5JSFA

Crystal structure of 17beta-hydroxysteroid dehydrogenase 14 s205 variant in complex with nad.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
268
structure length
268
Chain Sequence
GTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRASIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 17-beta-hydroxysteroid dehydrogenase 14
publication title New Insights into Human 17 beta-Hydroxysteroid Dehydrogenase Type 14: First Crystal Structures in Complex with a Steroidal Ligand and with a Potent Nonsteroidal Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 268
sequence length 268
ec nomenclature ec 1.1.1.-:
pdb deposition date 2016-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jsfA00
4BS9A 3WBFA 4IPTA 2HMSA 4XRGA 2ZTLA 3DQPA 4BB5A 4D46A 1PQWA 4MJLA 1EQUA 1BW9B 4IM7A 3ANMA 4DUPA 3SJ7A 4OAQA 1UDBA 1ZW1A 1DC5A 1F06A 3PHHA 4GH5A 3RU7A 3ZHXA 2CY0A 2H63A 2TMDA 3G3EA 1EK6A 1JU9A 2JD2A 1M2WA 1KEWA 4BNGA 1PJCA 1B8UA 1Q1NA 3L07A 4YBZA 4HNHA 1R66A 1YB5A 3FNGA 4CM9D 1IHXA 3LU1A 2X6TA 1QLJA 5L45A 8ADHA 3R1IA 3ROKA 4UULA 4XRRA 2RBEA 3Q11A 1C0IA 2F1KA 2DFDA 2VRCA 5F1OA 2UV8A 4E31A 2FOIA 4BNZA 4PFJA 3NTRA 1DSSG 1F8GA 1PJ4A 3ICCA 3LDHA 4BV9A 4L76A 3H2SA 1G1AA 1NFQA 1PGQA 4KQWA 1XU7A 2AQHA 3OICA 1N1GA 2DC1A 2XF8A 3CMCO 3FI9A 2PH3A 5BNFA 3JD1A 4BNIA 4FOOA 4IDGA 4GGPA 4EI2A 5C7IO 1SB9A 4W99A 2Y93A 4GX1A 4JIGA 3W1VA 1Y8QB 2RH8A 4EZBA 3FPLA 5F1KA 1L7EA 4MPDA 5L53A 2NVUB 1R0SA 1UP7A 1NVTA 4RORA 3ZNNA 2G5CA 4LCEA 2HMVA 1K0UA 2YQ5A 3H7AA 5HM8A 1PL8A 4Z0TA 2BD0A 4CQMA 1DO8A 4WE3A 1E6UA 1PGNA 2Y66A 2P4HX 3F4BA 1RJWA 3GGGA 4RVGA 3AUTA 3PGXA 2EWMA 1EUCA 4GVLA 4PVCA 4GWGA 3AUAA 3H5AA 5C7LO 3WTCA 3SLGA 2W8ZA 1ISFA 1JAXA 1ZUD1 4L8VA 2IODA 3HDYA 4CMIB 2HUNA 2VWGA 1ZK1A 4NBTA 4CLEA 4DMMA 3NUGA 1UR5A 2GDZA 3H9UA 4YAIA 5BT9A 1M76A 4RQTA 4UREA 4L74A 3TN7A 4JROA 1C0PA 5FYDA 3NKLA 3R3SA 3W4KA 5BSFA 4K28A 3OJEA 4KUEA 4AG3A 4K1LA 4BNUA 3PYMA 4E32A 4J49A 3TQHA 2GZ2A 1M6WA 1BTOA 1O8CA 3QP9A 4O63O 5EESA 1Q0LA 4UEJA 1E6EA 1I10A 4B79A 4OJNA 5L9AA 3RKUA 2HRBA 1DAPA 3VH4A 4WLVA 4E12A 2VHXA 2YUTA 1PIWA 1HDYA 3OETA 1GPDG 4BHTA 2FHSA 1PQUA 2EV9A 2PV7A 2PFGA 3QSGA 3WG9A 3G79A 3SLKA 1PL6A 4DIFA 8LDHA 1DC4A 3JQEA 4BIIA 2PR2A 5KWEA 4FPXA 1F17A 3AY7A 3DBHB 1RM5A 3K73O 1K3TA 4GL4A 3HB5X 2I65A 4UVIA 3SEFA 3GT0A 1ZKMA 5DT9A 4CR7A 4AJHA 5AXDA 4EITA 3PFWO 2CZCA 3OSUA 1YDEA 2PK3A 1ZMOA 3KLMX 1KC3A 3DB2A 4J1NA 4DLBA 2CMDA 4F6CA 2EGGA 4L4XA 2DLDA 4CL8A 2EP7A 3GG2A 4II2A 2XOXA 1ZSVA 4B8WA 2YZ7A 1AGNA 4FW8A 4LVCA 3GG9A 2BGKA 2AMFA 4FJ1A 3DWFA 3FWZA 1MX3A 1H6BA 1Y1PA 2W2LD 3PK0A 4RF2A 2PTGA 4I8XA 4CLXA 3I5MA 2YDYA 4IMRA 4Z9FA 5JE8A 2DTDA 3RBVA 4H16A 2P91A 5I7FA 3LSYA 3MTJA 4LGVA 3ONEA 3W4JA 3QE3A 1XIVA 1BMDA 4GPD1 4G2NA 2WD7B 4UEKA 4E4YA 2NM0A 1B7GO 3AY3A 3RSHA 1BDMA 2B37A 5G2OA 4YRDA 4WECA 2B4RO 5T67A 3GPDG 4BV8A 3E9NA 3NTOA 5KVVA 5A02A 3DZFA 4B4UA 3NJ8A 2O3SA 5A1TA 3DOOA 3HFSA 2PA3A 3B1KA 3I4FA 3WOHA 4YJHA 4DMLA 3R0IA 3DAFA 4PLFA 1NHGA 3JQ9A 1LRLA 1R4MB 5T64A 4MVJH 4A03A 1I3KA 4Z9XA 2IE0A 1I3NA 2ZTUA 3O9ZA 1PWXA 3JQ9C 3AUUA 4FQ8A 3GZNB 2EKQA 4BO8A 3GFGA 3H5RA 1PGJA 4L4SA 1IE3A 1MUUA 5L7WA 2FZWA 3JYPA 2DT5A 4IJWA 3HUDA 4CMHA 5BNTA 3GY0A 2PZLA 1GEEA 3ZV5A 3NT4A 3WJ7A 4N18A 4H7PA 3U09A 1Z82A 1KEVA 2Q3EA 3JQAA 1E5QA 3W6UA 1QYXA 3RQSA 1LSSA 3GZ4A 3FRJA 3MJ4A 2PKRA 1K6IA 2G76A 2OBYA 4Q39A 4U6QA 4XX0A 3E18A 2NACA 5JYEA 4I5DA 2O3QA 1X14A 1IULA 4UUNA 4YT2A 3VPXA 3LLVA 5J23A 3R6DA 2HU2A 2WTBA 5JAIA 3LZ6A 1EE2A 3TL3A 4NBRA 1A4UA 2GN8A 1LRJA 1YS4A 3K5PA 2WYVA 3RC7A 3MJEA 3PGJA 5IAAA 3JCZA 5A05A 1BVUA 3GDOA 4L75A 1I32A 1DC3A 4J4TA 5A9SB 4KMSA 4BNKA 2ZYDA 1U7HA 4YVFA 3DAPA 3L6DA 2JJYA 1RM0A 1EUDA 1LDBA 2CVOA 3ENNA 3WXBA 5IFLA 5JO0A 1O95A 2LDBA 1FDWA 3PDJA 4J0FA 1ZO8A 4NBWA 2IDZA 1ISJA 4BGEA 1C0LA 3IUSA 3NGXA 3SC6A 4J6FA 4WOJA 4B7UA 3G0OA 3KYCA 4O6VA 2NADA 4EW6A 5JFOA 4FFOA 4J9UE 1GTMA 4X54A 1J4AA 1UZLA 2YDXA 1QMGA 3KV3O 4MDHA 5F21A 1PX0A 5A9RA 5JC8A 1DLIA 1JWAB 4MKXA 2FWMX 1WWKA 2ZCUA 1XLTA 2GF2A 2WMDA 3CPSA 1KETA 2X5JO 3IP3A 3VDQA 1NYTA 3CINA 1D8AA 4E2WA 2V6GA 3WGYA 3VTZA 4FSHA 5F3RA 3E1KA 1MC4A 1QR6A 5H82A 4M89A 3JD2A 3MJCA 5MGBA 3UOGA 1GQQA 2VYVA 2Z95A 3DFZA 3OJLA 3PVZA 3DZBA 1BDBA 3S2FA 3WGOA 1U2GA 4BOYA 3ONDA 2H9IA 1NQTA 2NSDA 3NDRA 4FD3A 4AJ4A 2AEFA 3GVIA 3L9WA 3FCOA 4WOKA 3I52A 4A26A 4F6LA 3WX0A 4IGFA 2PD4A 3DZKA 3RUHA 1KC1A 1WAMA 4PLPA 3F3SA 3K2BA 5L40A 4RV9A 3ST7A 4E2ZA 1TI7A 3DZGA 3KB6A 4K26A 2Y1DA 1T26A 2YV1A 3P2OA 2X5KO 2OZPA 4GAEA 4U8GA 5JAQA 2VT3A 4XQ9A 5C3MA 1GV0A 3ZWOA 5T57A 3MJVA 5DP1A 3JQ7A 4R1SA 4LRSB 4FC6A 1O94A 3KEQA 4TRMA 3I9LA 3S1LA 2GO1A 2WSBA 3TFQA 4CODB 3WSVA 1UDCA 5HTOA 1UAGA 1G0NA 4DPLA 3Q0EA 1WZEA 2YJZA 3DZIA 3JQGA 2GLXA 3JTMA 3M6IA 2BRUA 2H6EA 4IDBA 2PNFA 4JCOA 4AJJA 4D0RA 3U4HA 4FFMA 1NWHA 4DVJA 1GCUA 3FTPA 4J4BA 4TKLA 3OFSA 1QXSA 3I83A 1ADCA 1QRRA 4FGWA 3QV1A 3D5QA 3QJ5A 2Z1MA 2UVDA 1T4DA 5F5NA 4UVDA 1NXQA 2UDPA 4KDEA 1PZFA 4LMPA 3GNTA 4Z3KA 3A28A 4QO7A 5T8KA 1ZXBA 4ROSA 2VCYA 5L3ZA 1J5PA 3Q9NA 4PRLA 4EEXA 3DZJA 5T8KC 2ZB8A 1ENOA 3HSKA 1DEHA 1WDMA 3HJAA 4KWIA 2ZYAA 3QVXA 