4DJTA

Crystal structure of a nuclear gtp-binding protein from encephalitozoon cuniculi bound to gdp-mg2+
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
190
structure length
186
Chain Sequence
LTYKICLIGDGGVGKTTYINRVLDGRFEKNYNATVGAVNHPVTFLDDQGNVIKFNVWDTAGQEKKAVLKDVYYIGASGAILFFDVTSRITCQNLARWVKEFQAVVGNEAPIVVCANKIDIKISKKLVMEVLKGKNYEYFEISAKTAHNFGLPFLHLARIFTGRPDLIFVSNVNLEPTEVNYDYHSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein
molecule keywords GTP-binding nuclear protein GSP1
publication title Crystal structure of a nuclear GTP-binding protein from Encephalitozoon cuniculi bound to GDP-Mg2+
rcsb
source organism Encephalitozoon cuniculi
total genus 61
structure length 186
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08477 Roc Ras of Complex, Roc, domain of DAPkinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4djtA00
2FNAA 2J0UA 3UANA 2SHKA 3NG1A 5JSZA 1UBFA 5DSZA 3C14C 3JVVA 4IEEA 4ARZB 1AJEA 3C8UA 4C0BA 4D4KA 4HLCA 2WSSA 1QHHA 1ZUHA 5IT5A 4LJAA 3MLEA 2ZJZA 5E3HA 1EK0A 1J8YF 1SVWA 1CULC 4KV9A 3UWOA 3M0EA 3B8HA 1Z07A 4LZZA 1F2TA 1GILA 2FPLA 4DWJA 1DPFA 2ODEA 4KFSA 4RZUA 3VR3A 4MKHA 1ZNZA 1YZNA 2J59A 3U3MA 1XPRA 1BH2A 3FKSA 3KDSE 3PCRB 4XH9B 1YZGA 3SHWA 3R9IA 1HV8A 2ANCA 1H8EA 3FFBA 2VL7A 2QP3A 2REXB 5HKKD 5DO9A 2WIAA 3EPJA 2BM1A 1NMYA 2F3TA 4NYIR 1P9WA 4D81A 2GZHA 2WV9A 1YRAA 2FZ4A 4B32A 1E79A 3TUZC 5CIQA 2JLWA 3RRZA 3WYFA 1IXRC 2D7DA 2BVNA 1G7SA 3MD0A 1T3HA 2BWJA 2NOAA 2VTKA 1RE0A 4QGHA 1OKKD 2NGRA 4XVRA 4I1OA 1IXSB 3LVQE 3CUEF 2B7BA 1Z0AA 4GOJA 2FSFA 4A8JA 1S2MA 5AUPB 1XEWY 5K8LA 2AFHE 1EWRA 4U7DA 3TH5A 1Q21A 2GETA 2WVJA 4UJ3A 1XTQA 1R0WA 3ND9A 4JVLA 4RD6A 4JMPA 3KB2A 1Z47A 2UKDA 4AYWA 4I1SA 1GKUB 4KU4A 5KPJA 3TVTA 2LCFA 4FCWA 4LYAA 2V6JA 1DE0A 4P4TA 4A2QA 5BYKA 2ZRFA 2JATA 1NRJB 3VR2A 1TF2A 1Q1ZA 2O8DB 3GMTA 4AC9A 1R0YA 3REFA 4DLTA 2BC9A 2QGNA 4RY2A 4NCJA 2IS4A 4EJSA 1DELA 3PUWA 1LF0A 2BMJA 4TL7A 3QF4A 4DIEA 3CX8A 4D25A 1OH5A 5AJXA 1YZQA 2BCJQ 5GJBA 2GESA 2MMGA 3AEZA 2CCJA 1KSGA 4OK5A 4JZKA 4R98A 5J47A 1P7CA 1JQLB 4UNQA 4B43A 2VHJA 2BIFA 4O25A 4ASUA 2AKYA 3LX8A 4D2IA 2C8VA 1OXXK 4OK3A 1KK1A 4G5QA 1NKTA 4L9SA 1XMVA 5EUMA 3P4XA 4XWOA 2ZU0C 1KMHB 1R8SA 3NWJA 1E2MA 1E2LA 3NH9A 2PBRA 4PANA 4WA7A 3DMNA 5E7IA 4DT1B 4AKGA 3BC1A 4PC2A 3GJ4A 4Q03A 2PZFA 3DHWC 1E9EA 3R20A 2QORA 3K0EA 3KJHA 1MOZA 2RMKA 2ORWA 5DNYB 3U7HB 2C98A 3QJYA 4XSGA 1B0UA 3QBTA 2GF0A 1W36B 2R6GA 3I8SA 1ZUIA 4G5GA 3W3AA 5AR1A 1TQDA 1UAAA 3O8RA 2JDIA 1CEEA 2X19A 1A2BA 1YZKA 4JL6A 1IAQA 4LV5B 5FTMA 1XEWX 1F48A 4O0MA 4BE7B 1U0LA 3SQXA 2VP0A 1J90A 3NTUA 5FOWA 4KYUA 3D6TB 6Q21A 2GTPA 3L0SA 1ZU5A 1OV4A 1FZQA 4AK9A 2DCUA 1G8PA 1JAHA 3F0TA 4QGFA 4N0EA 1CS4C 2EWVA 3VTKA 1EFRA 3UG7A 1IONA 1KO8A 2CE2X 2E9SA 2H17A 1E9FA 1UPTA 4NYMQ 4Q66C 2OAP1 3A1TA 3C4JA 4DCNA 4X8LA 3DM9B 1FQJA 3MAAC 5EXSA 2ZJYA 2JASA 2XNDA 1WP9A 4LHXA 1A4RA 1UFQA 4EPVA 5SZKB 4OJKA 2AD5A 5KUTA 3W90A 3IGFA 5C18A 1CLUA 1WBDA 5FUVA 3P1JA 4BFVA 5CK5A 3EIQA 1QHNA 1WRBA 3HJNA 2CL6X 5IRCD 4IFEA 1J2JA 1KZGB 5KO2A 2ORIA 3U7EB 1JNYA 2CHVA 4GFDA 4Q1FA 3LXRA 3IPYA 5AWFC 3ZZTA 3BRWD 2D2EA 5KNBA 3RS4A 2JLSA 4M53A 5G3ZA 3AGQA 1A2KC 4P32A 4UNSA 4CIDA 2BBOA 3L43A 1G8GA 1HQCA 1M7HA 3ZS8A 4CF7A 1ZM3A 3OZXA 1T0HB 2QRNA 1GUAA 2RGNC 4PAOA 1MO6A 1X1RA 3HR7A 4BRWA 5B2ZA 2ZI3A 1KI4A 2LWIA 1G291 2QY9A 3TAHA 2REOA 2CJWB 4PHTA 3LLUA 2VHQA 4GDFA 1W2GA 4S2EA 4KFUA 3ZJYA 3ADDA 3G82C 2JLXA 2G88A 1CKEA 2OV2A 1GDDA 1JB1A 2C9YA 2ZTSA 1TEXA 1G8YA 1UBEA 2ZS9A 4F91B 3QPUA 5HE9A 2ODWA 3EX7C 2NO1A 4NPHA 1FPMA 3IEVA 3AVYA 1O87A 2V7QD 4ITRC 1U98A 2AWNA 5E4FA 1E2QA 3CPEA 1YZTA 3BH0A 4IVQA 4FMBB 3EPLA 3TBKA 1DBSA 4PZZA 4MGIR 4GZMA 3WRXC 2OEPA 4AG6A 1TQ6A 1XTRA 4D82A 4IOLA 3BB1A 3HP1A 1W0JA 4G01B 3SDZA 4V0MA 4K8OA 3EA0A 3V4FA 4A36A 5CJPA 2OBNA 3MCAA 1W48A 4UXHA 4B3FX 3IPXA 2J0VA 3PFIA 3VX3A 2EYQA 2CMKA 3LVRE 1OB5A 3SOPA 3CX6A 4Q9IA 4E22A 1US8B 1L4UA 2HEIA 4TLCA 3TW8B 2ZAOA 2FA9A 2IYQA 1XMSA 4HEJA 5FOUA 2QMHA 2VP6A 3HYRA 3GJ8A 2GVDC 5HZHA 4ZDIA 3TRFA 2IYWA 2JJ8A 4L5BA 4Q21A 1HE1C 2EFCB 5EE1A 5C4GB 3QXXA 3AVPA 3NC1C 2YZ2A 4QHSA 2QPOA 5CLQA 5GADl 3FHTA 1LV7A 2QPTA 1E9RA 2P3SA 4LJ7A 3JVUA 4EPWA 2WSMA 1G21E 2V54A 1S1CA 3AM1A 1S4QA 4AG5A 1SHZA 2CHGA 3GEEA 3NBXX 4JLKA 4M1KA 3CM0A 3CZPA 3VKGA 1E0SA 2R6DA 1WXQA 2FWRA 4W7SA 4H9GA 2OT3B 3R7WB 4DB4A 5C4MA 1AIPA 3UK6A 5FOVA 4ZPXA 1F60A 2NO9A 2IHBA 3HU2A 1CR1A 2J5XA 1XD9A 4G5RA 4EKDA 1R4AA 4HLUC 4HYYA 1LS6A 4TN1A 1Q3TA 2ZRPA 3MWKA 3X1XA 3P4YA 4PSAA 4DRZA 2F1RA 5TV2A 3CWZA 3THWB 1G6HA 1N6IA 1TMKA 1WF3A 2N1BA 2PMDA 3B2EA 4HAWA 5L3RA 4DCSA 4PX9A 2ATVA 3U3KA 1SVSA 4JLJA 4QNRA 2W58A 1G3RA 2PLFA 4PZYA 1GM5A 5B58C 1F2UB 1K8RA 5DN6D 4TLBA 2AXPA 3LDAA 3RS5A 1N6NA 3EWAA 2XXAB 2WWHA 3PUZA 4X8MA 1SVOA 2QAGA 4WIAA 3EXAA 1UKEA 3AF0A 4B35A 4Q48A 1VCNA 1AA9A 1VPLA 2ZITA 2CNWA 4R2IA 2JGNA 2A5YB 1AGRA 2NMVA 3SBEA 2XB2A 1VDZA 3U61B 4EQ6A 1CIPA 4PSKA 4UJ5A 1Z06A 3A1UA 4IKEA 4HZUB 4YDHB 1G3UA 1X86B 5KNDA 1W5SA 1C4OA 1KAGA 4OYHA 2QZ4A 2WAYA 4LV6A 1ZM7A 2WJYA 2QT1A 3VR4A 1QBKC 4GRAA 4MYHA 2DWOA 1XTSA 3B1WA 3N2IA 2B7CA 3OESA 5LB4A 5TMPA 4JVMA 5HZKA 3TQFA 