4DJTA

Crystal structure of a nuclear gtp-binding protein from encephalitozoon cuniculi bound to gdp-mg2+
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
190
structure length
186
Chain Sequence
LTYKICLIGDGGVGKTTYINRVLDGRFEKNYNATVGAVNHPVTFLDDQGNVIKFNVWDTAGQEKKAVLKDVYYIGASGAILFFDVTSRITCQNLARWVKEFQAVVGNEAPIVVCANKIDIKISKKLVMEVLKGKNYEYFEISAKTAHNFGLPFLHLARIFTGRPDLIFVSNVNLEPTEVNYDYHSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein GSP1
publication title Crystal structure of a nuclear GTP-binding protein from Encephalitozoon cuniculi bound to GDP-Mg2+
rcsb
source organism Encephalitozoon cuniculi
molecule tags Nuclear protein
total genus 61
structure length 186
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08477 Roc Ras of Complex, Roc, domain of DAPkinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4djtA00
3GLIE 1E4YA 4ACAA 2WM9B 1T5LA 1TF5A 1N5JA 2VYFA 4LPKA 1ZINA 4QBGB 2GEUA 1IONA 3ASYA 5ELXA 1UM8A 2C99A 1HE8B 4HZUB 3OE7D 3QEJA 3QF4A 5FBQB 3RAPR 4UNNA 1Q1BA 3QJYA 4A15A 2PMDA 4QXAA 1EGAA 3ETLA 5JRJA 4D26A 3Q7PA 3RS3A 4RKFA 4AWXA 1TF7A 5FTJA 4A82A 3O8BA 3BH0A 5BXQC 1RJ9A 2AK3A 3CPHA 4GP7A 3U44B 3MJHA 1KI6B 4J0QA 4D0NA 2P3SA 1UKYA 2YWHA 1Z0FA 5L3RA 3JVVA 3G0HA 3IO5A 5FTLA 3NEJA 1N6KA 4V0LA 1KI1A 3WBJA 4BUJA 2GAAA 3EC1A 4KFRA 4DLSA 2W00A 2ZJAA 3C16C 4X8LA 4HB2A 2IF2A 5AJXA 3CBQA 4JL5A 1IN4A 4NTZA 4RSGA 5P21A 1P4SA 1SVSA 3IIJA 4MYHA 4NH0A 4TMXA 4DDTA 1JR3A 1G16A 1Z3IX 1ZM3A 2QUZA 3N2EA 1P9RA 4LJ7A 4IDOA 1YE8A 1G8GA 4Q4HB 1G8FA 5JCPA 2WPDA 3WYAA 2XXAB 3TBKA 4KFUA 5F3WB 3EC2A 5TB5A 2J41A 1OFHA 2ONJA 2OCAA 5CDFA 2ONKA 3KX2A 1KMHA 4EIWA 3THWA 5IF9A 2R62A 2FFQA 4PSAA 4HLCA 4ZDWA 1Q12A 3L0PA 1QHIA 3TSZA 3GJ8A 3FYHA 1NIPA 3SU8A 1UEJA 3BGWA 4JYCA 2CCJA 3ZD7A 1DE0A 5G3YA 3NKVA 2XZLA 1CR4A 1COWD 1DAHA 1K6MA 2NO1A 1P61B 2DFKB 2ZSFA 1XRJA 5IHPA 3KFVA 2FMXA 2C5LA 3VKWA 1XPOA 1GTVA 3EXAA 1J7KA 2J9RA 2RGGA 2DPXA 4NL4H 4M9QA 1WP9A 3KQKA 4JZKA 4QNRA 1T91A 3HP1A 2GETA 2BMEA 1N6NA 5KSPA 3AVYA 1JR3E 1E1RA 2JDIA 2ZVPX 1W46A 2VRWA 4ZIRB 2Z0MA 4RD3A 5K8UA 3V4RA 2NO6A 2XTMA 1N6OA 3QVUA 4B2LA 4M8NE 4JLKA 4BRWA 1E9SA 2NTYC 1ZM2A 2QM7A 3T06B 1P72A 1L4UA 2J0VA 1IJFA 2RAPA 2Q9BA 4IFEA 4EUNA 1R4AA 5HE8A 1W4CA 2J0UB 4M4SA 2CK3D 5JJLA 2VP4A 3CRRA 4JBXA 1S1CA 1P5ZB 4NMMA 4KLZA 4URVR 5GJBA 1Z83A 2ZS8A 1NF3A 2WWIA 4P4SA 3JVUA 1OXXK 2IWRA 3AKCA 3I32A 4Q1EA 4MDEA 2OBLA 3P26A 1ELOA 4ERNA 2FFAA 3GFOA 1R0YA 5FH9A 1OH6A 2OSBA 3UKDA 1CRQA 1N0WA 2ZR7A 4NCKA 4B3DA 4KU4A 3AVUA 3B82A 3F8TA 1MOZA 2BKEA 4PAMA 2CJWB 2P6UA 2QPOA 3CRQA 3IBGA 4CIDA 2PCLA 3CPJB 4MKGA 2A7QA 3KQHA 1LNZA 4PSKA 3LO5A 2OAQ1 4HAZA 4GT1A 2BV3A 3U6KA 1SVIA 2J1LA 3BOSA 3PUWA 1KNQA 4LHWA 4ZKDA 4EJSA 4MGKR 5E7JA 4C4PA 1G5PA 2H57A 4TYNA 4KBGA 3BB1A 2CLCX 2EVWX 2QP9X 3GLGB 1P9WA 1PUJA 1TU4A 2V1XA 3WYGA 1E32A 4DEYA 1AS3A 5TVKA 1SHZA 3GLFE 3IPXA 1E2DA 1OH5A 5L3VA 2JLUA 1L8QA 3BJIC 4OI2A 2G1JA 5IDVA 4FMDB 1U94A 5IK2D 1XEXA 1W2GA 5KNCA 3OIVA 1CJTC 2P6NA 1N6PA 4FXPA 2DBYA 3HR8A 3KB1A 4RCZA 1R10A 2AXNA 2KWIA 2O8EA 2I4IA 1K5DA 4ARZA 1CJMA 3U6BA 1J8MF 3GLHA 3VR6A 3TUIC 4BFVA 1IHUA 4FINA 4M2LA 5FR1A 4MQBA 4RD0A 4XVUA 2HUPA 2FPMA 3W6PA 1I2DA 4LHYA 5E7IA 4PO8A 4BZQA 4YDHB 1DPFA 1AGPA 5FBVB 5KO2A 1YZGA 1VTKA 2O52A 2QU8A 2ZJZA 4QG7A 1N0VC 3CLVA 5FUWA 3X1WA 3I8SA 1KHTA 3TGPA 2G1KA 2NZ8A 5KHOC 1N6HA 4ON9A 3SI7A 1V5WA 2GTPA 4KODA 5HE9A 3VQTA 4IKEA 3K0AA 5GJVC 4BFTA 2O8DB 3PEWA 4LBYA 4EAQA 3FFAA 1V43A 2CHGA 4AKGA 1G291 3FKSA 3K0CC 1F6BA 1OHHD 2ATXA 1ZD9A 4B76A 2IYSA 4AKIA 1O3YA 4BFSA 1G7SA 4KITB 3OIYA 1EFRA 3FMIA 1HA3A 2EYUA 3LW7A 4Q4JA 4LHZA 2GBLC 3GJ7A 2HEIA 2PZFA 3OE7A 1SVMA 2AKAB 1G3UA 1VG1A 2Z4SA 5FL3A 4L9SA 1QVAA 3U2QA 4NBSA 4ZCMA 2O8BA 4URYR 1ONBA 2DYKA 4Q4LA 1UBEA 3DKVA 3KDSE 1O87A 3GLIB 5JI3E 2V7QD 2J46A 2SHKA 3SJZA 4A8JA 2JATA 2CNWD 4XH9B 3UG7A 4QGFA 1U98A 3RANA 4IJMA 3X2SA 2GJ8A 4HAYA 2F1HA 2RH5A 2G88A 3BRWD 1Q44A 4PTLA 2ZITA 1WMSA 2W83A 4CGZA 3G5UA 1DADA 4NE2A 3RS7A 4MYCA 2FZ4A 4R2HA 2ZM5A 2WKQA 4TMZA 2BHRA 3QKTA 4TTPA 2QPTA 4CT5A 3LWNA 1MR3F 2RMKA 5JEEA 2J3EA 3V4FA 2QI9C 2RGDA 3K53A 4ZV4A 1DG3A 2WHXA 5KPJA 1Q1EA 3KJHA 4AG5A 3CB4A 2Z83A 3W6NA 3MJRA 1SKYE 1Z0IA 5FOTA 1ZYUA 1E98A 2MSEB 4C0QC 1RRGA 4DKXA 4RZ2A 2N46A 2HT1A 5D3QA 1QHYA 4DDUA 3LBNA 1RFLA 2J5XA 2ZROA 1N6RA 1YR6A 2FH5B 4JT2A 2NMVA 1E2QA 1KJYA 3ZLJA 2FSGA 1EG7A 4LJAA 1SXJD 4KJZA 1COWA 4A4DA 2RKOA 2IC5A 4V0MA 4M1SA 2ZRMA 4TTRA 3VR4A 5CJ2A 4UXHA 4L15A 4NP6A 2OILA 5D3MA 5JZVA 3QPUA 4Y0AA 1KJZA 3QBVA 1ZNXA 4OBEA 1AS2A 2A5FA 4JVMA 4Q02A 2IHYA 1ZRHA 3DEFA 3QKRB 5EUQB 2Q21A 1G8HA 2REXB 5UKDA 5DLQC 3WP0A 2IW3A 2OLKA 3C41J 2D3WA 1PLKA 1KO7A 3A36A 3CX7A 4TQUS 1RVDA 1S4QA 3W3AA 5HCNA 1YZTA 3A4NA 2A5YB 2BOVA 2QL6A 3RSOA 3SBEA 3U3KA 621PA 1XNJA 3X1XA 4YMVA 2EFCB 1OSNA 4FIDA 2ZTSA 4F4JA 1KSHA 2YV5A 2O0JA 4POAA 2CK3A 2ZU0C 4CT4B 1U99A 2QEQA 4DJTA 4BFWA 1KI4A 1BYUA 4HDOB 3Q85A 1G20E 2F1RA 1E2MA 1E9EA 2YZ2A 4FMBB 4FI3C 1E4VA 2W6JD 1YZUA 4BRUA 2A30A 4DLTA 5AJWA 2D74A 4LJ8A 4DCVA 3SJCA 2GXQA 2PBRA 5DYGA 2E1RA 2ZJ8A 2H8KA 2NPFA 2BIFA 2IWHA 3U7EB 1GNPA 1GDDA 3QUSA 1RKBA 4ZDKA 2D62A 1MRNA 4BLPA 1JECA 