MRVA 1YQTA 1U9IC 3I62A 1H8HA 2WIBA 3T35A 1U8AA 3LFUA 2EU8A 1TEVA 4Q7KA 1KI2A 4FW9A 1SVLA 2EFEB 3CLVA 4HDCA 3EPHA 5DN6D 5C18A 1KIMA 2ZXUA 1OYWA 2XTNA 4I99A 3UWOA 4B47A 5FH9A 1DOAA 4DLVA 2GESA 1B23P 4LC1A 4E5UA 1XNJA 3CNOA 4PO8A 2P5TB 3T1TA 1FL9A 1ZM9A 1IXSB 3BS4A 5KOYA 1NJFA 4G5RA 4PX9A 5IK2D 1JALA 4RD1A 1E2GA 3FMIA 2FPMA 2ZRDA 1Z2AA 4TMKA 2JJ1D 3UATA 3AEZA 3WHKA 1BKDR 2OXRA 1A2KC 2YWGA 3QF4B 5DN6A 5A5GA 3BH6A 1L2TA 1VCIA 2IYRA 2GRJA 1OFIA 2PZGA 1GTVA 2OLKA 4EDHA 1E2NA 2WWWA 4EUNA 2A78A 1CEEA 4XWOA 3EWSA 5D3MB 3W8NA 2YOFA 3L0PA 1E9CA 2QP4A 4KI0A 2IYLD 4TYPA 5TDHA 1X1RA 3FGNA 3UWKA 4XOIA 1PJRA 1G18A 1OIWA 2WWGA 2X2FA 2ZJBA 5HR5A 4IXNA 2FSGA 3TW4A 5GADl 2OILA 5IK2A 5F9HA 2WKRA 4Q02A 1JEEA 1FTNA 1FZQA 2Z83A 4EPRA 3MLEA 1QG4A 4L9WA 1OXXK 2I3BA 1TPZA 3IIKA 2JJ1A 3DVLA 4DWJA 2O8FB 2G3YA 2J87A 1KMHB 2IX3A 3FPAA 1G8HA 3U7EB 1NBMA 2PJZA 2A9KA 2BEJA 3HPQA 2B21A 1WXQA 1T91A 3MJHA 1XPOA 3TH5A 3A4NA 4JS0A 1WBDA 2XOKA 3ZLJA 1S1CA 1TUIA 3A58B 2JIZD 1RPZA 4Q1BA 5CJPA 2AXPA 2BM0A 1E1QD 4U00A 2ZTSA 1PLJA 4R2IA 2JCSA 2D2EA 3P32A 1KY3A 1Z6YA 4TQ9A 4MKHA 3EZ6A 3SZRA 1G8GA 2G83A 2W2XA 3GEHA 1TL7C 2WOJA 2FFQA 1TAGA 4B3CA 3G5UA 4YMTA 3E2IA 4EPWA 4DZZA 5KHOC 1XDBA 3GLIE 4A36A 2J59A 3NEYA 4KO8A 1ZP6A 1G7CA 1JQJC 2YNMA 4GSYA 1OXUA 4LBVA 1QHGA 2ODBA 3R20A 2O0HA 2CJWB 5J4YA 4TT3D 1XWIA 3ND8A 4AIIA 4EQ6B 4MGYR 4WZAE 2ZYWX 1ETUA 4L8GA 3EASA 4A0RA 1TQ4A 3B85A 4BFXA 1Q1BA 3RRMA 3NH9A 2FH5B 4A0FA 2OFOA 1MV5A 3CB4A 4LY6A 1AIPA 1F2UB 2ODEA 5JRZA 3FKSA 2ZITA 4GNKA 3H86A 1DAIA 3P1JA 4FMDB 2J0UA 2YINC 3GMTA 5IDVA 5AUPB 3UMSA 1WB9A 1D2NA 4AURA 1XEWX 3L43A 1XPRA 2L0XA 1E2DA 4QGAA 4LHVA 1VKJA 1HTWA 2YKGA 1KO5A 1KO4A 1ZNXA 1M6NA 4ITRC 4FMDF 3IEVA 1IJFA 4ERNA 1KSGA 1Z0FA 4G0NA 4HATA 3TVDA 2ZR7A 4C0JA 5JSZA 3CF0A 1NN0A 3NEJA 1P60A 4QRHA 1G3RA 5AJZA 4HEJA 1BYIA 4EKDA 1E9RA 2IF2A 2WKQA 2VP9A 3O8DA 5C4GB 4FWTA 3PUVA 3C4JA 4Q1EA 3VKWA 2ZI3A 2GJKA 2OFXA 2CL0X 2V55B 5K8LA 5H8WA 4QC2A 3W5JA 4Q21A 3GEIA 4B6FA 1AN0A 2IYSA 2NPFA 1E3MA 1VYVA 3MUFA 1PLLA 4IOLA 3Q9LA 4UXJA 2D06A 4F92B 2ZVPX 3M1IA 4K8OA 5SZIA 1IM2A 1R7RA 1GL9B 4ARZA 4LV5B 1XEXB 2QAGC 1VHTA 3L0SA 3OEED 5BN4A 3QNUA 1LY1A 2ORWA 3OAAD 2QEQA 4M22A 1U8ZA 4KLNA 3CX6A 1F48A 4HLQB 3FMPB 3O8RA 2PX0A 3SQXA 2XSZD 3EXAA 4IW3B 3IBYA 5CJ2A 4B2LA 4HUTA 4EPXA 4TZ0A 3ZVNA 2P5SA 2ZJYA 4PHHA 2GHIA 3NVAA 3H2YA 2RGGA 3TIFA 2G88A 3TJZA 4ZDIA 2C98A 2RGNC 2V7QD 2Q6TA 1EXMA 2XZPA 4Z8YA 5BXQC 1AQUA 2VSXA 1Z6TA 4OQXA 1E96A 4Q47A 4OHYA 2ZM5A 1FFHA 3RS4A 1ZUNB 3OAAA 3W6PA 4BECA 3KB2A 1XTIA 3L8ZA 4YONB 3N70A 2GETA 3GJ5A 3W3AA 2C96A 3THYB 3ZYCA 1CR4A 5FUWA 4OHXA 2OE2A 2XSZA 4IRUB 1E6CA 3GEEA 1CIPA 1A5TA 1XJQA 3NBYC 2CMKA 4KJZA 3AVWA 5B30A 3QKSA 2ATVA 2W83A 3PUXA 3EIEA 3QXJA 4MRNA 2W6ID 2HJVA 4NU0A 4Q48A 4QBIA 5EE9A 3SEAA 2F3TA 4BLRA 1QHSA 2IL1A 1DADA 1JAHA 4KU4A 3BH0A 4E22A 3LWNA 2CHGA 2FFHA 3SOPA 4PFSA 1XCGB 4KODA 4W5JA 4PC6A 2PJRA 5FTLA 4PPQA 2IS6A 3RAPR 3T5GA 3IUYA 1WF3A 4AKHA 2J0VA 1ZNYA 1FX0B 4PAMA 3AKYA 3SE0A 1X3SA 2UVQA 4M8NE 1T3HA 2F1RA 1GFIA 1ZVQA 4G5SA 1I2MA 2A7QA 4MA4A 4MRSA 1NI3A 4Q9IA 3SJAA 4U7DA 2VHJA 5P21A 5IHPA 4JJKA 1OYYA 1Q1EA 1F2TB 1OT3A 3IEUA 3FVQA 1TQ2A 1M74A 1J7KA 2XZOA 2W6IA 3QG5A 1CR2A 3OIVA 1OXSC 4BPBA 1MO4A 4I1OA 1GAJA 1L7VC 2ZRPA 4IVPA 5KNCA 5SZKB 2HCBA 1G291 5CIQA 2QPAA 1P2VA 3HU1A 2A5DA 3C7KA 4TQAA 2WMNB 3CRQA 4OJQA 2VIIA 4M1YA 4W5HA 3KQUA 4Q4JB 4B2IA 3U3KA 4D4JA 4DCVA 2PBRA 2JAQA 4JMPA 4HUQB 3BB4A 1FNMA 1ZMXA 4GZLA 3R7WB 4F4JA 1TU3A 5LDDC 4D0LB 3SJBA 1K5DA 1XCMA 3THOA 4M9XA 1ZUIA 1RFLA 1UKEA 