4DJTA

Crystal structure of a nuclear gtp-binding protein from encephalitozoon cuniculi bound to gdp-mg2+
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
190
structure length
186
Chain Sequence
LTYKICLIGDGGVGKTTYINRVLDGRFEKNYNATVGAVNHPVTFLDDQGNVIKFNVWDTAGQEKKAVLKDVYYIGASGAILFFDVTSRITCQNLARWVKEFQAVVGNEAPIVVCANKIDIKISKKLVMEVLKGKNYEYFEISAKTAHNFGLPFLHLARIFTGRPDLIFVSNVNLEPTEVNYDYHSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein GSP1
publication title Crystal structure of a nuclear GTP-binding protein from Encephalitozoon cuniculi bound to GDP-Mg2+
rcsb
source organism Encephalitozoon cuniculi
molecule tags Nuclear protein
total genus 61
structure length 186
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08477 Roc Ras of Complex, Roc, domain of DAPkinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4djtA00
3BORA 3A37A 3BAFA 1MO3A 4L4UA 5HCNA 4HI0E 1G16A 3GLHA 5DE3A 4N3NA 3REGA 3K0AA 5EE0A 1XXHB 1XTRA 4ITRC 5C4GB 3U60B 3BERA 2IS2A 1J8MF 1U98A 1ZU4A 2FX3A 1F5NA 2ZIAA 3MRSA 4DLTA 1II9A 2GVZC 3FKSD 4LJYA 3W6PA 1QHXA 4CRWB 1E2KA 1Q1EA 4LY6A 4NCJA 1WB9A 4NCIA 2ZS7A 3TMKA 2JDIA 5JS8A 2ZU0C 1OKKD 4C0JA 1R0WA 5BXQC 1ETUA 5B30A 1DAIA 4JT4A 3EZ7A 2XOKD 1YR6A 1KTVA 1OXXK 4UXIA 3FYHA 3PUXA 5EP4A 4KFRA 4M1WA 3TUJC 1W2GA 3ADDA 1OIVA 2RMKA 3AVTA 4TMKA 3H1TA 2I4IA 1NJFA 1VECA 4ESVA 1VYUA 1Q12A 1P5ZB 1NG9A 1YZUA 2ZAOA 4IW3B 1FX0B 3B82A 1VPLA 1B23P 4OI4A 2ZE5A 2XXAA 3ZS8A 2AWNA 4QC2A 3CKLA 2P67A 1TQ2A 1XB2A 3OIVA 2EWVA 5H8WA 2O8FB 1LNZA 1Z5ZA 1W47A 4JIMA 3B78A 5UKDA 1TL7C 4A4DA 3BB3A 1M6NA 2QEQA 2WWXA 2ZSFA 1DEKA 2O8EB 5L3VA 3QY0A 3T1TA 3TBKA 5DYGA 1DAFA 2NQ2C 5KDOA 4C7OB 4PANA 3RYTC 2JLWA 1Z6YA 1NLYA 1NN5A 4YMWA 3EX7C 1ZNXA 2JJ2A 1NNEA 1W36B 3KFXA 1M8PA 2HJVA 3A8TA 4JT2A 4TYWA 2A78A 2R44A 4DBLC 3RS4A 3AP2A 1WBDA 3U4QB 2IEZA 2BDTA 3K0FB 1GNPA 4G0NA 2O8CB 3BH7A 1XEFA 3OIUA 1P7CA 4RCZA 3TAHA 4TTPA 5HZHA 1E9AA 1I2DA 5AUOB 1HA3A 4DRZA 2EFEB 3RSOA 2CLDX 3PR1A 4B73A 4C4PA 1P61B 4LI0A 1AS2A 1R0YA 1ESNA 3X1DA 4EJSB 3R9WA 3ND8A 2CE7A 2Q9CA 2WSSA 3QXJA 4IVPA 4WBSA 2ZJ2A 4DVGA 3SJAA 1RFLA 4OYHA 4PQFA 5B64A 4RD2A 5C4MA 4BQSA 1G3RA 3NBFA 3K8YA 1G3QA 2DB3A 4TTRA 2CEAA 1G7SA 4OL0A 4PTLA 3SBEA 4JLMA 4D0GA 1QG4A 4XSGA 2VL7A 4TLDA 2VHJA 1AM4D 4II7A 4D82A 3F3YA 2IA5A 1BYUA 4YXWA 1GRNA 1XZPA 3B8HA 3RSLA 2J87A 2WOJA 3A36A 3IQXA 3L0IB 5IDVA 4KFSA 3EPHA 2HEIA 1MV5A 5AJYA 4JVMA 3MWJA 4Q4AA 5CYOA 4N0EA 2AXPA 3S1AB 1SXJD 4IDNA 2QAJA 1KNQA 1WXQA 4PX9A 5TXGA 1TPZA 3IEUA 2QQEA 2OAQ1 5L3RA 3EC1A 2REBA 4MKGA 2E87A 2A5GA 2QTFA 1D5CA 4LHXA 4CF7A 2ZRGA 4ILEA 1GG2A 2OBLA 3KJIA 2W6ID 3CNLA 5CYPA 3ONWA 3B7GA 4WIAA 3JVVA 1EFCA 2ZSDA 3OEHD 2REXB 3TR5A 3TW8B 1E4YA 4EPTA 3PEYA 1KIMA 1Q21A 2RGNA 3WHKA 2CL6X 4BFVA 4Q21A 1S9HA 3B60A 1IXRC 1ZD9A 1N6PA 2MMGA 3L8ZA 4P31A 2QE7A 2WJGA 1G8YA 3FMFA 1NSTA 3EIHA 1XTSA 3QIAA 3MD0A 3AKDA 2D62A 1II8A 1VG0B 3A4MA 3SHWA 4BGDA 3GLIB 1W4AA 1S1MA 3AF4A 4MYUA 2H7VA 2RGGA 3NH9A 4EPRA 3UMSA 4B6FA 3WNDA 1KAOA 1QRAA 5EE1A 5E4FA 1G1MA 3WYFA 3QKRB 2ODBA 2UZIR 1E99A 4M22A 4PPNA 3W6OA 3ZZUA 5TDHA 3T1OA 4A0FA 4BFUA 3TSWA 4OKSA 1MABA 4DCUA 2XX3A 2PBRA 4HLQB 4TYQA 2ZRDA 1E96A 5GVSA 4PZLA 3T15A 2GXAA 1XPUA 2GJSA 1FQKA 2JJ1A 2EFCB 4TZ6A 2CJWB 1Q3TA 4OBEA 2F43B 1OT3A 4F92B 2R6FA 2JGNA 2P0EA 1Q1BA 1DOAA 1GTVA 2PCJA 4ZV4A 1BH2A 2FPKA 2EYQA 3LV8A 4KVAA 2ZRFA 1VHLA 2G3YA 1E2JA 1QHSA 3FDIA 4TLAA 3K70D 2F9MA 4NKRA 4PXAA 1N5JA 4Q9IA 1XX6A 4GT1A 4L16A 1XJCA 2WM9B 3THXB 4MA4A 4RFVA 3RDPA 1B0UA 4IOMA 1LW7A 3IIKA 3LX8A 4IDHA 3RS2A 1NLFA 2C95A 1XTJA 2PMDA 4XH9B 5KSZA 3BH0A 4LJ7A 5J40A 4C2TA 1WDTA 3SE0A 2ZYUX 1KI7A 2ZREA 4A2PA 1OV4A 5DI3B 1VG1A 2O8EA 2WKQA 2CK3D 3W90A 1QHNA 4QNMA 1WF3A 4RZXA 4QHTA 4LPSA 2XTNA 5EXTA 3RS3A 4C7OA 1BMFD 1BYIA 3WYGA 4RVCA 3AUXA 5CK4A 5EXSA 4WA7A 2W2XA 2BKEA 4FMCF 3HYRA 4ZIRB 2CHQA 1UBFA 4KV9A 3V4FA 4FCVA 3SJCA 1E69A 1CXZA 4NPHA 1E1RD 1P6XA 5DO9A 1V43A 2VP9A 4EPWA 4B3BA 3RRZA 1HTWA 4TSFA 4XD7D 3IQWA 4TL6A 2O8CA 2D06A 4AYTA 2ASEA 4A0HA 4BFYA 3T06B 2I1VB 4NYMQ 1XMJA 3PITA 3MG9A 521PA 1X1SA 4D4LA 1YKSA 2B7CA 2JLRA 2WAYA 3HPRA 4V0ME 5DIFA 4HDOB 3QPUA 4HAYA 3K9HA 3W8RA 5JI3E 4EJSA 2F1HA 3AUYA 1YVDA 3IKJA 3KXKA 2PZGA 3RHFA 5FH9A 1W36C 1EFUA 3LQRA 5IK2D 1IAQA 4NDZA 1CTQA 4WZ6A 4IXMA 1XU4A 4LC1A 1L7VC 1EFRA 1RRFA 4B47A 1TF7A 4I4LA 1KO8A 1X1RA 2J0VA 2WIBA 2ZANA 1A1VA 2ZEJA 1KO4A 2HT1A 1E6CA 4JLKA 1SXJC 3CWZA 4OQLA 4GP7A 2G88A 1CR4A 4HDCA 1K5DA 4IHQA 2YOFA 4CEHB 2E1RA 3I5XA 2N46A 4MGYR 3SZRA 4UJ5A 2JIZD 3QOFA 3NBZC 2J7PA 3A4LA 1GWNA 4KJZA 3SEAA 1EX7A 1U0LA 3NTUA 2B21A 4GMDA 4NYJQ 4WAUA 2VP5A 4L15A 2XTZA 2R8RA 1SHZA 4YMTA 2C78A 3KKOA 3NXSA 3M4YA 4D4JA 4K81B 2WOOA 2WWGA 3BXZA 5EXPA 2FEOA 3SU8A 1VCNA 3UANA 3UK6A 3OE7D 1G8FA 4RD3A 3U3JA 4JLJA 1J2JA 4OJQA 4G5GA 1GKUB 2ZRLA 2C96A 3CRW1 1JQJC 4V03A 1R7RA 1CKEA 4U7DA 2QMEA 4AYXA 4TMVA 2WIAA 3KQLA 3H84A 1U94A 4P4TA 2YYZA 1YQTA 3GLIA 1R0XA 1P62B 4HUQB 1XTIA 5HTKA 2GZAA 1NN0A 2Z0MA 3QKRA 2A30A 4IJMA 4PFSA 4MKFA 4DEYA 4EUNA 3AKYA 4PZYA 5KDDA 2IYYA 5H1YA 1XMVA 2HCJB 1ONBA 4B32A 5J4HA 3UWOA 4BZQA 4BLPA 3BFXA 1E2DA 1E2MA 4TZ0A 1EG7A 1Q20A 3EZ6A 3NC1C 