4DLZA

H-ras set 2 ca(oac)2/dte, ordered off
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
166
structure length
166
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDEYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Shift in the Equilibrium between On and Off States of the Allosteric Switch in Ras-GppNHp Affected by Small Molecules and Bulk Solvent Composition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 63
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2012-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dlzA00
4ILEA 4TMKA 2YHSA 5EQTA 3RVBA 3TVDA 2R8RA 1NBMA 3AF3A 4K46A 5FBQB 3M6AA 3VU9B 3THXA 4FD2A 2GCPA 2H1LA 2DB3A 3QG5A 3TUJC 1LW7A 2V4ZA 1E1RA 3THWB 2D4HA 4PAOA 4W5HA 1YZNA 1H8HA 1FMJA 2QAGA 3FDIA 4LHZA 3AF2A 1LS1A 3GLIB 2HEIA 5FOUA 2DFTA 2YYZA 3MSXA 3SHWA 3SDZA 4EPWA 1V43A 1CF4A 2ORVA 2ZTSA 4IEEA 5EE5B 2ASEA 5DN6D 3NBXX 3UIEA 3NG1A 4MUBA 4GDFA 2VL7A 4D4KA 2ODEA 1N5LA 2KJQA 4DLUA 4X8OA 2CLCX 1G18A 2OCBA 2I1QA 1JEEA 1Z28A 3NDBB 4FMCB 1BYIA 2KE5A 4ZPXA 3KL4A 2RGXA 1KO8A 3ZQJA 1FFHA 1GM5A 5DGXA 2OXCA 2ZR0A 2ZS7A 1DELA 1G4AE 1ZAKA 4GZMA 1JECA 4A1FA 2WBLC 1N2CE 1NY5A 4EJSA 4B43A 5DLQC 1PV4A 4EPVA 4MA4A 2KI5A 1G7TA 4IDHA 3R8CA 2N42A 4P32A 1D5CA 1KMQA 1EWRA 1IY1A 3JVVA 2ATXA 1S3SA 2IK8A 3O8CA 3ICEA 1NMYA 3T12A 2YC2C 3NEYA 4IJMA 1RC8A 5AJVB 1XMVA 1OHHA 4BLRA 1TAGA 3P26A 4C4PA 4AWXA 4IXMA 2ZRKA 3EAQA 5JCPA 2C9CA 3A36A 2P2LA 4PAMA 4S35A 4NE2A 5AUQA 4BECA 2ZRHA 5CDFE 3TR0A 4IRUB 2GEDA 4IVRA 3I3SR 4G5QA 2J0QA 4WZ6A 2GNOA 2A5GA 3CRRA 5KDLA 3L8ZA 3SS8A 1NNEA 4WXPA 1R0YA 1P9NA 2ZPTX 4P4TA 1W1WA 1KI7A 5FL7D 1G3RA 4CF7A 1HQYE 3ZQ6A 1X1SA 2PX3A 2ZJ5A 1HE8B 3DDCA 1GOTA 4NCNA 1OT3A 3HWSA 5FOTA 4UJ5A 4OK5A 2G9NA 1P2TA 2QAGC 4ASUD 3FOZA 4ERNA 1ZD8A 1W4CA 2ZJZA 3LWNA 1EFUA 1BMFD 4O2LA 2NTYC 3ZYCA 1TTTA 2FX3A 4H1VA 4H1UA 2WMNB 3UATA 4IDPA 4TYWA 1VCOA 3IUYA 4JLMA 5A0FA 4BFXA 4B73A 5CIWA 3GJ8A 4KFUA 2W6JA 1KK1A 1ZUIA 3W6OA 1NBMD 2KSQA 1ZNYA 1M8PA 2WJGA 3CPJB 1E1RD 2C04A 5LB2A 5JHGB 3ADDA 1F6BA 4V0NA 3AUYA 1H8HD 4LJYA 4K8OA 2OCYC 2VPPA 5EXTA 3TBKA 1QHXA 2JLUA 1DAFA 4RFSB 3I5XA 1G17A 3QSYA 3N2EA 2IYTA 1PJRA 3IQXA 1UFQA 3GJ7A 4EJSC 2GA8A 2YJTD 4JKIA 1J99A 2CEAA 3CONA 3U60B 3QVVA 3W3AA 4O2RA 2PZEA 3P27A 1PUJA 2OFOA 4NCHA 4P0TA 4TZ0A 1KJWA 2N1BA 3AF4A 4Q1AA 1Z07A 2R6DA 2X8AA 1E4YA 4NCKA 1QRAA 3WYGA 4B76A 3EG5A 4EDHA 1KI3A 1TQ6A 4MKHA 2VP6A 1GL6A 2ZRFA 2ZJAA 2R9VA 3E2IA 5UKDA 4A36A 3K0SA 2ZJ8A 4Z1MA 1XF9A 3V4RA 1G20E 1Q20A 4DCUA 4F4IA 1KI8A 1XTJA 4XTCS 4QKQA 4B3BA 4NTZA 5HCNA 4CIDA 1M34E 4WXRA 2VP5A 1U94A 3UMSA 4WVFA 4B74A 3UPUA 3L82B 3FVQA 2GBLA 3CF2A 4JJKA 1G8FA 4MKFA 4ARZA 1OHHD 5FOXA 4TTPA 3DM9B 1YQTA 2MSDB 4D6PA 1XTQA 4X8HA 1XD8A 4CEIB 4PTLA 2YZ2A 3LQQA 3A1SA 4LJ8A 1RVDA 3EW9A 5L3SA 1S96A 2V9PA 1P60A 2BKUA 1CEEA 3I92A 3SJBA 1G3UA 2WIAA 3G0HA 2DR3A 1N6IA 1XJQA 4QGFA 2W2TA 4CVNA 3EWAA 3KFVA 2IEZA 2Q21A 3X1DA 1TF5A 3X1YA 1ZNXA 1QHYA 3AF1A 4GL2A 1B0UA 3DZDA 1OH8A 2ZEJA 5BXQC 1Z47A 2BOVA 4I1VA 2J0UA 4O3MA 3A8TA 2GEUA 3ZZTA 1XMJA 1N6HA 5CLQA 3TK1A 4GSYA 1KSGA 3W5IA 2AWNA 3F5FA 2ONKA 4JKYA 2NZ8A 4K81B 4BFWA 3NC1C 3ASYA 4Q9JA 3LBNA 1KK0A 2VSFA 1SULA 1II8B 3RS0A 2GETA 2H57A 1Z0JA 3FPAA 5G53C 1S0UA 3C41J 2RGCA 1UBCA 1NRJB 5HE9A 1OH5A 2O8DA 2FV8A 2IYUA 5FFMA 1JPNA 4GRAA 2PCLA 2E1RA 1P9WA 2HDNB 2QUZA 4GOJA 2GF9A 1CLUA 2QP9X 4Q4HA 1NG9A 3GJ0A 2PL3A 1SVIA 2C99A 3K9HA 2XXAB 4Q1EA 5JECA 1F3OA 1YZKA 2XSZA 4KAXA 3AV0B 2PBRA 4JBWA 1W46A 3EA0A 4LDJA 2E9SA 3DOFA 4OQXA 1Q0UA 1R0WA 3TSOA 4XOIA 4EPXA 4C7OB 4L5BA 4GOKA 1UEIA 1J90A 4EIWA 2QL6A 1ZYUA 1QHHA 4X8MA 4DB4A 1XJ0A 1L4YA 2G0TA 1VKJA 4BPBA 4O0MA 4AC9A 5K8UA 2XB4A 2FPLA 4U02A 1E32A 4V02A 1FP7A 2WZQA 1YU9A 1FW6A 4B3XA 3BB4A 3JVUA 4XSHA 1KO1A 3LLMA 4Z1MD 1A82A 1JR3E 2MMCA 2ZITA 4D80A 3RNLA 2V8OA 2J9RA 3K0AB 2XB2A 4C0LA 4LI0A 5GVSA 2I4IA 2ZI5A 4MRPA 1TF7A 3AB3A 1NN1A 3RANA 4TZ6A 3HYTA 3DKPA 1P75A 2Q9AA 4L16A 1CJVC 1DBSA 1VYTA 4PPFA 5JHHB 1GDDA 1G8HA 1HT1E 1ZD9A 2KBEA 2NOAA 1U0LA 3EIHA 2QN6A 3CX6A 5DISB 5SZIA 4LYAA 1IY2A 4JBYA 2YKGA 1DAKA 5JS8A 3AVUA 2QGNA 2UZIR 3OIWA 1NG1A 2G6BA 1XPRA 3WYFA 4PQYA 1DTSA 2FNAA 2OILA 1Q1BA 4JT2A 1KAOA 1XPUA 3CWQA 5JWHA 3AVOA 1A5TA 2FEOA 1GNQA 2CVFA 2ZREA 4LHVA 4NYMQ 1M1YE 1ZCBA 3DHWC 3W6NA 3T1QA 1O87A 1AGPA 2VEDA 4PANA 1D9ZA 2FOLA 3QUSA 3AVQA 2ZSAA 1YZUA 1Q1QA 2ZJYA 4A8JB 4BZPA 4FMBB 4DXAA 1SXJE 1VMAA 5IT5A 1E0AA 1SVLA 1IXZA 3IO3A 2ZQ5A 2O8BB 1KO7A 2P6RA 4CGZA 2IUSA 1I2DA 4YDHB 2EWVA 2RGBA 3VR5A 2VF8A 2OLJA 2CHQA 1ZIPA 5HZKA 1G7RA 1FUUA 2BBTA 3CB4A 4DVGA 3AVXA 1X8JA 2DWOA 4YMSA 3RSLA 1KMHB 2B92A 5KO2A 4YMVA 5EP1A 3RS7A 3B1VA 5TVKA 3FWYA 3VR3A 1CRPA 3BB1A 2JLZA 2IHBA 2AL7A 3EZ6A 1FPMA 3AH8A 1GSIA 4I99A 2BJVA 2JLRA 2AKAB 1G21E 1Z29A 2DFNA 4JSYA 2VHUA 2XSZD 3K0FA 4Q01A 4D81A 3EZFA 1CJUC 3GFTA 2ZJ2A 3U6KA 3G5UA 1KGDA 3H1TA 5G41A 3LO5A 2QQ0A 1S4QA 2ORIA 4Q47A 1DPFA 2ZSFA 3I32A 1E98A 1SKYB 1XEWY 2F1HA 3IIMA 4FCVA 1TU4A 4WW0A 2X77A 4DZZA 5EXXA 2QSYA 2A3RA 4C0QC 2ZRIA 2PLRA 3UMFA 1P72A 4RZ3A 3T61A 2JEOA 1II8A 4QHSA 5DHAA 5FPHA 1XX6A 5FBLB 2ZVPX 3UWOA 4W9MC 3B8HA 4AYWA 