5FUXA 3ZYCA 2GILA 4LGMA 4NYIQ 4DDUA 1DEKA 1EXMA 2L0XA 3ZLJA 1E79D 3HPQA 4BFWA 3I72A 4IOKA 2F9LA 4RJLA 4C2TA 3RABA 3B6EA 4TTQA 2IEYA 4HAYA 1NG9A 1XMJA 5IK2D 2ZSEA 5AUNB 1P2TA 5TY0A 5F3WB 1UF9A 2XZOA 4WBSA 2OLJA 2OILA 4DCUA 3NBFA 1NIJA 3L0PA 5D3QA 3I62A 1JJ7A 1U8AA 1XEXA 3ZVRA 1D9XA 1U9IC 1MABB 3WXMA 4ILEA 4TQ9A 4FI3C 4IVRA 4MGYR 4RZ2A 4M9QA 4UXJA 1L8QA 2J41A 721PA 4OI2A 2Q0HA 3NBYC 2PZGA 1TADA 1Z5ZA 5AJZA 4F38A 3U3JA 1FUUA 3ZH9B 1N25A 2PJZA 3FOZA 4ZV4A 3Q85A 2ERXA 4MQBA 1G3IA 2V55B 4Y0AA 3RYTC 1ZBDA 4J0QA 1RJ9B 2I4IA 5FOTA 1MH1A 1BS1A 2ZE6A 4QOSA 5DYGA 1X3SA 4NMMA 4F4IA 3JZAA 4Q4JB 5JZVA 2X77A 2GF9A 1R5BA 4JJKA 2GJ9A 1S8FA 1XF9A 4Q4AB 1E2JA 3VR5A 2QTVB 3C5CA 4BQSA 1ZD9A 1NJFA 4RD2A 1X8LA 2QRZA 1JXMA 2RGEA 2RGGA 4JKIA 5IF9A 2P6NA 3U3OA 4F7WA 5JHHB 3SS8A 2GKSA 2AFIE 4PO8A 2O8CB 1VECA 3KB1A 1DG3A 4B75A 1PZNA 2WKRA 2A5JA 3A4LA 4TTPA 1KI7A 3D31A 3T34A 1KO5A 4B6FA 2ZSFA 2QI9C 1TQ2A 1G4AE 1JEDA 2ZQ5A 4TYNA 2O8FB 2VP2A 1G1MA 2JJ1A 3ADBA 4Q00A 4IDOA 3OAAA 2HCJB 2VP4A 1FTNA 3UKDA 2CCGA 3WNDA 1W2HA 4A6XA 5FL7D 4IHQA 4B33A 4JSTA 1OFUX 1W5TA 3U44B 4BUJA 1GG2A 3ZIAA 2O8BA 2H7VA 3B85A 4Q9KA 4IVPA 1JAIA 1Z2AA 2F7SA 5CM8B 4B73A 1JI0A 3GLGA 3VMFA 1XD2B 2Q3HA 3KKMA 4KHZA 4KJZA 4OKSA 2IS1A 4OQXA 1TU4A 4ZDWA 1AS2A 3ADCA 1IHUA 2ZSDA 2N46A 2ZAMA 2PCLA 2ANBA 1HH4A 1IBRA 1Z8FA 4YMSA 4BRUA 2IYVA 1FMLA 4PO1A 3U4QB 4KCGA 4GP7A 5M04A 3VX4A 4MKIA 1G8HA 4Q1EA 5JWHA 5D3MB 2FZLA 5KSPA 4LPSA 2QUZA 3PV0A 4R71A 2W2TA 3PEUA 2FSHA 4V02A 3CRRA 2OESA 3AKCA 4B2IA 3FGNA 1D6JA 2XNDD 3EZ9A 4YMWA 1P5ZB 3EWSA 2ZM5A 1MRSA 2A5GA 2FG5A 1I2MA 2FFAA 5J4LA 5LPNA 1R2QA 4HDCA 4HDQB 1XTKA 1BKDR 4TL8A 5J4HA 4RFVA 1PUJA 3SEAA 4PC1A 1XMIA 2IUUA 3RWOA 4BFZA 4MGZR 1P75A 2ERYA 2JA1A 3K0SA 1ZM2A 4LJ4A 2HF8A 2GK7A 1G6OA 4C2UA 4ERNA 4NCNA 2FPMA 1RRCA 1KSHA 2YOHA 4PHHA 1GFIA 2GHIA 4DEXA 4LK2A 2NPFA 1UBGA 1NMXA 1XTJA 3EZ2A 3FPAA 4A0GA 2C5LA 5BXQC 1KKLA 2OO7A 5ELXA 2UZIR 2Z43A 4DSUA 4P3YA 3MSXA 2FEOA 2ZUBA 3VKHA 2O8EA 2J7PA 3DL0A 1LNZA 3GD7A 4B71A 2ZRAA 1E3MA 4R7ZA 3W6PA 1U99A 1V43A 5LB2A 1XJ0A 2R62A 2VHUA 3BFVA 1V5WA 3AP3A 3U5ZB 4UXIA 2JEOA 1KMQA 2YYZA 3TMKA 4B34A 1ZW6A 1KNXA 1NG1A 2D2FA 2RGNA 3S1AB 3B1XA 3SBDA 1G3MA 4Q9JA 3SC3A 4OI0A 3EASA 5EP3A 1E69A 2DYKA 3ZVMA 1ZC4A 5BW8A 3K9NA 2ZU6A 1G16A 3CX7A 3U7FB 3CNOA 4C0QC 4EFMA 4P4SA 4TLEA 3DZ8A 4XD7D 2GXUA 3ASYA 1DAIA 4Z8YA 3UMSA 3THXA 1YRBA 2VHCA 1KAOA 4LBYA 3RS7A 4LJ9A 3TAUA 3E5HA 4QM6A 2FE4A 3B9QA 4AYXA 4PPFA 4DCTA 3MRSA 4QRHA 4MYCA 1HQYE 4CEIA 1ZM4A 3F8TA 1EG7A 3LWNA 4RZ3A 5DE3A 3CR7A 5FPTA 4URXR 1BMFA 4C3ZA 1E9CA 4M9ZA 4L15A 1LFDB 5JWOA 5FPSA 1OJLA 1LTQA 4TMWA 4LYFA 5JI3E 2OHFA 2NO7A 3QKRA 2KE5A 1N6LA 4LJ6A 4DB2A 4KSBA 2WJGA 3IIMA 2KBEA 2C77A 4NE2A 1IJFA 1KIMA 1IJEA 1AQUA 3GQBA 3QG1A 3A8TA 2ZRDA 2GBLC 3A1VA 4ABYA 1JR6A 4US2R 1U8YA 4LSGA 4YDSA 1T6NA 2D4HA 1GWNA 2YC4C 1Q20A 2R65A 2YWHA 2RB4A 4BFTA 4M9XA 3RC8A 2ZRIA 4OHWA 2CVFA 1JR3D 1ZUNB 1HTWA 3BB3A 2ZYVX 3Q5EA 4M0LA 2P5SA 3NEJA 4DLZA 1N0VC 3K0CC 1KI2A 1CJVC 1P72A 3NHBA 3AVWA 4DC9A 4C7OA 4M21A 3OFND 3HWSA 3PENA 4DSNA 5H70A 4IOJA 5GJCA 3BBPA 3TIFA 2O0KA 3TVDA 2CLDX 1QHIA 2WWFA 4ZCMA 1SXJE 2GDJA 3SYNA 3Q7PA 3A58B 4HUQB 3A6PC 1MO5A 1Q1QA 2A7QA 4YXWA 1G64A 5CYOA 4HLUA 3QPVA 5FR1A 4NKRA 5FBWB 5L3VA 2AR7A 2WPDA 4RFSB 4TL6A 2VF8A 1AGPA 4AKHA 2MSEB 5KDDA 3TE6A 4YMUA 1W36C 3GJ3A 3IKJA 3WP1B 3O8BA 3MFYA 1IQPA 1OLOA 2DFKB 3O8CA 3VQTA 1TU3A 4FD2A 4JLMA 4QHYA 2IW3A 2ZROA 5B57C 1X1SA 5FTNA 2V1UA 2JJ2A 2IS2A 2O52A 4D0GA 4GNKA 1X8JA 3K0AA 2IYUA 1SHKA 1Z2CA 1JBKA 2QQEA 1NVUQ 3OIWA 4NCIA 5G40A 2H18A 3GP8A 2F55A 1VYUA 3WRYC 3AGPA 4ACAA 2O8CA 2GJAA 2F9MA 4GT1A 2XOKD 1UDXA 1NN3A 3BH6A 4AY2A 1C9KA 1L7VC 1P73A 3UG6A 2IXEA 3ASZA 1YU9A 5P21A 1LB1B 2ODNA 3RHFA 2WKPA 1IY2A 2YWGA 5AJWA 4POAA 4M1WA 1LS1A 3GLIB 2QE7A 3LAWA 4AI6A 3I8XA 4URUR 5EXTA 1OYWA 4CEHA 3EA5A 5DLQC 4RKFA 3OE7A 4I4LA 2XSZD 2ZE8A 3TK1A 3K1JA 1OT3A 2XEXA 4LJ5A 2YVUA 5FPHA 1W4RA 3X1ZA 1NLYA 3AB3A 2QM8A 2ZI6A 3F3YA 2FFBA 5HCNA 3K0FA 5EP1A 2ZJOA 3VAAA 3RSLA 3U7GA 4MITA 2WMNB 4LHYA 1F3OA 1G7RA 1UEJA 1XZQA 3QKSB 1JXOA 3M6AA 3QQ5A 1WE2A 4O2RA 4S35A 3OHMA 1J8MF 2VP9A 3GLFE 1E9SA 2ZJ8A 1ZIPA 1MT0A 1MO4A 1UM8A 5HTKA 1U9IA 2ZEJA 3AH8A 4B3CA 2YHSA 2R6FA 1AS3A 2REBA 2BMEA 1JQJC 2PT7A 2G0NA 3P20A 3CZQA 4DUGA 2QL6A 3DDCA 3SYLA 1SKYB 1O3YA 4LYJA 4CEJA 1W49A 3W5JA 2XJ9A 3OEED 2RGBA 2C03A 2ZE7A 1M74A 4Q9HA 5UKDA 2D3WA 1ANKA 3C16C 1XNJA 4OI4A 3T5GA 3FWYA 4JT2A 4HB3A 4YQFA 3BFKA 1Z29A 2IXGA 3TUJC 4GI7A 4HI0E 1JEEA 2W6JA 2ZUCA 3M4YA 4M1SA 3THOA 2WJIA 4G1UC 1IN7A 1R8QA 2YJTD 3OAAD 2C9CA 2P65A 5AJYA 2YKGA 1Z0IA 2ZI7A 2Z5FA 5TVKA 1E4VA 1KI1A 1T4GA 2NO6A 3DPUA 1XPUA 3ICEA 2QBYA 4GOXA 2HT6A 1E1QD 2WAXA 1ZINA 3D8BA 3OF5A 5IHPA 2AD1A 1AQYA 3WBJA 2GEUA 3EZ6A 1TL7C 3W9YA 1SXJD 1RRGA 3FTQA 1KI6B 4JIMA 3RS3A 4M2LA 4A2PA 3DEFA 4C0SA 2ZRJA 2C96A 4OJQA 5B64A 1PLLA 1S9HA 4C30A 5FI1B 4FMCB 5JHGB 1KTVA 1EFUA 1R5OA 1XTIA 2EQBA 2VPPA 3A4NA 2K5UA 4BFUA 1GP2A 4GBMA 2GCNA 3WY9A 3T35A 1NVVQ 4AWXA 4E5UA 1E9DA 1U8ZA 5C2JB 3FE2A 2JAQA 1DVRA 2FDCA 1DARA 4DVGA 2IL1A 3PUXA 5TARA 4WW0A 3W3ZB 3ETLA 2QNRA 1ZYUA 3K8YA 3WMEA 2O5VA 4N1AA 3BOSA 1KO4A 