3LVFO 5HS4A 2V7PA 4J1QA 1P1KA 4NMHA 2Z1NA 4Q3AA 3LLSA 4XYEA 4CMBA 1MG5A 5B12A 3GGPA 1MG0A 3SVTA 4R3NA 2VN8A 4DBZA 1B3BA 1K5HA 1BVRA 5JY6A 3W8EA 1F8FA 4ZQFA 4XJTA 1R6DA 2EHDA 1TT7A 4Q9NA 5CHEA 2NV6A 4HFNA 3H3JA 1HWYA 4OOEA 5KJCA 4CMCA 4HFRA 3FBGA 4RLHA 4PLTA 3T7CA 1NPDA 1IPEA 3K6JA 1CQIA 3WGTA 2GN6A 3KUXA 1KVTA 4XGNA 4RVFA 4CUZA 4QXMA 4A5OA 1DPGA 4KOAA 4Z9YA 4YRBA 3QA9A 1Q0QA 2GN9A 4JP2A 4E5YA 2DQ4A 1YL7A 4J90A 2QZ9A 3EC7A 3F5QA 4BO5A 2XXBA 4YJHB 5IG2A 2BFOA 1UAYA 4GMFA 1GPJA 2VHYA 4OSOA 1N9GB 4BNHA 2QW8A 3TPCA 5THKA 3WQRA 4BKQA 1B0AA 5G0TA 4GX2A 2NTVA 3VH3A 3IKVA 4RF5A 4WNIA 1KERA 3WNVA 4YXFA 2IXBA 4MO2A 4WJZA 3DFUA 3OIDA 4C7JA 1UXGA 2DKNA 3UCEA 4MVJM 2NQTA 3IKTA 4PCVA 1I01A 5G4LA 3JQAB 2AE2A 4F3YA 4CLDA 1ZVMA 4HXYA 2EIHA 1ZJYA 4DIOA 1JDJA 3WSWA 4W4TA 4ZGWA 1LBEA 3U49A 4NJMA 4WASA 2P68A 5CPBA 5L4LA 1BXGB 2Y0EA 3GEGA 1TXGA 4HKTA 1WLYA 3D4NA 3RBXA 3KVOA 1LC3A 2E6UX 3TZQA 5EMHA 3OEYA 1LXCA 4M1QA 3FR7A 4BGVA 3ADOA 1IUKA 4E5MA 2GZ3A 3GLQA 2P4QA 1NFRA 2JCYA 5JPIA 1PEDA 1N7HA 3QVWA 1A72A 1H2HA 4FJ0A 3IDSA 4NFHA 3ULKA 4AJ1A 4PZCA 4CM8A 3ASVA 4OGWA 2AW5A 4I9NA 1SOVA 2OMEA 3DO5A 3BHJA 1LDGA 2CDBA 1SO8A 2GYYA 4JP3A 2FPIA 3RBZA 3HQ4O 3NTQA 5KNLA 3EVNA 3AM4A 1ID1A 3NJ4A 3BHMA 2YV2A 1VKOA 4BNJA 1O5IA 3D1LA 3H5NA 3WGQA 2C7GA 4N54A 1YL6A 2IYPA 1E77A 4U5QA 1PS9A 3Q9UA 5JCJD 5H81A 3HHPA 3DMYA 2Y0CA 1T1SA 3RD5A 1I36A 5A03A 4BNYA 1I3LA 3ZWYA 1F12A 5TT0A 1EZ4A 3VPSA 3ZWVA 5CEFA 4NU6A 3ROMA 1A27A 2O23A 4ND3A 1ADGA 2NLOA 4BUCA 3ETDA 1OBFO 2EEZA 2HMWA 1MP0A 4WLEA 5JO9A 5DCYA 3UH1A 5HRUA 3LT1A 1EVIA 3WICA 2TMGA 1YBAA 4WEQA 4CM3A 3D3WA 4B7CA 4NQZA 3VVCA 1KYQA 1ZIDA 1PJQA 3F4LA 3S2EA 2FR1A 1PR3A 4H15A 1I2CA 2HJRA 2O7SA 1G0OA 3BA1A 4E3ZA 2J5KA 4PLWA 2WEKA 4ALMA 1YGYA 4G81A 4DTIA 4B7XA 4PIVA 4XJSA 3WJAA 2O3JA 1Z7BA 4S1VA 4WLFA 3K2EA 5DBGA 3ZWNA 4BO9A 4BNTA 5I7EA 3O8QA 4KQXA 5EPOA 1P1FA 2DUWA 2VYND 4AJEA 1PJSA 1LJ8A 1TB4A 3UN1A 1GCOA 3GH3A 2D3TA 4BO2A 3OECA 3PPIA 2WWRA 3TSCA 1MB4A 3BMCA 4ND4A 2GR9A 1CQJA 3F9IA 5DN9A 3C8MA 4GQAA 4PLZA 3H9QA 1R0KA 3JQ7B 1FDVA 3AM5A 4JX8A 4H3VA 2HK9A 3F1LA 1GADO 1EE9A 3ZZNA 1P1HA 3AU8A 1ISIA 4CMJA 2AEJA 3H9EO 3KOUA 2VUTA 4BKPA 3JQGB 1SC6A 3HADA 4MVJE 3VH2A 3MJSA 4JK3A 3SBOA 1U1IA 5DCUA 4CM1A 4FB5A 3H9GA 5CG2A 4R41A 3KYDB 4UUPA 3ZHYA 1LC0A 5EERA 4D41A 4E13A 2PY6A 4XR9A 3ZW8A 4TROA 1C1XA 4L73A 2WYUA 3EMKA 1YJ8A 1NVGA 4AICA 5K0ZA 2OOSA 3JYLA 4QQRA 1WW8A 3A1NA 2E49A 1KY4A 1IOLA 4OQYA 4ID9A 1X0VA 2I3GA 4U7WA 3VPFA 4CLRA 1PQPA 5TGDA 4AJ2A 3PZBA 1T2AA 4B3IA 3TZ6A 4Y6SA 1B15A 4I9UA 1ADFA 4GSLA 4TVOA 5U9CA 1I30A 1SPXA 4J4HA 4IGEA 2W4QA 4DPKA 4PN3A 4IDEA 4GX0A 3ANLA 3G1UA 2VRCD 2PD3A 1ZBQA 1CERA 3IUPA 1A5ZA 3ZWCA 4BL5A 4OKNA 5TC4A 1E3IA 4DYVA 1CEQA 4I5FA 3T4EA 4NBVA 2OHXA 3KXDA 4FGSA 4R5MA 4MVJG 3W4IA 2X4GA 3UGKA 3M2TA 4A2CA 2W2KA 4YCAA 1MV8A 3FBTA 4U0KA 2BELA 3I9OA 4D3SA 5CP8A 2PLAA 1XDWA 2QX7A 1UXIA 1Y7TA 3TOXA 4ALIA 2AG5A 5KKCA 2UYYA 3D4OA 4OMUA 1QYDA 4HADA 4RDHA 3ZH2A 5TSDA 1X1EA 4PLGA 2O4CA 4CUKA 4RL6A 2EGHA 4IUYA 4TVBA 4ZN6A 2AQKA 4ZVVA 1NASA 4RJTA 1NWCA 4Y9DA 3TWOA 1P31A 3F5SA 3OM9A 5FI5A 1HE3A 3EYWA 1XA0A 3A4VA 1OOEA 4DC0A 1WDLA 4A73A 3WYEA 1VE9A 2R2GA 5EQDA 1DIGA 2IZ1A 5G0VA 1VSUA 3KBOA 1OC2A 1YDWA 1AN9A 3H65A 1NQOA 4S3MA 3VVBA 3LK7A 1LLQA 4UEOA 3AI2A 2ZQZA 1J0XO 3KSUA 1VM6A 1NR7A 4NJMB 4NR0A 5I7VA 3NDJA 3CUKA 3V2GA 3WTBA 5A04A 2NNLD 2CUKA 1S6YA 4RPHA 4DGSA 2FSVA 2HDHA 5IN4A 4GVXA 4QUKA 4FIZA 4Y6RA 1EBFA 3HN7A 1GD1O 4NIMA 1P0CA 4J1TA 2CSUA 1Y9AA 3Q3CA 4YAEA 2HSDA 3IAHA 1PS0A 3TJRA 4RQUA 4YR9A 5COBA 4YYZA 1PR9A 3WGZA 4LRTB 3FNFA 5DBFA 3AUSA 4QO8A 1DIHA 4WCFB 4O59O 5A9TA 4BB6A 5JBIA 2BKAA 2OGUA 4EJ0A 3W8DA 2GNAA 2X23A 1UDAA 1NAHA 3LT4A 4G5HA 4I08A 4E5NA 4TZTA 4PG6A 3MZ0A 4AJPA 6ADHA 1H94A 3VKUA 5FWNA 5JY1A 3K96A 3RFTA 5C5IA 2XAAA 4JBHA 4JXKA 4BO1A 3OIGA 3QWBA 3O26A 1JTVA 4YJDA 4G65A 4ND2A 3S2GA 4A0SA 4DPMA 2X5OA 1R0LA 1OAAA 1UUFA 4D42A 4FBGA 4HY3A 2EJVA 3IP1A 1AE1A 4D7AA 1PZGA 3PQFA 1N1EA 2Q1UA 3DDNA 4ZRNA 5TQVA 3D7LA 4MKZA 4CPDA 2HCTA 2VZ8A 4EJMA 3TNLA 1I33A 4EBFA 2FPGA 3BMQA 3D3WB 3QWAA 1BRMA 4FS3A 4MP6A 3HWRA 3ZU2A 3L77A 2B4TO 1BGVA 2PZMA 3O38A 3PTZA 4MVJP 5A3VA 1GYPA 4E30A 3NEPX 5ICSA 2YFQA 3FSRA 2Q2WA 5G4KA 4XYBA 1LDYA 1Q0HA 1CDOA 1QSGA 2QYTA 1XGKA 2E48A 1NHWA 1YXMA 2YYYA 3WS7A 3B1JA 5KVCA 4J3FA 2OFPA 1H9AA 3GF4A 3DTTA 1Y9EA 2C7VA 2V6MA 4QFDA 2NUAA 1QYCA 4R9RA 1HDXA 1A4IA 3O8QB 4LVUA 4J91A 3I23A 2J5RA 4YRAA 5KJEA 2YY7A 4R5HA 2DTEA 2P5UA 5ES3A 1E1MA 3ZV6A 4LK3A 1HZZA 3QRWA 3U4CA 2FN7A 2VNSA 4EUFA 3BMCB 2X9GA 1LA2A 4XDZA 3WGGA 2HMUA 3VAZA 1C14A 1P3DA 2VZ9A 4R16A 1W0CA 2NTNA 1GUFA 3IMFA 5IDXA 2ZJ1A 2QRKA 3UAGA 2Z5LA 3E5MA 2J3KA 4ITUA 1KOLA 1YBMA 1TT5B 4F46A 4IIVA 2D59A 4YTEA 2Q1SA 1Q7GA 1DFHA 3C7DB 3EW7A 4AJLA 1UZNA 3BZUA 2EF1A 4UVGA 3JQAD 3H4VA 1EFLA 3IJRA 3H2ZA 4CUJA 1IYZA 2PGLA 3GMDA 2FSSA 3AOGA 2V6BA 5AVOA 2VWQA 4Z3DA 4BKRA 1WMBA 4OSPA 2QZZA 1K6XA 3TZHA 4RO0A 1C1XB 3M2PA 4XKJA 2OXIA 1LTHR 3KEOA 4YACA 1RWBA 4I9HA 1ZCJA 2B35A 3DONA 5TJ9A 2VHWA 2JD0A 1A7AA 2PGJA 2FR8A 4XQCA 4CLRB 3ZHBA 4II3A 4AJKA 2YHUA 4P38A 3S8MA 1I5RA 1Y8RA 2IZZA 1HKUA 3NGLA 3M1LA 