4XVUA 2F55A 1NVVR 2OEPA 1OE0A 2O8CA 1Q3HA 2P67A 1OHHA 1E2JA 4EIWA 4GDFA 4NHOA 3AV0B 2H8KA 3PEVA 4JL8A 1NY5A 1WMSA 4MYHA 4NBSA 2AK2A 4KXFB 1ZINA 2PMDA 3VR5A 2IHBA 1KO8A 2A5JA 1G19A 3E1SA 2XXAB 2F1HA 1Z47A 1G4UR 3SN6A 5E4FA 4HLUC 3BBPA 4LUCA 1FUKA 1VIAA 2H16A 1Z0IA 3GLFA 2OESA 4LV6A 1QZXA 4NMMA 1IBRA 3QEOA 1CU1A 2CCGA 1QHNA 4NH0A 5FR2A 4BQSA 4Z8XA 3DPUA 1EWRA 4XH9B 1Z08A 1TQ6A 4RZXA 4O2RA 1SQ5A 4TL8A 4DDWA 4L15A 3MWLA 4RD6A 3WYFA 3TUZC 3DOFA 4HAYA 2GA8A 5AJVB 2QT0A 3P4YA 4A15A 1OFTA 2RH5A 3QQ5A 2CXXA 4V0ME 1LTQA 1G4AE 1XFAA 4F7WA 4QBHA 3KQKA 4DSNA 4P33A 1XJCA 2CK3A 2WJHA 4HZUB 4OQLA 2FSFA 3AF3A 1MABA 3ZZTA 5GJCA 4JLJA 5E7JA 2CLSA 1US8B 3BGWA 1W36C 4JLNA 2QZ4A 1P5ZB 4LX0A 3C8UA 2IYUA 4PHGA 2ZANA 2J45A 3B6EA 4N3NA 2IUSA 4D0GA 1Z0DA 2IS4A 2G0NA 4Q4HB 2CVHA 1JEDA 4PPFA 5KSZA 1ZYUA 2PEZA 2ZR9A 1XF9A 4A8JA 4E09A 2ZR0A 5JHGB 4CT5A 5E7MA 4B6EA 1IQPA 1NJGA 4HSEA 5AUOB 2J7KA 4JLMA 3K0FA 3ZVLA 4M9SA 3NDPA 3I8SA 3B9PA 2Q3FA 1ZM4A 1JR3E 4ZIRB 4GOXA 1P73A 2DWQA 2ZJ8A 4JVLA 4C7OB 1I4DD 1YR6A 3CR8A 4FMBB 3K70D 1W36B 1CJMA 3KKMA 1V5WA 2IEYA 1JR6A 3JVUA 4Q66C 5G40A 3I5XA 3LW7A 3KTAB 4WAUA 1G16A 1Z6GA 4QGFA 5FTNA 1Q57A 1CXZA 4BFTA 5TB5A 2O8BA 4RJLA 2HYDA 2IS2A 1A2BA 1VCOA 2QSYA 2REXB 1S0UA 1Z28A 4MDFA 5EXTA 3ADDA 1S3GA 4I1UA 1AGPA 1QVAA 3QVUA 2ORVA 3RS2A 2ZSAA 4L9SA 2ZU6A 1KGDA 3SBDA 4E03A 1AJEA 3REGA 3BB3A 2DFTA 4B3FX 3GQBA 1Z83A 4OL0A 4DLXA 3IQWA 3GJ7A 4EAQA 1UADA 1O3YA 4FINA 1HEIA 2XX3A 5GVRA 3GLHA 2VHCA 3QXXA 2P65A 3LLUA 4BGDA 3A8TA 2FNAA 2CLCX 3RVBA 4QXAA 1E32A 5JMTA 1P9WA 2K5UA 4HB2A 1HH4A 3HDTA 1DG3A 4UXHA 4ZDKA 3LRPA 1RKBA 4US1R 1E1RD 5TXGA 1F6BA 2ZRNA 5FBWB 1C1YA 2V1UA 5L3VA 3REFA 4CRWB 2O8DA 1D6JA 1KDRA 4LPKA 3KL4A 2X2EA 1YZUA 1Z0KA 4O25A 2IWHA 4D6PA 1U0JA 4MKGA 1SVKA 1N6PA 2WPDD 3QXHA 2WSMA 2ZRKA 2ORIA 4OI4A 3FB4A 5FPTA 1OIVA 4P31A 5F3WB 2OBMA 4DEXA 4GRAA 4LJ6A 5AWFC 4GMXA 5JJIA 2PZFA 1DAKA 3UMRA 3LV8A 3V4FA 3ZD6A 2D7CA 2JEOA 3MJRA 2EWWA 3I5YA 2FN4A 3MWYW 2REOA 5L3QB 5DNYB 2IUTA 1AQYA 2IF0A 1E1RA 5GJWC 4NKRA 3SYNA 4M9ZA 1I2DA 2GF0A 3CF2A 2H5EA 1KK3A 3WBJA 4M0LA 4FXPA 3X2SA 3C5CA 3AF2A 3X1DA 4NDZA 2GEVA 4X8LA 4YXWD 3FHTA 1I4TD 2BMDA 5EE0A 2WPDA 4URZR 2WWYA 2WJVA 2ODWA 5FPYA 1RE0A 1T8TA 1GZSA 4ESVA 1HA3A 1SHKA 4XSHA 3WNCA 1KJZA 2XTZA 4BFZA 2OO7A 4NONA 2P0EA 2KI5A 6Q21A 4D81A 2KJQA 1EFHA 2GXUA 1Z06A 2QU8A 2BBSA 3KKQA 1JBKA 3L8YA 1E9BA 4FIDA 4PPNA 2DBYA 4RZUA 1N0WA 3QVVA 4PZLA 4KITB 4LDJA 4MRPA 2H57A 3IO3A 5K8TA 5JBQA 4I1SA 3VNVA 2J41A 2FGJA 2YZ2A 3X1WA 4KYUA 4B3DA 4YXWA 4M1MA 1SXJC 2ZETA 1YZTA 4PPGA 1OJLA 1H8ED 5J40A 3THWA 2YC2C 3EZ2A 2X77A 4JLAA 3BE4A 1HY3A 2IK8A 2Y8EA 1P2SA 4UNQA 5TY0A 3SHFA 3GJ4A 3HP1A 5EE1A 4B43A 4BLSA 4BZQA 2Q9CA 5FTMA 5KDLA 1F60A 1OB2A 1VPLA 3ADKA 3A6PC 3VR1A 1FQJA 4WVFA 3CRW1 4M1WA 2BC9A 4IFBA 4O3MA 1ZNWA 4RKEA 1WCV1 1D9XA 1ZD9A 3EPKA 3QXCA 3RS5A 1J8MF 1YKSA 1ZC4A 1CF4A 1TQDA 1SXJB 2RMKA 2GNOA 1FP7A 2X8AA 5EZ6B 2R2AA 4ZKEA 3HPRA 2JGNA 2PLRA 4HB4A 4UQOA 3FWYA 1VCNA 3VKGA 5G41A 2VTKA 4RD4A 1KJYA 4QBFA 3VU9A 3AP2A 4RCYA 1MO6A 5FBRB 3T1OA 1G5RA 3W8RA 2HF8A 4D80A 4CIDA 1BOFA 3LLMA 4LHWA 4LJ5A 5CB8A 5GJVC 3ASZA 1SVOA 1OIXA 3A4MA 4JLKA 2Z0MA 5KNBA 2EYUA 1SZPA 1VCMA 4IDQA 4HLDA 1ODFA 3QE0A 3TKLA 3CM0A 3UK6A 1HQYE 2FEMA 4US2R 2H7VA 4HLCA 1NF3A 1Q21A 1WBBA 2FGKA 3OESA 1E0SA 1GKYA 4DIEA 3KQNA 4N0DA 4H1UA 4WXRA 5D3QA 2BKUA 1UBFA 1KDTA 3OFND 3B1YA 3W6OA 3THXA 5FOSA 2ZRGA 4PHTA 4U5XA 3PEYA 3EARA 3C15C 4GBMA 1DAMA 1M34E 4FCVA 2KWIA 1R0WA 2BJVA 5IF9A 1G1MA 4JVSB 4YMUA 4Q9KA 3EIHA 1GNPA 1EFRD 3T1VA 