3S1AA 1A82A 2RHDA 1KI9A 3I92A 2ZANA 2DB3A 5EP2A 4DCVA 3TJZA 1GOTA 3MJHA 2CEAA 2CL0X 1TF5A 2G83A 2MSDB 4QXAA 2WTUA 3VU9A 1D9ZA 1U0HC 3OEHA 1NBMD 1XRJA 4E03A 1NY5A 4KYIB 2H57A 1Q3HA 2F3RA 3MWJA 3QXSA 3LD9A 2PZEA 3R8CA 4Q4HB 5CDFA 1AZTA 4JYBA 3EW9A 4DSOA 3H1TA 1CRQA 2LKCA 3KTAB 1P2UA 1E4YA 2FEMA 2A2ZA 4URZR 1G19A 1H8HD 1GVNB 1NSTA 1VYVA 2CCKA 4HB2A 3R7WA 2V3CC 1KDPA 2XX3A 4M1OA 5G3YA 2QT0A 5GJWC 4W5WA 1NY6A 3SJAA 3QOFA 1P9NA 2VEDA 1SXJB 1E2NA 2PMKA 3WHKA 5DH9A 4QG7A 3R8FA 5K8IA 4TYQA 1E6CA 4TMVA 1N6HA 2CK3A 2FSIA 2IF0A 5CLLA 1UKYA 3ZD7A 3PXGA 2HDNB 3FMPB 3FMIA 4ZIRB 1UDWA 2JIZA 1OH7A 2WWYA 2DBYA 1XWIA 5HCIA 5KHOC 1YVDA 2GEDA 1KI8A 4IJMA 2PLRA 4V0LA 1KDOA 1P60A 3QSYA 4EPRA 1XCMA 2OZEA 1A1VA 1LY1A 1W0KA 3QE0A 5TXGA 4BLPA 3KJGA 5EZ5A 1NI3A 1II8B 3Q8XB 1XU4A 1YZLA 2EWWA 2AXNA 1E1RA 3UMRA 4BGDA 1P61B 1KO1A 3BFXA 3TSOA 1K6MA 2QG6A 4LBZA 4KODA 4U00A 4QC2A 4CT4B 2QM7A 1T5LA 1VCOA 3QVUA 1J99A 2Q9AA 1Q12A 4ARZA 4URWR 1P9RA 4Q47A 4DLYA 4RD3A 1UBCA 3A1SA 1JPNA 3E2IA 5J40A 2Y8EA 2HT1A 5C1BA 2X2EA 3HYTA 3LQRA 2NO0A 5IDVA 3QXJA 2AL7A 2ATXA 3I32A 3H84A 1KOFA 2W6ID 4CGZA 4E07A 1DAKA 4B74A 3X2SA 4HZIA 2IWRA 2ZSBA 4DJTA 1VIYA 2PEYA 1N5JA 4B3GA 1SVLA 5FI0B 1HY3A 4BWYA 1YR8A 3WYAA 5DI9A 1EX6A 1EESA 1G4UR 4TZ0A 1COWA 4TSFA 3DZDA 1GL7A 4MKGA 4PAMA 1T3LA 3TLXA 1P62B 1ZVQA 1FUKA 4IDHA 4K46A 1IY0A 4M1MA 3UXMA 5LDDC 4FWTA 4KVAA 4GL2A 1NLFA 1N6OA 3K70D 4BPBA 2FFQA 2G1JA 2BCGY 3WHLA 5BN5A 4RCYA 3GLHB 421PA 1RFLA 3W6NA 1CBUA 1OHHA 2IYTA 5DISB 4NDZA 2OG2A 2F1HA 4JYCA 3U2QA 4F4JA 3KKPA 4NZYA 1FW6A 1FP6A 2VHTA 3CRW1 5EQTA 2HLDA 1D8TA 2G6BA 2W2VA 3CONA 1A5TA 1ZJ6A 5A5GA 2NZ8A 1JALA 2JCSA 2V4ZA 4N0DA 4Q01A 1AK2A 3SNHA 2HJVA 3LRPA 3GLFB 1CR4A 1SVIA 2G3YA 1FX0B 3KFVA 3BH7A 4NCKA 4Q9LA 4IXMA 1CRPA 2AX4A 2DR3A 1GL9B 2WSSD 3AF4A 2GBLA 3V4RA 3LY5A 2HUPA 3GEIA 4PQFA 2O8DA 1KY3A 1F5NA 4JJZA 4RKEA 3IHLA 1FP7A 3BERA 2XGJA 1XXHB 1DAFA 2IT1A 5GJVC 5JRZA 1KHTA 2FFHA 2WJVA 5L3SB 3EPKA 1RZ3A 2YNMA 3ZDQA 3U6BA 1Q57A 3FKSD 4ZDKA 3KL4A 2GNOA 3KXLA 1S1MA 4I1UA 1H8ED 1IY1A 2VIIA 3L8ZA 3K0CA 5DI3B 2GXAA 1RW4A 4AD8A 1YR9A 2WIBA 5L3QB 5HE8A 4P4UA 4Q1CA 5HKKA 3CLVA 3WNBA 1KGDA 3CF6R 1AM4D 1Z6GA 2CL7X 3GJ7A 4I99A 4MUAA 1Q1EA 1YJ5A 2N42A 3K70B 2W00A 3G0HA 1W7AA 3ONWA 4HAZA 4R9UC 1KMHA 5KPDA 4F92B 5ANRB 1OKKA 4V0NA 4DT1A 3NKVA 4PQRA 2IXFA 2Q3MA 2QP9X 2DWPA 3TR5A 3TQCA 2H1LA 3H0KA 4O2LA 2GZAA 3E1SA 2PX0A 3KQNA 3K9LA 4OQFA 3TGPA 1D2NA 3KJEA 4KXFB 1KJYA 1RRFA 1UKVY 2J0UB 4PC7A 3K09A 2IF2A 4FMDB 3TR0A 3GFOA 3UIEA 4DLXA 4IXNA 5JSZB 3P26A 4K81B 4AIIA 1Z0FA 5EXPA 1QHXA 2D62A 2OSBA 4QJ4A 2W0SA 3QI2A 4OK6A 3LLMA 1XZPA 1QHHB 3TNFA 2Q9CA 4C4PA 3IHWA 1U81A 1BYUA 1PLKA 1NP6A 2ZI4A 2NPIA 5FBVB 2PX3A 1F2TB 2WWIA 4A0RA 4DBLC 1CR2A 5BQ5A 2ZS7A 4JBXA 2QA5A 1OIVA 2P6UA 4IRUB 4C9BA 2OFOA 3AVTA 2B8WA 1OIWA 4I1VA 5E7JA 5GVRA 1Z6YA 3T1QA 1GKIA 4CDGA 4QGGA 4LV8B 3I3SR 4A2WA 2P6RA 4HSEA 2ODBA 1T0JB 1E2FA 5FBRB 4EUNA 4ASUD 3RRMA 4BLQA 1T8UA 2BMFA 3EPHA 1CP2A 1ZC3A 2E1RA 4FCTA 2J3EA 4L4UA 1PVOA 3RDPA 3A4MA 3GEHA 3FFAA 2VRWA 3HPRA 8OHMA 1SZPA 4Z8XA 621PA 3REGA 2VLIA 4G0NA 1XX6A 2HF9A 2XTNA 1NN5A 1U0JA 3MMPA 3T12A 2KWIA 3WMFA 5LBIA 3W8RA 1TEVA 1HUQA 4ZDJA 2B6HA 3AF3A 5EUQB 2F43B 2QEQA 3TSWA 4A8JB 3T1TA 2FMXA 2WJHA 3CH4B 1VYTA 3K9HA 5H8WA 3A36A 3PQCA 1NKSA 3W8NA 3CKLA 2IHYA 4ESVA 4JL5A 3FVQA 2JDID 4MH0R 1ZD1A 1FTSA 1AKEA 5EE0A 3CRMA 1GAJA 4NP6A 2CJWA 4B2PA 3GCGA 2I1QA 3U3RA 1VG8A 2OXCA 5EXXA 2IEZA 1SVKA 3NVAA 3T61A 4M1TA 3VKWA 1FNNA 5CB8A 1VMAA 2PT5A 1Q44A 4LBVA 1QHYA 3NBZC 1E99A 1NVVR 2GJSA 4EJSB 2RAPA 1EGAA 3QF4B 4WVFA 1NSFA 1JR3E 4KO8A 1EFRD 2WOJA 4P0TA 4MRSA 5JS7A 1DAGA 1BO6A 2DWQA 2G0TA 2X1VA 4NU0A 4DLSA 2FU5C 2ZJAA 5CJ2A 1R7RA 4WZBE 2ZXUA 4YMTA 3I5XA 2X2FA 1MO3A 1MV5A 1WA5A 2CLSA 5FUYA 1TQ4A 2A3RA 5J5CA 2QPAA 3VNUA 5JJIA 3GJ6A 2GCOB 3GLIE 4YLGA 1N5IA 1W4CA 5F9FA 3B1YA 4QJ3A 3QUSA 2FSGA 3NIBA 2ZRHA 521PA 4B6EA 2NIPA 5KYKA 2XAUA 1Z83A 2Z6VA 2PH1A 5FOSA 4OHXA 4DIDA 2EW1A 2VBCA 2WWGA 3P32A 4D0NA 3IO5A 4TWZA 5LD2C 2C99A 3FMOB 3T1OA 1NMZA 3LBIA 1US8A 4BZXA 2JLZA 1A7JA 3SN6A 5SZHB 2QSZA 1G3QA 1ONBA 3NEYA 4II7A 1OSNA 4B3XA 3LXXA 4X8HA 3QXHA 3LW8A 4RD0A 4YMVA 1ZCAA 2YWEA 2J46A 1G17A 3X1DA 2ZYWX 3RS2A 1OB2A 2ZI9A 1VCIA 4Z54A 3TSZA 5JCZA 4NL4H 5HPYB 2FJUA 2EFHB 1RIFA 2IA5A 1OE0A 1N3BA 2BHRA 1CR0A 4PC3A 4KBFA 3L8YA 4FW9A 3QEOA 3AP1A 1SKYE 3RS0A 4JBYA 4Q5IA 2WKQA 1ZM9A 3PR1A 1UADA 2F1IA 3IUYA 3BJIC 1W1WA 2I1VB 2BKUA 2BV3A 3IQWA 1S3GA 3LH5A 4OHZA 1LW7A 4URYR 5FPKA 4C0JA 3AVVA 3LNCA 2ZRMA 3IIKA 4JLPA 1ZNWA 4NYJR 1GZSA 5KOYA 1W44A 4KLNA 3AVXA 4HATA 2XB4A 3AKEA 5A0FA 1OFTA 2OM2A 4W5HA 2J0QA 2GAAA 1AZSC 3GJ5A 3THWA 2VQSA 4NHOA 3B82A 4ESHA 1W0JD 4LPKA 1N5LA 4GP6A 4HDOB 4DLVA 1DTSA 2IK8A 1E2PA 2D74A 2D7CA 1NIPA 3HU3A 1F2UA 2QMUA 2VH5R 3H4MA 3KKNA 1TUIA 2ZREA 4L9WA 1E98A 1G20E 3PEWA 2XXAA 4OBEA 1GIAA 1N2CE 3EC2A 3IBGA 2ONKA 2VO1A 2J0SA 1NVXQ 2WICA 3KUCA 1QF9A 1E96A 4OQNA 3VR6A 2AK3A 4EPXA 1CXZA 1HYQA 3GJXC 1E9AA 1HT2E 2KI5A 2NTYC 1Z22A 3B78A 4HZUA 1B23P 3K9GA 5JWRA 3HR8A 4QJ5A 5AUQA 2IS6A 3SYKA 5BN4A 1FFHA 5JI2E 2QU8A 4JL8A 3VHLB 1J7KA 2KJQA 4JLBA 4PPGA 1WB9A 4HAXA 2C2HA 5EE5B 