5JSFA

Crystal structure of 17beta-hydroxysteroid dehydrogenase 14 s205 variant in complex with nad.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
268
structure length
268
Chain Sequence
GTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRASIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New Insights into Human 17 beta-Hydroxysteroid Dehydrogenase Type 14: First Crystal Structures in Complex with a Steroidal Ligand and with a Potent Nonsteroidal Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 17-beta-hydroxysteroid dehydrogenase 14
total genus 92
structure length 268
sequence length 268
ec nomenclature ec 1.1.1.-:
pdb deposition date 2016-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jsfA00
2QRJA 4QXMA 1HE5A 4B7XA 1F8FA 3BTSA 3QVSA 4F45A 4U6QA 1HE3A 1TI7A 1ZW1A 1I3NA 2I76A 2UYYA 2V6GA 2BRUA 3SC4A 3QIVA 3X2EA 1VJ1A 2GZ2A 3IDSA 3L4BC 1E3JA 1Y8QA 3RUCA 3RUHA 4LVCA 3ZV6A 4QO8A 4E31A 3RQSA 1V9LA 4KQXA 5AOVA 1LDYA 3D5TA 1QRRA 4TSKA 1C1XB 3AU8A 3DHYA 4ZVVA 2B4RO 2JHFA 1LBEA 1ZMOA 4XDZA 4D3DA 2FY8A 3GC6A 3K31A 2GN6A 3CPSA 3VZSA 5JC1A 4YJHB 3I4CA 3ONFA 5ILOA 4W4TA 3IUSA 1SZJG 3HJAA 3JQCA 2X1HA 1H6AA 1UP7A 4QSMA 2EG9A 1IB6A 5CAEA 1O94A 1GQYA 1N5DA 2VQ3A 1NHGA 2O3JA 1LLQA 1WDLA 2Z95A 2O2SA 4BL5A 2UAGA 3GGPA 2IYPA 4GMGA 2X86A 3HDQA 4RVFA 3WB9A 1SOVA 1GTMA 4ZRMA 4CV3A 2XXBA 4DIFA 4Q39A 4OOFA 3VVBA 5EQFA 3UXYA 1N1GA 4IGFA 1HZZA 2C07A 3E48A 4D43A 2WWRA 1O0SA 5AXDA 1ZZEA 1I3KA 3HG7A 2J3HA 3DTYA 9LDTA 1XR3A 3V2GA 5AYVA 1NAHA 1I8TA 4ALLA 4HADA 1E7MA 3DBLA 3QY9A 4IM7A 3WNQA 2O3SA 4J4TA 1X7HA 1E7WA 4BGIA 3HZZA 3VH2A 4CM8A 2JCYA 2VN8A 2IDZA 3DFUA 3TN7A 3H3FA 1LRLA 1UZNA 4IS3A 3DL2A 3AI1A 3IOYA 3WBBA 5HTOA 3PK0A 3GN1A 1LLDA 2CVZA 4OSOA 4FIZA 5T8KA 8ADHA 3IIEA 1JQBA 4MKZA 5F1KA 1VC2A 5I7EA 2VYNA 3G49A 3GOHA 1NHWA 1PGJA 4JLWA 3TWOA 4A73A 3GF4A 1P9LA 1GV1A 2Q99A 1LTHR 2WE7A 3S2EA 4CLOA 3U0BA 5JYEA 4Z0TA 3RBXA 4M49A 4OJNA 4KMSA 3GUCA 4NQZA 5I9NA 1HLDA 2NU7A 1GEGA 3PHGA 1MC5A 3NT4A 3NTQA 4JN6B 4IXWA 1JDJA 1WXDA 2I99A 3OQ6A 2SCUA 3E5MA 4CM4B 2CD9A 3WMWA 5U9CA 1PJ2A 1T26A 1KY5A 4R5MA 1P44A 1I32A 2GNAA 3AY3A 3KM0A 1E6WA 2FPGA 1D7OA 4CMAA 4BKOA 2NVUB 3WS7A 1WLYA 3KB6A 5DT9A 3ETEA 3H65A 2EHDA 1X7DA 1YBAA 3MCVA 2B35A 2VUUA 2E37A 4TVBA 3WFJA 1LSOA 2OMEA 3LZ6A 4UEKA 3CTMA 5F5NA 1NR7A 1HDRA 2PZLA 4EW6A 2TMDA 4NG5A 3PLNA 1QV6A 3GN2A 5A9RA 3B1FA 3ANNA 1XCBA 4CMEA 1ML3A 3B20A 4LSWA 2HCTA 1AUPA 4MIYA 2C59A 3W1VA 1GUZA 3BMOA 5TSDA 4ZU3A 4WK6A 4CMIA 5BR7A 3AI3A 3D64A 3VZPA 3M6IA 2W4QA 5I9LA 1E1KA 2WSBA 4BNXA 1VSUA 2QYTA 4II3A 3LLVA 5MGBA 2GERA 2GSDA 1PZGA 3KTDA 2VYND 3AJRA 3LU1A 3P2YA 3VVCA 3ZZNA 4R9RA 1G1AA 3RI3A 3TPCA 3D1LA 4MINA 4KZPA 1P77A 2AEJA 5KKCA 4CJXA 4EI2A 4Z9XA 2PY6A 3HHPA 3I9NA 4HY3A 5DCWA 4GPD1 2DBVO 4J2OA 2J8ZA 3C8MA 2PZJA 4CM9D 4E5KA 1X13A 3F1LA 4RF3A 3GZNB 3M1AA 1I5RA 1ZKMA 4YDRA 3RSHA 2NUAA 1H5QA 2VNAA 3Q9NA 2Y1GA 4DQXA 4BKRA 4EEXA 5IG2A 4B3HA 1Y9EA 1IYZA 5L9AA 4DLAA 5IXSA 5JLAA 3E9QA 2NNLD 4O59O 1ZMTA 1Q7CA 4XGKA 4X54A 3CKYA 3UCFA 1GYRA 2FPIA 4Z3KA 1PJ3A 1G0OA 1AE1A 4LRSB 4INAA 4UVEA 3FBGA 2GD1O 3E03A 4I9NA 4GKVA 4GWKA 3KO8A 3JQEA 3OIDA 2G0TA 1SB8A 3BTUA 1YXMA 3KUXA 3HDHA 1ULUA 3WTBA 2FR1A 1OAAA 3BXXA 2I3AA 4JP2A 3QVWA 4LISA 5EINA 4YBZA 2A92A 3RFXA 5L40A 5A1TA 2GASA 4Z0HO 1S6YA 3L77A 3RASA 2JD0A 4Y6RA 4DREA 1T4BA 3E8XA 4MPDA 2CVOA 5DN9A 4MVJM 3ICPA 1OBFO 3I6QA 5GZ1A 2TMGA 3MTJA 2PWZA 4LGVA 1FDUA 3HFSA 2XXJA 2DTEA 2D5CA 2NVBA 2G82A 5BSEA 2HU2A 5T67A 2DM6A 3HADA 2UUOA 3EUWA 3S55A 3IP3A 1B3RA 2QZZA 4YB8A 3ZU4A 1W6UA 3GH3A 5CEJA 1YE3A 3GG2A 1Z6ZA 3VTZA 3GNTA 4WJZA 3PYMA 2OORA 4E5MA 3ZWVA 2B69A 3LC2O 4WEOA 1SB9A 1D1SA 1GL3A 3QJ5A 4OAQA 5FFFA 5ENVA 3JQAA 2IXBA 5EL0A 3U4DA 9LDBA 5I7SA 2VHYA 3H8VA 2NADA 1A27A 2W98A 3OJEA 1BRMA 4XRRA 3UKOA 3M2TA 1GFSA 2IE0A 3E82A 3CEAA 4I5FA 1QSGA 3LQFA 2H5LA 3INGA 4TRJA 4OGWA 5G0VA 2BGKA 4OH1A 2IZZA 2QIOA 1DXYA 1Q7GA 2CY0A 1PS8A 1PR3A 3VHRA 5T64A 2WD7A 3U49A 1DPGA 3H3JA 3F3SA 4PG4A 4A7PA 1PS0A 3ETGA 4BNNA 5COBA 1FMCA 3MJEA 1JVBA 3Q3CA 3RUAA 5KVCA 4B4OA 2X0IA 3QWBA 4F3YA 3IJRA 4CV1A 1BMDA 2W2KB 4NFYA 1HDXA 3R1IA 4GGOA 5JY1A 5B4UA 3ZV3A 2BLLA 2O4UX 3PQDA 5H83A 1ENYA 1A72A 3DZJA 3EGOA 4PRKA 4O5OA 2EW2A 2VOJA 2E82A 4YEDA 2I6TA 5TX7A 3DOJA 4W82A 3OP4A 1JKIA 3FNGA 4ALNA 5JC8A 1NXQA 1Z82A 1HTBA 5G0SA 3MOIA 4JX8A 1KEUA 3GHHA 3WSWA 3U3XA 5HS4A 1BTOA 5JNLA 3INRA 2RBEA 1GPDG 1PJTA 2DBQA 4RGBA 1Q1NA 3RCBA 3TZKA 1EUCA 2VRBA 2Q1UA 1WNTA 1O5IA 5JE8A 2D0IA 2Q50A 3PGJA 1FDSA 1T1SA 2ZYGA 2PD6A 1LRKA 4RCVA 4EJ6A 2X5OA 3RU7A 1KS9A 1HE2A 1E3EA 2OFPA 4PZEA 3DBRB 1U5CA 2JHGA 4U7WA 4YAKA 3SC6A 3Q2IA 3VH3A 4MP6A 4QUKA 4OSPA 2NWQA 4Y98A 1FDVA 1ULSA 2VOEA 5L53A 4J91A 4AVYA 4HNHA 2OOSA 3W6UA 5LDGA 4E32A 5A05A 2FOIA 2B36A 2D8AA 4XJSA 1K6IA 1UJMA 4FCCA 3MEQA 4R1NA 4E6PA 4I9UA 2YZ7A 1DLJA 4FSHA 3VDQA 1CWUA 1ENPA 3QVXA 4YAEA 4TROA 3FPCA 5JFOA 4GX5A 4ALJA 4ID9A 2ZCUA 1IHXA 4R9SA 4PRLA 2JL1A 4M1QA 3DOCA 3ZNPA 5TS3A 3QWIA 1PGQA 3GDGA 3S2GA 3COSA 3SBOA 3KRTA 3PDUA 3V1YA 4TWRA 3FNEA 4UVHA 4GKBA 2VWHA 3LT1A 4CM6A 4RF2A 3CZMA 3WIDA 5IZCA 4BNMA 4N5NA 4NZ9A 