2C5LA 1AGRA 2QP3A 1Z0AA 2KB0A 1TX4B 3C14C 2FF7A 3AUXA 4DSTA 2CE2X 4YC7A 5AUNB 3LQRA 1UAAA 1MRSA 1T4GA 2FPLA 4NYIQ 4P4SA 4DT1A 3CF6R 2QGZA 1WE2A 4OYHA 3CIOA 4BEBA 3LX8A 3M0EA 3OIYA 5EP3A 3OFNA 3K0CA 3PCRB 4PO1A 2V54A 4OI2A 3PVSA 2C03A 3LXRA 1Z2CA 5LB2A 1MH1A 1Z22A 4ZO4A 4F4CA 4KAXA 1Q0UA 1SKYB 1XXHE 2PH1A 3UANA 3IHLA 4ZDJA 1KAOA 1BIFA 5M04A 1EFRA 2JATA 1FTSA 1KI8A 2DPXA 3IIMA 2QBYB 3KKOA 4US0R 1NG1A 5CDFA 2GJ9A 1TF5A 3UIEA 4F38A 1IN6A 4QM7A 2X1VA 2WVJA 2RHDA 5KSOA 4ILEA 1G7RA 4HAXA 2BMJA 5KPDA 3K9NA 5JHHB 2NQ2C 4CGZA 3AUYA 1PV4A 1S9DA 2QTHA 1YR8A 1ZM3A 2ZUDA 2RCNA 3CONA 3U3JA 4DB4A 3KX2A 2XAUA 1K8RA 1QHHA 4UXIA 4C0AC 5C4MA 5HCNA 2QL6A 1P6XA 5EUMA 1R4AA 1HT2E 4FI3C 2A30A 2RB4A 4TQUS 4HDOB 2BHRA 1NBMD 3GFPA 4D82A 4DCSA 3R8CA 2VP2A 2WAXA 4HAUA 2XGJA 4CEIA 2ZE6A 5CM9C 3UMFA 2XOKD 4DSOA 621PA 4JIMA 1DBSA 3WNBA 1VG8A 2QMUA 2GDJA 3ZH9B 1EWQA 4B76A 4RZ2A 1QRAA 1P2TA 1SVSA 1W44A 2VF7A 2YJTD 4TYWA 3T5DA 2O0JA 4DC9A 4QKQA 5GJBA 4B73A 4C0SA 2IUUA 4MQBA 1Q1QA 2FDCA 4IOMA 1G8YA 1XZQA 5JWRA 4A9AA 2B7CA 2QG6A 2XB4A 1R0YA 2D2FA 1G7SA 3HU2A 3KKNA 5DLQC 2DYKA 1ZD8A 4RVCA 1HURA 2O5VA 4LOAA 4D4KA 3DKPA 2AKAB 3LVRE 2YHSA 1Q22A 5BN5A 5JCZA 3FHCB 3AF0A 1Q3TA 1GP2A 1CR0A 2OCYC 4QBGB 2VP0A 2ANBA 2FV8A 4PSVA 4I4LA 3U6KA 2DFNA 4MYTA 2JJ2D 3WYGA 2AX4A 3DO6A 1CRPA 4BFYA 2ZJZA 2O0KA 4L16A 1HYQA 4V0OA 3NWJA 2JA1A 4DLZA 1SXJE 3G0HA 5JI2E 1XMVA 3U7FB 4KFUA 3AVYA 2J0UB 1MOZA 2X19A 1XJ0A 2A2ZA 5EE3A 2F43B 4C2UA 5L3SA 3FKSD 1E2EA 1XRJA 2VRWA 3KZ1E 4GOJA 2YOHA 3FDIA 1ESMA 1MT0A 2VF8A 2IXFA 1AS0A 3KJEA 5H68A 1RJ9B 1IXRC 4NYIR 5FBLB 4G5QA 1W4RA 2OAP1 2WV9A 5B2ZA 3U61B 1N2CE 4JVMA 4V0KA 1LF5A 3LO5A 5D3MA 5JSZB 2GZHA 4DLWA 1MO5A 5SZJA 3WYAA 3JVVA 3E70C 2JJ2A 1KAGA 2GCNA 4A6PA 3CH4B 2JLZA 2ZE8A 1D5CA 2A5GA 1G6HA 1PLKA 4OBEA 4Q7JB 5DI9A 3W3ZB 2NOAA 2QORA 1OH6A 4M1OA 1D8TA 2F1IA 3LD9A 1XP8A 2R6GA 1VYTA 2ZUCA 4PQRA 3BXZA 1O87A 1KKLA 1KNXA 1XCPA 3H4MA 1C9KA 4OK3A 4NL4H 5A4JA 3MD0A 3TLXA 1YZGA 2HV8A 2C78A 2EFHB 4KSBA 5FOXA 4ARZB 4HZIA 1II0A 4IDNA 2PX3A 1P9NA 2QRNA 2ZYUX 5AJXA 5KSPA 3T06B 4B74A 4EJSA 1I4LD 1E9AA 2ZUBA 4GP7A 5J47A 4K46A 4M1SA 2ZU0C 1RRGA 4LGMA 5CLQA 3VNUA 1N6LA 2R6FA 4TTQA 2W2VA 1M1YE 1SVWA 1U0LA 4ZKDA 1VHLA 3DMDA 3EPLA 1GITA 4Q7LA 4WZ6A 1KSFX 1LV7A 1Q20A 4OQFA 4LJYA 1SVIA 3S1AA 4C0BA 2XB2A 3U7HB 3DZDA 5K8IA 2I1QA 4M4SA 3EIQA 5DI3A 4FN5A 1SKYE 2IYWA 3BOSA 3VX4A 4B32A 3IHWA 4OI1A 1JJ7A 4Q4AB 1XZPA 4XSGA 4I81A 4NYMQ 4DHEA 1UDWA 4UJ5A 1P62B 2Q9AA 2GKSA 2UZ3A 4QJ3A 1VYUA 1XMIA 2V1XA 3TVTA 1YJ5A 1KI4A 1HUQA 4AKIA 4LJ9A 2BDTA 4ACBA 3FOZA 4G3XA 4GPTA 3Q7QA 4JKIA 3U6BA 2FZ4A 2O8EB 1NN1A 1ZJ6A 1XU4A 4CEHB 1TF2A 2PL3A 3KJIA 8OHMA 3U3OA 5JWHA 4DCUA 2DWOA 3PUYA 4Q00A 4B34A 1B0UA 3QKTA 4DSUA 5JS7A 5J5CA 4EFNA 4BFVA 3I92A 3JZMA 2QAGB 2ZJ5A 2RHMA 4JBXA 4RKFA 3WHLA 1T0HB 1GRNA 1ZU5A 4R7ZA 1MR3F 2GAOA 4LPSA 3QUSA 3TK1A 2ZS7A 2LKCA 4BEJA 1Q12A 2ERYA 2A5FA 4HAZA 5TMPA 3U2QA 2GXQA 2OHFA 3NHBA 2VL7A 3N2EA 2AK3A 1R6BX 1SULA 5CK5A 1UKVY 2RGDA 1CLUA 1OLOA 3I1FA 1HV8A 2PMKA 3K09A 1F5NA 3FYHA 521PA 4IOJA 2JLYA 3GPLA 1T5LA 1JXOA 1T5IA 5EJEA 2W00A 4UNRA 4QHYA 2ZYVX 2XJ4A 3DKVA 2D4HA 2OG2A 4B3XA 3PR1A 3FHOA 1RW4A 3QJYA 1QDEA 3VX3A 2ECKA 1IN8A 4AYWA 1JNYA 1XEXA 1KI3A 2GEUA 1N0UA 2BVNA 2GAAA 2W0SA 3KJHA 4MYUA 4UJ3A 3TSWA 1KI1A 4MKIA 1YVDA 1DG1G 2WJGA 4Z51A 5FOVA 1U90A 1W4CA 4O2LA 2VPPA 3CRRA 1J8YF 4BUJA 4Q4LA 1XPUA 2JLRA 3ZS8A 4NYJQ 5DO9A
chains in the Genus database with same CATH superfamily