1K8RA 3VKHA 4PR0A 2WOJA 1WDTA 1S1MA 3BWDD 4HB4A 3BBPA 2A5DA 4TLEA 5L3SB 1X8KA 5CLQA 1AQUA 3MMPA 2PT5A 4QRHA 1N5LA 1FL9A 4MGYR 4TYPA 1ZIOA 3KKPA 2ZSAA 5F98A 2PLFA 3DVLA 1WA5A 1Z2AA 4L16A 3AKYA 2ZI9A 4PX9A 4B3XA 4KFTA 3THYA 4YQFA 1G21E 5C18A 1H8HD 2CE7A 1KTVA 5ANRB 3SHFA 4BLRA 5J4YA 3FHTA 5IK2A 2ZRPA 2GF0A 4QBIA 1CIPA 2HCJB 1I4DD 3BH7A 4A6XA 2WWYA 1TADA 4Q47A 3GLFB 2V8OA 1R5NA 1ZU5A 3KXLA 1RIFA 2NO0A 2YWGA 1NMXA 4ITRC 4DT1B 4Q4HA 3O47A 2FOLA 1VG8A 2XXAA 2OO7A 1S2MA 1KDTA 3EIEA 1KSFX 2ZUCA 2DWPA 4TYQA 4UXJA 2QENA 3SR0A 3T1QA 3VAAA 4DDVA 1AN0A 1GP2A 1TUEA 2FEMA 2ZAOA 3GJ4A 2XOKD 2WVJA 3L2OB 4QJ5A 1GNRA 3KTAB 5J40A 4DCSA 1B23P 5AJVB 5KUTA 4IVRA 3TMKA 4OI4A 4D0GA 4S2EA 2IUUA 3I73A 3ZZ0A 4AYWA 1WXQA 1LS1A 1OKKD 5BW8A 2C2HA 2C78A 4Q1CA 3RNLA 3TVTA 4GFDA 1CJUC 1OIWA 2JJ8A 1A4RA 4PSVA 1ZBDA 2D06A 2R6DA 3GPLA 2J7PD 2ZSBA 3WNDA 1WE2A 1W48A 4QNMA 2IS1A 2NO9A 1XMIA 4LYHA 1OHHA 4I4LA 4BLSA 3VHLB 4HSEA 2ERYA 3FHCB 1N5KA 4I1OA 1I2MA 4I99A 1UEIA 1FW6A 2OBMA 4XWAA 4B71A 4B2IA 1JQLB 4BE7B 2ERXA 3EPJA 4QHTA 4DVGA 3ICQB 1R7RA 3BORA 5IT5A 2DB3A 1CLUA 4TMVA 1VPLA 1CJVC 2JA1A 3O8DA 2QPAA 3I5YA 2EW1A 1S9DA 2V7QA 3RC8A 2RCNA 3CNNA 2J0UA 2ZI5A 2GVZC 1NN1A 2R6GA 5BQ5A 4TQ9A 3PITA 2CNWA 1E2KA 3R20A 1G3MA 2AN9A 1Z0KA 1Q57A 1NLFA 5B30A 4XJXA 5CM9C 4D4JA 4G1UC 2HDNB 2IXEA 3ICEA 3AF2A 3FMFA 4CEJA 1DO2A 1NP6A 1TPZA 4B6FA 4HAVA 3ZZUA 4HYYA 4ESVA 3LV8A 1NKSA 5G40A 1DO0A 1OLOA 3ADCA 4L5BA 2CJWA 1JXMA 1JJVA 1TX4B 3I62A 1R8SA 1US8A 3L0OA 521PA 5TY0A 4D82A 2VHUA 2GJAA 1U2RA 1OXUA 1U9IC 1NSTA 1ZC4A 2WTUA 4HDCA 3H86A 4QBFA 2YOFA 4LJYA 5LDDC 4CEHA 2FFHA 4PPFA 3UPUA 3TAHA 2QMEA 4D81A 1KIMA 1OB5A 2I3BA 1NBME 2FFBA 4DHEA 1Z47A 4EFNA 4HLUA 2BBWA 2NGRA 1SKYB 3U3MA 1SXJA 1LF5A 1S3SA 1XD2A 2J7KA 3P4XA 3K9HA 3NDPA 3QXJA 2GZAA 3PEYA 2OCYC 2ZETA 5EE9A 3CPEA 5JWRA 4MRNA 4DWJA 2O8CA 2OM2A 2UZ3A 4OYHA 4C7OA 1J70A 5EXTA 1QHSA 3IIKA 3EIQA 4TMTA 5H8WA 1R0WA 1A2KC 1N2CE 4KV9A 1IN5A 4JLDA 3B8HA 1RYFA 1N6LA 1Z0AA 2H7VA 2VBCA 4DLUA 4O2LA 3UIEA 5JMTA 1GOTA 3UATA 3K0FB 4QHYA 4B47A 1AS0A 2IYVA 5FOVA 1JEEA 4G3XA 1Z6TA 4DSOA 3AVOA 3AF0A 3SYLA 3P20A 1VCIA 4LC1A 1TEVA 3IQXA 3REFA 1FMJA 1UKVY 3AUYA 1FUKA 4BWYA 3C8UA 3ZJYA 3WRXC 2GAOA 3E5HA 4LV5B 3U60B 3DKPA 3X1DA 2IEYA 2FDCA 2CVHA 5KDDA 1ZD8A 1K5GA 4P3YA 4A0RA 2AL7A 4PHTA 3U7FB 1E94E 4GOJA 4CW7A 1MRSA 5EZ6B 1G4UR 1M8PA 2R9VA 2VHQA 1PZNA 3P1JA 5JHGB 4JJZA 2P5TB 4QBHA 3AGPA 4EQ6A 1TTTA 1FP7A 4DLYA 4F38A 2GESA 2IEZA 4JVNA 2W6JA 1G5TA 1G8YA 4LY6A 3HR7A 1MKYA 2XX3A 1HEIA 1XTKA 3QXSA 2GDJA 4BFUA 4TLAA 4JLMA 2GZHA 1FX0B 2QE7D 3B1VA 4IDPA 3PJRA 2CL0X 5G41A 2BM1A 3B2EA 3HU3A 1XB2A 2HYDA 3A4LA 3NXSA 4E09A 1PJRA 3D7MA 3F5FA 1YKSA 4DB4A 1G3IA 2DCUA 1H65A 2XTZA 5FOWA 4LOAA 1HUQA 1W2HA 3UWOA 3BFKA 1S0UA 1TQ4A 3MWKA 2JJ1D 1JJ7A 2I1QA 3FDIA 3A1WA 3RS4A 1VIYA 4B74A 2O0HA 1F3OA 2AR7A 2OCBA 1QHNA 2QN6A 2QT1A 3RLFA 1NVVQ 2CBZA 5BN5A 3H0KA 1DOAA 3B9PA 4U5XA 4ESHA 1KAGA 3ZS9A 1H8HA 2JEOA 3AV0B 3EZ9A 1IM2A 3IBYA 1CJKC 1FQKA 4TN1A 5EXSA 5AWFC 3AEZA 4L4UA 5SZKB 2ORIA 1GAJA 1EWQA 4Q7MB 4V02A 2ZR9A 2FNAA 3U5ZB 3SQWA 5DIFA 5EE5B 4AKEA 5JSZA 3JZAA 1IY1A 4AK9A 3NC0C 3NH9A 4HATA 1XD9A 2IYYA 3TK1A 4AY2A 2KBFA 4AI6A 1KZGB 1T3HA 4TYYA 2ZYTX 1NIJA 5CK4A 1XTJA 3THXB 1E79D 2ZI6A 3UWKA 4UJ5A 2Q9AA 1MV5A 2WJJA 3VR5A 5F2EA 4EPXA 3A6PC 1LW7A 3OEHD 4G5RA 2ZYVX 1QRAA 2XOKA 3RRNA 3TR5A 5DSZA 1LFDB 4P31A 4HI0E 1E0SA 1SZPA 2FEOA 2CLSA 4QGGA 4L8GA 4M1TA 3WY9A 2CLDX 2NZJA 3GD7A 5A4JA 821PA 1JPNA 2BDTA 4P4UA 5JEDA 1OKKA 3CUEF 2KJQA 2YOHA 2QROA 2J7PA 4TSFD 5SZIA 5TDHA 4O0MA 4GMDA 2YVUA 3LFUA 3U7GA 5AUNB 4UXIA 2O0KA 2WWWA 1E0KA 1HT1E 1GM5A 1GKYA 3ADBA 4DDWA 3S1AB 2IYQA 4LBZA 3K8YA 3SZRA 5DI3B 2KB0A 2QY9A 2V3CC 3V00A 1G7TA 3AVVA 3HJNA 1BO6A 2XGJA 3K09A 4Q7KA 2ZU6A 3DPUA 4KSCA 5DH9A 1AJEA 3EA0A 4O2RA 3FPAA 2ZS7A 3FTQA 4LBWA 4A0FA 4KLNA 1DVRA 4LC0A 4U7DA 5K8IA 4TMWA 3BERA 2RGBA 1E9DA 2DR3A 5J4VA 2QQEA 4IRUB 4TLDA 2RGNA 4KAXA 1FP6A 2NG1A 3WMGA 3K70D 1KDOA 2A5JA 5EP4A 4M9SA 1ETUA 4DCUA 4EFMA 3DOFA 3SNHA 1JAHA 4FCVA 4EDHA 1BKDR 4OHWA 4B43A 1VMAA 3QF7A 4OJQA 5FTMA 1ZMXA 4QM6A 4GDFA 2V1UA 3MCAA 4MGZR 2B8TA 2KBEA 1Q1QA 3ZH9B 1OXTA 2QSYA 3B13B 3M4YA 4URUR 4FD2A 5HKKD 1E1QD 3VHXA 3B1YA 4RZUA 1OH8A 4KXFB 3Q8XB 3E2IA 4ZI3A 2XJ9A 1G64A 4IVQA 4Q9IA 3ZVRA 1II8B 2J0QA 2CHVA 1NY6A 1TAGA 1Z6XA 2ZRCA 2FSFA 3SS8A 2VL7A 5CB8A 5JJKA 2A5GA 5TV2A 4LPSA 5CDFE 2QRZA 1NVWQ 2ASEA 2ZIAA 4MITA 4OI0A 3VNUA 1T0JB 2YNMA 4PZZA 5DNYB 2IUTA 4H9GA 4NPHA 4RD1A 1A2BA 3REGA 2QBYA 4LJ5A 1AA9A 1TNDA 5C4GB 3K0EA 3ND9A 2P65A 1ZNYA 2D4HA 2C98A 3U3OA 4RY2A 3KJIA 1J99A 3PUYA 3AVQA 2R6FA 3KJEA 4OQFA 1TQ6A 4EPTA 3EWSA 1M6NA 4B6EA 3TLXA 4HAXA 3RRMA 3TKLA 4W5JA 1F2TB 1LVGA 4NONA 2ZSDA 3R9XA 2MMCA 4EPWA 5FFMA 3M0EA 1AKEA 1BIFA 5FPKA 2XB4A 2DWQA 3A37A 4D4MA 4OJKA 3LLMA 3ZGXA 3U4QA 1VDZA 2ZRHA 4WXPA 5CIWA 1WF3A 4ZPXA 2CDNA 4H1UA 2A3RA 1A1VA 3TUZC 4Q19A 221PA 2Q0HA 3I1FA 4UQOA 4Q1AA 2LWIA 3VR2A 5L3QB 4TZ0A 1MO6A 5K8LA 1XJQA 2GJSA 3VMFA 4LHXA 2ZI4A 1F2UA 1X8LA 1QVRA 1Y63A 4NYMR 4QJ3A 1E2LA 2D2FA 2ZR0A 3DHWC 1T3LA 2F43B 3K9NA 5JBQA 4BFXA 3P32A 1NG9A 3CIOA 4F93B 5FI0B 4GOKA 1DBSA 2GCOA 3RWOA 