4DRYA 3VPHA 1GYQA 4XZ3A 3CIFA 2X9VA 4OKIA 3MEQA 3OJ0A 3WR5A 2W2LA 1YOVA 4IDFA 5AQ1A 3H8VA 4JJFA 5ER6A 3INRA 2R6JA 4GI2A 4J7CA 2IYOA 2CD9A 3D64A 3I9MA 2RIRA 2D0IA 2D1YA 1GQ2A 3DHNA 4AJOA 5DCWA 1ADBA 1C3VA 1PJ3A 5JDCA 3I3OA 3E8XA 1HRDA 1JWBB 3DC2A 5ER9A 2JFHA 2Y1FA 2Y68A 5I7SA 2VRBA 1JKJA 1RM3A 4O5OA 1VRWA 4N5NA 1DOHA 5JDCC 2C54A 2CFCA 5TNXA 3VC7A 2JFGA 1JKFA 1UP6A 2Y1GA 5I9MA 1NR1A 4PZDA 1GR0A 3GR6A 2WD8A 4TQGA 4IBOA 3LQFA 4FOSA 5U1PA 4PG8A 5JAMA 4OL9A 4B3JA 1E1KA 1E1NA 5I8WA 4IIUA 1PZEA 2GN4A 3JSAA 3EZYA 1VC2A 2Q1WA 4IDCA 1B14A 1Z74A 1ZEMA 4DQVA 1WP4A 1Y5RA 1IZ9A 1JA9A 4BMVA 2VYVD 3C1OA 3EHEA 3T4XA 3GDFA 4EGFA 1U3WA 3DHEA 2O48X 3BYZA 4YWJA 2G1UA 2C20A 3JQ8A 5ITWA 2YHIA 1OFGA 1D1SA 1QLHA 5HA5A 3DHYA 4GX5A 2YFHA 1VL6A 1DB3A 2GASA 3K30A 5KJ6A 1JQBA 3UHAA 4Y8VA 1UJMA 4KWHA 1CWUA 4PLHA 2BFPA 3I1JA 5FFFA 5CAEA 4D45A 1QKIA 3JYQA 4K9DA 2XXJA 1AXEA 4XIJA 3DR3A 2C82A 3CZMA 4CQMB 4CV2A 3RC2A 2A94A 2HAEA 3RU9A 3WWYA 4WNCA 5IZ4A 4HFMA 4I5EA 2Y1EA 4W9NA 4HBGA 4BGUA 3QVOA 4LSMA 4KZPA 1KBZA 3GEMA 5DOZA 1V3TA 1HDGO 3LYLA 3HG7A 4W9NC 1O6ZA 1HDZA 2CDCA 4E6PA 1DAOA 1HZJA 4RVHA 4XQGA 1EQ2A 1E0DA 5JXWA 4OH1A 3C1AA 5BSEA 4LW8A 2P9GA 2O50A 4IQGA 4RPGA 1K89A 1BWSA 2OBNA 2H5LA 4YT5A 4YJGA 2B4QA 3G1TA 1HL3A 3OQBA 4KP7A 5JLAA 3JYOA 5CDGA 1H5QA 4HUJA 3VDRA 3ZWPA 2B83A 3MOGA 4O0LA 4NK4A 3PYXA 5HWSA 1M67A 5ENDA 3I6QA 2Y1CA 3D4PA 3GUCA 1RKXA 2CF5A 2WYWA 5EJ2A 5TT1A 1I3MA 4M86A 3TDKA 3D0OA 4OIMA 5AOVA 3HN2A 1KY5A 1FF9A 5ITVA 4MOWA 1BG6A 3LF2A 1U3UA 1MFPA 4HFJA 4ZA2A 1N92A 3KRTA 3DMTA 1GZ4A 1C1DA 5DDIP 3PLNA 2HRZA 3PXXA 1L1FA 3ASUA 4BNFA 3TF5A 5G4KB 3WFJA 2B5VA 3DMTC 4P22A 4WCDA 5G0WA 1U5CA 2P9CA 5CEJA 2X0NA 1HSZA 1QYWA 2B5WA 1U28A 1ZMTA 3BIOA 5ICMA 1HTBA 3GUYA 1JAYA 3QVTA 4MVJA 3IS3A 1HLDA 1P1JA 3UCXA 5U4QA 3JQFA 5LDHA 4CM4A 4FC7A 2WM3A 3PZRA 1IY8A 1YBVA 4BNLA 4GGOA 3JQFC 1HDCA 1KVUA 3E6AA 4I5GA 1N5DA 4WEOA 3M1AA 2DUUA 1DDOA 1GFSA 3K9QO 3QY9A 3DAGA 3A06A 1W8DA 5IDYA 3TZCA 4DC1A 3PHLA 3WQSB 5AYVA 1TLTA 1W73A 1NNUA 2X7HA 3JD0A 4Q3BA 3ETEA 1DXYA 5K9ZA 3FNHA 3GC6A 1KS9A 4HX5A 4NI5A 4B8ZA 4MINA 4XB1A 2P2SA 1LX6A 1BSVA 1YQDA 1IZ0A 2OP0A 3I9JA 1O89A 9LDBA 4ZU3A 1SBYA 3DZHA 5TLSA 4YAGA 1X1TA 2VUSA 3PEFA 4MIEA 1QV6A 5BR7A 1GEGA 4MP3A 5COAA 1ULSA 1I24A 2EJWA 3EZLA 2JCXA 1ARZA 1U4OA 1FMCA 4UUOA 4J0EA 4CLHA 1HDOA 3F1KA 2YW9A 1YWGO 3A14A 3UF0A 1HE2A 3DBRA 2BGLA 5TX7A 5GY7A 5THQA 4M55A 3V2UA 2F00A 3FF4A 4JGBA 2AQ8A 1OZAA 1ZK4A 4RF3A 4XDYA 3GVPA 2EERA 3HFGA 1X13A 2HMTA 4XGKA 3TL2A 3ZHZA 1DHTA 3R3JA 4YPOA 2GGSA 5ADHA 2VWHA 1V3UA 1TVEA 1NP3A 1LQTA 1DFGA 3NV9A 1H9BA 4YDRA 2X86A 9LDTA 4IINA 1LNQA 1YE3A 1YL5A 2C2XA 2FP4A 1V8BA 5B1YA 1K2WA 1D3AA 2O3RA 2J5QA 3EK2A 5L4SA 4BMSA 4B4OA 4CMGA 3WDSA 3ONFA 4U0JA 1E7QA 4TRJA 3MCVA 5FEUA 3GGOA 4GLOA 2GPTA 2PZJA 3TZKA 3PHGA 4MP8A 4E2YA 4CM5A 3PHIA 3PWSA 2RH4A 3GRPA 3GNQA 3OEWA 4YQYA 4GKBA 4IY1A 1MXFA 4Y67A 3UW3A 5EIOA 3KLPX 4Y6PA 5DBIA 3BTUA 2PWZA 3RJ9A 2DTXA 1ZK2A 1U8FO 3WYCA 3PQEA 1EDOA 1ENZA 2E37A 1WXDA 5BSGA 2ZCVA 1E3EA 4GKVA 5CEEA 3V2HA 1VL0A 3OBBA 2E4AA 3PYLA 4E21A 3QW2A 1PJBA 1D4FA 4FFLA 2I67A 3KYCB 3DOCA 4IS2A 3JD3A 1ZZEA 2Q1TA 1NBOA 1Q7CA 3FHLA 4FN4A 2YHIB 4J2OA 4CM6A 4CMIA 1E6WA 1TEHA 2BH9A 1B3RA 3GVXA 3NAQA 2OO5A 1AXGA 3EAGA 4NJOA 3L4SO 3B20A 1EFKA 1WZIA 3RROA 3F6YA 1ENPA 3ITKA 4WLOA 5EINA 1T2CA 3EVTA 3OIFA 1VL8A 2Q99A 1WDKA 4FDAA 4B3HA 4EUHA 2GERA 3V8BA 4IJUA 2JHFA 1PJLA 1PU2A 1W4ZA 1ZH8A 4CL3A 3QWHA 3SC4A 3Q2KA 4DIBA 4ZQBA 3MJTA 4N7RA 2Q45A 2GSDA 2ZKLA 4RPJA 1IHYA 2C29D 1NQAO 3ZU3A 3QQPA 1V3VA 4BVAA 3ITDA 1B8PA 2GZ1A 3HB4X 4JN6B 2VOJA 3AW9A 3OH8A 5CDSA 1RPNA 2UUOA 4BNNA 2NVBA 1SEPA 3DBHA 3OJOA 4W7HA 1FJHA 4DYDA 2E82A 4JBIA 2J8ZA 1HSOA 4GWKA 3ZGYA 5CDTA 4YJGB 2FPPA 3ANNA 3INTA 3VZPA 4ALLA 3Q6IA 1L7DA 1ONOA 2R00A 3RUFA 2CDAA 4EDFA 2EW8A 5IN5A 4DXHA 4UUMA 2R00C 3ZWMA 2AEMA 4E33A 4JQCA 4ZRMA 5EN4A 5L7YA 4DBVO 3CE6A 4IQ0A 4XR4A 2QIOA 1E3LA 3RCBA 2BI7A 1DHRA 5DZSA 4RF4A 2I66A 1Z75A 3GPIA 1T4BA 2ZTMA 5ILOA 1EVZA 2DU8A 3KSZO 5CPFA 4B4VA 2I5PO 3I9KA 2WD7A 1HLPA 1QORA 1DJNA 1LLCA 1X7GA 2DBQA 4B4WA 2ET6A 3GHYA 3ZWAA 4R68A 1S7CA 2HJSA 3PJEA 1PJTA 2DPGA 5FF9A 3BMNA 3H3FA 4DQUA 4JLWA 1SNYA 3ZV3A 5B4TA 1SOWA 3WIEA 1FDTA 2NTJA 1ZSYA 2UUPA 1ML3A 3QWIA 1H6CA 5JW6A 1WNTA 1GV1A 3GK3A 1YB1A 2FR0A 3G49A 1R15A 2JD1A 3ON5A 3FTNA 3KHUA 1H2BA 2W98A 1R4MA 2X22A 2JKVA 3COSA 4IQ8A 4R1NA 2O2SA 1B8VA 1T2DA 3Q1LA 2NU8A 3UUWA 4BNVA 2C07A 1HDRA 3GZNA 4RLSA 3H6KA 4PG5A 4XIYA 3C1TA 3ZN2A 3BXXA 3GA0A 3UFXA 2Y99A 3V5NA 2B0JA 4I1IA 3ENKA 5JS6A 3LC2O 1HXHA 4FFPA 5JYDA 4NG5A 1SMKA 3VZSA 3IL2A 4ALKA 1DIRA 1H6DA 5JMWA 4EYEA 3V1YA 2X0IA 3B70A 1MA0A 1PWZA 2G0TA 2Q4BA 2ZB4A 1KEUA 2X9NA 4MIOA 5LCXA 1XEAA 3ROPA 3PQDA 3K92A 1GZ3A 4NPCA 1XELA 3PJDA 2J3JA 4UAGA 3DL2A 3WIDA 3WLEA 4RPKA 4BNMA 3RIHA 1D1TA 3I9NA 2BF7A 4P4GA 1NPYA 1SB8A 3E9MA 4UVHA 7MDHA 3EUWA 3E48A 4XCVA 4FFRA 1EUZA 2Y0DA 3DBRB 1PS8A 2VQ3A 3GOHA 4CQMD 4RGBA 3GN2A 3QLJA 3GDGA 2VTEA 3C7AA 1Z73A 2YQ4A 5A06A 2Q50A 5C7OO 4NZ9A 3C7CB 4QT0A 1RYDA 1N8KA 5EL0A 1UXKA 3T7EA 2BMAA 3ORFA 1UXJA 4KUHA 3U3XA 4ZQHA 5A9SA 4DWVA 1P45A 4TRRA 4BKUA 5C37A 