2W6IA 4IVQA 1WA5A 4ON9A 2BBWA 3EIEA 4UQOA 2CHGA 3VX4A 2O0JA 4JT4A 4NU0A 1EFTA 4XWAA 1D8TA 2C03A 1UEJA 2FG5A 2GAAA 1P9RA 3AP2A 5F2EA 1Z6GA 3AP1A 4B6FA 4CZ2A 4DSOA 3B85A 4V03A 2JLQA 1ZCAA 3CNLA 1QVRA 2REBA 3BH6A 2JJ2A 5FOSA 1UBFA 1NSTA 5LD2B 3EPJA 2AN9A 2R6CA 3SN6A 2FWRA 3U4QA 2DFLA 1IJFA 3TAUA 3WBJA 3NTUA 4MKIA 2EVWX 1WXQA 4IEIA 5EXPA 3S1AB 1AGRA 2VP4A 4DLSA 2ZE7A 4CRWB 2GJAA 1T5LA 3KUCA 4ZCLA 4MGYR 4AG5A 3GLGB 4JSTA 2JLYA 3THYA 1G9XA 2PX0A 4KLZA 5CDFA 1E79A 3VHLB 4CT5A 5HZHA 3QIAA 5JMTA 3JZAA 4PAQA 1FZQA 2O8CA 1E9CA 1RJ9A 1XEFA 2JCSA 4CEHA 3WXMA 1UADA 3A1UA 2CNWA 4TWZA 3OAAA 4HZUA 1UKVY 1WMSA 4LWZA 2CL6X 2ZUDA 1K5DA 3U3MA 5JWRA 2HT6A 3U2QA 2IYVA 2ZRBA 3CWZA 4RZXA 1WB9A 1XCMA 1DG1G 2GK7A 4URZR 1BKDR 4AD8A 1XTRA 4FINA 2F3RA 3MAAC 1JALA 1VPLA 3CM0A 5GJWC 3IBYA 3X1WA 3K0EA 3SEAA 4R71A 1M7HA 2HYDA 3DM5A 1JXOA 4UNPA 3CH4B 4FMDB 4Q9IA 4I4LA 2ECKA 4LYFA 4Q7JB 1T6NA 1OIXA 2EW1A 1CR0A 3OIVA 4U7DA 2ZYVX 2W83A 4JL8A 2XX3A 5TARA 1D2EA 2IWRA 3PEYA 1GTVA 4TQ9A 2GRJA 1U90A 2QP4A 1TPZA 5CYPA 3QBTA 2OFXA 1M74A 2V6IA 4W5JA 4NYJQ 2FGJA 2ERXA 4JLJA 1AIPA 3IEUA 4TYPA 2IS4A 2ZRAA 1DO2A 1JJ7A 1KDRA 2OHFA 3JZMA 3O8DA 4OQLA 4R98A 3AGQA 5FTJA 1KJZA 3MGCA 5L3RA 4A2WA 1W0JA 3TH5A 1NI3A 1TEVA 2VP9A 4BEBA 4PSVA 2WPDA 4MUAA 3IPXA 2IC5A 2WMOB 1WQ1R 2QROA 4TYNA 3TJZA 5DO9A 3HR8A 4NYIQ 1COWD 3H84A 1FTNA 2XJ4A 3CZQA 4JZKA 4WAUA 4N3NA 2NIPA 4Z54A 1MH1A 2XTNA 2D06A 2QE7A 3GFPA 3SJAA 3U3OA 3KUDA 4TL7A 1UBEA 4R2IA 5GJCA 4S2EA 3MWKA 4CYMA 5DN6A 2IYZA 1I4TD 2W6ID 2A5YB 4O25A 5AJZA 5TXGA 3H2YA 4HUQA 1GILA 2OBMA 1D9XA 2ZSEA 2IYWA 4HAYA 1FQJA 1QBKC 4OHYA 3I61A 3Q3JB 1Q12A 4IOMA 4A0HA 2ZRDA 1I4DD 4L9WA 3BRWD 1RW4A 3ZVNA 4QBHA 2ONJA 4ZDKA 3HYRA 4FI3C 3X1ZA 1VG1A 2V55B 2JJ2D 2HXYA 1W7AA 3LLUA 5FOWA 2HLDA 1OB5A 1E1QA 4TMZA 2FH5B 4RD0A 2Q9BA 3I62A 1W36C 4F93B 2WM9B 2QY9A 3L0OA 3MUFA 1VHTA 1ETUA 2OSBA 4OKSA 4JLOA 1F60A 1ZM2A 5TV2A 1XFAA 4D0NA 1IY0A 4CEJB 2YNMA 1EXMA 1NLFA 3TMKA 2ZM5A 3SZRA 2O0KA 1WDTA 4G01B 4GI7A 3T5DA 1Q1ZA 2P67A 121PA 4Q4AA 5JS7A 2E87A 1OKKD 3B9PA 5P21A 1E79D 4HUTA 3VTKA 1XZPA 2OZEA 4FMDF 3NBZC 1RE0A 3BK7A 3L0PA 1DOAA 4M2LA 4R2HA 4U00A 1MO6A 3OEEA 2JASA 3IDQA 2CNWD 1E2QA 4IXNA 1E69A 3U7FB 4Q5IA 1GNPA 2HUPA 1VYUA 2ZYTX 2VP0A 3PFIA 3VQTA 2ZRLA 3VR2A 4QJ3A 3KXKA 1W36D 3CX7A 3BXZA 1DAEA 4Y0VA 3B1ZA 4A0RA 3BFXA 4C0AC 2AK2A 3LH5A 1E2PA 4C3ZA 3GLFB 4A2QA 4EAQA 5GJVC 4EFMA 2BWJA 4M1SA 5AUNB 2EYQA 2WIBA 1MRNA 2OT3B 1DAHA 3KJIA 2NQ2C 2DY1A 4LX0A 4KV9A 4XJXA 4CDGA 5HTKA 2NPFA 3AKCA 3LV8A 3QKSA 1W4RA 2C78A 4RD6A 3HDTA 2VF7A 1ZINA 5FI0B 2G88A 3WNCA 5JFGA 2F1IA 3Q72A 2GHIA 1BYUA 1DG3A 3EIQA 1A2KC 3TR5A 2JA1A 2J3EA 1SQ5A 2L0XA 1NL3A 2CVHA 4GMDA 2F43A 2CCKA 1MO4A 1GG2A 4V0ME 1W0JD 1F2TB 2ZUCA 1T8UA 2IYLD 3TW4A 5JRJA 1VIAA 1IN8A 4XSGA 1TADA 2BMEA 2WPDD 3W8RA 1GWNA 4DKXA 5L3QA 3AVTA 2GVZC 1J7KA 2VHQA 4PHGA 5J4KA 2QMUA 4HATA 3GEHA 2RKOA 3RRZA 3RRYA 4D82A 5EJEA 2D7DA 1R7RA 5EUQB 1Z2AA 1S1MA 2ODWA 1E9DA 4M8NE 3T1VA 8OHMA 4KITB 2ZIAA 5JSZB 2QE7D 3KKQA 4HAWA 1U81A 3B5JA 4JLBA 2X19A 2ANBA 5KSOA 2Z4RA 5M04A 5G3YA 1VIYA 3TQFA 1OXXK 3SC3A 3IGFA 4Q66C 3RS4A 2NO1A 4I81A 3W3ZB 1KI6B 4Q7LA 3EPLA 3EXAA 1XXHB 2BVNA 2I1VB 2RMKA 3C14C 4ZDIA 4M1KA 2P0EA 2GZHA 3ADCA 1US8A 3AVWA 1JR3A 2YWEA 3KFXA 2WWXA 4XD7A 1ZJ6A 3AM1A 4TYYA 4BZQA 1XD9A 3B78A 4Q48A 1XEXA 2HLDD 1E1QD 2G3YA 3SBEA 3I5YA 4V0OA 5FUXA 4EPRA 2ZI7A 4B2PA 3CKLA 2QRNA 3CR8A 4LJ7A 2G83A 4LGMA 4MRNA 4TL8A 1E2JA 3W34A 2WJVA 4NP6A 3A37A 2F55A 1QG4A 2QTFA 4EKDA 3KB2A 5LD2C 4PPQA 2QSZA 2FSGA 4POAA 4BLOA 3FE2A 1LY1A 3CH5A 4R7ZA 5JZVA 4NPHA 4IOLA 4LPKA 3CBQA 2UKDA 4A92A 1SZPA 2WWWA 1W44A 4PPNA 1ZNWA 3OEED 4M1MA 4TMTA 3I73A 3K9LA 2VQSA 4QNMA 4UNNA 1X3SA 1G41A 4TLEA 1PZNA 2QM7A 4KFSA 5FUYA 2OESA 4Q4JA 1P73A 4MGIR 4OI1A 3RWMB 3T5GA 1MV5A 1OXUA 2X2EA 3E70C 4Q4LA 5TB5A 5JRZA 3ZLJA 1SXJA 5AWFC 1W2HA 5JBQA 1YVDA 3Q9LA 2QBYB 1W5TA 3A4NA 4WBSA 4LJ5A 5FBVB 4ZI3A 1XZQA 5TMPA 3B60A 4CEJA 5JEEA 4CW7A 1H65A 4MDFA 3MG9A 3IQWA 3WMFA 1G8PA 2X1VA 1QF9A 4EQ6A 2QG6A 2C8VA 2W58A 3EC2A 3QEOA 3ADBA 3BERA 3HU1A 4YQFA 2C9YA 3CR7A 4QBGB 2A9KA 1AKYA 1X8KA 4A6PA 3AVVA 4URUR 1EX7A 3BOSA 4IW3B 1GKUB 4JVNA 4QM6A 2WWHA 5CB6A 2FFQA 3BB3A 4YMWA 3PITA 3QF4B 4DJTA 2GEVA 1AS3A 4N1AA 1FOEB 2QTHA 2YWHA 3L0IB 2P5SA 1QHSA 2BCJQ 4X8LA 4ZKDA 1CS4C 1E0SA 1NJFA 1FX0B 3QKTA 4M9QA 1FNNA 2AR7A 3FMPB 3CIOA 3KQLA 3T34A 4BRUA 4PFSA 4AYXA 1G64A 4KCGA 1XB2A 1E9BA 3D6TB 1HURA 3K70B 4ZI2A 5KNCA 4AKGA 3QBVA 5EP4A 1CJTC 1IXRC 3LRPA 4DCTA 1IAQA 1W0KA 4BE7B 1RRCA 3B13B 1KY3A 1N0UA 2YOFA 3Q8XB 1W4AA 1CJMA 1GKYA 5DYIA 1KJYA 2FMXA 1JR3D 1KZ7B 4BLTA 1TQ4A 3D31A 2B7CA 1YR7A 4KFTA 4XD7D 5JJKA 2ZRJA 1YZLA 4LHXA 3VU9A 1UDWA 4BFZA 3ZGXA 1IN4A 2BCGY 3NH9A 2A5JA 2XNDA 2W0SA 2F9MA 4NKRA 1GZSA 1Q1EA 2P6NA 2LKDA 2WOOA 4Q9KA 3THWA 4LZZA 1L2TA 3SR0A 2ERYA 1MO3A 3B6EA 4C30A 1ZMXA 1NVUQ 3NH6A 3GLIA 2WKRA 4URWR 1SKYE 2F9LA 4BGDA 2FSHA 2QRZA 1SXJC 3H0KA 1U0HC 3CRQA 4D4JA 3N70A 5E7MA 4QJ5A 1Q44A 1JQJC 4P31A 4EFLA 2EFDB 4XIGS 5EZ6B 2DYKA 2IWHA 1YE8A 1Y3AA 3ZVMA 1J8MF 4XH9B 5HPYB 3MCAA 3FB4A 1MABB 1XPOA 2WTUA 5J4YA 2J1LA 2JAQA 1M2OB 