1T5IA 1M1YE 1HE8B 1TUEA 3KUDA 2GVZC 3BB4A 1SGWA 2Q6TA 3CNNA 2ZRCA 1ZP6A 3BK7A 3BORA 3KJIA 4V0OA 1LF5A 4M22A 2O0JA 4ACBA 3PJRA 1BYIA 3RVBA 2J1LA 3EZ7A 1KK3A 4OI1A 4TLAA 3I1FA 5A4JA 2RH5A 1G41A 2QTHA 3L0OA 2OE2A 1S9DA 2GAOA 1G7TA 2OUKA 3BGWA 5EE9A 1KSJA 3RWMB 2JLRA 2GEVA 1TTTA 1QRAA 4ON9A 3U60B 4IDNA 5CM9C 2BEJA 1CU1A 2CHQA 1IM2A 5DN6A 4HLDA 3RC3A 4RZXA 4A1FA 4BEJA 1MABA 1M6NA 1KY2A 2WOOA 4LY6A 3RANA 1FOEB 1UEIA 3T5DA 3TW4A 5J4YA 2BEKA 2Z4SA 3A1WA 3PG5A 2CNWD 3GJ0A 4CW7A 2Q9BA 3AVUA 2AK2A 4QNMA 2ZRLA 3HDTA 3NC0C 3B9PA 1P2SA 3B1VA 4KBGA 2JLQA 3DVLA 2CDNA 4EPYA 2Q21A 1U94A 1KZ7B 1S96A 4XSHA 3SFZA 2V9PA 4LBWA 4ZCIA 3K09C 1XPOA 2JLYA 1RJ9A 4LC0A 1WQ1R 3LV8A 4RCZA 3PITA 3TKLA 5H1YA 2CBZA 2ZR9A 2DFLA 2CE7A 4Q4JA 3SE0A 2FPKA 1HA3A 4B3BA 4DEYA 2GZDA 1PLJA 3BAFA 4Q4AA 4QBIA 1Y3AA 4IFBA 2QENA 5JLJA 2ZE5A 1QVAA 1YE8A 3B1ZA 4HLQB 1OW3B 2IYSA 3B5JA 4Q19A 4EPTA 4XTRA 1NBME 2EFEB 3DOFA 5EZ6B 1RKBA 2J9RA 1N6KA 3KQHA 4FINA 4NTZA 5FFMA 4CT5A 4G5OA 4OQMA 3FKQA 5E95A 3QBVA 4TZ6A 3PIRA 2O8FA 5IK2A 4IEIA 5AK0A 4Q7LA 2F43A 2V1XA 2YV5A 2FV8A 4WXPA 1W36D 1Z6XA 2ZYUX 3DMDA 3U44A 1ZAKA 3LBHA 4LDJA 3X1WA 4ZO4A 4UQOA 2Z83A 2B92A 2QAGB 3GLHE 4QBHA 5L8VA 5FTKA 5KNCA 3QIAA 1XD2A 2BM0A 4D0LB 2FGKA 1SVMA 3ZZ0A 4FCVA 5HR5A 4PXAA 1WBBA 2WWXA 4XTCS 4LJ8A 4EQ6B 1OFHA 2ECKA 3QENA 4HAVA 4D4LA 1G9XA 2UVQA 3U4QA 5F9HA 4B76A 1IN5A 1QVRA 1VG0B 2J45A 3F5FA 2R9VA 3NDPA 4XIGS 4TMTA 3AF2A 1G7CA 1NF3A 3O47A 1KYIA 1GNRA 4JVSB 5D3MA 5JJKA 4TYPA 1NNEA 2XJ4A 5F2EA 2IC5A 2GXQA 3KFXA 1OXTA 1W4AA 1VCMA 3OIVA 1XBTA 1XDBA 2GCOA 4Q7KA 2F1JA 2A78A 2BBWA 2GRJA 4M9SA 2OXRA 3W6OA 1XXHE 1S3SA 1SXJC 3CIOA 4JBWA 4MRPA 3ADKA 1PUIA 1H65A 3QEJA 1QHSA 4RD1A 1DAHA 2KBFA 3AQ4A 2R2AA 1JECA 4B48A 1CJUC 2ZJ2A 2JJ1D 3E70C 4Q02A 5FR2A 1IOZA 2AHOA 4B47A 4PQYA 1MR3F 4XJXA 1GSIA 5J4VA 3K53A 1L4YA 3AUXA 4R2HA 4DKXA 1II9A 5KDLA 1M7GA 5KSYA 5FL7A 1XEXB 2C04A 4NH0A 5SZJA 3SR0A 3T06B 3ZIAD 1NVWQ 4JLNA 3KQLA 4MYTA 5DIFA 3L0IB 4UNRA 3ZQJA 2G1KA 2ZR7A 3MJRA 3PEVA 4JKYA 5JMTA 4UNNA 4DDWA 5CYPA 1KI3A 2FGJA 2RGCA 1CJTC 2VSOA 3EARA 2H8KA 1PV4A 3DKPA 4LHZA 3D7MA 3DO6A 1ETUA 2A9KA 4LWZA 4EFNA 2IYZA 3HU1A 5FOXA 2XTMA 1EFCA 2NG1A 1FNMA 1XJCA 3KKQA 3FB4A 1GRRA 1T9HA 1C1YA 2ZVQX 1VG9B 4DLUA 1KNQA 1NJGA 1P3JA 2ORVA 3VR1A 1XP8A 1XD8A 2IX3A 4A6PA 3DKVA 4WOPA 2HYDA 2DHRA 4PHFA 3ZQ6A 2XNSA 1QZXA 4W5JA 2C9OA 4WZAE 4LOAA 4EIWA 5FPYA 1YHNA 2OFWA 4HAUA 4KFRA 1S0UA 5FTLA 3LFUA 1AKYA 4PTLA 3ZGXA 1W4BA 4LUCA 3GPLA 2NZJA 4C0AC 4TL9A 4LCBA 2FF7A 1KJWA 2B21A 2VYFA 2QAJA 3O8DA 5EE3A 1GRNA 4Q7JB 1VHTA 4D80A 3ZD6A 4ZI3A 2P0EA 5JBQA 2YC2C 5K8TA 4UNPA 4L8GA 2OAQ1 3G5UA 4PPQA 3Q7QA 4URVR 1I4TD 2JLUA 2HXSA 1VKJA 4N3NA 2VSXA 4DXAA 121PA 3UMFA 1L2TA 4OHYA 1RYHA 2RHMA 4HB0A 2GCPA 4TYWA 4CRWB 1Z0JA 1W46A 3LX5A 4UKDA 4TT3A 1N6PA 2O8BB 4BFSA 4NONA 4D26A 1HT1E 3N70A 1J70A 1VIAA 1ZIOA 2R6CA 3GLGB 1CJMA 2WM9B 3EIHA 1OXSC 2J7PD 2VA8A 4ZI2A 3CRVA 1WDTA 1OYYA 5G53C 1GTVA 1XFAA 5CK4A 2BJVA 3QKTA 3QF7A 1N0WA 1PJRA 1KK2A 3GFPA 4JLAA 3QXCA 4TQAA 2XZLA 4AURA 1F6BA 1ZMXA 4D4MA 5FL3A 4US1R 1NLZA 4RD4A 2ZJBA 4AYTA 2ZRBA 1XCGB 1II0A 4NYJQ 1E2DA 2DPXA 1RYFA 4LHWA 1Z6AA 3THYB 4MDFA 2GWHA 3FMFA 3SZRA 2HXYA 4QKQA 4FN5A 4TYYA 3VFDA 4BASA 1MRNA 2IYRA 4NBSA 3B7GA 4XVUA 1YR6A 2IYYA 1TPZA 1RC8A 4P33A 1R5NA 3KZ1E 5C46F 3MUFA 3LO5A 4A0HA 3RRNA 4QGAA 1IN4A 4Q7MB 4KITB 1AN0A 2BBTA 4XD7A 5CIWA 3K70C 4Z1MA 4QM7A 5FH9A 2I3BA 4HUQA 4F4CA 1OH8A 1QG2A 2XTZA 4NCHA 2LKDA 2O0HA 3N5CA 1BMFD 2ZRGA 4IDPA 2QP4A 4RFSA 1HEIA 3SQWA 4BZPA 1Z6TA 4Q1DA 3AVOA 3U6KA 1Q22A 3C15C 2FX3A 4B3DA 3H86A 3SJBA 3KX2A 1I2DA 2H92A 3DM5A 2UZ3A 2XITA 4BFYA 2O8EB 2ZETA 2EVWX 3MWYW 1M8PA 4D6PA 4CYMA 4EDHA 4JLDA 4RVCA 1ODFA 1KK0A 3IILA 5G41A 3Q72A 4IW3B 4Q1BA 1XB2A 2HV8A 5FUWA 3AUYA 1E0KA 1WCV1 3MG9A 3AVQA 3QVVA 5KSOA 2QSYA 3MWLA 1D5CA 2V6IA 1KO7A 1XJQA 3WP0A 1JR3A 1Y63A 1G5PA 1KJZA 1QG4A 2WBLC 1T8TA 2E87A 4KLZA 3JZMA 1P6XA 3FYHA 3C7KA 2DY1A 1E32A 3DOEA 4EAQA 4FMCF 3OFNA 1Z3IX 4OHVA 4P4SB 3T15A 5FTJA 1OH6A 3GLIA 1RVDA 4A82A 1UKZA 4BLRA 4PAQA 3THXB 1GNQA 4WXRA 2QN6A 3ND8A 1K5DA 1EFTA 4M1YA 3AKYA 2BBSA 1DOAA 4P31A 5DYIA 4B2LA 4YXWD 3ICQB 5AJVB 4IDQA 2FOLA 3QG5A 3NHAA 3RAPR 3OIUA 4DLWA 3V00A 3PEYA 1JPJA 4CEIB 2WPDD 2Z0MA 4JLOA 1M7BA 4JVNA 4A8JC 4U02A 5TDHA 5JECA 4A15A 4Q18A 1YKSA 4DZZA 4PZLA 2R6AA 2PJRA 1E2KA 2GXSA 3B60A 2HJGA 1WMSA 4DHEA 1Z28A 3CB4A 1E9BA 3CPHA 2CLCX 3IEUA 3QKSA 3IQXA 4LI0A 3BE4A 3QKRB 2A5FA 4V0KA 1NN1A 1GITA 1ZNXA 5K8UA 2IBMA 4MA4A 3I5YA 1G18A 5AUOB 2OCYC 4PSVA 2C95A 4Q4LA 2BDTA 1ZRHA 2JJ2D 4LJYA 1Q1BA 2BOVA 4BLOA 4C0HA 3SJZA 4F93B 3EAQA 2DFTA 4FWIB 4Z51A 4EJSC 2HCBA 3D3QA 3TUIC 1G5RA 2GK6A 4GPTA 3WYGA 2EFGA 2ZJ5A 3AV0B 1XCPA 3FHCB 3SJCA 5BWMA 5JEDA 1IN8A 4TTRA 4YC7A 5CDFE 2VSFA 3QPWA 4GMXA 3R9WA 1Z0DA 2XOKA 2P5TB 4V03A 1Z08A 1LVGA 4MRNA 1FL9A 1ELOA 4C7OB 2IWHA 2XZPA 1X8KA 1ZNYA 4TMZA 1U2RA 3NH6A 1R10A 3CWQA 1FQKA 2QE7D 2KB0A 2Q3FA 4A92A 3QKUA 4JSYA 2V8OA 4M8NE 2ASEA 5JS8A 3W34A 4ZKEA 3J81k 2JLVA 4DDTA 3WNCA 3OE7D 2PEZA 4QBGB 3BS4A 3KXKA 1KKMA 5EP4A 4PC6A 5KTYA 1KI6A 2ZUDA 2XSZA 3CBQA 1NL3A 3Q5DA 4PR0A 2W2XA 1JJVA 1Q0UA 3LBNA 3UPUA 2WWWA 