5JSFA

Crystal structure of 17beta-hydroxysteroid dehydrogenase 14 s205 variant in complex with nad.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
268
structure length
268
Chain Sequence
GTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRASIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New Insights into Human 17 beta-Hydroxysteroid Dehydrogenase Type 14: First Crystal Structures in Complex with a Steroidal Ligand and with a Potent Nonsteroidal Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 17-beta-hydroxysteroid dehydrogenase 14
total genus 92
structure length 268
sequence length 268
ec nomenclature ec 1.1.1.-:
pdb deposition date 2016-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jsfA00
3ZCXA 3BXXA 1QKIA 2BRUA 2HMTA 1XG5A 3ANLA 5B1YA 2CY0A 4Q9NA 2CFCA 1ZK2A 1B8VA 3FWZA 1Z7BA 4BO2A 3HDJA 1I2CA 1OC2A 3OMLA 4GVXA 3F47A 5DNAA 1E7SA 4INAA 1EE9A 3RUHA 3WIDA 3AOEA 4IS2A 1XQ6A 1I2ZA 1DEHA 2B5WA 3DFUA 5HS6A 1Q7BA 4II3A 1Y81A 3GZNA 5JCJD 2VHVA 3K73O 4QO7A 3RFXA 3ZNNA 4GH5A 2NSDA 2CDAA 3H65A 2P5YA 2NLOA 2IODA 1Q2XA 1H6AA 1U5AA 1VPDA 3L6OO 3P5SA 3I9NA 1NWCA 1LLDA 1W0CA 3PDUA 4J6FA 4YQYA 4YAKA 4ZGWA 2EERA 4LSMA 1VRWA 4IMRA 4BKOA 3WGZA 4B7UA 3RUEA 4ZN6A 4U7WA 5JFOA 3DMTA 1LSSA 1SEPA 3ST7A 3WTCA 3KBOA 1D1SA 1NASA 1KEUA 4R51A 3CZRA 2OP1A 4WASA 1BG6A 3CXRA 5EMHA 2B35A 2HCTA 1EBFA 2UVDA 5U9CA 3HFGA 2XOXA 3V2HA 1WDMA 3EZYA 1VLLA 3M1AA 4HFJA 4RVHA 3GGPA 3W8DA 3S2EA 2POQX 3VPFA 2WE7A 1Q1NA 3L07A 2ZIZA 3DMTC 2Q2QA 4P4NA 5AXAA 1NFFA 1PJBA 2O3JA 3ITDA 4OQZA 3QWAA 3PIIA 2J3KA 5KWEA 1ADBA 1OAAA 1U2GA 4E21A 2I99A 2VZ0A 3OBBA 1LI4A 5BSFA 2GUGA 2I3GA 1UXJA 1KVRA 1QV6A 4I5DA 5G4KB 2Z1MA 3PDJA 1HSZA 3M1LA 4DQVA 4Q3BA 4ZHSA 2V6MA 3UUWA 1HRDA 4LCJA 1ENOA 5TS3A 1YRLA 1RM4A 2BGKA 2V6GA 5JDCC 4K1LA 3WGOA 1I8TA 4K28A 3WGQA 1VKNA 3P2YA 3S8MA 1H0KA 1E3JA 5TF4A 1I36A 4BS9A 4CR8A 2HLPA 3RUIA 1U7TA 3NYWA 1P1KA 3D5QA 2CDCA 2G0TA 2Y1EA 