4KBFA 5EE0A 1XEWX 3VR1A 5FTLA 4MYUA 4HLQB 2VA8A 2FA9A 3Q7PA 4KYUA 5E3HA 4IOJA 1AQYA 3KJEA 3A58B 4LBVA 2ZAMA 2CJWB 4LCBA 3T35A 4PZZA 3EPHA 1E4VA 3OE7A 5G3ZA 2ZXUA 1SXJD 4UXHA 3HPRA 3GLHB 4LHYA 3TKLA 3QPUA 3A4MA 1FP6A 3NBFA 1B23P 2JLSA 1E2GA 4JVSB 1G3MA 3WYAA 1ZC4A 1W4BA 3VR4A 4US1R 1U98A 1RZ3A 2O52A 3IO5A 5K8TA 4QFMA 3WHKA 5H1YA 5JLJA 1HT2E 1NVWQ 1YKSA 4G5SA 2TMKA 1N6RA 1P4SA 4HDOB 5BN5A 3KX2A 2QP3A 4Q00A 4TMWA 1QZXA 1OPXA 3ASZA 5KPJA 1OXVA 3GLGE 4PO8A 1M7GA 1M7BA 3RSOA 3PG5A 1VDZA 2HF9A 3QF7A 5FH9A 3OIUA 2BM0A 2O8FB 5GADl 1QHNA 3B9QA 4MYTA 4NCJA 4D0LB 3LD9A 3RLFA 1IONA 4OK6A 2J7PA 2RGNA 1F5NA 2VTKA 2WWYA 1ZW6A 1NMZA 3GFOA 3H86A 3LDAA 1ZM3A 2R6GA 4XWOA 1DARA 1Z8FA 4HLUA 5EP3A 4PC6A 4C0KA 3REFA 5KNBA 1L8QA 1EGAA 4AG6A 1VECA 1W0KD 2DBYA 4OHVA 5LBIA 4UNQA 1RPZA 4Q7MB 5J40A 3PXGA 6Q21A 4QBFA 2B7BA 4PX9A 1MRSA 1N6PA 3LFUA 1KK3A 2R6FA 2VHTA 5FBRB 1E2IA 3AKEA 3V00A 3U6BA 2O8EB 1KSFX 2PEYA 3BH7A 5BN4A 1Q3TA 5EE1A 5CITA 2XNDD 2EFCB 5GVRA 3BBPA 3D7MA 3CLVA 2VYFA 1G6HA 4HSEA 4E22A 2CK3A 5FOVA 4UNSA 1NN3A 2RH5A 1XTIA 2GCOB 3QF4A 1W47A 5CM9C 3RDPA 4BEJA 3CRVA 3A6PC 2HCJB 4RFSA 1AN0A 3A4LA 1KHTA 2RB4A 5HE8A 3T06B 1TX4B 3MWJA 4B32A 2Q6TA 1ZUHA 4ZCMA 4Q19A 3KKMA 4YXWA 4DSUA 2IXGA 2Q0HA 4JLVA 3IEVA 1JPJA 4P4SB 1VCIA 1XMIA 1XD2B 1JXMA 4OHZA 3K9GA 1X6VA 2CBZA 3PEWA 5F98A 4MGKR 1KIMA 2PCJA 4DLTA 1G6OA 1DEKA 4AI6A 4BFTA 4P3YA 4QNRA 2H16A 4GNKA 5AR1A 1SKQA 2FU5C 3OE7D 2FSFA 3LVQE 1CKEA 3VNVA 1P2UA 5KPDA 2G1JA 1NVVR 1Q22A 5DH9A 2RHDA 4LRWA 3I72A 3GEIA 2BBSA 2FN4A 4L15A 4B33A 4B6EA 2RGNC 5KYKA 2BEKA 3B1WA 4F7WA 1UPTA 3MMPA 4XTRA 2HT1A 1Z08A 5E4FA 4IFEA 2QPAA 4JLNA 1GNRA 1ZUNB 2D2EA 3OHMA 3WY9A 2H92A 5E95A 1M6NA 5KTYA 4HLUC 1C9KA 1LVGA 2AFIE 3U44B 2A7QA 2IXEA 1EK0A 5FTNA 2VHCA 1Z06A 1P61B 4OHXA 1I4LD 3GJ5A 2P5TB 2GJ8A 3WBKA 5B64A 4M1OA 4R9UC 2VBCA 4CEIA 2VH5R 1G1MA 2BDTA 1Q3HA 2PMKA 3M0EA 1NMXA 5L3VA 4V0MA 4PQFA 2FZLA 1S2MA 3QVUA 5AUOB 2J7PD 2Q3MA 3AP3A 3ND8A 2W0MA 3BFKA 1QDEA 4GMXA 1ZRHA 2WV9A 1DAGA 3QE0A 2BM1A 2X2FA 2C98A 2PJRA 3H4MA 2KWIA 1EFRA 2CCJA 3PEUA 4Q21A 3TSZA 3GLFE 3U7HB 1Z0FA 2V3CC 2C95A 5DI3B 4LJAA 3T1OA 3I1FA 3AF0A 2A78A 1COWA 4KSCA 4NL4H 4MDEA 4B71A 4KFRA 4N0EA 2VHJA 4HB0A 3OEHA 2P3SA 4LJ6A 3PJRA 1T0HB 1W5SA 5SZKB 3SU8A 4JL5A 1WP9A 3V4FA 3K70C 1OYYA 5G40A 3R7WB 1E0KA 1W48A 1Z6TA 3QKRB 1G8GA 3ZD7A 2R62A 3O47A 5C1BA 1F2UB 4F91B 521PA 1E3MA 1Z83A 3FMFA 5EUMA 3T15A 2FEMA 2JLWA 5HCIA 4XVQA 3KB1A 1XJCA 2JJ8A 5KDOA 4DLRA 4A6XA 3VX3A 3IIKA 5C46F 2CK3D 2AK3A 4P33A 3MRSA 1WBBA 3QEJA 2QPOA 4MRSA 4JYCA 2CLSA 2XXAA 1GAJA 1G291 2XZLA 2AKYA 4OL0A 4JVLA 2BEJA 4KYIB 1YZTA 4HAVA 4HAZA 4YMTA 1SHKA 4C7OA 2DCUA 1R10A 1EESA 2LKCA 5TY0A 1KI1A 3BORA 4YXWD 3K70D 1WBDA 2PZGA 5DIFA 2RGGA 2ZE5A 1OJLA 4QM7A 4D2IA 3Q5DA 3R9WA 5EXSA 4B3FX 2G1KA 2C5LA 5LDDC 4KO8A 3BE4A 4US2R 3F0TA 1E2MA 1J70A 3WNDA 2Z83A 4ZIRB 2EU8A 4BFSA 2AXNA 1XXHE 821PA 1XCGB 4ACBA 2C77A 5J4HA 1YZQA 1OKKA 4M0LA 3C7KA 1WE2A 3LW7A 3BFVA 3PUXA 2J7KA 1KO4A 2RAPA 5D3MB 3K0AA 4DLVA 4FWIB 3CRW1 2YWFA 5B2ZA 1G19A 1W49A 5DHFA 2VRWA 1UAAA 1P62B 5KNDA 3AEZA 2JLXA 3QXCA 3NC0C 1PLJA 1K5GA 3KTAB 1XTKA 5C4GB 4MGZR 3C8UA 4TTQA 4XWKA 4PC7A 1KO5A 4IDQA 3RRNA 3KKPA 4G1UC 2CMKA 3DZ8A 1ZC3A 1E0JA 2A30A 2R6AA 1AKEA 1Z5ZA 4N0DA 5KHOC 1IN7A 4UXJA 4HLDA 3THXB 3K1JA 1NN0A 4URVR 1S3GA 2ZVQX 1G3QA 1P5ZB 3K53A 4M53A 4I1SA 3EC1A 4KVAA 4L9SA 3ZVLA 3MFYA 1V5WA 2KB0A 2LCFA 4RZ2A 4DWJA 1N6NA 3TQCA 2BIFA 3J81k 2QAGB 4AYTA 3QNUA 1E9EA 1VYVA 3DPUA 1C1YA 3PUZA 4QC2A 4WA7A 3ZJYA 2QI9C 4OHWA 2C96A 3IKJA 4YDSA 3TAHA 1Z6AA 3BH0A 3DMDA 5BN3A 2WWFA 1U8AA 4LUCA 4A8JA 4ACAA 1E99A 1EFRD 1T91A 1YR8A 3GJ4A 3IHWA 1CTQA 4M9XA 2ZE6A 1P6XA 3MJRA 2OCAA 1IM2A 5FTKA 3ICQB 2O8BA 1CJKC 3OEHD 1SVMA 3TIFA 1RFLA 3B82A 1N0VC 3CPHA 4JLKA 2JATA 1IXSB 2QT1A 3P4YA 2IS2A 5C18A 3CRMA 1ZVQA 1K6MA 2AX4A 1KMHA 1GL7A 2VSOA 2OBNA 1MO5A 1NY6A 5FPYA 1VHLA 2CL0X 3MD0A 2RCNA 1ONBA 2YOGA 4U5XA 3V9PA 1RRPA 3DL0A 3X2SA 3ZS9A 5CB8A 2NGRA 1GIAA 2R65A 4BQSA 2PH1A 2RHMA 1NKSA 1N6LA 3AKDA 1IOZA 3SNHA 4QGAA 3BJIC 2WKQA 3BWDD 2BV3A 3HU2A 3VHXA 2GXUA 4BUJA 3BGWA 2IEYA 1NVXQ 4AK9A 2WJJA 4GOXA 4EPYA 1U99A 1LTQA 2FSIA 5IHPA 1E2EA 1YHNA 4GZLA 1EG7A 1LS6A 1XMSA 3DKVA 4M9SA 3GJXC 1OW3B 4LOAA 1FQKA 4KBGA 4A2PA 4E5UA 1GRRA 5BYKA 1ANKA 2W2XA 3C5HA 1G5TA 3QKRA 3ZD6A 1Y63A 1X1RA 1Z0IA 3IHLA 2ZSDA 1AS2A 3LBIA 4L4UA 2IF2A 1VCNA 1YR6A 2OEPA 2QQEA 3MWLA 3FKSA 4NHOA 4HDQB 1TQDA 4FXPA 3ADKA 5DI9A 3UANA 1BH2A 1GFIA 3FHOA 3EARA 1JBKA 2IF0A 1RYHA 4OI2A 4MRVA 4HDCA 1GUAA 1UKZA 4OBEA 3FKQA 3X1XA 3LVRE 2PT7A 4RCYA 3DO6A 4A8JC 1G7SA 4Q03A 3C5CA 2GXAA 2QTVB 1W2GA 2DPXA 3NKVA 4M21A 1KAGA 3SJCA 3S1AA 1SVWA 1A1VA 2MMGA 3THOA 1SGWA 2IUTA 5ELXA 4RVCA 1QVAA 2ZJBA 1CU1A 3K0CA 3ND9A 4M4SA 2UVQA 5AUPB 2O0HA 2NO0A 1JNYA 2HF8A 3GLGA 4OQFA 3WRXC 5KDDA 1D2MA 4MQBA 3CO5A 1FL9A 3U5ZB 2WWGA 4KVGA 4OI0A 5EP2A 4Z51A 2IUUA 4I1UA 1KI4A 2V54A 1OH7A 2QGZA 4QGGA 4ESVA 2GXQA 3MWYW 2BMFA 4V0LA 4IHQA 3GLHE 5JI3E 3EX7C 1AQUA 3OFNA 2PZFA 4I1OA 4Z8YA 3M1IA 1LB1B 3MLEA 2PT5A 3KQUA 1IQPA 2FFAA 5A4JA 4UKDA 2OXRA 2F1JA 1T8TA 3LBHA 1XTSA 2VIIA 