3PI7A 3RC9A 3GFBA 4RVDA 4EJ6A 3AU9A 2J6IA 1AHHA 1XQ6A 3PIIA 3QVSA 1T25A 4Z6KA 1ORRA 2J3IA 1X0XA 3BTVA 1GY8A 2JL1A 4CM9A 3OQ6A 3AWDA 4OO3A 2V65A 3L9XA 1DRUA 1HETA 1ISHA 2I9PA 2I76A 3LF1A 3F46A 5LDGA 4CM8B 3CXRA 3RUCA 4O1MA 2O3TA 5TS3A 4CV1A 3JQBA 1I2ZA 3OJFA 1P77A 1UP4A 1YONA 2CVQA 1LRKA 2DBVO 2BLLA 3JQBC 3LT0A 1P44A 5DOVA 4FR5A 5TJHA 1HYGA 5LC1A 2C0CA 3CH6A 5DULA 2Q2VA 4FJ2A 6LDHA 1B16A 1XSEA 2FRDA 3FNEA 3UICA 3VKVA 4RDIA 3X2EA 1NQ5A 3WNQA 4D44A 1U4SA 3E5RA 1G6KA 3JYNA 2EG9A 2YV3A 3ICPA 3WMXA 3WWZA 3P5SA 1HEUA 4FFNA 1Y5MA 5F5LA 3DBLA 1E7MA 1NM5A 3RC1A 1Z6ZA 1W6UA 3B1FA 1CF2O 5IXYA 3AY6A 1U3VA 5B37A 4DREA 3CMMA 3ZCXA 5IDWA 2CNBA 2G17A 1EBUA 4WUVA 1YKFA 2CF6A 3CSDA 4D43A 2A35A 3CZRA 4A10A 4YJFA 4A7PA 1I2BA 3H9JA 5CG1A 4RZHA 1LSUA 1A7KA 2GCGA 2I99A 3JQ6A 1P1IA 3PJFA 4LN1A 3ZU4A 2DPHA 1P1RA 5IF3A 4R4JA 1TA4A 7ADHA 4Q3CA 1T2EA 3SX2A 5AXBA 3WYBA 3RFXA 1XG5A 4HNGA 3AJRA 2UAGA 3IC5A 4N5LA 4IZIA 3U4IA 3NYWA 3S2IA 1KVQA 1T1RA 4AJNA 3GN1A 3IOYA 4PLCA 4IDAA 1J6UA 1JN0A 1I0ZA 3DEYX 1Y81A 1XCBA 1ZFNA 2G82A 4ILKA 4ND5A 4XYMA 4QFCA 1DIBA 3GQVA 4J9VA 3RUEA 4CM7A 2DFVA 1DRVA 4D79A 1GQYA 4CMAA 5KTKA 4K6CA 2VTDA 1SZJG 2DBRA 3EDMA 2X58A 2IRWA 5KKAA 1HE5A 2VHZA 4XYLA 4J7UA 1ONPA 3RI3A 3F47A 1HYHA 2JCVA 3BMOA 2EW2A 3BTSA 4R01A 4Y98A 3SXPA 1X7DA 1D7OA 2DBZA 3VPGA 4CMKA 4PG7A 1QYVA 3ZV4A 1GU7A 2DVMA 3GRKA 2EP5A 2HKIA 3D5TA 3SJUA 4R3WA 1AHIA 2NVWA 4OHUA 4NU5A 1LLDA 3FPCA 1HF3A 2AXQA 5DP2A 3HE3A 4PG4A 3BMNB 2WDZA 2AHRA 3MOIA 1H6AA 2Y67A 3W8FA 3ZI0A 4DLAA 3WFIA 2AG8A 2AA3A 5T6BA 3FD8A 4L9RA 4YAKA 3OMLA 4BO7A 4W82A 1QP8A 1KIFA 1VKNA 1EK5A 2WE7A 4P8RA 3A9WA 4Q3NA 3WBBA 4WLUA 1N9GA 4XEHA 3RVDA 4DL9A 2HO5A 4L4RA 5L51A 4CJXA 3RASA 1FDSA 4INAA 2NU9A 2NQ8A 2SCUA 3PHJA 3OA0A 5IXSA 1MGOA 4DA9A 2H1SA 2C5AA 3U4DA 3PDUA 4C4OA 2WE8A 5FI3A 3WQQA 4IJVA 1K6JA 4KDFA 3RJ5A 1NAIA 3E03A 3OF2A 1KVRA 2Q2QA 2ZB7A 3HDJA 1PZHA 3GMSA 3JV7A 3PLRA 1E7RA 3L6EA 2W2KB 5F1PA 1I8TA 3ABIA 2X0RA 2O7QA 1IL0A 4YEDA 1LUAA 3QWFA 1YQGA 1SAYA 3OA2A 1XU9A 1ZSNA 3CEAA 5COQA 1BXGA 3MWDB 1BXZA 3OQ1A 4R69A 4YA6A 1C0KA 4TMFA 2Q4EA 1OI7A 1XYGA 3UXYA 1E5LA 2ZJ0A 5JCXA 1QV7A 4RVSA 2DM6A 1E7YA 2QRLA 4CV3A 4YT4A 2B36A 4ZHSA 5KJ1A 4LSWA 4BO4A 3RAJA 4JJGA 4D3FA 2O3UA 5JC1A 1EVJA 4JNKA 4ONEA 1VI2A 4E0BA 1LQUA 5KVSA 4JBGA 3ZNOA 1DLJA 3KO8A 1MXHA 1ZEJA 4QECA 5IZCA 5L95A 3ADPA 4IZHA 3RWBA 4IMPA 1E3WA 5IZCC 1VLLA 1UH5A 4GLLA 3IQDB 4Q3EA 3KETA 3LC7O 1SCUA 4W7IA 4J43A 3ETGA 4MIYA 2VOEA 4Q3DA 4F45A 5JDIA 4CLOA 4A27A 4XD2A 3FN4A 1Q2XA 3PRJA 4CQLA 1B2LA 4NHEA 5JDIC 4BQPA 2Q46A 1YRLA 1CIVA 1CETA 3KTDA 1DC6A 3GVCA 4CV0A 3C3XA 3DBVO 3N74A 3PP8A 5DNAA 4OXKA 1LEHA 1MFZA 2X8LA 1DJQA 1X15A 4ALJA 2JHGA 4TZKA 5L4NA 3ZWBA 1A9ZA 5GZ6A 4BO0A 2NWQA 4U6SA 3NT5A 2D4AA 3RKRA 5KOIA 2PZKA 5JMPA 5DF1A 4GMGA 4PLYA 1LLUA 1XKQA 5JAZA 1SEVA 4MVJI 5GZ1A 4AVYA 3AOEA 1KEPA 1VJTA 4URFA 5CDUA 5K6AA 2ZIZA 1MLDA 3E82A 5L7TA 4YQZA 3AOEC 1A71A 3VZRA 4DQXA 5K6AC 3AM3A 2GUGA 2PH5A 1ZNQO 4R54A 5JSFA 2O4UX 1E3SA 3RUAA 1Y6JA 5HS6A 4RPLA 4XB2A 3I6IA 4MVJD 1PTJA 1UZMA 2FMUA 2W90A 2EKLA 3DBLB 4GBJA 3K31A 2HQ1A 5I9NA 1ISMA 4JJIA 5EQFA 4ZICA 4XYGA 1O9BA 3QHAA 4M49A 4L0QA 3DXFA 3BMQB 4FCCA 3PFFA 3N7UA 1FDUA 4K6FA 5B4UA 3WB9A 5TF4A 1E3JA 1PSDA 4OOFA 5TRTA 4J16A 3HDHA 4KTTE 4OXYA 3N58A 4YJFB 2I6TA 4RVUA 1BHSA 1WVGA 2OP1A 5CDYA 2OL4A 3FR8A 4ZJUA 1U5AA 2PKQO 4WLNA 4P4NA 1LDEA 2ZK7A 2VZ0A 2XPCA 1R4NA 1XHLA 3DTYA 3HDQA 3KYDA 4AL4A 4GSKA 4HP8A 2HK8A 1YJQA 4LCJA 4OYRA 4AJIA 1DRWA 4IS3A 1N2SA 4YAJA 3E9QA 1LDNA 5HBRA 3INGA 2EKPA 3TOZA 1V6AA 5BQFA 1B26A 3STHA 1NVMB 1YQXA 4J7XA 1Z7EA 1U8XX 2ZATA 3GAFA 3HNPA 5KIAA 4WK6A 1X7HA 2V6FA 4MVJF 3V1UA 1H93A 1CRWG 1VJ1A 3V1TC 1CJCA 4PZEA 4ND1A 4J1SA 1GYRA 1RYEA 2RHRA 3BMOB 1QG6A 1T24A 2D5AA 4R51A 4TRNA 4OM8A 4CR8A 4XGIA 5JNLA 1BXKA 1BW9A 2ZB3A 2A92A 1OC4A 3GHHA 3VZQA 1V35A 2C5EA 5MDHA 1ZK0A 4BO3A 4D3DA 1GL3A 2B69A 5T5QA 4AFNA 4NFYA 4W6ZA 3U0BA 2VUUA 3GEDA 2ZYGA 1JVBA 1PL7A 4OQZA 2WJPA 5KJFA 2PGDA 4EEZA 1U9JA 1E7SA 3NX4A 1J49A 1YVEI 1NTOA 2DAPA 2QRJA 3LC1O 1EVYA 2BHLA 4RCVA 3BHIA 1Y8RB 1EEHA 1WMAA 1XWFA 3G17A 3QIVA 2ZTVA 4ZQEA 3BTOA 4N5MA 4QX6A 4XQEA 1R37A 1P0FA 1HYEA 4MKRA 2VT2A 1YOVB 4J2HA 4R1UA 2JAPA 4BNWA 2VNAA 1E1LA 1E7WA 4M87A 4R9SA 4D0SA 3TRIA 2BFAA 1GUYA 3NT2A 2IEBA 1P33A 3L0DA 2X1HA 4NBUA 3LT2A 3VOSA 1M75A 4WPGA 1F14A 2QQ5A 3PJGA 5A5EA 3AK4A 1JLLA 3MWEB 2HLPA 1DFIA 1Z45A 5KVQA 3ZU5A 3HZZA 5BNIA 5GZ3A 1U2DA 5TIIA 1DBVO 1PJ2A 1EMDA 2LDXA 2PKQP 1PGPA 2OORA 3IIEA 2C2YA 1YO6A 2VHVA 4BQRA 1Y8QA 4OXNA 3U9LA 2IXAA 1ISGA 1M6HA 1ZJZA 1GDHA 1E92A 3I4CA 3WLFA 2Y1OA 2NVUA 4BKOA 5ENVA 2OUIA 5H83A 3JQCA 4DLLA 3AI3A 4CMEA 4PVDA 1WPQA 3OHSX 1P9LA 1GAEO 1V0JA 2D5CA 3Q2IA 3OP4A 2QYSA 4YB8A 3L6OO 2BI8A 4CMEC 1NFFA 4WGGA 1CYDA 2A9FA 2IEDA 2AE1A 2JFFA 5I8ZA 4UVEA 1OMOA 1R12A 3C85A 3ZWXA 2Q49A 3U62A 3JQ8B 2ZQYA 4Z0HO 4RZIA 3P7MA 1ZXLA 2CVZA 2POQX 4WCFA 3C24A 1N7GA 3NRCA 2Y05A 2P9EA 4TKMA 1E3WB 1PGOA 4PLVA 2FZEA 4WCFC 2O2YA 3WGHA 4E5KA 1NPTO 5CFZA 4EUEA 3UCFA 3ZNPA 3NDIA 2QHXA 3FWNA 3PIDA 1GZ6A 1JW9B 4M54A 3IJPA 4WKGA 4XA8A 3ZW9A 4C7KA 4CLOB 3WGIA 1R16A 4CQLB 4HV4A 1U7TA 