3N5CA 5JLJA 1YZLA 5AUOB 4C0JA 2ZYWX 2G9NA 4ZDIA 4W5WA 1W49A 5GADl 3IUYA 1RPZA 4MKIA 1MO4A 5FTKA 4A36A 1YU9A 2QE7A 2JIZD 2EFGA 3BAFA 2OAP1 2X1VA 3D8BA 1UKEA 3U7HB 2QP4A 1W1WA 1G3RA 4ABYA 1CR2A 4Z54A 4JKYA 3MWJA 1S8FA 1FMLA 3EA5A 3BB3A 2JJ1A 2ZE6A 1HT2E 2QMOA 2H18A 2YOGA 1DAIA 4PPGA 1XEWX 3MAAC 1XXHA 1P3JA 4Q5IA 1HURA 2EWWA 4TLCA 3WNCA 2TMKA 1AQYA 2YKGA 3VR3A 2JLZA 1DAGA 3CWZA 1EFHA 3AP2A 2WICA 4MUAA 2GF9A 4LX0A 4A9AA 1FNMA 5EUMA 1X3SA 4B3FX 1ZJ6A 1GFIA 2Z5FA 2ZJ2A 3E70C 3RS0A 5L8VA 4GZLA 4Q00A 5H68A 1FNNA 4QL3A 1KGDA 1XD8A 2NIPA 2ZRFA 3MFYA 5CJPA 1W7AA 4LRWA 5FTNA 3LVQE 3CO5A 4B2PA 4MKFA 5B58C 4G0NA 4Q21A 4IXMA 1R5OA 4RFSA 1AM4D 1E79A 2LKDA 2XITA 4MRPA 3GLHE 3EZ6A 4JIMA 5TXGA 3NEYA 1LV7A 4LHVA 2ZXUA 4DBLC 4KBFA 4BZXA 3CRW1 3OEHA 1MH1A 5DI9A 4D4KA 2RB4A 2JLVA 1Q20A 4RZ3A 4CEIA 4WAUA 2V55B 2W2VA 5HZKA 1G6HA 3QNUA 2Z6VA 3QPVA 4DLVA 1LF0A 1ESNA 4I1UA 1ZCAA 2VF7A 4BZPA 5KYKA 2ODEA 1E2JA 1DG1G 2QSZA 2WMOB 2O8FB 1X1RA 4G01B 4HAWA 1OXVA 4D0LB 1KO8A 4Z1MD 1GL9B 2ZUBA 4KI0A 1Q22A 4TSFA 3UXMA 2XTNA 3NDBB 4Z8XA 3QI2A 4TT3D 2PCJA 3A1VA 2H17A 4OHVA 4DEXA 2I1VB 3L0SA 1OIXA 2CL7X 1M7GA 1P73A 2HV8A 3W90A 5LD2B 1GVNB 3G82C 1S9HA 3GMTA 3K0FA 4JSTA 1QG4A 3CZPA 1CEEA 1KZ7B 2W58A 3R7WB 1YZQA 1OYYA 3QKSB 3NVAA 1JR6A 4PC3A 1KNXA 3AB3A 1W5SA 2ZQ5A 1T4GA 4P33A 4MGIR 2V6IA 1RE0A 3GEHA 2BBSA 3A1TA 4OK5A 4B35A 4OQMA 4YLGA 3R9IA 4PC6A 3DM9B 3BIFA 4MDFA 4W7SA 4GP6A 4O25A 1SVOA 3TQFA 1XF9A 3WHKA 4NKRA 1P75A 4XTCS 2JLXA 2WSMA 1LB1B 1GRNA 3QF4B 1UAAA 4PZYA 2KI5A 1II9A 2OG2A 2XAUA 3ADKA 3LY5A 5CM8B 3SOPA 5LD2C 4WZAE 1D2MA 2WJVA 4HDQB 3C4JA 1JXOA 5J5CA 2WWGA 1KI2A 1Q3HA 2QZ4A 4PQFA 4M53A 1FTNA 1RJ9B 3DL0A 2Z4RA 2QAGA 4FCWA 2BMDA 3PV0A 2DFLA 3N2IA 2ZJBA 1U0HC 4PC1A 4ZDJA 4JL6A 5FBRB 1SULA 5HKKA 1E1QA 1QG2A 2REOA 1GZSA 1UDWA 4BEJA 4XWOA 2CMKA 5DHFA 3RWMB 1DAEA 4GPTA 4C0AC 3CRVA 2JLYA 3DOEA 3SEAA 4XWKA 4IVPA 3TUJC 3ZDQA 4AIIA 4B73A 1DEKA 4H1VA 2XNSA 5SZHB 3CF2A 5LB2A 4N1AA 3W3ZB 4B3BA 4Q03A 1KY3A 4CDGA 1ZP6A 3VU9A 4DCTA 4NCNA 3FGNA 3L8ZA 5C46F 3B1ZA 2ZE7A 2JLSA 2XNDD 1UPTA 1TEXA 4QKQA 4Q1DA 4F91B 4QFMA 1CU1A 4F92B 5DHAA 4FMDF 1TQDA 3KQUA 1ZUHA 1KMHB 3THWB 4URXR 3AP1A 2PMKA 1NVUQ 1M2OB 2ODWA 4URWR 4V0ME 2EYQA 3ZVLA 1QBKC 4Q9KA 3AH8A 3KKQA 4JVSB 4V0KA 2WWXA 3WNBA 3DM5A 4HZUA 1TQ2A 2FPKA 2G0TA 1HYQA 1XP8A 3T1VA 5CYPA 3R9WA 1AK2A 4NZYA 4IDNA 4XVRA 3HDTA 4Q7LA 3NIBA 2G83A 1Z2CA 5JCZA 3O8RA 2Q3FA 3THXA 2XJ4A 1IN7A 4OL0A 1HH4A 2MSDB 1IY0A 4X8HA 5CITA 5HZHA 121PA 1KKMA 4UNQA 1IY2A 3U44A 4LBVA 4C9BA 5BYJA 4NHOA 1KI6A 2YWFA 1ZD1A 4V0OA 2BM0A 1T8TA 1CBUA 4JS0A 2ORWA 1GITA 4QGHA 3KQNA 3V9PA 1XCGB 4D2IA 3AF3A 4JLJA 1OFUX 4LV6A 5FBLB 2QMUA 5JI2E 3LQRA 1KI3A 1DAKA 4A0GA 2ZRJA 1D2NA 1XU4A 2XEXA 2ZRGA 4I1SA 1U8ZA 4D80A 2RGNC 4Q66C 4E03A 1E2IA 1PLJA 2BCGY 2Q6TA 4LYJA 3H1TA 5FUVA 3AVWA 1XTRA 1AKYA 2JJ2D 4NCIA 2C9CA 5KSOA 4OQXA 3Q72A 4JLOA 2ZRNA 4S35A 4PQRA 4PQYA 2KE5A 3CH5A 1OYWA 1OV4A 4P4SB 3ZZTA 1OW3B 2OFXA 4LI0A 5KSZA 2Q3MA 3HYTA 1X8JA 2WKPA 3CF0A 4LJ9A 3IGFA 4IFBA 3SJAA 4OQLA 4CZ2A 2OV2A 4MA4A 2HF8A 1IJEA 4KHZA 1C9KA 1CRPA 1TUIA 4LGMA 3PXGA 3SJBA 3VTKA 1OIVA 4IDQA 1W0KD 5AJZA 1NN0A 4C0SA 2J45A 4IOKA 1NJFA 2QORA 3RVBA 4UKDA 1Z6YA 5C1BA 1GUAA 1Z07A 3R8CA 4B48A 1PV4A 5JWHA 3BE4A 3SFZA 2IBMA 1YZNA 4US1R 1E9CA 4B32A 2D7CA 1Q0UA 5EE0A 1XZPA 4HB0A 4KFSA 1RZ3A 2IF0A 3NHBA 2EQBA 1UDXA 5FUYA 1W36B 2VF8A 4U00A 1FOEB 2EFHB 3AF4A 4ZIRA 1XFAA 1Z29A 4KVAA 5HR5A 2REBA 5J47A 3BC1A 4BEBA 1XEXB 4DIDA 1EFTA 2BBOA 1E69A 1R2QA 1HE1C 3IDQA 4IW3B 1VCMA 1G41A 2VTKA 1TL7C 1VG9B 5CB6A 1R8QA 2IX3A 1UBFA 2O8EB 4ARZB 2F55A 4EJSC 4DSTA 3CR8A 2E9SA 3GLHB 3LX5A 3KL4A 1Z8FA 2Z43A 4PHFA 4M21A 4Z1MA 3ZS8A 1N5IA 4HUQB 2C77A 4C3ZA 4RFVA 5AUQA 3T1OA 3TAUA 2GA8A 3MRSA 1G5RA 1W36C 1XEWY 1RYHA 2X2EA 3OHMA 5A5GA 4TT3A 4OHXA 4JLNA 5EXPA 1NY5A 2OFOA 2GK7A 1AZTA 4MKHA 1RC8A 2VSFA 3H4MA 3EARA 1OPXA 5FPSA 1P6XA 1W4RA 2F3TA 4D6PA 4TL6A 1KK2A 4JSYA 2P2LA 1EFUA 3RDPA 1W0JD 2CXXA 3PCRB 1E2GA 3GEIA 4DXAA 3K0AB 2PX3A 3VR1A 4Q1BA 1XMSA 3W8RA 2BBTA 4P4TA 4TQAA 3MG9A 4OHYA 4OQNA 2FX3A 1NRJB 2QP3A 4FCTA 1S3GA 1VYUA 3ZQ6A 1DTSA 2WAYA 3W34A 4RKEA 1VCNA 2VP2A 2WSSD 5L3QA 3ZVMA 3QOFA 2A9KA 3ZQJA 4OKSA 3GLGA 2ZRAA 3IHLA 3QENA 3TJZA 4LJ4A 1HY3A 2IYRA 4GI7A 2XZOA 1HQCA 1IXRC 4B33A 3CF6R 3GJXC 2CL6X 5JWOA 2IXFA 2O8BB 3B85A 1FQJA 3ASZA 3EWAA 1P2SA 3CW2A 1NMZA 1W4AA 2PLRA 4IHQA 3PFIA 2IT1A 4XSGA 4W5HA 1XZQA 1ZAKA 2OXRA 4P0TA 1YJ5A 2AWNA 2NPIA 1D6JA 5DISB 1NLYA 1XTIA 1Z6GA 2OEPA 2GCPA 2GK6A 2X19A 2F6RA 1W44A 4A8JB 1AIPA 4XTRA 2HXYA 3UG6A 3UMFA 1P9NA 3TSWA 2OFWA 4CYMA 3T1TA 4B3GA 4EPRA 2FE4A 3K0CA 3E1SA 2ZRDA 2WBLC 1T9HA 4LYAA 4F7WA 1EFCA 5J4KA 3KXKA 3LVRE 1X6VA 1QDEA 4FWTA 1YZKA 2IYTA 3SBDA 1E9AA 3BH6A 3EPKA 3B5JA 721PA 2VLIA 2FGJA 1Q21A 4K81B 1ZM9A 4L9WA 3HWSA 3FWYA 1IBRA 5BYKA 3DO6A 1ZUNB 2BEKA 2IUSA 4A8JC 5LPNA 1IN8A 2O8DA 4TWZA 3IHWA 2XNDA 5FPTA 1Z63A 2IYWA 4F4CA 2ZRBA 2HT6A 1SXJE 3PUZA 4GRAA 2B8WA 3SYKA 4MYTA 3VX4A 2ODBA 2BJVA 2JASA 4TL7A 4LUCA 4LV8B 1OXSC 1WB9A 2IYZA 1WBDA 4DLZA 4BFYA 4KYUA 4C2UA 4EPVA 4PPQA 2HLDD 1XDBA 3GP8A 3RC3A 2QGZA 3LDAA 3LQQA 2A2ZA 3B60A 2XZPA 3NC1C 2BKUA 