1JEDA 2H8KA 1CULC 1KSJA 1OFIA 3GJ6A 1YR9A 4A0FA 1PVOA 4BLSA 1XP8A 1Z6YA 2BMDA 4AY2A 1E2NA 1AS0A 2J46A 1T3SA 3AVPA 2EWWA 3UMRA 1G16A 2EYUA 2PJZA 5FI1B 2V7QA 1JJVA 3PIRA 1TEXA 3RAPR 5B57C 1J8YF 2XEXA 3C4JA 4PSAA 4WZAE 4B2IA 5JJLA 3KDSE 1VCMA 4G5OA 5J4VA 1N25A 1ZU4A 3MJHA 4DDTA 4DCVA 3QJYA 2AHOA 2P6UA 5FBWB 3N5CA 4ZO4A 5HKKA 3SQWA 3W8NA 2CDNA 3BS4A 4ARZB 4PXAA 1D2NA 4DLWA 4JYBA 5GJBA 4HEJA 4LV5B 1ESNA 2A5FA 2IYQA 4LC1A 4LBZA 3RABA 3KXIA 4M22A 1KKLA 4TN1A 1YRBA 4JMPA 4BLQA 1UF9A 4PPGA 2ZS9A 1E9RA 5L3SB 4HB3A 4RSGA 2WJIA 2ORWA 1DE0A 5F9FA 1P2VA 2QM8A 2J45A 4TLCA 1HUQA 3CW2A 1G5RA 1HY3A 3U3KA 5C2JB 2JDIA 3PENA 4Q9LA 1I2MA 4TMXA 2J0UB 3K0CC 2OBLA 5CYOA 1Z0DA 1OH6A 3DEFA 3FKSD 1G4UR 3B7GA 4EFNA 2IHYA 4UNRA 1TQ2A 4MKGA 1DS6A 3KKOA 3NWJA 1VG8A 1ZBDA 4RD3A 3P4XA 3SJZA 1Q57A 4EPTA 3L2OB 3QKUA 3TVTA 1E2KA 1MR3F 4DLZA 1F48A 1SVKA 4RKFA 5IRCD 3SQXA 4YMUA 3KJHA 2GDJA 3P20A 2V1UA 2CHVA 1OIWA 1KY2A 4TL9A 3RS2A 3RC8A 3SFVA 1RRGA 2BC9A 2YVUA 2F1RA 2O8DB 4HAUA 3B1YA 3DOEA 3OZXA 5KU1A 3GJ3A 4G0NA 1JI0A 4AKHA 2HJVA 3R20A 2YC4C 4NYMR 2Q3HA 3W9YA 3KQKA 2EFGA 4Q4HB 4PZLA 1N6OA 4LV8B 3SE0A 3LY5A 4Q9HA 1MT0A 2GKSA 1CP2A 4BASA 2WKPA 4DDVA 2JLVA 4OK3A 5CK4A 2B8TA 3NBYC 1D6JA 3LX8A 3P32A 1Z22A 5H8WA 4B2LA 4Y0AA 4DUGA 1S8FA 2P65A 2YOHA 3W90A 2REXB 1QHHB 3QY0A 5FPTA 3RS5A 3ECCA 2VP2A 4IFBA 4KU4A 3LX5A 3OFND 4F4JA 2BKEA 2CE2X 2ZU6A 3ZS8A 4D4LA 2XITA 1T3LA 1LF5A 1Z2CA 1NN5A 2NO7A 3OIYA 3Q7QA 4L8GA 1KYIA 3GLFA 3F8TA 2WSSA 4CT4B 4Q1FA 2PEZA 2H17A 1J2JA 2CE7A 5FUWA 1ZU5A 1JAHA 1JAIA 3GD7A 3NVAA 4DDWA 3U61B 1ZNZA 4IDNA 3TE6A 5F9HA 4Q1DA 2ZRCA 3NEJA 2V7QD 3SFZA 4C0BA 2R44A 1YJ5A 3VR6A 3OESA 4JJZA 1ZM7A 4FMCF 3UKDA 2DWQA 5FPKA 1NSFA 4B3GA 3NXSA 2IT1A 2FJUA 2JIZA 4LPSA 5HKKD 3QENA 4DC9A 1HH4A 3TSWA 3NHAA 1F2TA 5AJXA 1KK2A 2KBFA 1DVRA 1N5IA 1ZIOA 4DEYA 1KKMA 5FUVA 1ZM4A 3QXHA 3TLXA 4NMMA 2D3WA 2NO9A 2GZDA 2WVJA 1OFUX 1HE1C 3HU3A 3PUYA 5H68A 4H9GA 5JSZA 4UJ3A 3ZZ0A 4RKEA 1KTVA 1R5OA 3HR7A 3R8FA 1O3YA 4UXIA 1UDXA 2AFHE 4QL3A 4J0QA 1NKTA 4IVPA 4B3CA 1UBGA 3FHCB 3CZPA 2JDID 4D0GA 1OV4A 1R2QA 2J5XA 2ZR7A 4D4MA 1KI6A 3FYHA 1XRJA 2IYXA 4FW9A 1KI2A 1XXHA 2R2AA 2NO6A 3EZ9A 1E2LA 1TNDA 4JVMA 1KI9A 1KSHA 1K8RA 2ZAOA 2XZOA 2WWIA 1NLYA 2GZAA 4TL6A 4ZKEA 3SHFA 2XOKA 4W5WA 2Z5FA 3PQCA 4QHTA 2QEQA 5E7IA 3BIFA 3NIBA 4A15A 4FN5A 1JR6A 3BAFA 5FR1A 5IDVA 3RC3A 2WOJA 3FGNA 3PVSA 1HV8A 3A1VA 5B58C 3VMFA 1R0ZA 4C9BA 4OQNA 3FMOB 1ZM9A 4A9AA 2WAYA 4QHYA 4OJKA 1XNJA 3BC1A 721PA 4G5GA 1KDPA 3Q5EA 2JJ1A 3LA6A 1OLOA 2IW3A 4TTRA 1S1CA 1U2RA 3AGPA 3CF6R 1SVOA 3WP0A 2IS6A 3K0FB 1NF3A 4C0JA 1QHGA 1LV7A 2C9OA 1AZTA 1A4RA 1LNZA 1HEIA 1II0A 1UJ2A 2NPIA 2BJWA 3R9XA 2YINC 2ZUBA 1A7JA 1RRFA 1G5PA 2GWHA 3NDPA 1YZGA 1TUEA 4HYYA 3OF5A 3QXSA 4PZYA 1XCPA 4DIDA 2FFHA 4IKEA 1R5NA 3L43A 3L8YA 1R8SA 4TLAA 3PR1A 1GITA 4ZDJA 4AURA 5JI2E 4NDZA 1OIVA 2CXXA 2F6RA 4QXAA 3SYLA 2W6JD 3PEVA 5DNYB 1E2DA 2WJHA 5CM8B 1UKEA 1BOFA 2FPMA 2WSSD 2WJYA 4PC3A 1XBTA 3VNUA 1G8YA 4YC7A 2QBYA 5KUTA 3SI7A 2GK6A 1NBME 2LWIA 4NYJR 2CCGA 3LAWA 3ZVRA 1IHUA 4EUNA 2BBOA 3VKWA 4TSFA 1NIJA 4G5RA 4MYCA 1GVNB 4BFYA 4BLPA 1MOZA 3SBDA 4DB2A 1HA3A 3R9IA 1JQLB 2JIZD 5CLLA 4QOSA 1IN5A 4B3DA 1FNMA 2IX3A 2AD1A 2AWOA 1VG9B 2H7VA 1WCV1 2GAOA 2QAJA 1BIFA 1QG2A 4NYIR 4F92B 2ZU0C 2HJGA 4MITA 4ZV4A 2OCPA 3U4QB 1OE0A 1DO0A 2B8WA 421PA 2ANCA 4GP6A 3C16C 1PUIA 2RGEA 1R5BA 4II7A 1AJEA 2GBLC 4V0KA 1Z3IX 2ODBA 4M9ZA 5BYJA 3VFDA 5E7JA 1KDTA 5IF9A 1FX0A 4JBXA 5FTMA 1GRNA 3CNNA 4F38A 3THYB 5JJIA 2D62A 2EQBA 3B1XA 3GPLA 2ZS8A 5L8VA 2FDCA 1CR4A 1CR1A 2GF0A 4MH0R 4QGHA 1RJ9B 4CEHB 2O8CB 5A5GA 4GPTA 1Q21A 2J0SA 4TQUS 5AJYA 4DCSA 2RGAA 4HZUB 1E96A 2OM2A 2Z43A 1E9SA 4HLCA 4LBWA 5C4MA 1P3JA 3LW8A 4W7SA 5EZ5A 3ZH9B 4ESHA 4PO1A 1W36B 1EFCA 5CJ2A 1CBUA 1H8EA 2IYRA 2DWPA 2XOKD 4NZYA 3TW8B 3WNBA 1FTSA 2FZ4A 4KJZA 3TUZC 1OYWA 1N3BA 1TL7C 4TLDA 2MSCB 3W5JA 3IILA 4E07A 5JEDA 4MYHA 3ZDQA 2QORA 4JL6A 1QHIA 2IA5A 4QJ4A 2F7SA 2W2VA 4F4CA 4LJ9A 2MSEB 4DBLC 1NJGA 4TMVA 1R6BX 2J41A 4M1YA 2HYIC 3ZZUA 4M1WA 5BWMA 2OE2A 5AK0A 2SHKA 4ZCIA 2JJ1D 1WRBA 1C4OA 2OAQ1 1E9FA 4Q18A 1TMKA 2QT0A 1KDOA 1L7VC 1EFHA 3AKYA 4TT3A 4LY6A 1VTKA 5FL3A 3WRYC 4LSGA 3K09A 4KHZA 1N5KA 3C15C 4LK2A 3TUIC 1OFHA 1MABA 1E94E 1XWIA 4AKIA 1AZSC 1CXZA 5IK2A 4B48A 3UXMA 3GP8A 2ATVA 1OSNA 1T3HA 1UKYA 3E1SA 4C2TA 4D26A 3QOFA 3QXJA 3B2EA 3UG6A 3FHTA 2QU8A 1DADA 2VSXA 4RD4A 2YWGA 2ZRNA 4RY2A 2WAXA 3VAAA 2CJWA 3N2IA 1P2SA 5LB4A 621PA 3WMEA 4PHHA 5B30A 3IBGA 3GLHA 1PLKA 2OLKA 2Y8EA 3FTQA 2JGNA 3BD9A 5LPNA 3M4YA 4HUQB 3T1TA 3O8RA 1TU3A 1ELOA 2D74A 3RS3A 1U9IA 4TLBA 3CF0A 4BZXA 1G3IA 2HXSA 4YLGA 2FPKA 2XAUA 3NHBA 3I8SA 2V6JA 4TSFD 2GVDC 3RRMA 2OAP1 2OUKA 3ETLA 4MRRA 3D8BA 5DSZA 1E2HA 3IIJA 3U7EB 4JLPA 4RCZA 2VO1A 2XNSA 3G82C 2WICA 2QMOA 3QPWA 5KSYA 1BO6A 4GT1A 2N46A 3DMNA 1OXSC 3EZ2A 2H5EA 4AIIA 4C2UA 5BW8A 1G7CA 3FFAA 2O8FA 4WIAA 1WF3A 2OFWA 4NONA 3PUWA 3TRFA 5FR2A 2GILA 2ZRGA 4FIDA 3LNCA 2FF7A 2UZ3A 4AKEA 3LXXA 4OJQA 4PSKA 5JCZA 5KOYA 2PLFA 3KQHA 4URYR 4KXFB 3KKNA 4US0R 4Q4AB 3UK6A 2WSMA 4DHEA 3LXRA 5KSZA 1SVSA 2D2FA 4DSNA 2A2ZA 4DT1B 1IN6A 