3JD4A 4TSKA 4NH4A 5AXAA 2X0JA 3VHRA 1YB4A 4BGIA 3AFNA 1IB6A 1VPDA 4M8SA 4YT8A 4CR6A 1LU9A 1ZK3A 1NX6A 4E5PA 2NU6A 1RM4A 3KSDO 4ZD6A 1KVSA 1F0YA 3ZNQA 4BNXA 2I3AA 3O03A 5G0UA 2D8AA 3EY4A 4NNJA 4E2XA 2GRAA 2J3HA 1GUZA 2D2IA 4QSMA 3B6ZA 3DOJA 3K8ZA 5JCJA 5A3JA 4PGFA 5AXCA 1JKIA 2A4KA 3W6ZA 4QEDA 1MC5A 4TWRA 3UVEA 1Q7BA 1XR3A 1T2FA 3X2FA 4XWYA 1HE4A 3PWZA 2PD6A 2IZ0A 3KM0A 3KZVA 4IDDA 4NFSA 3ZDFA 3CTMA 4R1TA 4BMNA 1JVSA 1LI4A 1V9LA 3MTGA 1YH3A 3P19A 3EGOA 3GVHA 1O0SA 3AFMA 5A4DA 3CKYA 4P4LA 4NK5A 2RHCA 3ROQA 3RUDA 1H0KA 3RUIA 2QG4A 3GNSA 2BFMA 4LMRA 1XQ1A 4IXTA 4HWKA 5IDQA 1AUPA 1UXHA 2GD1O 1U3TA 1C1DB 2ILTA 1TT5A 2VWPA 2BGMA 2RCYA 3JQDA 3ZWWA 2NU7A 1A9YA 2EXXA 3UKOA 3RFVA 5B4VA 1LDMA 1LSJA 4IXWA 1P74A 3S55A 2VYNA 1R4NB 4QTZA 2JAHA 4LISA 4ZQGA 1IPFA 4CM4B 3VH1A 3AI1A 1VSVA 2HK7A 4KTVE 1ENYA 3O4RA 2AQIA 3GAZA 4ALNA 3KYBA 3WMWA 3L4BA 4NDNE 4ESOA 1VJ0A 5IJZA 1FK8A 2RAFA 4KUGA 5I9LA 3D3EA 2FY8A 3L4BC 5ILGA 3VTFA 4BO6A 5KCZA 3TFOA 5BSHA 3PWKA 5GMOA 1LSOA 1ONNA 5A5FA 1HT0A 1M66A 2P5YA 3P2YA 1ULUA 4PRKA 4IJKA 4Z0PA 1DIAA 1FXSA 3U5TA 1EDZA 3BAZA 2C59A 5G0SA
chains in the Genus database with same CATH superfamily
3ENVA 3WNBA 4BS9A 2Y27A 3PV0A 1T0JB 3EVAA 3SQDA 3MS2A 3WAKA 4BNUA 3EZ2A 5FPTA 3QFTA 4D46A 5DTMA 4M8KA 1EQUA 1ZIOA 4A1FA 4AMZA 2NPIA 4IM7A 3RT1A 4FFBB 5KYVA 3ANMA 2CL6X 3KOOA 1J23A 1UPAA 4IJ6A 2EJTA 3SJ7A 3WWPA 5LNK6 2RGDA 1BH2A 2CHVA 1VYVA 3B2QA 3C4QA 4LYYA 3RU7A 3V32A 4EBBA 2TMDA 2A8YA 1SUEA 5CYGA 2BUBA 2XNHA 4PAMA 2WJZB 1M2WA 2Z83A 3IDFA 3P0RA 2RB5A 4Q47A 4UZFA 2R62A 3RJTA 4BNGA 1SVSA 3G9TA 1JFVA 3JRNA 4ENUA 2H2GA 3I64A 4FCTA 3O95A 1R66A 1YB5A 4BN4A 3ICVA 3NO4A 3D8TA 3PCXA 1QONA 2X6TA 4XOUA 3H2YA 4R9NA 1JPJA 3FIJA 1K1EA 1NXTA 2BOVA 4LNUA 4EG8A 3Q11A 1E4EB 5CD1A 2F1KA 2YS7A 1I7QB 2O1SA 4NONA 1DAMA 5EY5B 1MOQA 5LR6A 2UV8A 4E31A 2FOIA 1BDJA 2FRVA 1T5DX 4G86A 5JALA 5LVAA 1KQGA 5J5AA 2FOLA 5FUQA 3W5VA 5BSUA 2QRUA 2FPMA 1EFVB 3ENWA 2REQA 4BV9A 4EG7A 1I9CA 1NFQA 2PTHA 1BWQA 1PGQA 4ITVA 4PC7A 2PJUA 2AQHA 4KGVA 1XZAA 2DC1A 2XF8A 3U44A 1SZDA 1B8NA 1FQWA 3HU3A 3I3SR 5B1EA 4GI1A 4Q9LA 5CVCA 1J0EA 3M83A 5TMEA 4EI2A 2JANA 2MU1A 2CJPA 1SB9A 2VDQB 4W99A 4V0RA 1TYCA 5C35A 2WU1A 1V8OA 2QVLA 1XRRA 2BGJA 3LL4A 4P86A 2JAXA 2QT9A 1V1JA 1Z2PX 3LLCA 4H7DA 4P54A 4QM7A 3CF4G 3GH1A 3AUYA 3QVVA 1GGNA 1KSJA 5CVTA 3M0EA 2JGEA 1UC5B 4RORA 3BFPA 1LV8A 1YB7A 4KVFA 3LE8A 4M6WA 5EE0A 1UXOA 3N70A 1SUSA 1G2IA 1ITZA 1GCGA 3N2LA 4Z0TA 5HM8A 2BD0A 1DO8A 2GAAA 5J1TB 2KI5A 3KXIA 3T5AA 2HF2A 2QAGC 3EEQA 1M2VB 3ELDA 3QPVA 1UK6A 2JH8A 3ZBUA 3L7IA 2EWMA 3EZXA 4KGZA 1RPZA 4OQEA 4CEIB 2GNPA 4GVLA 4HN4B 1OIWA 4PVCA 1WUTA 3KT0A 1IVYA 4P5DA 5AI8A 5DU2A 3STXA 3LQ2A 4FDLA 4HQRA 4TPKA 4EMTA 1TTTA 3EEOA 2W8ZA 3BH7A 4MCIA 2FW8A 1ZUD1 4WCVA 5A7GA 4A6EA 4MWDA 4Q4AB 5HE8A 2HUNA 5J59A 2WK1A 3QI2A 1GA4A 2BFBB 1YQUA 2GJ4A 1K8RA 5CVUA 5JSKA 3B3FA 1V7QA 1KZHA 5IJ9A 1UR5A 4IEEA 5BT9A 1M76A 3CV3A 1NQWA 3HJUA 1NUUA 2C84A 1O58A 5DFAA 3SBEA 1G63A 1F8YA 4JROA 1E2IA 4H27A 5AM3A 1FFWA 4HDNB 4L5YA 3ORQA 3LUKA 1XZEA 3W4KA 1T3ZA 4Z4FA 3BE6A 3GGJA 3OJEA 1I1NA 2W48A 4HQFA 4MEJA 4G5FA 4ZAGA 5AHOA 3CBGA 4JHXA 3NWEA 1Z34A 1CB7A 1MU0A 5C51B 1NURA 5JTUA 4I50B 1T4CB 2HRBA 4TXLA 3V9AA 1DAPA 1NIJA 1Z2AA 2QLTA 1G5HA 4MV6A 3VH4A 1PIWA 3WSTA 1HDYA 1XL0A 1DBRA 5HUHA 5HQ3B 1GPDG 3I28A 3B53X 5E7JA 2NSHA 3QSGA 3WG9A 3G79A 3ZGVA 3SLKA 4MUKA 4DIFA 4QQKA 2FZKA 2H0RA 5KWEA 1R4AA 4HLDA 2Q4RA 2VTKA 3C8HA 4KXQA 3HB5X 1W5EA 3N1UA 2XUGA 3SEFA 2CB9A 5DT9A 2GK6A 1BMFA 2UZAA 5DMXA 4EITA 1WPXA 1NKSA 2Q9CA 3PFWO 3VR4H 2HLNA 3W8NA 4MA5A 3KLMX 2HQSA 1KYVA 2CMDA 4LXXA 4MW4A 2DLDA 4CL8A 1FP4A 2EP7A 4UBNA 2QTCA 2P35A 2YZ7A 4FW8A 3NUZA 4B83A 4BRWA 1ZPDA 4IWYA 2QN7A 3JZDA 5GONF 3RTBA 4X8LA 3W7BA 4FJ1A 3AVTA 3EG9A 3DWFA 3IBCA 4M60A 3KKKA 3BJRA 4CIXA 4JI5B 3KWLA 3ND7A 2OHOA 4RF2A 4CLXA 4GYJA 1NBAA 1KHHA 3KTAB 2YOFA 4GICA 4ND8A 2B20A 5JE8A 3RBVA 4H16A 2P91A 4HYEA 1ULBA 2D1QA 1V5FA 2NO0A 3DUFA 3W4JA 1XIVA 1BMDA 5I4CA 5GOZA 1EXMA 1S2MA 1B7GO 2W6CX 3I04A 4FMBB 3ZV7A 4ZI7F 3RSHA 5IJWA 3UPUA 1QS0A 3KHKA 4H18A 5GV8A 1DCKA 1BDMA 4WA7A 1OZHA 1C7ZA 1H2RS 2XB9A 1W85B 1U2EA 3TQOA 4G25A 1U0RA 1UODA 2I1VB 1RBYA 2XYQA 1AXRA 2D8MA 3GPDG 4UHDA 1Y63A 3NTOA 3M34A 4A8JC 5KVVA 4KSBA 1VYTA 4N49A 2XKAA 1KZYC 1KY3A 4JMLA 3DOOA 3PVSA 4TL8A 4ZEWA 4BB9A 5A1TA 2RH9B 2PA3A 2WKWA 3B1KA 5LQDA 1R5JA 4IO0A 4X8OA 2FPWA 3I4FA 1N6IA 3G9XA 4DMLA 2HUPA 3TH5A 3DMRA 2VI5A 3K0FA 4M1KA 4PLFA 5BV8A 4TYWA 3EF0A 2ZTSA 4TS3A 4MVJH 1OX4A 4QFMA 4Z9XA 4D9IA 1BA3A 2AFHB 4ENTA 1HURA 1TX4B 2V0NA 2D0PB 4S2UA 4NECA 2QD3A 4QXRA 3WLHA 4FQ8A 3GZNB 2FX2A 3BXOA 2EKQA 3UMSA 4BO8A 3GFGA 5F3DA 5JSZB 4AG6A 1QWSA 1MUUA 1UOEA 3UG7A 4ENPA 3JYPA 2XQGA 3SDSA 1AZTA 2JVIA 4L4UA 2V4ZA 4FLEA 1KO7A 3GY0A 4FVTA 1KDVA 1GEEA 1X1AA 2G36A 3E58A 1JEDA 3WJ7A 5E9QA 5K8IA 2FPUA 2HBZA 1NLMA 4B6JA 4MWGA 3W6UA 2H2WA 3EX7C 2IZOA 3GZ4A 4IIJB 4UM8B 1PFYA 3FOZA 2ZR8A 1OHHA 4PQGA 1EFAA 3LHDA 4B45A 1XZNA 1Z3CA 2OBYA 3NNSA 4Q39A 5CHYA 1WDTA 2NACA 1YIAA 2XBMA 3JALA 2W8BB 3G0DA 1H42A 1AKNA 1RACA 2GN2A 2QNRA 3LLVA 2CK3D 3HJCA 1RI2A 4G3XA 4GRIA 1C5KA 5F12A 