3K70C 1EX6A 4DT1B 2RGCA 3QJYA 5G3YA 2VRWA 2CJWA 2G1KA 2J9RA 2ZROA 2F43A 3NDBB 4UNPA 5KNCA 1K5GA 5CIQA 1G21E 3W9YA 4FINA 1W46A 5CB6A 4BFZA 1FUKA 3BWDD 4YONB 1EWQA 2FU5C 1E2LA 5KSYA 3BD9A 1S2MA 4AKEA 2HF9A 1IOZA 3THXA 3NBXX 3I72A 3I3SR 1G291 4BLRA 4XVUA 3MWYW 4MUBA 1JPNA 2IF2A 3BRWD 4OK5A 5FOSA 2BEJA 2Q6TA 1KI6A 1ZD8A 4MGKR 4QJ3A 5CB8A 3NEYA 3PUZA 5DI9A 1G19A 3GFTA 1E0AA 4MUAA 1OFIA 1Q3HA 3LLMA 4QRHA 4A1FA 1FW6A 5DI3A 1MKYA 3G5UA 2A5JA 4ARZB 3M0EA 2O52A 2JLUA 1KSJA 2Q0HA 1Q1ZA 4CW7A 1KK3A 2QAGB 5LDDC 3ZLJA 5FBRB 3Q3JB 1IN4A 2OAP1 5G41A 2WMNB 4G1UC 2H1LA 3Q5DA 3U7GA 3MLEA 2IXFA 2A7QA 3U44B 3Q5EA 1XD2A 3GLGA 4GFDA 2ZUBA 2DHRA 1JB1A 2Q3MA 4YDHB 1TF2A 2EVWX 1Z63A 1NN3A 1ZM2A 2X2FA 2ZSBA 5FTKA 4GI7A 5FOXA 2EFDB 3NC0C 3ZGXA 2KWIA 1UKVY 3CR7A 4GZMA 1I4TD 2VIIA 1YZNA 4JS0A 2QN6A 3R8FA 1GAJA 1F2TB 3RS5A 3LFUA 1IN8A 2VHUA 2YC4C 3TVDA 4JYCA 2QBYA 1BOFA 3AH8A 5E95A 1SVLA 2HYIC 3HYTA 2WWIA 2D2EA 4KODA 2R9VA 3QKTA 2JLYA 1OYYA 4PC2A 121PA 3ZVLA 1KGDA 4BASA 1VCOA 2GCOB 1WQ1R 2V6JA 1RZ3A 1D2MA 1E9RA 2GXQA 2OBMA 4LV8B 2GEUA 2HUPA 4M4SA 4DC9A 1QVAA 1S4QA 1DADA 4NP6A 1W0KD 2ANBA 3DOFA 3GJ3A 1KI1A 1G18A 3K9GA 4DLWA 4A9AA 3IDQA 1FFHA 4E07A 3U6KA 2C5LA 1IY1A 1KY2A 4FIDA 1UPTA 1L8QA 2GJAA 2IHBA 4CEHA 3X1YA 1HYQA 3PENA 3IILA 1E79A 2YNMA 4KHZA 1S96A 3D3QA 4GPTA 4IFBA 1ZNZA 2BVNA 1AA9A 4NYMR 5AJZA 4Z1MA 3VR6A 1COWA 2RGEA 1RE0A 2IYQA 4B71A 2BOVA 1LY1A 1JBKA 1DO2A 2H16A 3C7KA 2EU8A 4DEXA 4Q66C 2BJWA 4M53A 1I4DD 4YDSA 1IY0A 4NU0A 4PC6A 2GETA 3WP1B 4GOXA 1XEXB 1AZTA 2F1RA 4B75A 4FN5A 2GESA 2HJGA 4MYTA 4JYBA 1W48A 3QPWA 2AL7A 1ZUIA 2IC5A 3QI2A 4M1TA 4PQRA 4HZIA 4U5XA 5FPKA 5M04A 3DZDA 4FW9A 3K9LA 2PJRA 2ZRBA 1TUIA 2DFTA 5E7IA 3CB4A 4KFTA 3T5GA 4C0SA 2YV5A 1FNNA 2PH1A 2QPOA 3PUWA 2QRZA 2CCJA 2PLRA 3N2EA 4Q1EA 4ASUA 3FMPB 2RGBA 2QG6A 3TUIC 2X1VA 4NYJR 5FL7A 2ERYA 1KY3A 1LS6A 3L2OB 4M1YA 4RD0A 5K8LA 5KOYA 2DWOA 4QHYA 2RGDA 1IM2A 4MH0R 1E0SA 5D3QA 4DLSA 4AKHA 3EAQA 1U90A 5KSOA 2PCLA 4PO1A 2HLDD 4XTCS 4H1VA 4R9UC 2A3RA 2W6JD 1C1YA 2VP0A 4QOSA 2QSZA 4PSVA 5D3MB 2KBEA 1T8TA 3EZFA 1TQDA 4EQ6B 3VNUA 2FFQA 4I1UA 1HT1E 4C0BA 2XEXA 1IONA 4Q19A 4TMZA 1H8HD 4XVRA 1ZVQA 4W5WA 3BK7A 1N5IA 3CF0A 1F2UA 1P2TA 4Q9HA 3LH5A 1KKMA 1E4VA 2D2FA 5JWOA 1Q1QA 3MAAC 2IBMA 1AJEA 4I1OA 4NYIQ 1AQUA 1CRQA 2OXRA 1KDRA 2WKRA 3K9NA 4DUGA 2R6AA 3D6TB 4IVQA 5HPYB 3IBYA 4DLUA 3NVAA 1KJYA 3RWMB 1OFTA 1T91A 5A0FA 2AK2A 2ZJOA 3TGPA 2JLVA 1N0WA 2CL7X 3F8TA 1UEIA 2NZ8A 3I73A 1P72A 4YLGA 2ZJ5A 2GWHA 4AY2A 3VR5A 5FOUA 2HT6A 5FPTA 2REOA 2QTHA 1UBCA 1QDEA 4JJKA 1CP2A 3K0CA 4Q18A 5TY0A 3ZVRA 4DLZA 4ZCMA 2WWWA 4CGZA 1R5NA 3KB1A 1IXZA 4TTQA 3LW7A 1VHTA 5CM9C 1FNMA 3MWLA 3X1XA 3ZJYA 2QAGA 5FR2A 4AD8A 2XSZD 3VX4A 4XWKA 1VCIA 4F7WA 4CT4B 2RCNA 4MGIR 4LSGA 1HQYE 4AG5A 3PCRB 1TAGA 3C8UA 5TVKA 1UADA 1NLZA 3JVUA 2A5DA 5FBLB 4BLTA 4S2EA 3I61A 2FEMA 4LBZA 3TKLA 4KLZA 3SYNA 1ZYUA 3OIWA 3WRYC 4AKIA 1YZLA 4PHFA 3WYAA 1SULA 2C9OA 2VTKA 5JSZA 1JEEA 1NY5A 4TL7A 3V4RA 1NSFA 3AVOA 1E2QA 4JVSB 2WKPA 1HEIA 4BLSA 2OILA 2WTUA 3KQHA 3LNCA 4HAVA 2QM8A 4K8OA 4XSHA 4GL2A 3VX3A 4DWJA 3C14C 1F2TA 1XCPA 3RWOA 4UXHA 3E1SA 1DTSA 3VHXA 5K8UA 2IS6A 4NH0A 2XZPA 2R6DA 4QGFA 4PSAA 2QAGC 4HLDA 1G4UR 4Z51A 1U8YA 2YWGA 2QRNA 4DHEA 1T0JB 4ZDIA 4IRUB 2GCOA 4DKXA 4WXRA 3OHMA 3H4MA 1N6HA 4BLOA 1R0ZA 1K8RA 4HUTA 1CBUA 4LYJA 4EPVA 2J7KA 5JJIA 3SBDA 1R2QA 2QT0A 1EK0A 4Q1DA 2OFWA 1CR2A 1G3IA 1U2RA 3AP1A 3EXAA 2ZSEA 1LV7A 1C9KA 2Q9BA 3NEJA 4LYFA 4URUR 3PEUA 8OHMA 5H70A 1VYTA 3C5HA 1GP2A 4B76A 2JLXA 3RRYA 1F48A 2VF7A 3CH4B 2P65A 1OH8A 2ODNA 4UKDA 5EZ6B 2F3TA 3I1FA 2YHSA 1HE1C 4PO9A 2QUZA 3KKPA 5DN6D 1ELOA 1Z0DA 5FOVA 1XEXA 1I2MA 3IO3A 2H57A 4L5BA 2F7SA 2FN4A 1OJLA 2AWOA 2KSQA 3AF0A 4A8JB 3ZIAD 4BECA 4FMDF 2V8OA 4M9XA 5SZJA 2ZR9A 4DSUA 1MRNA 1AK2A 2VQSA 3P27A 1OH5A 2NPFA 4YXWD 3H0KA 5HKKD 4GDFA 1NN1A 2CNWA 1M74A 4LYAA 3QVUA 2IYXA 2ZI4A 3I8XA 4MRRA 3QEOA 4BFSA 4XOIA 1G20E 3GFOA 4V0LA 1OSNA 4JVLA 1RJ9A 5KUTA 1E98A 3K0EA 5AWFC 2FNAA 1YZKA 3TUZC 5EP3A 2JA1A 4M1MA 3OAAD 3CO5A 4JL6A 3QSYA 1NKTA 1BKDR 2GJ9A 5A4JA 1G64A 5GJBA 2PL3A 2YWFA 3FB4A 3OEED 5CK5A 3AVYA 1IXSB 2ORWA 2IYTA 3CRQA 1NMZA 1TEVA 2OFXA 4M1OA 5G40A 1MO5A 4D81A 2RHDA 4Q4JB 3W6NA 5JI2E 4JKYA 1NMYA 5LD2B 4TYPA 1UEJA 1AS3A 4LPKA 1NP6A 2N42A 2MSCB 4FI3C 3EW9A 4JL5A 3GCGA 1A2KC 4OI2A 4POAA 4TQAA 4C0LA 3A6PC 1II0A 1G7TA 5DNYB 2XB2A 1YZTA 1FP7A 2H5EA 4P4SB 3ZZ0A 3MSXA 2IS1A 4BWYA 1W4RA 1OB2A 1AKYA 3I32A 4IOLA 3N2IA 3LXRA 1S0UA 2O0KA 5LBIA 3GLFB 1G6HA 1NBMA 1SKQA 1SXJB 2AX4A 4NMMA 4IXNA 1YU9A 3B1VA 4B33A 1RRCA 2FSGA 3FFAA 3AVPA 1M34E 1T3LA 2AXNA 2JJ1D 3CLVA 3MGCA 1CF4A 1ZUHA 3N70A 2VHCA 1TU4A 4LK2A 2QP9X 5C1BA 1E9DA 4U00A 4Q7JB 4A2WA 3ZD6A 2NO9A 2D7CA 4TL9A 2GNOA 2WPDD 2EQBA 4R2HA 4B74A 2YZ2A 1N6KA 3VHLB 1AS0A 821PA 3ICEA 3IBGA 3MCAA 2BWJA 3F0TA 4UNSA 1JAIA 2V55B 1XJQA 1E9CA 2NMVA 5BN5A 1VG9B 1Z28A 1KAGA 2AFIE 3BBPA 4NYIR 1O3YA 3SS8A 2V3CC 2O0JA 3FKSA 5AJXA 2FPMA 3KTAA 5AK0A 5DLQC 2VA8A 5DGXA 1OKKA 3AEZA 3KKMA 2FMXA 5EE5B 3RS7A 4Q1BA 3B1YA 2H92A 2OESA 5KO2A 1E0KA 4GRAA 2Z4RA 4KAXA 5GJCA 3X1ZA 3A58B 2OCBA 2XOKA 3B5JA 3OF5A 5FTLA 1JECA 3B1XA 4A2QA 