2VHCA 3Q9LA 4M9XA 4RD4A 4RVCA 5FPYA 421PA 4ZCIA 3GLIA 3RHFA 4TYWA 5D3MB 2FV8A 3U61B 5A0FA 2IL1A 4C30A 4XSHA 5C2JB 2X77A 1E9BA 4CRWB 5CLLA 1E2FA 2ECKA 3LXXA 2IYLD 4TTQA 1TMKA 1H8ED 2F9LA 1Y3AA 2O8FA 3BFVA 1ANKA 2VEDA 1Z08A 3PEVA 2R8RA 4DIEA 1HV8A 2F1IA 1KK1A 4JT4A 4XD7D 2HJVA 2AX4A 3K70C 3BXZA 4M1YA 5CK5A 3O8CA 5AUPB 2B92A 3TVDA 4B34A 1PVOA 2JJ2A 1UF9A 1XTQA 1CULC 2B7CA 4UNRA 1CF4A 2ZVQX 2LKCA 2VA8A 4NDZA 1UKZA 3MSXA 1BH2A 3D31A 2G6BA 2ZSEA 3P4YA 4RJLA 2IS6A 4PHGA 3OAAD 3EIHA 4GOXA 1GSIA 2H1LA 3T61A 3GEEA 4ZO4A 2Q3HA 4JVLA 3UMSA 1R0XA 3U3JA 1VIAA 1UJ2A 5FI1B 2P6RA 4Q48A 2VP5A 4IXNA 1UADA 1EFRD 1E2HA 2PEYA 3KKNA 4HLQB 3VFDA 2YYZA 1E2EA 3TQCA 3RS2A 1YR8A 1YR7A 1E6CA 2CCKA 1W0KA 4HZIA 4KCGA 4W9MC 4Z8YA 3PENA 1E9FA 3QEOA 2OE2A 4MUBA 2NOAA 3MD0A 3L82B 4DB2A 1OFTA 3A58B 4Z51A 4HAUA 1D2EA 2VQSA 2ZUDA 1FUUA 5GVSA 1P2VA 3KKOA 3QKRA 1T0HB 1GKIA 2KSQA 3TH5A 3ND8A 1FFHA 5KNBA 4V03A 2GZDA 3THYB 2QG6A 5E7MA 1QHGA 3NBZC 3QIAA 1DAFA 5K8TA 3OIWA 4FMCF 1ZU4A 1P60A 2GWHA 4BLTA 5IRCD 1D8TA 3WP1B 3FMPB 4AKHA 3GJ3A 4IEEA 1VHLA 2QGNA 4EKDA 1EK0A 1EWRA 4M1MA 4PO1A 5KDOA 2QQ0A 3GJ6A 3PUXA 4NYIR 4JKIA 1VHTA 2B6HA 1NKTA 1G18A 4JJKA 5LBIA 3GQBA 2ORVA 3AKDA 4G5OA 2GJ9A 4PPNA 2GVDC 2OT3B 3FVQA 3MWYW 1Z5ZA 1M7HA 1XX6A 1NJGA 3IIMA 3SE0A 4GL2A 3QG5A 3W5IA 2AWOA 3N70A 2AK2A 3LA6A 3EPLA 1WRBA 4LDJA 4TZ6A 3LRPA 4LYFA 3OF5A 1AGRA 2CVFA 4NCJA 2NQ2C 2RGXA 4BLQA 1W0JA 4QJ4A 3CZQA 3I4LA 3VNVA 1M1YE 3OEED 4WOPA 3X1YA 2FWRA 3GCGA 4QHSA 2B7BA 2OESA 3T35A 5L3SA 2G3YA 1KDPA 1OT3A 2VP0A 1YQTA 2XSZD 3PQCA 4PAQA 4A0HA 1BYIA 2WSSA 4UJ3A 3U3RA 3ZYCA 2FF7A 2RHMA 5BN4A 2P67A 4ASUD 1RRPA 1GRQA 1ZUIA 2FN4A 3AUXA 2RHDA 4JYBA 3TRFA 4OI1A 3FE2A 4RD2A 3QG1A 3QPWA 4N0DA 4QOSA 5JJIA 1NI3A 4GMXA 1G7RA 3H84A 2WJYA 3EAQA 3GLFA 2FG5A 2JCSA 1NMYA 2W2TA 4AURA 5GJWC 1A82A 2R2AA 3EZFA 4DT1A 3UMRA 2QRNA 3LNCA 4R2IA 4KVGA 5EP3A 2GHIA 1M7BA 4LWZA 2W0SA 4LZZA 3TR0A 4CEJB 1E9RA 3IQWA 1CKEA 1U0LA 5KPDA 3KTAA 3WMFA 3KB2A 3MLEA 1N6IA 1ZNZA 1ZM4A 2B21A 1EESA 3Q3JB 1KAOA 2ZRLA 4NYJR 3DDCA 4GNKA 1G8PA 5EP1A 1US8B 4N0EA 1MABB 3LW8A 1Z22A 2QA5A 1GWNA 2HJGA 1XPUA 1QZXA 1U90A 4YC7A 4NCHA 5JS7A 2GXAA 4Q7JB 2GNOA 2J87A 1SQ5A 5CYOA 4E07A 1KI8A 3MWLA 2PX0A 2FGKA 1KY2A 4WXRA 4CEHB 2ZRIA 1JALA 3L0IB 2ZE8A 1F5NA 4TL8A 2ZPTX 4HLDA 1QHXA 1XBTA 3PUVA 3SHWA 3LLUA 1SKQA 3PR1A 1D9ZA 1DARA 1C1YA 2IXGA 5C4MA 3EZ2A 4TLBA 4A2PA 4C0KA 2ANCA 3LAWA 2HLDA 1SXJB 1XD2B 4E22A 1KDRA 2OHFA 4GBMA 2YC4C 4MRVA 1RRCA 2O8CB 3Q7QA 1D9XA 4C7OB 2J59A 3CWQA 3ZIAD 2W6ID 4Q4AB 1U9IA 3BD9A 2R65A 2VSXA 2IS4A 2F7SA 4GZMA 2C8VA 4M22A 4PANA 3HPQA 1H8EA 1KOFA 2AD5A 3NBFA 4HUQA 5GVRA 4HLUC 3SDZA 4DLXA 2VP6A 4UNSA 5FOUA 3PVSA 3T5GA 3AVTA 1SXJC 4Q9LA 3I5XA 1GKUB 2QMHA 2PZGA 2ZANA 3CX8A 3NBYC 4Q18A 4XD7A 4OK6A 4AD8A 4DZZA 1GL7A 3EW9A 3QXCA 1JPJA 4JLAA 1A5TA 2D2EA 3LD9A 1JI0A 4II7A 4IOJA 4MH0R 2PJZA 2HYIC 1ZNWA 1I4LD 3PEUA 2QAJA 4B3CA 3CKLA 2DFNA 4EQ6B 4US2R 2W0MA 3OAAA 3QXXA 3DZDA 3SYNA 1QHHB 1X1SA 5EE3A 2BMFA 4AYTA 1JAIA 1SVWA 2HF9A 3ZVNA 4BLOA 1ESMA 4BASA 4PXAA 2N1BA 4U02A 1QF9A 4YMWA 1NN3A 2RGAA 2ZEJA 3B1WA 4M1OA 1KSGA 1HQYE 1WCV1 1U8YA 2AXPA 2OUKA 2UZIR 2F1JA 4HUTA 1XXHE 1XJ0A 1G7CA 1C4OA 3NHAA 5FPHA 4BQSA 4DLWA 4LSGA 4YONB 2O5VA 3A8TA 3T15A 4B44A 2UVQA 1SVLA 1YVDA 1NBMD 1FZQA 3QXHA 2BC9A 3WYFA 4I81A 1DELA 2LCFA 2GEVA 4NYIQ 4PFSA 2FA9A 1Z28A 4O3MA 1CR0A 1R6BX 3OESA 1EX6A 2VO1A 4PHHA 3MGCA 2BEJA 4XIGS 3NG1A 3HU2A 3AVXA 4OHZA 3EASA 4DSUA 1SVKA 1XEFA 2IA5A 2FSIA 2GJKA 2C03A 2CHQA 2FSHA 3QVVA 5FL7D 3C7KA 5JRZA 3LX8A 4YMUA 4D25A 3CNLA 2ATVA 2BWJA 5HTKA 1Q1ZA 2VP9A 3QQ5A 4TMKA 4EFLA 2C96A 5E95A 2D7DA 2WMNB 2W2XA 4MRRA 4DC9A 1UBGA 3AF1A 1IXZA 1NL3A 3RRYA 3TNFA 3FHOA 5E4FA 5JSZB 1IXSB 3K1JA 2BJWA 5GJCA 2EU8A 2VPPA 1KO1A 1U81A 4OK3A 1G19A 2QT0A 1ZCBA 2WV9A 1P2UA 3P27A 3C14C 5HCIA 5SZJA 2L0XA 2ODNA 3IEUA 4JLVA 4Q01A 3D6TB 4FN5A 3CRMA 1ZM7A 4IEIA 3LXRA 1EX7A 5AK0A 4FWIB 1CXZA 2X2FA 1Z6AA 5KNDA 2MMGA 3K9LA 1L4YA 4NU0A 1J90A 1GIAA 1B0UA 4C0BA 3K9GA 5BN3A 3B6EA 1XJCA 1NLZA 3IO3A 2QTHA 5BWMA 3QBTA 3W9YA 1ODFA 3GFPA 1FX0A 1GRRA 2PT7A 2OCPA 1CS4C 1KSJA 3CM0A 5HPYB 2XB2A 3GJ0A 2A78A 4R71A 4A92A 1LY1A 3TE6A 4G5GA 2IYUA 2BCJQ 2DWOA 3OEEA 3RABA 3AVPA 3F0TA 5EXXA 2Y8EA 4RZXA 4WA7A 3TW4A 2XSZA 1BS1A 3HPRA 3CNOA 2AHOA 2IK8A 3W5JA 1G4AE 2HXSA 3A1SA 3AP3A 3VKGA 2X8AA 4ZCLA 3KQLA 1A7JA 3OFND 3Q5DA 4BFZA 4X8MA 3WXMA 4AC9A 4ASUA 4JBWA 4G5SA 4NYJQ 5FOSA 1OF1A 1W47A 4HEJA 2YINC 5FOXA 1Z0JA 3DMNA 4MYUA 2YHSA 4NYMQ 3IEVA 4X8OA 4JL8A 1NVXQ 4Q9JA 1M74A 1KI9A 3C5CA 3CX6A 3KFXA 5DYIA 2IYXA 4KSBA 1IN6A 1YRAA 8OHMA 2C9YA 1NG1A 5B57C 1SHKA 3HU1A 3D3QA 3T34A 4YXWD 2YC2C 4BPBA 1PLLA 1E2PA 2ZJ5A 3KZ1E 4QGAA 5KSYA 3LBIA 2ZRKA 1R5BA 3VX3A 2AFIE 3KUDA 1TU3A 2WAXA 1UBCA 4R98A 3T12A 4D4LA 4BGDA 1CP2A 3WMEA 3LBHA 3K09C 1FTSA 1MO5A 1VYTA 3FKQA 4C0HA 2GEDA 4M0LA 3NBXX 5LB4A 2ZYUX 4A6PA 2ANBA 3BB4A 2G77B 3RSLA 4ACBA 4I1VA 2VHJA 5M04A 6Q21A 1ZIPA 4XVQA 4M9ZA 4IDHA 5FUXA 1HTWA 4N3NA 5DGXA 4UNPA 4ILEA 3EPHA 4DUGD 2ZREA 3C15C 3A1UA 3THOA 2JAQA 2OLJA 1XCPA 4EPYA 2ZE5A 3S1AA 1G3QA 1LS6A 4A2QA 4YDSA 5B2ZA 1XTSA 3J81k 5DI3A 5DN6D 2QBYB 2JIZA 3KUCA 1Q3TA 