5TV2A 3TD2A 2EFJA 4WDRA 2QQGA 4AJPA 3NTQA 4J07A 1BS2A 4KXLA 1Z9BA 1IJBA 3ZY6A 1N78A 3NEAA 2PL5A 2D2XA 3ZK8A 3OJEA 1NJ6A 2RGBA 3GFQA 1CERA 5HX7A 4ENWA 3EODA 2PUHA 1HNXB 4Z4IA 1EESA 3LY9A 2GTPA 2H9AA 4KN8A 4R1TA 1U0HC 4NOLA 3VR5D 2GK7A 1MW9X 4YQZA 3T5PA 1I7DA 1V8OA 3B1JA 4YRNA 2YVQA 3PQCA 1HWYA 2C9DA 2WIGA 1AUXA 4BXOB 2VQEB 1CRQA 1DELA 4RVDA 3B52X 4K9KA 3HY4A 4OH1A 3UCXA 4LSZA 2OB1A 3N59A 3NOVA 2JBAB 3N7AA 5A5FA 3CYFA 5IT9A 1G7TA 1N32B 1RWPA 1EM8B 4ER3A 2PK3A 3T3GA 1W35A 3JYOA 4TKLA 4OJYA 3ZJ4A 1DHRA 2VT2A 2GK6A 3KR9A 2JFBA 4Z4EA 1ECGA 1ZGGA 4ZEXA 4EB6B 1W9MA 2AWOA 3OCJA 4UTZA 3SLKA 5A9SB 4U7WA 1TCAA 3VQTA 3OIDA 3WMGA 4ITUA 2AT1A 4DJDC 3DMHA 5KQMA 4NH4A 1OU4A 4OP1A 4F0JA 4A8JC 2VLBA 2JLWA 2JGEA 3GZNB 3MXTA 3LF1A 1ZSNA 2AQIA 2OFPA 2IXBA 3A04A 5K0ZA 3UKJA 1P44A 5EHIA 2ZCJA 5TGZA 4ZVRA 5FNVB 5JC8A 2R97A 4KIJA 2XYRA 1LC3A 4E51A 4WW0A 5KVAA 2QMYA 4BLQA 1S2MA 4Q7EA 2VJPA 4ZQIA 1FRQA 1GUAA 1U9YA 3QPUA 1JPJA 1M5UA 5AXDA 5B1DA 5IRCD 2GOYA 4JXXA 2CK3D 1E4VA 1Z5VA 1UF9A 4HMPA 3FOBA 5B7PA 4E5DA 3RLIA 1XFDA 2B9VA 3DLBA 5LWHA 2NZUG 2QQEA 5IZ4A 1WNFA 1X8KA 3O2SB 3USZA 2EATA 1JDUA 3QYFA 1D4ZA 3TR5A 1K0FA 1SG6A 1TTTA 4HQRA 4EI8A 4CMCA 2N46A 2V6IA 3KE8A 1D2MA 2XGMA 2Z1MA 4DKJA 2GWHA 1PGJA 1QGDA 2O2SA 3LZDA 4LCBA 4LYDA 1NG9A 1JYEA 1AV6A 5KOIA 3OIWA 2E4YA 4NV3A 4OLHA 4RK6A 5IJ0A 2C54A 4NBNA 1BU8A 2YDYA 1UAYA 2C20A 3WWZA 3TBFA 1G55A 4TGLA 5L4SA 3RSZA 3DVQX 4UTPA 1FNDA 1X0VA 1YB7A 3I32A 3ZCXA 1GGVA 1MB0A 4CG3A 1VLVA 2C1XA 2EX0A 5C46F 3S81A 2ZI6A 3KTFA 4NDAA 2XUOA 4WK6A 4QUGA 1D2GA 4RVFA 1YR3A 4YRKA 1NZJA 3R7WA 4HNUA 1XL1A 3H9QA 1Y81A 2FFRA 1PFVA 3KUDA 3OOYA 2ZE7A 2O8BB 2YUTA 1ZIOA 1WABA 3RRXA 4FM9A 1VG0B 2AWNA 4K9PA 4PLPA 1K4KA 1RI4A 2GLUA 2HQOA 3DKRA 3MOSA 3HB0A 2ZSBA 4FGSA 5FQOA 2ERXA 2NUAA 2OZKA 4B3IA 1MLDA 1R6DA 1CKEA 4EJMA 1CDZA 2BBTA 4RPCA 5KYYB 3S5UA 3N1UA 1Q0QA 2PVPA 3DULA 4ER0A 2WBLC 3CW2A 3HJUA 1SIOA 2XXAA 4JOSA 3WP1B 2F6RA 2QE6A 5AOAA 3UHAA 4TUYA 2ZBQA 3B6IA 3O38A 1VE6A 1AK2A 1J0XO 4M0FA 3ZNNA 4BFSA 4I5EA 2R4UA 3C1TA 5DTRA 1V3TA 4YDQA 1H4TA 3PC2A 4X90A 5IYZA 3EIOA 4PBTA 4BO7A 4YP1A 3KZCA 3MRSA 2KPOA 2PFGA 4DV3B 5B3LA 2VSNA 2YX1A 3L92A 3SVTA 1ZRMA 2ETVA 2IDMA 2XUDA 4WXPA 3U80A 1CZRA 1BH2A 1ESDA 5A9TA 1NMSA 3D0RA 4D3YA 2J6BA 1JZSA 3SFTA 1JXMA 1OZGA 2VYVD 2QYOA 4FJ0A 5JCJA 3RWMB 4PYMA 2RONA 2YIJA 4ZA2A 1A8HA 4BP3A 1RYMA 1JHRA 3QPAA 2VSOA 3FCUB 1TADA 2DB3A 4QEKA 4C05A 5FUXA 1Z8DA 3MRVA 3HXQA 5IXYA 1XJ5A 4Z9YA 3C6ZA 4IEEA 1INLA 5JRJA 4TQGA 2VCYA 1WHTA 5TQVA 3P9KA 2XMGA 3GRPA 3O94A 3OLWA 1Q0ZA 1NVWQ 2ODTX 1P5JA 5ESXA 2Z8YM 4MUGA 5I4IA 5AM2A 2YY6A 1F6DA 5B2EA 3MK31 1J5EB 2I1VB 1TUBA 2OM6A 3BFPA 3UMCA 4RU1A 5BR7A 1YVEI 1XQ1A 4FC6A 5K6AC 4FCTA 3ICEA 4F3TA 4BNLA 1M0TA 5BSTA 2C3OA 2WABA 3JQEA 5JI3E 1RKVA 3QKRB 3V2GA 3LCMA 2PRIA 4Y1EA 7AT1A 4ITVA 4UVEA 2C8JA 1LLUA 4FSDA 1QCZA 3WRVA 4C2AA 2QP9X 4G37A 4JVNA 3OP1A 4FYWA 1B0AA 4YEDA 2LWIA 1SZDA 5CAEA 1X42A 5MGNA 4MRRA 3RU2A 2WF5A 1M2OB 3RIHA 1G66A 3NHAA 3Q6IA 4M9CA 5HUQA 5GONA 2HHCA 1C1XA 4H6VA 3LQFA 2GB4A 3N76A 4LN1A 1YMVA 1C9DB 1GPYA 5DYNA 1EDOA 4CQMB 4B44A 3DH0A 3KUCA 2H4ZA 4UCQA 2WUWE 4EG0A 4F7DA 1J70A 2EKPA 4DCNA 1Y9DA 1T3ZA 4K6GA 4AP9A 2BWJA 3MQ4A 1V39A 4ZI3A 3L7MA 1TA0A 5LA6A 1BJKA 1TJ4A 1P4JA 4E21A 3GVCA 1L5HA 2ZBDA 3FWKA 1G6KA 1OF1A 2VJNA 2W6JD 3WYNA 3BKWA 3IGFA 2QJWA 1OKKD 4IHJF 3HFRA 2XY4A 3ZTTA 3EC1A 3KWLA 2WIJA 4QO8A 3UAXA 1OLUA 1D0IA 13PKA 1M34A 1CUDA 4LE0A 4P83A 4WPGA 3WB2A 3DZ8A 5IAKA 3HYLA 4I9FA 3WP0A 4YLYA 4QTYA 1MV8A 3PT9A 3AVPA 3HB7A 1V6SA 3RVKA 4EZIA 3AIIA 3AUJB 4LFAB 1PNVA 2BV3A 2W8BA 2OMEA 2Z2XA 3L7OA 3QMMA 3DB2A 1E60A 