3JYQA 3OJOA 2DBZA 2D4AA 2EF1A 2ZB3A 3DZFA 1C1XB 9LDTA 4NBTA 4C7KA 3I6IA 4FN4A 4IDBA 3SXPA 2CZCA 1PTJA 2BI7A 3P19A 4GVLA 5L4LA 1NQ5A 4O5OA 4E6PA 2NVUA 3O9ZA 3IC5A 4FJ0A 4E5KA 2EKLA 3VKVA 2EV9A 2DUUA 2X9VA 3GEGA 3OQ6A 1V3TA 3SLKA 2NU6A 2VRCA 4D0RA 1VSVA 5KIAA 3KUXA 5KVCA 1V6AA 1H2HA 1LU9A 2W8ZA 1ZK3A 2BFMA 1EVZA 3DTTA 3DFZA 4CLEA 3UH1A 1L7EA 1X14A 1Z74A 1W73A 3U62A 1ISFA 3MOIA 3VOSA 4PFJA 4WEQA 3DOCA 2VTDA 3HUDA 4FW8A 1UR5A 1CERA 1NPDA 5JNLA 2QYSA 3PLRA 2YDYA 2Q46A 1C14A 5G0VA 2RIRA 2ZB7A 2GERA 2HJRA 3V8BA 5L40A 1NHWA 1QG6A 3ITKA 3PYMA 5DBIA 4J90A 1WDLA 3P7MA 3WS7A 2R00C 4CM9D 4EGFA 4RZIA 4BVAA 4WNCA 3BHIA 2O2SA 1O9BA 1GQYA 3U5TA 1CIVA 1K3TA 5FI5A 5EESA 3RC7A 4CMGA 4G81A 4MPDA 4JBGA 4JCOA 5IDYA 1LQUA 4YYZA 3LLSA 3WWZA 2AG8A 1M6HA 3GQVA 3NT4A 6LDHA 1O0SA 1Y1PA 4O59O 1T1RA 4J2HA 2DLDA 3OA0A 3QWFA 5JAZA 4E5NA 3VVBA 3UN1A 4YJHB 1A7AA 2DTXA 1UJMA 4E2XA 1B0AA 3TQHA 5IZCA 1WMAA 3WSWA 4IM7A 1XCBA 2VUUA 2GF2A 4IINA 1DIGA 4YAEA 2E49A 1A72A 3QWIA 4I1IA 4RPJA 3C1OA 5G4LA 3WYCA 5ILOA 1ISGA 2Y1CA 3STHA 1RKXA 4ILKA 5HM8A 4Y6PA 4ALNA 1IUKA 1OI7A 4JP3A 4W4TA 2NUAA 4GQAA 2I3AA 3MOGA 2SCUA 3ZWCA 4G65A 1U4OA 4RCVA 3G3EA 1ZFNA 3RKRA 1ADCA 2VNSA 2I6TA 2D8AA 2Z1NA 4IJVA 4CV2A 5TT1A 5AOVA 2RHRA 2RBEA 1N2SA 1UXKA 3NT2A 3DEYX 5H81A 4NBVA 5CAEA 3PJDA 2J5KA 1H93A 1BRMA 3E9MA 4W7HA 2YW9A 1LDGA 1GPDG 1MFPA 3DBHA 3F1KA 3B20A 4YACA 2CMDA 4WCFA 5CEEA 2D0IA 3WOHA 1ISMA 4B4VA 3LT2A 4J4BA 2D2IA 2O3SA 2BKAA 5JLAA 4KUHA 1U2DA 4WPGA 2WD8A 1X7GA 3U09A 1LXCA 1F8FA 4TSKA 1B2LA 1VI2A 1YL7A 3RJ5A 1DHRA 3ZHYA 3F4LA 4BMVA 5A03A 3PQDA 4CPDA 3KEOA 1LDEA 1P31A 3AI1A 1MGOA 2Y05A 2Q2VA 4HWKA 2DTDA 2G5CA 2YFHA 2NQTA 1SAYA 4BIIA 3ZWPA 4XYLA 1VJTA 2CDBA 4CL3A 2Y0EA 3CIFA 3GAZA 1EMDA 4NK4A 1GDHA 4PVCA 1LDYA 4PG5A 1Y8QA 5EINA 5L95A 3PHIA 2ZCVA 5JC1A 4IGEA 5T57A 5B37A 3OICA 4R5MA 2ET6A 3U4CA 4G2NA 1JTVA 3CH6A 5L7WA 4GX2A 4D41A 3MCVA 5CDSA 1MLDA 4CUJA 3F5SA 1HE4A 2CVQA 1HDZA 3HNPA 