4DJTA

Crystal structure of a nuclear gtp-binding protein from encephalitozoon cuniculi bound to gdp-mg2+
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
190
structure length
186
Chain Sequence
LTYKICLIGDGGVGKTTYINRVLDGRFEKNYNATVGAVNHPVTFLDDQGNVIKFNVWDTAGQEKKAVLKDVYYIGASGAILFFDVTSRITCQNLARWVKEFQAVVGNEAPIVVCANKIDIKISKKLVMEVLKGKNYEYFEISAKTAHNFGLPFLHLARIFTGRPDLIFVSNVNLEPTEVNYDYHSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a nuclear GTP-binding protein from Encephalitozoon cuniculi bound to GDP-Mg2+
rcsb
source organism Encephalitozoon cuniculi
molecule tags Nuclear protein
molecule keywords GTP-binding nuclear protein GSP1
total genus 61
structure length 186
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08477 Roc Ras of Complex, Roc, domain of DAPkinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4djtA00
4XD7A 5DE3A 5JCZA 2JA1A 2VSOA 4MYHA 1KSGA 5H1YA 3MFYA 2KI5A 4V0MA 4DEYA 3EA0A 1BH2A 1V43A 1R6BX 2W6JA 2WAXA 4LDJA 4QL3A 2EFEB 1WXQA 3AEZA 1NNEA 3GJ8A 4LC0A 2O8EA 2QAGA 4HAXA 1XB2A 3OZXA 2PCJA 4M53A 4UNRA 2WVJA 3C5CA 2J7PD 3ECCA 4MDFA 3T1TA 3Q3JB 4QG7A 3Q85A 4L16A 4JVMA 4D4KA 1S8FA 5B57C 4XH9B 4RZ2A 1FFHA 2FV8A 4W5JA 3MRSA 4US1R 4M4SA 1E4YA 1HT2E 4TL9A 4I99A 3LWNA 3FMOB 1J7KA 2FGKA 3A1VA 2D2FA 3AB3A 1FW6A 2ZI3A 5KOYA 5C2JB 2PLRA 4DCSA 3L2OB 4NCNA 3RS2A 4Y0VA 2Z4SA 4TL7A 2OFXA 2HXYA 3CIOA 5D3MB 4KSCA 1TQDA 2XXAA 1XD9A 4H9GA 1F2TA 5F2EA 4LOAA 5EE3A 3I61A 1SVSA 3QIAA 4FMCF 3VR3A 4Q4AB 3FYHA 3L8ZA 2GEDA 1NVVR 5FBRB 5KHOC 2QTVB 1DO0A 3BB3A 2O8BB 1UFQA 1NKSA 2NO0A 3W8NA 3UKDA 1XD8A 4IDOA 3WYFA 1WQ1R 3U7FB 1G9XA 1FNNA 2O8EB 3GJXC 1A2KC 1YR9A 1ZNZA 2FFQA 3LLMA 4FMDF 4FMDB 5AUNB 3NEJA 3EPLA 1WBBA 1OXVA 2HT1A 2Z6VA 2ZRPA 4C0LA 3PCRB 5HCNA 4FI3C 1X86B 3LBIA 3CUEF 2XX3A 4TYWA 3BK7A 5JI3E 2OZEA 1OKKD 4ASUA 3Q8XB 3QUSA 1AS3A 2GHIA 2WOOA 4XTRA 3UATA 4JSYA 4E09A 1ZINA 1YZKA 3ZIAD 2O5VA 1VKJA 2QA5A 4PHGA 1YE8A 4L8GA 3AM1A 2XAUA 4A0HA 3PUYA 1KSHA 5GJWC 3DO6A 5H68A 3WYGA 1O3YA 2CLDX 1LNZA 2W2XA 4BFVA 1OPXA 1XEXA 2NZ8A 2V55B 3GD7A 1D2EA 1NY6A 1NN5A 2C78A 2QGZA 4C0JA 2QEQA 1IQPA 4Z1MD 2PX3A 3KKOA 4DLTA 3KUCA 4UNNA 3L8YA 1BMFA 3NDPA 3UWOA 1XF9A 4JJZA 2CCGA 2ZVPX 4F4IA 4N3NA 4JLNA 2LKDA 3GJ6A 1VYUA 3PFIA 3FOZA 4JLDA 2QPAA 3P26A 3SU8A 1DPFA 2WICA 2E1RA 3AP1A 4Q03A 4ARZB 1TQ2A 1XTKA 3QY0A 3CONA 1UEIA 2GJAA 2PT5A 1G5PA 1II0A 2R9VA 3RRYA 1CKEA 2ZRDA 1G3UA 3P32A 2YZ2A 3SHWA 1F2UB 3IO5A 4NHOA 4GI7A 3DOFA 3UXMA 5BW8A 3ZDQA 4NTZA 3CX7A 2FFBA 2G1JA 1W0JD 4P4TA 1U9IA 1J70A 2OBLA 4HZUB 1R0ZA 1X8LA 4ZKEA 3AVVA 1VMAA 4GOXA 1W4CA 2V9PA 5BWMA 1II9A 5CIQA 3B1YA 4LYFA 2FSFA 2CMKA 2JJ1D 1G19A 5H70A 3EPHA 1EFUA 4LV8B 1ANKA 1G1MA 3THXA 4P31A 1T5IA 3GJ5A 3JZAA 2W6JD 3LD9A 1G17A 4PPNA 1Z0IA 2C9YA 3LVRE 3K0AB 3G0HA 1DAKA 2GAAA 1Q20A 2G3YA 4URYR 2VP2A 2QSYA 2HLDA 5G40A 1JR3A 1G8GA 2ZRIA 5FR2A 1XMSA 5G3YA 1KZ7B 5KDLA 1GSIA 2WJJA 2WOJA 2ZI4A 2ZJ8A 5L3QA 4V0NA 2ZREA 3C5HA 4QHSA 2IYSA 5AK0A 2CLSA 1XMJA 5IK2D 1XDBA 1DAGA 3V4FA 2NGRA 2AR7A 4P33A 2CHGA 4QC2A 5JEEA 4IOMA 1KSFX 2ZRJA 2P6RA 2BBTA 4BFWA 5GJBA 2IL1A 4IHQA 4DIEA 4YMSA 4B2PA 4ESHA 4F92B 4LI0A 3NBYC 3CZQA 3CB4A 4LJ8A 1VYVA 2PJRA 2MMGA 2OM2A 2CE7A 2RGDA 2ZITA 1E0SA 1P73A 4JL6A 5KSOA 4V0OA 2GBLA 1QZXA 2KE5A 3QVVA 4FD2A 4QXAA 4L9SA 2ZAMA 4ZCLA 4TYNA 1K6MA 1T0HB 1Q22A 2F43B 1GNQA 1IY2A 2HF8A 4DLWA 2F6RA 3TW8B 1CJUC 2WM9B 4OQNA 3GLIA 5AJVB 1W36B 1GRQA 4JVNA 3B9PA 1FP7A 2JIZA 3A37A 3KQLA 1ELOA 5JFGA 5JWRA 4YXWA 3B60A 3KDSE 2F1RA 4JLJA 4PPFA 1TUIA 1KDTA 3ADKA 4OK6A 1S3GA 2CHQA 4HUTA 1CJVC 4M1SA 2A2ZA 2ECKA 2F43A 1E9AA 2FSGA 4IOLA 2IS6A 4LSGA 3TUZC 3GLGE 1LS1A 1SVKA 1W5TA 2ANBA 5GJVC 2CCKA 2ZI6A 1XTQA 2K5UA 4C0QC 3W8RA 1OJLA 1M7HA 3TK1A 3BFVA 3CR8A 2ZQ5A 3AF3A 3KKMA 3L0SA 2XITA 1KNXA 3H4MA 1SVOA 3EZ7A 1TU4A 4LZZA 2F7SA 4DDTA 4Q9IA 2H57A 3MWLA 4A8JC 1RZ3A 5CDFE 4C0SA 1OSNA 4M1YA 1BMFD 1AIPA 1GIAA 2VRWA 1OIXA 1OW3B 1SKYE 4L4UA 3OIYA 2I4IA 4IOKA 4E07A 2JLRA 2KBEA 3K9GA 2D62A 3BD9A 5EUMA 5TARA 5E7JA 1X1SA 4YONB 3ZH9B 2V7QD 2WKPA 2JLSA 3SJBA 1G64A 1YZQA 5KU1A 2CBZA 5CB6A 3T12A 2GJSA 4AK9A 3A58B 3UIEA 2C2HA 4RCYA 4TLEA 3RLFA 3CF6R 4HI0E 4Q7MB 3FE2A 4P32A 4KJZA 4B48A 2GZHA 1NMYA 1OXUA 2PL3A 2F9MA 2QRNA 5DSZA 3T1VA 2HYDA 2VP6A 2QP9X 1B23P 3TUIC 2ODNA 1E2DA 3OEEA 4O2LA 1Z0KA 4YDHB 4Q4LA 1CRQA 2J46A 3IHWA 2UZ3A 1TTTA 3RRNA 3U44A 4NE2A 4NYIR 3HWSA 1R5OA 3QI2A 2SHKA 3NC0C 4C4PA 3ZVNA 1GITA 2IX3A 1QRAA 1QHHA 4WZBE 4AC9A 4NDZA 3THYA 2BBWA 4DT1A 4OI1A 3EA5A 1IJEA 1Q1EA 4ZIRA 1OXXK 1M8PA 3U44B 3DKVA 2Q21A 2ZRKA 2BMFA 3C8UA 4RZXA 4D4JA 2BIFA 1JI0A 1FMJA 2RB4A 2XZOA 2ZI5A 2GRJA 1Q44A 3WMFA 3C14C 2OSBA 2WWXA 5LPNA 1W36D 1F5NA 4QGAA 1CTQA 4I4LA 1SKQA 4DC9A 2GF0A 2YWFA 3KJHA 2H7VA 3KKNA 3WRYC 3ZD7A 1G3QA 3T35A 2IS4A 2P0EA 5B2ZA 1JJVA 2QE7D 3QG5A 2RGAA 4ZIRB 1HUQA 1II8B 2YWEA 4RD0A 2XB2A 4IEEA 3PENA 1GKYA 2JJ2D 4GPTA 1FUKA 3HU3A 4MYUA 3CWQA 2OG2A 3FHTA 2XZLA 1B0UA 3OHMA 4TYYA 1RRFA 3K9HA 1S1MA 1TADA 2JJ8A 2UZIR 4WVFA 2A9KA 3CR7A 3OEHD 3VR1A 3T06B 1YRAA 2Z43A 5FUWA 1YRBA 3PEYA 1NVUQ 3MWKA 3KKQA 4DSNA 3MAAC 4KXFB 5FTJA 5C4MA 4G5SA 1Z08A 4OBEA 2JLQA 5CLLA 2ZSDA 5K8IA 