3CF2A 1YR9A 1WRBA 4HYYA 1IHUA 2W0MA 4PHHA 1Z3IX 2J0UA 3MJHA 2XZOA 4AWXA 4TWZA 3EARA 1D9ZA 2ZYWX 3T1VA 2YOGA 3AGPA 3PUYA 2ONKA 3BGWA 3K70B 3HR7A 1QBKC 4RFSB 2ODWA 1ZNYA 1KI4A 3GEHA 3FMOB 4BFWA 1HH4A 2AR7A 2O8DB 3GLHE 1XXHA 4M1SA 3KQKA 3LVRE 4NE2A 2CL0X 1AGPA 1HT2E 3TW4A 2NOAA 3VR4A 1XMSA 1GL7A 5E7MA 2ZI5A 5LB2A 4H1UA 3IUYA 3CM0A 2ZVPX 5FTJA 1U81A 3LBNA 4PO8A 2ZRIA 4OHZA 1NVWQ 3TLXA 1FUUA 2Z4SA 5B58C 1P75A 2GILA 5FUYA 2ERXA 1N6IA 3L0OA 3UATA 4AKGA 2QU8A 1YHNA 3VR3A 3UXMA 3VTKA 3NBYC 1R6BX 4EPXA 5DHFA 5EUMA 3EZ2A 3CR8A 1SVSA 2FDCA 4MDFA 2BJVA 2DYKA 2QL6A 5SZIA 4DLXA 3FWYA 1G8HA 2J7PD 4HB3A 4OHYA 4G01B 4CYMA 4OHXA 4H9GA 4LBWA 4MDEA 3I4LA 3BOSA 2C9CA 3BFKA 1CJKC 1NY6A 3CRRA 4M9ZA 4HAUA 3LDAA 5E7JA 1OW3B 3AVWA 1FX0A 1Z8FA 4E03A 2G1JA 4CIDA 4WZBE 1GL6A 1TX4B 3TIFA 4LV6A 1PVOA 2O8FA 1H65A 1OXVA 4O0MA 1PV4A 1CLUA 4A8JC 3QXCA 3EPKA 2ZPTX 4Q4JA 1G3UA 4Q48A 1ZW6A 4LHYA 2O8BB 2VHTA 1W4CA 1YZGA 4JZKA 1GM5A 3THWB 3K1JA 4F4JA 1CJMA 1ZAKA 5HZKA 1RVDA 1X86B 4QBGB 3SN6A 2P2LA 2GKSA 5GJVC 3U7HB 4I1SA 2IUSA 2XNDD 5JHHB 1Z83A 2AN9A 1FL9A 1SKYE 4L9SA 1OXTA 1SVOA 4QGAA 5F9FA 4TMXA 3U4QA 5K8IA 4HATA 3K0FA 4ZKEA 4R98A 3GLFA 1SXJA 2WVJA 4ESHA 2LKCA 4A92A 3U2QA 4LGMA 1XPOA 1YR8A 1CS4C 2ZI3A 1QZXA 4RKEA 5LD2C 2GAOA 4B3DA 4HLUC 5CDFA 2BMFA 2IYVA 3I62A 2W6IA 1E0JA 3GEEA 2ORVA 1GIAA 1T5IA 3LAWA 5HE9A 4JLVA 1FMJA 4G5RA 2KJQA 1SVWA 1W0JD 3GJ8A 2R6CA 2GXUA 2GCPA 1TEXA 3EIQA 1ZM4A 2A9KA 3VFDA 5EXXA 1RIFA 1ZC4A 2VP4A 2KE5A 2B7BA 1U8ZA 2CLCX 2OUKA 2X19A 1SZPA 2C8VA 2GEVA 4TT3D 4A6PA 1FTSA 2ZRHA 4DB4A 1T9HA 3B13B 4M8NE 4XIGS 5C18A 2FV8A 1E2HA 4PAOA 1CRPA 2DWQA 3EWAA 3LRPA 5C2JB 4KBGA 2PX0A 4TLCA 5EZ5A 4GMXA 4TN1A 4QJ4A 2C77A 1RRPA 3M1IA 2EFGA 4JBWA 3LW8A 3CIOA 3CPJB 5IHPA 5TMPA 2B6HA 3S1AA 4UNNA 3QG5A 3DMNA 3AVXA 1CJVC 3R9XA 4BEJA 2G6BA 3QKSB 1OIXA 1UF9A 4B2IA 4ZI2A 3QE0A 1GVNB 4C9BA 3OFND 2C9YA 1RRGA 2RGXA 3BE4A 4R2IA 3WNCA 1KSFX 3RNLA 4PPFA 2F9LA 5JZVA 4QM7A 5FI0B 4RKFA 2CMKA 1XCMA 4NHOA 2ZRPA 4TMWA 4LJAA 2VPPA 221PA 2ZRJA 2VYFA 1XCGB 4M2LA 3BFVA 2IUTA 3FKQA 2A2ZA 4JMPA 4LJ8A 3WBKA 2CCKA 2J0SA 2O8DA 2CHVA 1JALA 1US8B 2ZS8A 1JAHA 4O2LA 1G3MA 3FE2A 1NKSA 3MFYA 2QQ0A 4IOJA 3WHLA 4Q5IA 1XDBA 5CM8B 4A6XA 2BEKA 1YJ5A 4BZPA 4TMTA 3B1ZA 1J70A 1UDWA 3FPAA 4F4IA 2CK3A 2GJ8A 2OEPA 2QPAA 1Z2AA 4O3MA 1P2UA 5TARA 4AIIA 4DDVA 1BMFA 3Q85A 1E2EA 1UJ2A 1GDDA 5EP2A 4K46A 2BBWA 4LCBA 3GFPA 4HZUB 3NHAA 3UG7A 4KCGA 5FBWB 1JQLB 3TJZA 1E1RA 5BWMA 2V7QD 2IYRA 3P20A 4RZ2A 3UMRA 2QMUA 1DAMA 4RD6A 1TNDA 2ZXUA 3SOPA 3LY5A 1GITA 3MWKA 4Q7LA 4JSTA 4PHGA 2Z83A 1G8PA 1EESA 2BMJA 3LA6A 3DMDA 1N0UA 5AR1A 3WNBA 1HE8B 3D31A 4C3ZA 1JXOA 2AHOA 1YRAA 2YJTD 2ZR7A 3HU3A 1VKJA 4LBVA 5LPNA 3RC8A 1ZJ6A 2RHMA 3A4NA 5KDLA 3E2IA 4URXR 2ZVQX 5IK2A 3LWNA 4TL8A 2ZTSA 3G0HA 2FGKA 1DVRA 1ZBDA 2NTYC 2HXSA 5BYKA 2O8BA 4X8MA 2IHYA 2QGNA 2QA5A 3L82B 5F98A 3TE6A 1NF3A 3I8SA 2KBFA 3DM5A 2WWHA 5AJVB 2HYDA 4ZIRA 1W5SA 2J41A 4DCSA 4QXAA 1VG8A 2XZLA 2X2EA 2FFBA 2QZ4A 2XAUA 2J46A 1N6RA 4G3XA 1ZIOA 5FUWA 3QEJA 1E1QD 2BBTA 2WHXA 2ZRAA 1LVGA 2JIZA 3O8RA 4RSGA 3TNFA 1V5WA 1ZU5A 1OIWA 5L3QB 1IY2A 4L9WA 4A0GA 4FD2A 4IVRA 3NHBA 1EGAA 4C2UA 2CVHA 3EG5A 2F1JA 3R7WB 4AURA 1KZGB 1DAEA 4KI0A 4M21A 2RAPA 1CJUC 2VHQA 2WJVA 4KU4A 4OQFA 5DSZA 3QNUA 4IFEA 3OE7A 4Q1AA 4NCHA 2QSYA 4Q00A 4C0QC 4Z8YA 4BRUA 4DCTA 1KO1A 3ETLA 5KHOC 3LQQA 4C0AC 4URZR 1R8SA 2NGRA 3DL0A 4LHWA 5AUNB 5GADl 4FWTA 2G77B 2ZI9A 2QP4A 4OQXA 1ZCAA 2QT1A 3OIYA 3WMGA 3KDSE 1QF9A 3DZ8A 4YC7A 4MQBA 3SNHA 5JJKA 3RABA 4P0TA 1CR1A 1G5TA 4NBSA 2IYUA 3EC2A 4UXJA 5JWRA 1PLJA 1VMAA 1JR3A 5J5CA 2QROA 1KNXA 5EJEA 4TYYA 4AI6A 4Z8XA 3CBQA 2WJHA 1OHHD 4NCKA 3M6AA 2LCFA 1Z6TA 3BS4A 4YMUA 2GBLC 1G6OA 3Q7PA 4LJ6A 3EZ9A 5CLQA 2C04A 4PR0A 4CEJB 3ZYCA 5FUXA 1IN7A 1TU3A 4W7SA 1Q57A 4GSYA 1KKLA 1KO7A 1ZM3A 3P32A 2RGAA 2A5FA 4D0LB 3OESA 2VO1A 4AG6A 2CVFA 3QVVA 4Q01A 2JLZA 3GLHB 3PUVA 1XP8A 3K0AB 4OHVA 4LJ5A 1L4UA 2ATVA 1XD8A 2ECKA 5CJPA 2MSEB 2TMKA 2P3SA 4AYWA 1TMKA 3TH5A 2MSDB 3B9PA 1KDTA 3T61A 2YINC 3AF1A 4D80A 2ZQ5A 1E9SA 3W5JA 2ZRKA 4B44A 3IHWA 1Y63A 2ZRNA 3O47A 1JXMA 1QHHB 3G82C 3PQCA 2ONJA 4Q4HB 5H68A 1X8LA 3QPVA 1FZQA 4HUQA 4QBHA 4KSCA 3DM9B 5KPDA 3GLIE 3GJ6A 2XITA 2IW3A 1YZQA 1ESMA 1VYVA 2Z43A 3VR2A 3GJXC 4P4UA 3GJ4A 4CEIB 1TF5A 3WMFA 3CZQA 3TSZA 1DG1G 2JAQA 3HU1A 1P3JA 5FTMA 4RD1A 5KYKA 1PJRA 4DLVA 1OFUX 2JJ8A 2EFHB 4HB0A 3CX7A 4BFTA 2ZITA 2Q9AA 1KK2A 1BS1A 2XTMA 3PVSA 2CXXA 4DT1A 3UKDA 3C5CA 3D8BA 1ZMXA 4NONA 2XXAB 3KFVA 3LX5A 3R8CA 4B2LA 3KZ1E 1WBBA 1WCV1 4XTRA 1JNYA 2OE2A 5JJLA 1FP6A 2MMCA 4TQUS 1BIFA 2R6GA 5L3SB 2OV2A 3OZXA 1ZC3A 1LS1A 1R10A 2JDID 2ZYVX 3RAPR 1KI2A 2GK7A 2X8AA 4IDPA 4LHZA 2GCNA 1DELA 4JL8A 2LKDA 2W0SA 4B2PA 3KXLA 2FF7A 2BIFA 3HJNA 4MRNA 1EFTA 4ACBA 4O25A 5CLLA 3TAUA 1SKYB 1OYWA 3SJZA 1O87A 5F2EA 3C4JA 3VU9B 4O2RA 4PSKA 4JVNA 4LHVA 3ZS9A 3LO5A 4LJ9A 3V9PA 1P9WA 1QHYA 2YWEA 4ARZA 4ERNA 2PX3A 1CR0A 1KI3A 1WE2A 4B3GA 5FOWA 2GDJA 2I1QA 3GJ5A 2WJYA 4QL3A 3LBHA 4EKDA 5JLJA 2V1XA 2CHGA 5AJWA 5JWHA 4I99A 4HB4A 1Z29A 4HB2A 1SVMA 4KBFA 4S35A 2FH5B 3SI7A 4LJ4A 4XJXA 3U44A 3QXXA 2BM1A 1R4AA 3KB2A 5JHGB 2G0NA 1G8GA 1IJFA 