2XNSA 4E5VA 3E3LA 4PYOA 4PO3X 1XRPA 5MDHA 3E3OA 4DM7A 3P0EA 1RM5A 2X9NA 4MVJF 4Y7DA 4HYYA 1PW5A 3C4VA 3NKFA 5EJGA 1WOYA 2P68A 5CMLA 1G0NA 2WWXA 3H04A 1FVXA 2ZJAA 2J9XB 4JX9A 4BO0A 2ZBUA 3JZAA 3ZI0A 1ZOOA 1LDBA 2Y3IA 5J59A 3ZH2A 3GBVA 1AS2A 2AR7A 5JEDA 2XRZA 3VU9B 1I10A 1OYVA 2SHKA 3UWKA 2M6LA 2CFSA 1D2EA 1D2HA 1L9XA 2VEDA 3AR4A 1BN7A 2VRCD 3GR6A 4R31A 4O4LF 4BQIA 1U0NA 1PR3A 3DP9A 3IR6A 5BWMA 1DX9A 5H83A 4ZCRA 1Y7TA 4AG5A 1RRMA 2X4GA 1M1UA 2EEZA 3OQIB 1AX9A 3DDSA 5ALYA 5A7GA 1K1EA 2YRFA 3P2EA 3BSWA 3PJFA 1MG0A 4CCAA 4F9FA 3WL3A 4NS4A 2Z98A 4IWXA 1E7RA 4O08A 2FQQA 4FJ1A 1AGYA 3RJZA 3ZWNA 1T10A 3F6BX 1YBVA 4NPHA 5CB4F 4QWMA 5KQLA 5L3QA 2CFRA 3LSTA 1NMXA 4PGAA 4UASA 1E7YA 1GUYA 1COWA 2VUIB 3CUYA 5TMDA 5CNIA 2NTEA 3M1YA 4HC4A 3VPBA 1IVSA 4UBOA 4YAIA 1GU0A 2SNIE 3ROXA 5EXSA 4DXHA 5BP7A 2RFLA 5C37A 1PKEA 1BRMA 3OIUA 5AKLA 5I7OA 2AUTA 2BF4A 4JCOA 4PZZA 4BNNA 1F8XA 5ESWA 4YY3B 1PGQA 2OHIA 4J1NA 5DCYA 3K0CC 4XWWA 1NP7A 3B82A 1YRBA 3KYDA 4W9MC 2RAPA 4FLFA 1CJSA 3MHTA 1L5RA 1M8PA 2XUIA 3N0XA 3LUFA 3ASUA 1DWUA 1IJEA 4JI0B 3RS7A 4Z99A 1IG3A 1MJGA 3AUTA 3VR4A 1N6KA 5ULLA 4CVNA 2F8SA 5M29A 3KQVA 4DS3A 3FFWA 1NW5A 3QYPA 4R1SA 5CDSA 4CI0B 2Q6OA 1WLYA 2B1QA 4GKBA 4RJ2A 3V6MA 2H17A 1WW3A 2B5WA 2RG1A 4RFSA 1CUZA 2PUGA 2QSZA 1S8FA 1T8RA 5D5QA 1EH5A 1PZXA 3NHMA 2WVHA 3ED1A 3OURA 4M0KA 3ZD8A 5LQNA 4DLYA 4J0KA 2BZSA 3O0DA 4K3UA 3VDRA 4DB2A 3DEAA 3L7JA 3D7RA 1CUWA 2NO0A 3NRCA 2CXPA 5DYGA 8LDHA 3QW2A 3KB1A 3GGJA 4E5SA 2TMKA 5C35A 3CSUA 3MCAA 2WF9A 1D07A 3KOZA 3WJ2A 1M7BA 2GPTA 3PUKA 1UMDA 1W25A 4M0PA 3PXAA 2PMCA 1JDSA 3GFTA 3STWA 5EHQA 1IOLA 5GMOA 4HKTA 4HQOA 1Z5ZA 2C1EA 2CHEA 2I5PO 2JZCA 2Z3ZA 1QFSA 1ZUWA 3GRYA 4JB2A 4LE1A 4YVFA 1VJTA 4Q1AA 3B60A 1PZHA 4LOLA 3A4VA 1T2AA 2R1TB 4Q01A 4YDHB 5JVDA 1W5AA 2JG3A 5F9FA 4FE4A 3BE5A 1VPDA 3SX2A 3FNQA 1Y4DE 1EFVB 3DYIA 1KARA 3SYMA 5JAUA 3SHOA 1JQLB 2QTTA 4A8TA 2XZLA 2GKOA 1KFKB 2Q41A 1AF7A 1WO8A 1OAOC 4N0QA 4CETA 4II7A 1A7JA 2H1WA 3SXUB 4U4AA 3U09A 2GR9A 3UXHA 3CNLA 2GZRA 4JQZA 3RVLA 5CDTA 1FOEB 4IVRA 4RY2A 1GQSA 2J3LA 3OQ1A 4N5HX 4PTLA 1L5GB 3U31A 3NVKI 4IUCS 5JARA 1II9A 1TQHA 4RZ3A 2ZRFA 1E9DA 1EAMA 1RKXA 3KJZA 3LUGA 4HDMA 4P58A 4X61A 1NIJA 4CEIB 3IQXA 3INNA 1O6CA 5D5PA 3ZVRA 3MINA 3R76A 3SC2A 1M33A 3JTMA 5D3KA 5K8JB 4WOKA 3WY9A 1FMFA 3DVRX 3HA5A 2WHXA 2WSSD 3LVFO 4M8KA 4QDTA 1P1BA 3I1IA 4YMVA 2FMIA 3U1BA 2B0JA 2C92A 3FZGA 5JH7A 4QO7A 4O1HA 2CXSA 1LV8A 1ORTA 3VZDA 1XJWA 4E15A 4LVCA 2HRQA 1B00A 1U2ZA 1RZRD 3RI3A 3GFRA 3VGJA 3W2TA 2XNKA 4DXDA 2AJLI 3ET4A 1H94A 3HDJA 1NXWA 3P9YA 3SKVA 1SC3A 16PKA 5IT5A 5JD3A 4ZDWA 1L4GA 2MR6A 3N53A 3B70A 4FP9A 3PFWO 3F5FA 2BJWA 1QGYA 4H7KA 5BN5B 3VO1A 4PFQA 1YZ3A 3WS7A 4UHCA 2PUEA 3OWHA 3OM0A 4ISCA 5KJ6A 1Y8AA 2YN4A 1M8FA 4AZSA 4MS3A 1QGZA 2XMPA 1WF6A 2ZBRA 1RXWA 4QPDA 4QXMA 4UM8B 2EJBA 4NOMA 5HFAA 4RK1A 4UU8A 4YI3A 3RS3A 3VYUB 4D8TA 2Q7XA 3TQQA 3DJFA 4ZPXA 1EFKA 4UMDA 1L8QA 2B30A 1VJCA 2HM7A 1ZD1A 3IVRA 4YTEA 4PLFA 2B4RO 3AERA 3MGCA 1USWA 3Q8XB 3AKZA 1LWNA 4QPZA 3KJGA 5L3SB 3F49S 3L7KA 1GPJA 4GH5A 4O1IA 5L3RA 2PT7A 2DFPA 4CN9A 1E98A 3L0OA 2F7SA 5ITZB 1NA5A 2CF5A 2DQYA 4FEGA 4XGQA 1M2FA 2NO6A 4DHWA 3EW9A 5AVUA 5ALGA 3B5JA 4J6FA 4NBUA 1Z35A 3ND7A 1EUZA 3I8OA 5FI0B 2QKYA 1UMCA 3DXXA 4F06A 4LQ4A 4J1QA 1W76A 2KS6A 2WOOA 2XYQA 1MAWA 2IUYA 2YWEA 3KXDA 3EXFA 4LAFA 1K4MA 1U2QA 2WRZA 3B13B 3ND5A 4GGMX 4ZCLA 3UFXA 2YTZA 5CCEA 3B3GA 4UAGA 3NG1A 1R9JA 5I8PA 1YR2A 5G2OA 1P61B 4G0PA 1USUA 1QPGA 4JT4A 4LWQA 4E6PA 3QX3A 3PEFA 4TTPA 1XQ6A 1N5OX 4D9NA 4GC9A 3QV2A 4H7HA 