1NY5A 4GOKA 3X1XA 4C2UA 2IS2A 1P62B 3O8BA 3QVUA 4B47A 4JLBA 1YZGA 2JLYA 3B1XA 2A30A 3QF7A 3U3JA 3ZYCA 1XCMA 2AHOA 5FR1A 1KDPA 1YKSA 1WA5A 1Y63A 2H17A 3A1SA 2ATVA 4Q4JB 2G9NA 4PQRA 3B1WA 2XTNA 1MR3F 3LH5A 3QBVA 3KL4A 3AF0A 4BLOA 5J4KA 5BN5A 5HKKA 1N5JA 1UBFA 1UKVY 1WP9A 1XD2B 2QUZA 4ZPXA 1E2HA 2A78A 4PHFA 1E2LA 4G01B 4MRPA 4LBZA 4IXNA 4OHZA 4A1FA 4QM6A 4D6PA 5C4GB 4QOSA 1JR6A 2ZE6A 1DAEA 3FTQA 1NIJA 1E2NA 4AURA 5A4JA 1XMVA 3C7KA 3FDIA 4FCVA 2PLFA 3TGPA 3IEVA 2JAQA 4NL4H 2VP5A 2ERXA 4WA7A 1TMKA 1IAQA 3MD0A 1KDRA 4EJSB 1NF3A 2R6AA 1UM8A 3IPXA 3ZVLA 5C18A 1ZBDA 1X6VA 2QM7A 1FMLA 1ONBA 4I1SA 3BOSA 4JLMA 4TLDA 2ZUCA 4F4CA 3IIMA 3OAAA 4JLKA 2Q3HA 3TVTA 2GXQA 5CJ2A 3M6AA 3AVXA 4LWZA 2D7DA 3EWSA 4IVPA 1E9DA 5AUPB 1IY0A 5CK5A 1KMHA 1XRJA 2IHBA 1UKYA 1WDTA 3W34A 5E7MA 5KNDA 4P4UA 1N0WA 3K09C 2AK2A 2C99A 2C9OA 4W5WA 2GEVA 2O8BA 1SXJD 1OB2A 1ZUIA 2X2EA 1ZD9A 4NCKA 5L3SB 1U99A 1MO6A 3BFXA 2IUUA 2OUKA 1UADA 1ZD8A 4M21A 1NSFA 4Q47A 4JLOA 4UXHA 4NYMQ 2OCBA 4BLPA 2AKAB 1DS6A 5D3MA 3CNNA 1E9BA 3TMKA 1FX0A 1YJ5A 4EPRA 1GG2A 3C16C 3Q5DA 1U81A 1KTVA 3AV0B 3A1WA 2P3SA 2JIZD 4D82A 2HYIC 2RGEA 2ZROA 3K70C 4YXWD 4LCBA 1CF4A 1NKTA 1LVGA 3MJHA 3K0AA 1S2MA 3ICEA 5JBQA 2NO6A 3FFBA 1FQJA 1UBGA 2XNSA 3BIFA 1NN1A 2JATA 3TSWA 4LK2A 1EG7A 4Q19A 5DO9A 4Q1FA 4OHYA 3K0SA 1XP8A 1G20E 1QHNA 3RHFA 1NP6A 4NYIQ 3B85A 4TL8A 3SI7A 3VTKA 1RRCA 4OQLA 3C15C 3SOPA 3O8DA 2QROA 3IUYA 1AJEA 4DSUA 1WE2A 4K8OA 2G83A 4DCUA 3E1SA 2QAGC 3IIJA 5L3QB 4DSOA 2ZSFA 4B3FX 1KZGB 3CNLA 3OEHA 1GRNA 3PR1A 1XXHE 2ZE7A 4G5OA 1QBKC 5BYJA 4AYTA 3UMFA 4TMXA 2DFKB 2JJ2A 5HZHA 2QP3A 4HLCA 3GEHA 3AF2A 1T91A 3GLFB 2QTHA 3PV0A 2IYXA 2HUPA 3D7MA 2WIAA 3SBDA 2Z5FA 3QF4A 3L43A 3UG7A 5KUTA 4QJ5A 2IWHA 3KFVA 2O0KA 1DOAA 4RCZA 3BFKA 3EARA 4GMDA 3TR0A 3QOFA 4GNKA 3PUXA 4Q1BA 121PA 2AL7A 1JEDA 4A6PA 3FWYA 5FL7A 1YZNA 3WNDA 2RGXA 1CJKC 4NH0A 4D0NA 1VPLA 4TTPA 1ZMXA 4LHZA 3RS7A 3OF5A 1J99A 4UQOA 4CEJB 4HB2A 2ZXUA 2NTYC 2QBYB 3LDAA 1N5KA 4BZQA 1D5CA 1KAGA 4FCWA 5SZJA 2FPLA 1ZIPA 2QT1A 3WMEA 2YKGA 3FB4A 5L8VA 2O8CB 2G77B 2BJVA 1ZUHA 3KXIA 3CRW1 2LWIA 1DG1G 5GADl 3ASYA 1XTIA 3TE6A 1CRPA 4LV5B 3BWDD 3WP1B 3EAQA 5BN3A 2FNAA 2WWFA 3E70C 4NYJQ 2HCBA 2OXRA 4RKEA 5FOVA 4P0TA 1OF1A 4D0GA 5F9FA 1ZVQA 1GVNB 1XEXB 3U3MA 3KXKA 4YQFA 2HJGA 1GFIA 1XWIA 3AKDA 5C1BA 4KYIB 4ZCIA 4LYHA 1W49A 3F5FA 2YHSA 1RIFA 1MOZA 2EYUA 1T6NA 4QRHA 4GRAA 4OK3A 5KTYA 5TXGA 2NMVA 3LNCA 1FZQA 3EC2A 4R2HA 4MRVA 3W6NA 2JDIA 1OH5A 4Q9LA 1G4AE 5FBLB 2IUSA 3BB1A 5A5GA 1F3OA 4MYCA 2B8WA 1T8TA 4II7A 4Q7LA 3LO5A 3UPUA 4YMUA 3RAPR 1Z0DA 3B9QA 3DZ8A 2DBYA 3RS4A 3WMGA 1IONA 1DG3A 1SXJA 3FFAA 4OQMA 2O8DA 3QE0A 2FSHA 2RHMA 3DL0A 4RFSB 4A15A 2O0JA 1JPNA 1VG1A 3AP3A 1E79A 3W6PA 1TF7A 3Q7QA 4DLSA 3NHBA 4D0LB 2IYVA 1XEWX 4FWIB 1GDDA 5HE9A 1AGPA 3NH9A 4LBVA 4LYAA 3QKRA 4XD7D 1D9ZA 2REBA 4Q4AA 2WJHA 4AG6A 2NPIA 4XOIA 1NLFA 4C9BA 4PANA 3AGQA 1JBKA 3GLIB 2KJQA 4O25A 3MCAA 3TNFA 4BEJA 2HT6A 3P4YA 4IW3B 1RYFA 2WSMA 5FUXA 4HUQB 4X8HA 4WXPA 3REFA 1A5TA 2C96A 2VP4A 4R2IA 1TQ4A 3FMPB 3QEOA 1A1VA 5IF9A 1QHHB 3QXCA 4DBLC 1C1YA 1N6OA 1E6CA 3WBKA 4IFBA 5EXTA 4Z1MA 3PEUA 2IF2A 3AKCA 3HP1A 3ZS8A 2WWWA 1CR2A 1EXMA 4TMKA 4JSTA 1PLKA 3EX7C 2VP9A 3G5UA 4BRWA 4KBFA 4Q1CA 3I32A 4LYJA 3BB4A 1P2UA 1XTJA 3BJIC 4YMVA 4JIMA 4KV9A 3TJZA 1YR7A 3LBNA 3U3KA 1N6IA 4OI4A 4Z8XA 2J1LA 1EFCA 3B1VA 4CZ2A 3T5GA 1G8PA 2WJGA 4W5HA 2IYWA 2FPKA 4XSHA 4NCJA 4NBSA 1KK1A 1H65A 1XTSA 5HR5A 1MKYA 2FF7A 1KI2A 1ZJ6A 4C0HA 4KAXA 5KNBA 1A7JA 3VQTA 4R71A 1TF5A 1VCIA 4V02A 3S1AB 4DLZA 1E3MA 2ERYA 1E1RA 2AD1A 2Y8EA 2ZJZA 2ANCA 4N1AA 3QPUA 1GOTA 2DWOA 1D6JA 1L4YA 3RSOA 1OXSC 5KDDA 2OV2A 1H8HD 2P2LA 1KO4A 3LQQA 2DFLA 2ZJAA 2L0XA 1D2MA 1IN8A 1SHZA 1PLLA 3PJRA 4HLUA 3W5IA 3I62A 2X19A 4CF7A 1HTWA 3BXZA 621PA 1JAHA 2BEJA 5H8WA 2IC5A 4EFMA 1Q12A 2R6FA 3N2EA 3QG1A 3X1ZA 1TUEA 1JXOA 3CX8A 4KFTA 5P21A 3AKEA 2GKSA 2ZSEA 1DE0A 1N6PA 1ESNA 4G5GA 4R7ZA 3B13B 1MO5A 3X1YA 2W6IA 4KHZA 4KLZA 1SKYB 2XOKD 1R2QA 3WXMA 3ZZ0A 5CK4A 2OCAA 3AQ4A 2O8FA 2IXEA 2VTKA 1KK2A 1W47A 1XCPA 2GCPA 4LUCA 3GJ4A 4LJ9A 3IO3A 1OHHD 3ZVRA 3U60B 3DOEA 1P9NA 2VYFA 2C03A 1JR3E 4O0MA 1JAIA 1YZLA 4HEJA 3RSLA 4LHWA 3TUJC 3OFNA 4MRNA 3VX4A 2FU5C 1NRJB 2EVWX 3LA6A 3PUWA 5G3ZA 4AIIA 2MSEB 2FX3A 4CDGA 1E79D 1HQYE 2DB3A 1E2JA 2XTMA 2RHDA 1UKEA 2J0UA 4F38A 1O87A 3TQFA 3E2IA 4JMPA 2IWRA 2AXPA 3AVPA 2QM8A 4LJ5A 4URZR 1EFRD 4ESVA 2UVQA 1OXTA 2H92A 3EASA 2Q3MA 3MSXA 4LJ7A 5CIWA 2DY1A 1L8QA 2BJWA 3PEVA 5CLQA 4V0ME 2FG5A 2KB0A 4TWZA 3ZZUA 2GTPA 4H1VA 2VEDA 2IYRA 3RS5A 3ASZA 1ZC4A 3NBFA 2BOVA 3K0FA 3R8FA 2OAQ1 1OYYA 4YC7A 4M0LA 1EX6A 4EPWA 1CEEA 5EE5B 4HB0A 4C3ZA 1AS2A 2FOLA 4URVR 4OQFA 1BO6A 1I4DD 4ACBA 1DVRA 4XVRA 3UANA 2VHQA 1E9CA 1SVMA 4TL6A 4TZ6A 4DDVA 1CJMA 2W83A 3EZFA 3CRQA 1US8A 2AWOA 2AD5A 1S9DA 4DT1B 4Q9KA 4TMZA 3ZIAA 2CEAA 3BH6A 3BH7A 1NBME 1X8JA 5LB2A 2GXAA 3VMFA 3GJ0A 5K8TA 3I5XA 1QHXA 3DM5A 3K0FB 3AP2A 1KO1A 2C5LA 2FEMA 1F2TB 1TX4B 1ZUNB 3R7WA 3CWZA 4NPHA 2BM0A 2J5XA 3MJRA 4B76A 2PH1A 1RE0A 1HEIA 1KI3A 1OIWA 2GXUA 3ADDA 4A92A 3MLEA 1E0KA 1ZD1A 1E2IA 1FP6A 3ZVMA 3QXHA 5JHHB 1EX7A 1R10A 3D8BA 2ODWA 4KFRA 1U0LA 