4B4WA 3DEYX 3D4OA 3I52A 2VYVA 3ROPA 2O2YA 3D3WA 1WZIA 1JN0A 4FGWA 4BNVA 5TT1A 1E7QA 3DBHB 1ZFNA 3WWZA 1E3LA 4DC0A 3UH1A 3BHJA 3HQ4O 1E5LA 3KYDA 2EJVA 3I9OA 4Z9FA 1CDOA 5GZ3A 4XR4A 1Y7TA 4RPKA 3IJPA 4Z9YA 3L4BA 3CSDA 1LDEA 2C7VA 3F9IA 3T4XA 1YKFA 5I7FA 2ZIZA 1U8XX 5EIOA 4PGFA 4PVDA 2D59A 3PHIA 1UZMA 1F12A 1T24A 5KJCA 4Q3AA 4R41A 2UV8A 1U4OA 4LRTB 1BVRA 3Q9UA 3CMMA 5TRTA 4BNWA 3ZNNA 4MVJF 5G0TA 2VCYA 4FOSA 1C3VA 1ZK4A 2DC1A 2GGSA 1MGOA 3EZLA 1CETA 4QO7A 4KWIA 4WUVA 1BXGB 1UUFA 3FCOA 3DONA 2EXXA 5COAA 3V2HA 1HDCA 4XDYA 5G2OA 3KZVA 4YAGA 1DIAA 1AXGA 4CV2A 3PJEA 4FC6A 2F1KA 1YB1A 5ADHA 4CR6A 2ZQYA 2OP1A 2NVUA 3L6EA 3OF2A 4I8XA 4H3VA 4GSKA 3RIHA 3ZHYA 4A03A 3IL2A 3GFBA 2B0JA 2AEMA 1WWKA 5F21A 3LF2A 4UVIA 1H93A 3AM5A 4R5HA 5EJ2A 1EDZA 1MG0A 1R16A 2H9IA 4IJKA 3JQ8B 1E77A 4IQ0A 4WECA 3VKUA 3L4SO 1XU7A 4CLDA 5KOIA 1ORRA 5L95A 1EBUA 1U5AA 1B16A 1VL6A 2B83A 1DFIA 3OQ1A 3OQBA 4KUGA 4NJOA 1GYQA 1NVMB 1DFHA 2YJZA 2PKQP 4L8VA 4CLRB 1HKUA 1GYPA 3GG9A 2ZB4A 2YV3A 1SCUA 1UXJA 2VHZA 4OOEA 2FRDA 5ITWA 3TRIA 1WZEA 3TL2A 3PI7A 1E5QA 4M86A 5DF1A 4UEJA 1J4AA 4M87A 3F4BA 5F5LA 4QECA 1ZNQO 4KOAA 1DJQA 1YB5A 4LMPA 1DC5A 4Y6PA 1MFZA 1NBOA 5DCUA 5HS6A 4BVAA 1MV8A 2D2IA 4XYMA 5LCXA 3RKRA 2WYUA 5JDIA 5JCJD 3F5SA 3TNLA 2PZMA 2BH9A 1YL7A 4J7XA 4UEOA 5TC4A 4AJLA 3PVZA 3PWSA 3VDRA 3VC7A 4CQMB 4J7UA 3VTFA 4JQCA 1DJNA 1R66A 3E6AA 1VI2A 2PGJA 3ZNQA 4XX0A 5CP8A 1B7GO 5JDCC 4BUCA 3WLEA 3ZHZA 3KYDB 4R1TA 1XHLA 4TVOA 4BMVA 4DYVA 3RWBA 3P2OA 3AOGA 5A03A 5L51A 2Q2WA 3IQDB 5L4SA 3PPIA 4DQVA 1CJCA 2YV2A 4RVSA 3JCZA 1UXHA 1IZ0A 4L73A 1YDWA 2FZWA 3OIFA 3RFVA 4RV9A 2D5AA 1PSDA 2IODA 1M2WA 1I10A 4YAJA 5K0ZA 2BHLA 1E3IA 2IEDA 3BMQA 1C0KA 2PLAA 1O8CA 1ZK3A 1I0ZA 2C5EA 1D8AA 1V3VA 4TRMA 4B7CA 3DZFA 4OIMA 3UFXA 1RM3A 4JP3A 2Y68A 3C24A 4M55A 3DZIA 4TZTA 5B4VA 4CQMD 3HSKA 1VLLA 1IHYA 4DC1A 2W8ZA 4CLRA 4QTZA 4KUEA 1ONPA 3MTGA 3T4EA 3NDJA 4PLGA 3BA1A 4J16A 4ESOA 5LC1A 3GAZA 1YBMA 2I67A 2WJPA 1GY8A 2AE2A 4NFSA 4PLZA 3ZU2A 4CPDA 2Y0CA 1GZ4A 3FPLA 1RWBA 3PDJA 1A7AA 2X9NA 3I9JA 3LYLA 4IQ8A 3VPXA 5I7VA 5TQVA 4QFCA 3RROA 2CDAA 3STHA 1E7SA 1A7KA 1ONOA 3UICA 4EDFA 1KETA 2XAAA 1ARZA 3CH6A 4P38A 5KVVA 1F8GA 4RPHA 3V1UA 4BB5A 1QLHA 1EK5A 4GVLA 3ONEA 4R4JA 1EFKA 1DC3A 3JQAB 1XG5A 5EPOA 4BNUA 3FWNA 3LDHA 1K0UA 1U3VA 2RH8A 1M75A 2HK7A 1MUUA 4IIVA 3CZRA 4ZRNA 3RUFA 3U4CA 3ETDA 5EMHA 3GFGA 4XGNA 3KOUA 4GMFA 4N7RA 2D3TA 4OM8A 1U28A 4KTVE 4I08A 3F4LA 4AJEA 5L45A 2ZYAA 3ITDA 3NTOA 8LDHA 3D3EA 4W99A 4BO7A 1NP3A 2PTGA 3IC5A 3WDSA 5BQFA 1DFGA 2YFHA 4NH4A 2IEBA 2EV9A 4TKLA 4AJ2A 5C7IO 2JCXA 2R6JA 4GLOA 3U9LA 1I2ZA 4P4GA 4Z3DA 3IKTA 2GF2A 3AWDA 5JDCA 2RCYA 4MP3A 1LC3A 3IS3A 3CUKA 2XF8A 4F6CA 4DBZA 1Z75A 5CDGA 4RVDA 4ZD6A 1YVEI 2Q1SA 2DTXA 4EUFA 4AICA 5FYDA 4BNZA 1OMOA 1S7CA 3F1KA 1K5HA 5JXWA 1U2GA 3O03A 5L3ZA 1DHTA 4FFLA 2OUIA 3JQ9C 4FR5A 4B3IA 4CV0A 1DRUA 2DUUA 2CDCA 1XDWA 4XB1A 4BS9A 2YHIA 4XA8A 2PFGA 4D41A 2ZJ1A 1AHHA 5C7LO 1DC4A 2EERA 3WR5A 1NQTA 5IAAA 2WTBA 3MWEB 4A26A 5CFZA 2P4HX 2Y0DA 3UGKA 1GD1O 1BW9A 1ISFA 1PZHA 4GQAA 1IULA 3DBRA 4L75A 2HJSA 3P19A 4BNLA 2HK9A 4U5QA 3SEFA 1A9YA 3K2BA 4J1SA 1UDBA 2EKPA 4D3FA 2FP4A 3U5TA 3H5AA 4PLTA 3EVTA 2QG4A 4PG5A 5BSFA 1QYDA 1P33A 4NMHA 5JAIA 2O3QA 4B3JA 3PZRA 4Z6KA 1MB4A 3D0OA 4I5EA 1C1DA 4NK5A 1ZBQA 1FDWA 3RC7A 1B3BA 1O9BA 4BKUA 2YYYA 4YT8A 1EBFA 2E6UX 1LSSA 4IY1A 1LJ8A 1KC3A 3NGXA 3JD0A 2HMVA 1PJCA 3FHLA 4HKTA 3RC1A 2PZKA 4FFOA 4HFNA 4HWKA 4YT2A 1P31A 2I5PO 3EC7A 3JV7A 4CQLA 1B15A 1U3WA 1NFRA 2HO5A 4HV4A 4UUOA 4WLVA 4CMKA 1ISMA 4NBWA 4PN3A 1LDMA 1N8KA 4H7PA 1X7GA 3ZWPA 3W4JA 5KCZA 1GQ2A 3ZHXA 2VHVA 5DP1A 5A5EA 1YQGA 1J0XO 4EBFA 3TSCA 2DFVA 3H5RA 4Y67A 3H6KA 1QMGA 4RJTA 5KJ6A 2Y67A 3OBBA 3O26A 1TT7A 3RUDA 5IN4A 2J3KA 2DT5A 5MDHA 1ISIA 1CQIA 1LI4A 3QVOA 4YAIA 1YS4A 4R01A 2EW8A 4D0SA 3R3SA 3WLFA 1ISGA 1RM4A 4OKIA 1DIBA 1P74A 1BW9B 4OQYA 4BO2A 2BF7A 4CMCA 5JDIC 2YQ5A 2ZB7A 2EJWA 2FPPA 1XSEA 1YGYA 4ZA2A 4E5PA 1GUYA 3GDFA 3D7LA 4QX6A 5BT9A 1A5ZA 2P5YA 4WLOA 4EITA 2FR8A 2QZ9A 1I30A 1KERA 1YBVA 3AI2A 3VPHA 3TDKA 2X58A 3M1LA 3QHAA 3L6OO 3JQGB 4E0BA 4NHEA 1J6UA 4RPJA 1OFGA 2HMWA 4YJGB 1C0IA 1E1MA 1SNYA 2B4TO 4P4NA 1UAYA 1VRWA 4FFNA 4DGSA 1JTVA 4CODB 1IE3A 3L07A 3ZHBA 1QYXA 1AGNA 1ZIDA 3AUAA 1NPYA 3GT0A 4O6VA 4IMRA 1PZEA 5COQA 5JW6A 3RD5A 3OFSA 3DC2A 3JTMA 3O9ZA 1EQ2A 5U4QA 3S2IA 3GGGA 4J1TA 3I3OA 4LCEA 1XQ1A 3JYOA 1M6HA 3I5MA 1PTJA 1DDOA 4F46A 1NVGA 3RUIA 5ENDA 3UW3A 5DOZA 5ES3A 4YRBA 3JYNA 3G1UA 1P45A 1M66A 4W9NC 5JY6A 1PJ4A 1IY8A 3BHIA 4B79A 3EAGA 3QW2A 1YDEA 4AJJA 4XKJA 4NBRA 3PWKA 1LA2A 3L9XA 4UREA 3G0OA 1XGKA 3H9JA 4XJTA 4DMLA 4ALKA 1KEVA 3UVEA 4B8ZA 2WMDA 5GMOA 4ALIA 5JS6A 4DLLA 1JKJA 5T8KC 1UP4A 4RORA 1Q2XA 2GN9A 4YRDA 1DAPA 2GRAA 2YHIB 3PHHA 5DBIA 3TZ6A 3AY7A 3VH1A 3RAJA 3HE3A 3VAZA 1R0SA 1Q0QA 4J2HA 5BSGA 3A1NA 1KVSA 1DC6A 2OZPA 3ADPA 5FWNA 3V2UA 5G4KA 3OEWA 4K6FA 1YONA 4F6LA 2B5WA 1UXKA 4U6SA 4XYLA 1L1FA 4G2NA 4DVJA 1XWFA 4L74A 3QP9A 1I24A 3BHMA 4C7JA 1U2DA 1MA0A 3E9MA 4OL9A 5B1YA 2G76A 2J3IA 5A9SA 4MIEA 5KVQA 4IDCA 3DXFA 5HBRA 4CR7A 2Q46A 4E5YA 1M6WA 2V7PA 1ZK1A 1IPFA 1N92A 3KLMX 1L7EA 