1DG1G 1CF4A 5JEEA 1E2IA 4MGKR 4V0ME 2RCNA 2ZI5A 1OF1A 1ESMA 1P4SA 4WZ6A 3B13B 4DLRA 2ZRKA 2ONJA 3UWKA 4A0FA 3A37A 3SHFA 4E09A 2YWFA 4PPNA 3R9XA 1EWQA 2NQ2C 2WZQA 1T91A 1OPXA 3FDIA 3P27A 4ZKDA 1OIXA 4X8OA 4D4JA 3ZS9A 3CPJB 2J87A 3MGCA 4EFLA 3CF2A 2PL3A 1OFIA 5DHAA 4CVNA 1DO2A 3M1IA 5TB5A 1EFHA 2BKEA 1HURA 4DSTA 5SZIA 4DUGD 3OIYA 1N6RA 3K0AB 4LRWA 5JFGA 4QL3A 3PUVA 1TX4B 3AF1A 1R0ZA 2FN4A 3H2YA 1KDTA 3T1VA 1RRPA 3EC1A 2RGDA 1KSFX 3IDQA 3OEEA 5CITA 5E7MA 4BLSA 3X1YA 4MUBA 4MYUA 2W6JD 1R0XA 1VTKA 1DO0A 2PCJA 4Q4HA 2ZS8A 5J4KA 4KSCA 3IBYA 1SQ5A 1ZD8A 3KTAA 2MSCB 2WJJA 4WAUA 2GA8A 1R6BX 3AP2A 1E0JA 4CEHB 3IO3A 1P2VA 1N0UA 2KSQA 4TMXA 1G8FA 1E1QA 1N5KA 2F6RA 2YOFA 2ZIAA 5CB6A 4JS0A 3L2OB 1E0AA 2OBMA 1SXJA 3KQUA 1DS6A 2BMDA 2W83A 4QHTA 3BXZA 3CF0A 1M34E 2YINC 4NYMR 3SI7A 2P2LA 3I61A 1D2MA 1GKYA 4LX0A 3K0FB 1OXVA 4ZIRA 2RKOA 2DFNA 2CVHA 4FXPA 2G9NA 5KSZA 3L82B 2TMKA 3CW2A 4GOKA 221PA 2X8AA 1MKYA 1D2EA 1SKQA 2AKAB 3VHXA 2FH5B 4XWAA 1VG1A 2H5EA 1EX7A 3Q9LA 1II8A 1VHLA 2GJKA 2WHXA 3CR8A 3Q3JB 4GSYA 3KKOA 4PHGA 4JLVA 3THYA 1X6VA 3GFTA 4HUTA 4W9MC 1G5TA 4AKIA 5FBLB 2QQ0A 3V9PA 4I81A 1AS0A 2ZPTX 5DHFA 4CEJB 3OEHD 4Q1AA 4KAXA 2D06A 4BEBA 1NBMA 3N2EA 1IXZA 2QGZA 4G3XA 4LYHA 2C78A 821PA 5DGXA 2BJWA 2QROA 2OCPA 3EIEA 4BZQA 2EYUA 4M4SA 1E94E 4MRRA 3NXSA 2QMOA 1E2EA 2OCBA 3PUYA 3EG5A 3I4LA 3WMGA 1H8HA 4QBFA 2QBYB 1GRQA 2VF7A 4PO9A 2R8RA 4TT3D 1KDRA 2OLKA 3W5IA 5JCPA 1I4DD 4KFTA 3ZZUA 1BIFA 4Y0VA 3BIFA 4YONB 1NN0A 2A30A 2A5DA 2G77B 2V7QA 2Z4RA 2CK3D 1CJKC 2ZVPX 5BN3A 4C0LA 5KU1A 2VP5A 2JIZD 2RGXA 4FMDF 4GMDA 3GLHA 1ZU4A 1TF7A 3KXIA 4KI0A 3ZVNA 1CTQA 3LQQA 3RNLA 1YZUA 2CXXA 1BOFA 4H1UA 4BECA 5KDOA 2OFXA 3SFVA 1K5GA 1QHGA 1FMJA 1I4LD 1W0KD 4G5SA 2H16A 1TAGA 1TNDA 1YR7A 4FIDA 3RRYA 5B30A 4AKEA 1IN6A 2ZYTX 2IYLD 3NDBB 3BD9A 1ESNA 3UATA 1E1RD 3GLFA 1FX0A 2EU8A 3FHOA 2B8TA 3C41J 2RGAA 2IYXA 4DDVA 4H1VA 5JJLA 3C5HA 5H68A 3ZVLA 1E2GA 1Z63A 3ECCA 5GVSA 2OCAA 2W0MA 4IOMA 4CZ2A 2AN9A 3VU9B 2QTFA 3WBKA 2ZR0A 3BWDD 1GNPA 4GZLA 4LC1A 4A9AA 1UJ2A 4Z1MD 2YOGA 3RSOA 3QY0A 1E2HA 1XXHA 3AKDA 5L3SA 3KQKA 3PVSA 1DAEA 4XOIA 2W6IA 4LHVA 4RSGA 4BFXA 4U5XA 4A4DA 4L16A 3QNUA 3CO5A 5F98A 2IUTA 3EZFA 4JT4A 4KVGA 3RLFA 1XEFA 2ZSAA 1COWD 4MKFA 4TSFD 1T3SA 1DAMA 2EFDB 5DI3A 5FBQB 4ZCLA 1W47A 4QFMA 5L3QA 5EJEA 1DADA 4OQLA 3SU8A 1M2OB 2AWOA 1RPZA 4XWKA 2P67A 3LA6A 3CH5A 2QAGC 3I73A 4TQUS 1OXUA 3IIJA 4B44A 2WMOB 4US0R 1U90A 4OL0A 1YQTA 1OHHD 3LW7A 3CNLA 5BYJA 5LD2B 2ZRNA 2OBLA 4TMKA 3CRQA 4HB4A 4XVQA 1SULA 2MMCA 2GJ8A 4MDEA 5JRJA 2HLDD 1QDEA 2IUSA 4O3MA 4TLDA 4PFSA 1GL6A 4MRVA 3VNVA 2QMEA 3GLGE 2HYIC 1Z0KA 2J7KA 4C0KA 1ZCBA 4BLTA 2R44A
chains in the Genus database with same CATH superfamily
1ZK1A 4HN2A 2J0UA 4OY3A 2SHKA 5IM5A 2DHDA 1I0ZA 4BQNA 5MN6A 2I76A 1PVDA 5DSZA 2PX4A 4IEEA 1ECPA 1U1DA 3HKCA 3K2QA 1ECLA 1INLA 2UUOA 3C8UA 1WAMA 3G23A 4R4JA 4FIZA 4HLCA 1A71A 1D0IA 1U0RA 4YRDA 3DPIA 1ZUHA 5A3QA 5JPDA 3V97A 1Q0LA 2ZJZA 4P3PA 3N8IA 2B4TO 4IZIA 1CULC 4HUJA 4KV9A 1Y8QA 3M0EA 3LT1A 5AK3A 2FPLA 4OLJA 3GMIA 1LD3A 4FW8A 1EJ6A 2PGDA 2OOSA 3TSYA 2ZSUA 1FF9A 4RZUA 1RXUA 5EL0A 4HQLA 4MVJI 3KYDB 5U4QA 4BMDA 4Y9SA 2ZIXA 3L92A 3MELA 3PCRB 1KDZA 5MFZA 1YZGA 4PRLA 2YIDA 3NV7A 4G65A 1Z37A 1Q0PA 1DJMA 4ZCQA 4ZARA 5GPBA 1G6KA 2VL7A 5KIAA 3P7MA 5EJIA 1CE8A 1C0PA 2REXB 1KAMA 2VK8A 2NW6A 2YWBA 4RVDA 4ZT4A 4B83A 3DDWA 5KREA 1NMYA 5GWXA 4YO8A 1KBQA 4OSOA 2GZHA 2IU6A 1LJLA 1HT0A 2R8XA 5CIQA 1PJ4A 1X7HA 4IXDA 3WYFA 2HXGA 5FWAA 1G7SA 2C57A 1T3HA 3MD0A 4F5ZA 2BWJA 4RULA 1QKJA 3W5UA 2VTKA 3LK7A 1OKKD 1RTTA 2NGRA 3PNSA 4I1OA 4WFIA 3CEJA 4BPRA 5A4KA 1M8JA 2HRBA 4Y7CA 4B6OA 1Z6ZA 1A9RA 1M6YA 1HSOA 1MMFB 4GOJA 1RLJA 5T67A 1P8AA 4EEKA 1S3FA 1WLYA 4NFYA 1WR8A 2FSFA 3LWZA 1K7XB 2CXHA 5JQGB 4E5KA 1YFKA 1QC5B 4BWYA 2J4FA 1VRWA 1C9JA 3SM3A 4LVCA 1XLUA 3VI4B 4ZHSA 5L4NA 5AVRA 3ZTWA 1SU4A 3NHYA 1Q21A 1TT5A 2P6MA 3TH5A 1K0UA 2GYVA 3OSUA 3P2MA 4A16A 4M46A 1Z0UA 4E1VA 4JVLA 2WK1A 3IUBA 4B7AA 2EW8A 2QTZA 1Z47A 1ZZEA 4MYDA 5IXSA 1TLFA 2OGWA 1E5QA 3P9CA 5E4YA 6ABPA 3IVXA 3PYXA 1F4VA 1SEPA 4KU4A 3TVTA 5KPJA 4FCWA 2ZYAA 2NZ2A 2V6JA 4CHGA 5BYKA 1L4BA 1SG0A 4PLYA 5J59A 3HR4A 4J43A 1TF2A 4WACA 5E8RA 5I4IA 3GMTA 2WLTA 2A0XA 4IM7A 3WLJA 2QY6A 1L8LA 2AYXA 3WKEA 4EJSA 4G8DA 5DTEA 2BMJA 4TL7A 1NFFA 1ID8A 3QF4A 3C3BA 5JNLA 2NSJA 5C8XA 3AFIA 4Y2UA 2A88A 4CE6A 2FUKA 3D7RA 3GOQA 1SCUB 2VZ9A 4DC1A 5KC9A 4D25A 3M3HA 1HRKA 4ZZ0A 1OH5A 4MX8A 2D1QA 2GESA 4BEVA 4L28A 3RB8A 1VBFA 2WY2D 4E7OA 2YIJA 1WB4A 2H1IA 1XDSA 4K87A 1G0OA 1QVWA 2D59A 3QOYA 3I9LA 3RKSA 2VHJA 4B43A 1JHUA 2ICAA 1JHXA 1L7OA 4ASUA 1KMIY 2EP5A 3K1YA 4D2IA 4PGHA 4ID9A 5FHQA 4X9XA 4RDCA 1CDDA 5IANA 3QEMB 1CJSA 2PKWA 3HFJA 3DE1X 2NXCA 1U2DA 3OQPA 3NWJA 1D2RA 2PKEA 2WWRA 2Z3VA 3L07A 3OPVA 4MVJG 4WA7A 3RK1A 4AUMA 3A70A 2ZBUA 4QGBA 4RHCA 2PAAA 4GGMX 4AKGA 2BJHA 5K2OA 3GJ4A 2XCUA 3E48A 1PG0A 1XMOB 5DU2A 3WYEA 3UJ7A 2P68A 4C87A 2GF0A 1NMSA 2PUJA 3EXG1 4Z0PA 1M1NA 3W3AA 5EEHA 1UAAA 1QJCA 4MVCA 4B82A 4CM5A 4KKVA 1FMCA 3IX7A 2X19A 4MVJD 3D2CA 3OU6A 4JL6A 1LRLA 1IAQA 1NQUA 3OPYB 1DZIA 2EJVA 4O0MA 1FTGA 3RVJA 4CMEC 1FJGB 5DNCA 2VP0A 1J90A 