3V9PA 3LY5A 5L3SA 4DLVA 1MH1A 4A0FA 4FMCB 4UXIA 3X2SA 4OI0A 4URWR 2B8TA 4OJKA 2GJ8A 1M34E 4FIDA 1BOFA 2GCOA 3BE4A 3DMDA 4CRWB 1RJ9B 4TQAA 5EXXA 4DLYA 2V1UA 4TLBA 2AX4A 5FOUA 2H1LA 4UKDA 1CLUA 4M9SA 3QQ5A 1S96A 3UMRA 4Z54A 1W0KA 2A5FA 3SFZA 4M1TA 3W3AA 4R98A 3KB2A 3GP8A 2J7KA 2ATXA 2RH5A 3W3ZB 2J0UB 4PPQA 1YR8A 2CJWA 4B71A 3M4YA 3LRPA 3MG9A 1P75A 3DZDA 2Q3FA 5KSPA 5HZKA 2NO1A 3FPAA 4DUGA 2QRZA 4BEBA 1R0XA 4MKGA 3QSYA 2X2FA 1G291 4BFYA 2ODEA 3L0OA 1G7SA 2ONKA 3TBKA 3ZQ6A 2F55A 2ZE8A 1UF9A 4DVGA 4PC1A 1XJCA 1Q3TA 3QXXA 1KNQA 5FPHA 1KK3A 1NJFA 1PZNA 4A2WA 2WMOB 4EKDA 2VHUA 2F9LA 5SZIA 2OE2A 3ADCA 1W2HA 4AY2A 1X8KA 5E7IA 4UNPA 1OYWA 2TMKA 4DZZA 3GCGA 1AZSC 1RYHA 1ZM2A 4C2TA 4CW7A 1W2GA 4XTCS 2EFCB 2Z4RA 3IDQA 4JS0A 2B6HA 4I1UA 4ZDIA 3MWJA 1K5DA 1W44A 4QBHA 4BFUA 2WJIA 4DB4A 5DNYB 3QKSA 2O52A 4JBYA 1WRBA 2C98A 5FI1B 2AKYA 3U4QA 5DH9A 4X8MA 5FTLA 4HSEA 4JLAA 2Q9BA 1G8HA 1U9IC 4PC6A 2V8OA 3RS0A 1IN6A 3VNVA 3CF2A 4NCHA 4BASA 5J4VA 4F4JA 5JJLA 3SZRA 2CK3D 3I5YA 1MRSA 4GDFA 1QF9A 4GBMA 4HDCA 4JL5A 1ZAKA 1KHTA 1NMZA 5E4FA 4IDQA 2ZJOA 4QKQA 1LV7A 2IS1A 2WKQA 2HCJB 1E2PA 4NONA 2DPXA 6Q21A 4I81A 1P9RA 3B6EA 1Z83A 1XXHA 1BIFA 4KFSA 4YDSA 1H8HA 1Q0UA 1SQ5A 3NKVA 3CZPA 2BBOA 2VSFA 3D3QA 4PTLA 4DLXA 3M0EA 2OBNA 1EFTA 3KKPA 1IHUA 4KODA 1Z28A 2XEXA 2ZUDA 5DYIA 4KFUA 2BM1A 2GWHA 4MGKR 2X8AA 1GL6A 1NBMA 3IIKA 1TQ6A 2WWIA 3HJNA 3IGFA 3ETLA 3BC1A 2QG6A 3QPVA 4Q01A 1L7VC 3R7WB 4NP6A 1ZNYA 3SR0A 1UPTA 3TQCA 5KSZA 4BZXA 1AM4D 4PAQA 3GFTA 4KSBA 1S4QA 1UAAA 4CEIB 2ZR0A 2NZJA 4LPKA 2JGNA 4NMMA 4KVGA 1RW4A 4C0BA 1JNYA 2HF9A 4BUJA 2G6BA 5FTNA 1XX6A 5FBVB 4C7OB 1XPUA 2C04A 1G3RA 3X1DA 4ABYA 5FPTA 5DLQC 1N6LA 3VX3A 2WBLC 2QT0A 1UJ2A 2PT7A 4B3GA 2H5EA 3HU2A 2F3RA 1P4SA 1E2FA 4ZI2A 3I8XA 4D26A 2GBLC 2REXB 1AQYA 4AKIA 5TY0A 4BGDA 2AFHE 3OIUA 2FH5B 1F2UA 2YVUA 3PUZA 1LF0A 2OFWA 4Q1AA 4UNSA 1XEWY 1G21E 1ZP6A 1Z6TA 4AKHA 3QKTA 2CJWB 5M04A 3OFND 1M7GA 4TTQA 5FPSA 5L3RA 2F3TA 1ZM3A 3FKSD 3GLHA 2V3CC 2P67A 5EUQB 4E03A 1E94E 1SVLA 1MV5A 1IJFA 4BFSA 1HYQA 2CE2X 4UNQA 2VH5R 2ZRMA 5JRJA 2PZEA 3BAFA 4QM7A 4TQ9A 1LF5A 3P1JA 2BCGY 1CU1A 5SZHB 2WTUA 1GZSA 2ZJBA 3RWOA 2BV3A 1DTSA 1CS4C 2ZSAA 4DLUA 1GP2A 4PAOA 1AGRA 3KJEA 2QMUA 5JLJA 4TYPA 3WY9A 4BLSA 4H1UA 4CVNA 1SGWA 3KQHA 5DI3A 2FE4A 4TLAA 2XGJA 3NWJA 1KIMA 5J4YA 4HAZA 1GL7A 2CHVA 2ZE5A 4K81B 1R7RA 5FBQB 2Q9CA 2BMJA 2YV5A 4HB4A 4MYTA 5TV2A 1G7RA 1GILA 4LJYA 2GNOA 2H16A 4M9ZA 3VR2A 1SXJE 2P5TB 2QP4A 4TZ0A 4TSFA 2ZAOA 4A4DA 1VCOA 2IXFA 2QZ4A 3LQRA 3DM9B 2GDJA 1KAOA 3HYTA 2BKEA 4LHYA 2LKCA 3TIFA 5FH9A 2ZYVX 1M2OB 4FXPA 3CPEA 5AUQA 2QQEA 4LJAA 1I4TD 1PJRA 1TPZA 1SHKA 2ZRAA 1KSJA 3LBHA 4PSKA 1AKEA 4TN1A 2QL6A 3TR5A 1Z07A 5FI0B 1Z8FA 2P6NA 5IHPA 2XB4A 1FTSA 5B58C 1DAIA 1W48A 4EQ6B 3VKWA 1QHYA 3NC1C 1YR6A 3A4MA 3KQUA 3SYKA 1WF3A 1JALA 2IBMA 3A1UA 2ZI9A 1IY1A 3R9IA 4RD3A 3WYAA 4ZDWA 3AVUA 5DN6A 1II8A 2KWIA 2XZPA 1W5SA 3LV8A 2OFOA 4F93B 1KI6B 4DWJA 4NZYA 1JEEA 4RD2A 1Q21A 4HZUA 1RPZA 2G1KA 721PA 2DCUA 2OO7A 1ZM4A 1G18A 3DPUA 5JWOA 4PO8A 4QFMA 1N6KA 1E0JA 4KYUA 1E1QD 3K70D 4M22A 1P9WA 4J0QA 5FBWB 5G41A 1T9HA 1XPOA 5EE9A 1XPRA 1K5GA 5CM8B 1KKLA 1ZU5A 2FZLA 2RAPA 4OQXA 5HTKA 3AVQA 2EWVA 1N5IA 2R6GA 3EZ6A 5HKKD 2FZ4A 4LJ6A 5IDVA 4ERNA 4N0DA 4PC7A 2W0SA 3VHXA 4LPSA 3I1FA 3W9YA 2WSSA 2XJ9A 3OIVA 2PCLA 3GFOA 4MUBA 4Q66C 2YNMA 3SC3A 1SULA 1U8AA 4WOPA 1S1CA 4RD4A 3TAHA 2PMDA 3CF0A 1EWRA 1XD2A 3F0TA 1E4VA 1M7BA 2AN9A 2D7CA 3BGWA 4GZMA 2J0VA 4ZO4A 3THWA 2Z83A 1UEJA 2B21A 5ANRB 3O47A 3UG6A 3EZ2A 2IT1A 3VR4A 1M74A 2R62A 1HE8B 4XJXA 4BWYA 2PJZA 2J87A 2G0NA 1QVRA 2RGGA 2W2TA 5LD2C 2IYUA 2D4HA 3NEYA 2YWHA 2DFTA 4BFZA 2FGJA 1XZPA 3DMNA 1UBEA 4P4SA 5KNCA 1U8ZA 3U4QB 4DCTA 2MSDB 1FUUA 3I72A 4R9UC 4Y0AA 4D80A 3VHLB 1G41A 1XBTA 2A5GA 4LY6A 1NLYA 4PZZA 3SJZA 4B3DA 2ZYWX 4BECA 4EAQA 2FDCA 1XFAA 4WAUA 2YYZA 3CM0A 1OE0A 2HV8A 2ZVQX 3O8CA 5CB8A 1GL9B 1DAHA 1MABB 1P2TA 2CL7X 4LX0A 2V6JA 4C7OA 4AWXA 4Q1DA 4B73A 3IBYA 3GMTA 1RRGA 3S1AA 4AYWA 1T3SA 4HAWA 4AKEA 2V7QA 1VTKA 3FHOA 4MKIA 4PSAA 3EG5A 3BERA 1IN7A 4JVLA 4TSFD 4QJ3A 1TF2A 4QNMA 2WHXA 3W90A 1G7TA 1AZTA 3BS4A 4RVCA 4RKFA 3K0CA 3IILA 1G3MA 1Z06A 4E22A 3IQXA 3K0CC 2VQSA 3EIQA 1T3LA 2N1BA 421PA 3KZ1E 5SZKB 2P5SA 1L2TA 1QHIA 3R9XA 3KUDA 5EE0A 2QSZA 1QG2A 3Q9LA 2FSIA 1J2JA 1FTNA 1M6NA 1E69A 5FOSA 5JCPA 1ETUA 2OBMA 3LW7A 3SNHA 4U7DA 2AXNA 4O3MA 1Y3AA 2BMDA 3FGNA 1VIYA 5F98A 1Z6GA 4US2R 3F8TA 2GXSA 4U02A 5ELXA 1T5LA 2ZETA 1R0YA 1U98A 1TEXA 2V54A 3RRMA 1Z6XA 3K53A 4ILEA 5JECA 1KOFA 2IA5A 2X1VA 3FVQA 4A8JA 3K1JA 1ZW6A 2I1QA 3SS8A 2F1IA 3DDCA 1Z22A 1GKUB 4N0EA 4OJQA 1GNRA 1BS1A 2BEKA 2X77A 5HPYB 2YC2C 1G6OA 2EFGA 2WMNB 2WWHA 3H2YA 3OAAD 3AVTA 3U61B 2GK6A 4DB2A 2AFIE 2QNRA 3THOA 3GLGA 3RVBA 5BN4A 2ZYUX 5F9HA 4A8JB 1ZCBA 2E87A 4C0KA 1J8YF 1D2NA 1G4UR 2P65A 1VYTA 3TLXA 1YHNA 1VG8A 2N42A 4KITB 1NJGA 3UK6A 1J90A 2JJ1A 4NU0A 3T34A 1OT3A 3GEIA 3SHFA 4KU4A 1N3BA 3QNUA 1QHSA 1NL3A 2ORIA 5D3QA 2OCYC 4G3XA 1G8YA 3K9NA 4D2IA 5EXPA 2BDTA 4DJTA 5TVKA 3A8TA 2WSSD 4PFSA 4I1VA 4QGFA 1Q3HA 1X3SA 3WHKA 3J81k 3Q7PA 4TMVA 2XTZA 1KK0A 4HUQA 2QBYA 4JYBA 2O8DB 3TAUA 2GF9A 3QKUA 