1PEDA 2AEFA 3OA0A 4I9HA 4EJMA 3AUUA 1SC6A 4BOYA 2I65A 3W6ZA 4LW8A 2Z5LA 2P9GA 5EQDA 4MKXA 1YOVB 3GY0A 3TFOA 1NR1A 1U7HA 3NRCA 3QWHA 4WKGA 4CUKA 4K6CA 4O0LA 1MP0A 1J49A 4FOOA 4EZBA 5JMWA 1AHIA 4AJHA 3KEQA 1MG5A 4GLLA 1F06A 5G0UA 4BNHA 4XIYA 1K89A 4L9RA 3F46A 1MXFA 1ZUD1 1BVUA 3KSUA 2AG8A 3Q2KA 1KEWA 5IZCC 3ZU5A 3A28A 4PG6A 1F17A 2QW8A 4B7UA 2UUPA 4YA6A 3ASVA 4NI5A 3JD4A 1AXEA 2CZCA 3D5QA 4K28A 4GI2A 4PZCA 4ZICA 3V5NA 1MX3A 1YOVA 1W4ZA 4KTTE 4S3MA 1NFQA 3KYCA 3FNFA 4CL8A 1VJTA 3UF0A 3PZBA 2BFMA 3DR3A 1VSVA 4Z0PA 3ZGYA 2BKAA 2FMUA 2AHRA 2Y1FA 4RPLA 4WASA 4DPLA 4J90A 3WOHA 1JKFA 1BWSA 4Q3NA 4OKNA 2PD4A 2Y1OA 3B1JA 1HT0A 3ABIA 3I9MA 2VHWA 2CF6A 1ISJA 1XKQA 1CIVA 1PJBA 3H9UA 1H6CA 3ROKA 3OJOA 5G4KB 4GL4A 4DIOA 5HRUA 3ZWAA 4JGBA 5IDQA 1SEPA 3GEMA 4IDBA 3JYPA 2Y93A 2X4GA 1JLLA 2X8LA 1EVJA 1KOLA 3W4IA 1GDHA 3FN4A 5IN5A 4JXKA 5AXCA 3JQFC 3Q1LA 4NU6A 3AY6A 1LC0A 3BMOB 1KVUA 3QVTA 4MVJH 3I83A 2BI7A 3WWYA 1BSVA 1HRDA 1H2HA 2Y66A 4XZ3A 2BFAA 4NJMB 4RZIA 4YQYA 3ZN2A 4WLEA 1F14A 4JJIA 4IDEA 4BO9A 4I1IA 1LEHA 3R0IA 3ZI0A 2VUSA 2AW5A 4G5HA 3IKVA 2G5CA 3PIDA 1HETA 4J6FA 4AJNA 3ZDFA 3C85A 1ZJZA 3MJ4A 5BNFA 4FPXA 3JQBA 4XQ9A 5TF4A 2C2XA 4BMSA 3NX4A 4A27A 3V8BA 3GHYA 3K96A 3OETA 3SX2A 3FNHA 2V6BA 4JCOA 5ILGA 5I8ZA 2EKLA 1YO6A 3TZQA 5DCYA 2D4AA 4ND2A 2P5UA 2G17A 2WD8A 4BO3A 5J23A 3ENNA 4EJ0A 1R4MA 3PFFA 4Y6SA 4W6ZA 4YWJA 4CM8B 1N2SA 4GWGA 2Q2QA 3WQRA 3RU9A 3C1TA 3LSYA 3A14A 4FJ0A 2Q49A 5IDYA 1SMKA 4CM3A 2YW9A 2HMTA 2C54A 1E0DA 2J5KA 5GZ6A 5U1PA 1IOLA 2Z1MA 5KNLA 3DMYA 1YRLA 2GN8A 4WCFC 1ZK0A 3RUEA 1TA4A 1WMAA 2GDZA 2VNSA 2NACA 3LC7O 3ZWYA 4BO1A 2DVMA 4G81A 2IZ1A 4UVDA 3SXPA 4YXFA 1Z74A 4CMGA 3HB5X 4XR9A 3WNVA 2FSSA 5F3RA 2Y05A 4HFRA 3TQHA 1DIRA 1I3LA 3HN7A 4CM9A 1BDBA 1NWHA 4E2YA 2RH4A 4MVJP 4CM4A 2RIRA 2EWMA 1DIGA 2ZK7A 1Z7EA 6LDHA 3GGOA 1NX6A 4D7AA 3B70A 3I9KA 4BV9A 1NYTA 4CL3A 1NM5A 3ULKA 4K26A 5IJZA 4NIMA 3WG9A 4IMPA 1DLIA 2FSVA 3PJDA 2PH5A 2Q4EA 1B8VA 1C1DB 3EY4A 2NV6A 3AFNA 3WGQA 5BNTA 4FS3A 4IIUA 3DBHA 4DPMA 2E4AA 1SBYA 3EK2A 1A4UA 3U09A 4BQPA 2JFFA 1LSUA 2ZCVA 3FD8A 4J0EA 2ZQZA 5ITVA 2H6EA 5I8WA 2O3RA 1E6UA 5L7TA 1EZ4A 4BNTA 5TLSA 1MXHA 1HL3A 1X15A 1R6DA 2P4QA 2GYYA 1EQUA 3N58A 3PJGA 2DLDA 2R00A 1NFFA 1DRVA 4BO5A 3RVDA 3DAGA 3QLJA 4ND5A 3VKVA 3AM4A 3MJSA 3T7EA 3K6JA 2QRKA 2ZTVA 3PWZA 3BTVA 2QRLA 3TFQA 1R15A 3Q11A 5CHEA 3GEDA 3NTRA 3JQDA 4IZHA 1DEHA 2DQ4A 1P0CA 4Y9DA 5K6AA 1IUKA 1CYDA 3FTPA 4GSLA 4TRRA 4R68A 1CQJA 5KJ1A 2BELA 2AQHA 4HUJA 2HMSA 5TIIA 2VYVD 3H2SA 3OJ0A 1FJHA 5TJHA 5IFLA 3HDJA 3PFWO 1SEVA 5GY7A 4M8SA 4RF5A 1WDMA 1ZK2A 1HXHA 4J4HA 4TQGA 3NT2A 2CDBA 5A04A 1ZCJA 5B12A 3S8MA 4BO0A 2GO1A 4Y8VA 2Y99A 3WQQA 3WYBA 1UAGA 3QA9A 3W8DA 3PIIA 3NDIA 3PJFA 3PQFA 3JQ7B 4J43A 4LN1A 1OOEA 4CLXA 1HF3A 2OBYA 3A06A 4PFJA 4IDAA 1PIWA 4RLSA 1Y5MA 3ZWOA 4BGUA 1A9ZA 4IDDA 4XQEA 4CLHA 4CM1A 1T2FA 1HZJA 2ZKLA 3GRPA 3ZU3A 4E2ZA 3WTCA 4D3SA 1U3TA 4Q9NA 3DZHA 1JA9A 2C7GA 3DDNA 4DTIA 5C5IA 1QR6A 3EYWA 2EF1A 4GH5A 1QKIA 1Y81A 1UXIA 2EKQA 1HYHA 2FZEA 1PS9A 3TL3A 3VZRA 3NKLA 1GEEA 1KEPA 2DFDA 2QHXA 1V8BA 4U8GA 3L0DA 1NQOA 3C7DB 4WEQA 3ZW9A 1MC4A 1LLUA 4IJVA 5KWEA 4YQZA 1GCUA 3JSAA 5A3VA 1YL6A 2UDPA 3C7CB 1UR5A 1VKNA 1T4DA 3LF1A 3WJ7A 4IINA 3NDRA 2PV7A 4E12A 3CE6A 3LT2A 1RYDA 3KVOA 5JCJA 1JAYA 1X14A 3E18A 4XQCA 1U9JA 1E92A 3QV1A 1V3TA 1HSOA 1XA0A 5FI3A 3ZNOA 1BGVA 1XLTA 3O38A 5CEFA 1RPNA 2IZ0A 3H9EO 3PQEA 3LT0A 4CMIB 4E33A 1U4SA 1TXGA 3BMCB 1GADO 3K5PA 2C20A 3KLPX 4AFNA 3EHEA 1HE4A 1Z7BA 3GUYA 1VKOA 1T2CA 5AQ1A 2IYOA 2GR9A 2F00A 4IBOA 4WGGA 5L7YA 2WDZA 4EUHA 1LLCA 1BXZA 3SJ7A 3PYLA 3CMCO 1UXGA 1LDBA 2AXQA 1C0LA 2POQX 4BIIA 3QSGA 1N7HA 5KJFA 3BMQB 5L4NA 3D4PA 2Q45A 1BG6A 4MIOA 1I33A 5HA5A 1OC2A 4RDIA 1EFLA 2DUWA 4QQRA 1HSZA 4NPCA 1I01A 4CR8A 2H63A 4KUHA 4J9UE 4J49A 1ZJYA 1M67A 2AQIA 3D3WB 3KXDA 4J7CA 4YACA 3KBOA 2W2LA 1DHRA 3JQ7A 4KDEA 3FI9A 2NQ8A 2ZJ0A 4YJFB 5JMPA 2Y1CA 2CF5A 1PJSA 4LMRA 3CINA 4MVJA 5LDHA 1B2LA 3GDOA 2OGUA 2NLOA 1LDGA 2X0RA 3WBFA 4A0SA 4JNKA 2YHUA 4P8RA 4WOJA 1NQAO 2VTDA 4XWYA 4BV8A 4CMBA 4CMHA 3PYXA 4BO4A 1BDMA 2HQ1A 1ZSYA 4ZQBA 2VTEA 2HSDA 1N9GA 3NJ8A 3OA2A 3WYEA 2QYSA 3L6DA 5AXBA 3HNPA 1F0YA 4W7IA 4FJ2A 2XPCA 2RAFA 4FFMA 3DFZA 4PG8A 5ICMA 3BMCA 2PR2A 5CDYA 2YDYA 3GK3A 1PL8A 4FFRA 4PLYA 3WXBA 3WX0A 2HMUA 3EW7A 3T7CA 2JD1A 3DWFA 1WMBA 1WVGA 4OMUA 1X0VA 3DMTC 5FF9A 4Q3CA 1NWCA 3B6ZA 3DB2A 3E1KA 1TVEA 1D3AA 1DSSG 4A10A 3JQFA 1XU9A 1PQUA 3V1TC 1CF2O 1TEHA 3GRKA 1ZEJA 3AOEA 3SLKA 2FWMX 3ORFA 3TJRA 5FEUA 5JAMA 1PJQA 2VZ9A 2GZ3A 1P1RA 1LQTA 1OI7A 5JAZA 1D1TA 4YJFA 4XRGA 2NTVA 2Y0EA 4M54A 4RPGA 2EGGA 2VUTA 2X0JA 4L76A 4BNKA 4R54A 5JCXA 4BNJA 1TT5B 4FGSA 3RKUA 1LDNA 1V0JA 5FI5A 1QP8A 2C5AA 1NNUA 1T2EA 3E9NA 3KYCB 5F1OA 3C1OA 1YQDA 2GN4A 1GZ3A 4XCVA 3ZWCA 5CDTA 1DOHA 2O4CA 4N54A 4IPTA 5JPIA 1JVSA 3OICA 4N5LA 4PLFA 3WGOA 5C3MA 4KWHA 4RVGA 3ENKA 3WGTA 5BSHA 5IF3A 4FB5A 3ANLA 2HRBA 1O95A 4FFPA 4E2WA 5DBGA 5TNXA 2P9EA 2Q3EA 4OXYA 4WE3A 3QWAA 3G1TA 3H4VA 3GZ4A 4ZQFA 1FF9A 4J1QA 3BIOA 4BO6A 1IL0A 3DZBA 4TMFA 1HDZA 4NU5A 4W7HA 1B26A 4YTEA 5DBFA 4EUEA 1WPQA 1EE9A 3TZCA 2X6TA 3JQAD 1W8DA 