2G77B 4TQAA 1A2BA 4LYHA 1TUIA 3ZIAA 2QMHA 5FPSA 2HV8A 3QG1A 1CR2A 3FFBA 2EFHB 5J47A 2RGDA 3HP1A 4PHFA 3PV0A 4WZBE 1KNXA 3KZ1E 4OQMA 1H8ED 1FUKA 1NIPA 3K09C 4JS0A 5KSPA 2ZI6A 3CUEF 2O8EA 1R0XA 2J59A 4HB2A 4JLAA 3VKGA 2C2HA 1E2FA 3GLIE 1Z63A 2IS1A 1ESMA 1KOFA 2GESA 4NCIA 1GKIA 4HB4A 4PC2A 2REOA 1RKBA 2ZJOA 3E5HA 1P7CA 2XJ9A 1OB2A 1EWQA 1AM4D 4DLXA 2GCOA 3HPQA 3K9NA 4ZDWA 1LF0A 3QKSB 4QBIA 3W6PA 4B47A 4Z8XA 2XTMA 4FCTA 3U3JA 4LC0A 4B35A 2H18A 4PO9A 1IJEA 2K5UA 4TT3D 1RIFA 1DAIA 2I3BA 2J87A 2F43B 3HJNA 2QENA 1U9IC 3QI2A 4P4SA 1XD2A 3EPKA 2ZR9A 3EA5A 5D3QA 3QXXA 2GJKA 1CRQA 3DVLA 4HAXA 3LQRA 3PCRB 5IK2D 5L3QB 2XGJA 5CIQA 3TNFA 1RYFA 4Q7KA 4B44A 4NBSA 4JIMA 3CNOA 4E03A 5TDHA 1PLLA 1UM8A 4XVRA 2ZRMA 1OFTA 3EWSA 5SZJA 3KXLA 4ITRC 4IDOA 4LJ4A 4A82A 4DLYA 3EASA 2FGKA 2NZJA 2ODNA 2J0VA 2VLIA 3I8XA 2OV2A 5H70A 4XVUA 2YV5A 1U8YA 1N0WA 221PA 2XZPA 2Q3FA 4KI0A 4E09A 4PQRA 2B21A 4G3XA 1X8LA 5JWOA 1XDBA 5CJPA 4C0HA 1EX6A 2ZYWX 2O5VA 2FE4A 4HZIA 2GJ9A 1US8B 1VG0B 4DCNA 2NMVA 4YONB 1R4AA 3U3RA 1E9AA 1Z0AA 2PMDA 4KODA 4DEXA 4PR0A 3U44A 3A1TA 3WMGA 4DSTA 4JLDA 2GTPA 2FFBA 2BMJA 4RZUA 1U0JA 1XEXB 2F3TA 4BFUA 4NH0A 1L4UA 4EJSB 3RWOA 1HQCA 4HI0E 2OO7A 4OYHA 5K8IA 1T4GA 2ZANA 3PUVA 2Z4SA 1ZP6A 5DYGA 1XU4A 2QNRA 4ABYA 2QMEA 5ANRB 4Q02A 2A5DA 2B6HA 5J4LA 2Q9CA 2AXPA 3UWKA 4LYJA 1GRQA 1KZGB 4PHTA 2D7CA 1ZD1A 3SYNA 4GFDA 3GMTA 2AD5A 2Z0MA 4KLNA 2GJSA 3WHLA 2V1XA 2QPTA 2DHRA 5DI3A 4BRWA 5K8LA 1GL9B 2QA5A 3RYTC 3GQBA 5DE3A 3ZIAD 4URXR 4FWTA 3AVYA 1ODFA 2OG2A 2GXSA 3SYKA 3K8YA 4KSBA 4Q4JB 3AQ4A 4QG7A 4A4DA 2CL7X 5J5CA 1HTWA 5CK5A 3R7WA 1OF1A 1R8QA 2W00A 2DFKB 2IYYA 3A1WA 3GCGA 3KJGA 4A0GA 2ZE8A 1F2UA 1SXJB 3VKHA 1AK2A 2ZRPA 4D25A 2BHRA 1BS1A 3QQ5A 5SZHB 3AUXA 4P4UA 2ZI3A 3U7GA 2HCBA 1U8ZA 1N6KA 2QZ4A 4GP7A 1NLZA 4FCWA 3KQNA 4GBMA 4RD2A 1NVVQ 2IBMA 2IYSA 4LV6A 5HR5A 2CLDX 3EZ7A 4PC1A 3I4LA 4Q1CA 1HYQA 3QPVA 4RD1A 1FMLA 2NG1A 3SOPA 4EQ6B 4QRHA 5AJWA 3FMIA 1NP6A 4LBYA 2IL1A 1YRAA 1KNQA 3TGPA 1OXTA 2G0NA 2ZI9A 3L0SA 4DIEA 1MKYA 2XTZA 3RHFA 4DT1A 1T5IA 3O8BA 3ONWA 2ZSBA 3OAAD 4RJLA 2WHXA 3CX8A 1N5JA 1LFDB 4ZIRA 4Q1BA 4BFVA 1E6CA 1SHZA 2EFEB 3GEEA 2ZETA 3Q85A 4TYQA 1S9HA 3F3YA 5FL7A 1GP2A 2IXFA 4B34A 3P1JA 1S9DA 4M1TA 2Z6VA 4DUGD 3D3QA 4DRZA 5F3WB 4WOPA 5EE9A 3WP1B 3IPYA 4B75A 5D3MA 1T9HA 3UG7A 5BQ5A 2ZI4A 2GCNA 1TF2A 1JB1A 1DAMA 1IBRA 2ZROA 4RFVA 4ASUA 4C0SA 2ZYUX 1Z0KA 1Z6XA 1AA9A 4BWYA 4IOKA 1BMFA 1T0JB 1X86B 4OI4A 5EE3A 4LHWA 1II9A 3CPEA 4DDUA 3KTAA 1CIPA 3REGA
chains in the Genus database with same CATH superfamily
4ILEA 1DJQA 1SY7A 5EQTA 5CXSA 2R8RA 1EUDA 4YRFA 4DNFA 1S02A 1HE4A 1E3TA 4G2TA 3QBDA 1KAQA 3Q3EA 1U5CA 1NXOA 1Y1RA 1JHXA 2A8YA 2DUNA 2FPPB 2H31A 2J85A 3TUJC 3EFOA 2YH2A 4BB6A 2V4ZA 3THWB 3EG9A 2D4HA 1J8DA 3H9JA 5E4JA 5T6MA 2IPNA 5ECWA 4M0KA 4DARA 4XIJA 3U56A 5EJ5A 3AF2A 4MIOA 4QICA 1JGTA 3PPWA 1MEEA 1EK2A 2YYZA 3AR5A 4V24A 1CF4A 2JH9A 1GAQA 1TTQB 2FEAA 2VXYA 1D1SA 4HYTA 4KOEC 1OI3A 1V8DA 4TPKA 5J59A 5LZ5A 3U0BA 4D4IA 4B45A 2FI1A 4B0OA 4CJXA 3NG1A 4MUBA 4BO8A 5CTAA 2F3QA 4BX0A 4D4KA 2ODEA 1N5LA 3WV4A 3TO5A 3I1YA 3S2UA 1H4VB 4N3GA 1U80A 4S0ZA 4RTMA 3NFYA 3QYFA 4X8OA 2WSIA 3AI7A 3TMAA 2R0QC 4EUKA 3BTUA 3LPCA 1Z33A 2WHQA 1UBKS 3AUJB 1XU9A 3QE4A 4X5OA 2BE7A 1KMNA 1O5TA 3B7WA 4KVFA 5EOVA 1HNZB 4L4ZA 1FXUA 3KL4A 2OGUA 1LPOA 3RG2A 1NMSA 1GM5A 2QUHA 3LNTA 3IKLA 1QYIA 4PGMA 4YR7A 4E1VA 2OXCA 4N47A 2A9QA 3JQ8B 1KRXA 1JFFB 4G1EB 3JQAB 3OZUA 1QMPA 2XUPA 4A1FA 4LJRA 2WBLC 3N53A 1N2CE 3IA7A 4B79A 4P81A 4Z1OA 2QJOA 4EPVA 2JVJA 2EKDA 1NNUA 1AC5A 4YRLA 1X92A 3IIEA 4IDHA 2N42A 4KKVA 1BE1A 3JVVA 2ATXA 2IK8A 1I33A 2WHPA 4G1FA 4C89A 3T12A 1TUBA 3NEYA 4IJMA 4QRDA 3X2EA 1RC8A 2AJBA 4A16A 5BN5B 3E81A 2R8YA 1Z2DA 3AXTA 3RJ9A 2D0PB 5A9TA 4PZ9A 3SR3A 4EL0A 3S5UA 3EVDA 3H6KA 3KV1A 5DOVA 5EEHA 2R7NA 3RODA 1FLDA 3A36A 3DVRX 4PLHA 5DGDA 4BECA 4OKIA 1EVZA 3GROA 2C9MA 3KR0A 3WLLA 2QXTA 3O31A 3TR0A 4KE7A 4IRUB 3DHVA 3I3SR 3BGIA 2ZKIA 3WMWA 4CMCA 2M6RA 3CRRA 5AK4A 3PXDA 3U17A 1R0YA 1GQYA 1U2PA 2ZPTX 2WM8A 5F7ZA 2GVNA 4DSZA 4PN7A 4CF7A 1U0BB 2IYPA 1EK6A 1HQYE 1X1SA 4UBOA 5DCYA 3BJZA 4NOLA 1HE8B 5BUQA 1KP9A 1QPBA 1OT3A 2PYZA 4NCNA 5J63A 4AF8A 4OK5A 4CTMA 4ZD6A 2Z1DA 5CFRA 3T5CA 2QG4A 4BN4A 4ERNA 5LR6A 2RAVA 3GDWA 3GEMA 2NTYC 1XO1A 4RPJA 3A32A 2FX3A 2VT2A 3AM4A 4PEVA 4RJ2A 3WKDA 1WXGA 3INTA 3UATA 3UKOA 5BSKA 1VCOA 4B73A 1W29A 3Q3GE 3F1KA 1C3EA 3GRCA 5CIWA 2YJZA 3IQZA 5KSWB 1M5RA 4MS1B 1KK1A 3KQTA 5TT1A 2KSQA 1U1DA 4UEJA 2YWRA 4ZOLF 1L5WA 3K7EA 5A7HA 3ZE6A 1QAQA 3O2NA 2WJGA 3FFXA 2GHTA 1BGVA 3F97A 4P2GA 3ZK8A 4B3HA 4UHBA 1E1RD 2C04A 3EISA 4YMLA 3FCUB 5BOVA 1AVTA 1RXEA 1HYEA 1O6GA 3P2IA 4K8OA 5LZ2A 2AC2A 2CFIA 1WHTB 2JLUA 1XA0A 4RFSB 4QQ8A 1OFUA 5KVCA 4QJIA 3AL3A 3IQXA 1UFQA 2NADA 4IJ6A 4EJSC 4NZOA 1RLMA 2GA8A 3GLUA 2NZYA 2Y6VA 1DIHA 1LWNA 2W2MA 4FEEA 3ZOZA 4C78A 2CEAA 3CONA 3L8MA 4BVGA 4UHCA 2WYIA 3HEBA 5EI5A 4KNYA 2D0DA 4YV1A 4TZ0A 1GNLA 3QE9Y 2PMBA 3ANSA 4K9SA 4L8FA 4PLCA 4WY5A 3WYGA 4DMLA 2COEA 1QRAA 3I28A 4NCKA 4EDHA 1TQ6A 3A6KA 4P5EA 1GL6A 2ZJAA 1H9BA 1U02A 2R9VA 3PXUA 1MJGM 3UHAA 4CKWB 