3QENA 3TW4A 4CEHB 2ZRBA 4Q9JA 2R44A 4JLPA 1HH4A 2D3WA 2VHCA 4YMTA 1FX0B 3P4XA 1T0JB 3CRVA 1P2SA 1ZU4A 2VA8A 2WWGA 4HAUA 5AJXA 3PXGA 2HLDD 2WJYA 1VG0B 3CH5A 3GJ3A 5K8LA 1AK2A 4PX9A 1S3SA 5KYKA 5EZ6B 1R5BA 3CH4B 1NN0A 5LDDC 2GETA 3T15A 2BHRA 2OLKA 4M1WA 2FMXA 3WNBA 5EJEA 2ZRNA 3Q72A 1DELA 3KFXA 4Q4JA 3VR6A 4A2PA 4B74A 2JDID 1H8EA 2CVFA 2F1JA 3FKQA 4YMWA 2OILA 2JCSA 3GLHB 4LBWA 2V1XA 3PQCA 2CXXA 4URUR 4XIGS 2QMHA 2WWYA 3H84A 2RMKA 3E5HA 2Q0HA 3SEAA 3VKGA 1VG9B 4QBFA 2H18A 1FPMA 5DHAA 3U3OA 1JPJA 4MKFA 4RFVA 5JZVA 1P6XA 1NI3A 2OT3B 3Q5EA 4PQFA 1E2QA 2ZJ2A 3JVVA 2J9RA 2O0HA 3BBPA 4EPTA 1NN3A 1ZCAA 2RGNC 3AUYA 2R65A 2QPTA 4ACAA 4CT5A 5LD2B 4LHXA 1IBRA 4TMWA 5KSYA 4DSTA 4EPXA 4TQUS 2IUTA 2YOHA 1KKMA 5DN6D 3I92A 3IQWA 2D06A 3IKJA 4RSGA 2ONJA 3SJAA 1A4RA 2IHYA 3GLFA 1IN5A 4US0R 2IF0A 1AA9A 2IYQA 4JKYA 2ASEA 3NBXX 2PZGA 4FCTA 1US8B 4IJMA 1P61B 3OESA 3TVDA 2QGNA 2XOKA 4BLTA 1XNJA 4CEIA 2CK3A 4NCIA 1DADA 4TLCA 1G6HA 4KO8A 2QMEA 1E2GA 1COWD 1LW7A 2GJKA 3LXXA 4DCNA 1ZRHA 1PV4A 1I2DA 2GK7A 4M9QA 3MWYW 3W6OA 1U0HC 3I8SA 3VFDA 2CL6X 2VL7A 2NPFA 3KQNA 3RDPA 2VLIA 4KCGA 3RYTC 1P2VA 3KJIA 1KJYA 4GSYA 5J47A 3D31A 5KDOA 1E2EA 1TAGA 3T61A 2W2VA 3FMFA 1HT1E 1OKKA 3K8YA 2IW3A 3WRXC 1PUIA 3RNLA 1E0AA 2GAOA 3X1WA 3LFUA 2FFAA 1TNDA 2QAGB 2YC4C 3CKLA 2R2AA 1DAMA 1Z2CA 2GVZC 2OESA 4JBXA 2J0SA 3RC8A 3UWKA 3R8CA 3GEEA 4D25A 1JR3D 3CPJB 1GWNA 4OI2A 3ZS9A 1RRPA 4CT4B 3PUVA 3AGPA 5EXSA 2IYTA 4RZ3A 1N6HA 1UDWA 2VP0A 4QGHA 4LJ4A 4KVAA 4EUNA 2B7CA 2GILA 4JT4A 3TRFA 4IDHA 4WXRA 5DIFA 2ZR9A 4C0AC 1PUJA 2NQ2C 4HZIA 1UKZA 4HB3A 3QBTA 4LHVA 1W0KD 5CYOA 1SZPA 4A2QA 5JHGB 2JLXA 1T8UA 3K70B 1IOZA 3KTAA 2OLJA 3HYRA 1VECA 4GZLA 1NIPA 4AYXA 1KI4A 5IRCD 4E5UA 3A36A 4BE7B 3VAAA 3QEJA 1COWA 4HDOB 3JZMA 3OIWA 4JVSB 2CVHA 1YQTA 2GJ9A 3DKPA 1Z29A 1YZUA 2VSXA 3CX6A 1WMSA 1T4GA 2QMOA 4XWOA 2EFDB 4GFDA 3U5ZB 4Q18A 3F3YA 3BH0A 3N70A 2ZRHA 3NVAA 3C41J 2EYQA 2IEZA 5EP1A 4PZYA 3T1OA 3WHLA 3W5JA 1CJTC 1E1QA 4QHYA 3WNCA 1J8MF 4AKGA 2PX0A 2P6UA 2Q6TA 3GFPA 5TB5A 3AUXA 4F7WA 1SXJB 4Q9HA 1IXSB 4U5XA 1UBCA 3NBZC 1EFHA 3PIRA 3PG5A 4B3XA 3A1TA 4DRZA 1U2RA 4RJLA 4WW0A 1JB1A 1CXZA 3REGA 2A5DA 4XWAA 5JEDA 3NHAA 2W6ID 3EXAA 2NOAA 2ZEJA 1PLJA 4CYMA 3VU9B 2E9SA 4MQBA 2DHRA 1EK0A 2EW1A 1KMQA 4FMBB 2QE7A 4HAYA 4B43A 2Q9AA 4V0LA 4PHTA 2KSQA 4NYMR 3HR8A 2W0MA 4OHXA 3V4RA 1CBUA 3A4LA 5BXQC 1P60A 1VCMA 4B3CA 2ZS7A 4ZI3A 4D4MA 5CJPA 3L0PA 4UJ3A 1JXMA 4BQSA 5JJKA 3LVQE 3VR5A 4IDNA 1TL7C 4AG5A 3R20A 1JJ7A 1KI1A 2J45A 5J4HA 1CULC 2QENA 5B64A 3EIHA 2CNWD 4Q02A 2OHFA 4MRSA 4DXAA 3NDBB 1XXHB 3HR7A 1A82A 2J59A 1KJZA 1JQJC 2QU8A 1NMXA 4GMXA 4C30A 4A0RA 4EJSA 1P72A 4Z51A 2WAYA 2GCOB 3CO5A 5EP3A 3SFVA 5K8UA 3HU1A 3SE0A 1NBMD 4WZAE 2CLCX 4PQYA 2DWQA 3KQKA 1AQUA 4D4LA 1E2KA 1KGDA 4S2EA 2ZI7A 4MA4A 1N6NA 2BKUA 2FJUA 3MMPA 1HV8A 2ZUBA 3GQBA 4G0NA 2B92A 1FQKA 8OHMA 3SBEA 2GESA 2QTFA 4PC3A 3R9WA 1Z0AA 1DARA 3IHLA 3HPRA 3CNOA 4B3BA 5JS8A 3AKYA 1LS6A 3LX5A 2PEYA 4ON9A 2ZS8A 5HCIA 3RC3A 3UMSA 3JVUA 2D74A 1FL9A 1G5TA 4GP7A 4PAMA 4B75A 1Z47A 2ZYTX 4LC1A 4EDHA 4WZ6A 2V4ZA 5TMPA 4AD8A 4EIWA 3M1IA 4EQ6A 2BVNA 2W58A 3TSZA 2HJVA 1E9SA 1OHHA 2A5JA 2DYKA 2ODBA 5DISB 3TSOA 3EZ9A 2LCFA 4KBGA 5LBIA 5JJIA 4DLRA 1GM5A 4I1OA 4M9XA 3IPYA 3B1ZA 5J5CA 1KO7A 3T5DA 1AN0A 5JRZA 4DDWA 4WBSA 3TH5A 3QXJA 1P3JA 3SQWA 1EWQA 4A6XA 5IK2A 1CR1A 1LTQA 2VF7A 1WBDA 4L5BA 3EW9A 2MMCA 3LXRA 1E9FA 1WCV1 2EFHB 1VDZA 3B7GA 1RC8A 4D81A 1OFUX 2HEIA 4MKHA 1Z3IX 3L0IB 4W7SA 5JWHA 3NIBA 4BLQA 1SXJC 4JYCA 5A0FA 4G5RA 3CPHA 1OFHA 1KI6A 2XNDD 1W4RA 1HURA 5G53C 3L82B 1BYUA 5JI2E 3B8HA 2ZU0C 4AI6A 2WKRA 2DWPA 3EWAA 3I73A 1TU3A 2JLVA 4BPBA 4OYHA 5J40A 2ZJYA 3RRZA 2JLWA 2DR3A 3CBQA 4DHEA 2ZRCA 4OK5A 1OFTA 2BMEA 3KJGA 2YOGA 3OEED 4S35A 2GA8A 2GZAA 1XTRA 5FUYA 4JJKA 4MGYR 1GUAA 2CL0X 2EU8A 1CR4A 2ZIAA 3PVSA 4OHVA 2JLUA 1ZC3A 2PMKA 3VNUA 1ODFA 1GRRA 3CW2A 1KYIA 4DIDA 4JBWA 4MGIR 4ZV4A 4A36A 1GNPA 1KY2A 2ZU6A 1G7CA 1GAJA 3VKHA 4PZLA 2VO1A 4Q7JB 2GCNA 3BORA 4B34A 2J0QA 2I1VB 4L15A 1GKIA 2R6CA 1I4LD 2Z0MA 3NXSA 1CR0A 3SYNA 2J41A 2VPPA 2VF8A 4IOJA 2QORA 3BRWD 2AK3A 4EFNA 5KO2A 4WIAA 3GLGB 3LW8A 3WP0A 1YZTA 2ZS9A 5KPJA 4P3YA 2QPOA 1OIVA 1VHTA 1XJ0A 2NO7A 2BBSA 5FOWA 1CIPA 5BYKA 3B78A 2HDNB 4HLQB 5EZ5A 2NO9A 3K0EA 3C4JA 1N5LA 2ZRLA 4PHHA 1HQCA 1E9RA 2JEOA 5FTMA 3QXSA 4ZDKA 1W36C 3RANA 1YVDA 1D8TA 3KTAB 3WBJA 1FOEB 1HA3A 1YU9A 2YOFA 4G5QA 1W46A 4OKSA 2OXCA 4TYQA 5DI9A 2RCNA 1N6RA 2J3EA 4EPYA 2PZFA 2ORWA 3ADBA 3ZD6A 2YINC 3P20A 4A9AA 3N5CA 3D6TB 1LFDB 3GJ7A 1NLZA 1Z0JA 4HLUC 4Q5IA 1Q1QA 1E2MA 2FA9A 4NYJR 2VHJA 4DCVA 1G16A 1C9KA 1SVWA 1V5WA 2RGCA 5FFMA 3SN6A 3GLFE 3THXB 2WPDA 1S9HA 1MRNA 4X8LA 1XZQA 1M1YE 3GPLA 2REOA 1S0UA 2G0TA 2ORVA 4A82A 3HDTA 5FPKA 1DBSA 3H1TA 4M2LA 4EJSC 1KDOA 4PO9A 4O2RA 1G3IA 2KBFA 4FINA 4A0GA 4ZKDA 3O8RA 5C46F 1N0VC 5FL3A 1Q1ZA 4ASUD 3SJCA 3CLVA 3THYB 1KI8A 2XSZA 1EGAA 2A7QA 2GZDA 2DFNA 4GL2A 1LB1B 2RKOA 1T3HA 4DUGD 4QBIA 2MSCB 4Q21A 2FEOA 2QAJA 4M1OA 1MT0A 2V6IA 4HATA 4M1MA 3A4NA 3QPWA 521PA 4Q7KA 4DEXA 2YJTD 2XJ4A 1G5RA 3U6BA 1X1RA 2IXGA 3AF4A 1E98A 1RVDA 4B6EA 2QI9C 3K9LA 4XVUA 1K8RA 4HLDA 4EFLA 1Q57A 