4JMPA 4JBYA 1CTQA 3KXIA 4G5QA 2C95A 4JLPA 1T3SA 5DO9A 1W5TA 1VYVA 1L7VC 1BMFD 5EJEA 4LK2A 2EFDB 4RD6A 2EWVA 3ZIAA 3UANA 2W6IA 2P5SA 4B75A 1ZVQA 4K8OA 2C9OA 1E2NA 1G6OA 1RRFA 4WW0A 1YRBA 1WQ1R 3R8FA 3X1ZA 1N3BA 2V54A 3OIUA 4LJ6A 1L2TA 3DZ8A 4WZ6A 3C5HA 3UK6A 5J4HA 3I8XA 5AJYA 3QKUA 3U4QB 3BS4A 3I61A 1P7CA 5H1YA 2WKRA 4YMSA 1NVVR 2QTVB 1GILA 4EJSB 2UKDA 2DHRA 2QTFA 2WIBA 3TIFA 2AD1A 4F4IA 4P32A 1PUIA 1J2JA 1F2UB 1P62B 2OBNA 3EX7C 2R6CA 2H5EA 1VCOA 2BMJA 2WJHA 4LCBA 3RYTC 2EFEB 1II8A 2JGNA 2VHTA 1S96A 4BECA 2GCOB 2WOOA 3K0SA 2H16A 1XMVA 3WHLA 3WBKA 4PC7A 2AFHE 1JR3D 1NSFA 2Q9CA 4WZBE 5AR1A 3QE0A 5G53C 2MSCB 1OFIA 2CEAA 2GRJA 3LH5A 2V6JA 4IOMA 4AYXA 2PJRA 3IPYA 3ZD6A 2IS2A 1W4BA 2PH1A 4M1WA 5KU1A 2WPDD 3W6OA 1E99A 1YR9A 3AKEA 2CCGA 4C0LA 5J4LA 3FFBA 2RGEA 5B64A 2FJUA 1NNEA 2FZLA 1NBMA 2GILA 4QC2A 4DRZA 4A1FA 3OZXA 1T5IA 1F2TA 4PO9A 2WWFA 5JHHB 2C04A 3GFTA 2ZS9A 1KJWA 1XXHB 5EQTA 1E96A 1KMQA 3CH4B 2JLWA 1R0ZA 5DE3A 2WIAA 3M1IA 2ZI3A 1MO3A 2HCBA 1G9XA 3NTUA 2CE2X 5FL7A 2PZEA 3EG5A 2ZJOA 4YMTA 1G17A 1X86B 2F3RA 4PC2A 3RS5A 1N0UA 1P2TA 1LTQA 4V0NA 3Q5EA 3NWJA 3L8YA 1NN5A 3AGQA 5JS8A 1JB1A 2RGCA 4Q4JB 5EP2A 2JDID 1E1RD 1MABA 3B1XA 5H70A 2F43A 1IQPA 2IHBA 5CIQA 3B7GA 1II0A 2WJGA 1ZC3A 4FMCB 4RFSB 1DS6A 4Y0VA 4KO8A 2YJTD 3AQ4A 1GNQA 3CONA 2JLQA 2OZEA 4JLBA 4CEIB 2BVNA 3EZ7A 2F9MA 5JECA 3IKJA 1FPMA 1KI7A 3HYRA 1Z0DA 1KO5A 1U8AA 4K46A 4WBSA 1KK0A 2VSOA 3PG5A 1GL6A 2P0EA 1OE0A 5E3HA 1VKJA 1T6NA 4PAOA 3FOZA 4TL9A 1SGWA 3A4MA 3NH6A 1KO4A 1U0JA 2GBLA 3L43A 4PZLA 4Q1FA 2DFTA 1VECA 1EXMA 1IAQA 1KKLA 3FB4A 5JFGA 3SQXA 4Q4AA 1XWIA 1KYIA 4ZKEA 4WIAA 2VH5R 4DLRA 1E3MA 3BFXA 3OFNA 2ZI7A 3I72A 1TF2A 3JZMA 3GLGE 2H92A 3T5DA 1E0AA 1F60A 4A2WA 4QM7A 3TW8B 1KK3A 4RCYA 3ECCA 3QY0A 3SFVA 4CVNA 2ZAMA 1N25A 4DSNA 5FBWB 4CF7A 1BOFA 3IILA 1XCMA 1YHNA 5KTYA 4E5UA 2QM8A 1ZW6A 3DMDA 2GXUA 3KJGA 3I3SR 4XOIA 1W36D 2N42A 1JBKA 1AZSC 3B9QA 3M6AA 1Z06A 4MRSA 2FU5C 2YWEA 2V9PA 4YXWA 1G1MA 1OB2A 4C2TA 2E87A 4M1KA 5G3ZA 3K70B 1DAMA 3MUFA 3ONWA 1MT0A 4R9UC 3PIRA 3RRZA 2AKYA 2GXSA 2R44A 3KKMA 2PEZA 4KYIB 1QHHA 1I4TD 5EZ5A 2J0SA 2K5UA 2QAGB 2WJIA 2DY1A 1RW4A 2R6AA 1T8UA 3AM1A 1UFQA 1J8YF 3TSOA 1M34E 4URZR 1JEDA 5TMPA 4R7ZA 1IOZA 2VIIA 3W8NA 2V4ZA 3FMOB 5F9HA 4DUGA 3GJ5A 2PL3A 2GCNA 4Q9HA 2OXCA 3I92A 4HB3A 1CR1A 1XPRA 2JLRA 4US0R 3ADDA 4WVFA 1GG2A 4IOLA 2ZJYA 2G0NA 4AG6A 2GKSA 1JNYA 3SC3A 1OH7A 2NO7A 5FR2A 1JQJC 3VU9B 5DN6A 2QAGC 5EE1A 3F3YA 2QNRA 2WZQA 3R7WA 1VG0B 1OJLA 5KOYA 3QKSA 3B78A 1WBBA 2FPLA 2WWHA 1E0JA 5F9FA 3QSYA 1F48A 3BK7A 4FW9A 4DCNA 1XMJA 4ZI2A 1D5CA 4GSYA 3FKSD 3WRYC 3H2YA 3SN6A 5TARA 1BMFA 3CR7A 5KDLA
chains in the Genus database with same CATH superfamily
4ACAA 1TF5A 4JLSA 4QBGB 3AEQA 4J4HA 2XA1A 5J2TF 5ELXA 2QWXA 2BDUA 2VK2A 1HE8B 3ZHXA 1YACA 3EFBA 3OE7D 3W05A 3R7SA 1CFJA 1CUJA 2YRFA 3Q7PA 4DG9A 2A1TR 3GUUA 4TV8B 2H3EA 3NM4A 4E46A 1GZHB 5FTJA 5KKNB 1HQDA 4BHTA 4G97A 3IAFA 1YJAA 5KOJA 1AGNA 2IY7A 1RJ9A 5EHXA 2AK3A 2WMYA 3U44B 4QUJA 1BCSA 3B12A 3DBRA 3I9V6 1RT9A 4HS4A 1SRRA 1I3MA 3EZXA 4K3VA 5TPWA 4D0NA 3WIOA 2P3SA 4UUNA 2YWHA 4Y6SA 1SU6A 2HD4A 3JVVA 3ANSA 3DBVO 3C0KA 4A8HA 3IO5A 4EK9A 4JMLA 3WE7A 5FTLA 2OFFA 1RYBA 4KPEC 1KI1A 4S12A 3WBJA 4BUJA 5IH7A 5FFNA 1Y3IA 4KFRA 3EIFA 2OCIA 3LGAA 8ATCA 3BWCA 4X8LA 4YV2A 2IBTA 1KVSA 5AJXA 2BFFB 4RA9B 4CDRA 2ISCA 2W6ZA 3E9MA 5P21A 1SVSA 3EULA 3IIJA 4MYHA 2CUNA 3UB4A 4C6HA 1CRWG 1LFAA 1BXRB 1XA3A 4TMXA 3V1KA 1JR3A 1G16A 4K9KA 3ESAA 4LJ7A 4RGYA 1P9RA 2AG1A 5LDHA 1WMAA 3HXMA 4IDOA 2NU8A 1OWMA 2VWHA 1L8OA 1KYWA 1BS9A 1YE8A 1G8GA 4FFLA 5EERA 1G2PA 1G8FA 2P9HA 1YUBA 2WPDA 5JCPA 3NT2A 2RHWA 3R0VA 3FNEA 2XW6A 3H5LA 3CFYA 1KMNA 1OFHA 1Z74A 1KU6A 1QR6A 1NBAA 2BFBA 2OCAA 2Q4RA 2ONKA 1RXUA 2XH8A 3FYDA 4JCOA 5G1NA 1KMHA 4HGZA 2OVBA 4E3ZA 4E4RA 3A2KA 1T5HX 3IDAA 1QCCA 4HTFB 2R62A 2FFQA 3A1NA 4HLCA 4PSAA 3TNDA 5ICCA 4BMDA 1Q12A 3SVLA 3L0PA 1UOOA 4MRAA 2JIRA 1DKRA 2D0IA 2XUZA 4KKXB 3TSZA 1UJ6A 2OB2A 2WP0A 3BHJA 2VUIB 4Y1RB 2OXIA 1IE3A 1UEJA 3SU8A 3ZD7A 3O4JA 3Q3VA 3RUCA 4DLAA 1RCFA 4EMTA 1KVTA 4B7CA 2NO1A 2DFKB 4U1RA 4U2EA 4ND5A 5HF5A 3CEPB 5ALPA 1U1FA 1XEAA 2HSDA 4DZRA 3KCNA 1HE5A 5A4MS 2PKWA 2FMXA 3ENWA 1UT5A 4XQEA 1XPOA 2DY0A 1YH3A 4NU6A 1J7KA 2AJDA 1EAMA 5DYWA 4M9QA 1SUAA 4E5VA 4TLLB 5IVDA 1C29B 1T91A 1W2WB 3HP1A 3K5WA 1KBZA 4MIOA 2JIPA 2AC2A 2QRLA 4JGBA 4TX1A 4UBOA 3TFWA 4DQDA 5J3JA 5I8WA 1JR3E 3RJMA 2I4MA 2PUHA 2X5KO 2PUCA 1T0BA 3NHFA 4FBMA 2YJ6A 4Q7EA 1QB8A 2NO6A 1HZZC 4FLEA 1N6OA 4MS3A 5CR9A 1XLVA 4KQ2A 4MQMA 3LL7A 5HOQA 3H11A 5HDBB 1P72A 3QBJA 1NYRA 1W19A 4IQ0A 1L4UA 4URHA 4BGIA 4ZCMA 4EHNA 5NLLA 4EJ2A 4EUNA 2Q4BA 4IDDA 3ITEA 4ENTA 3FZEA 2EBHX 3ZZNA 3T3EA 4LQDA 3B2QA 3LUCA 3ZR4B 3W2TA 5F73A 4E5SA 4WQMA 2J3DA 1PR4A 1KVRA 5COBA 4BDTA 2XIJA 2VRNA 2Z2ZA 3ET5A 2GM5A 3Q3IA 1XQWA 4URVR 1KJ8A 4XM0A 5BMVA 2WWIA 1A7AA 2GN0A 4P98A 4WSOA 5E7JA 1ZN7A 2QTWB 2JEZA 1U28C 3ONFA 4TV9A 4W5TA 1OWNA 3P26A 3TTXA 2GVNA 2FFAA 2N0SA 3GFOA 1R0YA 1YRYE 3ZCVA 1OH6A 3TOXA 1R5JA 1HGXA 1DEHA 4DRXB 1RFGE 2Q1XA 3MMNA 4KIWA 5TGZA 3RUIA 3F8TA 2BKEA 3CMCO 1Y3BE 3O26A 5FUBA 4BLUA 5DNUA 4DNXA 2VTDA 5TNXA 