4ZHQF 4KREA 5K3BA 3A6ZA 1JTFA 3DQQA 3M81A 4KYUA 1AY0A 3L0SA 1CG6A 2Q8QA 2WM8A 4YJHA 2POQX 4AK9A 1XZIA 3DZKA 3ND6A 4Z7JA 4UDOA 4MRMB 1M8FA 4BKRA 3ZX5A 1CS4C 1K9VF 4TQGA 2H4WA 3GLKA 7ADHA 5BY2A 2CE2X 3ICPA 5EHIA 2E9SA 4Q05A 4BP9A 4NYMQ 1P4GA 1UPTA 1QIKA 3BIJA 5FXMA 3WHIA 5HIKA 1B73A 4OM7A 1IQUA 3FDXA 1RPNA 4PX3A 5AKIA 3KT0A 2JASA 2RH8A 3GVXA 4BBPA 4LHXA 3I9V6 3OX4A 3ABQB 4DMGA 4IWYA 2I7XA 3H83A 4OJKA 1U28C 4B46A 2YMLA 4GBGA 5K6TA 5C18A 1CLUA 1GPWB 3RVNA 5FUVA 2OR3A 1QCZA 3COSA 3GGGA 3P1JA 1SB9A 1AXGA 1WRBA 1P9LA 3F7OA 2ZIUB 4C01A 4IFEA 1J2JA 1KZGB 4DXDA 5HA5A 2IXTA 4K88A 3U7EB 1H2ZA 3H13A 1S2OA 5ALKA 3LHDA 5K3FA 1C0LA 2NYAA 3IPYA 3PBKA 3QWFA 1AO3A 3VZPA 3BRWD 2EKLA 1CB7A 1TRKA 1DXHA 3RS4A 2JI7A 4NG5A 4W6ZA 3AGQA 5FF9A 4HNTA 1RHKA 4JX8A 4CIDA 4LCJA 5I8WA 3Q98A 2X3UA 3Q9UA 5C5EA 1THMA 2XF2A 1YR3A 1KPGA 3BGVA 1WZUA 5KX5F 1MBZA 2QQGA 3OZXA 4F86A 1T0HB 2QRNA 4V1CA 1HOXA 5K0EA 1X1RA 3HR7A 2Y3IA 3FH0A 3IYLW 4QUGA 2E48A 4RY9A 2LWIA 4TWJA 1G291 4UU1A 5B2ZA 1L7MA 1N2XA 3UN1A 5BQ3A 4CKYA 2W2OA 2REOA 4PHTA 3EZXA 4CODB 2VHQA 4G5YA 5DTMA 1L5MA 3L18A 3DGFC 2EKQA 2J09A 3QLUC 2Y1WA 3G82C 1H93A 2G88A 1CKEA 2OV2A 4U7WA 2V4MA 5AVTA 3GG9A 4A6DA 1JB1A 2XH8A 3OKFA 5AKXA 1HETA 2ZQZA 1JPUA 3QPUA 2G5GX 2AMYA 3RU2A 5EJ8A 4AXXA 2B4YA 2BY4A 2Z8XA 2NO1A 2XKJE 4Q3EA 1ZEJA 2QYOA 2HF7A 3D8NA 1QANA 2V7QD 3Q8WA 2R8OA 1JRLA 5AI0A 1SIBE 3OUZA 4J7AA 3N3AC 3ZI4A 2VJAA 1X7DA 4BX2A 1KWGA 1Y1LA 1PEKE 3A25A 3GXOA 3EPLA 3LOPA 1NRXA 2XLBA 1DBSA 3TLEA 4B5LA 2ZBRA 3DMRA 4LJLA 5JADA 4IOLA 4HDMA 5AH0A 2V97A 4WINA 4EW3A 2IHUA 3LCVB 1WPXA 4EHKA 4Z4CA 3SWWA 5CM2Z 4V0MA 3HDYA 3EA0A 3DWGA 1QFMA 1GNTA 4YP7A 4D9IA 1KU0A 1W48A 4ECEA 2PVCA 2EYQA 1BN7A 2CMKA 3BMCB 3ZG6A 2O5RA 1HG0A 1MA3A 1ZIXA 5F98A 3UF0A 2FWIA 3TW8B 4RDXA 2I8LA 2ZAOA 3TRKA 1XMSA 4HEJA 5FOUA 2VP6A 5E7QA 3GJ8A 2EGHA 5AM1A 2BFCB 1GVHA 2B4QA 3VZBA 5KEIA 2EV9A 1TKBA 3TRFA 2IYWA 4JJ4A 1A88A 2PS9A 5EMNA 4PZCA 1CYEA 4GECA 3V46A 3CT4A 4MPJA 4LRXA 3UT0A 3GNSA 2LUOA 1ONPA 5CLQA 3FHTA 2BI4A 1QB8A 3WLRA 1E9RA 2AFHB 3MNFA 4RXTA 1LFAA 2WSMA 2IV7A 1DV1A 1WNTA 5JVDA 1I30A 4AG5A 4HTFB 1DHTA 5CDGA 2BFEA 4LNUB 2JIMA 4M1KA 4OREX 3EZYA 1XQWA 3UB2A 3UJ8A 4Q4CA 4K9OA 5M34A 1Z3CA 4ZU6X 5IJAA 4QBTA 2OT3B 1SHTX 1NXXA 2QLNA 1AIPA 3GUVA 3O82A 1NVKA 1KYYA 3DV9A 3GRPA 4GMFA 3AY7A 5HYVA 3A14A 3LT4A 1GLVA 3CLKA 3LPCA 3DFIA 3Q11A 5KYXA 3L77A 2HMWA 2BKXA 3C6XA 4GXQA 1EFVA 4HYYA 3V4PB 4BFCA 4Y1EA 4TN1A 3MTJA 4YWJA 4DWVA 3FSGD 3STHA 4CQLB 3QEAZ 1B7GO 2VT3A 3I04A 3MWKA 5DIZA 4IIJF 5BW6B 5A6SB 3RVPA 3LF1A 2JCBA 4PSAA 4DUPA 2DQZA 2YRXA 3MJFA 4DUYB 4ZJYA 4DJ5X 3R5FA 1M34A 2N1BA 3USZA 1TMGE 1I1HA 2Z2YA 4BN4A 4DREA 2EIHA 1FXWA 2VZ0A 3G2JA 3MA0A 3DUFB 3MEQA 2O7RA 5BSFA 4PZYA 1GM5A 2PO5A 5JMWA 3NIDB 5AW1A 2E21A 1XC7A 3KSRA 2XBLA 4OOEA 1K8RA 5DN6D 2AXPA 1EB9A 2YZGA 2G1UA 4NBNA 1V8OA 3LDAA 4OF4A 1OGIA 3DE5X 3JAWA 5EG5A 2FPPA 1G2OA 1WXXA 3KJNA 2WWHA 4PGGA 1APBA 2QAGA 5T6BA 5KKAA 1C0KA 3AOGA 3WLIA 3EC7A 1DRJA 1VCNA 1AA9A 1OAOC 1VPLA 3RRXA 2JAUA 2CNWA 2GPAA 1AGRA 1U3VA 5JSKA 5C81A 4JHXA 5B55A 5B7PA 3SBEA 2JFXA 5HUQA 1U7WA 4H3KB 4MCIA 3ZV7A 4N39A 4YCBA 3DOCA 4AICA 2DAPA 2X41A 1N3YA 2PFKA 4GLJA 1X86B 2BGJA 4PLWA 1FMTA 1MDBA 2V7GA 3P5BA 1KP3A 1KAGA 3ANYB 3DP9A 3DWIA 1AUOA 3KO8A 1NMQA 4Q1VA 1BHSA 4LV6A 1ZM7A 3O8QA 5ERYA 2UXBB 4MV1A 4FHFA 1PK9A 2E4YA 2OXTA 1A4IA 1SQ0A 5LB4A 1AVTA 4LDZA 2QUAA 5HZKA 3TQFA 5GMOA 1JHYA 2GILA 3K9CA 3ZE0B 5EVCA 1WULS 2HCTA 2L0XA 3HM2A 4LECA 3ZLJA 1KYTA 1EXWA 3I72A 3OHPA 3AL2A 5FJJA 4FGUA 2F9LA 4RJLA 1ORVA 3PFCA 3IT0A 4HAYA 3ZBUA 1TVMA 1XNQB 2AJTA 1TPYA 5DEOA 3TDNA 1OH6A 1RJWA 5F3WB 1POWA 3SMQA 2OLJA 1LK0A 3RUDA 4HWRA 2HQOA 3NBFA 3G1TA 4EKNB 4BOYA 3IP5A 1QO7A 4QOJA 1TECE 4BNZA 2PQ6A 4CLRA 3P97A 4R69A 2GPBA 1XVLA 2XGGA 3ZLTA 3G3EA 1MABB 3WOVA 1RWNA 3M1AA 2F67A 4K6HA 3KDAA 4FI3C 5K9ZA 3OMWA 1I13A 3T1HB 1H9AA 2H52A 1L8QA 2J41A 4L78A 721PA 2Q0HA 3K05A 2Q4EA 2ZXEA 3IVAA 5IXYA 2ZR8A 5AJZA 1MVLA 3PSHA 4F38A 4LZJA 1WXFA 4DQKA 1FUUA 3ZH9B 1C7EA 3PC3A 4RTSA 5CLFA 3FPBA 5E1MA 1HQDA 1AQIA 3WLNA 1B15A 2ERXA 3ZXUB 4AWBA 4P54A 4BEWA 2Y68A 3EA4A 1YZHA 4MJ7A 3GJTA 4H7EA 1SELA 1ZBDA 3RYTC 2I4IA 1U3GA 5B3JC 3DMGA 1MH1A 1BS1A 4L8LA 5IBCA 1L5LA 2E4UA 1JEQA 3WLPA 3RYHA 4BKQA 3EOAI 3RAGA 5JZVA 3EHEA 4GZ6A 2X77A 1P0MA 3MC1A 2P79A 4IXTA 4Q4AB 5LQUA 1PNQA 2HI0A 2QTVB 3VOAA 3NHJA 3VR5A 2LV8A 3U7IA 2JFNA 4RD2A 5I9NA 4WFKA 2RGEA 4BO9A 4JKIA 2Q5JA 4BRSA 2P6NA 3ST7A 1BOOA 3ELDA 4I5EA 5JUWA 2YFKA 4W1QA 2CLOB 4MNTA 4A8HA 1DKLA 3HL4A 3C43A 3TSCA 4RQAA 4RXUA 3TTVA 5EWJB 3Q6IA 3WLAA 3T34A 3V7YA 4KPEC 2ZSFA 2QI9C 3SBXA 3RVLA 3INRA 3REQA 2VP2A 1F5SA 1MB4A 4RQTA 3OSZA 4Q3NA 1CX9B 3ADBA 4ZU1X 1SQFA 4YP0A 3L9XA 1YKFA 3WNDA 2C7OA 3FWZA 5FL7D 2R751 3F7NA 4JSTA 1EX9A 3I4FA 2J9ZB 2QD5A 1XDGA 2O7VA 1SHLA 3PLRA 4ZEWA 3TLBA 1XZLA 3C3XA 1JAIA 2F7SA 1TYCA 3VPFA 1Z7WA 4FHZA 3VSCA 4HDRB 3M9XA 4ZWNA 1LBQA 3U17A 4YUWA 3ONFA 4TS3A 5BR4A 1ILEA 1KMCA 1GZ5A 2JFHA 4QT4A 1O58A 4FZ3A 1V4BA 2PJUA 4P38A 4KVFA 2AZDA 1V1MB 2B1GA 2BF4A 2W37A 3OPXA 4OQXA 3PYMA 4ZDWA 2Q45A 3ADCA 1BQ3A 1Y6RA 1O8CA 1SK9A 2P9EA 2PCLA 1RQ2A 3CFYA 4O08A 3VSBA 2X8JA 3TX6A 