1PVOA 1U0JA 2GVDC 1VIAA 2ZSBA 2NG1A 5GJCA 1OH8A 4GP6A 5B30A 4K46A 4POAA 4P4SB 1NG1A 1RFLA 5LB4A 1N2CE 4DDUA 1OH7A 3G82C 2J7PA 4NKRA 4Q4HB 2F1HA 2CNWA 1BYIA 3B2EA 4FN5A 1MO4A 4B33A 2ZR7A 3ND8A 4B2IA 3EPKA 1W0JA 1E9EA 5JSZA 4FWTA 1P7CA 4XVQA 4TT3A 2R6DA 2UKDA 1NVXQ 3U7EB 3KB1A 3SQXA 1DAFA 3KX2A 5EP4A 4XSGA 2QQ0A 5DYGA 4BRUA 2OAP1 2WJVA 4ZCMA 3DVLA 3I4LA 2BC9A 1L4UA 1Z5ZA 3A6PC 3EIEA 1KJWA 2D2EA 3I3SR 4X8OA 4RY2A 2WZQA 4V0KA 5AJWA 3SDZA 3OE7D 2C95A 1W7AA 3AVWA 2ZPTX 5FPYA 4LBYA 2FWRA 5E95A 5CDFA 5UKDA 2W00A 3U3RA 2GEUA 3ZQJA 4ARZA 3B82A 5F3WB 4W9MC 2A3RA 2FFHA 4QHTA 3SYLA 1AKYA 4QGGA 1NVWQ 5JSZB 1QDEA 1WB9A 4PR0A 4RD1A 4B2LA 4URXR 1QVAA 3ZLJA 3FHCB 4Q1EA 4OL0A 2ZRFA 4TMTA 4PC2A 3KXLA 4Q4HA 4IXMA 2CCJA 2XXAB 4PXAA 2OEPA 4V03A 5KPDA 1HY3A 2I3BA 2N46A 4CGZA 1KI9A 1TEVA 1ZNXA 821PA 3V00A 2VHTA 3EC1A 3NG1A 5AJYA 4CEHA 5BQ5A 5TDHA 1CP2A 4MH0R 3THWB 3HPQA 2ZM5A 221PA 4YLGA 4MUAA 5E3HA 4XWKA 4IEIA 4B44A 4IDPA 4ITRC 2IYLD 3RABA 2WIBA 1GTVA 4M8NE 5AR1A 1NVVQ 1R8QA 1IXRC 1C4OA 3QF4B 1G8FA 1JECA 2YWGA 1R8SA 2WV9A 4HDQB 4L9WA 2XNDA 2IEYA 1OLOA 1D9XA 4RFSA 4GOJA 4B35A 4FW9A 3LAWA 2RGNA 5CM9C 1XEFA 1Q1BA 1Z0FA 5EP2A 4QBGB 4B32A 4CIDA 3MUFA 3ND9A 3AH8A 4JL8A 4MDEA 2VIIA 3QKRB 4F91B 4CEJA 3B5JA 4U00A 2VBCA 1HE1C 1E96A 1KO8A 4DKXA 1UDXA 1U8YA 5IT5A 1ESMA 3ICQB 1F60A 1U94A 2XSZD 4QNRA 2BWJA 4RZUA 4IVQA 1ZM9A 3H86A 1KY3A 3DEFA 1OFIA 3ZZTA 2A5YB 2IK8A 4TTRA 1DEKA 1W1WA 2R8RA 4LGMA 2QN6A 4LV6A 2FN4A 2C77A 1OB5A 5EE1A 1F48A 5CYPA 4BZPA 1R5NA 3AF1A 3MGCA 3N2IA 3PITA 4UXJA 5L3VA 4JT2A 5FL7D 4IRUB 4LRWA 2C8VA 4M1KA 1W4BA 2OCPA 4G1UC 1Z63A 4KI0A 1H8ED 1VHLA 4MITA 1VCNA 2PEZA 3P27A 3U7HB 1ZYUA 3NH6A 3DHWC 3QKSB 2B7BA 3ONWA 4JLVA 4Q00A 5FOXA 3GLIE 4HAVA 2RGBA 1XMIA 3AVOA 4OHWA 5GVRA 5AJZA 1ZNWA 1QG4A 1JQLB 3FMIA 2HXSA 3NTUA 1OH6A 4PO1A 1Z6YA 1XU4A 3T1QA 2AWNA 1W4AA 1Z2AA 2ZANA 3LX8A 4MGZR 1N25A 5JMTA 4MRRA 4IFEA 3GLHE 1A2BA 4GT1A 5DHFA 3ZGXA 2C9CA 2QY9A 1R0WA 1P5ZB 2JASA 5DI3B 1IN4A 5AUOB 5JS7A 1EFRA 1E99A 4QJ4A 4BFXA 2IYZA 1LY1A 1OV4A 1R4AA 3U7GA 1U90A 1N0UA 3LLUA 2NIPA 2EQBA 3EPJA 4PSVA 4TT3D 1AS0A 1F6BA 4HYYA 4RD6A 5FTKA 3RWMB 1NSTA 3K09A 5FUVA 2G88A 4JZKA 4JKIA 3OE7A 4EPVA 5CITA 1BKDR 5EQTA 3IBGA 1FNMA 2EWWA 3IEUA 4KLNA 4Z8YA 1NG9A 2O8FB 3FKSA 1KO5A 1MABA 2ZTSA 4IKEA 3ZJYA 3TKLA 1IXZA 1KI7A 2WPDD 1Z6AA 1E1RD 3QJYA 3CRRA 4PPGA 4UJ5A 2JLZA 1E32A 2IYYA 5FOTA 3AVYA 1KMHB 4ZDJA 3RS3A 3U6KA 1XJQA 3H0KA 3U2QA 1MO3A 4IVRA 1ZIOA 2ZRGA 3CRMA 2CDNA 2FPMA 1ZM7A 5AWFC 2ZJ5A 1EESA 1RKBA 4Q48A 1IM2A 1I2MA 1SVIA 2H8KA 1XCGB 5J4LA 4BFTA 2PBRA 2O8CA 5HE8A 1QHGA 5GVSA 3VU9A 2BCJQ 3PEWA 1RJ9A 5DGXA 4B6FA 4BLRA 1DO2A
chains in the Genus database with same CATH superfamily
4C14A 2Q28A 4DV4B 3NOQA 4W7HA 5JCZA 2JC3A 2JA1A 5J2TA 1NVFA 1KSGA 1V7CA 2CMHA 4PSCA 3EGOA 4DEYA 1GCUA 1THMA 1V43A 1X13A 2W6JA 2F3SA 3NCTA 4ZHQA 4DGSA 1GPWB 4QL3A 5C35A 2EFEB 3IOCA 1YTLA 3NT2A 1TZ2A 4MARA 2I2WA 1K06A 3CX3A 5DSXA 3WMWA 1BDHA 2DRIA 1LSJA 2X6TA 4ZCTA 3EVCA 2O8EA 4O1HA 2WVJA 2CXNA 2AA3A 2VCEA 3ANNA 2GN4A 4MDFA 3TZEA 1R27A 3T1TA 3F71A 2JCGA 3Q3JB 4TX1A 3Q85A 4ZAVA 2OV8A 3MCWA 3E9QA 4JVMA 2UZ4A 3DFMA 3FOCA 3M6IA 4MV3A 4MVJP 5G2OA 3KWFA 5I4CA 1T15A 3IH5A 3CVWA 1YK0A 3LWNA 3CLHA 2AZMA 1LUAA 2ISCA 1RPTA 2HSZA 3SEFA 4J0EA 4WDQA 2QD2A 2RJOA 4JJGA 3RTDA 3EUEA 4ZN6A 5K03A 4DCSA 1YDWA 2A94A 3RS2A 4FCCA 2D1TA 5CA0B 4Y0VA 4GYWA 5KYGA 5E0OA 1VE6A 4R1OA 2OFXA 3CIOA 4I5EA 5D3MB 2H11A 3PVCA 1M8KA 3BFJA 4GC9A 2ZYGA 3S2IA 2XXAA 1A04A 5F2EA 3OQPA 3HYNA 4Q3CA 3S29A 2IKQA 5EINA 5SYAA 3G59A 4FOOA 1Y4UA 2IW1A 1J5XA 2J9GA 4YAJA 4XXHA 2CBGA 2Z98A 4LVCA 4Q4AB 3RC1A 4EMSA 2I4OA 3LDGA 1IMOA 1YS1X 1BMQA 3SSOA 4CMGA 2QTVB 2FLWA 4V1CB 1DO0A 1HYEA 2EARA 2O8BB 1H4VB 2GK4A 4QT0A 3NI2A 3BGIA 1XD8A 1R12A 3JTMA 3FR7A 1G9XA 3O93A 1FNNA 1BVYF 4R7TA 1YR9A 1RBYA 1ZNZA 1AUOA 2CEKA 4FMDB 4FMDF 4RBNA 3V5NA 5BUQA 2UU9B 4HYQA 4P34A 2WNHA 3PCRB 5HCNA 3H3JA 3BL5A 1PX0A 5AVVA 1ORRA 4GZ6A 3C7DB 3BK7A 3DB2A 2OZEA 3QUSA 5KWEA 4JSYA 1L5MA 3DXFA 1QFJA 2NZVG 1LQ2A 2BEVB 3WL6A 1L9XA 2O50A 3B1KA 4PHGA 1IBSA 3CEJA 2A57A 1YS6A 4K6OA 3AM1A 2ZPUA 2OCLA 4A0HA 1YDFA 1KSHA 2AJ8A 1C0PA 3KE9A 1DXOA 3SR4A 1YQGA 2CLDX 3WO0A 3AEUB 1P7YA 3WYGA 1XEXA 4DY6A 3OTGA 4HNHA 1NN5A 1QH8B 2Y0BA 1AKWA 1IQPA 1M8GA 3FHJA 3PYXA 4J16A 3KKOA 3V80A 2FSVC 3GGCA 5AIAA 3ZXXA 5FV4A 5DX0A 1PI3A 3N6RA 5BVHA 1BMFA 2NU6B 1PQUA 3DAYA 3NDPA 3AU9A 4JJZA 4CDRA 3MC1A 3D3JA 4JLNA 4ER3A 1I0IA 1KRHA 3FOZA 3WAJA 4YAUA 4JLDA 1T1SA 2QPAA 3A27A 2CNKA 3I1YA 1H2RS 3P26A 2I99A 4PY2A 3RFTA 3SU8A 4EG7A 2WYUA 2AV6A 3EDYA 4Q03A 4ARZB 4ECEA 5HRAA 3LE8A 1M10A 1P0IA 4W5OA 3CONA 5HG0A 2UXDB 2GJAA 2PVCA 3RSGA 1G5PA 3OWXA 5EJIA 4DWWA 4EEKA 5CXQA 3WRWA 1KORA 1U3VA 4C1NA 1EX9A 1PJSA 2FXVA 1XJ5A 3SHWA 4UHBA 4A26A 1WV0A 2GT1A 2JI6A 3LZ6A 4IQ0A 1LDYA 4NHOA 4QTUB 4C07A 5BW8A 1ZK0A 2CFTA 4ZP1A 2YS6A 3Q98A 3C4QA 4X44A 2E55A 3CX7A 1ZD4A 1GA1A 3QWFA 4N01A 1PDWA 1MZPA 1U2ZA 1U2DC 2YN2A 3E05A 3IC5A 2KQUA 4CN9A 1F6DA 1E1CA 1OGIA 1JSZA 2C58A 3CEAA 4N18A 4ZKEA 3AVVA 1NW3A 3KV3O 1P2GA 5G0UA 3I8OA 3CVJA 3DZBA 5LZ2A 3UJPA 4J03A 5HZMA 3GVCA 1UM9B 2FSFA 2JJ1D 1ZIDA 2PO5A 