3IBGA 1V8OA 3EG9A 4MKGA 3KQHA 3QE3A 2W42A 3AB7A 1CQIA 4TZTA 2I3GA 2W8BA 5JMPA 5LYJF 4A1OA 5HRUA 3BT7A 3QTLA 1XU9A 4RLHA 4WADA 3MINB 1Y7IA 3RE1A 3DEYX 2JA2A 3EK2A 1V39A 3H1BA 3IELA 1GPYA 1XI2A 4GM0A 3S99A 3DP7A 1RBYA 3G8DA 4LI3X 3IA7A 4EJSA 4ZN6A 1I36A 4IBOA 4C4PA 3WGIA 2PRSA 4EITA 4GP9A 3UJ7A 3AR2A 2V1XA 4NMHA 3KTFA 1PX2A 3CKYA 1T4CB 1UBLS 4BX8A 4DEYA 1SHZA 5HVNA 3I9KA 3S40A 1RWMA 2P41A 4LJRA 1W85A 5L3VA 3SM9A 2EG5A 4I46A 3BJIC 3KB6A 2WINI 3KLBA 5KNCA 4LDZA 5LP6C 2R6R1 1W2GA 2XF2A 4NS4A 4EG7A 2UZ4A 1E3WA 1R12A 2GJ4A 2PD6A 2AKEA 1CJTC 3TXAA 5K99A 3KG2A 4FXPA 3F90A 5KVQA 4YCLA 3JW8A 4KWHA 3DQQA 1RMTA 3KB1A 1R9GA 1NWCA 4RCZA 2KWIA 4KUEA 3OM8A 1WU8A 3N53A 1ABFA 4EUHA 4J16C 4MV4A 1CJMA 4IIJF 1DEOA 2Q3LA 1MNQA 3LKDA 1EDBA 4L28A 4WY2A 4XVUA 3UCEA 2B82A 4QBKA 1K2VN 4JUCA 4LHYA 3PS9A 4HF7A 3FOFC 3I2IA 4BZQA 4BLVA 2ZYSA 4R5MA 1YDGA 2C5BA 2HPAA 2GZ3A 5BNTA 5KO2A 1J22A 2QRHA 4XDGA 3TL2A 2ZJZA 1L8AA 2PGIA 2QU8A 5EIOA 1ONPA 3SMQA 3PTAA 4N5LA 1KHTA 2C4UA 2AN4A 2G1KA 3ABQB 3ORYA 5AI8A 1W1UA 2G04A 3ZWCA 2B5WA 3HWRA 4J7AA 2JAHA 4P93A 3G8BA 1OGYA 4QYSA 3I9NA 3IQIX 2FPGB 2PL5A 1XQYA 4GDMA 4ZV7A 5K6AC 3WGNA 2O8DB 4LBYA 3UKOA 4EAQA 3IOMA 4MYDA 4PG8A 1KH2A 4CM8A 1QZ3A 3GT4A 2AYYA 2Y1CA 4G85A 1XF1A 4GL4A 4M1EA 5EC8A 1I51A 1OHHD 1RLOA 4KK4A 4NV1A 1QFJA 3HGMA 2O2GA 4CIXA 4BFSA 3W7VA 3OIYA 1Y3FE 1HA3A 2XUAA 3UA3A 4A7PA 4XWGA 4UFPA 4LHZA 3RGWS 2GBLC 4IMPA 3JASB 3I53A 3STTA 2HEIA 2X9QA 2PQ0A 1G3UA 2HGZA 1QH1A 2QD5A 4MKRA 5LIRA 2O8BA 4UDXX 3PDUA 3SZOA 5BP7A 3K5HA 4Q4LA 2DYKA 2TMDA 1D7AA 1UBEA 1Y8CA 5CBPB 4YJ2A 1TK9A 3KS9A 2V7QD 2WIDA 3DV0A 3F9CA 2YXPX 4A8JA 4DN6A 1ESEA 1XIVA 3GB9A 1K63A 1SRQA 3HC7A 2IHTA 1XROA 4HEA1 3UG7A 1HDEA 4FHCA 4CV0A 4Y2VA 4GKBA 2G88A 4BN5A 4D1YA 1Y5IA 1BFUA 2YIJA 3FNQA 4AQYB 4CGZA 2NZWA 1A5SB 1E1CB 4F9GA 5BV0A 3AI3A 1LI4A 2WKQA 4TMZA 7ABPA 5DNWA 1ND5A 3QKTA 1TKCA 2AHRA 4CT5A 5F7ZA 3LWNA 3INGA 3UGQA 2XMGA 4JQSA 3L6OO 5LA6A 4GMHA 5GGXA 2QI9C 2WUDA 1W5BA 3K53A 3RYHB 3PIDA 3KJHA 4L27A 2CW5A 4YP7A 2P1RA 1EVIA 1W30A 3VNRA 2P3OA 2Q9UA 3W6NA 1NQ5A 2WTXA 3OO1A 2J3JA 5DT9A 5M2QA 1NBEA 2Q5QA 1J97A 5ESXA 4C0QC 5BN1A 1GZ4A 1PDWA 4GLOA 4HYEA 4PFQA 2GPYA 3A9RA 4I4CA 4RZ2A 5I47A 2N46A 5FLXA 1U63A 3GCZA 3WB2A 3EC7A 1SOAA 3NWEA 1N6RA 1YR6A 2CL5A 2WJZB 2X14A 5CD9A 1E2QA 2HLPA 1VJCA 5CDTA 5LP6F 3ZLJA 3L8HA 1SXJD 2NSHA 1GA1A 4KC0A 3WZ2A 3DZKA 4ENQA 3KSDO 1HLGA 3QVTA 1DRUA 2ZRMA 1VCHA 5CJ2A 4UXHA 3DH0A 5D3MA 1BJTA 2JPDA 3OLWA 4Y0AA 4EKNB 5JXJA 5MN6A 2CLOB 4LTDA 4DLBA 3TLGB 1ZNXA 1B16A 1AS2A 5ITVA 5LXTF 3DEFA 5AJTA 3QKRB 4MI1A 4HFMA 1O6ZA 5EUQB 1LK5A 5D1HA 4BJ5A 4OFZA 1G8HA 5KTNA 5LZ9A 4LRTB 1NDHA 3NIDB 4ZYVA 4UATA 5FYQA 1TM1E 2IW3A 2OLKA 4EMBA 3C41J 3RV3A 3E7PA 5AI0A 3JY6A 3QEMB 2WJ4A 3GARA 1YZTA 1EXNA 4YPVA 1GGEA 2A5YB 1QIJA 3I1JA 4QSMA 1MC8A 2QL6A 3QOXA 4L22A 4QATA 5ARCA 1B76A 3T9DA 1EFPA 1C9NA 1PEAA 1XNJA 2EKZA 5KVSA 3T95A 3QVOA 1VKZA 2QS9A 2Q8QA 4QRIA 1KSHA 3Q9UA 4POAA 1VLJA 2BY4A 2FW8A 1QV6A 3AR5A 5CGZA 1FTYA 2HA4A 4ZREA 2V45A 1U99A 3IMKA 2R4UA 3ZTTA 1KI4A 5CTJA 3TIVA 5KREA 1K86A 3EA4A 1G20E 4QPNA 3B5IA 3C98A 3B7WA 2F1RA 4HDMA 3CT4A 4FMBB 4HNAA 3L6DA 4Q34A 3ILXA 1E4VA 1ZIDA 4ETMA 2VPQA 1SMKA 1FP4A 5MN5A 2ILTA 3CLRC 2A30A 1SCNE 5JRDS 1L8XA 5J9FA 3SJCA 2Y9MB 1CUVA 2PBRA 3B3AA 2E1RA 2ZJ8A 2BIFA 2IWHA 1BDIA 3U7EB 3DB2A 4HWKA 5LFAA 3L4BA 2QTZA 1MEOA 1MRNA 4BLPA 5HM8A 1JECA 1LLFA 3PPXA 3KUUA 2PUEA 5T7BA 1NXQA 5E6RA 2A1UA 3PQ2A 3BWDD 1GTZA 1VKOA 4HB4A 2A5DA 4U63A 4YJGA 4PGHA 1HQKA 2CNOA 4HX2A 4A6EA 1MLDA 1FL9A 4FB5A 2BLNA 1PJCA 2GX6A 5CNJA 2JAWA 1R0KA 3HLTA 4PVCA 4QOHA 4YGXB 1A04A 5BN4B 4ER5A 1VPVA 4L16A 3AKYA 3I9JA 4PX9A 5ALWA 4AICA 3KOXA 3THYA 3ZCUA 3HKEA 2P6OA 1H8HD 4DM4A 2I3DA 5ANRB 3UV6A 3G2IA 2GF0A 2HCJB 1F5SA 3NDRA 4MNTA 5L7YA 3ZU4A 4MV9A 4D8TA 2CFCA 4EG0A 4A6XA 5JC8A 4AP6A 4HG2A 1QLHA 3E1KA 2VWQA 4Q47A 4XIIA 3VVCA 2KS6A 2NVWA 3IVMA 3VC1A 1XDWA 2V8OA 3F2VA 4UVHA 4HC4A 2QJRA 2VRCA 4Q3NA 4GXNA 1GNLA 2YWGA 4ITRC 4KZKA 4UASA 3ZX5A 1TGYA 3JZDA 3OQBA 3FH0A 2XXAA 2OO7A 1QG6A 1S2MA 3P2YA 1T8SA 2UZ1A 3JALB 4X7PA 2OHOA 3CBGA 3JAKA 3SSAA 4CHGA 1YJQA 1IY9A 3KXDA 1ZK0A 2PGNA 4GW3A 4RF4A 5M3BA 3V32A 5B4UA 2HR1A 3HSKA 1CUEA 4BX9A 3QA9A 4MVWA 1GNRA 3KTAB 4DCSA 4X66B 2Q1UA 3NHJA 4OI4A 2ATIA 4AULA 3OCJA 1WMDA 2QUHA 4FSXA 5KAMA 1B43A 2YY7A 1BHJA 4L5AA 5DIZA 4YJFB 4ZVKA 3CUWA 2VJMB 1KTIA 1EQAA 1CUXA 3GGGA 1P31A 1R9NA 3RNLA 1HDYA 2NNLD 2Z8XA 4IPTA 4GFDA 4FILA 1P1RA 1OIWA 1UL1X 3FW1A 1A4RA 5CB0A 3EIXA 3LCUA 4D8YA 3GPLA 4WVLA 2UUBB 3WNDA 5KYXA 1D2GA 1K9VF 1W48A 2RJ3A 3VPCA 1EFDN 1FU4A 3DLPX 1NR1A 2NO9A 2YXNA 3EZYA 2ZYAA 3MQ4A 5H4GA 1E3QA 3FUTA 4J3JA 3WLPA 2ZSKA 4WOCA 4O4HB 4M8LA 2F17A 1BZYA 1ISSA 2WUWE 4Z4IA 3KZMA 1KEZA 3G2QA 4I99A 1I2MA 1XTZA 4K88A 4IJUA 5HUHA 1JH8A 1CUYA 1YI1A 4P7GA 4KN6A 2OYRA 2OBMA 4XWAA 4B71A 3IESA 5AXCA 1UJBA 1FYWA 5AKKA 4PSDA 4FN5A 1R7RA 3BORA 2CMGA 2NPOA 4W6QA 5AKHA 2RIRA 3M4NA 4I5FA 4LWPA 3CZRA 3GR6A 1CJVC 3H2KA 1SD2A 3I5YA 1AUQA 3FCCA 3ORSA 1K6XA 2QIPA 3Q7EA 1N2SA 1Z4LA 3ZWWA 4FMPA 1H5UA 3ZCSA 3UK1A 4R0NA 2J0UA 3CLTD 3FYTA 4TOIA 1E2KA 3KKKA 2IP2A 1Y9EA 1XPJA 2H4HA 3NLLA 4ZU6X 2ODTX 