2IOFK 4OHRA 3K0SA 1GA6A 3CJTA 3DE7X 4JGIA 3KVNA 1XF9A 4Z1MA 1QVVA 4C4XA 5KQLA 1GU1A 2EZ4A 1KI8A 3ER6A 4BIMA 1N8NA 4WZBA 4WN9B 3IAS1 1O08A 4MQEA 4MO2A 1RMTA 4FU0A 3TQSA 1T4MA 5L6LB 2FPGB 4IDFA 3OJOA 1QE0A 4WVFA 3UPUA 3L49A 3VPXA 3NOXA 2GBLA 2C3PA 4BNGA 4XUGB 1JT2A 2D1YA 3K15A 3R9KA 4POOA 4WWHA 3RRFA 4TTPA 1K98A 2J9YB 3DM9B 1TM4E 1XDUA 2E7ZA 3QTLA 5A5VA 5CLHA 2MSDB 4UCQA 4XWWA 1HZZA 1XD8A 1CZNA 3STVA 3LQQA 3F46A 4E46A 4M37A 3C1OA 1X0VA 1RVDA 3CH7A 5L3SA 1S96A 2V9PA 2CV2A 2BKUA 1U7HA 5CFMA 1CEEA 2XVZA 5ALWA 2DR3A 2I7CA 1T0UA 1GPH1 4YRIA 1I0IA 3TXYA 1PBTA 4UBLA 4HMOA 4R8KA 5FF9A 3FVWA 2FQXA 1TF5A 2Q4BA 1FFBA 3X1DA 4E3WA 4EG7A 3OQOA 1QHYA 3AF1A 4HQLA 1B0UA 3NALA 2R85A 1H22A 3K8OE 4WJLA 3CU5A 3PVCA 4BVAA 2CV0A 1F5SA 3KEQA 4OG2A 4O3MA 4L4XA 3ZZTA 1WXWA 3W5IA 3MTBA 2IE0A 2OPBA 5ITWA 4BFWA 3E8SA 1Y7LA 4Q9JA 2H85A 4Y2GA 1TC2A 1CUBA 1KK0A 2DP4E 2I6GA 3IBTA 3BILA 3Q88A 5AO9A 5JO0A 1RKQA 2O0LA 2H57A 3UQYS 4B6GA 1QDUA 5AJHA 2O9JA 5BNZA 4MA0A 3KAKA 2RGCA 4IWYA 4DA7A 4KOAA 3MJDA 1A04A 1E6UA 1KZ4A 3VH1A 1RR6A 5DNDA 3FGPA 3QYJA 3KAJA 5FBHA 4RBNA 2GF9A 2HM7A 3FR8A 2QP9X 3WGJA 2MSKA 1JDSA 3LA8A 4M0EA 3FWPA 1SVIA 1HFEL 1ZNQO 3KUKA 1FNSA 3NONA 5YASA 3SS9X 4TKVA 2XSZA 4X3CA 3HB7A 2VJBA 4JBWA 5B12A 1W5AA 4WNYA 4LDJA 3PIIA 3COSA 3CKYA 4OQXA 1Q0UA 1R0WA 3TSOA 4R41A 4C7OB 4L5BA 1SNYA 1K08A 3CXUA 5KYNA 4YRGA 2W2KB 2QL6A 3QWBA 3FBTA 4FHFA 3B48A 3W3AD 4G65A 3WWEA 1XJ0A 4LZPA 4C1NA 4RQUA 4DV3B 3HO1A 1YTLA 2ZATA 3M4ZA 1EEXB 3U7IA 3LY7A 3WL8A 1QV6A 1EJ6A 1IHOA 3K73O 3ZOKA 5B1SA 4BO7A 3BBLA 3UHPA 3QTBA 4L6CA 2VDVE 2FPLA 2VYNA 3N3AC 4LQDA 4M8LA 5ALYA 4FBGA 2DFPA 2PANA 4OFWA 1QGDA 4BMNA 4AL4A 3WGUA 1E32A 5E1MA 1YQQA 1XRLA 2OO5A 3ZU2A 1FP7A 4ZJUA 5BP7A 1YU9A 1S2OA 1MAUA 1J2UA 4ZT6A 2A1UB 4MULA 4YJ2A 2E5WA 4CL8A 3BWEA 2ZITA 5AQ1A 2V8OA 2WFMA 2XB2A 4FEYA 2FXIA 1YQEA 4LI0A 5HS6A 1ZW1A 1TF7A 2OMEA 3WQQA 3H65A 1LGYA 4OSOA 1C0EA 1RQRA 5TEVA 1WEHA 2B9VA 3JSXA 5BV7A 1DRUA 1J9EA 2F8SA 2KBEA 1NQVA 3EIHA 1U0LA 3RC7A 2B8NA 2B4RO 5AK5A 1EUYA 3DCJA 3A25A 3KHUA 3DBRB 3CX6A 4M99A 4BKQA 3Q9NA 1E1KA 4J4BA 1WDMA 4K40A 5KQRA 2QGNA 5IPFA 3F5QA 4KE6A 1L4HA 4O1HA 2ZDGA 1VI5A 3WYFA 1ODIA 3ETDA 4D42A 3JD4A 2IPAB 2FNAA 5D01A 2H9AA 1YA4A 2ODAA 5JH7A 1KAOA 4B6RA 5MDHA 3OKCA 5JWHA 3F3MA 2AI1A 1A5TA 4HVTA 1GZ6A 1FDIA 3DOIA 3FB1A 2HUNA 5LNK1 1M1YE 2NVUB 1SUCA 2AOTB 2Q4TA 2ZSUA 1JBEA 2PZKA 3DHWC 4K26A 1NRIA 1WP4A 1G8KA 4CTNA 4ND2A 4KBYA 4R6WA 1AGPA 1Y3BE 2I22A 3FPSA 2PUAA 2KM1A 2QI9F 4PANA 5KYXA 2FOLA 2AMJA 4UM9B 1R4ZA 4PYOA 4XQ0A 1RI4A 2GSWA 2HHLA 4BGUA 2IOYA 2O05A 2VAVA 4FMBB 1CY6A 5JU6A 4I55F 2NT4A 4DA0A 1P1KA 2F67A 1PFKA 4EI7A 3UGJA 2EXXA 5I4BA 1Z2NX 1WLSA 2P6RA 2X0FA 1LV8A 3EGDB 3QJGA 3L7BA 4CCWA 1DO8A 2R8ZA 3AJ8A 1EWKA 4ND1A 4CQLB 1VKHA 2V5UA 1WMBA 1NBWB 3HDQA 2VF8A 1RCUA 4BTLA 2CHQA 1COZA 1B73A 3PDCA 5HZKA 5J3JA 4IMIB 4DVGA 1EYZA 1GLNA 4DR3B 1X8JA 1PJSA 5T67A 4YMSA 5JSZA 1J0CA 2B92A 4YMVA 4YRSA 3B1VA 2I99A 3UY4A 3GFSA 3O1LA 1L1EA 3AJEA 1ORIA 2FLKA 4MQFA 3QX8A 1F1BA 2EJBA 3GYBA 4EHIA 1TU0A 2IHBA 3M7IA 5H4GA 3EZ6A 1A0OA 1KF0A 3BN3A 3LHFA 3S40A 3KE9A 1ZD2P 4HVAA 3QW2A 4G4GA 5K6TA 1EU1A 3KXPA 4NBRA 3SVLA 2X86A 2UU9B 3AB7A 1ZEMA 1QK4A 2P1ZA 1SEPA 4X65B 3NASA 3G5UA 1M34B 2R8OA 3U6KA 2OP1A 4L27A 5AMXA 5FJJA 2QQ0A 3C7DB 3VHXB 1M1XB 1S4QA 4F9EA 1JQAA 4L72A 4Q47A 5JMWA 3HWX1 5JQGB 2JAXA 2JFHA 5C0OE 5LYJF 1TU4A 4DZZA 4ZRNA 5B7NA 3HXOA 2JFUA 2QYHA 4N76A 4BNKA 4MA5A 3ZU6A 2NAFA 1IQ0A 1VKZA 2A3RA 1DJOA 2H63A 2QSYA 2EW8A 3D2LA 3ONNA 1ZD3A 4F3KA 3T61A 4EG8A 3HRHA 5FAXA 1SB8A 2JEOA 5AVVA 3TE7A 3BMCA 1DBQA 2WJWA 1D0SA 2ZTLA 1T6YA 2V6GA 2RJ3A 3N87A 4KAJA 4MW5A 4BUZA 1AKWA 1UP4A 3B8HA 2W6IA 4G36A 3USZA 4AYWA 5BMVB 1WA5A 5IXJA 1UBJS 4FYMA 3EIEA 1AQJA 1Q1NA 4M1QA 4INOA 4FGUA 3UAOA 1D8TA 4NBVA 1TW2A 3W2HA 2FG5A 3RTAA 4NAUA 2GAAA 1P1CA 3G0GA 1P9RA 2EV9A 5BN1A 3UTDA 1C50A 4CZ2A 2IYOA 3B85A 4V03A 2FF5A 2YS7A 3CEJA 4YR9A 1NONA 3RUCA 1BAPA 5FA5A 3HP7A 3LZ6A 5FOSA 4OUKX 5AHWA 1NSTA 4C76A 1JHVA 3PFNA 2D5AA 4ROTA 1G8MA 3PXAA 3URKA 4BN5A 2YQ5A 3LLSA 2R6CA 2O0MA 2X8WA 4FR0A 4MQ6A 3U4QA 4KTVE 3NTUA 4I14A 1SBHA 1CRWG 1YZHA 1G5QA 1AGRA 1MXHA 1KAHA 2VP4A 4DLSA 4FR5A 1UM9B 2GJAA 4L5AA 4BX8A 2F3PA 4CRWB 3HLYA 4TROA 2LCQA 5HRUA 3RW9A 2P78A 4U9IS 5F23A 4ZU1X 2WUWE 3OETA 1UMBA 3JYHA 5E38A 1XQ6A 2JRCA 1XA3A 4JSTA 1CUUA 3ETCA 3O4FA 4HY3A 4XB1A 5IBQA 4KLZA 5CDFA 3SF8B 4CL2A 5HZHA 5JMTA 2C7QA 3EXEB 4PAQA 1MQ8B 1WU7A 3V48A 5B4VA 2Y1FA 4CEHA 1RWXA 1IJBA 3RK4A 2O19A 3IE0A 1C7ZA 4FX2A 2H4WA 1X19A 3FPGA 2CHEA 3H3JA 4TWZA 3SWWA 4HZUA 1PFGA 3OQIA 4LWZA 3VH2A 2ZUDA 3U3MA 1GGJA 2X1MA 5ALHA 2ZRBA 3NHJA 2O2DA 4Y7CA 3ZLTA 1DG1G 3KQMA 4I4CA 3I52A 1BKDR 1SCUB 3QYPA 4PX5A 3FVTA 1SHLA 4Q34A 3V7NA 5GJWC 5K7SA 4FIZA 2P91A 2WFAA 4CCYB 3P0RA 1M7HA 4OX9Y 3WV5A 2OG1A 3FROA 1XHLA 4FOTA 4FMDB 3F49S 2ECKA 1P1HA 3N7UA 1Y37A 1T13A 4Q7JB 3KP1A 1T6NA 4OLAA 2EW1A 2QYTA 5EIEA 1DTWA 2IU6A 3I2FA 5LOVB 1XLTA 2MT9A 1NATA 2W83A 4MICA 3QVGA 3PEYA 4UTRA 4LOIA 2MSNA 4P38A 1KQ3A 1KRWA 4QDJA 1TPZA 2V6IA 4FKBA 2FGJA 4FKZA 4JLJA 4MARA 3LPMA 2CSUA 2WJPA 1DO2A 4OQLA 2OHFA 3RUPA 3QPCA 