1UM8A 1X6VA 4FMBB 5JRZA 3FHOA 1GKIA 2C98A 3GLGE 3QKUA 4DXAA 4GOKA 2W00A 4RCYA 1JR6A 3FFBA 4OQMA 4IOKA 3I5YA 2R2AA 3VNVA 4GBMA 3R7WA 1DO0A 5AUPB 2DWPA 2JJ2D 5DISB 2C03A 2GAAA 4G5SA 2GZDA 3K09C 1XRJA 2FGJA 5FTNA 2WJJA 2OCPA 1OH6A 3CPHA 3NDPA 4UNRA 2F3RA 2Q21A 1Z0IA 4Q9JA 1PUJA 4P33A 1W44A 4KYUA 2D7DA 1Z2CA 2F55A 5J4KA 1CJTC 4E5UA 2OSBA 1VIYA 1DE0A 1VTKA 3FMIA 4Q9LA 4CZ2A 3L0SA 2PEYA 4UQOA 1DBSA 1NMXA 4HEJA 4Y0AA 1YRBA 2BCGY 3SJBA 1VDZA 2OO7A 1JR3E 1J90A 1GNQA 4LDJA 1A5TA 4KSBA 3Q8XB 5E3HA 4YMVA 2WSSD 1Z0JA 1F6BA 2NG1A 4IEIA 2P5TB 1PZNA 4B6EA 3DVLA 4JLBA 3GD7A 4CEJA 2FJUA 4F38A 2HLDA 3T5DA 2CDNA 1U9IC 1ZIPA 4P3YA 3SHFA 1J8YF 3CUEF 2W6JA 3AVQA 1Z6GA 2QI9C 1P2SA 3KX2A 4MKIA 3W5IA 1ZP6A 4QNRA 5LB4A 2NPIA 3U3MA 4BUJA 5EQTA 2ZE7A 2BMDA 1UAAA 4KITB 5JCZA 1II8B 2DFKB 2CE2X 4LBYA 3TK1A 1AN0A 1H8HA 4KO8A 3WRXC 2IEYA 1S3SA 1ZNWA 2H17A 4Q02A 4WVFA 3UG6A 2F6RA 2QENA 3W3AA 2AD5A 3BIFA 4DSOA 5JEDA 2NO0A 3CX6A 4LWZA 4MYCA 1M7GA 3P1JA 3FTQA 4EPYA 2IS4A 1UFQA 1MABB 2RKOA 4HAWA 1P60A 2H18A 1FQJA 1XEWY 4FXPA 4M0LA 4EFNA 3VKHA 4M9SA 1M1YE 1PLLA 4JJZA 3CF6R 1QHHA 3LD9A 4Q4HA 1GILA 2Y8EA 5KNDA 3THYB 3HU2A 1XWIA 3KUCA 4MGZR 4NCNA 5F9HA 2ORIA 1GFIA 2J5XA 2VLIA 4WZAE 1QHGA 1QVRA 5DH9A 4EFMA 2B8WA 4CEIA 1Q0UA 2GRJA 5J4VA 1G5PA 2QE7D 3L0PA 2IYWA 4AC9A 3CNNA 3LLUA 4V0OA 2ZAMA 2XSZA 4B48A 5D3MA 4EQ6A 1Z0AA 2G0TA 2DFNA 3LBIA 3VKGA 2QY9A 2IT1A 3MMPA 1HY3A 5JMTA 2ZJ8A 5IRCD 1OF1A 2H8KA 2W83A 3PJRA 1QG2A 4KYIB 3T35A 5L3SA 4MITA 3CWQA 3VKWA 2DR3A 1H8EA 2JATA 2J45A 4DIEA 4BZXA 2ZI7A 3AM1A 2P6RA 1AKEA 1E2IA 4CVNA 3P26A 2ZM5A 3NKVA 3H86A 3IPXA 3HR8A 4HAZA 3VU9A 3NH6A 1GRRA 2QM7A 1KI9A 2ANCA 3QBTA 3KQNA 5J47A 1HUQA 2W2VA 3NG1A 3SYKA 3VR1A 1XTKA 2J1LA 4URVR 2OXCA 2RH5A 3ECCA 3EA5A 1J99A 4B3XA 4LYHA 1Z6AA 1L4YA 1DAHA 4V0MA 5FOTA 3WBJA 2FFHA 1ZD1A 1ZM7A 2R65A 3X1WA 3CRVA 2EW1A 3QXSA 4URWR 4OHWA 4QJ5A 5J4YA 3QBVA 1Y3AA 5G53C 4FMCB 1TQ4A 3GJ7A 1G5RA 2CCGA 1G7RA 1N0VC 1OFHA 1PUIA 3EA0A 3KJEA 4JLNA 4PZZA 4Q7MB 2AKYA 3THOA 2DFLA 4B3FX 1T5LA 5DN6A 4EDHA 4Q7KA 3IIJA 2FSIA 3QF4B 4QM6A 3TQCA 1Q44A 2QP3A 1W36D 1MO6A 3ZIAA 1NVXQ 4ZCLA 4FCTA 2Q3HA 3GPLA 3T1QA 2GEDA 3UPUA 5HKKA 2WJIA 2VSOA 1E2GA 2ZYTX 1F3OA 1U0HC 1XF9A 3J81k 4TSFD 1NVVQ 3GQBA 5DYIA 5JFGA 1NG1A 4NZYA 2DCUA 2B8TA 1Z22A 2ZUCA 1R8QA 2DBYA 4JSYA 1T8UA 4ON9A 2AFHE 1ZCBA 1TQ6A 3OAAA 2NIPA 3KKQA 4JLAA 2FG5A 2GK6A 1Z6XA 1VIAA 2GA8A 3OEEA 1ZINA 1DAGA 2F1IA 3ZVNA 4Q03A 2OLKA 421PA 4DLRA 3PFIA 4QKQA 5BN4A 3NWJA 5C46F 3TR0A 1EFRD 1S8FA 5CIWA 5F3WB 1OXSC 2BMEA 2HV8A 4FCWA 1E2FA 2WV9A 3ASYA 4N0DA 4ZCIA 5GJWC 2GF9A 4LOAA 3U3RA 4A8JA 2XB4A 3SFZA 3U6BA 5TB5A 4BRWA 4LUCA 1T0HB 2EWWA 3TSOA 1NI3A 3RRMA 2HXYA 4QG7A 5SZHB 1U8AA 2ZETA 2FZ4A 3JZMA 2VF8A 3GP8A 3KQUA 3CZPA 3PG5A 2D4HA 2CBZA 4DLYA 1JI0A 5K8TA 3H2YA 3REFA 1CIPA 2RGNC 1IN5A 1WMSA 5G3ZA 1QHIA 4ACAA 2QTVB 4B34A 4ZI3A 5KPJA 4LZZA 3A1TA 1GUAA 3A1UA 2JLSA 4MRVA 5FPYA 3THYA 3DEFA 2IXEA 2HCBA 4WW0A 3HPQA 1KO5A 2P6NA 2WZQA 4M1KA 1Z08A 1A82A 3DPUA 4ZKDA 2WPDA 2P6UA 3V00A 4BLQA 1HV8A 3L8YA 4W5HA 3CONA 4HLUA 1P4SA 3Q72A 4N1AA 4X8LA 5BW8A 2QNRA 3IO5A 2ZRMA 2OCAA 1T3SA 4MYHA 3R9IA 1IJEA 1Z0FA 2CLSA 1N25A 1Q22A 2DPXA 4E09A 4GZLA 1Z47A 3AKEA 4F91B 1KI6B 4QBIA 4RZUA 3GJ0A 5FL3A 1CULC 4P4SA 1VCMA 3EPLA 2UZ3A 4PAQA 2FPLA 3SQXA 4JBXA 1CU1A 3UMFA 3A1VA 3D7MA 1T3HA 2WAXA 1N3BA 1T4GA 3DKPA 4PPGA 1KDPA 4KFUA 4NL4H 3QQ5A 2FFAA 1BO6A 1NBME 2VBCA 1N2CE 2IK8A 3ZQ6A 3NIBA 4L8GA 1RYHA 3BB4A 4QGGA 2JLQA 2FZLA 3ZVMA 4E22A 2V9PA 3OEHA 1XD2B 4A82A 2N1BA 4IKEA 4V0NA 2YC2C 3GLGB 1K6MA 2BCJQ 1X8JA 4IDOA 1FTNA 4UJ3A 4B3CA 1E2NA 3CNOA 1M2OB 3U3KA 1YR7A 1E94E 2ATXA 1KJWA 2ZJYA 3CRMA 5ANRB 5B57C 2YWHA 5L8VA 2G9NA 1I4LD 1N6OA 2IYLD 4DDWA 2IX3A 1GOTA 4GNKA 2XGJA 1IN6A 2GVDC 4F4CA 1GNRA 3SR0A 2V54A 2ZI6A 4PC7A 3AF2A 4W9MC 2QBYB 3QXHA 3FHCB 4D2IA 5BN3A 3W3ZB 5SZKB 3ICQB 5FBQB 1ZUNB 4FWIB 4JLOA 4D26A 1KK0A 2GF0A 4JLPA 3Q9LA 5FUVA 1W7AA 1TTTA 1SVIA 4US2R 2WWYA 3AQ4A 2FWRA 1SGWA 3QF4A 2GXSA 5TV2A 4RJLA 1Z07A 3PEWA 4A36A 3WXMA 3ZDQA 4D4MA 3C41J 3P4XA 3AP3A 4GOJA 4Y0VA 3WP0A 1HQCA 3Q7QA 3B1WA 4DIDA 4BPBA 1LB1B 2SHKA 3ADBA 1ZM9A 2QMOA 3RVBA 2ZJAA 1A2BA 3ADKA 3VAAA 3W8NA 3U3OA 4EJSC 5J4LA 621PA 3RC3A 2OBNA 2IL1A 5KU1A 4I81A 1UDXA 2P5SA 2V6IA 2YVUA 4TLEA 3KL4A 3CH5A 1MRSA 2O5VA 4RFSA 1WP9A 5FPHA 2PZFA 3MUFA 4A15A 3I92A 1XXHE 3EASA 1A4RA 1D8TA 2DY1A 3KXIA 1GL9B 3TVTA 3K0SA 1MOZA 2JCSA 1DAKA 1KI8A 2VH5R 3U7EB 2OFOA 1P73A 1E3MA 2PT7A 5JS7A 1JEDA 2OM2A 3EPJA 5CJ2A 2ZRCA 4WXPA 5HE8A 1JR3D 2XNDA 1LFDB 5A5GA 2PT5A 4TLBA 1NVVR 5FBVB 4EIWA 2A5YB 2JASA 1AZSC 1E79D 1NIJA 2PMKA 4KLNA 1KDOA 4Z1MD 2OZEA 3DDCA 1COWD 3KKNA 3LXXA 3ZZTA 4LX0A 2NO7A 5EE3A 1SQ5A 1XBTA 3C15C 4Q47A 1UKEA 4XD7A 3U5ZB 4Q1FA 1P2VA 4ZPXA 1F60A 3FGNA 3T12A 4ZO4A 2OCYC 2KB0A 1IQPA 2PZEA 2LWIA 2ZSAA 2NZJA 1E9EA 2G83A 3N5CA 2Z6VA 1Z0KA 2OHFA 3ZQJA 1L2TA 3HWSA 1E2PA 1N6LA 3O8CA 1F2UB 5IF9A 4YQFA 2BM0A 2EYUA 1OPXA 1RW4A 3E5HA 3PIRA 2OLJA 3EWSA 5JCPA 1W0JA 1R5BA 4D4KA 3DOEA 1KMHB 4DDUA 3ND9A 3BC1A 2AD1A 4UNQA 4A0RA 3THWA 4C30A 1GKYA 3CX8A 4RZ3A 4LC0A 1NIPA 2KI5A 4EFLA 1MT0A 1KSGA 2PEZA 4TT3A 3AVVA 3AGQA 2IWRA 4ASUD 3WY9A 