2C0PA 3ELWA 4MR8B 3REOA 3BRWA 3HDVA 2B1JA 3IE2A 3AF2A 3TRKA 4ALIA 5C7YA 1JEYA 4MLCA 1P7VA 1ZVVA 3OPNA 3T4EA 4MUFA 1ZH8A 4YECA 3LV8A 1OT5A 3GVPA 4IICA 1PSDA 1OLOA 3PGJA 3G2LA 4L5BA 5K0LA 3UBTA 2XZLA 4BFLA 1QH9A 2CJWA 1JXMA 4OHRA 1R8SA 521PA 5TY0A 4LF8B 4HQ6A 1K8XB 4QEKA 2GUWA 1VC2A 2R84A 3EDYA 3HN2A 4HWSA 4LXQA 2HRBA 1JU9A 1GZ5A 4NXNB 3M3DA 3T3GA 1DCMA 3D9QX 3OTOB 4X45A 3GGCA 4EYKA 4FM9A 3GOHA 1LJLA 1QQ7A 4TXNA 4F7DA 4QQRA 3ED1A 2WIFA 4G0MA 3UPUA 3T1HB 3TAHA 4ITVA 2HU5A 2G28A 2VJOA 1OB5A 3BEOA 4ZYZA 3QGMA 5FWXB 4DHEA 4EFNA 1D4FA 1E61A 3I37X 3D8TA 2NGRA 2OMKA 1X80A 4OHOA 4C07A 3EJ6A 1LLCA 1YB4A 1Z4PX 4EO9A 1OMOA 1PE0A 1H94A 2BRUC 3U3MA 2CV1A 2HTFA 2ACKA 3SIWA 4LF4B 3NEAA 2IS4A 4KIUA 3VZQA 1JVNA 2YFHA 1MAWA 3DLAA 3E9EA 2RH4A 3G79A 1Q7GA 1STOA 5AVUA 5JWRA 2O8CA 3D5EA 4OYHA 4C7OA 5EXTA 1QHSA 3VYUB 5JADA 1S02A 1UH5A 2F3UA 1W5FA 1LTKA 4OQZA 2PS9A 4JEHA 3OI7A 4WK4B 4YV1A 3DFIA 1XMQB 1IN5A 1CY8A 5LR6A 1YB2A 3B8HA 3GGOA 3BICA 1N6LA 2WVGA 4KYVA 1OWPA 2HMSA 2Q46A 2OBXA 5B36A 5C3MA 4G4IA 2WFMA 1R4NB 1PJLA 1GPMA 4GNRA 4I19A 1C9MA 4N0PA 4O4LB 3UFBA 1G66A 1L4EA 2HNAA 3GIWA 4NATA 1Z6TA 2BF4A 1CB7A 1VPTA 1HLDA 3AF0A 2HBYA 3P2EA 5AXBA 3IQXA 1UDRA 2A9PA 1UKVY 1O57A 2ZGVA 5KQGA 3BFJA 4X95A 3SK0A 2P77A 3L77A 4MP8A 1L5WA 3Q10A 1C7EA 5FJIA 1C50A 1U9JA 3WRXC 4YO8A 4ARCA 4P1ZA 1YONA 4FYMA 3DKPA 1N2XA 2IEYA 2BE7A 3IHTA 4TRMA 5KDDA 2FDCA 3TL6A 1K5GA 1Z7BA 4MVJP 4P3YA 4PHTA 2HF2A 4GOJA 3UXEA 3R7FA 3DKRA 4JJZA 5AK4A 1AKRA 4YWJA 4EQ6A 1XTBA 4F38A 1YTUA 1OD6A 2IEZA 2Q6IA 3LDGA 2W6JA 3F5MA 5L4NA 1ZNQO 4NPCA 4X71A 3TQIA 4ER7A 5BWOA 1I94B 2JC3A 1ZCJA 3K1AA 2YFKA 1VIDA 1H0RA 2XX3A 3E18A 3L1JA 3QXSA 1B8NA 4U7JA 4BFUA 5JDIA 1TB4A 5JAPA 1UODA 4JOCA 5TEWA 2VJLA 5IKXA 3B1VA 2BM1A 1RBZA 3DE3X 3HU3A 2HYDA 3JPWA 2RB5A 1XHEA 2AFIB 1R4ZA 2C2XA 4E09A 5E9QA 2Z95A 4J0FA 2ZSUA 4B79A 1DU4A 1UPUA 3A6GA 1E1MA 2DCUA 5FOWA 1JHRA 3O8OB 4DBZA 5HQTA 1YZHA 3OJWA 1G2QA 1NJSA 1RCUA 4LOAA 1J7JA 3BFKA 3UWOA 1TQ4A 3MWKA 3X44A 1HDRA 2JJQA 1DIAA 1FSFA 2JNWA 1JJ7A 2I1QA 2X0IA 5CNKA 4CXMA 4NEHB 3O1IC 2FSVC 2R7NA 2XKAA 3A1WA 3RS4A 1Z18A 4RMJA 1ABBA 2O20A 2OCBA 5LZ4A 3RLFA 3H5AA 4D9CA 2I3ZA 2WABA 1GYRA 1WMBA 1XZMA 1YOBA 3QEAZ 2JEOA 3AV0B 5K03A 3ETJA 3IBYA 4C4AA 3PCXA 1J0EA 3Q6NA 2ORIA 2ZDGA 1NLMA 3I2HA 4OUKX 3TQSA 1Y6RA 1VLVA 3GO4A 3C7TA 4DMFA 3I58A 1VL6A 1WEHA 1G98A 1ISGA 1IY1A 1EDZA 3D6AA 3F8WA 3H5RA 4PO3X 3PQDA 3ER9A 3U56A 4UHBA 1QCDA 1FS4A 3CQ9A 4MVJH 4XIJA 2KBFA 5JBIA 4XWWA 1W35A 2A88A 4MOWA 3P94A 1NIJA 4X20B 5A5EA 5A5VA 1XTJA 4W5OA 3THXB 4ZVUA 2PR2A 1EU1A 3H5IA 4QUGA 5H3CA 2PZMA 1RAFA 5EQJB 1EINA 2Y6UA 3M33A 5F2EA 1LW7A 2INGX 4EPXA 1V2HE 4NZ9A 3GHHA 4G5RA 1NJ6A 2ZYVX 3IV9A 1QRAA 3F74A 3NBAA 1KRHA 2X6QA 5DSZA 5H9WA 2VAMA 4P31A 1E0SA 3I01M 1A95A 4FOPA 2JFQA 4MEJA 1A7KA 1KFJB 4U9IS 3WY9A 3CUVA 4FU0A 3ZNPA 2CLDX 4BMVA 2NZJA 3GD7A 1N9KA 2VN8A 1JPNA 1USVA 1PO7A 3BCRA 3I05A 5A4JA 4EECA 1WDWB 1AGXA 1EGQA 3I4FA 3O3MB 2D1TA 3KELA 3JX9A 1T0IA 4ZCSA 5KC9A 5BPHA 5JPDA 5LZ2A 5SZIA 1UPCA 3HFGA 3AR3A 1DJOA 3O90A 1NGSA 4IILA 4O0MA 5AUNB 2QTMA 4MV7A 4R4JA 1C8VB 1CY1A 5JS6A 1H1LB 1PR1A 4CG0A 4DDWA 3EQ9A 4Q6BA 1IWPB 5BY2A 2HMUA 3WYNA 5DI3B 4EF6A 4DV0B 1JG4A 3V00A 5IG2A 4XGKA 3SDBA 3RJZA 5GGYA 1WUKS 4KSCA 1QGYA 4UUOA 3MCVA 1RM4A 3JQFA 4NOLA 1DP4A 5CA0A 4O2RA 4M7RA 1PR6A 2ZVJA 2R6HA 4I4TF 3FPAA 4A0FA 2ECFA 3L49A 5CCXA 1H6DA 4MQFB 1Z5WA 2LCIA 4KLNA 2ID8A 3PIIA 1F2DA 1BCRA 7AT1A 2NXNA 1XSEA 2H1RA 2FWIA 3R9KA 3UK7A 2ZTMA 2ZKLA 2RGBA 3K9CA 4DGSA 4F21A 3NTRA 5HCIA 4IRUB 5A6VA 3TNYA 5C7IO 4X7MA 5LLTA 4LF6B 4XASA 3K70D 1KDOA 3BMCA 4M9SA 2Z30A 1CFZA 3WGJA 1WHTB 3KDAA 4FCVA 1CPYA 3ZDDA 1SR8A 4OHWA 4B43A 2JH8A 5FEMA 5KKCA 3R40A 4FGZA 2CB9A 4IVNA 4UTXA 5MFZA 2B8TA 1V8ZA 2X41A 3PXBA 2B94A 1CZRA 3L8GA 3TX6A 4A0QA 2GN1A 4C29A 1VE3A 3SYMA 3FYCA 3E2IA 4ZI3A 1G64A 1UJ4A 3GRZA 3H6KA 4G23A 1SH7A 1YIAA 4PIVA 4F4HA 3SS8A 2O2SA 5KHAA 2GBIA 3HZZA 1GCOA 1K6JA 2A5GA 1MVOA 2I67A 4OH7A 1FBNA 3SS7X 3JWJA 1NVWQ 1SKAA 1AD2A 2ASEA 2ZIAA 3H1EA 1FFGA 1KXZA 1PL8A 3B2NA 3FPHA 3IIIA 3NTOA 3TNJA 4D9JA 1U7TA 4RDXA 5KMGA 3VNUA 3BCHA 3R6DA 1O95D 4S24A 2QBYA 1DKUA 1DKNA 3GCWA 4LJ5A 2C7QA 5C4GB 2B8NA 2XWBF 2PZKA 1CVLA 2J09A 2WNIA 2CZQA 1OI2A 3O4IA 4PGAA 1HL3A 1HTBA 1OZ0A 3U3OA 2IOYA 4HHEA 1J99A 3PUYA 4Z9XA 2R6FA 3KJEA 2PJUA 3A11A 2IELA 3QITA 4HAXA 1XUOA 2VSNA 3HDYA 4N03A 4PZ9A 5JD4A 3IURA 1P0CA 2ZSDA 3BRQA 3H2SA 2Q5CA 5FFMA 1BIFA 3O1LA 1GCIA 2XB4A 3K6SA 4L4RA 3AIKA 4M8SA 3RK4A 3J7TA 3NC4A 4W7HA 3LLMA 1YDWA 3DFFA 3U4QA 3E03A 2ZRHA 4R3UC 2PX5A 1WF3A 2V7GA 5IVIA 4TTVA 5F1PA 5IASA 2A3RA 3RG8A 2JRCA 1XLWA 1P44A 5EKUA 3U17A 5BNIA 3TUZC 2Q0HA 2ZIUB 1DJLA 3I1FA 4FC7A 3VR2A 2X8BA 4TZ0A 1JAYA 3UJ3X 1FLNA 4I08A 3KOYA 3RYFA 5M34A 4DG5A 2ZI4A 3GZNB 1QVRA 1Y63A 2HJ9A 4E14A 1E2LA 2ZR0A 4AUMA 1PTJA 3WKCA 4QJ3A 3DHWC 2XCRB 1O54A 1T3LA 1V37A 2YZMA 4RHXA 1IXKA 1EH5A 1M1UA 1K92A 2X1MA 5T67A 1DBSA 3PNKA 1J00A 1YHYA 3N5CA 5JLJA 1NXPA 2XOEA 4IEFB 5BQXA 2P7IA 4JI6B 4EGSA 5DOVA 1QNLA 3EGVA 3IUBA 5GADl 3S0JA 4MKIA 1MO4A 5FTKA 1YU9A 2HB6A 2JIZD 4Y9RA 4DV7B 2BFMA 1XN1A 1TLFA 2B8EA 3D8BA 4UTNA 5DNVA 4IZ6A 3W5DA 3HKBA 