2O23A 4J2OA 3FPCA 4IDFA 2GGSA 3E48A 1EDOA 3WLEA 3QQPA 4DQUA 1HYGA 1CQIA 2P4HX 1O89A 2VOJA 1ZK1A 1IZ0A 3WQQA 1E7YA 2VHXA 4N18A 3MTGA 3PXXA 1XHLA 1F8GA 2HKIA 2OMEA 3NJ8A 1YE3A 3PGJA 4CUZA 2O3UA 4PN3A 2O4UX 2Y0CA 3L4BC 4N7RA 3DBRB 4W7IA 5A9RA 1P45A 1UZMA 1Q0LA 4WJZA 3C8MA 3DO5A 2X6TA 4FR5A 4A26A 4XA8A 2JAHA 2VUTA 3I5MA 2WE8A 1X13A 4BNTA 4IQ0A 4YJGA 4BHTA 1A9ZA 1U3UA 1IB6A 3LLVA 4LISA 4BV9A 2AXQA 3ULKA 5BSGA 3PQEA 1BDBA 2C0CA 4CM9A 1MG0A 2B69A 1NQOA 3AU8A 2VHYA 4NNJA 3VC7A 3OJFA 3I6QA 3GR6A 4BNFA 3PLNA 4XJTA 4DQXA 4Y67A 2DUWA 4E12A 3H5AA 3PYLA 4XQCA 3U4HA 5A5FA 3KEQA 1P1RA 3GMSA 4JIGA 4ND3A 2FZEA 4Q3DA 1CYDA 3UKOA 3GVHA 4GWKA 3ONFA 5JO9A 4DMLA 1M66A 5KKAA 1T2EA 4UVGA 1PL6A 1YO6A 1JAXA 2IEBA 3CMCO 3ONDA 4J16A 2NWQA 5IF3A 3D3EA 4LN1A 5IAAA 2ZJ1A 3JQCA 3VH3A 4IPTA 3GDGA 1BHSA 1NVTA 1E7MA 3SC6A 3IUPA 4OO3A 1MFZA 1D8AA 4XEHA 1YQDA 2EJWA 2ILTA 1KVSA 1PZFA 1WP4A 1K89A 5G0UA 4OOFA 4FS3A 3W4JA 3TOZA 4KDFA 2FN7A 3RROA 3L77A 4NIMA 1NFRA 5KOIA 1O94A 4MVJH 2DFVA 1PS9A 8ADHA 3ADOA 1PIWA 4PIVA 2Y99A 1EE2A 4MKXA 3VPGA 5HRUA 3C1AA 4TVBA 3M6IA 2OO5A 1HXHA 1ULUA 2HK7A 1K2WA 1GYRA 3CMMA 2HK9A 4AICA 3PZRA 2JFHA 1OC4A 2YQ5A 1ZBQA 1XKQA 2UUOA 4CV0A 5BT9A 5KJ6A 4A7PA 5JC8A 3GFGA 2WYUA 4IQGA 4E31A 4CM8B 4Z0HO 1SO8A 1OFGA 3E6AA 3QVTA 5A3VA 3SJ7A 4CM4B 4KTTE 5JCXA 3EY4A 4W6ZA 4LSWA 2DM6A 4L8VA 4IZIA 4P4LA 1TT7A 4L76A 4N5MA 4CQMA 3KRTA 2G17A 4NK5A 4QTZA 3DAGA 1A27A 3OJ0A 2C20A 3VDQA 1NXQA 3JD3A 4XQ9A 4A10A 3DBVO 3EVNA 1NAHA 4WK6A 2CUKA 1X15A 2AW5A 2I5PO 5TX7A 3VZPA 4PZDA 4U0JA 4YTEA 3UFXA 2B4TO 4MDHA 1E3WB 2IE0A 1ZSNA 2P5UA 3INTA 2P9CA 4TKLA 4I9HA 5F1OA 1I3KA 3DOJA 2EP5A 1RM3A 4AJEA 1S7CA 2AEJA 4UEJA 4HP8A 2AMFA 3H2SA 4OQYA 4A0SA 3PWSA 1X0XA 5DBFA 2DU8A 3QP9A 1IPEA 1C0PA 1JU9A 4AJPA 1Y9EA 5HA5A 1ZXLA 1ADFA 4RQUA 2J6IA 4I9UA 2HMUA 4ZD6A 3FN4A 5MGBA 1NM5A 1HLDA 4NHEA 1Y8QB 4QSMA 4Z0TA 3FBTA 5F5LA 1A4IA 2YQ4A 4EUEA 4RJTA 3RUCA 2I9PA 3ZU5A 1NTOA 3SLGA 5KJFA 