4QUHA 1GTSA 3AGQA 1S2DA 5FTJA 5BSFA 1W0JA 3SEFA 3VDQA 1YJCA 2WPDA 5AW2A 3IESA 4MUAA 3IPXA 2WMOB 1WQ1R 2QROA 3TI7A 1DQSA 1WF6A 2C88A 3A26A 1T3GA 3DMPA 4NYIQ 3R7BA 3TJZA 1V5FA 5EC8A 4F4UA 3BJRA 3OOJA 3CZQA 3ECAA 4GHWA 4Z54A 1R12A 2NIPA 2D06A 3I34X 4KGXA 3WDKA 4X85A 4WUTA 3ZUPA 3O4IA 4S2EA 4CYMA 3GIDA 4DANA 3CUTA 2IYZA 1I4TD 3ZWKA 3Q7EA 4HDNB 2OFFA 3HKEA 4DV2B 5LDHA 4HEQA 3H2YA 1LXCA 4X90A 4HUQA 4N41A 4UHFA 2YX1A 3LDFA 4Q9NA 4TV9B 4AN1A 1D9XA 5ITZA 1B26A 5AXCA 3CC8A 3VOAA 4A0HA 2ZRDA 2R751 3JX9A 2HH9A 3QA3E 1PGPA 1AXRA 4DFDA 1V7ZA 3B6KA 4F72A 1UOPA 1Q7CA 1QC5B 4C0WA 4QBHA 3HDVA 4ZDKA 1OLUA 4KDCA 1VG1A 2JJ2D 1MNAA 3QEMB 4XWTA 2GR9A 2IITA 3GBVA 5G0SA 1Z38A 4C08A 1YNOA 2HLDA 1OB5A 1E1QA 3ZU4A 4HN9A 5BWOA 1I36A 5DMXA 2Q9BA 1TIPA 3CLTC 3I62A 2HDOA 4H6XA 1PX0A 4X93A 2ETXA 3HDJA 3CEHA 1ETUA 3UUEA 3K6SA 1POXA 2AFIB 2YNMA 1EXMA 3CZAA 1E1MA 4CIAA 1W1IA 3BA6A 2O0KA 1WDTA 3OM1A 1ES9A 2QQ5A 3WISA 1UDRA 2JAPA 2OCDA 3KFLA 1XN1A 1UC9A 4ND4A 3RVPA 5HTOA 1QFXA 4TT8A 2OZEA 2EHJA 3VTKA 1RE0A 2QIPA 1UMCB 3L0PA 4WK6A 3D4IA 5AI4A 4FFWA 1QBGA 1RLOA 2B83A 2JHAA 2Y1DA 2QL7A 1MO6A 3OEEA 4M2LA 4UD6A 3WK5A 1ZOLA 2CNWD 3D6HA 4UAGA 3QUAA 4ZVPA 3WGYA 1E69A 1K7EB 1N7HA 2P2SA 3SIWA 1WPXA 4U7TB 5JC1A 3ZDBA 1NC3A 3GRAA 2ZYTX 1Z7EA 3Q8WA 4IIVA 3FSEA 1W36D 1RZUA 2C1ZA 4C4RA 1A9RA 3CUVA 2NLOA 3UOGA 2PFGA 4OHOA 2P2CA 1E2PA 3DFKA 3LH5A 5AI0A 3IJEB 5G4KB 4UBNA 1M1UA 3FR7A 3G68A 2Q6IA 3EOZA 3VU1A 3HY6A 2A1TS 3PDUA 4EFMA 2R25B 1UXKA 4Y2HA 1HOTA 2X4IA 4KUHA 3OO0A 5AUNB 4DYVA 2WIBA 2I03A 2PFKA 1TAHA 3UFXA 4K9PA 2DPGA 4QPNA 3VZDA 3ZE8A 1JKJA 2OHGA 3O82A 4CDGA 1OTYA 5HRAA 1NOIA 5KX5F 3NAZA 4W8HA 1LLQA 3QKSA 2AYXA 2C78A 4NK5A 4QOGA 5CJJA 2NPFA 3UC5A 3IQFA 4AMUA 2D1QA 5JFGA 1UJCA 3Q72A 4TVBA 2W6ZA 2GHIA 2JCGA 3DP7A 2O1WA 2O2IA 5HUHA 1M2FA 3DWGA 4B3MB 4R3NA 1SQ5A 2L0XA 3D3NA 4CMIB 4DV7B 1N7IA 3NWPA 4MV6A 3PHIA 3ZHZA 3ER9A 3WLNA 2I62A 5TS2A 1T8UA 2IYLD 2X5OA 1RQNA 2V98A 1L5SA 1CY8A 4MHTA 2PSDA 2GLUA 4QO7A 3LUJA 3RSGA 3WX0A 1E1CA 2GH1A 2FZWA 5EYPB 2GVZC 1QYRA 4JJ7A 1QH9A 1ZJYA 2VHQA 4P1ZA 5HDQA 2A67A 1JF8A 2XYQA 3DE4X 3GEHA 3RRZA 1JZQA 4D82A 5HS4A 1VL1A 4EMBA 3CG0A 2OHHA 1S1MA 2VCYA 5HQ3B 4MX8A 1D7OA 2CLOB 2XVAA 1RAIA 5AW6A 3B5JA 1HDIA 3A1EA 3K2QA 1Z5PA 3GCZA 1FQWA 1USWA 4C4OA 4HVLA 3GV0A 1Q84A 3TQFA 3O2JA 1SD1A 3O4VA 3AEUB 3KM0A 3O6VA 2YJ3A 4Q4CA 1ZUD1 8GPBA 4I81A 1V6CA 2JNWA 1I5EA 3EPLA 4G9BA 2C4VA 3H16A 2BVNA 2RMKA 1MH9A 1NWCA 3PC4A 4DMFA 2SBTA 4QT4A 3ZIUA 3TS1A 1US8A 1O96B 3TX2A 4M60A 3EFEA 4R3UC 4YV2A 5ERYA 3VRHA 1N4DA 2GPSA 2ZTHA 3JTEA 3EGVA 4JJGA 4K7JA 2QTGA 4V1CB 5K0GA 5TQ0A 1ZJ6A 2OXFA 3HVJA 4P2BA 4U9UA 5A71A 5LP6C 1XD9A 3B78A 3IDFA 5G0UA 4Q48A 1LW6E 4MV4A 1QQ7A 3EXFB 2VZ0A 1T1RA 4HHEA 1RWVA 5FUXA 4FJ0A 4Q37A 1HDGO 2G7MC 2I4RA 1VJCA 3CKLA 2QRNA 3F7TA 1FVOA 1CUHA 4LGMA 2C2WA 2ZB8A 4TL8A 4ONEA 4DMGA 1Z17A 5BSWA 3U49A 1PNVA 4AROA 4EKDA 3L0BA 5HM6A 3WGIA 3IKMB 2XD9A 2FSGA 4A8HA 4N6GA 2PBFA 3PSAA 3G2JA 1N8TA 3BZUA 4G1CA 2ABWA 4WQMA 1HT3A 2XVYA 3CH5A 4GWLA 4BLOA 2M2IA 3UHFA 1EUZA 5CP8A 3KLOA 4FYVA 4RS3A 4JR1A 1AQNA 2J9XB 3CBQA 3K72B 2ZM6B 5EUBA 4FYKA 3KSBC 1IXYA 5LJIA 1ZNWA 3DDSA 2JD0A 4M1MA 1F0YA 5KOHB 2VQSA 1U7XA 4YAJA 3BGDA 5BT8A 3PKJA 4PYJA 4ZHSA 2I78A 2QM7A 4KFSA 5FUYA 3OF2A 4GGMX 4Z5XA 4QAQA 1RADA 4OI1A 4IHAA 4CG0A 4KGZA 1OXUA 3HFGA 4ZHQB 4Q4LA 5TB5A 4TVKA 5JRZA 1QTQA 2WU0A 4JJ6A 2FE1A 5MN4A 4FFDA 5D5QA 1W88A 3ZCQA 5F1KA 1E4EA 3NX4A 3ABRB 4MVJP 4N7JA 1Z8HA 2OO3A 4U9HS 3PGVA 1ZICA 2IHNA 5E0OA 3L4BA 4I6JA 2Z5GA 3PVZA 4OXRA 4RLSA 3AFOA 4X7RA 3RYHA 1JG4A 4LJ5A 1DB3A 4ZI3A 1EIWA 2I7DA 5TMPA 4ETIA 1EFPA 1DQNA 3L8GA 1N3IA 2X1VA 4INAA 4IDBA 4D98A 2WT4A 2B8EA 4A6DA 2QG6A 2C8VA 2GTIA 2Z8XA 5TQ2A 4QBGB 3GA7A 5JS2A 2YWDA 4GD3Q 3WIEA 4EMUA 1FVFA 4URUR 1UT8A 2IXDA 4ZQBA 3DZKA 3ND7A 2V0GA 1J33A 4OGLA 5AI8A 3EOBI 3KYIB 4YMWA 3G9UA 1JJBA 3O1IC 3PITA 2CLMB 2P5SA 2PZAA 1Y1QA 3X2FA 2RI0A 2X0IA 2ZUSA 2BFNA 4Q12A 5EJ8A 2PJUA 1FRNA 4NFLA 3PNLA 3FMPB 2Y9PB 3QFSA 4YWHA 3PQ4A 1Y4UA 2HJHA 2PSFA 3RYIB 1IHXA 5IEBA 4PFSA 3DUFB 1W19A 2J4FA 1CUSA 1YBMA 4W8GA 4RK4A 3Q2IA 1NJ2A 1HURA 5CLJA 4ZI2A 4KH0A 1I8TA 3TWOA 3NFRA 3JVEA 4DCTA 3WLRA 1O4VA 2Z58A 4JI1B 1ZOOA 2E1PA 3G89A 4MYDA 3VYRB 3LYAA 2COKA 1KJYA 4NJMA 1JR3D 3GRFA 2AJDA 4HX9A 1GDTA 1GDHA 4J0HA 2B7CA 4RVDA 3FIUA 3VU9A 4BFZA 4YB8A 5F3RA 5C8YB 2WHEA 3ZGXA 1JKMA 3D7KA 1YJXA 1TOAA 2BCGY 3QKIA 4FDMA 2XNDA 4PRLA 5IJAA 3AI2A 3L6DA 1GZSA 3MJCA 4MMXB 4IO0A 5ENZA 1B41A 1QIJA 3QEKA 1JQBA 2ZIGA 4LZZA 9MHTA 1WULS 3NJRA 3SR0A 1AO0A 1ULZA 1CQJB 1AXGA 3EXG2 4WCFC 1RS0A 4LMBA 3RSCA 2B1IA 5HQJA 3A9CA 4IJQA 4LECA 1PQYA 4FOSA 5JSKA 3O3NB 2P8JA 2VPTA 3GELA 2OENG 2YV4A 1B74A 4FSDA 1Q44A 3U48A 4ZCTA 3JD2A 5KJCA 2ZDHA 3GNTA 1YI1A 4XIGS 4ZOLA 5EZ6B 1Y8RA 1U0GA 2OBYA 2YZ7A 2IWHA 5I01A 3QH4A 3RO7A 2IOFA 5TMBA 3WAGA 4BJ5A 1GYQA 2Y68A 3MCAA 4JU9A 3FB4A 4YV7A 1XPOA 2WTUA 5J4YA 1FZTA 1M2OB 4PGGA 1HI9A 4XGIA 2NU7B 4RV4A 1V71A 3WQSB 5IWCA 4Q4DA 1NFRA 1EJ0A 3Q7PA 4ZXFA 4IOJA 2PGOA 1AQYA 1I9GA 1JMKC 4HNVA 1L8OA 4MWEA 4BP1A 4BTVA 1BEEA 4PIVA 4LCBA 1M5UA 2VQDA 3OE7A 4EEXA 1DBPA 1GQQA 5JISA 