2V1UA 5BQ5A 4D6PA 3BJIC 721PA 1C4OA 2IUUA 4URYR 3RS0A 1W2HA 1YE8A 3AVUA 2C99A 4KVGA 4LV5B 3P4YA 5FL7D 1GRQA 4D0NA 2WMOB 4DSNA 1E9FA 4HLCA 1RPZA 2GJKA 1GZSA 2QMHA 3SDZA 4DJTA 1EXMA 2IXGA 2BBSA 5FI1B 3GLFE 1SXJE 4G5QA 4HAXA 4QHSA 4NTZA 2ZJBA 4OJKA 2FSHA 5JECA 3VMFA 4DDTA 5B2ZA 3PEVA 1KZ7B 4X8OA 2B92A 3SQWA 2GBLA 1PLKA 1T6NA 4QBFA 2W2TA 5CDFE 1XEWX 2ZR0A 3OFNA 2OG2A 1G7CA 3EIEA 2D3WA 3O8DA 1RKBA 4Q9KA 5JSZB 1DPFA 2ZE6A 2VP6A 5IT5A 4RD4A 2VSFA 1OXUA 2RB4A 4US0R 1OLOA 4DUGD 1P9NA 3HDTA 3IPYA 1KJZA 1OE0A 4OQNA 1U99A 4V02A 4Q4LA 4GP6A 1XFAA 3ASZA 3TQFA 2ZE8A 2UKDA 2R62A 4HDQB 3IEVA 2WICA 3C16C 3FHTA 5EUQB 3UIEA 2J0QA 3X2SA 4BEBA 1P9RA 1TUEA 1G41A 3AV0B 3TRFA 2BKUA 2Z5FA 1JJVA 2VSXA 3DO6A 1KSHA 4I1VA 3RLFA 3ZH9B 2QPTA 3QKSA 2ZS9A 2J59A 1XPRA 2IYSA 1SVKA 1S3GA 1WA5A 3AB3A 3PV0A 3UWKA 2FSFA 2X77A 5AUQA 1A7JA 1KMQA 4G5OA 1W49A 4R7ZA 2AKAB 3DKVA 2V7QA 5FPSA 1HURA 2AK3A 1KK1A 4DZZA 3BH6A 5HCIA 1XNJA 4DB2A 3GMTA 1W1WA 4XVQA 2FE4A 5DHAA 1G17A 2HF8A 2C2HA 3LVQE 3A1SA 1US8A 5HR5A 5JRJA 3B6EA 5JBQA 3SC3A 1AGRA 1NJGA 1MR3F 2BBOA 1N6NA 1XJ0A 1CEEA 2GHIA 3CW2A 2V4ZA 2QORA 1UBEA 2ODEA 3HP1A 5P21A 2YKGA 1KHTA 2PLFA 1FPMA 1IBRA 3R20A 3QUSA 1RJ9B 3T34A 1LF0A 4JLDA 1OH7A 2BV3A 6Q21A 3B85A 1NRJB 3L43A 2ZJZA 1D9XA 4JBYA 1E32A 4HZUA 3PXGA 3W34A 1D2EA 2QGZA 1E1QA 1ANKA 4RY2A 4C0KA 4OI0A 1EFHA 1X8KA 4FMDB 2ZUDA 3A1WA 4IEEA 4TYNA 1AIPA 1G9XA 4MKHA 4MRPA 1M7HA 3AF3A 4DCVA 3MJRA 1ODFA 3GEIA 4BFXA 1MH1A 2W58A 4OK3A 4EAQA 2O0HA 4ZDWA 1UKZA 2WSMA 4J0QA 3BB1A 3KJHA 1TADA 1LF5A 4PHTA 4XWAA 4Z54A 3F5FA 4Q1CA 2L0XA 1D2NA 5ELXA 2XJ9A 3IHLA 4XWOA 3DHWC 4OI1A 3QENA 1RYFA 4PPQA 3IGFA 1W5TA 2CNWD 4DSTA 2JEOA 4V0KA 5GVRA 4MRSA 1NL3A 1KMHA 1Z06A 2OT3B 4PQYA 3K53A 3WMEA 3K09A 1W0KA 3CPEA 1S1CA 4KXFB 2BHRA 4PAMA 5BYJA 4BE7B 4D25A 1FOEB 1MO4A 4US1R 3SFVA 3AKCA 1W4BA 1LTQA 3VQTA 1EWRA 1OHHA 3RRNA 1D6JA 5L3QA 2BC9A 4JKIA 4X8HA 1R5OA 2HDNB 1J7KA 1S9DA 2XJ4A 3O8BA 4AK9A 3IIMA 2IF0A 1JJ7A 2J3EA 3B9QA 4HSEA 5EP1A 1XTQA 1X3SA 4WOPA 1UKYA 2PJZA 4CT5A 4ZDJA 5JEEA 4TQ9A 3KUDA 1RC8A 4U02A 1SHKA 2GZHA 1DARA 2VP2A 3RANA 1UBGA 1FMLA 3E70C 3QF7A 3U61B 1KYIA 2YOHA 1XZQA 1NVUQ 1U9IA 1OB5A 3QG1A 4R71A 4ABYA 3U7FB 3KTAB 2WWFA 4F93B 2K5UA 4LRWA 1AQYA 2VEDA 2FA9A 1ZRHA 4M9QA 2NO1A 1H8ED 4Q4AB 5FR1A 4B43A 2GTPA 2D74A 4PC3A 1NBMD 4CDGA 3ZD7A 5CITA 2NO6A 2WBLC 4OK6A 2I3BA 4P32A 2E9SA 3KJGA 4W5JA 3SYLA 3ADCA 4YMSA 4QFMA 5FFMA 4DCNA 5EE9A 2IYZA 4C0HA 3K0CC 1U0JA 1DS6A 2FOLA 4ZDKA 3JZAA 2XNSA 3FVQA 3FOZA 4QGHA 4B35A 5KSPA 1GSIA 2Q3FA 4IDQA 1M7BA 5KTYA 1DG3A 2UVQA 2IWHA 1XMIA 2J0UB 1KOFA 1JPJA 5KNBA 1E9BA 1G4AE 4PC1A 1XD9A 1N5LA 1N5KA 2ZU6A 3B2EA
chains in the Genus database with same CATH superfamily
3AHGA 1NASA 3DFKA 2HRDA 1FMFA 3MEQA 4MA0A 2OK8A 1WPXA 5KYXA 3IQFA 4LOKA 3HTXA 2PGNA 3REGA 1UBSB 1L4MA 4A8HA 5KOYA 1KQ3A 1T2CA 1XTRA 4UDXX 2Z1DA 1J8MF 3MRSA 3IAS1 4BNUA 4MQ6A 2ENWA 2NACA 4DJJA 4TXMA 2PBLA 3DUFB 4LG1A 1WB9A 1QHXA 2WAOA 1E2KA 3CRZA 3O8OA 4LY6A 3RAJA 2Z2ZA 3TMKA 1OFVA 1L5ZA 3NTQA 3TE7A 1TO6A 4DMRA 1JG2A 5P8WA 1JFFB 1IUOA 2TMDA 4BB6A 6ADHA 1MO2A 2IU3A 5MN4A 1DAIA 2DX7A 1W1IA 2DOKA 4F5DA 4WESA 1BXRB 5LP6B 1QVZA 1Z2NX 1CY1A 5CGZA 3LDUA 4E7PA 2JKVA 4LKOA 3FBWA 1CX9B 3AJRA 1WEHA 2ZTMA 4M1WA 3WYCA 4ADSG 2P5YA 1W2GA 1GPDG 1OIVA 2RMKA 3LHDA 3AVTA 3QU2A 4OU4A 4ZVUA 1N8SA 1VKOA 1WCIB 3BSWA 2BR4A 1HE3A 3PI6A 4PCLA 4WN9B 1U8XX 1IK6A 3PDIA 3FI9A 3H8WA 4FD3A 1DKQA 1YUNA 2EZTA 3M8KA 3MJTA 1MC4A 3RJ5A 1ID8A 4P53A 3PDUA 2EP7A 5FJIA 3QW2A 2YXDA 2ZIWB 5AJHA 1JWAB 1UPUA 1LRJA 2HSGA 2L82A 2QXUA 2RI6A 3B82A 2C57A 3DHVA 1ODTC 2EJUA 2I62A 3DYVA 3I37X 4RDIA 1T15A 2OZLB 2DBQA 2ZYGA 3WA7A 4L5AA 4AN0A 3O2SB 1IZ0A 1LNZA 2C9DA 5A4IS 4YI3A 3PL5A 2G9VA 3MWGA 5UKDA 4A4DA 2BGLA 2I22A 5JH7F 2WWXA 3EAFA 1QO0A 1PT5A 2VZ0A 4LCJA 4NDNE 5ECGC 2WM8A 3QY0A 3U4CA 2O8EB 3F1LA 4ZRMA 1I3OA 3IPCA 1IZZA 2Q5IA 5JSYA 5KDOA 4C7OB 3M3PA 1G6Q1 3JQ8A 3EX7C 1ZNXA 1W36B 4YRLA 1VQ1A 3MCZA 3E2MA 4YR9A 1QE0A 5BV2P 4UFPA 3A8TA 4H35A 1V5FA 2ETVA 4JT2A 4TYWA 2IPOA 2PX8A 1A1SA 1AUQA 3HE3A 2VATA 4J7CA 1R8JA 4LSWA 4M99A 3RRXA 5EWJA 3DOHA 1OI7A 2V65A 4R6XA 4K2HA 5KOJB 4GAEA 4WE3A 5CEJA 4G0NA 1D7AA 2Q3EA 3BH7A 4RKRA 3IR6A 3OIUA 1AKWA 1P7CA 3IKLA 4MR8A 4RCZA 1WUKS 2HSWA 4HH3C 5F33A 3TAHA 5A2GA 4B4VA 3OLQA 4Z9BA 1I2DA 2I2DA 5LYYA 3SY8A 1UOOA 5IJ0B 3BJEA 3ONFA 1KJ8A 2EFEB 2QL7A 2ZAIA 2H1SA 2CLDX 5DB4A 4EVSA 5MFPA 1OQAA 1P3Y1 1P61B 3PSAA 4AJ9A 4EJSB 5ALPA 3NVMB 1NJ1A 4L5IA 4ATNA 2AOXA 1N1DA 4WBSA 4DVGA 2O3SA 5B7PA 2R8EA 1XVAA 3DV0B 1TC1A 3OICA 4MZXA 4UC0A 1U1FA 1EWKA 3BTSA 3EN0A 2XMQA 3K8YA 3NBFA 2BEUB 5EXEA 4TTRA 3E3AA 5IVPA 2COKA 2CEAA 4NMXB 4L5CA 5LZ4A 1E7MA 1G7SA 3E9ZA 3LVFO 4HXYA 4KIGA 4OL0A 1K2VN 2EJWA 2VWPA 4HD8A 4JLMA 4IV5A 2BPOA 1V48A 4II7A 4OIMA 5CBPA 5KTOA 5IYZB 4GGPA 2JVKA 3PWSA 2QKYA 1XZPA 3B8HA 4YXWA 2J87A 3A36A 5F5NA 2IDZA 5IDVA 4KFSA 5A4AA 3W6UA 2BFEA 4JBNA 2HEIA 4MUNA 1RWVA 3HJBA 3MWJA 4BLVA 3C3YA 4TKMA 1DC6A 1QK4A 2DRIA 3E0XA 4WXEA 3WDSA 3VDNB 1KNQA 1M0TA 4MB0A 5REQA 4Z9XA 1TPZA 4K26A 5TXGA 4A26A 3R9XB 2OAQ1 4EHBA 3LTNC 4RF3A 4CIYA 2VHEA 4MKGA 2DTXA 2E87A 4LHXA 1D5CA 2Z30A 3BM5A 1TEZA 