3CPSA 2W98A 3OIDA 1Z73A 2VT3A 2XF8A 3DZKA 3NRCA 2PR2A 1MA0A 1X7DA 2R6JA 1NNUA 2NV6A 3ZNPA 1FDUA 2BLLA 4MVJP 3QVXA 1C0IA 1H2BA 2O7QA 3QW2A 4OM8A 3WQSB 4CM6A 3WB9A 1MV8A 3W6UA 4WE3A 3I23A 5JYDA 1QYXA 3TZHA 1HTBA 4CLHA 5ER9A 1XLTA 1A5ZA 3O38A 4DLLA 3K9QO 3VPHA 1DRVA 2ZYDA 3HN2A 4BNNA 4CMJA 5K9ZA 4R69A 1SEVA 4OSOA 2ZCUA 3D1LA 1T2FA 1WMBA 4ROSA 1UUFA 2J3JA 4J91A 4Q3EA 1R4MA 1P74A 4QFCA 4E32A 1LJ8A 2G76A 4NU5A 1HETA 4RVSA 2X4GA 3I4FA 3JTMA 1H94A 4R3WA 5AXBA 2IXBA 1I30A 3AUSA 5JAIA 4MIOA 5KJEA 2Y68A 1TB4A 1VL6A 2OUIA 3K5PA 3IL2A 1DRWA 4J1SA 2F1KA 3D64A 2BI8A 3GK3A 5COBA 1UDBA 2VT2A 2BGMA 2PGLA 1PL8A 1YVEI 2VYVA 4ID9A 4ZQEA 1GZ3A 5T5QA 4EITA 4J49A 5T8KC 3RFTA 2AG5A 2HJSA 4DC1A 3EC7A 1PZHA 3GNQA 1K6XA 1JA9A 1ONOA 3GPIA 5THQA 4ZU3A 1J4AA 2IZZA 5IJZA 1ZKMA 5GMOA 1K5HA 5L3ZA 3RUAA 3ZWNA 1YJQA 2FSSA 1FDVA 1JAYA 4R3NA 2Q49A 1EK5A 1XU7A 1LNQA 2VZ9A 2E82A 2VWHA 1ISJA 4KP7A 4EJ0A 5CDUA 1JN0A 3JYPA 3E18A 2I65A 2YYYA 4ZJUA 3HJAA 3MZ0A 3HSKA 1XSEA 5KCZA 4R16A 5ENDA 4D44A 5ER6A 5L51A 1GUZA 4GPD1 3PIDA 3QIVA 2R2GA 1DFIA 4R4JA 4I8XA 2X1HA 2FR8A 3JQ9A 1ONPA 4H3VA 2BELA 3RIHA 3VTFA 2EJVA 3JYNA 1ZMOA 4L0QA 4B4UA 4WCFC 1E7QA 3CZMA 4AJNA 4BO0A 3IP3A 3Q0EA 2Q50A 3EAGA 5IDWA 1T2CA 1LDNA 2O50A 3JQ7B 4IIUA 4PLPA 4FSHA 1PZEA 1RYDA 4LCEA 2WTBA 1EFLA 1GADO 3CUKA 3O26A 4OMUA 3H9EO 1KIFA 4BNYA 3FNEA 1A7KA 3RFVA 1R6DA 1P77A 4FIZA 3F9IA 5A3JA 2PKQO 4L74A 4WUVA 3QA9A 4JN6B 3GVXA 1P1FA 3NDIA 4DPLA 3RUDA 4XGKA 1DSSG 4O0LA 4PGFA 5KKCA 4YA6A 4MKZA 3EGOA 4GX1A 3TOXA 2YHIB 4IJWA 3WGIA 4PZEA 3LZ6A 3QV1A 1U28A 1WNTA 1IHYA 4B4OA 4M8SA 3D4OA 3KOUA 1ORRA 3PP8A 4I9NA 4PG7A 5AQ1A 4MVJI 3L4BA 1HDCA 5B4UA 3DL2A 1ZK4A 1KEVA 1DC6A 3DC2A 5BR7A 3I9MA 1GEEA 3ZNOA 4D3FA 3ORFA 3ASVA 4I5EA 2QZ9A 3R0IA 5COQA 3IJPA 1GV0A 1YBVA 2X0JA 3DXFA 3DMYA 4E33A 5F5NA 4Y9DA 4B8WA 1YB4A 3NV9A 3HN7A 2EHDA 2DAPA 1R0SA 4YDRA 1VE9A 2A94A 2DPGA 1SOVA 4QT0A 4FC7A 3N58A 1N92A 4YRAA 2ZYAA 2NU7A 4XIJA 3FRJA 