2HADA 3QFTA 3FBGA 2LIVA 4X20B 1BXGB 3PHLA 1QGED 3QPUA 3NBFA 1Z2EA 5DHPA 1E2GA 1KAEA 4FHDA 2Z9CA 4PS0A 3WYAA 1PR3A 1QS0B 3VKFA 5FBZA 3VR4A 4K9LA 1MB4A 5EKDA 2QNBA 1FLAA 2GO7A 2BFEB 4CQJA 3IO5A 3T9FA 1C0KA 4JP5A 5A1JA 2PN1A 4NMLA 1BE8A 3RT1A 4UTVA 1K4YA 4IQ0A 1Q1GA 4G5SA 4EH1A 1N6RA 4HDOB 1KEVA 3OECA 7YASA 3AG5A 1JLHA 3ASZA 4WZAB 3UO8B 1CQWA 1OXVA 5AJUA 4PO8A 1J1IA 1NI4B 1WY5A 2YR0A 3H3XA 1B3RA 1ODKA 2V4MA 5EN4A 1IWOA 3PG5A 2NU8A 4PFJA 3UAZA 5AW1A 3QFFA 3V8PA 4AECA 3GT0A 1QTNA 2ARKA 2HF9A 4QXMA 3QF7A 1CQXA 4GU5A 2O8FB 4UMVA 1QHNA 3B9QA 4ZYLA 1WD7A 1QYDA 2P4SA 4OK6A 5HEKA 4JUDX 4EAAA 2IYEA 3U1BA 5H9WA 1NR1A 4HNSA 4L3OA 4MR7A 2WWYA 1QQAA 3KZVA 1ETHA 3WMRA 3ISTA 3KB6A 1Y80A 3GFOA 3KQWA 2YW9A 4HFMA 1UJ5A 1DC7A 1X7XA 3G1TA 4GICA 4IIDA 2H4YA 1DARA 1ZRNA 2XMPA 3DAGA 3Q10A 4HLUA 4RVSA 4YMGA 3HSSA 4ND6A 5HX7A 2GEBA 4I8IA 5GV8A 4C0KA 2OORA 1DC4A 3REFA 5CEJA 4F85A 5COBA 4LF8B 2XWPA 4OXKA 4UNQA 2EQAA 4Q7MB 2A9RA 2YMPA 4XI9A 4BNUA 4QVGA 2BCEA 4JUBA 1JU3A 2B7BA 3STTA 1ND6A 4BC0A 4DNQA 2VCHA 1U2EA 2FRVA 1KK3A 5FBRB 3W4IA 3U6BA 1E2IA 4RH1A 1KSFX 3AW9A 4FR2A 5JAQA 3RH0A 3TEJA 3UJ9A 1KS2A 4QPPA 1N7GA 2Z98A 3ZZNA 1Q3TA 4EG3A 2CXNA 3CSDA 3ELWA 2DMRA 4ZAGA 5BN4A 1KMCA 5I5EA 5BW5A 1BVRA 3I76A 2DPHA 2DR0A 4QDZA 2VYFA 1EA7A 4E22A 3PCTA 5FOVA 1CY2A 4F1WA 1QRRA 1NN3A 4GSKA 1PBNA 4UNSA 2GCOB 1W47A 5CM9C 5I4CA 1IUKA 1INLA 2QMQA 3P9XA 1YI8A 4JJEA 2A4MA 5D51S 5DYTA 4BNLA 1BA2A 3KQSA 1XFDA 4PYQA 1YDFA 3A4LA 2WMYA 3JASB 4BVKA 1Z75A 1RYYA 3GLQA 3T06B 2P4QA 4QODA 4FDTA 5ALOA 2N1MA 2P9QA 5T3YA 3SM9A 3U7RA 4Q19A 3IVGA 1FUIA 3KKMA 3V4ZA 4DSUA 1G6KA 5LA6F 5F1PA 4JLVA 1JPJA 3NETA 3MTJA 1JXMA 1KFJB 2VDUE 3NUGA 3DP9A 3K9GA 3ESYA 5TX7A 3GT4A 3SEZA 3SSOA 1L6RA 4HQ0A 1HKUA 3VU8A 3ILHA 3QMWA 3WC4A 1K4KA 4G5YA 1NYLA 3I4FA 3R3ZA 3QWHA 4AI6A 1YGPA 1DDIA 2EKQA 2J9ZB 2Q62A 1TGVA 1K0FA 2ZTMA 4MV1A 3SX2A 4P3YA 4GMFA 4YUAA 4QNRA 5IARA 1HF3A 1QFMA 1SKQA 4DA9A 4ZTZB 1JDNA 3GCWA 1M3SA 4F5EA 1BDBA 4XYGA 3PDJA 4S1WA 3IR7A 1OAAA 4ZQCB 5EAIA 3UB2A 2G1JA 3ANNA 4C4ZA 5KPDA 1QG6A 2C1XA 4B3RB 3JRXA 1HPLA 2JAHA 4LRWA 5KTOA 3MWDB 2OVFA 4QDUA 2UXCB 3ROPA 4K6FA 2CMDA 2JARA 1FPQA 5ESRA 3B1WA 4CV2A 3MMPA 3DF9A 2C4UA 1RP1A 3SX4A 1A69A 5A4AA 3DDUA 1GNRA 1X38A 2FSPA 2D2EA 4P0PB 3I6QA 1HYHA 1BHQ1 3FXAA 2IZ7A 4I19A 1M6NA 3SY8A 1H2ZA 2OAEA 4D7AA 3ZDYB 3U44B 2AFIE 2BF7A 3LYHA 1JWAB 4S1OA 2A7QA 2IXEA 2R5WA 2C4WA 4X6XA 5FTNA 4RVUA 1Z06A 3PJEA 3HEMA 3HI4A 3ML1A 2J08A 1IUOA 2VZLA 3BMQA 4URHA 3J81A 4M1OA 4M0MA 4R9UC 4CEIA 4J1TA 2DBRA 4PZEA 4UMFA 4ZQIA 5DM2A 1F7VA 4C5AA 1ZN9A 3N0XA 5KQSA 3T1YB 1TQ8A 4UBJA 2BDTA 2PMKA 5H16A 4ENSA 4KP7A 4D5GA 4DIUA 4IUYA 3G7UA 2ENWA 1EE1A 3ROKA 3ZHTA 4EF5A 2OL4A 3CINA 3TLEA 5AUOB 1NW9B 3ND8A 5HWSA 2ZBDA 3BFKA 3DTTA 2QMYA 1Z15A 4GMXA 3S6JA 1HYBA 1D1TA 3DFFA 5AKLA 5EZYB 1TI7A 1ZRHA 3W9BA 3LKBA 2H54A 2MINB 2PJRA 3H4MA 4K86A 2KWIA 4BNDB 2X3FA 1KBZA 2IQ5A 1LK7A 3WGLA 5ILQA 4JI8B 1U2TA 4DAOA 4OAPA 3EMVA 3I1FA 5BWCA 1XZ8A 5JRDS 3V1KA 1CLEA 3KQQA 3SK0A 2IEAA 4MUEA 2DAPA 1GPAA 2Z2ZA 3OEHA 4LJ6A 3EHEA 4ZT2A 4Z0NA 5F5XA 1Y5RA 4X1YA 5SZKB 3AIMA 4JL5A 2J9FB 3HJRA 1OYYA 3FWZA 4MP8A 4MQ5A 5G40A 3ZD7A 3I6MA 3UJ7A 1NM5A 1NBAA 1CT9A 2WVHA 3A9TA 4FGZA 4YRRA 4OLHA 5D1HA 3FDXA 2LW7A 4DREA 5K0SA 4GGOA 1VZ3A 1Z83A 1XZFA 3QV2A 4NAHA 5I48A 3KB1A 1XJCA 3QFHA 4OA5A 2IZOA 4CIYA 1U9CA 3W4JA 3ZR4B 3U5TA 3VX3A 3CLRC 4I3GA 1P17A 4Q3KA 2QD5A 3DNMA 3GWZA 5KMGB 2YUIA 3Q15C 4UHKA 2JB9A 4YJ3F 4DCMA 3TNDA 4H7FA 4JBHA 2NUAA 3QLUA 2QLLA 1TO1E 4NS4A 2V96A 4NICA 5AYVA 1C1DB 2DCUA 2OP0A 3VO1A 1D2GA 2LKCA 5AXDA 4QTZA 4U3JA 3K30A 5AVRA 3M81A 4P4LA 3V1YA 3BORA 4H31A 4Z3KA 4NBUA 1TKCA 2AH5A 2RGGA 2XTJA 2ZE5A 1OJLA 5DIFA 5DSXA 2QUKA 3PHGA 4XASA 4Z3DA 1QSGA 3Q5DA 5TPWA 5EXSA 5ARBA 2C5LA 5LDDC 4AJ1A 2BI4A 2ONYA 2Z8YM 4DIBA 4US2R 2J67A 3DAYA 2PR7A 2WTBA 3OZRA 2PUHA 1FTYA 2YHUA 3OTWA 3ICCA 4NMXB 2D2XA 2WJ4A 2AF4C 1A95A 1XCGB 2DKOA 3I2IA 4ACBA 2C2YA 3RYTC 4FWTA 1YZQA 1FJ2A 3B1KA 4WKPA 3OOEA 3ZCRA 1KO4A 1GNVA 1M1ZA 1S5PA 1DQRA 2PKEA 5GZ6A 5LYJA 3WFJA 4W99A 3RS9A 3NHWA 2B0JA 2VRWA 1ULAA 4HH0A 3WLPA 2XVMA 2NT3A 3PUHA 4TV8F 4FYYA 1JKXA 2P9GA 1WHSB 2FVYA 3CGGA 1K5GA 3QTTA 3JATB 4FYJA 4WEQA 3R44A 1IUPA 4KXVA 4L0DA 5GMOA 1OC2A 4TTQA 1U28C 3PCXA 3H4VA 2EQ5A 3LBFA 3AHHA 1BXKA 1ZL0A 4P83A 4RL6A 3DZ8A 5E9AA 3VO9A 1MXFA 3TLGB 4C87A 5K6AA 1LRLA 2R6AA 3BXEA 3H8WA 1Z5ZA 4K6GA 5T4HA 1F0NA 3FCOA 3LUPA 3DOHA 5CW2A 4CGYA 1SQGA 1AGYA 3TRKA 2XCSB 3PX2A 3H2GA 4JZYA 5DBFA 2ZVQX 4F04A 4RMGA 3BUSA 3V80A 1QRSA 3EC1A 4KVAA 4XRRA 1P5RA 2DECA 4RZ2A 2XHEA 2BIFA 4CMAA 7AT1A 1QFJA 4WLFA 4A7PA 5KVAA 3J81k 2QAGB 4AYTA 3A0UA 2UVDA 3GFFA 2AOUA 2BL4A 2IPMA 1YIAA 1VYVA 3B6JA 1C1YA 3C8ZA 1NV9A 3E8MA 3PUZA 4P3PA 4QC2A 3WFZA 5HM8A 2HHJA 1P81A 4P5PA 4GKJB 3EBPA 3OG9A 4DBLE 3HYNA 4K9RA 3QEAZ 3TD9A 2C94A 2JIBA 2MU1A 3CKKA 3DMDA 5BN3A 3NYWA 3H83A 2WWFA 1NBIA 1U8AA 2HSWA 4K6CA 3MW8A 4LUCA 4O2AB 5DTMA 3T5AA 1T91A 2HQBA 5T5QA 3HKDB 1CTQA 2QV7A 2VPWA 4M9XA 4JP1A 1YO6A 2ZE6A 1VSTA 3H1PA 4P22A 4DYHA 3UJBA 4WDRA 2O8BA 1CJKC 4WX2B 4ARAA 3RF6A 1D1QA 1J0EA 2FPIA 2XMBA 4FYPA 1FEZA 3PC6A 4XM2A