1M7GA 3BFJA 1F3LA 1IIRA 1XTTA 3RBVA 1WPRA 2FFBA 4OKNA 5EUQB 1MF7A 4EABA 3KR2A 1L5OA 4LRWA 4YWHA 3AEQA 1ZM2A 1Y6RA 3VUEA 2IW3A 1ENPA 3MS2A 5JROA 3N2KA 3H6GA 5FWDA 2QJFA 2Q1UA 4F45A 4B3GA 1NHWA 4HN2A 4C08A 1UQRA 2YYZA 3W5AA 4Z9BA 1XZCA 3DMNA 2FW7A 1N5IA 2JIOA 3JR3A 3KEMA 4BC0A 1X80A 4HDQB 2IPNA 2Q28A 3I28A 4ASUD 1WU7A 2QMEA 2NXCA 5A5VA 5DFAA 2BBWA 4OATA 3CWQA 4KNYA 2PA3A 3FE2A 4UU7A 3H9UA 4H15A 4ABYA 1M1XB 3OM1A 3FFXA 4KE7A 4MH0R 4EMTA 3GJ6A 4G4SP 3MGBA 4N5IX 1BC5A 1JHAA 3PGKA 4N01A 1KAMA 5DMXA 3S1AB 3KOWA 4PX2A 3S2YA 2FSIA 5I6DA 5IJWA 3VTKA 2DFKB 4DC1A 4WX2B 5K0TA 3BH7A 3LGXA 4KFTA 3SEFA 5BSGA 5AW7A 5JYDA 1ZIPA 2RH4A 4GP6A 4RE5A 5DKFA 3IR7A 3KS9A 3CRVA 3DMPA 3BMQA 3K8QA 4QU9A 1BMFA 2A59A 2JIZA 5EFOA 1MQSA 5FIUA 3GEGA 3PC8A 1QFMA 3UUGA 3K53A 2NO9A 4HJXA 2W2TA 1A8PA 4EF6A 5IFKA 1DE0A 2C2HA 1JHDA 3E4DA 4H2DA 4AY2A 3O2NA 1ZU4A 3DEFA 2WWHA 4J6EA 5JMWA 3DLIA 2O1WA 4A0GA 4AMYA 5L3ZA 4LNAA 1FPQA 4A6DA 5ICMA 1UBEA 2XCQA 4RBNA 4AC9A 1BA3A 1UC4B 3OZEA 3PI7A 2HO4A 2H5LA 3ZGXA 4BRWA 3CRZA 4LYJA 1XA4A 1GTG1 3GPBA 2FLVA 1Z0JA 3AP1A 1BXGB 2GLXA 3EJ6A 2IJGX 3PUWA 2F43A 4O59O 2EBHX 4JI4B 3H1PA 1HGXA 6GPBA 4W6ZA 3ICQB 1GG9A 4B87A 4B0PA 1DKMA 4KQXA 3F2IA 3KVOA 4FLEA 4IKEA 2ASEA 2FK7A 1S2LA 4H1TA 1ZZGA 5I47A 5ER9A 2F1JA 2I8LA 2YFKA 4F6RB 4ZYTA 3KAJA 3ZHVA 2JLQA 3KKEA 3DE0X 2A35A 3OOSA 4YA6A 5DNDA 2R79A 821PA 1YCFA 4YRAA 1GXSA 5DX1A 1DIGA 1EX6A 1M3SA 1D4AA 1VFPA 8GPBA 4NENB 2P62A 3RRNA 2JIDA 2C1ZA 1GUZA 5AYVA 4D92A 2VDRB 1M67A 1XZHA 4OTZA 1R10A 1BGVA 2BHSA 5C31A 4D26A 4KR2A 1TM4E 3PGJA 1KMMA 3RKUA 4P98A 4M3NA 3IJRA 3W5UA 4HPXB 4O2BA 4BUZA 4NFLA 1KY5A 2PUTA 2WEKA 2OA0A 1PDWA 2WIAA 3ISJA 3W5IA 3BZWA 1GRQA 1Y34E 5LNK6 2W2LD 3R3JA 4XVHA 1M1ZA 2P40A 3KAPA 4A92A 4D4GA 2Q99A 3C5HA 1ORIA 2MIIA 3OLVA 1QX4A 4K6MA 4PS1A 3IULA 4V03A 3U37A 2AFIB 1C1DB 4A2WA 4DDTA 5C80A 2B2CA 3L82B 1KJWA 3HL0A 4EPYA 1RR6A 1IOWA 3HWX1 5T4BA 1L5MA 2WYOA 2TSYB 3QY0A 1SXIA 2R00C 5JTTA 2MU1A 5CLLA 2NU7B 2B1JA 1T0BA 3PF9A 5CCXA 1MX3A 2DR3A 2XQJA 4HQNA 4KBGA 3F3KA 2G70A 1H2XA 1R18A 1T5BA 1ZW6A 3V97A 2WUFA 5AM3A 4RH3A 4ALKA 4JYMA 2ANCA 4QATA 1NVUQ 1YDEA 2ATEA 1OLXB 1JKJA 1GR1A 4X85A 4S12A 3BERA 1OH7A 1UWLA 5BN1A 3W9YA 5HILA 4B2PA 3GRVA 4NTZA 3L8GA 4FFPA 2HWXA 2OQIA 3Q5DA 4FCCA 4UTXA 2WINI 4PXAA 1NVXQ 3TXAA 4Q4AA 1B8VA 3IEXA 3AR8A 4YLGA 3OEEA 1NYRA 2IYQA 4J0EA 5EC8A 1PJTA 3SOZA 5IDWA 2E87A 2YOGA 4KLAA 2IH4A 4EGQA 1F51E 4FSXA 2WTUA 2FEXA 2VBFA 1JR3D 4J9VA 1VQ1A 2OZLA 4I6JA 1QO7A 4MYCA 1NBOA 4RK5A 4Z9XA 4PYNA 1I4EB 1CY8A 3EVGA 4YMSA 5FYQA 5IPFA 1DAGA 2FUEA 4FHCA 4P7BA 2O3SA 1G0OA 2EDCA 2P9ZA 3E8XA 1E79A 5F1PA 1TW2A 5CK4A 5FBZA 4ZYXA 1TQ8A 1MG5A 1GTJ1 2OV3A 2WYHA 4FILA 4R5HA 4ZT6A 1UWCA 2WDZA 2AKEA 3G9TA 4M1KA 4KK4A 1I1QB 4ZOAA 1SUEA 1M7HA 3WL8A 1AKRA 4YV2A 3WLQA 1O94A 2WMOB 3GG2A 4MR8A 2PCJA 1A69A 2MJLA 4QNMA 2P30A 1T2DA 4MZXA 2HA2A 2ZKLA 4MARA 1SR8A 3ZDQA 2JLAA 5D7BA 4D9MA 1EVYA 1GCUA 2OT3B 1PP4A 2JLCA 4KWIA 5GV8A 3GN2A 1OAAA 3IRUA 3PC4A 4TM8A 4L4YA 3M83A 3W1EA 1NXVA 3RTEA 3WDMA 3X1JA 3E81A 2BKEA 2WHPB 3BF8A 4R2WA 4ZEVA 1A1VA 2ZBGA 1W93A 3H2JA 4AKGA 2PRZA 3EXEA 3P8ZA 2V7GA 2V7UA 1RABA 1YE5A 1SCUB 1UOEA 2P35A 2X42A 4NCIA 3GLFB 1J49A 3K16A 4HS9A 1IN4A 4KLZA 1JS1X 1U2TA 1VB3A 5DTQA 2GPSA 3T7KA 2XCSB 2J7PA 4KXUA 3N6XA 1I5RA 4LW8A 1BG6A 3RHSA 1H69A 1WZ2A 3I30X 2BIFA 1GGKA 1PJQA 4TMZA 3WXMA 4R7GA 3EPRA 3H7AA 3LVBA 1U99A 2ONJA 4FE3A 1FS5A 2RGWA 4FMPA 4X71A 3MWJA 3DV9A 1E2KA 1DJOA 1P4AA 1OW3B 2C99A 3D2LA 4LYFA 4IHAA 1XZAA 4PQFA 5IBRA 4F9EA 5LM3A 3T1YB 3WGKA 5KTYA 3PRYA 