2X23A 4NDNE 3BAZA 1Y9AA 3GNQA 5H81A 1E3WA 2W2LD 4MP8A 4WCFA 2BI8A 5G4LA 4BNGA 4EYEA 2JAPA 2NU8A 1J5PA 5AVOA 1LUAA 3OH8A 2GUGA 3UAGA 2DKNA 1CEQA 2GLXA 1O6ZA 1K2WA 3JD2A 1Z73A 1T1RA 4NJMA 4RLHA 5JYDA 3DOOA 5IDXA 2PNFA 1LSJA 1NTOA 1Y8QB 2OP0A 2C2YA 3ANMA 3DMTA 3UOGA 3MWDB 1YJQA 2G1UA 2LDBA 1NPTO 2X9GA 5A02A 2H1SA 2Y1DA 4E21A 2FN7A 1G0NA 4MVJG 2LDXA 2Q4BA 1VM6A 4GX1A 4CLOB 3KV3O 3MJCA 3GVHA 1JU9A 2P91A 3FR7A 4IJWA 5DNAA 4RO0A 2J3JA 3AM3A 4DUPA 5A06A 2ILTA 2I66A 1UZLA 4U0KA 1I2CA 5C7OO 2DTDA 3JQ6A 1HDYA 2PA3A 3GVPA 4UULA 3GNSA 3C3XA 3DHEA 4HBGA 2ZTUA 4O63O 1QYCA 2VT3A 4WCFB 4H16A 5B4TA 5KKAA 3ITKA 4FN4A 4PLCA 2IXAA 5CPFA 4FW8A 3GVXA 2ET6A 4PLVA 4BKQA 1BXKA 3MJTA 3KYBA 3EVNA 2YQ4A 1E7YA 1LNQA 4IXTA 4BHTA 3SVTA 1A4IA 4XD2A 5C37A 3PGXA 1BHSA 3DBVO 4MJLA 3ROMA 1RKXA 4RF4A 5T6BA 4A5OA 1P1JA 4CUZA 3LLSA 4W9NA 3HB4X 2ZB3A 1EUDA 2QQ5A 1HDGO 1QYVA 4GGPA 1PJLA 2I3GA 4D45A 5DOVA 3WSVA 4C4OA 2EP5A 4ND1A 4AJOA 2D1YA 2E48A 2HKIA 1W0CA 4N18A 5A4DA 1X1EA 5CDUA 1WP4A 4MKRA 3ZWXA 5A5FA 3AOEC 3WFIA 1V3UA 3DAFA 3PHLA 4J3FA 4RQUA 4PLHA 1PWZA 4L4XA 3ST7A 4XGIA 2YDXA 4DL9A 3VPSA 3QQPA 3P5SA 1C1XA 3ASUA 4J1NA 2YY7A 2XOXA 1KBZA 1SPXA 3LT4A 3WQSB 4BO8A 3WIEA 1YJ8A 2JCVA 3G79A 4R51A 4YCAA 1ADFA 4OYRA 4GBJA 4UUNA 4WLUA 4CQMA 4LCJA 1ADGA 1KVQA 2BFPA 2WYWA 1E1NA 1EDOA 3RBVA 3KSDO 4D0RA 3BTOA 3MZ0A 3H5NA 3PXXA 4WCDA 2YUTA 1H9AA 1IPEA 4JBGA 3UCXA 5IXYA 1N1EA 3F47A 3NAQA 1RJWA 4BQRA 3R6DA 4K1LA 3ZV5A 2NVWA 1R0LA 4PG7A 4AG3A 1A71A 1K6JA 3B1KA 1Y6JA 1X1TA 2GPTA 3A4VA 3DAPA 4CLEA 3CXRA 1GU7A 2J6IA 4KP7A 1FXSA 3DTTA 4ALMA 1ZXBA 1I2BA 1EVZA 3JD1A 3I4FA 2C82A 4A2CA 4CMJA 1T25A 4RVHA 3DZGA 3IAHA 1U1IA 3UHAA 3VZQA 3PRJA 1U3UA 3JYLA 4MVJI 1XIVA 2NM0A 1E3WB 3ADOA 4BNIA 1AN9A 4BGVA 1V6AA 4NK4A 2C0CA 2O50A 4FC7A 1PL6A 1EVYA 3ROQA 3AK4A 4LVUA 3GZNA 1Y8RB 3QE3A 2I9PA 1RM0A 1OC4A 4NBTA 4YYZA 1NASA 5DULA 1Z45A 1YQXA 3HWRA 1QORA 4ND4A 4RZHA 1YH3A 2PKQO 1ZSNA 4MO2A 3AW9A 1DO8A 1WW8A 2UVDA 2P2SA 3AFMA 4QT0A 4JK3A 2OL4A 2X22A 3D4NA 4MVJD 4CUJA 5K6AC 1EEHA 1GZ6A 1EVIA 1LX6A 1ZSVA 1Q7BA 5KIAA 2WE8A 1VJ0A 3AU9A 1E7RA 2BGMA 2OHXA 3TOXA 2PGDA 1C14A 3IP1A 4YRAA 2X7HA 3K73O 2ZB8A 3RJ9A 5JO0A 4ZHSA 1JAXA 2O7QA 3ON5A 3OMLA 1TT5A 3H2ZA 1O89A 1EE2A 4YT4A 2CSUA 1HLPA 3L9WA 2AA3A 2VT2A 3P7MA 1B8UA 1I3MA 4D44A 1GPJA 1JWBB 1EUZA 2R00C 4RVUA 3W8FA 2BD0A 3NGLA 4TRNA 4D46A 5CDSA 1H2BA 1CRWG 2QX7A 1U7TA 2NU6A 2X5JO 3NYWA 2V65A 2Q1TA 4Q3DA 3AUTA 3F6YA 1IZ9A 4IS2A 5ER9A 4C7KA 5TT0A 3HFGA 1GR0A 1YB4A 3GEGA 3NUGA 4GVXA 4O1MA 7ADHA 3Q0EA 2VWPA 1HWYA 4RL6A 3RC2A 2ZYDA 3ZCXA 1UDCA 4NBUA 2W2KA 1T2DA 4HFMA 5JO9A 5A9TA 3W4KA 5K9ZA 2A94A 3Q6IA 1QV7A 3PHJA 7MDHA 2HK8A 1I36A 1KIFA 3H9GA 4WNIA 1E3SA 2GCGA 3FSRA 3RJ5A 1PWXA 4PLWA 1P1HA 3PP8A 3WGIA 3GA0A 2RHRA 4XEHA 1YL5A 4DA9A 4ZN6A 2PD3A 3C7AA 4IQGA 4BMNA 4E30A 3EZYA 4AJ4A 4YPOA 2EP7A 1D4FA 4OXNA 5HM8A 3LVFO 5F1PA 1JW9B 1FK8A 2FHSA 1U8FO 2IRWA 4NNJA 3WGGA 4D79A 4GX0A 4I5GA 1QYWA 1XELA 4L4SA 4BNYA 4CMEC 4ILKA 1H9BA 3N74A 3TZHA 4WOKA 4B8WA 1ZH8A 3QRWA 1R4MB 3OECA 2VZ8A 2X0NA 1LRJA 3KHUA 2NQTA 5G0WA 4CM5A 3U4IA 3OSUA 3OIGA 3FBTA 3INTA 1OZAA 3MJVA 4ROSA 3WGYA 1P3DA 3MOGA 4IJUA 4PCVA 3NT5A 2O3TA 2JFHA 3IUPA 1PQWA 2GZ1A 4OHUA 4OQZA 2R2GA 4N5MA 2ZATA 2ZTMA 4PIVA 1PR9A 2WM3A 2Y1EA 4R3WA 4UVGA 4S1VA 2OXIA 5DP2A 3WGZA 3RFTA 4E5NA 2DPHA 3ZW8A 4II2A 4XB2A 4ZQHA 1UH5A 2EIHA 4H15A 4B4VA 1SAYA 1LXCA 3GR6A 3GQVA 2OO5A 4XYEA 1Q0HA 1PGPA 3WICA 3FWZA 4EEZA 1DBVO 2BFOA 2WEKA 3DZKA 4PVCA 3I6IA 1GV0A 4ZQEA 3M2PA 4XYGA 4L0QA 3JQGA 4ZQGA 3ZWNA 3CIFA 2DBZA 2AQ8A 2VWGA 4YT5A 4R1UA 2W90A 2NSDA 3K9QO 3JYQA 4HNGA 2WYVA 3G17A 1PQPA 4GAEA 4RDHA 2YFQA 3KETA 1ZXLA 1TLTA 4BGEA 5A9SB 2A9FA 1NQ5A 4XIJA 5H82A 2VRCD 1H6DA 4MVJE 4TZKA 3FRJA 3PTZA 2Q2VA 1GQQA 2EGHA 4JROA 2PKRA 3EDMA 3JQ9A 2Q1WA 1PZFA 3G3EA 2P68A 4NFHA 4DRYA 1G6KA 2X5KO 4IDGA 4FQ8A 4XQGA 2JFGA 1KVRA 1HEUA 1PGOA 1UDAA 2HLPA 1C0PA 1FDTA 5B37A 1ADBA 4KDFA 3X2FA 4JJFA 4FDAA 2FR0A 5DDIP 4J4BA 3AUSA 3I23A 5AXAA 4IDFA 4P22A 3NEPX 1R4NA 3R3JA 5KVSA 3PEFA 1PX0A 3FTNA 2B4QA 3O8QB 4QFDA 4PLPA 4E4YA 4BKPA 2PGLA 3H7AA 1B0AA 1EMDA 1R37A 1E6EA 1T2AA 3DHNA 1NPDA 3GMDA 5I9MA 5TGDA 2WD7B 3K92A 1CERA 4WLNA 3U62A 3VH4A 5BNIA 5IDWA 4URFA 1R12A 4LSMA 2PK3A 4K9DA 5JSFA 4UUMA 2JKVA 1ADCA 4AJPA 4U0JA 3HUDA 1ISHA 1DRWA 2AE1A 4I5DA 5KTKA 3BMNB 4JJGA 2CMDA 3VOSA 3K8ZA 2NTJA 5CG1A 1ENOA 3TF5A 1QLJA 4AJKA 3DO5A 1H6BA 1ONNA 2B37A 1SO8A 4WPGA 2RHCA 5L7WA 1Q0LA 4YJDA 3GVIA 4TKMA 2EEZA 3A9WA 4UUPA 4NR0A 3GVCA 1Y1PA 1DB3A 5IZ4A 4R1SA 4D42A 3S2FA 3OJFA 1W73A 4HXYA 1K3TA 3S1LA 3JQBC 3WGHA 1L7DA 4JBIA 3FR8A 5A3JA 1QXSA 1R0KA 4DMMA 3ZWMA 4IUYA 1GUFA 4AJ1A 4QEDA 1HYEA 1M76A 4HP8A 5EERA 3GLQA 3UUWA 4R3NA 4BB6A 1KY4A 4ITUA 4YVFA 3TOZA 1P1KA 2HAEA 4CQLB 4AJIA 3HN2A 2Z1NA 2CVQA 5L4LA 4L4RA 3GAFA 4DPKA 3BZUA 1HYGA 1DIHA 4G65A 1WAMA 4CM7A 2CUKA 4RQTA 1KVTA 1VL0A 1XQ6A 3OEYA 4HFJA 1Y5RA 3LK7A 1LU9A 4HX5A 1VE9A 1VPDA 3KSZO 2VZ0A 5CG2A 2DPGA 2B5VA 2AG5A 2VRCA 5EN4A 2C29D 4FJ1A 4E13A 1ENZA 5JBIA 3I9LA 3E5RA 4M89A 4E2XA 4ZGWA 3U4HA 4XYBA 2E49A 3WYCA 1XYGA 1BXGA 3IMFA 3JD3A 4J9VA 4DBVO 1ZVMA 4DLBA 3ZWWA 4LK3A 2JAHA 