2WU4A 4AURA 2FG7C 1PJ8A 1D2EA 3L0IB 3WOVA 4EDHA 2ZIUB 1EE2A 2AOVA 1RPTA 4JR2A 2QVGA 1RDFA 1WOMA 2BEKA 4RSMA 2NZUG 3IB6A 1E1CB 2JJMA 3JCZA 1V8DA 2DYKA 4O4IF 4CF7A 1KMIY 1XLWA 3U3RA 1DC3A 5A9SB 4KMSA 5FCDA 3ZTWA 4R98A 4NAUA 4YVFA 3E3OA 4PWYA 2X13A 2BGUA 3L6DA 3B3QA 1EUDA 2CVOA 3SS9X 5JO0A 5KMGB 2FUG6 5IFLA 3PC6A 3RSSA 3S1SA 1GG8A 4QPCA 2Q7OE 2P7IA 2Y4NA 1FDWA 3VR4D 2A5JA 3KCNA 4L2IB 4NBWA 3E35A 4XPIA 4P2GA 3BQMB 4ZCQA 4B7UA 1DQYA 4UMDA 5FAKA 1IHOA 1FQKA 1TQ8A 4ISBA 3OOSA 3ASZA 3BWBA 1BGWA 3C5HA 4D9JA 3OESA 3WA7A 4RX1A 3OFVA 1J4AA 3KV3O 3SVZA 4L9SA 5A9RA 4QJBA 1PX0A 3C3WA 3H5WA 1G7SA 1ESDA 2B3TA 1JWAB 3QUSA 4MKXA 5D8DA 2OFFA 2RJ3A 4XLLA 1CZRA 1RCUA 1D6JA 5I3CA 5CVJA 3UC9A 5AVTA 1C3OA 2ODPA 1M5TA 2ZCUA 4JHLA 4X1IB 5C4IA 3MLEA 2X5JO 3VDQA 4Q7LA 1JQLB 4Q03A 4WBSA 3TLCA 3HCWA 1X1RA 3KDAA 3ZIAD 3FSGD 4E2WA 3ET5A 3ZWQA 2C83A 1QZTA 2FKAA 2VKTA 2BBTA 4M7WA 1AV6A 2PZGA 2V8BA 1RWMA 1A82A 3KPUA 3Q7RA 3ROZA 5MGBA 1THTA 2QAGB 2ZE5A 3UOGA 2GK3A 3E84A 2VDKB 1GQQA 1QDUA 3P27A 4R1PA 3PHCA 2EATA 1A77A 3GL9A 5MGNA 3DFZA 2IT1A 4GMHA 4BLVA 4YCLA 1GVHA 2V55B 2M2IA 3S2FA 1P4JA 1SVIA 1U2GA 3HJGA 5BNWA 3ONDA 2OCBA 5EEHA 2P2LA 4YJ3B 1O77A 3CLSC 3GVIA 4KNWA 4FGZA 3FCOA 4HOYA 5E6SA 2ZBGA 4D9HA 1JG2A 1HOXA 3WX0A 4IGFA 1QOPB 3EA0A 1X9HA 3RW9A 5A1JA 4PLPA 3K2BA 2P40A 4ZOEA 3OWHA 4RV9A 3O8BA 5G02A 3ST7A 3ZR4B 3ZOZA 4E2ZA 3JRXA 4KWTA 2RIPA 5AIBA 2D7DA 3VR3D 1ND5A 2OZPA 2X5KO 2RKWA 4BU1A 3NHSA 5M34A 1TZKA 2P62A 4WZAE 1CDZA 2HA3A 2IXFA 3G8CA 1MA3A 3K09C 2EBWA 4BV3A 3JQ7A 2CJFA 4TXJA 4DLVA 2C5GA 2OV6A 2NZJA 1O94A 4TRMA 1GG9A 1QIFA 3PF8A 2FN3A 1E3TA 2A88A 2AD5A 2G1JA 2P1ZA 3AJ8A 3NTVA 4UU7A 4JL6A 4C6RA 1XZLA 3WSVA 1UDCA 5HTOA 4I4TB 4EF5A 4HWGA 1JGTA 4DPLA 2I6GA 2R66A 3FX2A 4HDQB 5BVGA 5EVJA 1E1QD 1RW4A 2WF8A 1L5ZA 1UADA 3T61A 2PVCA 2QZPA 3CWZA 5DX1A 1FSGA 3RFCA 3UENA 3VC2A 1NYRA 3R44A 2G7MC 2PG3A 1EFDN 2BRUC 4OQFA 4CF6A 5BV7A 1SQFA 3LK6A 1C8KA 4F2PA 3FGNA 4XSHA 2YIVX 3OZIA 3CEHA 1MW8X 3I34X 2F43B 4HYYA 4ENVA 1M1UA 1MO4A 1M2NA 4I2NA 2VZLA 1KO4A 1PZFA 1E0KA 4HZUB 4HS9A 2D1SA 3BB1A 3O1IC 3GNTA 4R0MA 1VPWA 2F1HA 1UJBA 1UQRA 1ZXBA 5FEMA 5L3ZA 3SMQA 2HQRA 1WIWA 4EEXA 4ES6A 5KYWB 5IJAA 5T8KC 3ZDXB 2BJHA 1XTIA 1N6KA 4MMXB 4BJ3A 4PONA 3EGDB 4IDNA 1WDMA 5NLLA 1LKZA 1SC1A 2ZYAA 1VL1A 3GEBA 5HS4A 5CR9A 3KUCA 5JVDF 1P1KA 3AGPA 1BD3A 1RQXA 1GXSA 1QO9A 2CNNA 2Z1NA 3HYRA 1RCTE 3LLSA 4V0QA 1MG5A 3VU9A 4ASUD 1JFTA 4JUAA 1SU6A 1A5TA 3K1JA 4RW0A 3COPA 2R3SA 1BVRA 5AESA 1JHYA 2CYCA 1F4LA 4ACAA 3LQKA 1NSFA 2V74B 1TT7A 1JHVA 1D07A 3EC1A 2JLBA 5AJUA 4ZEXA 4CKBA 2NV6A 4QOJA 4PZZA 3JWIA 3H3JA 3IA2A 3GJ4A 3ILSA 2CVHA 4PQFA 3TQRA 4HFRA 4E14A 3MRTA 1M10A 3QMWA 1ZHHA 1IDOA 2QDXA 2I3DA 4TLCA 1Q84A 1A1SA 1QNLA 1IPEA 2HT6A 5KYGA 1XZPA 5KQPA 2GN6A 3KUXA 2FEPA 4B76A 2WAOA 3Q7EA 4B3XA 2OVFA 4JJEA 4TXNA 2IU6A 4YUZA 1GILA 1VIMA 2DT8A 2OSVA 3QA9A 3VYSB 4CNBA 5LMZA 4WK4B 2C2KA 4E5YA 2KYRA 3SIPA 3T9BA 1QPGA 3V4SA 1NRXA 1CUGA 2BM0A 2HHJA 3JU3A 5JS8A 1H2FA 2BFOA 3MIZA 4OSOA 3U7FB 3N59A 1T91A 1YFKA 5JLJA 3PA8A 3TPCA 7AT1A 5AVZA 4XM0A 4J0IA 5ECWA 3LP5A 3NBMA 4GX2A 3TXAA 1DQPA 2I6UA 4KIFA 1W0KA 1TO1E 1W76A 2I6SA 3OP1A 4R40A 2P6OA 2OGZA 4JA0A 2IXBA 3OZSA 5BOSA 2WP0A 3DFUA 3FCXA 3OIDA 2V3CC 1N3IA 4GPAA 1G7RA 3IKTA 1LW7A 4C2TA 2ZS7A 3HGTA 1XPJA 1KQOA 4UXHA 5AP9A 2AE2A 2BKUA 3L40A 4F3YA 4CLDA 2DWUA 4CEHB 3HKDB 5EJ6A 2FRXA 2FZ4A 1X7XB 2ZVDA 3F3YA 4KGDA 4DIOA 2VK4A 3A3KA 1I1OA 3TZBA 2C96A 2P0AA 2XUOA 4RK6A 2HQOA 4MQEB 3F5DA 3VJLA 2ZPTX 4WASA 1MTZA 2CV1A 2C9ZA 3SQXA 1BXGB 3GEGA 4RK5A 1UMDA 3TBFA 5JV5A 1WLYA 2VJMB 2YJ4A 1T9HA 5D5HA 5TMBA 5JH7F 1AQJA 3KU4A 3RBXA 2O8EB 1GSAA 3TZEA 2B2CA 3R3WA 2HZ7A 3ADOA 3CXUA 4B2LA 1KY2A 4BGVA 2GZ3A 4B44A 4OCZA 1CQWA 1NFRA 5C8YF 4PRYA 1LPBB 1N7HA 3D3JA 5AK0A 3VA7A 1U2PA 2FUEA 1T4GA 3K6SA 3IDSA 4KNYA 3AHGA 4AJ1A 4Z7OB 1KZGB 1FBNA 1NF8A 2QM8A 3CHYA 3CO5A 4S1TA 2GCPA 3LQ1A 2NP6A 3GMTA 2W2OA 4QLAA 3FUTA 4N65A 1IWOA 5JRJA 1LDGA 3QE4A 2CDBA 4FHZA 3TIVA 3DTVB 5F35A 3PGKA 3MCAA 4ARZA 3AL2A 2B7CA 1ILWA 3IXQA 4LHXA 2QL6A 4O4HB 1W36C 1R6BX 4J0QA 3BHMA 4A9AA 3EPLA 2CB0A 2IPOA 3H5NA 3WGQA 2YICA 2QPOA 3KR2A 1YL6A 3CGGA 1E77A 3M5CA 2N46A 3L0SA 4HEQA 2DSNA 4OJKA 3UWSA 3TSWA 5H81A 2FHPA 2NZYA 3DMYA 4TL7A 3TW6A 3WJ2A 2Y0CA 4YY3B 1E1RA 1IIRA 1T1SA 1ADYA 3RD5A 2ZYHA 1I3LA 3G23A 2M98A 1QTRA 1QG2A 1F12A 1TVKB 2J32A 4LI3X 5FO0A 2NOAA 5TT0A 4YMUA 1RR6A 2IJGX 2VNJA 5AUNB 5FKJA 4FFWA 4YCCA 1ADGA 2ACEA 2CLSA 3RRXA 2I8AA 4B4DA 1R6TA 5I9IA 1MP0A 2O5CA 1EGQA 3PU6A 1A4XA 1CD5A 1GTJ1 2H85A 1HNNA 3SBDA 3M6XA 2TMGA 3SIWA 5BOVA 1RRGA 4JLKA 3WICA 1AB6A 2J3LA 2G80A 1V1RA 3PUJA 2ATVA 1Z0DA 4LXYA 4MWSA 4PY2A 5TQ2A 4I3GA 5HJ7A 5KNBH 5JJKA 1Z26A 4HGQA 5EIBD 3VVCA 2C9MA 1NATA 5JROA 2OEPA 1PJQA 3AMVA 3H84A 2RJNA 3Q5EA 5IBPA 3ZE7A 4H15A 4RFLA 3MPUA 3QYPA 1I2CA 3UIEA 5CXUA 2O7SA 2O5RA 1G0OA 2BR5A 1A5SB 2KLBA 4PZPA 4PLWA 5AI6A 4QYXA 4CTOA 1JL3A 4I14A 5EMKA 4DRXB 4XJSA 3WJAA 1LBTA 4YXWA 4WLFA 3ZWNA 5EQJB 2Q9UA 1RRFA 1Z4PX 3OMXA 3EGCA 4QEZA 4KQXA 1FUKA 4AJEA 4N7BA 5CLHA 1CY1A 2NUPB 1SBZA 3UN1A 5AK4A 3ZCVA 3WDMA 4EELA 2LCIA 5EJGA 2R85A 3I01A 2WWRA 1AUQA 3HJNA 