3KJIA 4DCGA 1HNNA 1O4VA 4ND6A 3B7GA 3HBFA 1NDHA 4W1SA 3DZKA 3OEHD 1PJCA 3TW8B 1E4YA 4PLZA 4D9FA 1T4CA 1KIMA 1Q21A 4OFZA 4UPDA 4E2FA 1R4ZA 2ACVA 1IEWA 4JP3A 4IQGA 4LMAA 2O1XA 2MMGA 1B1AA 1P17A 3E61A 5KTSA 1WDWB 4C88A 2I8AA 1HDOA 4L9RA 1G8YA 5I3CA 3TR6A 2LV8A 3KEOA 3EIHA 3ZWKA 1XTSA 3QIAA 1VBFA 2VK1A 1XVTA 3NRCA 4ZQHA 3LA8A 4BNKA 3SC2B 3C3CA 4JR2A 1BMQA 4BGDA 1W6UA 1W85A 2HBZA 3AF4A 3BTVA 2RGGA 4JJ4A 1Y1KE 2X86A 3T9AA 2RC6A 1KAOA 1JDBB 2A1IA 4CM9D 5E4FA 3BWVA 2ODBA 5JDIA 1O4WA 3C3XA 4DPKA 1M73E 2JW5A 4XGRA 1JQEA 3DYBA 2NU6B 3HYLA 4P86A 2P2NA 1MABA 1EVIA 2L19A 1K0FA 1DX9A 1DQPA 2GDZA 2XX3A 1VMIA 3N3AC 2ZRDA 1EZ1A 3PKJA 4RU1A 4DIOA 3L6OO 2WSBA 1OFUA 4OYYA 4P4GA 1Y8RA 3SQWA 1AO0A 4JK3A 2DQYA 1UK7A 2GF2A 2BFCB 1K63A 2JJ1A 3DKRA 2GZ3A 4LJSA 1AC5A 3S2EA 4EW6A 2F43B 1OT3A 2ZJ7A 1PTKA 3K6KA 1C7QA 5CCXA 1WXGA 1QX3A 3V48A 4QRIA 4OKIA 4TSKA 3T5PA 1ZHOA 4KVAA 2Q0SA 2Q1WA 1YD7A 4DIKA 3FDIA 2Q45A 2VXOA 1B76A 4TLAA 4XZ3A 4MX8A 5T41A 3K70D 4Q9IA 4XWGA 2VJNA 5K9ZA 3EGEA 3P96A 1QYCA 2C2MA 3LI2A 1K97A 5DTRA 3ZV5A 1I2ZA 4MPDA 1B0UA 3GEDA 4ROSA 1XRLA 4BNWA 3DVSX 4IDHA 1OZFA 4XH9B 1RPJA 2GOYA 2PMDA 4GWLA 2Y77A 4QQKA 2I1LA 1DWUA 1JTVA 3BH0A 5LZ5A 1WDTA 4QVKA 1KMNA 5C80A 3FNFA 3H2ZA 2ZYUX 4CKZA 3K72B 1ZUWA 4A2PA 1OV4A 1KVRA 4RY0A 5DI3B 3IYLW 1VG1A 2G71A 2WKQA 2R1UA 3W90A 1QHNA 3ERCA 1WF3A 1KPIA 3CGGA 3ZHOA 2XTNA 2OWDA 2OO5A 5CTJA 3K5HA 2QN7A 2VDQB 2FWPA 4R2KA 3WYGA 4RVCA 5EXSA 1MX5A 4WA7A 1K4KA 2W2XA 1W19A 5DGIA 3HYRA 3RTEA 5K4GA 3RTAA 1F20A 1Q17A 4Q3LA 3TTXA 3ZXSA 2O6HA 4TV9B 2X13A 2AN5A 4BJ5A 4G0WA 4KR0A 1HDXA 2WU1A 3G5TA 4FC6A 4HX9A 3KZCA 2IHUA 3NT2A 4JH0A 1GLGA 1P6XA 3IEIA 2VP9A 1YONA 4CQMD 5HKAA 1NDUA 1L4GA 4TSFA 4XD7D 4ETWA 4BFLA 1U9JA 5A6VA 5BOSA 2Q6LA 4TOIA 3S28A 2I1VB 3QU4A 2WFLB 2ZIVB 2GFIA 1G5QA 2I6FA 2YW2A 3HJTA 4M98A 3UB3A 4JQCA 2JLRA 1L7AA 3OJXA 2QRLA 4HDOB 3QPUA 4G1CA 4EGAA 3K9HA 2YJZA 1W5EA 1J2YA 5JI3E 2JFFA 2X23A 1LC3A 1YVDA 3E9YA 1JA0A 2O05A 2XIQA 3KXKA 3RHFA 1IEQA 1OZGA 2P9BA 3LQRA 1CUDA 4L4ZA 4OHPA 2C54A 4H77A 4IXMA 3TLJA 1K75A 2R751 1C7ZA 1PJ8A 1QTRA 1RRFA 4KQ6A 1DRVA 4I4LA 1KO8A 4R05A 3W0LB 4B7XA 4CL2A 4N3GA 2W71A 1LU9A 2VS1A 3L7AA 2D1TA 4GMHA 1E6CA 3OZVA 3KWLA 4PIMA 4RH0A 1NVGA 1NSYA 4NFLA 1WTCA 4OQLA 4QDJA 1B0AA 5A7GA 5C9ZA 3EOAI 3C2QA 3ZTTA 5EGNA 1K5DA 1Y3CE 3P0EA 2YOFA 1UZLA 2CXRA 2E1RA 3AJDA 3K0KA 2CNNA 2N46A 2VT7A 3OLYA 1XVLA 2CMGA 4MGYR 4X7BA 5BSHA 1IL0A 3L0CA 3DR3A 3QOFA 2P7IA 1I4WA 2QM0A 3AFHA 5G0VA 3ICEA 5KVVA 2B21A 1Q7TA 1KU0A 1UBNA 2VP5A 1Q0SA 4AMYA 2G6TA 3FVVA 4LQDA 4U7GA 5AM2A 2C5SA 1GPUA 1YBAA 4YCMA 1IJKA 1EINA 3MMNA 2WWGA 3ETJA 4G0OA 1BJRE 2GAFA 5FO0A 2FEOA 5BMVB 3ED5A 4I46A 1X87A 1G8FA 5HM8A 5BP7A 3U3JA 1TA4A 5T8KC 1P7VA 2NZXA 1J2JA 2A58A 3LJKA 2PA0A 4G5GA 1GKUB 4LXGA 3YASA 3P9ZA 1EZZA 4K0KB 4HDSB 4CLOA 4ZCSA 5KBYA 3D0KA 4DTIA 5ER9A 1PR5A 3D5TA 1D03A 3G8CA 2YR0A 4EO9A 4GW3A 4U7DA 3CUKA 3HXOA 3BIXA 3KQLA 3VU0A 4K9MA 3TDNA 3FF1A 1RQNA 5FWDA 1MZVA 3DGFC 4MVJM 3IP1A 1UANA 2R87A 1OXMA 2XVZA 3FOWA 3RF6A 3WJ2A 4ARCA 1TKAA 4XCQA 4INPA 4R31A 2PYDA 3INTA 3JASB 4IILA 3EF1A 5FDFA 4G4GA 4NC9A 4PFSA 2RGYA 1W8DA 4CCWA 2L18A 3F90A 4DJFC 4EUNA 3AKYA 3NX4A 3UGTA 5K0GA 4IH1A 1OREA 1QMGA 3R2JA 4CKXA 1XMVA 1O89A 4BLWA 5C1IA 1ONBA 4RTKA 3P2OA 3OCXA 4XE5A 2QTVA 4BLPA 1E2DA 2NNLD 1E2MA 1A96A 1UT8A 4PONA 4M46A 3OQOA 4TZ0A 4U2EA 3K70C 4W63A 5G3YA 1IEVA 1A04A 2JFUA 2PANA 2J9RA 2M6LA 1VC2A 2VCEA 4ZI7F 4UNPA 1FXWA 4BNXA 4ZHQB 3GG9A 2PVCA 1TA9A 2NUTB 1X7YB 1YQEA 3BF7A 3EVEA 3GH3A 3AEUB 4MPJA 4ZYVA 3ZV4A 4YONB 3MB8A 3AY3A 4PRYA 3HDVA 3BIJA 1DEAA 4ISCA 1VL1A 3I72A 1E1DA 3DTVD 1O96A 3H1EA 4TV9F 4XYEA 4YAGA 3MWYW 4MUBA 2IF2A 4OK5A 1MPXA 5FOSA 5IDQA 1U02A 4MEAA 1J39A 1KI6A 1V1RB 3ILYA 3QJGA 3R5FA 4HFNA 1P1IA 4MGKR 3VH2A 3WLKX 5JD6A 5K20A 1OV6A 3ABZA 1OWNA 2DERA 1G19A 1QV6A 1RI3A 3NTOA 4P92A 1E0AA 2VF4X 2FW8A 1Y4ZA 4NBWA 4HPXB 1OFIA 4FSHA 1XROA 1Z62A 3ENVA 4PG5A 3G5UA 1M9NA 3H5OA 3TRIA 3HWX1 4IICA 2JLUA 3E18A 3I2HA 1ZN2A 1KK3A 3KSUA 4M3NA 1V47A 2QAGB 2FOIA 5ALZA 4DCMA 2VNAA 4OLHA 2Y1GA 2ID9A 4C06A 2Z98A 3Q5DA 4RVHA 5CB0A 3MLEA 4IJKA 3ZY6A 5DEOA 3CUSA 1OWMA 1XZEA 2QU7A 3LRXA 5L7WA 3AXTA 4R9VA 3GJZA 1DEXA 1XWWA 3G49A 4RTRA 4ID9A 5ENDA 3FLBA 1JB1A 4RTSA 4OP1A 1NN3A 1ZM2A 1NDQA 2HEGA 1E3EA 1U3UA 4KMSA 1MQ8B 2PGLA 4RELA 5DPMA 4GI7A 4K8RB 3ZGXA 3ZU5A 4BCDA 1UKVY 1XE3A 2OV4A 3PRHA 1PS9A 2R1TB 4F21A 4FNMA 1E5TA 1KQGA 3R8FA 4GU5A 1F2TB 1Q5PA 1IRXA 1ZH6A 2YC4C 4UAVA 5EIWA 2GPNA 2L17A 2DR2A 3GVCA 1SIBE 1VLZA 5EYPB 5K3FA 2PUFA 2EQ5A 3AH8A 1ZNQO 1SBTA 2ZJFA 4KODA 3RVSA 2C9ZA 2FSPA 1GTZA 2YJ5A 3MPUA 4MMYB 2IEDA 1WMFA 2XUPA 3GOQA 4L6IA 3ZVLA 4D9IA 1P4GA 4M86A 2LE0A 3B3JA 3H2BA 3ORFA 1BS2A 1D2MA 4O5OA 4AJEA 2GXQA 2V8BA 3IV7A 3WISA 1THZA 4E6PA 2FN7A 5HILA 2XDQA 1QVAA 3BSYA 2QW8A 4J0JA 3TQQA 1UAGA 1BXZA 2ANBA 4A0QA 3RADC 1GZHB 3LKVA 4IIFA 2ENUA 4LJRA 1EHIA 4X41A 2DMRA 3U6KA 1IY1A 4W5RA 5A2QA 1J1UA 1UPTA 4TKUB 1L8QA 2GJAA 3NTXA 3X1YA 4KK3A 2VPYA 4RHCA 4FGWA 4GRIA 1E79A 2YNMA 4GPTA 4RFLA 1AA9A 3I9NA 4CIWA 4XB6B 3RVLA 4MO2A 4ZTUB 1Q6YA 1RE0A 2NX2A 2BOVA 3FGZA 2J30A 4J3FA 3WGHA 1TEHA 5KJFA 5D6OA 1LVUA 3RAGA 