3EXFB 2Q46A 3ZWOA 3P2MA 3EPHA 1G1MA 1VOTA 4O4JA 2AC4A 1DT3A 1PNQA 2QUKA 1H42A 2Q0QA 3PCXA 3R77A 4YCCA 1OLUA 1MIHA 1X38A 1HO3A 1GTZA 2Y67A 2W6JD 1N4DA 3BZWA 3TLGA 4E21A 3HXQA 3E5NA 3F47A 3T3NA 1Z0IA 4JCOA 3V8MA 1LZLA 2IZOA 3LVRE 3OCVA 1DAKA 2G80A 3G2JA 4RESA 3WGOA 2VP2A 3V9AA 2R87A 5AI8A 5D5PA 5G40A 2C20A 2ZRIA 3MWDA 3KDAA 4KN5A 3I5UA 5DHTA 1XDGA 4HD8A 5G3YA 5KDLA 3H4VA 4EKIA 2WJJA 2Z58A 5L3QA 1UBNA 4QQFA 1DKMA 4DYDA 3L7DA 1Z7WA 3R0JA 3MW8A 1SPXA 1KBOA 1DAGA 1KAQA 2NGRA 3K8ZA 3V4FA 2CHGA 5A5EA 2RI1A 4XCQA 2ZRJA 3M4ZA 3F3KA 3OQMA 2I9KA 2P6RA 4E30A 2BBTA 4F92B 2A8YA 4LI0A 5AKZA 5DWVA 3TW6A 3VYUB 2OGSA 4RLHA 5IYZA 4LRQA 3TTTA 2PJRA 4XLLA 2ZB3A 1MBZA 2OM2A 3IR6A 4QOFA 4B3MB 4ND8A 3UH1A 2G04A 3AR5A 4I14A 4JL6A 3ZG6A 2XRZA 2GBLA 3QVVA 4E4TA 5HKAA 2ZAMA 1K6MA 4GMKA 1I2ZA 4LNUA 4Y6GB 2XCTB 2M6LA 2PVSA 2VTVA 3G0GA 4OLHA 2V0GA 3KEMA 3WA6A 3L0YA 2P8JA 1XF1A 3BXPA 4DEVA 1G5FA 5HFNA 3UJHA 2CUKA 3D8UA 3WGJA 2EF0A 4HZGA 4JEUA 4JVNA 4AJHA 2G36A 3ODPA 5A3SA 5L4SA 4NJMA 1FP7A 3KQLA 2AEMA 1CY6A 4MQUA 1JILA 3E7FA 4MWDA 1PWYE 4DC0A 3IJPA 2ATIA 1CY7A 4OK6A 3D1LA 2DWUA 5CA0F 2NW6A 3F1KA 1CJVC 1L5VA 4M1SA 5C1PA 5B1SA 5EIHA 3PLRA 3QYFA 4N5MA 4DAOA 2V7PA 1E9AA 4DLBA 4IOLA 1VIDA 3KTDA 4QUJA 1Y80A 4ZCPA 1SNYA 4LSGA 4XB2A 4QU9A 1EQAA 2YUIA 3PPWA 3AY3A 2PLAA 3OCUA 5DGCA 1LI7A 2ANBA 1W5TA 2K2QB 3CUYA 1OXKB 3ZJVA 4YECA 1A69A 1XTQA 3HFJA 4C0QC 4ZYYA 5KHLB 4EJ0A 4HX9A 4PN7A 1M7HA 1DDIA 3C8DA 3DO5A 5LWHA 2Q2QA 2GN1A 2GQ0A 2D0OB 1L5HA 3V2UA 3JQEA 4M76B 4L74A 4X97A 2ZATA 1L7QA 1YIAA 4YUAA 3BSSA 1KNXA 5EHQA 1ZIYA 2P9CA 2V5AA 2YRWA 3EMBA 4IS2A 2R4QA 4U9HS 3G7NA 1HORA 3EZ7A 3OT1B 4ND3A 3HZOA 4LZZA 5LZ5A 4HNAB 5AYVA 2JCBA 4FFMA 2CHUA 4MEJA 1MJFA 1RZ3A 3OJ0A 3PDWA 4YRFA 3VZCA 1QQTA 1JQDA 3DE1X 4Y6RA 1OSNA 4HJXA 4C05A 1FMFA 1BMFD 4BO0A 1NMSA 1SKYE 4L4UA 3OIYA 2AW5A 2V45A 2IBSA 4BJ1A 4UHJA 5KYXA 4E07A 2X6QA 2GPAA 4JODA 4F1KA 3BD9A 1E7YA 3GHHA 5TARA 4FYJA 4HQNA 5ESWA 1ONNA 2A7XA 1AKMA 5GZ1A 2PMCA 3SJBA 4ENUA 2AI2A 4B1FA 1GZ6A 2HWXA 3WIBA 1KKUA 2CBZA 3G89A 3KQYA 2XH8A 5EPEA 4AK9A 3A58B 1ZL0A 1UPXA 2C2HA 3UHPA 3LLSA 3C8ZA 3Q0TA 3RLFA 3AHCA 2ID8A 2MWMA 3CF6R 4HI0E 3RNOA 1J4AA 3K1AA 4B48A 1YE3A 3F6EX 1ZOSA 4KWHA 2PL3A 5HUQA 1ACMA 4QPZA 1DEOA 1JH8A 1EU1A 2B36A 4J3FA 4ZI7A 3OZ7A 5TJHA 2MCFA 2QP9X 3MWEA 1RQ2A 2JD1A 1QO0A 3QEMA 4G4SP 5I45A 2OCIA 5FBHA 2BPOA 4O08A 1MC1A 2Q4OA 4HN4B 1XZFA 4NZMA 1JPVA 2C4TA 1TTTA 2ICAA 1SU4A 5CTAA 2JEZA 1QG6A 4U6NA 4Z6KA 5H9WA 1RRKA 3IQGX 3Q9SA 2HA7A 4NYIR 1K3UB 3HBAA 3HWSA 1R5OA 3OJXA 4KB5A 4RKQA 3ZKAA 1F0PA 3KC2A 1GITA 4I1RA 2AGVA 2XDAA 4FC7A 4YIKA 3EMKA 2FP3A 4CKBA 2IX3A 1LBHA 2ZCVA 1E1MA 1CQXA 2BH9A 3DMTC 3GGPA 3VH4A 1UXJA 1P5RA 1LZKA 4E5DA 4NDZA 4ZQBA 2BBWA 5TGZA 2ZTMA 3IUSA 4OI1A 4DT1A 5KNLA 3JARA 1I8TA 4M36A 4BB6A 3TZBA 1LLCA 1WXFA 3DKVA 1TLLA 2ZRKA 3CU5A 2BMFA 4HXGA 4OB8A 2WD7A 3M49A 5D7BA 5GONA 3CZRA 4EF6A 1XMOB 1B8NA 4LZNA 3QP9A 2C4WA 2HTFA 3GC6A 3C14C 2WWXA 3GPIA 4NCXA 1ZS9A 5BW6B 2A9RA 4QGAA 1STOA 3SQMA 3DOCA 4Z99A 3THSA 5LKRA 4I4LA 2YJGA 4DC9A 3ZD7A 2H7VA 4A2CA 3T35A 3VZBA 4GX2A 2P0EA 4JY7A 1JJVA 2QE7D 1B2LA 1JDNA 3QG5A 4NENA 4R0VA 1HUQA 3T9CA 1MDBA 4YX9A 4IJQA 3LC2O 2XB2A 3TRKA 4X7RA 4EHDA 4K6GA 4DA4A 3HU3A 3JD3A 3CWQA 4B4VA 2WF9A 4MYDA 5HUHA 2XZLA 1JYFA 4P7FA 1RRFA 2PD3A 5A03A 3HCFA 4BOYA 4KHPB 2UZIR 3FUCA 1BRTA 2RARA 3CR7A 3OEHD 4M60A 4N0PA 2NXCA 1QTNA 1B4DA 3EJ6A 4FJ2A 4INPA 3T06B 4BC0A 4C7VA 5JISA 3U1BA 3FAZA 5DLDA 1HSZA 1Z26A 3K1ZA 2G17A 1LLUA 1C14A 2P4QA 4IFIA 1YRYE 3MAAC 4KXFB 5ECGC 3MTQA 1Z08A 1BDMA 1ECFA 5CLLA 4IEFB 5FTJA 5K8IA 4XIFA 3X1XA 4EHJA 4L4XA 1P62B 2R6HA 2JLYA 1J5EB 3B1XA 4KNWA 2KHZA 4AFNA 3ESRA 4ENSA 1Q91A 4KYVA 1HE5A 4NENB 3W2TA 5IDWA 2C7QA 2AHOA 2VR1A 1H2FA 1CB7A 3IULA 1YKSA 1WA5A 2H17A 3PRHA 2XTNA 1MR3F 1VMIA 3LH5A 3QBVA 4FQ7A 1XKXA 2Y93A 3A4TA 5HJ5A 4BLOA 2OGUA 4D5GA 2AG0A 1L5FA 1L0BA 1E60A 3QFFA 5BN5A 5J4KA 2JFPA 5F52A 1UKVY 1XD2B 4ZPXA 2V59A 2AXEA 3TSYA 1E2HA 2LW7A 3PUKA 1KERA 1USKA 4PHFA 1E2LA 1GTL1 2VF5X 4IXNA 1HXHA 4ZC1A 3PA8A 1L5RA 3C3YA 4QOSA 2DR0A 4D6PA 4ALNA 3PGA1 2VRBA 1T5HX 4L8YA 1KEWA 2HWKA 2VHEA 4MZDA 4AS2A 1XMVA 4BX9A 1DUSA 1THTA 2E3JA 2JAQA 3QTBA 1SKAA 4I36A 2OFFA 1VBMA 2ERXA 4IJUA 2H9YA 1DKQA 1TMKA 3ICWA 4DIFA 1IAQA 3MD0A 1MZVA 3IPXA 2VPXA 4P08A 3DKKA 5I9BA 1WWKA 3QZUA 4MI1A 1UIMA 1CIVA 1TVMA 1RWPA 4TLDA 3OAAA 2R2GA 4FFBA 3PWTA 3TVTA 4JNCA 4F4UA 4LTMA 5CJ2A 3RUEA 2D7DA 2C4KA 4G97A 3EWSA 1MLDA 3Q1LA 2OP0A 4I9UA 4QOJA 3FPJA 1KMHA 1A9TA 1MORA 1XRJA 3SM9A 1WDTA 3LOQA 4GYJA 2NNWB 3AEQA 4I4CA 4P4UA 5K3BA 1F9AA 3NV7A 2C99A 1QIGA 2GOYA 4CR7A 4D9NA 2B1QA 5A1TA 4X3CA 4HDMA 2GEVA 3FTDA 2O8BA 1NR1A 1ZUIA 5BSFA 5C5CA 2VDOB 3H11B 1ZD9A 2AG6A 3LT4A 4NCKA 1U99A 4PLWA 5D8DA 3W2EA 3G2PA 2IUUA 2UAGA 4KO4S 4XYBA 4YCMA 2XMZA 3LQ4A 4DA7A 3S28A 3HQ4O 4UUNA 4D8WA 3H8SA 5D3MA 4WQMA 3EEYA 5IT0A 4ZQIA 2OPBA 1YJAA 3D81A 1GG2A 3Q5DA 3TX6A 2JG3A 2C2MA 2BLNA 4R9VA 4YUYA 2G1AA 4H3VA 4D82A 2HYIC 3GO4A 1TJ5A 3K70C 4LZPA 4YXWD 5BOSB 4KMRA 4AWBA 3CSUA 2ZUTA 1BWQA 5IKXA 3K0AA 1LWNA 2NO6A 1AC5A 3F6CA 4X6LA 4LF8B 2XNSA 3EXIA 1F8FA 4EB8A 2W4IA 1L5HB 1XHLA 1MV8A 1Q6ZA 2YHBA 2Z08A 