4COOA 2PFSA 1G3RA 1IXYA 2B36A 3KBOA 5B3JA 4EHIA 1E2UA 4LNUA 1XALA 3MWJA 3Q3GE 1M8KA 3LK7A 2FY8A 3WLIA 3PXCX 3H0EA 2JJ1A 2ZE6A 3E6AA 5DM70 3FOBA 2YYSA 4PLGA 1MOSA 4LGYA 3SLGA 4GZ5A 4JNCA 1F0KA 1QK5A 1REQB 1TI7A 1KIAA 4Q5IA 4DV4B 1PJTA 1DGQA 1E6EA 1DLIA 2EWWA 1RM0A 1GFWA 1M66A 4G8CA 1VMIA 3V1YA 4ZHQB 5KVVA 1FRVA 1N2HA 4R81A 5TPZA 1AXRA 1FQWA 4LX0A 4UU0A 1Y7HA 1BX3A 1NU8A 1YR2A 4B7ZA 4X54A 5EUMA 2X3YA 3RS0A 5L8VA 1XZCA 1YK0A 1ODCA 1KGDA 2NZYA 3ASVA 2L19A 2I2AA 5FF9A 4HWTA 1X1TA 3LVQE 4LZPA 5E1BA 2JBAB 4X1IA 2I03A 2DC1A 5BW6B 4RCVA 5B58C 1CYDA 4H7EA 4IXMA 4BMSA 2UYGA 4U2FA 1U7ZA 3BZBA 4P3OA 4GI2A 5EHNA 4C76A 1WLYA 2J30A 3EZ6A 1TMYA 5AVRA 5DCYA 5T4HA 3LZCA 1LV7A 3CZ4A 2ZXUA 4KBFA 3IDOA 3OZTA 1NBHA 3A9VA 3OEHA 5DI9A 2HF7A 3T54A 5JJBA 2JLVA 4C08A 2WYUA 4WAUA 2V55B 3DVSX 3GCXA 5JLAA 2QX8A 5HZKA 1IB0A 3QNUA 2R00C 3K1TA 3QIVA 4Z9BA 1LF0A 1ESNA 3EQ8A 2JIQA 3WWDA 9LDBA 1XO1A 2FUNB 3HABA 1YMUA 2HWWA 1IBSA 3LECA 4Q3OA 3SEFA 2FRXA 2JF0A 5HG0A 4TTSA 4Z1MD 1PFQA 1RXWA 4ZQBA 3NXKA 1A71A 4UREA 2ZUBA 1A27A 2PKXA 3EXIB 3VNQA 1JIIA 1FUIA 2XTNA 3NDBB 4HRYA 4PCVA 4Z8XA 3QI2A 4TT3D 3LPLA 3WADA 4AUKA 2AG0A 1WBJB 4ZOAA 4OHVA 4DLKA 4EI2A 1D6MA 2FRDA 3CLKA 4L0MA 3LS2A 4MI9A 5LOVA 1BN7A 1M7GA 1PYOA 1R0CA 2YVQA 3D4OA 3OLYA 3PDHA 2JVKA 2P40A 1ZMOA 5M29A 3A6JA 3DULA 4EG6A 1UEXC 1GXSB 4KH0A 2W6CX 4FR5A 3K0FA 4XUCA 1S9HA 3E8SA 3GMTA 4NR0A 3UV7A 5LD2B 3QSGA 4BVJA 3COWA 3HYCA 5BR7A 3R7WB 5LL6P 3NR2A 1YZQA 2Z3WA 3TQRA 2H48A 2O0LA 3EEYA 1UBTS 4C2BA 4M8IA 3UEOA 1ZGGA 2ZQ5A 4I50F 2Q5JA 1R4MB 2V6IA 4C0XA 5GTDA 1F7UA 2BBSA 3A1TA 4NNPA 6YASA 4OK5A 4B35A 2UUPA 3R9IA 3ZC3A 3HA2A 4RVDA 2G4LA 3I5MA 2O8VA 1CUBA 1KFEB 4O25A 5JYDA 2QK4A 1XF9A 3AEQB 2EDCA 1P4AA 3D0RA 2AYZA 4PR3A 3WHKA 1XCLA 3QVLA 1ECFA 1B6TA 2DX7A 2YV3A 3JVDA 3VI4B 4EG5A 2O14A 2ZIXA 1UAAA 3IERA 3ADKA 1DQRA 2FUCA 3D7LA 3N2YA 4MYRA 2GEJA 5B1YA 3C4JA 2RONA 5J5CA 1ID1A 2JFYA 3SR3A 3WGHA 1KI2A 2QZ4A 4WK6A 5KOJB 3PX7A 1RJ9B 4P3KA 3W8EA 3DL0A 4FCWA 1BCSB 3DBRB 2BMDA 2DFLA 3N2IA 2ZJBA 5TPWB 4DJEC 2Z2YA 1LC0A 4PC1A 3W0LB 5IUKC 5B3KA 1H6BA 1SULA 2REQA 2FWAA 4YASA 2AUMA 2REOA 5BUCA 1LPOA 5ECYA 1PI3A 4BEJA 3LXMA 3HE3A 1SUDA 1WL8A 4OREX 2GZMA 3N8KA 4MW4A 1W88A 5FIUA 4ZV9A 1QFSA 1WETA 3CRVA 1RNLA 3TOVA 4B81A 2OV6A 1M10A 2AF4C 3A7DA 3ZDQA 4B73A 4D5EA 2G1UA 1DEKA 1Z2OX 3ICPA 3S1SA 1J1UA 1JHZA 1E1YA 4GKKB 4KP7A 5LB2A 5D1NA 1TKAA 2XNKA 3HS3A 3JQEA 5TJHA 4ESOA 5B2FA 2CLEB 3S4YA 4DCJA 1KMIY 4RUKA 2O5CA 4AWBA 2JKZA 2VDKB 4GX5A 1WUHS 5FNVA 4X64B 2VK1A 3TBFA 3T7DA 5FTWA 1N75A 1OLUA 1X74A 4ED9A 2ZE7A 4H6VA 2G67A 4AQDA 4HX5A 3Q2KA 1KU0A 3PRYA 4WINA 4C22A 4F92B 1CU1A 2BFBB 2NSJA 3KQOA 3J7AC 1YMQA 1ZUHA 1H3EA 5IVHA 1KMHB 2HV9A 2O1EA 3AP1A 2I2BA 1NVUQ 1OX5A 4V0ME 4HVAA 2ACWA 3U09A 4NCXA 3QFSA 4JVSB 4ZVLA 3TGLA 1I1HA 2JH9A 5GMOA 3RSCA 3WI7A 2WWXA 4TM7A 2QDXA 4HZUA 2G0TA 1PF7E 2XVMA 4F1KA 2HA5A 5CYPA 3R9WA 1Z7WA 4NZYA 5LQRA 1BNCA 3TTWA 2G83A 3O8RA 2XBUA 2BZGA 2XJ4A 5A3JA 2JJMA 1IY0A 2PGOA 1AMUA 2GFIA 3MWDA 121PA 4QXRA 1KKMA 2JZNA 2QU7A 1IY2A 4I2NA 4PX5A 4UNQA 3SCZA 3QHQA 1QYIA 1XZIA 4LFCB 1FMFA 1Y7LA 3UV3A 1KI6A 4BJ6A 1W5EA 2YWFA 2R5NA 5CVTA 3INTA 4XCQA 5EHQA 1CBUA 4JS0A 4QGHA 3NMUF 1DBPA 2GLXA 3HMKA 4IXDA 3QVMA 3D8UA 3QA3E 3AF3A 3WIEA 5BSVA 1GGFA 4PSCA 1S8OA 1QZTA 3KKZA 5JI2E 1KMMA 2ZUUA 1K27A 4I6JA 1DAKA 4M0KA 2CMHA 2ZRJA 4D80A 1U8ZA 1V3VA 1ZXLA 2VNHA 4MS3B 1BVYF 2G70A 3DF9A 1P7YA 3H11B 1WB5A 4KNVA 4DR4B 5IAAA 1FNDA 2GLUA 3G2KA 4K2AA 4LYJA 2J07A 3H1TA 4IIXA 1BWPA 3GRUA 1AKYA 5BSMA 4C14A 2NXCA 4NCIA 4G2NA 4MVYA 1Z0ZA 5DM60 3TRJA 4OQXA 3CISA 5KCMA 1H2AS 5K3EA 3F71A 2ZBUA 3U9TA 2WAOA 3RPEA 4PVDA 5BMVB 1OYWA 4JJIA 5JZSA 4Q9DA 1ADYA 4B45A 4JENA 3HYTA 3W04A 4F85A 4WERA 4R1NA 4TV9B 3O03A 3CR3C 1KBQA 2WKPA 3RTAA 4LJ9A 4CM6A 4GR9A 2CV2A 3NAZA 4IFBA 4XCVA 4OQLA 4XQGA 2OV2A 5T8KC 3SJAA 1EK6A 8GPBA 1XFDA 4YR9A 3EH2A 3F1KA 5FAKA 3ZBQA 4TWJA 1O77A 3E15A 1CRPA 4MSUA 1HZZA 3QP9A 2YMMA 5H59A 3MTDA 1W0KD 1YO6A 3EG9B 4HS9A 2J45A 4X3PA 2QORA 1CQIB 2VDWB 3RVBA 2W8BB 1GCGA 1CZOA 1M2NA 2ZBEA 1GUAA 1T5BA 2OO5A 3R8CA 3ZE9A 4B48A 5JWHA 1FFYA 2PVPA 3KFLA 4P6VF 1K4YA 4KR0A 4FOOA 1YZNA 4MUMA 4US1R 4B32A 2I2WA 1Q0UA 3NIFB 1P39A 3OO0A 5EE0A 4KFSA 4UE2A 5JQGA 2B4AA 2KYRA 1RZ3A 3LSYA 4MWSA 1DJPA 3DDHA 4YLEA 1V4VA 1SWWA 1U28A 4DV6B 3PC3A 2ATCA 3LYAA 4U00A 4IDGA 1W85B 1Z29A 2JAOA 5DRTA 2YBDA 4EI8A 1VHQA 3AI7A 4NJOA 1XU7A 4BEBA 1FVXA 1E3WB 5IC5A 1QYDA 3FZQA 3IT1A 4ZQFA 2VPIA 1UXHA 2VZ9A 2QYSA 1BA2A 1YV9A 3R5KA 5E6UA 4AZTA 2H6EA 3FVVA 3PDWA 4ND7A 3SKVA 4H3HB 4NJEA 3JTEA 3UMGA 3B48A 1R8QA 2GZ1A 1D3AA 1UBFA 4IJWA 2WA1A 2F55A 2L17A 2LBPA 3HCBA 3MT7A 3QNMA 2VQEB 4F72A 5JCOC 1QO9A 1S5PA 5EKSA 3ZS8A 4B6OA 1KDYA 2I2CA 4B6PA 3VDMA 3H2IA 3IBFA 3MRSA 5EVCA 1NUSA 3C6KA 2X2EA 4X1YB 4HQOA 1ODLA 1NW3A 4ZEWA 1IVSA 5ENZA 3EMDA 4RQUA 5J2UA 1ZCZA 3H65A 5CDSA 1NY5A 4DEVA 3KWMA 4JY7A 3MILA 2VSFA 3R0QA 1HT0A 3EARA 3JU3A 4F2PA 1OPXA 5FPSA 3O83A 2F3TA 5AOBA 1W581 1QYWA 3QV2A 5A3RA 4NCAA 2ET6A 3D0KA 4F6RA 4YCBA 4Q9NA 3RAGA 2QD4A 2BFWA 3P9NA 1L1EA 3EIWA 4Z86A 4DXAA 4Y2QA 1KYQA 2PX3A 1E7WA 2YHUA 3W8RA 5INTA 1FSPA 3PQ7A 2B9VA 4OQNA 4NRDA 3CURA