1AZWA 2JZCA 3MXOA 2HWYA 1W9HA 2GR9A 1CQJA 4GQIA 4E1AA 4N8SA 4HPJB 3LPMA 221PA 3NUQA 4PLZA 4QXOA 2IH2A 5ELXA 2LW7A 2OENG 1FDVA 3AM5A 3BBLA 3HV2A 4H3VA 1A50B 2J46A 3TVYA 1W9MA 4H77A 3ZQUA 4WXPA 1M1YE 1JJ7A 3CQ9A 2QSZA 2PWYA 3LPLA 3OT1A 4O4LB 2VJKA 3GJQA 4N48A 1TA0A 1K75A 2LUOA 4JSRA 4JVMA 3KOUA 1VJGA 1J8FA 3E81A 3WO1A 4BZZA 4WNAA 1V11B 3F7OA 4RVNA 4ZEOA 3MN1A 3L7NA 4OF4A 2Q6LA 2QENA 3OLXA 1S3FA 2ECKA 2FZVA 3R0VA 4LHEA 5HS6A 3SBOA 5LQUA 5DCUA 5KKNB 4X1KB 1DCMA 4X6UA 2WUGA 5CA0A 2OCKA 4R41A 3TK1A 3HCPA 4OHVA 1PQ4A 5T4FA 2XVZA 3W3ZB 1J2RA 2HJVA 4D41A 4EGQA 3A2KA 1L7PA 3HC7A 1XZCA 4U39A 1I6KA 4XR9A 4C5AA 5K8UA 3EY9A 2FUKA 3SHVA 2DPMA 3JYLA 4N0QA 4UHCA 4JY7A 4X63A 3GOQA 1S96A 2ZU0C 3TLJA 1KOGA 1HQDA 2OM2A 4YRCA 4AJ2A 2YY6A 1V1MB 3GCXA 4GKKB 2CXSA 2VKQA 4Y6SA 2WJVA 4N5DA 2Y77A 3ND5A 1BMQA 1ADFA 3EXEB 1BQ3A 4TVOA 5FYQA 3RF7A 3TGLA 1RE1A 1HL7A 1I30A 1M34A 1L7MA 1SPXA 4DWWA 2E21A 4F3RA 1DI0A 2FSIA 4V1CB 4IGEA 5I9SA 1KDPA 1XTQA 2JIQA 4PN3A 4DCSA 3I2YX 4Q1AA 3DPSA 4OK6A 3ANLA 4TV8A 1J33A 2J6BA 1FC0A 2IUUA 3NAGA 1XNQB 3DTNA 1Z4QA 2B82A 3BX1A 5F64A 4EY7A 1CERA 2ZIAA 1A5ZA 1E62A 2YIJA 3LOQA 4LE0A 1D2MA 1E3IA 4LRUA 4FS8A 1CEQA 4IDPA 4OKNA 4WSOA 4DYVA 3V8NA 1A9XA 5BMOA 4DE5A 2YC4C 5K0JA 1YR8A 1C3LA 1ZAKA 3KXDA 4EATA 2VK8A 1JQDA 2HSZA 1ZU5A 2WTEA 2MJLA 4YQFA 3UGKA 4A2CA 2ZJ4A 2YIMA 4NV3A 2DJIA 1MV8A 3R6TA 4TS9A 5AKGA 4WMLA 5BWBA 5CX1A 2CXUA 4OB8A 5HJEA 2YJ3A 2ZJ5A 2HIGA 4KBGA 3WADA 5I7UA 3AR5A 4G0MA 4QAJA 4QU5A 5B5SA 2CZGA 2QX7A 3EXHC 1Y7TA 2VDVE 3QE2A 3PQCA 2OBBA 2YXLA 3HR7A 3E05A 3ELUA 2O6LA 4CDRA 3KV1A 4QUIA 4TL6A 1SXJA 4RL6A 3QENA 4TVBA 3B12A 3PUYA 4UOQA 3W9UA 2JLZA 2XCOA 1H8EA 2ZUUA 2E1RA 1YKSA 3M9WA 5C31A 4F2HA 1M2KA 2H06A 3UATA 1BRTA 1HG1A 3DL4A 3DKIA 1MJNA 2QGFA 4RTQA 3IPLA 2QT1A 2QLLA 2K7FA 4Z9BA 3F5SA 3V1MA 3HCAA 1XA0A 3G68A 4N3GA 5FOSA 3A4VA 1ACLA 3AF2A 1MKYA 2AN9A 1YFJA 1E59A 1P2FA 3D8SA 4Z4HA 4YRNA 3WRWA 5H4GA 2ZIVB 3GJXC 4DMCA 2G70A 1L5SA 3L8HA 4QSHA 2YX1A 4QZVA 2QIPA 1LS6A 1VJCA 2AMVA 3LXMA 5EWJA 2E4ZA 1I51A 1F2VA 1LLQA 1W75A 1CDEA 3KSUA 6Q21A 4KQ1A 1VM6A 1NR7A 3U7QA 3CB4A 3LQ4A 1N6RA 2DWCA 3IP9A 5BURA 4E3WA 1FDRA 2AG6A 2IX9A 2FZCA 5B2FA 5LWQA 5A04A 1UPBA 1AKVA 1EYZA 2CUKA 2H8KA 2X2OA 5EIHA 1S6YA 4RPHA 3TCXB 2FSVA 2HDHA 1EGVB 1V5WA 5IN4A 2LV8A 2RC5A 4QUKA 4WW0A 4FIZA 3TTSA 5DPMA 3P45A 1GD1O 4YMLA 3LUDA 1XZBA 1YZHA 2O5VA 2QAJA 4KLAA 5JI2E 5JANA 2BEWB 2QYHA 3IAHA 5IYZA 4DDTA 1LI5A 1RMYA 1YE8A 3ETCA 3LAWA 4J1TC 2GBFA 4QYIB 4RQUA 3WGZA 2CL5A 2HLHA 3P9CA 4TV9F 4QO8A 1UIMA 2ZRNA 4O59O 4BBPA 1W36B 4S0ZA 3BK2A 2PAFA 4BB6A 3EIOA 3K32A 3ZVMA 1RQLA 2JEOA 2HH9A 4GD3Q 2BKAA 2J9FB 1ZN9A 4FHGA 2GNAA 2BFCA 1UDAA 3S1AA 4EK9A 2ODTX 2M1XA 4IIFA 4PYLA 4TZTA 4H4EA 2VJOA 1N32B 1G59A 3KQUA 3ZLBA 3TNDA 3PNVA 2YXDA 5DM1A 4P7GA 2ZYSA 4GI3A 2YWRA 1CVRA 3K96A 4HQNA 3EIHA 4FILA 4IVPA 5C5IA 5KPDA 4FGUA 1BXRB 1EP2B 2O8VA 1DZ3A 1YDHA 4ZHQA 2ID7A 1PWHA 2GILA 3DWGA 4IFEA 3RGGA 1XYYA 4C4AA 3NNDA 4DOMA 2P6RA 1R3UA 3U0VA 1II9A 1VBMA 3R5JA 3S2GA 4A0SA 3N2GA 4EG3A 3A6LA 1PF7E 1FEZA 3K0AA 4IDOA 1P7VA 3WLIA 5JASA 1PZGA 1JFSA 1F8UA 1KL7A 3FAZA 4CPDA 1H22A 1CCWA 1LF0A 2HCTA 3DEZA 3FPJA 4MKZA 1UDXA 4HAXA 1ZDMA 4DZTA 2CJYA 4EJMA 1FIUA 3L84A 1NN3A 3TNLA 3JX9A 1IZ8A 3D3WB 1XMXA 1GFZA 1BRMA 4Z7QB 4WZAA 1F7UA 1WCXA 3QXSA 1GQSA 1U4NA 3OMWA 4QVKA 2EJBA 3RYFA 4E30A 4JFAA 2YFQA 5G4KA 2EDAA 2WG1A 2JFUA 1C8VB 1IN1A 1E60A 1CDOA 2ZSAA 3K8QA 1YZUA 2HOQA 1XGKA 2J59A 3MPOA 3HA7A 3VZDA 2YYYA 3WS7A 5EC8A 1YGPA 1USVA 4M46A 4ARBA 3A1DA 4HNVA 5KVCA 5LJIA 5G3YA 3A0UA 3JATA 3V48A 1ESEA 3DTTA 3Q2OA 2V6MA 4FFDA 3GFVA 4QFDA 4R9RA 1YI1A 3KE9A 2YWEA 3LBYA 3LKVA 5EWLB 5JS2A 1O54A 5KJEA 2YY7A 3WLPA 4BWFB 3EQ7A 4TVKA 1QHYA 1D0SA 1WHSB 1V2HE 2DQZA 4LK3A 4YRSA 3AM1A 2VNSA 1LBSA 2XA1A 1L5WA 2X9GA 1X9GA 1LA2A 1GT91 4XDZA 3R7BA 3ROXA 1P0QA 1VYHA 3WGGA 5LMNB 2AKEA 2HU7A 3VAZA 2ATCA 1C14A 3B9BA 4WX2B 1GUFA 4TOIA 4HMQA 4DANA 1I7PA 4M1WA 2ZJ1A 4EMUA 1XHFA 3WRYC 1U7ZA 2J3KA 3AJ9A 4E5UA 4D1YA 1XMOB 1X1QA 1KOLA 1IH8A 3S2SA 4IIVA 3GP5A 1FLDA 4YTEA 5C4GB 1ST3A 3EISA 3IIIA 4JT9A 1MQ9A 4KX3A 5FNVA 3MAJA 1UZNA 5IPFA 3BZUA 2EF1A 4ZVPA 2GKOA 4UVGA 3J7AC 5FWYA 1OFVA 3JQAD 3H4VA 3M7IA 1ZD8A 1YVDA 3CZPA 3H2ZA 3VHXA 3NHRA 1YC5A 2OCLA 1O6CA 1N0WA 1QIJA 1ZOSA 2FSUA 2PGLA 2HN9A 3ED1A 5ECDA 3TTWA 2FSSA 1XK7A 3W2EA 2V6BA 2HXSA 2VWQA 1IFXA 1VKHA 4Z3DA 4Y2TA 3TZHA 4B6GA 4BKRA 3N28A 4RO0A 1C1XB 1KKMA 1ZVKA 4IVRA 1QOQB 4YACA 1Z4LA 1RWBA 1V16A 3C3JA 1KZ1A 1JT9A 2CNWD 3C4JA 3IBGA 4ZIRA 4LXHA 2PGJA 4HH1A 2FR8A 4MULA 1EXVA 1UKBA 2P6MA 1B76A 2PH7A 2JGNA 3ZHBA 4CLRB 4WACA 2VF2A 4GMDA 4K6MA 2IZZA 2QU8A 4MAFA 4LCBA 3MS4A 3M1LA 5JFTA 1EA7A 3VPHA 1GYQA 2QVCA 1Y3CE 2IFTA 4XZ3A 1NULA 3VC1A 4D9KA 5I8PA 4B9AA 3L5OA 5AQ1A 2W2LA 2Q0HA 1QRAA 1RYZA 3T1NA 1XTRA 1FJGB 4EZIA 2O19A 1PE0A 4W1SA 4QOSA 1IPHA 2J7PD 2XUPA 2HRCA 3SWWA 1Q14A 1NUHA 1ZI9A 3FBWA 3TRHA 2GDJA 2RIRA 2XDAA 1KKLA 2CBZA 3CR3C 3DKKA 4RIEA 1WEKA 3ZH9B 1O95D 4ZO8A 2I71A 3L7OA 1N9KA 1PJ3A 1Y6ZA 4IHAA 4ZJPA 3D7NA 4JENA 3KQQA 4C7VA 2ZBRA 1RM3A 4N5NA 3GLFB 1DOHA 2AJLI 3GRYA 4OYLA 5BMVA 3P9XA 1VGQA 5AVWA 3WVNA 1ESMA 