1Z8FA 3AESB 3Q2OA 4MIYA 4UC0A 1FFXB 3CZAA 3L0BA 1FMLA 2C9ZA 1ZJYA 3EXFA 4O4HB 1YL5A 2GI4A 4EG7A 4FU0A 2Z98A 4HGPA 1DOHA 4J9VA 4U3JA 1G4HA 3FWPA 1K8QA 4PSUA 1JA1A 2IPXA 4CF3A 4YS6A 4A0QA 5KSPA 2QUZA 4R71A 4V02A 1EM8B 4X3CA 3OCWA 5T4EA 1JKXA 3AKCA 4ZVQA 3MN1A 4FYYA 1S3IA 1K63A 2XNDD 3RROA 3EZ9A 3E9ZA 3GJQA 3EWSA 3F5DA 4CMEA 4ENSA 2QOEA 2P78A 1P1RA 3N7TA 2A5GA 2FG5A 1I2MA 1U7OA 2BMVA 5EXDA 5J4LA 4AJEA 1I3LA 4DLPA 2I6UA 4BGEA 1XTKA 2VJOA 5LZ9A 2ZKLA 4RFVA 4PC1A 2QF7A 1VQ1A 4WBXC 2IUUA 1LVHA 4IHJF 2FUG6 4N0MA 3TXXA 1IBLB 1OXMA 2BEWB 4LJ4A 3K0SA 4RTMA 1G6OA 3WLSA 1EVJA 4ERNA 1SUBA 1PG2A 1RRCA 3I01A 4PHHA 3UT5A 1GFIA 1GGFA 2PQ2A 2BGIA 3K0BA 4CKCB 4ZAYA 3THRA 1ESEA 2JIPA 3OCYA 1EE9A 2C5LA 1F8YA 2ZW9A 2OO7A 3UV6A 2Z43A 4QXPA 1CEYA 1U28A 1DBIA 4PGFA 3V6MA 4DR1B 1V2GA 3FYUB 2Y0CA 5K20A 1BXRB 1AHHA 4O0LA 3VKHA 3E5MA 1L5NA 3C5VA 3K6SA 4EY7A 1YS2X 3DL0A 3ZDDA 1N1DA 3T95A 2HQ1A 5LM3A 4B4DA 4B71A 1E3MA 1HYHA 2Z3ZA 2R1VB 3C3EA 3RQSA 2F90A 1EVIA 1J6UA 4QXOA 3JVEA 3WK7A 3IP1A 4D46A 1G5QA 1XWFA 4MPRA 3LT2A 2JEOA 1CYDA 3URKA 2A1IA 2PKCA 2VJKA 2IOQA 4U9IS 1I2AA 1QSGA 1YQUA 4XW2A 3RUCA 3S1AB 5HZHA 4IKOA 3E84A 3MQFA 1C80A 1DJPA 1BCRB 3U4HA 3LX6A 5EIOA 3SC3A 2DYKA 2M1ZA 3L7NA 1U1EA 1YBVA 1G16A 3W6ZA 4YRGA 2BR3A 2I66A 1EUCB 2WE7A 3LCUA 3QLUA 3E8MA 2Q2QA 3R5SA 4P4SA 4TLEA 4IIYA 4XD7D 2GXUA 1PU2A 1DAIA 4NEQA 4WFQA 2HA6A 3UMSA 3THXA 1YRBA 2AQIA 4HR7A 1IAVA 1NYLA 1PG5A 1E7SA 3HO6A 4TV8B 2XUFA 4EB3A 5JATA 4LJ9A 4PFQA 3E5HA 5ALXA 2P2YA 2P3LA 4OU4A 5GZ3A 1GFZA 3B9QA 1M83A 3HA5A 5AHWA 5G4KB 3RQIA 3T7TA 2VF5X 2ATIA 4DCTA 2CVQA 4HLNA 1OWLA 2AX3A 4HQRA 4QRHA 3S27A 3TLGA 3H5NA 4CTKA 2DE0X 3C6YA 2YFYA 3CR7A 3I9FA 3M9WA 4URXR 3P9KA 4CL2A 1BWSA 5JYBA 2OVBA 1RM0A 5K01A 1NTOA 3BILA 5CFLA 1UXGA 3IVRA 5EA2A 4QLAA 2MHCA 4XVHA 1LTQA 1XJ5A 4WASA 3ZGZA 4DNOA 1GA1A 3R2JA 2NO7A 4L5IA 3WISA 3AONB 3QKRA 2KE5A 1N6LA 4UPDA 5F1PA 2ON6A 4V0SA 2GHQA 3IMKA 1KIMA 1IJEA 1AQUA 4L0QA 3H9CA 3OJ0A 2B3TA 4TTVA 3A1VA 2GBLC 3T7SA 1JR6A 4AJ2A 1YHZA 4TT8A 4YDRA 1U8YA 4CG1A 2DPLA 3HN6A 3K4PA 4RL6A 2QNIA 4RW0A 3PF8A 3FNGA 1JA9A 4XIJA 1GWNA 2YC4C 1Q20A 2WUGA 4MV3A 2D5IA 5A4DA 4UCXA 2H2DA 1KXZA 2R65A 2YWHA 3BMOB 4H3SA 3UUFA 4M9XA 4EABA 5J2TA 5I7OA 2XNCA 1E5TA 1NW4A 2CSUA 3BB3A 1HLGA 4JH0A 4M0LA 3HVIA 2DHEA 2H2FA 4FDLA 4XQ9A 4GQIA 5B3AA 4EG0A 1DDGA 2Y92A 3EGVA 4QPJC 1L1RA 4YRTA 1A04A 4DC9A 3MOSA 2PRJA 3OFND 3HWSA 3PENA 1A0OA 5GJCA 2X0NA 5CLIA 4C0XA 3MWFA 1NWCA 4J4TA 2J08A 2IRWA 1ZD4A 3OA2A 2FJ0A 4MWSA 1G8JA 4LAFA 1FYWA 3TVDA 3KSBC 2GSDA 2YJ4A 1SXJE 2AUMA 3NWOA 2VZLA 4JUAA 3IP8A 4KC0A 5ALNA 1QE5A 4FKMA 1IE3A 2BYTA 4I1RA 3WQQA 5LIPA 1UQTA 3EFOA 4HNAB 4TM8A 2X0FA 4JEUA 1YB5A 3M33A 4RTRA 3QPVA 1DPGA 4WZZA 5FBWB 1OLUA 1FFAA 4RFSB 3ZV4A 3FYTA 1BEZA 3VC3A 2C3MA 3EZNA 2CD9A 3IP3A 4R2JA 3TE6A 3WGUA 3DBLA 3PNPA 5H80A 3JPYA 2BN4A 3WRVA 5KOHB 2Y1GA 3F6BX 3FUWA 4P92A 4MKXA 1FY2A 3O8BA 3MFYA 2PFSA 1JEYB 3P9IA 1Y81A 1RACA 1N4DA 2FEAA 3U5TA 3OTQA 1V5FA 4OMCA 1BXZA 2F3SA 1TU3A 2KLHA 2OWEA 3IURA 1ST3A 4KDCA 5ALUA 2BSAA 4QHYA 1SHUX 4GMHA 3EBOA 2JHFA 2PGLA 1K2WA 2I7CA 3UMCA 5HJ5A 1VRCA 2IS2A 1RPJA 2NUTB 4GDMA 5LXTF 4GNKA 2CW5A 4AXBA 1X8JA 3FLBA 5AW6A 1OAOA 2WIJA 5MN4A 1BRMA 1HZJA 3PPIA 4NEHB 1UDCA 3OEWA 3IRVA 3WRYC 3CXRA 4Z2YA 4ACAA 2QMZA 1FQWA 4ZI7B 1OVGA 5K7SA 1NYQA 2HA0A 4ZOEA 3HA7A 1CETA 1VIMA 3BH6A 5FV4A 3Q3HA 3JY6A 4AY2A 3NTLA 1P73A 3L6OO 4L6AA 3F3KA 4N18A 5KSWB 1Y9DA 2HU7A 1W581 3ASZA 1BE6A 3DD1A 3VUEA 2E6UX 4WZBB 5K0JA 2AYZA 2WKPA 3WIDA 3JQAB 4IJ5A 1JAZA 2ISSD 4M1WA 4ED9A 3T3PB 1AX9A 3I8XA 4FR2A 4Z4EA 1J0EA 1WG8A 1W9MA 1ZQ9A 3MXTA 4CEHA 3PWKA 3RSSA 2BP7B 1SU7A 3QH4A 4LYEA 3OLZA 1DZ3A 3BMXA 1VJ0A 3ABOB 5LYJB 5T8KC 3TK1A 4PBSA 1OT3A 2XEXA 5FPHA 4G6ZA 3IOCA 2ONZA 2VDRB 2PXAA 2G71A 2YTZA 3DC2A 2OA0A 3U48A 4CKEA 3HRIA 2FFBA 3NNNA 2ZCJA 4R3WA 3RSLA 5LP6C 3F4LA 1HSZA 2ROQA 1XZQA 3VC7A 2H51A 4EHFA 3ZZ1A 1JXOA 3QQ5A 1GZ4A 5DM70 2YICA 1OWMA 4WN9A 1WE2A 4O2RA 4S35A 2Q5FA 1S7GA 3F6PA 4Y7DA 3CUTA 5JD3A 3C3YA 4H27A 2FQ1A 2ACVA 3NXKA 5HXAA 3EGEA 5HTKA 1UT5A 3R7BA 4HVCA 3R0ZA 4LRTB 4UM7A 3QYJA 1Z35A 2CL5A 4JT8A 4DKJA 3IVMA 3NV9A 2GTIA 3AI3A 1ZXXA 3ZCPA 1JQJC 2PX2A 3IIIA 2B1QA 2DTDA 4QEZA 5SYAA 5IJ9A 3CZQA 2JGDA 3WK4A 4P93A 2HZBA 4EG4A 1EA7A 1BU5A 1O3YA 2R3SA 2X5XA 4JWKA 4A27A 4CEJA 4BGDA 2I03A 1QGYA 1PYGA 3E7WA 4URHA 2RGBA 2C03A 1YCFA 1OZAA 3RYFA 4DCGA 2HU2A 2I2WA 4NPCA 3IAAA 2FWPA 1ZJJA 5IJ0B 5JNSA 4N49A 5JAQA 1TZBA 4GI7A 5B3JA 3EN0A 4RPLA 1QONA 2IVFA 2ZUCA 3KPUA 3M4YA 2YDXA 1R8QA 1T8PA 3IEPA 3OAAD 1M2NA 2ZI7A 3T7EA 2Z5FA 5TVKA 3ICEA 1PJSA 2NO6A 1IZZA 3GJRA 3O0TA 4A1OA 2HA2A 3G9TA 5FLEX 1RE1A 2WAXA 3H18A 2RAFA 1AQYA 3WBJA 2ISQA 4B6PA 4MGEA 3W9YA 1GG5A 1K7SN 1SXJD 1N2HA 1RRGA 1WB5A 1KI6B 3A6JA 4JIMA 5AK4A 4M2LA 4C88A 4A2PA 3DEFA 4C0SA 3LZ6A 2ZRJA 1O6ZA 2C96A 4OJQA 5B64A 2PIAA 4K7JA 1OX4B 1SXPA 4LN1A 2JPDA 4D99A 5FI1B 4M8KA 3ZWKA 3A6GA 1FE8A 1TCCA 2PSJA 1KTVA 4JBHA 4P0QB 1R5OA 1ULHA 4RK0A 3A4NA 4W9NC 2MCFA 1JLLA 3FOAA 4ENVA 1O03A 1NPDA 4ER5A 2R48A 4YRIA 3W06A 2IXBA 3FYSA 4OB7A 4AWXA 5DHUA 3DE0X 1UBUS 2Z2XA 1FRFS 3HU5A 1H42A 2WHQA 3FE2A 1NVFA 4CMJA 4UPVA 1R5JA 1IXYA 5A5FA 