3BYZA 5DZSA 2OBNA 1ID1A 3KEOA 4KQWA 1B14A 1PU2A 2DU8A 1NVTA 4E3ZA 1RYEA 1N9GB 2O23A 2HUNA 4WNCA 4OO3A 4JIGA 1KYQA 3W8EA 4PZDA 1DAOA 4UAGA 4YJGA 1MLDA 1R4NB 1RM5A 3FF4A 3UN1A 4P4LA 1HDOA 3SJUA 5T5QA 3ICCA 2J5RA 3JQ8A 1P1IA 1E1LA 4EGFA 5EESA 5CEEA 5JAQA 4DXHA 2A4KA 4IZIA 5THKA 1XEAA 1GAEO 3GPIA 1MFPA 1TB4A 3I1JA 3LC1O 3VPGA 2VHXA 4JBHA 4R69A 3F5QA 4ZJUA 2O3UA 4R16A 1P0FA 2P9CA 3O4RA 2BGLA 2DAPA 1ZEMA 2HRZA 3O8QA 6ADHA 3H9QA 2NU9A 2YV1A 3OJLA 3ZV4A 3GPDG 1SOWA 4YR9A 2AQKA 3NJ4A 2BMAA 2CFCA 2HJRA 5HWSA 4J0FA 3HDYA 5ICSA 1Y8RA 4DWVA 1GCOA 1WDKA 3EMKA 3K30A 4ONEA 3VPFA 3WJAA 5ER6A 3UCEA 2X9VA 4OXKA 3QWFA 4Q3BA 2O7SA 3BMNA 1EK6A 3OHSX 1QG6A 5KJEA 1UP6A 1KC1A 1NAIA 3N7UA 4FD3A 2V6MA 1ZO8A 3K2EA 3PLRA 1PGNA 4DIBA 1H94A 4NBVA 4YJHA 3DBLB 5T57A 3DQPA 3WMXA 2A35A 4MDHA 4DQUA 2DBRA 3RC9A 2ZTLA 2O48X 5TJ9A 2JJYA 1K6XA 1LQUA 1P1FA 3RBZA 4AL4A 1B8PA 1H0KA 5THQA 3GMSA 2V6FA 2CNBA 4BNFA 4IGEA 2NTNA 4ND3A 1PL7A 2AMFA 3OM9A 4GX2A 4Q3EA 1N7GA 1VL8A 4B4UA 3NV9A 3C1AA 2PH3A 3SLGA 2J5QA 1X0XA 3ZH2A 4FBGA 1YWGO 5CPBA 2VWQA 4DYDA 4MOWA 2JD2A 1V35A 2HDHA 3ZWBA 1JWAB 3ONDA 4WLFA
chains in the Genus database with same CATH superfamily
3DG9A 3F0TA 3TNYA 4Z5XA 1FTWA 1U7PA 1HE5A 1E1QD 4DUYB 4F45A 1HE3A 2V6GA 2UYYA 2WAYA 4Y2JA 2HPAA 4QU0A 3EZGA 4XUCA 2BRUA 5CT8A 5EOVA 3QIVA 1VJ1A 3RUCA 1NY6A 1RXCA 3L4BC 4LVCA 3QE2A 4E31A 5AOVA 2YV5A 5GJWC 1Z6TA 2IYTA 3LD9A 4MWTA 1DV1A 4TSKA 1C1XB 1PTJC 1T2UA 3AU8A 1VSBA 1D2HA 3D6HA 3WGJA 3K94A 4XDZA 2BEWB 2ZWIA 4MGYR 2GETA 3SC2B 2X77A 5IM4A 2FYTA 2E4WA 3ZE0B 4IHJF 4NYIQ 1TKCA 3BCRA 3GC6A 4FMBB 2D1QA 3CPSA 5H9VA 4J2TA 4YJHB 3VZSA 1L7OA 3ONFA 3ZHCA 3LA8A 4IIBA 5ILOA 4W4TA 3WC4A 1SZJG 3K5HA 1JUDA 1LK0A 1BDJA 2RFLA 2UVPA 3F6RA 3JQCA 3LM8A 1JHOA 1Z5PA 2NTYC 1P1BA 1V5FA 4EATA 3PPVA 1QU3A 2EG9A 2DPMA 3SE7A 1O94A 1X1BA 1N5DA 3K5WA 1N2ZA 4A6DA 2C00A 4AMGA 1WDLA 3WJ1A 3SGLA 3ZXYA 4A3SA 2O2SA 4D4JA 5IARA 2UAGA 3WAGA 1T91A 3FYCA 4GMGA 3Q8MA 3PC8C 4IV8A 3FW1A 3AVQA 4N8DA 4Q39A 3LCCA 2IXTA 4OOFA 3C1UA 4NE9A 4HDOB 3ZXUB 1Z4LA 2C07A 4OM7A 3CLUD 2B2XA 1JG1A 1II0A 1S2MA 3BGVA 2J3HA 3EEQA 3ESRA 4EMBA 2R7AA 3DTYA 4ARSA 3U4AA 1M2JA 5LIPA 1T15A 3V2GA 1BMTA 1NJ5A 3CVVA 3WGUA 1AT1A 5FAKA 1E7MA 2P6NA 2O3SA 2B1GA 1V2HE 2BGWA 3OX1A 5BPHA 2D1FA 1E7WA 4EF6A 4G1VA 3E22B 4IHQA 4BGIA 4CM8A 3V4SA 4B76A 4EBBA 2LUOA 1LRLA 3V1KA 2FW0A 2WYOA 3DL2A 3AI1A 4HDKB 2G1JA 4IS3A 4C89A 4EEKA 2JFVA 1SD2A 1QFYA 3GBPA 3EIWA 1CZOA 3L7YA 3HR4A 1Z4OA 4KO2S 3TGWA 8ADHA 2F6RA 5F1KA 4CZ2A 1VC2A 2XMPA 1F3OA 3LUHA 3R0JA 2RGDA 4CXMA 5KNDD 1NHWA 1XZKA 1TF5A 3PXUA 4HB2A 4KLRA 4MK4A 5SYNA 2F67A 3N05A 1X1DA 4FD2A 1RHRA 5CVEA 3UQYS 1SVKA 1GV1A 5DLQC 3TKYA 3NWOA 5AVWA 4Q66C 4IJ5A 2XNDD 3S2EA 5JYEA 3OPMA 4M49A 5FKJA 4D8UA 2FOXA 1VXRA 3LVQE 1GEGA 4CI9A 3PHGA 1Q22A 3KPVA 5B64A 1JBEA 1F2TA 1JDJA 1WXDA 1KBQA 2I99A 3MF4A 4IXWA 5LL6P 2AVDA 2PMDA 5HF8A 3E5MA 3AVUA 2CD9A 4LRWA 3WMWA 4EJSB 1I13A 1PJ2A 1WDTA 1KNQA 5J59A 5C31A 4HTFA 1OLXA 3LLCA 1KY5A 4O2AA 3HJFA 4AYWA 1AA6A 3KM0A 1E9FA 1E6WA 1KH2A 4CGZA 2I29A 3EEBA 3HEAA 1QTQA 5TVGA 1PFGA 4QQ8A 5BXQC 5C9ZA 2NVUB 5ICCA 2ATXA 4I66A 1QC5A 2MMGA 3FYUC 1WLYA 4RGVA 3V80A 3ZY4A 1JG6A 1YOBA 3ETEA 3H65A 4Y2TA 4MITA 3MCVA 4D0NA 1DX4A 1EAMA 1EH5A 1STOA 5IW8A 1KL7A 5E0OA 2C8JA 2XD4A 4UEKA 5DFAA 3T9FA 3ZY3A 3WLPA 2WWTA 1BU5A 2DP4E 2ZIGA 1KPHA 1QHGA 2ZS9A 4H7JA 3VQTA 3W5JA 4Q3OA 3PLNA 2H1HA 1EJ0A 1XCBA 3ANNA 4C6TA 4LSWA 3UT5B 1N9ZA 5LUBA 5LXTF 4TTSA 4TV8B 3TDNA 2YWEA 1WEKA 2JFZA 2ZAOA 3CE9A 4OHZA 1EA7A 4Z1OA 3MPUA 3WRXA 4HQ6A 4A1OA 3VZPA 1YV9A 4UHCA 5H3CA 3ZYZA 4JVLA 1OU0A 1ZGAA 2WSBA 1OX5A 2C9DA 1OAKA 2GCPA 3FJYA 2Q4TA 1VSUA 4M38A 4Q7KA 1J5EB 2V6JA 5EE9A 3N2NA 1RQPA 2QYTA 2B4YA 2EP8A 5KSWB 1P5RA 3OPYI 4L3WA 2FK8A 3HA2A 1R00A 4GPBA 5SYMA 2C4TA 2FVYA 1T8UA 2GSDA 1UWCA 3EIHA 2X1LA 5JOQA 5JD4A 1EJBA 4PPYA 4KXXA 4DJTA 5ES4B 1FFSA 1E63A 2VYND 3I3SR 4LI0A 1UPTA 3AJRA 3IGFA 1GU0A 3NTXA 3P2YA 2QSYA 5DYTA 3WMRA 3R6TA 4R9RA 1SR8A 1G1AA 3LP8A 4AVYA 2REQB 1IBKB 2XI4A 2XSZD 2I2WA 3AEQB 3LWZA 1P77A 1PV2A 3PC8A 4YBRA 2JH3A 4EHDA 4PQFA 1GZSA 3I6ZA 1F9EA 3KU4A 2HA5A 1D2MA 3IOMA 4HY3A 1B43A 4OUKX 4Z9XA 4UOEA 3LK6A 5DCWA 3RC8A 2OKCA 1AGYA 2VQDA 3BB1A 3MM4A 4J2OA 1ESCA 2H4JA 3I2HA 3C8MA 2YOHA 2H2HA 4MV0A 3AP3A 3P8ZA 5D2CA 4E5KA 1X13A 2YWCA 2J0SA 3SBXA 2GBGA 1OVGA 3FF1A 2C2GA 4ZOLF 5AQEA 5K5EA 4ZZ2A 1G2IA 2NUAA 1JAHA 1H5QA 2VP9A 2Y1GA 3KV1A 4F91B 4EEXA 1DUVG 3A1CA 5FOQA 5K7SA 2H4YA 1TTTA 4FU0A 5GM2A 2B20A 4EB3A 5JLAA 5BQ3A 3E9QA 1C4KA 4BEVA 2KQUA 4HAZA 2UZ4A 4WERA 5BWMA 4X54A 3HCFA 1G7RA 1GYRA 1SXJB 2JLCA 2V7WA 4Z3KA 1A4RA 3K32A 1AE1A 4UVEA 3MGBA 4BE4A 2CHEA 3E03A 1JIIA 2G25A 4AZ0A 1VLHA 2ZYUX 3P5BA 4I9NA 4TLAA 4WQMA 4WZBB 2B7CA 4KAAA 3WLNA 1SU4A 1XK7A 3DVRX 2PZBA 4KMOA 3M8KA 4X20B 1WUIS 2LWIA 2R5FA 1YXMA 2P90A 4HYTA 5LMNB 1RJGA 1HT1E 2XUIA 3HDHA 3USES 3VR5A 1XN4A 3WTBA 3BXXA 5AM2A 2WIDA 1MJNA 4Z99A 3R7WA 4MV6A 5EINA 5BW6B 3GEIA 2A92A 3MWDA 2R2AA 4FOLA 3U17A 4YQFA 1P2DA 3SYMA 4DQKA 3OFVA 1S6YA 3FZYA 3RVLA 4G1UC 4Y6RA 3WP1B 3TD2A 2CVOA 5DNVA 5I5EA 2IUUA 3NIWA 4RKFA 2P2YA 4LGVA 2ZJYA 3FMPB 2WUFA 2Y77A 4FR2A 