2BDUA 4B75A 1CFJA 3AEQA 3PQ8A 2VP9A 3EXHB 1JR2A 2EWWA 1T15A 2YL2A 1PT8A 4DV3B 4IBOA 1GRVA 2GK7A 1XX6A 2ZAIA 3I76A 3LWZA 1NP6A 1E1NA 4OL9A 5EIFA 4LNUB 3RREA 3TIXB 4AUNA 1FMTA 2IYFA 4IIUA 2GN4A 4RY9A 2IS6A 4B74A 3EZYA 1FRZA 3ER9A 4JSTA 3QEKA 4LZZA 1ZEMA 4GZLA 4TZ6A 4DQVA 1POXA 3QH4A 5IUKC 1IOVA 3R9KA 4RA9A 4F71A 1IZ9A 2L82A 3R74A 1Y6GA 4JJ7A 4KMOA 1LB1B 1DT5A 2VYVD 4PAOA 5CB0A 3K3PA 4PQEA 1IJEA 3GDFA 1T0BA 4OHOA 3OEHD 4GOND 2OOKA 3NIGB 5I4KA 5KQRA 3KKPA 4WOPA 3JQ8A 1EAYA 2C20A 4U7DA 4PTYA 5ITWA 2HGZA 3OZXA 4YAUA 5I5EA 4D4KA 4NEHB 4UTZA 2GPAA 3DMHA 3GXBA 5FTMA 3WGMA 1UPXA 2HRDA 3TX6A 1A4RA 1JDTA 5HHTA 3I72A 4US1R 3BMXA 2XQJA 2YH2A 4KWHA 4YALA 1WCYA 1YBFA 5AJTA 3U4GA 2VXBA 3T7AA 2BFPA 4D4LA 2RGCA 4RHCA 1LV7A 1JYFA 1QKIA 1SQGA 1L5MA 2H4HA 3A1SA 3JYQA 3PXAA 4K9DA 1AXEA 1I7SB 4NH0A 4WZBE 3DAHA 2IZ7A 3DR3A 2C82A 4D8TA 1PLLA 1WB4A 3KJGA 2RAUA 3HEAA 5AVXA 4HRVA 3LO8A 5HILA 5TXGA 5LD2C 4HFMA 3PFGA 4JELA 4HNSA 5K8LA 2C1ZA 1T9DA 4HBGA 4DLYA 4KZPA 1KBZA 3GEMA 3OPYI 4LYAA 2AOTA 3DW1X 3SQMA 5JJBA 5KBYA 4O2BB 4H2DA 3LYLA 3HG7A 4R7TA 1D0VA 4JI4B 1HDZA 1W581 3VNAA 2V7XA 1GTVA 2XTNA 4XQGA 1SIOA 4R2LA 4AWAA 4MZXA 3PNBA 1DBPA 2QI9C 5AJVB 1VDMA 5BSEA 3HWWA 5K01A 4LW8A 1YULA 4FLFA 1AGXA 2P9GA 4MEBA 1TGYA 2A0WA 3IIMA 4IQGA 2OBNA 2G72A 2G7ZA 2H5LA 1P80A 1ORIA 5IKEA 3ZQKA 1S0UA 5CD9A 3IJEB 1PFQA 3OQBA 4IIGA 1JNXX 5CDGA 5CNMA 3ZWPA 3K4HA 3K4PA 4BLSA 4O0LA 3C16C 5JPCA 1JE1A 1YR6A 2B1GA 1JA1A 3A7EA 3N07A 1EPUA 2DH6A 1RWNA 3GD7A 1M67A 1U2TA 2GQ0A 3F96A 4WADA 3X1DA 1VLHA 4Q15A 5AFSA 3U6KA 5IT9A 3M3DA 2CXXA 3ILHA 2Y1CA 4XVHA 3C8DA 5FIUA 4F3TA 3D4PA 4B3BA 1RKXA 1X92A 3B6KA 2QZJA 1GPWB 5TT1A 1WXXA 1G2QA 4MHSA 2A57A 2IYNA 1NR5A 4BWGA 1KY5A 2WYHA 5ITVA 4L72A 3DKPA 2FPGB 4PZ9A 4PR3A 1DAKA 1PLKA 2X5XA 3L2OB 1L5VA 4N7JA 3DMTA 5D3QA 1AQYA 2AF4C 3LSTA 2OYCA 3PLNA 4ZARA 1C30B 2QV0A 2H2HA 3EHDA 4KO2S 4AS1A 1M1YA 2WVHA 3BORA 2P9CA 1V43A 4RGVA 1P61B 2J9GA 3PFCA 5FWXA 3ZXSA 5LXTA 1USUA 2B61A 3PX7A 3G85A 5F7JA 2II6A 1R8SA 2D1FA 3UUGA 5LDHA 1IY8A 4BNLA 3EG9B 1GGVA 4ZZ1A 3ILXA 1MH1A 4BZXA 2QP4A 1YFZA 3E7DA 1AO3A 4BMYA 2JI7A 4UOZA 4C0SA 4QJIA 3M1AA 5K0TA 3LC0A 2GZAA 2XIQA 4ND8B 3K9QO 5EIEA 3RU3A 3A06A 3ER6A 1UM8A 4A0HA 4CG2A 4DCTA 1W8DA 2AWOA 5IDYA 4WBNF 4DC1A 1M2HA 3PHLA 4NC9A 3CRW1 3IEUA 5C3UA 3QTBA 2J0VA 2Z98A 3OQJA 2IY9A 4PBSA 3D6NB 3PXGA 1TLTA 1C9JA 3A1WA 4Z5XA 4Q3BA 3FPKA 1DXYA 3FNHA 3HYCA 4POOA 3CVWA 4MINA 4XB1A 1XOIA 1BSVA 2P2SA 1IZ0A 4FXOA 3I9JA 3WWZA 3UG6A 1NF2A 2QPTA 1GAXA 3DZHA 4YAGA 1X1TA 2VUSA 4NZYA 4N41A 4GL2A 1T5BA 1GEGA 2R1ZA 3HDTA 3HJTA 5COAA 3REFA 5HUQA 1JEQA 2XB8A 2PU5A 4P93A 2YFYA 1AC5A 4PC6A 1YMVA 5AUOB 1T1IA 1IIBA 1ARZA 1IZZA 1YK1A 1U4OA 4UUOA 3LI2A 5F51A 3W34A 3VJKA 1YWGO 5JEEA 1ZVJA 3NC1C 4L7VA 1Z16A 1HE2A 3KVRA 3R4VA 2BGLA 3NYIA 5TX7A 4ERXA 2X2FA 4JGBA 3FF4A 2AQ8A 1ZK4A 3HFGA 2EERA 2V8OA 1OJ7A 1K97A 5CVEA 2MYNA 2Z4TA 2GGSA 3DW3X 5EKDA 4YPOA 3WZLA 3LGAA 4RY2A 1XXHA 1QHXA 3R5SA 1WKVA 3U1VA 9LDTA 2X86A 3FF1A 1AGRA 4IINA 1LNQA 1Y48E 3EOBI 4LF5B 3I0ZA 3N3AC 1V8BA 1BNCA 1W5BA 3QY0A 3TIIA 4AS3A 4F86A 4AXXA 2O3RA 1J97A 1NSTA 4UCFA 5IAJA 3EK2A 4AO8A 4BMSA 4MAAA 5L4SA 1Z29A 3JALB 1QVRA 2J09A 1AUOA 2QM0A 2XRZA 3BD6A 2WUDA 4LDZA 5GM2A 1JH8A 2HPZA 4TRJA 3BJEA 5FEUA 1UC9A 2JFWA 5H1YA 4TSFA 3ZXIA 2HJ9A 1EGAA 3RHSA 4YMTA 4ZDJA 4NYMQ 4L28A 1DVRA 3GGSA 4MRMA 2W6ZA 4RE6A 4UHKA 3M3PA 1K4MA 1U7OA 4IJ5A 1Q6YA 4IOMA 1T1GA 4P5PA 4Y6PA 2Q21A 2AMLA 2PBFA 3B1VA 3FOEC 5LBTA 1D2RA 4GBMA 2GCEA 5K20A 1DEXA 1RBQA 3BTUA 1CUYA 4KLZA 3KTFA 4RHYA 5ANRB 3RJ9A 4E94A 4ZCRA 3WYCA 4EKGA 5BSVA 1JR3A 1P73A 4G5SA 4TUYF 4XB6B 1GPMA 3R6LA 3MIIA 1SPBS 4HL6A 3V2HA 3DDHA 2JDIA 3DZCA 5CXSA 3OBBA 1I2DA 2E4AA 4KQCA 4AQYB 4K6HA 5FUVA 5BW5A 6CHYA 1PJBA 5M7EA 1CR1A 2I67A 3GELA 2IHBA 2QTRA 4IS2A 2KX7A 1J0AA 4RGYA 3M6LA 3UJPA 4DMHA 4DILA 2Q1TA 3FVTA 1NBOA 4IR7A 2Y4OA 3KPJA 4CM6A 2W6MA 2R25B 3ROEA 1J5XA 5K0NA 2VA9A 1E6WA 4CMIA 3FRIA 4HR7A 3OVMA 1AXGA 1C3OB 4NJOA 3L4SO 3B20A 3F6YA 1GITA 1V7CA 2ZLBA 4WLOA 4B71A 1K7FB 1NBWB 4M21A 3VXKA 1VL8A 1SELA 2Q6OA 1L5HA 4EX6A 4N8DA 4DJFC 1WL8A 1T2NA 5DNUA 2Z30A 1LY1A 4Z8YA 4DJJA 1RS0A 2JHFA 4UD6A 5LD2B 3W3AH 4CL3A 2PUFA 1P6QA 1RYBA 4PNPA 3LGSA 5DSTA 3F0TA 3PT5A 4P58A 4JOQA 6PFKA 1J5EB 3WGLA 2FQWA 1WEHA 4N7RA 4IFIA 4L6CA 2ECPA 1XAGA 1EXNA 1XQWA 4GE0A 4QDJA 3MTAA 2YC2C 1O4WA 2P8SA 1CUSA 1GTG1 1CUXA 1IN7A 1M7BA 1VIVA 2C29D 4LC1A 5I48A 3K70D 1R0BA 1RMQA 3KR9A 1FU8A 2NSYA 4JEUA 1QO7A 4BVAA 4ZDIA 1B8PA 3R09A 1W48A 3OH8A 1RXUA 2PXHA 1RPNA 3HYTA 5ULLA 3TL6A 1SKYE 4BNNA 4ZAWA 4DJTA 2FVYA 2JH9A 1QQ7A 2WHPA 2R8XA 4LJ5A 3DBHA 5E38A 1ZUNA 5IFKA 1DUSA 1X87A 3KG2A 1RRKA 2YW2A 3ANXA 2FCRA 3MTIA 4JBIA 1EJ0A 2J8ZA 5DIFA 3S44A 3ZGYA 4YJGB 2FPPA 1ZHOA 3HCRA 2WNHA 1LWOA 3INTA 3VZPA 4BE9A 2C9OA 5LBUA 4Q02A 3HBMA 2CDAA 4Y0NA 2EW8A 1ID8A 3PJRA 2DHCA 2KM1A 3A1UA 5JISA 5IN5A 3VVMA 3CX7A 3T5TA 3N7TA 4UUMA 5K3OA 1QAOA 3ZWMA 3BZWA 3K2IA 5DGCA 3EW9A 1O0BA 1D8TA 3QM1A 1QO0A 5EN4A 3GPBA 5AKYA 3ZGLA 5AM4A 1CUJA 4EJSC 2Z2ZA 1EDEA 2CL0X 3DLTA 3WRVA 3LPDA 1DHRA 1IUNA 2QTZA 2YWFA 3PFIA 2Q3LA 1U2QA 2VP4A 5DZSA 1QYIA 3W5JA 4EMSA 5BN3B