3K0SA 5ICFA 1EUDB 3B1WA 3GYGA 3AILA 5HIAA 1SUAA 5EP4A 2G9ZA 4ZVLA 3ZIDA 5AW0A 4DVGA 1NUUA 1FNBA 1XRRA 2PBLA 1CYEA 2PAFA 2XDAA 2QT1A 4P7JA 1P5FA 4UNPA 4YR7A 1H6AA 2Y9MB 3BK7A 3QY9A 1FW6A 1OFUA 2H92A 2A1TS 3WLOA 1AMUA 4Y1GA 1NNUA 2AG1A 1DFIA 4QELA 1QP0A 2FJPA 1VMEA 4J0IA 5M2QA 1DV1A 1JZQA 2ZWPA 3NFRA 3QE3A 4IXMA 3SYLA 2O52A 5HHTA 4JFAA 4JAVC 4NI5A 4ZI7A 3E48A 3B7GA 2HU8A 3EN0A 4L4UA 4GOKA 1Z6ZA 4U5QA 5DBIA 3TAHA 3OE7A 2YWFA 3EZYA 4I4TB 4WZBB 4AJNA 3V4VB 1ZAYA 3B6JA 3I1JA 4F1KA 4CT4B 2FVYA 3GUHA 5BV8A 4PC7A 2W58A 5DNAA 2DRIA 4G24A 3AH8A 2MSWA 3F98A 2GRUA 1KVQA 4DUGD 3EA0A 5TJ9A 2XUPA 1TNDA 2PXCA 3ICCA 5CXXA 3HU3A 1I13A 3GFSA 5THKA 3TLBA 3UGTA 5FL7A 1W0JA 3KK0A 4XVQA 4DIBA 1V26A 3LYAA 4PG7A 4YJFA 3TAXA 2MSEB 4LXTA 3BA1A 2J4CA 4TUYF 3VPAA 3HDQA 4MS4A 1VKOA 1W0KD 1BVRA 2PT5A 1YTUA 1ARZA 2AYXA 3BUSA 4N12A 5IYZF 3DE6X 2HTFA 1UJCA 2Y4OA 2ICAA 4MR9A 5J4VA 1M75A 3R8FA 1HC7A 3JTEA 5KC8A 3Q8WA 1FMLA 4X1YA 3ROEA 4QODA 4GLFA 3GAZA 1CW2B 3PA6A 4R9UC 4P5PA 4JBIA 3T12A 4EB0A 3FGZA 4L27A 4O4JB 1JEJA 3NC0C 1G5PA 4L5BA 3UVEA 2V59A 1ES9A 3HP7A 1RYFA 4M0CA 4PNZA 1RXVA 3UV3A 1PT5A 4GPD1 1L4YA 3LKVA 2AFIE 2WTBA 1H65A 1Y5NA 2XAAA 2XNDD 1FSZA 5TVKA 4PAWA 1U8YA 1C4OA 3GJQA 4MUKA 2Y1EA 5D51S 4YI5A 1T6ZA 1ZD2P 2Z3WA 3ZXSA 5ALIA 5J43A 4E7PA 4D8XA 1DO0A 1H3EA 4HWGA 2YCLA 5CM2Z 2H1RA 2GFQA 3ZJUA 3QVWA 4EAAA 2XDYA 3G2NA 3IPXA 1XZBA 4PEVA 3VR3D 2XIQA 1EZ1A 2L82A 4WESA 4BO6A 3OCXA 5AKJA 2ZPUA 3PF8A 2AQ8A 3IBFA 4W8OA 4EX7A 1XTQA 2NVUB 3P2MA 1MNAA 1ZCAA 1CJVC 1LS1A 3KXIA 1V11B 1A9ZA 1IZ8A 2I4NA 2F17A 2OC4A 3L7CA 5AIAA 1GPUA 4MUNA 1JMVA 1DRVA 4CLXA 2LIVA 2UYCA 3ZY5A 3AIOA 1DRWA 2IBMA 3BQNB 4WK4B 2YZMA 4AYTA 1SD1A 4RKRA 5JCOA 5CVUA 1U7TA 2PKRA 1N6IA 1OAKA 2PJUA 2WZBA 3RFCA 5KTKA 2PUCA 3J81k 1GNTA 3GLGB 3FVTA 3RYTC 3ZIAD 2LDBA 4HZUA 3ZUGA 1M76A 2OKGA 2PWZA 3GDHA 4K03A 3E7PA 5H0IA 4MRMB 1FPMA 3O8CA 2PBFA 1US8A 3ONFA 4G2TA 1CBUA 4Q1VA 2GPBA 5DRYA 5GIPE 3PGMA 2EF0A 3E7WA 5GONF 2CW5A 4IJVA 2GJAA 4O5OA 1YU9A 4KQ6A 3ORRA 1R12A 2P2ZA 4JC8A 4D8VA 2C59A 5E7IA 1G21A 1URPA 3IX7A 1JL3A 3LSYA 4HEQA 1PG2A 3O1JC 2P1ZA 4OO3A 5ICEA 4H7EA 1NSTA 1Y7LA 3O8NA 5LA6F 2ON6A 4L8WB 3H1TA 2FOLA 2CNWA 2RHWA 2ZLBA 4YAKA 3O4FA 2DX7A 4RGBA 1W59A 1NMQA 2KW5A 3QU4A 4UMVA 2ORED 3QLUA 1RYNA 4ZIRA 3V1KA 5K8UA 2FOXA 1MW8X 3N7TA 4WUVA 2AZXA 1ULZA 2D2VA 4EJ2A 2E89A 1C4WA 2C4MA 2H4FA 4B33A 3GLFE 2Z08A 3COJA 4EVIA 1A95A 2A1UB 4MNTA 2J9FA 3PCTA 3FIUA 1VP3A 4CMIB 4W1QA 2QROA 1P1HA 1K5GA 1S96A 5J58A 2BFEB 1BXKA 3TJMA 4CLRB 3KYCA 4I8IA 4A1FA 1W52X 2DOKA 2H63A 3TTSA 4G36A 1RXSA 4X6YA 4N3CA 3L07A 2X9GA 4ND7A 4W99A 3TL3A 3ZU6A 5CCDA 3KD3A 3K96A 3RRZA 4DXAA 2B1IA 1JLLA 4TV8A 4MVJP 5DMHA 3F73A 3DFMA 2CFTA 5FUVA 4CCWA 4WKCA 4UU1A 3G85A 4Y2SA 2CMDA 3RABA 1QK3A 2I99A 1I3MA 2AVNA 2JA2A 4K81B 2B92A 1ZCZA 2FPPA 1QCCA 4MUEA 3FUTA 4NU5A 2DLNA 4ZN6A 3M6XA 4NFSA 4OK5A 1LJ8A 3EGWA 4JH0A 1KE2A 3A26A 1NZFA 4PS0A 2R86A 3I8XA 4D4LA 2BGGA 2VHQA 2LPMA 3KQLA 4MSUA 1DMSA 3M89A 4KOAA 3RSCA 4R4JA 1M2KA 1JR4A 1S2NA 1SBHA 5F4ZA 3W2HA 3V1TC 2CCKA 4CMEC 4WZBE 4BKMA 4EX6A 4ZVVA 2ZYTX 1Q1AA 1RLMA 2JDIA 1ZISA 3GJXC 1IONA 1VLMA 1K8YB 2SKEA 1E3QA 2QR2A 2HLDD 5KQRA 1DEKA 1E5VA 4ACAA 5EXPA 1AC5A 2HLPA 5K01A 2Z6UA 1B6SA 5FYDA 4BNFA 2J3HA 3LP8A 1PFKA 2R6AA 1PYGA 2BOVA 2ZRAA 3N9IA 3WLIA 1Q0SA 4BKUA 5L9AA 3I0NA 1W1IA 2HCJB 2ZZMA 4R1PA 4GI5A 2GXSA 1E5QA 3NKLA 1H1TA 4GYYA 1RYHA 4MI6A 4LEIA 2B7BA 5BQXA 4TN1A 3ZJ5A 5H81A 2VO1A 1X9IA 4PBSA 4C30A 4UPVA 2DHDA 3HVKA 3H5LA 4KQ1A 1JDZA 2EX1A 3H05A 5EA2A 1YCHA 4ZT7A 1RBQA 2E48A 