1I4DD 1Z2PX 1IY0A 1N7IA 2LBPA 1MVNA 2ZTLA 4EKIA 2FWMX 1OAAA 2FCAA 1WEKA 1P5FA 2JI4A 4GOXA 1XEXB 3PDCA 3WP1B 1GTMA 2YV3A 2GESA 4FN5A 3WGLA 3AZQA 1ZZEA 1P4AA 1W48A 3OOWA 1ZUIA 3DBRB 3QI2A 4CM8A 4F60A 4FGLA 4HZIA 4LNHA 5IT4A 5KTNA 3ZD8A 1AK9A 1BHQ1 3FR8A 3UV6A 1YRWA 1U31A 4IIBA 4BEVA 3K9LA 4J16C 1O03A 4J1SA 2ZRBA 2PJRA 2DFTA 2J31A 5E7IA 3T5GA 4B6JA 3EVAA 5I47A 3RUCA 4O4LF 2PH1A 1DQYA 3QWIA 2QRZA 2ZB2A 3N2EA 4ZHQF 3L5OA 3C3JA 2F3QA 5HG0A 1H23A 1YS6A 2CN1A 4B3RB 3Q8MA 1NQAO 4BMOB 1U3CA 3A6LA 2QX8A 2ERYA 1KY3A 1LS6A 4MVCA 4WZAA 4K9RA 2H7CA 5K8LA 2FWJA 4G67A 2DWOA 2ONCA 2P4QA 4U4AA 2RGDA 3DBHB 3RE1A 1Z4QA 3LT1A 4AKHA 1PQPA 2H65A 4ZVOA 1XQXA 1D07A 5T64A 5K8VA 1Z38A 2AI1A 2C9MA 1ZX1A 4PRZA 4Z9FA 4EMBA 1JEYB 1ZGAA 2PZJA 1XTPA 4ZVTA 4QOSA 4HP8A 1XRMA 1SQSA 2QSZA 1J8FA 4WT7A 3ZHQA 3EZFA 4R2WA 5F2NA 2XA2A 3LT5A 4I1UA 4AVYA 1Y8QA 3CH7A 3NU1A 1JIKA 1LH0A 5EHQA 5IW8A 2R60A 1KERA 4XVRA 2H1WA 2X8JA 3NYQA 1LDGA 2YRXA 2ZSHA 3PC2A 3WIDA 4AO6A 1ZDMA 3LH5A 1J7JA 1H42A 4H2DA 2W2LA 5D1HA 1JA9A 2D2FA 1E3WB 1XCLA 1SOVA 4YT5A 5JE8A 3RCBA 3SXUA 2DGDA 3B6MA 4I1OA 1PQUA 1W6RA 4PAGA 3H9GA 4L08A 3K9NA 2C2ZA 3S2YA 1C7IA 4HMQA 4DUGA 3D6TB 1GYQA 4UPVA 2YIDA 4IZHA 4Q3KA 2P2CA 2KPOA 5TGDA 3OSUA 4ND4A 1OFTA 1BQ3A 3EGDB 1T91A 4DNOA 4M54A 3KG2A 5IVDA 4DV5B 2IODA 3F8TA 3I73A 2YRFA 5ULLA 4ER0A 1Y6RA 3OMWA 4YLGA 1EDZA 1VJDA 4U2BA 2ZWOA 1MOQA 2XW6A 3UXYA 5FPTA 3UO8B 2REOA 4WJZA 1QBGA 5EIXA 1UBCA 3DSRA 1QDEA 4JJKA 3VHRA 3CSDA 3HNRA 3VYVA 3ZVRA 3B7PA 3EXEA 1R5NA 4NECA 3NIGB 4B5LA 5BW5A 1T0PA 4ZAXA 1GLNA 4ENTA 1JYSA 2PKQO 3TQHA 4A27A 1YUBA 4I5FA 4AD8A 4YIHA 2QTNA 4F7WA 4N12A 1T24A 4ZCPA 9LDTA 2UUPA 4FHGA 1TAGA 5TVKA 3AYZB 1UADA 4WOCA 3JVUA 5FBLB 5AVWA 4S2EA 5AVKA 3C4QA 2X1LA 3LM8A 3BGIA 5JARA 1YQQA 1KBZA 3SYNA 3WB9A 3ZQ4A 3G85A 5H80A 3OIWA 4WINA 4AKIA 5JSZA 3E05A 3WYAA 2C9OA 2VTKA 2DHDA 1O5TA 1JEEA 1NY5A 4WLEA 3TIGA 4JHLA 2QRHA 3WKCA 1QGAA 4DIFA 5IFKA 1HEIA 2W43A 4KQHA 2WTUA 3R5TA 4PWYA 4XSHA 4ZYTA 1EUYA 4G37A 3RT9A 4QOJA 3LUCA 3RWOA 1PNTA 3OJWA 3IP6A 1IUKA 3HR4A 4WCFB 3TKAA 4KW7A 3SG0A 2OOSA 4NH0A 3GAMA 3ZY3A 3NMUF 4FQ5A 4RVDA 4MQLA 1NPTO 2NV6A 4LIPD 1FNSA 3MTEA 3GRKA 4C2BA 2GB4A 2QRNA 3RBVA 1T1GA 4IRUB 1XAHA 2B9VA 3LTEA 2GCOA 3UUGA 1CDEA 1NTRA 4DTCA 2RK6A 2JHFA 4PBRA 1R0ZA 5LDGA 4UBLA 1CBUA 2VKQA 4C0XA 5LQNA 1C3XA 5A04A 4YUVA 4E5NA 1R2QA 3HVJA 3OY7A 1EK0A 2DPMA 3IRUA 3KJQA 3AR8A 3MWDA 1ZVKA 1QGYA 1E3SA 4EG6A 1C9KA 1QTQA 2CLOB 3TIVA 4YREA 3PEUA 2Q7DA 1CF9A 3P9RA 4RVGA 1F8XA 3H1PA 5GMOA 3KSAC 5JO0A 5C8YF 5BVHA 1GP2A 1TTPB 2V7VA 2AZMA 4MV3A 1MEEA 2JFBA 3FCUB 3O4IA 2YIMA 3IUSA 4TVSA 5EZ6B 4MW9A 3I1FA 3SC6A 2YHSA 1HE1C 4P7JA 1BTOA 2BGMA 2MWMA 4EEXA 3L4JA 2GLTA 1B2RA 4GX1A 1I2MA 2QAIA 2H57A 2PRIA 2Y3IA 3IO3A 4MGEA 2AWOA 4WNAA 3ZIAD 4GMFA 5G4LA 3V1TC 1REQA 3A05A 4FMDF 4RK4A 1A8IA 1E7RA 1AURA 1MRNA 1AK2A 5CGQB 4BNHA 4RMJA 2NPFA 1SB8A 1OASA 2B99A 2G5TA 1WDLA 5KREA 3ITEA 1M74A 1E3LA 4O4IA 4MVWA 2WWVD 2ZBVA 3GP5A 3ZK8A 2IYXA 4MVJI 3ISJA 3BEOA 4OXNA 4DCSA 1G20E 3GFOA 4AECA 1ESZA 4TWIA 5IHXA 3K6SB 1RJ9A 1E98A 1PTJA 2HRZA 4QUKA 4YJ3B 3OZFA 5MN6A 1IY8A 1KWKA 4R1MA 3RJZA 2HR1A 5I9MA 1YZKA 1W5BA 3E9QA 2EX4A 5EP3A 1XQ6A 4UOQA 3OAAD 3C1UA 3EGOA 1BA3A 1NKTA 1BKDR 1UCFA 2GJ9A 3D7KA 3VJRA 1SUPA 5FOQA 1CETA 1W52X 3H13A 5BNIA 3CRQA 4XR4A 1NMZA 5BW4A 2B1RA 3UK7A 5E9WA 2RHDA 2NZYA 5J63A 4AF8A 4PNZA 4ZO9A 5JI2E 4R2XA 2CNLA 3L1UA 3NHLA 4U9IS 3S2SA 1UEJA 3LCJA 2J3QA 1NP6A 3IJ5A 4JFRA 3T3IA 3VZDA 5ALVA 5JZVA 3EW9A 4KE7A 3ZDCA 5ER6A 4F8JA 1ISFA 1UP6A 3A6PC 3FHJA 3QP9A 2ET6A 2NUBA 3PFKA 1X42A 2H5EA 2ZIZA 3WGTA 3DZIA 4XX0A 3ZZ0A 3MSXA 4Y9DA 5IC5A 3JV7A 3Q6MA 1WY5A 3R6WA 1UQTA 1KRHA 1CQJA 3IOBA 4LXQA 2CSUA 1P1HA 2YWBA 5BV1A 4QRDA 4RK0A 3BT7A 3EOZA 3E9MA 4KRYA 1NQ5A 3LPMA 1SKQA 1EFPB 4M60A 4FDLA 3B1VA 2NSYA 1QFYA 1U7OA 5I8WA 1HDYA 4RGYA 5AIBA 1T3LA 4Q24A 1K5PA 1WWKA 3RTBA 4P2BA 3MGCA 1O8BA 2LD4A 5C4IA 1YS1X 2Y0PA 4RVSA 4DQDA 1CYDA 1TU4A 2SNIE 4KK4A 4L4YA 4LK2A 5AVXA 1K3TA 3QLVC 1E9DA 1L8OA 1X0XA 2QR3A 2R6ZA 4A2WA 5AVSA 2D6FA 2NO9A 4DJAA 4EJ2A 1H3NA 4MV1A 4RS4A 1GV0A 5H5JA 2XCUA 2XE7A 1U0SY 3QSGA 2AV6A 3KPYA 2II6A 5F78A 1XVIA 1Z12A 1J24A 1NQWA 4GWKA 4E5MA 3IBGA 4HK4A 1WZEA 4J2HA 4AICA 4J76A 3FDXA 5IBPA 3WGIA 4IF4A 5K4HA 5HNKA 3AC0A 4DSZA 3PNKA 3CXRA 4LX8A 1FK8A 1FXUA 2EKZA 3BBPA 1C30A 4DM4A 2YICA 4KN5A 4NYIR 4QOEA 3VBEA 3F7NA 3FKSA 3I3OA 4RTNA 5TX7A 5DM0A 4DM7A 3F9RA 3KTAA 2JFHA 5DLQC 2XNJA 2ZIXA 4NATA 3V7WA 4AJLA 1QGOA 2XQVA 3KKMA 5JTUA 2FMXA 3G2KA 3R5HA 5EE5B 4AZ3A 5DNCA 2PGOA 2Z1NA 5AKXA 1JQAA 5GQSA 1P7PA 2OYSA 1XJ5A 3WYNA 4GRAA 3IFSA 4J2TA 4PZAA 5GJCA 1JLMA 1ZH0A 2XOKA 5EJGA 3RYCA 3FTPA 1F0KA 1DX4A 1TO1E 1X14A 3KFLA 4PGHA 3B1XA 4Z53A 2XQJA 3EXFA 1PEAA 4RVUA 1KOLA 2JEYA 1WRBA 1YDMA 5BQPA 3PF9A 1Z3IX 4WD3A 2J0UA 1HT0A 1L4LA 4ME6A 2XA9A 3T1NA 4DC0A 3IBTA 1EA5A 1S8NA 2A9QA 2QL9A 4FK8A 2W2KB 3PUYA 3BGWA 4G5YA 2DU8A 3W5IA 3C6ZA 4AJ1A 1BGVA 5ES4B 2ZCVA 1WU8A 1EFLA 1A7AA 1QBKC 2HLPA 2AQIA 3KAKA 4N54A 4F96A 5IULC 5IT9A 1VJTA 3A31A 3GEHA 4C1NA 3U17A 3NB0A 2XHEA 4PLTA 1XXHA 1ORVA 4JB2A 4JIGA 2IRWA 4FT4A 4YH1A 2BSQA 2WP0A 3QPAA 3KQVA 4MYRA 5DCYA 3HK2A 