4ZAYA 3W7AA 5AW8A 3HFSA 2I71A 1L5KA 3U3JA 3EBOA 3UJ6A 1FJGB 2G82A 2O57A 1SQ5A 1U65A 3CLHA 2HU2A 3KYIB 1CRQA 5T67A 2DM6A 4QUHA 2C1XA 3EUWA 4CKEA 1W1IA 5A4IS 2ZRDA 1FNSA 1QCDA 5DGDA 2CBGA 2JRCA 1EYZA 3VR4D 3WVNA 1PX2A 2Q9AA 4JVMA 1XZDA 4NCNA 2ONZA 3IUBA 1W6UA 1RAGA 4YB8A 4BRUA 1X8JA 4ARZA 3GG2A 1VDZA 3VTZA 3MAAC 1QOZA 4AMVA 3STTA 1J0EA 2GFQA 4E5MA 3MMSA 1Q3TA 2QIPA 3LC2O 4F2WA 1D5CA 3CBGA 4JUCA 5FFFA 1PFVA 2W6JD 1C2TA 3RTDA 5ENVA 4P86A 4EO9A 1AU9A 1T4MA 5JI2E 4XOUA 1I6MA 3EAQA 5JPDA 3H8VA 2HXGA 3OJEA 4UOQA 4F9EA 3TCNA 3UKOA 1L4NA 3GJYA 3E5NA 5DI3A 5EVJA 4TTRA 1E2UA 3RYTC 3PKJA 3OZAA 2H5LA 3PHCA 5M29A 3K0FA 4OGWA 2ZUSA 4ICIA 3IIMA 2V3CC 2IZZA 4DUZB 1DBIA 4IDOA 1JGTA 1EE1A 2X2FA 1RQRA 1PR3A 1IMOA 3HZHA 5T64A 2C8VA 1YHZA 2WD7A 4UCWA 3MTQA 4UM9D 3RS0A 1GRVA 2AK3A 5DEOA 1N3IA 5HQJA 3ETGA 3O3MB 2HQSA 2PZFA 1E1QA 1JR3A 3MJEA 3M5DA 2QTNA 2HB6A 5COBA 3M9LA 3Q3CA 1XF1A 1PR6A 2QVYX 4KIFA 3RUAA 5HQ3A 3VPBA 4NFYA 2R6HA 4Z4HA 4OK3A 4FTWA 4Q1DA 1N5JA 3VOBA 3ZVRA 2WZQA 5JY1A 2O4UX 4WCVA 5LLTA 5H83A 3TTXA 2IHZA 1ENYA 5L3QB 4B4KA 3EGOA 5CM8B 1XK6A 4JLDA 4YEDA 1YR6A 1Y98A 4GBGA 2DHQA 2ORVA 4L3VA 4ALNA 5KS2A 5JC8A 2C2HA 1NXQA 3L49A 4GG1A 1JDUA 1BN7A 5JSKA 4DAOA 4WNAB 2AJCA 5C1IA 2RHTA 1K4KA 3MRTA 4K40A 3I34X 2IW3A 1NSYA 5FOSA 1KEUA 1X7ZB 1NSFA 1U11A 1GNRA 4ROTA 3OF3A 3AHEA 3FPSA 3EPPA 5B53A 3U3XA 5JNLA 1NLYA 3A1EA 1GPDG 2RBEA 2AN9A 3INRA 2PPVA 2A0YA 1Z13A 4RGBA 1Q1NA 3RCBA 3TZKA 1EUCA 5A2GA 4LF9B 3KTAA 3GJZA 4GBED 3W2FA 4JV5B 3ZD6A 3S5UA 3P96A 3SYKA 2XOKD 4QJ3A 2BE9A 3HMKA 2WF8A 3IT2A 3GJ7A 1IMJA 3PGJA 3KQTA 4EYSA 1KS9A 3HRIA 5A7FA 2OFPA 4PZEA 1CS4C 2Q8NA 4GR4A 1VP9A 2GLTA 2JIZD 2JHGA 3ORQA 4HDSB 1NG1A 1ZR2A 1QZUA 1II8B 3FRHA 2CK3A 4U7HA 4DQ0A 4PWYA 4N4AA 1Z4QA 4PS1A 4LOAA 4A0FA 4XQ0A 1TJ5A 2Q4OA 3R09A 3B6KA 2XGGA 2AMYA 2QQEA 3MTBA 4JBYA 2RE8A 2OOSA 3E23A 1DO2A 2X8JA 3NVAA 3W6UA 4DXDA 2FOIA 3UW1A 4MXDA 4XJSA 3GPLA 2V0GA 1UJMA 4FFBB 2PQ0A 5DNDA 4L85A 4BQNA 2P79A 4R1NA 2IZ5A 4FLEA 4ZCLA 4HGYA 1Z8NA 2ZIFA 1YCFA 2YYZA 4DG9A 2VCHA 1DLJA 3C8ZA 1QTNA 4FSHA 5TARA 1AKYA 3UZUA 3QEBZ 4RK1A 2QVZX 2XQGA 4UEWA 2JBWA 4AKSA 1I1OA 1SVIA 1Y3FE 3N70A 1T8YA 2XV1A 4TROA 3FPCA 1PR0A 2PQ2A 3H18A 2JJQA 4FEYA 4IH4A 4X6UA 4ALJA 5F7XA 4FT2A 2ZCUA 4R9SA 3PQ5A 5EJ4A 3FTEA 3NUZA 1N2GA 3CYFA 2HA0A 1HFKA 2JL1A 4RACA 3RWOA 3ZNPA 3RFUA 4KQKA 1KJQA 4ZDKA 2W5UA 3PNMA 1YRQA 1JG3A 3R7AA 4MV5A 3KZ1E 1GPKA 3KT8A 3OP1A 5FTKA 3KRTA 3I6BA 3PUJA 5FBWB 5ESRA 1F20A 4EY5A 1OH5A 3C6ZA 4TWRA 2ZWAA 3C2QA 4GKBA 5HZHA 1RBQA 4HAXA 1KEZA 1U7WA 1XRSB 1K8YB 3CZMA 3HU1A 4GU5A 3RK0A 3BQNB 3P2IA 1LF5A 2P4SA 4B4WA 2OZVA 2Z6VA 4M21A 1WZIA 1DEKA 4Y6OA 5HUJA 5KC9A 1ZFNA 2H4ZA 4OUDA 4WVFA 1JXMA 3D6JA 3ZHUA 4PXSA 2EJVA 3VO8A 2BDTA 1CDOA 1XVIA 2PAFA 4XR4A 5LPNA 1RWOA 3NJRA 5ARDA 5JHGB 4QTTB 2C61A 3AZQA 4II7A 3CSDA 3JXEA 4QXQA 3F9IA 1H23A 1YKFA 3AZPA 3T4XA 5EIOA 5A3SA 3I2IA 4DC9A 4PGFA 3S1AA 2GKOA 4LBYA 4ER7A 1P5ZB 2G9ZA 5JJLA 2W2NA 2QN9A 5D1HA 1TKRA 2JA2A 1GAJA 4LRTB 4KIUA 3HRHA 2VP0A 1ILWA 4IHAA 4H3SA 4P3YA 3AR6A 2ZROA 4QUBA 2VCYA 3LBHA 1C3VA 1ZK4A 2ORYA 2GGSA 4AP9A 5LQRA 3EZLA 1IOVA 2OCYC 3HFRA 2ZAYA 1QS0A 5IWCA 3CUWA 4Y6QA 3GP8A 2WTXA 4E09A 4JI8B 2EXXA 4YO7A 1ODTC 5JISA 1F1JA 1CQWA 2BT4A 1N9KA 1XVAA 5FCDA 5G2OA 1MEOA 2YNMA 1WXFA 1RI4A 3ND6A 1L3CA 3GLHA 1WQ4A 3LL7A 3Q5DA 4YAGA 3MMZA 3THYB 3IEVA 1YB1A 4XXHA 4CR6A 1NZJA 3GFPA 3UA3A 5EWJA 1IY9A 2BEUA 3G6KA 1TKBA 5FOVA 4I8XA 1MVLA 2EVWX 1T3GA 4QRIA 1IM5A 1LY1A 4DM7A 4MMZB 1EX6A 1TKAA 4I4TA 4XPZA 3D6UA 4A03A 1JDZA 4AIIA 3LF2A 1H2RS 1Q20A 4QICA 1H93A 3AM5A 4J0DA 2L69A 4MNTA 4RGQA 4UVIA 3CLUC 4WZBA 3WNBA 1M3SA 2AX4A 4NXNB 1R16A 2ZR8A 4GZLA 4M7OA 1J0AA 1ZIXA 2AJDA 4PBRA 4ZEXA 1E77A 4WECA 3CVWA 3F3YA 3H05A 4MV4A 1XU7A 3ZHOA 4PYIA 5L95A 1SUIA 4MR8B 5HF5A 2GEBA 5B55A 1B16A 1RLOA 1HYQA 3LA6A 4G9GA 1GAWA 4K8RB 2PA0A 3OQ1A 3CVYA 1JFSA 1GYQA 1NVMB 2JKZA 4CKCB 2PKQP 1YQUA 2KB0A 3GG9A 3FAKA 4GPEA 1JH8A 4G0UA 4YH1A 5DHUA 4OLAA 4OOEA 2D3WA 5ITWA 3EAFA 1LPBB 3TL2A 2IF2A 3AR7A 1QOPB 4M86A 4ESEA 4M87A 2COUA 1AF4A 3C98A 1K7XB 2D2EA 1K9VF 3IR5A 3F4BA 1E0KA 2W93A 1PT7A 3KLBA 2ZJAA 1U7XA 3Q7RA 4IV5A 4QECA 5EHZA 1QX4A 1P72A 3NDBB 1WXEA 4PF1A 2WU3A 1NBOA 3KHTA 5HS6A 3BFVA 4O4JF 2KE5A 1WR8A 5LCXA 4Q9LA 3HVJA 2CXRA 5HKLA 3SHFA 2HU7A 1EVLA 3O47A 4BBZA 3NTUA 4KU4A 1HDEA 3VPDA 5JDIA 3AG6A 5EJGA 2YN0A 5IM4F 1U1CA 1XBTA 2JJ2D 3OPXA 4LZLA 3KJIA 2AXNA 1U2GC 3TUJC 5BUSA 4B85A 4YCDA 4F92B 5J2TB 1O0CA 1AV6A 4Q6BA 4ESVA 3PWSA 3I4LA 1AKUA 3UH0A 2WR8A 3UB3A 3O90A 4DKXA 3QM1A 3E6AA 3EXHC 1L2TA 4XX0A 1B7GO 4PWZA 2HWXA 4K3VA 5CX1A 3QVLA 2BR3A 3EZ6A 2V97A 3KYDB 3S4YA 4R1TA 3TXAA 3ILSA 4DYVA 4LFBB 2XLBA 3SXUB 4AO8A 4O2RA 4UTVA 1LLFA 4H7KA 2WAOA 1Q44A 1SUAA 3R7LA 5L51A 4B2YA 4K2AA 4NBNA 4TMVA 3CGGA 5CA1B 4RVSA 3JCZA 3RTCA 1IZ0A 4BFVA 4LYYA 2ID8A 5CNMA 4DCUA 1I6KA 3RFVA 3ZLUA 2I4IA 1Y37A 4NICA 4ACAA 3L1HA 2FWIA 3E27A 3P9YA 1VIYA 4KVGA 4YAJA 1UBKS 3DJYA 1VHQA 4UATA 2BHLA 3OUTA 2Z9DA 2ZRPA 3M89A 1YMVA 2PLAA 4R6WA 3KXKA 5HIJA 5CCXA 2QD2A 2COEA 3B1XA 3EQ2A 2C5EA 1V3VA 4FYJA 1QH1B 4ENPA 1SQGA 4R1OA 5LZ5A 5KOHB 1IRXA 1Z62A 4B7CA 4KK3A 4MCHA 