5IKPA 2IDJA 3RUIA 5JO0A 3MQFA 4Q1FA 1ISHA 2LDBA 3SC2A 2QW8A 1ZMTA 4NFSA 1CQWA 2IZZA 3KDPA 4EM6A 5CD1A 3HGTA 4C89A 2BFBA 3SI7A 3F9CA 4H31A 5KOIA 4YAOA 3CW9A 1VBKA 2W6PA 5FYQA 3IDAA 1AJEA 3NM5A 2VNHA 2HNAA 5I3ZA 4YWHA 2WEKA 5DM60 5L3QB 4N12A 4B3FX 3DCYA 3HMKA 3NKFA 3R0ZA 4BQOA 4NV0A 1XXLA 2ZE7A 1G8JA 6ADHA 1X7WB 4TQGA 3KTOA 4MWCA 3W5DA 4IQFA 1MD9A 2C5GA 2JJ2A 1QFSA 4OQQA 2HRCA 4PRYA 1ZK4A 2TMGA 3SZGA 2FZCA 3EOBI 2PMEA 4BN0A 1OX6A 5BQXA 2CFRA 3QHQA 1RQLA 4F2PA 1Y82A 2IYXA 3D7MA 1MAAA 5F35A 5LXTF 5BWBA 3D1VA 2BFNA 4JP1A 4EKGA 3JZIA 1RMTA 1BCRB 4C04A 1HL3A 2IE0A 3RU7A 4GKBA 3JD2A 3L77A 3UG7A 4R6WA 4ZQHA 4QJ5A 3H5OA 4DQXA 2QT9A 1SHJA 1E7MA 1SQGA 3KFVA 2GCIA 3EARA 3NPMA 1LK5A 3B9RA 3QOFA 1IZ7A 1W29A 1GY8A 1PR9A 3PUXA 4GNKA 2PR2A 4LZJA 4OUDA 4CKEB 1TEHA 4N5IX 1SY7A 3FWYA 3LHKA 3ROTA 3TSZA 1WOMA 4NH0A 5GPBA 2P0YA 4JC5A 5J63A 1GRVA 2OV6A 4RF2A 1C7FA 1XRRA 1FRZA 4MSUA 1KQOA 1J99A 4UQOA 5LUAA 5CTJA 2ZXUA 2NTYC 2ZVDA 2GJ4A 1N5KA 1YZVA 2WJ4A 1D5CA 3I9KA 3KTFA 2WINI 4RPHA 5EJGA 1NUAA 5HOQA 4HMOA 4MVJD 2O8CB 6NULA 1ECCA 1TKRA 5IM5A 3OHPA 2QVZX 2W2KA 1B3RA 4N5HX 5CX1A 1WXIA 3RUHA 5B3JC 1DG1G 3KJZA 1GGFA 1M83A 2IPNA 3EBOA 3AFNA 2YVQA 4BRZA 4ZJYA 3TE6A 2H1SA 1OTXA 3N8DA 1H9BA 3LC1O 3UMMA 4DHWA 1QB8A 3AHIA 3QUTA 4WUTA 1W73A 2HCBA 3PFGA 2OXRA 3EQZA 3FDXA 3PC3A 4NNJA 1FFGA 1LVHA 4MIOA 4RKEA 1FFDA 3BJMA 4YH1A 1BDBA 3KELA 2ZJ6A 5FOVA 1XEXB 4D0GA 3GNLA 3ZU6A 3U3MA 4CLRA 4BMOB 4JUIA 3GRPA 5C1BA 3ZUPA 3AKDA 1NONA 5DNDA 4U2DA 1AG9A 1SCAA 1RIFA 2YHSA 3OO0A 4FB4A 1MOZA 2EYUA 3PFFA 4QRHA 3ZGYA 4GRAA 4OK3A 1E58A 2YIDA 3HVKA 4M46A 1IOLA 4ZYLA 3LNCA 4QU5A 1FZQA 2POCA 4RGVA 5AQEA 4L5JA 4R2HA 3H3FA 4MRVA 3EXG2 2GBIA 4QUDA 5EG5A 2IUSA 1L3CA 3BB1A 3QMMA 3T7EA 4Q7LA 3BN3A 1YDHA 1T8TA 1XZCA 1N9GB 3LO5A 4II7A 5HKLA 5JFTA 5LOVA 1Z0DA 3B9QA 5KNDD 5JAZA 1Z73A 3A2MA 2BFDB 2G40A 4F5DA 5B7GA 2OQRA 3FFAA 1LGYA 4KLRA 4NE9A 1V16B 3ROXA 4H35A 4TTJA 3F7OA 4RTMA 4MQ4A 4MTCA 4A15A 4GXQA 5IJ9A 4TVKA 1D04A 3DPIA 1VG1A 1M67A 4IYRA 1T9KA 1PTJA 2HQBA 3W6PA 2BUBA 1VIVA 3K92A 3MINA 3AX6A 2XKAA 3NHRA 4I4TF 4LE1A 4BLWA 2PU7A 5U9CA 2ZIWB 3E5RA 4PS0A 4D7AA 4IWYA 3VISA 5I3CA 1CZRA 4LYAA 2REBA 4Q4AA 4G1VA 1WB5A 3HM9A 4RQAA 4B8WA 3QE2A 4DPKA 4FYKA 2DHCA 4XOIA 1NLFA 2X13A 3WSVA 3QWHA 1E3WB 2B30A 4MS4A 3H9JA 2CXSA 4BN5A 1V16A 4C9BA 3AHJA 4PZCA 5HM8A 3GEBA 1OCEA 1XWFA 1BXGA 1SU8A 3MCAA 2DUWA 2H0QA 2HT6A 3P4YA 2ESRA 3ESCA 4OV6B 5LOVB 5DP2A 3JYQA 1OZHA 1V8ZA 3OFVA 2HN9A 2WKSA 4HUQB 3VPHA 1AKQA 3COWA 4MVCA 4PW0A 1QFYA 1Z2OX 1I2AA 1MQAA 2BAGA 3IUQA 1E64A 1YS7A 3LHFA 5HXAA 4PXSA 2FLVA 5IF9A 3INNA 1LLFA 2HBRA 4JUBA 3IE1A 3IT3A 5LJIA 4DBLC 1Y6JA 3CH7A 3KZXA 3N7AA 1N6OA 1J0CA 1WSBA 1CY1A 4OKNA 5EXTA 3TZKA 1Q0QA 2EX4A 4Z1MA 1QQ6A 3WLFA 4BVGA 4UOQA 1JEYA 2A0XA 3ZW7A 1SURA 1NFQA 3ETHA 3GBVA 4DL9A 1LH0A 2JA2A 2G9VA 2VK2A 4JSTA 4UHCA 3EK2A 3G5UA 4KBFA 4RF3A 2VUTA 3FCUB 4Q3AA 1E3WA 3OX1A 4X1KA 4CV3A 1P2UA 2VT7A 1EFPB 3BJIC 4L8WB 5D84A 3D7LA 3T9BA 4KDFA 4K9MA 3PWSA 1RWNA 3JQGB 1IH8A 3FG9A 4OJMX 2QVXX 5CH8A 1O94C 3FTPA 3JRXA 1UJBA 4GRDA 4RPCA 3T5GA 5BR4A 4HN9A 3JQ8B 5ALLA 4NCJA 3DEZA 1NXSA 3ZN2A 3QJGA 3QUAA 1H65A 4W63A 1XTSA 5BSWA 3EDCA 4BEVA 3R0XA 4MRAA 1MKYA 2FF7A 3W9UA 1N0HA 1ZJ6A 1YIDA 1FW8A 1M73E 1A7JA 2H5JA 4OOFA 3UF0A 3VQTA 1KPHA 1WIWA 3OX2A 1TF5A 1R4MB 3NTLA 4DLZA 1ODIA 3G8DA 1P1RA 5T4BA 4KIGA 4WZZA 1FJXA 2RK4A 1MMFB 1NJ6A 1D6JA 4OFWA 3TCXB 1FNSA 1MEEA 2F3PA 2C0PA 2OV2A 1H8HD 5T6BA 2JRCA 1NW5A 3EHDA 3F67A 1THZA 4J8PA 1SHZA 1WEHA 1PLLA 4IUBS 1RMQA 3U13A 1A9XA 4UM9B 3PJRA 2X19A 3G17A 3AIKA 3BXZA 4LWQA 4XDZA 9ABPA 5H8WA 4PM4A 5H59A 4JJAA 3DDUA 4D79A 3D3KA 5JROA 3TECE 1UPBA 2WLSA 2J3IA 2H2GA 1QGDA 2XNJA 3E18A 1MGOA 3E1KA 1F8XA 4NFHA 4BWGA 3N2EA 4EFMA 1JL3A 1GZDA 2VYCA 2RD2A 1L5SA 3T9DA 4J7UA 1NVDA 1VKRA 4RHCA 2FEPA 4C3UA 4JBGA 1XU9A 1T2NA 4FK8A 2GKSA 3B52X 4O4LB 4G24A 1XQYA 1LV8A 3PE6A 4E2YA 3JU3A 1N6PA 5IZ4A 1FS4A 4R7ZA 4ZV9A 5MHTA 1EZZA 2W6ZA 3ICCA 5BWOA 4XGRA 3CVUA 4ZVNA 3MHTA 1W581 1QUEA 3O3OB 3EZNA 1L7NA 2XOKD 1R2QA 3LUHA 3OIFA 2Z3VA 5EGSA 1NP3A 1L8XA 4HVLA 1QE0A 2IXEA 2VTKA 4BYGA 1XCPA 4HLNA 2VJCA 1JFSA 3GP5A 3IO3A 3DOEA 3A32A 4FC6A 4Y2YA 1FCJA 1WD7A 3NAGA 1BU5A 1YZ3A 2PKYX 4G37A 4K9PA 4QUEA 4TWIA 4OHCA 5FFFA 4O0MA 1JAIA 4FHGA 1J25A 5DTRA 3L1JA 2ZYSA 2M9MA 3ELBA 3IODA 4FP9A 1Y3HA 3HDHA 4OHMA 2MSKA 4WKOA 4BJHB 1Z5NA 4H3KB 1GDTA 2ZSKA 1E79D 1XAJA 4QXQA 4KMSA 1E2JA 1WMFA 2J0UA 3KYJB 5IVDA 4YP9A 5AW6A 4H3HB 4IM7A 2AZ4A 2AXPA 2IWRA 3UJ7A 1RP7A 5EJ8A 3BMXA 4B6QA 4BNLA 4RDXA 1DTEA 3L6DA 1O77A 1DBPA 2XYVA 3HVUA 5CIWA 5TQ2A 3CUSA 2XYGA 2I80A 3FGPA 3U4IA 5E1BA 2HFKA 4M6WB 2FG5A 3OBIA 2KB0A 4ND4A 3ZU2A 2JFFA 4TWZA 3RF7A 2GTPA 2HV9A 2VEDA 2BN4A 1QH0A 2AYZA 2BFPA 2O4CA 3STUA 3ZE9A 1OYYA 1QJ4A 2HJ9A 1EX6A 4M0LA 4YY3B 4WH0A 4DR1B 1U8EA 5EE5B 3CGWA 3DA8A 3PPXA 4WESA 1UKCA 1XLTA 3A6GA 1AS2A 2WU1A 4I1IA 4R8KA 1E6WA 1K92A 2FOLA 4M1QA 4OQFA 4URVR 3UHAA 3V1LA 2VQ6A 1P2FA 3DZFA 1CFZA 1QZUA 4XVRA 4ZT7A 3ZLVA 5BPHA 3KSZO 4KQJA 1T34A 1SUWA 3KPVA 4MA4A 5ITSA 1ORWA 4RUKA 4QGSA 3L4JA 4DDVA 1CJMA 1RJWA 1ZL2A 4NU6A 4YO8A 5F51A 8GPBA 3HKBA 4R68A 4ZOLB 5K3CA 3WDLA 2KW5A 