1WSWA 2PAFA 2FDCA 4DVGA 4OFBA 3PUXA 2XMPA 1N75A 3IJRA 3D3WA 1VKZA 4WW0A 3ETLA 2QNRA 4RDIA 5LOVA 2R6R1 2LNDA 3SIRA 4N1AA 1WVIA 5HWSA 1PTJC 1PBTA 2GZ1A 1KI9A 4P3XA 2EZ8A 3DBHA 2NXJA 2ZANA 1C3EA 1J2UA 1VSUA 4I19A 5EP2A 3TJZA 4D43A 1E9VA 1FDRA 2CEAA 2MSDB 3ET4A 4XGQA 3H8JA 3CBGA 1K5PA 4ZZIA 1XRJA 4X63A 4YN3A 4C2BA 4BTEA 2W4QA 3PICA 4U2DA 2LPMA 2F3RA 2XLCA 3QXSA 1HE4A 4H1TA 4Y9DA 5D6NA 4YX9A 1EJBA 3LFHA 3K2BA 5CDFA 1AZTA 3UJBA 4JYZA 1Z4IA 3CW9A 4IGFA 2LKCA 4G09A 2NU6A 3RYIB 4ZANA 1G19A 3P19A 1NSTA 4B5KA 2X1LA 2V3CC 1UJNA 5FWDA 3A9RA 3L9WA 3MMZA 3QIVA 5G3YA 4CHTA 3NHFA 4CM8B 3L8GA 3TOSA 3BD8A 1NY6A 3SJAA 2O2IA 3LPNA 3TZHA 4F2HA 1Q0SA 2I5PO 1E2NA 5HNKA 4LZPA 3S2SA 4JX9A 3DXZA 4Q24A 5ESWA 3ZHBA 3R8FA 5AW4A 2C42A 1VFNA 4TMVA 4XGKA 4RTKA 1O0CA 1ZRMA 1X8XA 4XQEA 1UKYA 3SQNA 4FEAA 4PYOA 5BN1A 1IZ0A 1OWPA 3FMIA 1OH7A 5ED4A 3AG5A 2V3WA 4CV1A 2DBYA 1XWIA 4GP9A 5KHOC 1XG5A 3BZUA 1WD7A 2FW6A 1ISJA 1P60A 4QTZA 5CUQA 5LDGA 3QE0A 2C7GA 2YVQA 4RNCA 2JCGA 4KP7A 4D3FA 1JH9A 2JHPA 2IXAA 2BFDB 1CQWA 2OP1A 2EWWA 5H83A 1E1RA 4JLWA 1X3LA 1GYPA 2XDYA 2G9ZA 4KODA 4U00A 4QC2A 1Y6QA 2QM7A 1T5LA 1VCOA 3KHSA 1PGPA 3PQ3A 1WEHA 4KXMA 3WBBA 1PW5A 2Q9AA 3SEFA 5CAEA 2Z2ZA 4Y0NA 3GEPA 3ZHYA 3N8DA 1PEAA 4RD3A 3C1OA 1E64A 4OUDB 3ITDA 5DHRA 3FTFA 5J40A 2Z08A 4INOA 4UVGA 4G81A 3RV3A 3NHUA 4OU5A 1X7ZA 4F46A 2ATXA 4QAQA 2NYVA 3WJAA 1KOFA 2IY7A 5DWQA 2EQAA 4G84A 1CQIA 3KAJA 2Q9UA 1S8NA 4HAOA 3RVDA 5D00A 3X2SA 5EKTA 4ZTBA 1N5JA 4B3GA 1SVLA 4PRKA 4BX9A 1E89A 2RDMA 4GSLA 2H4FA 1YR8A 3HXLA 4NSNA 3Q41A 2HNKA 1PR0A 3L4SO 4O2BA 4X94A 2LCQA 2MYPA 1EESA 2ZRQA 3KV1A 1COWA 3GUUA 4KXQA 2P9TA 4I4NA 4MKGA 5DXAA 4EUEA 2IGTA 3UH1A 3TLXA 4MR8A 1ZVQA 1FLNA 5LZ5A 3TZQA 2JZCA 4MR7A 5HIJA 3TL2A 3UXMA 2NVWA 2FW0A 5D6OA 3UJCA 1HNZB 3ECAA 1HLPA 4GL2A 3DCJA 4X1IA 1HORA 1XNGA 2FFQA 2W6OA 4HDKB 1EX1A 4G8CA 4HXEB 3NVDA 4R2WA 3VZDA 4DWOA 2VPQA 2EEPA 2DR0A 3GLHB 3ENVA 4IFTA 1UFOA 3IKVA 3RAJA 2PQ0A 2HDWA 1W75A 1U04A 3KSAC 5HRAA 3WNQA 1FW6A 1DCMA 5DXFA 5HMMA 4YJ2A 1LRKA 2QTAA 5DBIA 3G68A 4J76A 4Z9BA 1TO2E 1D8TA 3M4ZA 1QK3A 2B3DA 2CJFA 2WT8A 3JWGA 3KD3A 1NNUA 2Q0QA 4ML3A 4HVTA 3SNHA 2HJVA 3LRPA 3IBTA 1WDLA 3DQZA 2G3YA 4L4RA 4UTPA 1LEHA 5T7BA 3A9CA 4C4TA 5DVZA 1ADFA 3MTBA 1SURA 4F72A 2AX4A 2DR3A 3BZWA 4CMKA 5HRCA 5TGTA 1Y3HA 3CEHA 1TXGA 2GHTA 2WSSD 1YDWA 3AF4A 3OJEA 2GBLA 2AOVA 4RMNA 1ZOIA 4ER7A 2HUPA 1O77A 2WF9A 3AT1A 1KY3A 2GM5A 3DO8A 5ERGB 4MVWA 1LLCA 3IHLA 2SBTA 4RKEA 5CPBA 4RBNA 2IT1A 5JRZA 5A71A 4DUZB 2WJVA 3HH8A 1RZ3A 3LP6A 3NJ4A 4BO1A 2C8KA 1ULTA 4RK1A 3EPPA 3U6BA 2LR0A 1JX6A 4DGSA 3NHLA 1PT8A 2Z30A 3FKSD 4G25A 5FNZA 2GMWA 3KL4A 4ZDKA 1I0LA 2GLTA 1S1MA 2GNOA 2R97A 1ZMTA 2XUDA 3KXLA 2VIIA 1QIFA 5G1NA 4Z3DA 5T4HA 1JKFA 1N2ZA 1JYFA 3WMRA 4KWIA 2YXLA 4A10A 5IX8A 5AXCA 1F7VA 3E7DA 3D3EA 3FHLA 2WA1A 1ZH6A 3DAPA 1LBEA 2Z6AA 3FUVA 1I7PA 2PSDA 3KBBA 1NF9A 3P2IA 3GOHA 3NDIA 3GJ7A 2JLVA 4EI8A 5D1HA 3KETA 3KYIB 3H5AA 5KPDA 1T1JA 2Z9CA 1DRWA 4FYWA 3OH8A 3HKDB 4RZQA 9ATCA 1OKKA 4GI1A 3ZKWA 5BPFA 4DT1A 3OPNA 1T36A 2QP9X 3NM5A 3JQ8B 3WGKA 4ZAZA 2GPNA 4O2LA 2C5EA 2GZAA 5GZ6A 1OBHA 5KNCH 1AKUA 3TGPA 1QP0A 2FQQA 1OYOA 4X61A 3EG9B 2JAWA 3BG5A 1G5IA 4F1JA 1L7DA 1P33A 4EZIA 3EAGA 3FFWA 2IF2A 4NENB 5K5EA 1DIAA 4HMQA 1I01A 3UIEA 3K16A 4IXNA 4L5CA 3EISA 3LQFA 1Z12A 4AIIA 1Z0FA 5EXPA 2QLMA 1J39A 4KE8A 4QJ4A 3QI2A 1T9CA 3QKWA 4OK6A 1XZPA 4XPZA 4MGHA 3VR2D 4BMXA 3UW1A 3PXAA 4RMHA 5KYNA 3FTPA 2BD0A 1PLKA 2JNWA 5FO0A 3ACCA 4IICA 4LYDA 2D2XA 2VPXA 3OCJA 5JXJA 1PDWA 1YDFA 1SC6A 1X1QA 2BRUC 4TXLA 5BQ5A 2QA5A 3AVTA 2CFRA 3CY6A 5LFAA 1UM9A 2A9QA 4R3UC 2JIQA 4PS1A 4L5YA 3AR4A 3VNQA 3VNRA 2UXDB 1CVIA 4I1VA 4DCVA 5GVRA 2DEUA 3K6RA 4V24A 1SKMA 2V7EA 4O4LB 1G8KA 3T1QA 4BRZA 5CDTA 5DYYA 2ZYHA 2CHFA 2QRHA 3TLCA 1DU4A 4MAMA 4A2WA 2P6RA 4WKCA 1AKRA 4J0HA 5M7EA 4R8SA 1YFJA 2X8WA 3DVAA 4RE6A 4DAOA 4FEEA 3EVZA 1A8QA 2Y0BA 3QTBA 4ENTA 4AZ3A 1EDOA 2CNLA 2VHXA 4HX2A 4O4JB 1PVOA 4YP9A 1HMPA 1F8FA 3HPRA 2V0NA 2VRWA 1X7XB 1MUUA 1Q84A 3MMPA 4KDEA 4KXVA 5JRDS 2KWIA 2VT2A 3AHFA 3UHFA 2ACEA 3PFHA 2FMHA 3OY7A 1PT7A 1HUQA 4KXNA 1C8VB 1D1SA 5T8KA 4D4GA 1C7JA 5LMCA 2B6HA 3AF3A 5EJFA 1H94A 3QPAA 2J3DA 4KXXA 3RK0A 4A8JB 3T1TA 1P0CA 2R4TA 2V0GA 1SUDA 2WJHA 3M70A 3BXEA 3CH4B 5FA5A 2DFDA 4W63A 4BUZA 1VYTA 3GB9A 2M6KA 2FZCA 4OB6A 5H8WA 3I0NA 1QK4A 2B1RA 5CH3A 5LP6A 3GYGA 4KBYA 2FB9A 1VGVA 1F1BA 2G36A 3D6UA 4JL5A 4BBJA 4ZYTA 2ZYRA 4ESVA 3ENKA 3TTSA 4QGSA 4Z9AA 4KMOA 3OZBA 4NP6A 1JQKA 2CJWA 4J16C 1LQTA 1G6Q1 1NVBA 3UYLA 4ZGWA 2FPGA 4X1KB 2I1QA 2VAVA 3G79A 1VG8A 3G7SA 3DL2A 4AZ0A 1OVMA 1FFBA 2E5WA 2QV7A 4LRUA 5IVPA 4RV5A 1ULBA 5EMHA 1Z26A 2WG1A 2PT5A 1B43A 2A9VA 3HO8A 3VNAA 5JZSA 2GJSA 1P7YA 2RAPA 4E6EA 1EGAA 1V3UA 4OAPA 2F8SA 1ZLYA 3OZSA 1JR3E 3BDAA 2ZXFA 2WOJA 3VXKA 3R41A 1Q83A 4MRSA 1DAGA 4NU0A 4WWHA 3RVRA 1BHO1 3OCVA 2FU5C 1GLNA 2GFIA 1ES9A 2VDJA 3B2NA 1C4KA 2XZDA 2ZXUA 1JG6A 4DPKA 1MO3A 4K40A 1LA2A 1TQ4A 2A3RA 3BM5A 2PWZA 3GHYA 3GLIE 4MQ4A 4TKUA 4YLGA 4D9FA 2ID8A 3IPLA 3S28A 3SEQA 1RMYA 4OHPA 3ROKA 4B8WA 3QUSA 1VLQA 2OZVA 2VATA 4UMEA 5BWCA 3NIBA 5JD5A 3C1UA 4OHMA 3EDRA 4OHKA 5EYPB 2NIPA 2XAUA 3INGA 2Z6VA