4CIVA 2DCUA 1CDZA 3DZFA 4U9UA 1GUDA 1RM3A 2GD0A 4MCAA 4GMKA 1S0UA 1S8OA 1FLAA 4RD6A 2J4FA 4WZAA 1A97A 2B1IA 2QD3A 3DCIA 2Y92A 3ILXA 3RLFA 3HSKA 1A8UA 4DC1A 4B80A 5A4JA 3EDYA 5TPWA 2W8ZA 2GBLC 3DMRA 4ENTA 4MWDA 1JVNA 4PN7A 2J30A 1PEYA 4QTZA 2M2IA 4Z0NA 3OZBA 3FCXA 3BA1A 5H1YA 5E7MA 2VPYA 2IEZA 3KC2A 1KQGA 2ECQA 3FPLA 4C14A 3MG9A 4NAHA 1I51A 3PDJA 5I9TA 1A69A 2J3DA 4HEA1 3I9JA 4Y1RB 3SZOA 4ARAA 8AT1A 4QFCA 4ZVNA 1TUBB 3MVEA 4HYQA 1VBFA 5E4TA 2H5IA 2RHJA 1QR2A 1GN9A 1SXJE 1S1MA 5LNK6 3OCVA 3UJPA 1KETA 2R1VA 3M6XA 1ARZA 3PPXA 5DTIA 5B7GA 2WIAA 3OQIA 1L9XA 3OOWA 4JR2A 2BM1A 3RAGA 2DQSA 4ZO4A 1YTUA 4FBLA 2CLDX 5JARA 5IVIA 1Z38A 3IV7A 3K70C 3SSOA 3C0KA 3R7NA 1TAQA 1XG5A 2VPTA 1DI0A 1GTG1 3IPLA 1N57A 1B73A 3THYA 4LG1A 1K0UA 2CEAA 1WVIA 3FFXA 2RH8A 4X0EA 2HK7A 1MUUA 4HXGA 3RRFA 3RUFA 1H1LA 1A76A 1M2OB 2GEFA 3B7PA 4I4CA 2WQZA 4KQEA 1CNEA 1KMMA 3GFGA 1A9XB 4EGCB 2Q6VA 1E5XA 3M1IA 4GMFA 4BMYA 9ABPA 4QOFA 1U28A 1X3LA 5EIFA 3U39A 4L5IA 3A58B 4R7TA 2QVLA 8LDHA 4KO4S 3BDAA 4QG7A 3RYHA 4UFPA 2HJWA 2FPPB 3ME5A 3WDSA 4PHCA 4AUNA 4YMLA 4G3XA 2E5FA 2H16A 1DFGA 2CFOA 1YA6A 1M1UA 1HL7A 2EZ4A 1YR9A 3KKQA 5C7IO 3P9RA 3ZDDA 3G6WA 2BTQA 3IODA 1L4EA 2YQZA 1B6GA 3JR7A 1BGWA 4M9XA 1ZGHA 5JDCA 1VE1A 2WSSD 1XDBA 4CKCA 2PIAA 1MB9A 2G0AA 1Z75A 4OHCA 1E9EA 2E0IA 1YVEI 4F93B 4MMYB 1KJNA 4YV1A 3V8EA 4R9NA 3I0ZA 3NRBA 2IEIA 4KJZA 3L0PA 3W90A 1U2GA 2JLAA 4OUDB 1M34A 4CCSA 2AGVA 2ID7A 2GM5A 2GT1A 2OUIA 2QTCA 3BIWA 4DLYA 3OLVA 1C9YA 3ICOA 4FNAA 3MWKA 4CV0A 1DRUA 2WILA 4JOCA 1MABB 5EZSA 1RYMA 1XDWA 2O2XA 1XX6A 5KQRA 2PFGA 2Y6UA 3O8OB 5EE1A 4IIFA 1O5TA 3I5UA 2F17A 1GXSA 3PX7A 1MBZA 2Y0DA 5EWLB 2GYVA 1TVKA 1RE1A 2WIJA 4X1OA 3ZQKA 4P3OA 1CUDA 5CLHA 4K9KA 4NCIA 4J16C 5ESDA 3GRZA 1R9MA 3DBRA 2GAOA 1NW6A 4M6WA 3JATB 2QUHA 4RVOA 4QBHA 3RVJA 3G8AA 1Z63A 2QEQA 1Y82A 4J1SA 4N8SA 2ZBFA 4RHFA 5BYAA 5EJ6A 4ZCMA 3B5EA 4OGKA 4ARVA 1V9CA 1E9AA 1Y4DE 3H5AA 4QL3A 1C29B 1DRJA 5JWOA 2QG4A 2Q6TA 4PG5A 1R4AA 2BC9A 1BKSB 2P2NA 4Q4JA 1P33A 1BH2A 2G5TA 2XDQB 2ZJOA 3L8CA 3NM4A 3HLYA 5JNTA 1JA0A 5JMTA 3C5EA 3IE1A 1L6RA 1WQ3A 3PTLA 1NN3A 4GE0A 4MGIR 3PZRA 3RT7A 4C4SA 2YNMD 2XE7A 5FJJA 3DAYA 3VDXA 1C1DA 1KPIA 3OU2A 4Z6KA 1O9BA 2FEOA 4MR9B 1D7AA 1H2AS 1PKEA 2FWAA 2H51A 2KBFA 5BSTA 4QUJA 4RETA 3MC1A 4DAEA 3Q41A 3SFTA 1LJ8A 1KC3A 4LTNA 3JD0A 4C7MA 2HMVA 3DCNA 4QOEA 4H9GA 3VNQA 1MHTA 4OQFA 1ECJA 4YT2A 3UM9A 1MABA 4MX8A 1M33A 2QTMA 1NFRA 1SHZA 1E4OA 2B1QA 4LE1A 4HV4A 1QP0A 2ID9A 2O0HA 1N8KA 2E4YA 5EG5A 1X7GA 5D01A 5P21A 4Z54A 5KCZA 4G0QA 4UBMA 3K70B 3G0BA 1JXQA 2Y4OA 5DP1A 1JSRA 3UMBA 1YQGA 3CLKA 3OTQA 4YCMA 2Q8QA 3AEXA 2OY0A 1E0SA 1TECE 2C99A 1GPUA 2CGEA 4BP3A 4Y67A 3SHQA 2ZANA 4M9UA 4PZAA 4Z4QA 1FOEB 1C7FA 3ZJ4A 5KJ6A 3AHCA 1Z7WA 3FCUB 1TT7A 3OMWA 3RUDA 4BWFB 2HT1A 2BGTA 2DT5A 1SCKA 2ZRMA 3IDZA 5EIWA 1CQIA 3NDPA 3QVOA 4EPRA 1YS4A 2EW8A 1KFJB 1AY0A 1M2KA 4HCJA 1RM4A 1L4GA 3GJSA 2ZUTA 4FX5A 5H9WA 1SHTX 2BF7A 1CUUA 2Q3FA 4REQB 2P5SA 5L6MB 4WESB 3GROA 3QPUA 4OJYA 1YB2A 3C5WP 3MJDA 4EK9A 1GUYA 3CUUA 1TADA 2R1VB 3GDFA 3RVRA 3GI1A 3TLGB 1FSZA 1H4SA 1GGEA 2Z58A 2AV6A 4EITA 2VAXA 4KV9A 3VHXA 2YOFA 2QZ9A 2V5AA 1N8TA 1KERA 3AI2A 3ECAA 5H5JA 1GITA 5ARBA 1ZUNB 3ADCA 2JI8A 3FUXA 3RADC 3M1LA 1JR2A 4FYHA 4R8RA 4E0BA 4IGKA 3RSLA 4NHEA 1J6UA 4I4TB 1A7UA 2OGZA 2IHJA 2A9PA 4DGSA 1UAYA 3M82A 4FFNA 4GRDA 1GAXA 2FN9A 5ALPA 3L07A 4XPIB 4WSOA 2H1VA 4LOJA 1U90A 1Q1AA 1GT91 1NATA 1NPYA 3I2JA 4B73A 1QIGA 4WBXC 2R79A 3RD5A 2GCNA 1ODFA 2DGDA 2YJGA 3DC2A 1RKVA 1YQWA 5BR1A 4RDXA 1TF7A 4LY9A 2IP1A 3THXA 4DMRA 4CKXA 2ZE8A 5FBKA 1MT3A 1Z9BA 3I3OA 4XEUA 1VKJA 4Q1AA 4EB0A 2WFZA 3FZNA 4UBKA 1M6HA 2HJVA 4IVNA 3KZKA 3EQ7A 4F46A 1S2DA 2YXDA 4IOMA 2IYEA 2QG6A 1E9RA 1BIFA 3DKVA 3UXEA 2HR1A 4HH4A 4NABA 4YRBA 2Q5IA 3G1UA 5JY6A 1PJ4A 1IY8A 1HO3A 1OYYA 2I33A 4EABA 2XCRB 5AI4A 1U9IC 4XKJA 4NBRA 4F7WA 3RARA 2J6CA 1OXUA 3NBAA 3L9XA 3PBKA 2J3EA 5T4EA 4IKEA 5AVJA 4IG9A 4BDSA 4DMLA 5HKKD 1DEAA 3BE6A 1D6SA 4WZAB 2WMDA 1QU2A 2G8LA 4EA9A 5JS6A 3JWJA 4QDXA 4DLLA 1A4XA 3HFJA 3E2MA 1U7ZA 4YRDA 4KBGA 2GRAA 2CYCA 4JGIA 4NFLA 4KYTA 3AJ8A 3BB4A 1GNQA 2XMRA 3VH1A 4YUAA 4XPIA 3OIWA 4WNYA 2JAUA 1IK6A 1XP8A 3R5HA 1VA5A 4Q5IA 3BCHA 1MX1A 4IR7A 2GK6A 3ADPA 5KNCA 1IHOA 5ADVA 1W46A 4H17A 3HZOA 2WJHA 2CMGA 2I4OA 3OEWA 2UKDA 4K6FA 4QSHA 2EBFX 3EB9A 3A6DA 3WV5A 2OFOA 5F2NA 1XWFA 4LC0A 3QP9A 1G2QA 3BHMA 2ZYWX 4C7JA 2RC6A 3S70A 1AOXA 3VO1A 3ZVMA 3E9MA 3OM1A 1XKTA 3NANA 4BFTA 3PIRA 4FHCA 1NN1A 1KY3A 4IDCA 4PSDA 2Q46A 4QKQA 3H5LA 1OLOA 1M2FA 2V7PA 5AUOB 3LGSA 4C0BA 2IXGA 2I9KA 2RCNA 1IPFA 2ZT8A 2VH1A 1G5IA 1PEDA 3VR4H 3ZIAA 4A9AA 3OA0A 3VM6A 5EPUA 3DNMA 3F6SA 3W1EA 3AUUA 1SC6A 3N7AA 2I65A 5SY6A 5IYZB 1UCFA 4ZK6A 4LW8A 5IUJC 1P2VA 4ASUD 1L5ZA 2V03A 1YOVB 1YAJA 1NR1A 1HKHA 4H7EA 4OK6A 1AMOA 4RW0A 2DBYA 4WKGA 4P6VF 3SC2A 4W5RA 1AHIA 3ADDA 1PT9A 4FYVA 4QODA 3M6UA 4YHHB 2VP2A 4G01B 4MICA 4FHZA 1SRQA 1BE6A 1OA0A 1EFPB 1JV2B 2ZSKA 2YZ2A 4YX9A 2TECE 1WD7A 3CUTA 2QW8A 3L0ZA 1BGXT 4EENA 1VMDA 2VQFB 3WIUA 4NI5A 3GZTB 4EA8A 3D5QA 3QH4A 4X85A 1X8LA 3OPYB 1D0IA 3UK7A 1PP4A 4ZICA 1MX3A 1T4CB 1NF3A 2NUPA 1AZWA 1UIMA 