3TW4A 1RHMA 3VR4A 4BCBA 1UK8A 2FZVA 1LTKA 1GL7A 5E7MA 2J4FA 2ZI5A 3EIFA 4LSZA 4XX1A 5AOAA 1VA5A 5JADA 2RAUA 3BMCA 1DAOA 3FWHA 4YJ3F 5DCWA 3VO8A 2E5LB 4ZRDA 1PWYE 2AOUA 2GPTA 1Y7PA 2AUNA 4ID3A 4MGHA 4D8XA 5C8VA 1YULA 2ZRIA 1F5SA 2XMZA 4OHZA 1ZD3A 1NVWQ 1JRLA 2IZOA 1P75A 1YIDA 1VKRA 3DONA 3N6RA 3Q3GE 4G1VA 4JSRA 4MQ4A 2BH2A 4LTNA 2CVZA 2WIFA 2ERXA 3WKBA 3L0OA 3UATA 4YRZA 4AKGA 2XKAA 1Z2DA 3QNMA 2QU8A 4MQUA 3ORHA 1OJ7A 1IC6A 3OQJA 1X7HA 4EPXA 2J67A 5JMOA 2C29D 2GH1A 2ZQZA 3P0JA 5DBHX 3D6MA 5E6RB 1SVSA 2X4IA 1H2EA 3CMCO 2DYKA 4QOHA 2QX9A 5SZIA 3WK9A 1G8HA 1Z4OA 2J7PD 1ZD4A 4NSNA 5IP5A 1ZITA 3F47A 1ILEA 2OAGA 1OX6A 2GZ2A 3EIXA 5KVCA 3CVUA 4MDEA 2G17A 2VHZA 3LQYA 2XUHA 4M1EA 2H3HA 2NUAA 2ON6A 2C9CA 4YB8A 2AC7A 1T34A 3Q41A 1TB4A 2YUTA 4PIPA 3SX4A 3RFCA 3TMYA 2K87A 1RXCA 1TYBE 5BWOA 2G1JA 2GASA 1V37A 1GL6A 1P19A 2BF7A 2BI4A 3F96A 4PX3A 1DGQA 2X5KO 1Z4IA 3TEFA 4E2XA 4PYJA 4G9BA 5AJTA 1KQOA 4AL4A 4F46A 4IDGA 4TV8A 1XRSB 1CLUA 4HNQA 3F98A 4O6VA 1N3IA 2GPJA 1TPYA 2JGFA 2VHWA 2ZPTX 4CL8A 1G3UA 4LHYA 1YBFA 2V74B 3ZCTA 2VHTA 2RI1A 3U7GA 1ZHFA 2NP7A 4U9HS 2VFAA 2HHAA 1GM5A 3THWB 1EZ4A 4G5HA 4IIXA 1CJMA 1AF7A 1ZAKA 2JJMA 5K99A 1LBIA 1KF0A 1RVDA 2QJTA 1XJWA 4QXQA 4NJEA 4DKXA 2EKLA 4MJLA 5GJVC 3PQ6A 1I8TA 3N8NA 4GX5A 2IUSA 2JL1A 3B36A 5E9QA 1J23A 2AN9A 4F4HA 1CUJA 2WU3A 2FJ0A 4WTOA 5L53A 3N87A 2GQ0A 1SVOA 3D59A 4EG1A 5F9FA 1MAHA 4BB9A 4EUKA 4PGFA 1RWBA 2CMFA 2H5JA 1VI5A 2LKCA 3FYCA 3D6HA 2I1WA 3PGJA 1QLHA 5CDYA 4NBLA 1IBCA 1JAZA 1NV8A 1TK2A 3UT5A 1UBJS 1KQFA 5LD2C 4HLUC 3WV5A 5HOEA 3Q9NA 1RP7A 1F4PA 4GC9A 4UTPA 4N6NA 4NLLA 1V71A 3QTLA 3W1WA 3LAWA 1JMKC 2VF2A 3HKBA 3QUQA 2ZVDA 1NQVA 1RBZA 4J8PA 1JDTA 1VHQA 5HE9A 3AZPA 4G5RA 2O9JA 3EH2A 3OFVA 4Z9YA 3I9FA 1DSSG 2O2XA 4EBFA 3EIQA 2VXCA 3EEIA 2Y6VA 2HK9A 5A9TA 1CPYA 3UCFA 4N7MA 4WKNA 2J0EA 4A6PA 1DFGA 2C8VA 3LYUA 4G25A 4E70A 5HZGA 1N33B 4JC5A 3OFJA 1T9HA 4H0CA 4XIGS 3EGIA 2FV8A 2OCGA 1X7XB 1G98A 3D4IA 1VE7A 3LRPA 1N2XA 2H1IA 3OZ7A 4N7BA 4OBWA 4R1LA 1HDRA 2PX0A 4TN1A 4R8MA 4QJ4A 1TD9A 3WLTA 2PXAA 1RRPA 1H4SA 2BEWA 1OU4A 3A4YA 3HV2A 4IZIA 3GRCA 2JH8A 2QVYX 3BZUA 4NJMB 1OWPA 3CIOA 4H3KB 5IHPA 2B6HA 3S1AA 4UNNA 5LNK1 5J2TA 2Q3DA 5AW0A 3AVXA 1CE8A 4KUHA 2C2BA 3IMEA 2F90A 4URFA 3REQB 4BEJA 2WAAA 2G6BA 3FDZB 1BG6A 5CU7A 2JI8A 1UF9A 1MJNA 4RV4A 1KBQA 4B2IA 4ZI2A 1PG0A 5HMLA 4ZO8A 5AW7A 1GVNB 1M2NA 4Z3KA 4RLHA 4FGUA 1VE6A 2JGIA 4EW3A 4Z1OA 3RNLA 2WM2A 4I50A 3LQ4A 2J6CA 3KD2A 3PJFA 4KR7A 3UV7A 3OTIA 4D9CA 2J4DA 5I5EA 1TCCA 3QVXA 2ZRPA 2QYTA 4TMWA 2NZVG 3LT4A 4JELA 4OBBA 2R1VB 1UJ5A 221PA 3GQVA 3PNBA 2VYFA 1A0OA 1XCGB 2PNJA 3WSTA 2O8VA 5GM1A 1F0PA 1TLTA 4GOLD 2Y6UA 1GUDA 4FOLA 2IXTA 4FE3A 4RABA 2O8DA 3KVNA 3FBTA 5EJIA 5DHTA 4NEHB 1MJ5A 5JR3A 3FE2A 4FYYA 4J2OA 4RJ2A 4GHWA 3WHLA 3BXEA 2BMVA 2FMKA 1XDBA 4FOOA 5EMKA 2JK1A 4S12A 4A6XA 1QJ4A 1YJ5A 3ILVA 2PTGA 5DU2A 5E4JA 4MMXB 3TJMA 1UDWA 2HD4A 3RSZA 1EI9A 4R7GA 3F8WA 2VI5A 3BGDA 4OGGA 1PZXA 3LP8A 4JI7B 2AYYA 3I9LA 1U1GA 1FU4A 3F5SA 5AOBA 1Z2AA 4O3MA 1E4EA 2BP7B 4ZU3A 3ZWCA 3D7RA 5AK6A 1IWPB 1E2EA 1UJ2A 3IDAA 5EP2A 3WVNA 1XK7A 2NNWB 4XDYA 2CFRA 3GFPA 3IJRA 4EMSA 1PGPA 4I8XA 3MWEA 5TJHA 3AJEA 3PRJA 3OQ6A 3UG7A 3ZIUA 4WFQA 4XYLA 1HORA 3AIMA 1JQLB 4KCGA 4MKRA 3QTTA 5FBWB 3H0CA 4CODB 2IYRA 2LW7A 3KOZA 4YN3A 3UMRA 2ZXFA 2RB5A 4LOIA 4RD6A 4FYKA 2I2WA 5F9MA 2IHNA 1J09A 2E4XA 3HCRA 1ENPA 2FVXA 1NYLA 3O0TA 3F3MA 5CYGA 3VO2A 1DBPA 3ZQUA 4HDRB 2D0OB 4DDHA 1V7PC 2J07A 2O57A 2CXOA 1J21A 4KXYA 5LPNA 2BT4A 5KDLA 4DA6A 2PKEA 3BBLA 1ONPA 4TL8A 4CMGA 3OZBA 1SB9A 1PF7E 1DVRA 2CB0A 1YZFA 2KHZA 2NTYC 2XVMA 2M6RA 3DE4X 1KP2A 3EB9A 4OHFA 1QYXA 3V6MA 4I08A 2VG8A 1R9GA 1E6MA 3E7DA 1V8ZA 2PMEA 1AUVA 2VZEA 4F3TA 1D4OA 4X3CA 1HL7A 4O0LA 5ARDA 3M33A 3H2IA 4M55A 3DM5A 2WUVA 3T0IA 3T3EA 1NW9B 3AUTA 5AJVB 1FTYA 4MKXA 1W5SA 5HJ5A 1GTG1 5DLDA 3ILXA 4DCOA 1YZHA 4P82A 1GR1A 2QB5A 4S1WA 4W6ZA 2QZ4A 3A1DA 3B3AA 5HFNA 2EQAA 1T9GR 4YK7A 2VJCA 1ZIOA 1RU3A 4MVXA 5BWBA 3EZXA 2ZRAA 4JYPA 2JIZA 3WL5A 1MF7A 1OTYA 3FLAA 4I5GA 5KAMA 4DLNA 2DT5A 1GRVA 2GEKA 4D9NA 3O8RA 2CB9A 3CEJA 2WM3A 4JROA 1HE5A 2A57A 1PFVA 1TT5B 3FSRA 3AERA 3K6JA 3L3BA 4EABA 4C2UA 4UVDA 2V9CA 4UBMA 3R7WB 1A50B 3RFVA 1ADYA 1DAEA 3JATB 2ECFA 4YA6A 1QKKA 5AKJA 5F12A 5F3RA 1K27A 2AXEA 3GEMA 3GLRA 3MC1A 5H83A 3UAOA 3VJMA 2B69A 4YROA 4BAGA 2B5OA 1NRWA 2Q62A 1ZLXA 2ZAYA 3NJ4A 3Q0IA 2QSYA 2WZDA 3JQBA 3GCZA 4G9GA 4MIYA 4Q1AA 4X3PA 1QJCA 4BRUA 4DCTA 2HRRA 5HVNA 1KO1A 4B6OA 5KHOC 3OQMA 1R0KA 4RSRA 3PIIA 4RHFA 4ZOLB 3DL0A 4LHWA 1OC4A 1V4VA 4FR0A 3KWMA 1SC4A 1ZCAA 2O4UX 2QT1A 3BWXA 4LTMA 3JX9A 1JG7A 1QF9A 4L4XA 2E4WA 5ADVA 4MQBA 2XD4A 3T9EA 1ISMA 4KQEA 3DV2A 3LF2A 3SXJA 3TXXA 4KQCA 3VJKA 3W5VA 2FWNA 3TM4A 1LK7A 1VMAA 5D7NA 1I9CA 4ETIA 1O6BA 3ZLTA 5J5CA 1RYYA 2DF8A 4CRWB 3ZW7A 4NCKA 3HCBA 4G4SP 5HOQA 3WZLA 5EHNA 3BS4A 2NLOA 4Q0MA 2G25A 2AN4A 3IR5A 1G6OA 5BV8A 4JBHA 5FV4A 1NC1A 2OPHA 3AY7A 2UYHA 3GLTA 4B40A 3DZCA 3G9TA 3CLTD 1IN7A 5FUXA 4MROA 4W7SA 1DBVO 2BFDA 2HA5A 1KKLA 3ET5A 5TMDA 3AWDA 3KV3O 3MTGA 2VTBA 2A5FA 5IAGA 5T3UA 4AG6A 3ESBA 3KS9A 4LHEA 1DRWA 3PC4A 4LFBB 3JYHA 2AW5A 3NP9A 4XPIA 4EYOA 1EVZA