1T5BA 1RJGA 3HSKA 4Q9KA 4TMZA 3UBMA 4CKCB 5FIUA 1T9BA 5LA6B 4DTIA 1P7ZA 3BH7A 1G9SA 1NBME 4X91A 4L0CA 5LB2A 1JDTA 3ZBQA 3W5SA 4EHNA 3LTEA 3VVCA 1W1UA 2X5OA 3KL2A 3ORRA 4CG1A 3GJ0A 2OTCA 2V9ZA 2AOTA 3K0FB 3AP2A 2C5LA 2G76A 3WL5A 1F2TB 1RM0A 4Q9AA 1ZMBA 2HK8A 1LDEA 2OGTA 1ZG3A 1GVHA 2X8JA 3BDAA 1XMPA 2HLPA 3D5EA 4TUYB 5CT5A 1Z5OA 5DWDA 4B76A 1HEIA 1KI3A 1OIWA 3L0DA 1PR3A 5ICMA 3I2FA 1W34A 3ZNPA 1LDNA 2YHIB 4JQOA 3IMEA 4LF7B 1ZD1A 1H1LB 1FP6A 5BN4B 2EP5A 4KZPA 3QXHA 3ZWWA 2ODWA 4KFRA 1N1EA 3CCCA 2QTMA 3UENA 1U63A 3CR3C 1KQGA 1S8OA 4A0FA 4RHYA 4HYTA 4C4AA 4DKJA 2VJMA 3F4BA 4UAJA 5DBIA 5KJEA 3HBFA 4JP2A 1PJCA 2PUBA 2Y71A 2GJ8A 1M34E 3ONVA 3BE4A 3DMDA 1TAHA 1JZSA 1TZMA 4CRWB 5EXXA 5CDTA 3PQ7A 3UAGA 5U4QA 4BO5A 3Q6MA 2P2SA 1CLUA 1E1YA 4M9SA 4TYMA 2WU0A 4ZA2A 2FZVA 1O0SA 4ZT4A 4B40A 3TQSA 1O95C 1W0KA 3RRXA 1H23A 5K99A 2B8JA 3SFZA 1N32B 2QUBA 2PH5A 1BMTA 3W3AA 4TRMA 4B7ZA 4UU0A 4KP7A 3EQ7A 6REQB 2FOXA 2J7KA 1SUCA 1TRKA 1ZRNA 5AVRA 3BGSA 4AU1A 3TG8A 1LEHA 2CXTA 1KETA 3LRPA 4O3FA 3I30X 2YCLA 1XZEA 2FN7A 3LFTA 4FFLA 3FCAA 3NBQA 3DFIA 3I01A 2FW0A 1SKUA 3R6LA 3QI7A 4BFCA 4E5KA 1ADJA 2QRZA 4OH7A 4NMXB 2DUJA 4C03A 2ODEA 1G7SA 1GUDA 2EG5A 1XK7A 2W7TA 1X70A 2ZE8A 2WMYA 1C4KA 4BB9A 4PC1A 5B1IA 3QXXA 3RFXA 1NJFA 3W2GA 4HWSA 4MRMB 3F78A 4RV4A 2VHUA 3H2JA 4PVCA 2F9LA 5KQMA 1VLJA 1GA6A 2RHHA 3AXSA 3OU2A 2QTTA 5T7BA 4AY2A 4Q9NA 3HWRA 4TV9A 4DZZA 1JDVA 3MGKA 4GVLA 4HGPA 3B3GA 4ENWA 2DPGA 1AZSC 3AERB 4WBNF 3ELWA 1TK2A 4DFDA 2VH2A 4ER5A 2JHAA 4INAA 2Q1UA 5BNIA 3W8EA 3ZYZA 5KC8A 3N86A 2GR9A 3D8RA 3K2IA 4FHFA 4EMUA 4XUDA 1W44A 1ZGCA 3L1KA 4QBHA 5ICFA 5HWSA 5DX8A 2CDBA 2O52A 3ZDBA 1WRBA 2B1RA 4PQGA 1SPBS 5BMVA 1CUFA 5MDHA 2C98A 1YKGA 4ICIA 1XMQB 1BROA 4OUDB 3GVPA 2PY6A 2PGDA 4NI5A 5ILOA 2A88A 3ROPA 3TOZA 2Q9BA 4BS9A 3KAPA 1JLHA 1CY2A 1U2DA 1WZUA 5HDBB 4EMBA 1MX5A 3SPXA 2VUHB 3RS0A 1IN6A 1IUKA 4NCHA 4BASA 1REQB 2BHTA 3AUTA 4F4JA 2R00C 1MRSA 1QF9A 4Q3KA 3V8NA 1VSBA 5E4FA 1UPFA 1IE3A 2PVPA 1MG0A 2QX8A 4ZI7B 4IZHA 4GX0A 3EVGA 1TM2A 1Y4ZA 2C7GA 3H1GA 1VZ3A 1SUBA 3RVOA 2BD0A 1ZESA 3NP7A 2R6ZA 5JXJA 2UYHA 1Z83A 2BFCB 2WUEA 4G0QA 1IDN1 1O6BA 4MVXA 3U81A 3Q2OA 1WVGA 1XEAA 3ZJ5A 4DLXA 3KKPA 1O89A 2FB9A 5BRAA 5ITZA 1DRJA 1Z28A 5DYIA 1KEPA 2ERCA 2GWHA 3LQFA 2OCDA 4MGKR 4RU1A 2X2OA 2XKKA 2JH8A 2VRCA 1RQXA 4ZVOA 4EY3A 1PHRA 3SR0A 1RHJA 4LE2A 1ZNYA 2WM2A 5KSZA 1AM4D 4PAQA 4CEIB 2CZGA 1K8YB 1BAPA 2L2QA 2QOEA 2QPLA 1BWPA 2NZJA 3WOVA 1B41A 1S7CA 2CNNA 3RJTA 1RW4A 3AM3A 1JNYA 1HTTA 3DE0X 5GOTA 5TPZD 2G6BA 5FTNA 3WV4A 1JTFA 5FBVB 4C7OB 4EH1A 1E3EA 2H1HA 1E4EA 3G23A 3VX3A 1YFZA 3W1VA 4B3GA 1SMKA 2RHGB 1AXRA 1O57A 3IUPA 3LI2A 3VR6D 2I4TA 1ATZA 2F3RA 3HU2A 4D3XA 2PGNA 3KPUA 4ZI2A 2H2AA 2C29D 2OAGA 4NBKA 2GBLC 5JCOC 3P9NA 1JDSA 1NW6A 3ZHXA 1REQA 4MP6A 3WGQA 1UXKA 4U2KA 3ZHUA 4UNSA 3OUTA 3B5IA 3QKTA 4WN3A 5M04A 3OFND 1Y7TA 2AZXA 2NV2B 4UASA 2G63A 5FPSA 3FKSD 1BGXT 1JTVA 1ZM3A 3IP7A 4JEHA 4YHBA 5EUQB 4FFNA 5CNIA 4ZEXA 1A9OA 4DA6A 5IBCA 1K6JA 1CUWA 1N2EA 1YCHA 2Q6LA 5IUJC 2HBYA 4LXHA 3DONA 3T5MA 3AFGA 2Q2WA 2PWZA 3GP3A 3H5TA 4XLZA 5F73A 4BFSA 4CLEA 2CE2X 4UNQA 4KX3A 2O0LA 2PZEA 1R6UA 4RANA 1LF5A 5SZHB 5EJ4A 1CU1A 1O96A 1M2HA 2JH9A 5KOHB 4DUZB 3DDHA 4PLZA 5E8RA 1C7RA 3CPSA 1YDEA 5ESXA 1HNNA 4KR3A 1SCBA 4M9RA 5B6IA 1DTSA 1CS4C 2ZSAA 1WUYA 4FKBA 4QO7A 4XB6B 4ARSA 2OWEA 4PAOA 3GFRA 5LQUA 5NULA 2PGIA 5HIKA 1GT6A 4CVNA 4M7PA 5IAAA 1XGKA 5DI3A 1Y7HA 4TLAA 3EEIA 3NWJA 2OBBA 3ZY4A 1JQAA 4HAZA 1GL7A 2GN8A 4EGJA 3H6GA 2M1ZA 3VOBA 1M9NA 3TQTA 1GTRA 1PJ8A 5LMNB 2CWDA 5B6JA 2Q5JA 1A5BB 2Q9CA 5TV2A 4MYTA 3GRZA 2RAUA 1AE1A 1ENPA 5A5DA 4XGKA 5KBYA 5LU9A 3HJCA 5J2UB 2WUDA 4FS8A 1BEZA 3VR2A 1DRKA 2F4VB 3UAWA 2P5TB 5IN5A 1K4MA 2P41A 4TSFA 4RTLA 1P4JA 2R5FA 2DEUA 1PE0A 1EUYA 1R0BA 1F4VA 1ZVKA 3Q3VA 2UUAB 4L0DA 2ZWOA 5C37A 1PS8A 4IZIA 3OT4A 1QK5A 4MP8A 4LHYA 2LKCA 2IGBA 1LRJA 1M2OB 2ZYVX 3CPEA 4FXPA 4LJAA 5EJ5A 1I4TD 4J1TA 1VPDA 4YTEA 1KSJA 3LBHA 1D4OA 1J09A 3N8IA 4TSRA 1Z07A 3DC2A 3R3SA 3PUIA 3MGBA 1YH3A 1W48A 1YL7A 2P6MA 5KIAA 1CPYA 4L51A 1R4NA 4BMSA 3H1EA 2GD6A 4CMHA 5A3QA 1Z4JA 3M1YA 5JH7B 2VJMB 2GZMA 1WF3A 1G98A 5ALDA 3W6ZA 5B4UA 3SXUB 3AVUA 3WYAA 4ZDWA 1BKSB 4FLFA 4MWBA 2XZPA 3QK7A 4JX8A 3DULA 3H9BA 5LFAA 1KI6B 2X1LA 4NZYA 4OM8A 1Q21A 1R74A 5KJ1A 4DREA 1RPZA 3ILYA 2H3HA 2NZWA 3L84A 721PA 1ZM4A 4YRBA 3ZDDA 1MU0A 1CNMA 3RO7A 3DPUA 1NWHA 3DLCA 1HG0A 1QV9A 3QWBA 4PO8A 4AZ3B 1L1FA 4KYUA 2P2NA 4BBPA 4C6RA 5EWJB 3K70D 1XRSB 3I76A 3I9MA 5G41A 1B8PA 4MEBA 4CIBA 2WUGA 1M0EA 1K5GA 5CM8B 5GIOE 2NYAA 4QJIA 1TAUA 2FZLA 1UAYA 4ZALA 2WTNA 5SYNA 3T5PA 3LHSA 2EWVA 3RWBA 3EDOA 1WD5A 3EZ6A 1JKFA 2FZ4A 2QJOA 5IDVA 2FE1A 4PC7A 2UZ0A 4Y30A 3SR3A 2VRCD 4NS1A 4C01A 1ZJ4A 1QTQA 1SWVA 1ZI6A 4ZAZA 2XJ9A 1I6MA 3W9SA 4WVLA 3LA8A 3NIFB 1J5PA 2YNMA 2XCLA 1OC4A 1U8AA 3UJ6A 3KALA 1WXWA 4I1YA 1PEKE 5BRNA 4JQZA 1J2EA 4MRMA 3D3EA 4RVFA 2E4XA 1H1DA 3TFWA 3PCTA 2PMDA 3T9FA 3B12A 4LE0A 5GMOA 3CF0A 1EWRA 3BILA 2XADA 3FZYA 1M7BA 1O9HA 5B3KA 2XCUA 1HEUA 2IY9A 3BJRA 3THWA 3O0DA 1F0KA 2Z83A 3DKRA 4DA9A 4J0FA 3ME5A 3IVGA 4X71A 4OHYA 3DE6X 2GRAA 3HCPA 4YLYA 5DGIA 5CA1B 5JZSA 3RODA 3ZEI