4WI1A 1P81A 2FSHA 1RHRA 4FOOA 3DLAA 4RELA 4R68A 5ITVA 3H9GA 4I2VA 2QA5A 1PQYA 1B16A 3RK4A 2Y99A 4OAOA 4WXEA 4G1UC 2VVTA 4RQTA 1PG0A 2HF2A 4HX2A 2QE7A 3JQBC 3FDZA 3H2KA 2GCOB 5HE9A 3TPFA 2VR1A 3EUWA 2I34A 3IUEA 1LI4A 4MWTA 3OTQA 4WOCA 2B36A 1FXUA 4MIKA 2ZYAA 1NQVA 5FX2A 3RWBA 2WQ7A 3WJAA 1NGSA 2XMSA 2NIPA 4XCXA 1QQBA 2DZDA 3C3DA 4LHZA 1V43A 1X38A 4GOLD 2R25B 2BR3A 3HADA 1KI6B 4BNYA 4Z4HA 2IY8A 2Y1WA 1LNZA 1IYZA 4P4UA 5FJJA 4EMSA 1DDIA 3RVSA 2SBTA 4F4IA 1H5QA 2XNCA 2NZ2A 1TECE 4RTOA 3JQ8A 1S3FA 4TXLA 4C06A 1N4DA 5JVDF 2Y1GA 1R4ZA 2WFLB 4V39A 3DL0A 2L42A 3IOCA 4KE6A 3T4XA 4GX2A 3TFQA 4R8KA 4KHPB 3IUQA 4JT2A 1SKAA 3L9WA 2IHYA 1FMJA 1W88A 3GF4A 5LOVB 2QL9A 3EVEA 1ZK1A 2YWXA 2QMQA 4W5RA 3KU1A 1I30A 2BEUA 3BFVA 3EWAA 3LQ4A 5IT4A 5TLSA 3GLGE 1BEUB 3BIOA 1ZLYA 1BOOA 4H77A 4B4OA 4BNKA 1TRKA 3VC1A 3HHEA 1Z7YA 3SC6A 1E9FA 1QQTA 2H65A 3KQMA 3N2YA 4PHCA 2ZS9A 4U2EA 4CIWA 4DUYB 4C2TA 5EIXA 3OTIA 4LRTB 4MV7A 4AY6A 2R6JA 1N0VC 4L4ZA 1UJBA 4J94A 3CKMA 3QYJA 4MGZR 4U6SA 3VKFA 1L7AA 4GI3A 4DNFA 5FPSA 3Q9SA 4HQ0A 4MVXA 1SXJA 2IUEA 5A02A 3ZZUA 2IYEA 2Q6KA 3IVAA 1ZCJA 2IYZA 3KV1A 4DR5B 2O2CA 3U0BA 1U31A 1K75A 3GVXA 1MB3A 5J4HA 5JH7F 4O0MA 2Q4BA 4CG0A 3AFGA 1VLHA 1OPRA 4Z0PA 4UHHA 1CJTC 5IKPA 2IHKA 1V4NA 3DF7A 4WSOA 1UKYA 1AGNA 1VE1A 3MTJA 3Q85A 4RGYA 1USGA 4RCZA 3VZQA 3B2EA 3CIFA 4WVLA 5GAJA 4BMVA 1ZSYA 4A5SA 1E2HA 4ZAGA 3MYRA 3DFUA 5FFFA 2ZI5A 1G8MA 3L40A 2E5FA 3LUPA 3B5IA 2VJMB 4ZAYA 3WRWA 3CUEF 5EXXA 4YMGA 3CLKA 3O83A 3MA0A 3WGMA 4G4GA 4W4TA 1KYVA 1XMOB 1DXHA 4LJ8A 4RPJA 7REQA 2VFAA 3ONNA 2CJFA 3PNQA 3PGXA 1O95C 2C3PA 4U7TB 1B0PA 2A9JA 3ES9A 2ZGVA 4YQEA 5ITWA 2WIBA 3I62A 2Q2VA 4JODA 3F7NA 4LYGA 3GGGA 3UJAA 1TW3A 2BEVA 3LFUA 1WY5A 3K35A 3TLCA 3V8EA 1TEVA 4XEHA 2YDXA 1SELA 4HDCA 4YRIA 2JC3A 3FUCA 1HDGO 3RG2A 4AG3A 1C8VB 4DBLE 1MN6A 5JW6A 5DN6D 4FNOA 1CQPA 5C18A 2Q5JA 3O5AA 4YJGB 5ES4B 2O48X 2XTNA 5C7OO 1QWOA 3IELA 4A8JB 4N65A 3WGZA 4DLVA 1KYWA 1Z8HA 4TMYA 5CW2A 5CD9A 2ORYA 4E5UA 1F1BA 1MDBA 4KWEA 3G0BA 2OCLA 4QFCA 3SC4A 4HF7A 3ZI7A 1M1YA 2VHVA 5FWXB 3VUFA 2C7PA 3V55A 2FYTA 1MQ9A 1CUUA 1BCRB 2D1FA 4Y1FA 4LGYA 5EWJB 1Z2AA 1E66A 1SIWA 1ZESA 2IIPA 2OCKA 3JALB 1U2GC 1ZHFA 2HMUA 2OXRA 1A2KC 3GYBA 1UXOA 1ZWKA 5JQGA 4FD3A 4XUEA 4BMYA 1VCIA 1AUQA 2ZUVA 2VDQB 3CV3A 1A88A 1GZ7A 1TLTA 3H8SA 3R3VA 4IIJB 2NSDA 1RJWA 2AOTB 3HSSA 3I39X 2EP7A 3BGVA 1E2NA 1B76A 1M2JA 1ZXLA 3LWZA 4MRAA 5C8YA 3IQZA 4BWGA 4EUNA 1ZCFA 5CH8A 1E8DA 2QP4A 2WA2A 2NXWA 2IXDA 1FLVA 1DUSA 2GBGA 5AVXA 3FGNA 3HXLA 1IQ0A 1ULBA 1L4MA 1ZGBA 3AL2A 3W2IA 1G6Q1 4M8IA 1DBIA 3STVA 2IZ0A 2WWGA 2ZJBA 1W85B 3OE1A 2FSGA 4LECA 2WKRA 3F9RA 2WFZA 4EPRA 3IOMA 2I3BA 3IJ5A 4B6GA 5FV7A 1NQWA 3FOZA 1C4XA 3DVLA 2CL5A 1PS9A 1S2OA 4MEJA 2G3YA 2J87A 5ENVA 2I2BA 1DU4A 3OY7A 2PUDA 1WKBA 1SXQA 1G8HA 4BFLA 2P2DA 3ZTWA 3D1LA 2WU1A 3TO5A 4E5KA 1ZQ9A 2OXIA 3QW4B 1Z2EA 4YJ3B 5IULC 1CY7A 4KPGA 1U4SA 2O6HA 3HVIA 3ZBUA 4HV4A 1XZMA 2P4SA 1U4OA 3MWEA 5LFAA 2HFJA 5AKKA 1ZPDA 2GM4A 4B82A 1TUIA 1X7XA 2O20A 2YNMD 3A58B 3DXFA 5KTTA 3C97A 4Q1BA 5G4KB 5BMOA 1VKNA 2ZK7A 5CNMA 3WIEA 4QARA 3B20A 4MP6A 5EIEA 5HIIA 3RM3A 4NOKA 4RMHA 1ONSA 1QV6A 4NBKA 2B2NA 1KMNA 1ENYA 2D2EA 1QO0D 1KY3A 2FG7C 4O4HF 5DHTA 4MKHA 5IC5A 3PD0A 2LV8A 1P33A 2W2XA 3DDWA 4EGSA 1PT8A 1KL7A 4YJDA 1A5SB 1P4RA 1IFXA 3D7NA 3NJ8A 4OV6B 1U65A 4OPMA 4P1ZA 5BWCA 2BZ1A 4WN9B 3TLJA 3L1UA 1T4DA 1VPWA 2HWUA 1XDBA 2Q8QA 4YFYA 3NC4A 4A36A 1HEYA 1Q95A 3GFFA 3E9CA 4NZNA 3FOEC 1G7CA 5JMPA 5KQSA 1JIUA 4UQLA 2YHBA 1CHDA 2Z1DA 3GH1A 2CJWB 5J4YA 3D4NA 4BNHA 3QKIA