4KPUA 3IP5A 6YASA 4S3MA 1F6BA 1PN3A 4U2GA 1P3Y1 3RYFA 3VR2A 1W1WA 4RZ3A 5D3MB 4GQIA 4U7PB 1B4DA 2P11A 2VJYA 2BZ0A 3OLWA 4NEGA 1XFAA 2CZQA 4Z0PA 3TLGA 1Z6PA 2YXEA 4GI3A 2BKAA 5A62A 2YJ6A 3DA8A 2FMUA 3IVAA 4TL6A 3AKYA 1KFKB 3B6EA 5JNSA 3DJFA 4Q48A 5BN4A 1XZAA 1YBHA 4XLLA 3V32A 2Q3HA 4LYFA 4NMLA 3E58A 3BB3A 3A3PA 4J90A 1UJ6A 1JKFA 3KR2A 4HH3C 4QYTA 4PCUA 4DCVA 3WHKA 1U9IA 2O0JA 3NHKA 2CXTA 3WKAA 2Q3JA 3X43A 1DINA 2OAQ1 1BWPA 1KTVA 4H3KB 4WV3A 9MHTA 3H9UA 2PMEA 3VKWA 3VYSB 3OJOA 3TI7A 3NMUF 3RUPA 3AFOA 5JWHA 3KDSE 4F5YA 1SEPA 3NKFA 3BWXA 4NSNA 3QG1A 1UJ4A 1JECA 2BHTA 1QGUB 3KB1A 5FPYA 4QRHA 1T0BA 4YJ3F 3SJAA 1GDHA 4R2HA 1H9CA 3C5VA 2Q8PA 4R1MA 4Q15A 2ZWOA 5ALLA 3IAXA 5F51A 1XZHA 3TPZA 2VJMA 1KU6A 3AY6A 5K45A 4MVJH 1W0JA 1KYWA 3ZZMA 1BSVA 1AK1A 4QG3A 1ODJA 3GCZA 3I5YA 1H2HA 2Y66A 3ABOB 4NJMB 2O8DA 4YQYA 2R7LA 4GXTA 4B2PA 1F14A 2AF3C 3M7IA 3DVQX 3OCCA 2HTFA 2XGMA 1LEHA 2RBKA 2RHOA 4G5HA 2FPMA 4EGQA 3VR3D 1HETA 3WB1A 3C85A 5IKPA 4BMSA 3MBKA 2C2XA 1M54A 1XALA 3NX4A 3KKPA 1K8QA 3QXHA 3HDTA 3FY4A 2X15A 4O1IA 1ZLYA 1T5LA 3OETA 2BFEA 3FNHA 3SX2A 5K0FA 3ZZ1A 3E7WA 3BL5A 2EKLA 3TZQA 4JR0A 5JH7A 2OGSA 5J23A 1Q92A 1DTEA 3GLUA 1NUHA 5HDBB 5K0NA 1HGXA 3O4HA 3HS3A 4CM8B 4F56A 2TMKA 2E5LB 5A71A 3DLIA 4KAJA 2E2WA 3NLLA 4LSZA 4RH1A 1JTEA 2H7YA 1Z35A 5TMEA 2X0EA 2GAAA 1DKQA 2FZLA 3LBNA 2R25B 5IDYA 3GGCA 3UFBA 3X1YA 3NIBA 3QPBA 1Z2OX 2XA2A 4QGFA 2HMTA 1WX1A 1W52X 1N8NA 3UMSA 4X7MA 3W5IA 3N59A 5IU6A 4V1CB 4R81A 1JYFA 5GGXA 4EG8A 1YRLA 2GN8A 4WCFC 3ZTTA 5JVDA 2OC4A 1TA4A 2OAP1 3GJ8A 3P9CA 4EDHA 1IHDA 2FW1A 3SXPA 2IZ1A 4QEKA 5T3YA 3KPYA 5KTPA 4XR9A 5AKGA 3WNVA 5BW4A 3A11A 2EDAA 2AMJA 2BKXA 4KSBA 3TQHA 1DIRA 4YV0A 2WZDA 4K9PA 5EMLA 4CU5A 1A5BB 4YRCA 5EFOA 2C2WA 3LUGA 2WP0A 1QIFA 5ECYA 4DBLC 5IANA 3AEUB 1MO6A 1XCMA 1DNPA 3UUGA 2B82A 1PFKA 3H4MA 2HJ9A 3EC1A 3AHIA 3K9NA 1ZMXA 2GZHA 3DTVD 4LNHA 3EJWA 2G63A 4Y6GB 1NX6A 5FB3A 3VV3A 4K6MA 2O1EA 3OQHA 3I5XA 1N6HA 3EPKA 4H77A 4JXZA 4QTXA 3QOWA 3NVMB 3F3KA 1DC7A 3TZBA 1DAHA 2O0LA 1KMIY 2E21A 3A70A 3E9YA 3FKQA 2AD1A 1SUPA 1U8AA 2PT7A 4OMDA 5CURA 4BC1A 4M9QA 1FL9A 2GZDA 3AXTA 2AT1A 3HHEA 1Z0KA 4P83A 5ALKA 3G8CA 5EUCA 3WGQA 1YU6A 4IIUA 3DBHA 2X0DA 3HM2A 1SUFA 1RKBA 4LGCA 2QL9A 2VDNB 3HB0A 2E4AA 4GGMX 1DKRA 2OHHA 1A4UA 1J22A 3EK2A 5FTNA 1KZHA 3G02A 4PXAA 4QU8A 4BFLA 4DT1A 1W5EA 4HAYA 4QASA 1G5RA 1WTCA 1E2DA 2ZQZA 4FIDA 3QF4A 3F96A 1K75A 4FKMA 4X1IA 1UANA 5I8WA 1E6UA 2AC2A 3MTDA 4FNOA 1JDSA 5CAEB 1ZISA 1HL3A 3AQ4A 1OTXA 4DS3A 3KKMA 1EQUA 4E2FA 5HX7A 2DLDA 721PA 3OJWA 1H1DA 2OZKA 1PD0A 5ERXA 1Y80A 3OMXA 1WBBA 4JI7B 4BO5A 3RVDA 3DAGA 3QLJA 1FP4A 3UT0A 2SHKA 4Q19A 3H5IA 5JCOC 3MWFA 4HNUA 3CRRA 3M4ZA 3T7EA 3K6JA 2ZTVA 3IALA 3LPMA 3PWZA 5JJCA 3OQPA 4OB7A 3H2YA 2HEGA 2WHPA 4JUAA 3ZQUA 4CDGA 5F7OA 3DH0A 3Q11A 1O97C 4BX8A 2X9QA 3HI4A 3K72B 1PV4A 3NTRA 3MSCA 4Y9DA 1VHTA 1CSEE 3D9QX 2IV2X 3A2MA 3IKJA 3FTPA 2QGNA 4R68A 1GPLA 1FDOA 2IVZA 1BRTA 1L4LA 3LPLA 3P0FA 1CQJA 4QVGA 2BM8A 2J7PD 5KJ1A 1CLUA 2QAGA 5KYGA 2FR8C 3W5UA 5TIIA 2VYVD 2P35A 2ZP1A 3I09A 4JQSA 5TJHA 3R23A 4MGHA 3I8OA 1TLFA 5JWRA 2LXNA 2RHGB 4R83A 1SEVA 1XMIA 1NU6A 1ZCZA 2X5NA 1ZK2A 2G3YA 2WJWA 1H3NA 2R4UA 4J4HA 4S1OA 3GFTA 2GA8A 1O1YA 1J2EA 4KX5A 2OTCA 4QDOA 2O5RA 4B71A 3BD7A 4UHFA 2GO1A 1WY5A 4Y8VA 4F06A 3WYBA 1XJCA 3QA9A 1A8IA 1PD1A 5K0TA 1PR5A 4AMUA 2G1PA 1CY1A 1XLWA 4F72A 1LVHA 3AR4A 2VK8A 2FDXA 4TLDA 5CH8A 1URPA 4K87A 5FUXA 2HV8A 2WM8A 5HNKA 2OBYA 1WF3A 3A06A 2VKQA 3AIMA 4PFJA 4ACBA 1DC8A 1PIWA 3OZTA 4CIBA 4JGGA 1N5MA 3EMBA 2PIDA 4G6ZA 4ID3A 5CNIA 5M3BA 3ZIUA 4C87A 4DSAA 4GNKA 2Z09A 3EVAA 4FMDF 3GRPA 3PUIA 4XFKA 5A6SB 1QO7A 4LC9A 1TK9A 3IURA 2JAQA 4MS1B 4YLEA 3PFHA 2HPZA 3JWEA 4MKGA 5IVDA 5JD6A 4DTIA 5AW6A 1JE1A 3EYWA 1U1DA 2EF1A 1C50A 1BE0A 1QKIA 1Y81A 2FZ5A 1UXIA 2R11A 5CT6A 1UBLS 2FZEA 3TIFA 5HIAA 4JWTA 1PS9A 5IC5A 3TL3A 4JLUA 5CFPA 1N2BA 4PICA 5DW0A 1KH3A 3EVZA 1Y1KE 4JYBA 3FUTA 3C7DB 2IH2A 3ZQ6A 2IGTA 4FEEA 2IA5A 5JVDB 1LLUA 4GYWA 4A2PA 1U2PA 4HGQA 4YQZA 4ZALA 3V2IA 2JFXA 3JSAA 3EH1A 2EJBA 4HDNA 1YHNA 2BFNA 3FYUB 4OB6A 2FRDC 4IINA 2AWNA 1PYGA 4E12A 4KNYA 5CT9A 3KVOA 4KV7A 4JELA 5JCJA 3E18A 4MAFA 5G53C 3YASA 3FPHA 4XQCA 3RSZA 4M8LA 3S8EA 1G5TA 4DE5A 1WKBA 1HSOA 3MTIA 4Y2PA 5CEFA 4GYJA 2A59A 1RPNA 4HWSA 5HRCA 3PQEA 3L6RA 5BUQA 4NZYA 1WXGA 3BMCB 1JH9A 3HVIA 2F9FA 3GLFE 1Z7BA 1HE4A 2Y3IA 3GUYA 4XLTA 1LW6E 1N2CA 4MLDA 3UATA 1E4EB 3FDXA 1L3IA 2GR9A 4F2DA 5AQ1A 5AH0A 2F00A 1CIJA 1CUCA 4D8YA 2QN8A 3V97A 4GKJB 3A1DA 4RIHA 3CW9A 4WGGA 5DXAA 2FFAA 3FYDA 5CK5A 1LLCA 4RXUA 4UBJA 1FUUA 1KK2A 5H80A 1K8XB 3WMFA 1V8ZA 3CCCA 4FI3C 1BXZA 3VNAA 2AFIA 3D8UA 4KR0A 3TLXA 2IYZA 2I3DA 2KI5A 3KTAB 1MKYA 4PINA 1T3SA 2POQX 4EG4A 1N7HA 3SHVA 4IFTA 1EP1B 2HBZA 3HYRA 1E60A 3BMQB 1H65A 1QK4A 3D4PA 5HCNA 2PGIA 3KALA 4Z4GA 3DFMA 1OC2A 2K87A 4QQRA 5IK2A 4CR8A 2QUKA 4J9UE 3LE8A 4J49A 3UAXA 1M67A 4ZQIA 3KXDA 1BFUA 4IDHA 4J7CA 4KBYA 2V9CA 4BNDA 3QE4A 1W0JD 4H1HA 2BTEA 3E0XA 3KE8A 4KDEA 2CYAA 1NW8A 1XRJA 3SNKA 2QM7A 4LMRA 3J7AC 3B9PA 3CRMA 1G20A 2J0UA 3QNUA 4MVJA 1R8XA 1QGZA 4KFRA 5J63A 4BJHB 2FGKA 2NLOA 1LDGA 2X0RA 4F12A