3MTJA 3OFSA 3H7AA 2JHGA 2WM3A 3AUAA 3LC1O 3FI9A 4R5HA 1DIHA 3VKUA 1QYCA 4Y8VA 1LRLA 3U3XA 1ENPA 1E5LA 4HFRA 1E3EA 4HADA 3U4DA 4HNHA 1Z6ZA 1IL0A 3ETGA 2BF7A 1R15A 3H3JA 3H4VA 1E7RA 4JXKA 3CTMA 1DAPA 1DHTA 3GY0A 3HWRA 4OKIA 1M67A 3G0OA 5ES3A 2E48A 3H9QA 1HYHA 3LQFA 3KB6A 3OQ1A 1UH5A 1E0DA 3KSZO 4KMSA 3T7CA 4AG3A 3D5TA 1HYEA 1I0ZA 3PZBA 4WLVA 3ANNA 4LMRA 4K26A 3ZV4A 2VOEA 4GX5A 2ZB4A 4DLBA 1YOVB 5EQFA 3AOEC 1YQXA 4WLEA 4BNHA 4BO4A 2VCYA 3ZWBA 5C7IO 2BH9A 4M89A 3VHRA 1LQTA 2VRCD 3PQFA 4IDDA 3FNGA 3RASA 2NNLD 3FR8A 3QRWA 4CMEC 1BVUA 1L7DA 4GLLA 1ZIDA 3MJCA 4GI2A 4PLFA 4CLOB 3ROQA 3BMQA 1FXSA 4OSPA 3D4NA 4RF2A 4ZICA 2C54A 3AUTA 3BMOB 5FYDA 3H5NA 4BOYA 5AVOA 4LRTB 1X7HA 4IDGA 4ALJA 2QYTA 3K2EA 1DO8A 2QRKA 4MIYA 1PGOA 3WTBA 2CF6A 1I3MA 5BSHA 3FTNA 4H16A 1AN9A 2FMUA 3E5RA 4ZA2A 1UDAA 2VNAA 4WNIA 2BGLA 5C37A 2B5VA 1QXSA 2D3TA 3JQGA 3AOGA 5FWNA 1KYQA 4PG4A 3GVIA 3JQBA 2PTGA 3TSCA 1LLUA 1P0CA 4BO6A 2W4QA 1CF2O 4YB8A 1N9GB 1OBFO 2QW8A 2X0NA 1H9AA 1Q7CA 1LLCA 3PHGA 1U8XX 1GQ2A 3WDSA 3FR7A 3C85A 1I3NA 3AFNA 5A9SB 5A1TA 3AY6A 1E1NA 1J0XO 4J4HA 4JBHA 1ZZEA 4DPMA 3OF2A 3FD8A 1DBVO 3BMNA 4BNMA 1G0NA 1PL7A 1YBAA 3GAFA 1MG5A 1AXEA 3COSA 3W8FA 2YHUA 3ROKA 4CUKA 1X0VA 2PZLA 3LU1A 3NTQA 1PJ4A 3FNHA 3VDRA 4OXNA 4ZQHA 3G17A 1TEHA 4E0BA 4Z6KA 1UP4A 4MKRA 2P4QA 5ILGA 4XGIA 1YKFA 1DDOA 1WXDA 4WLUA 3F4BA 5I9NA 5IG2A 3ZWOA 4AJHA 1GUFA 1RM5A 1V9LA 3T7EA 3C7DB 3OHSX 1UZLA 2DC1A 4CM1A 3I52A 4DA9A 1HE5A 2CF5A 5DN9A 1SNYA 3TN7A 3UCXA 2PNFA 4CM7A 3KYDA 2HMWA 3JSAA 4XGNA 4BMSA 2G1UA 1E6EA 1EVIA 4EW6A 1UAGA 3DZBA 4RLSA 4RGBA 4EDFA 1HWYA 3GHYA 3PFWO 3ZV6A 3MJVA 3PWKA 1T2DA 4RF3A 5CP8A 4ZRMA 1O5IA 5COAA 1I5RA 4DMMA 1H5QA 4R9SA 3UW3A 3OJLA 2Q1SA 4JX8A 3IMFA 4AJIA 1KVTA 3UCEA 4CMIA 1JKJA 5I7EA 1A9YA 2ZQZA 5CPFA 1SC6A 3NUGA 3JQFA 3ZWWA 5BQFA 5MDHA 1FDSA 4R1TA 5AXCA 5L53A 4P38A 5LCXA 1QLHA 3ASUA 3GRPA 5FFFA 5ICMA 4MOWA 4G5HA 3PHHA 1QSGA 5CG2A 2X86A 5A9TA 5EIOA 4CL8A 5KVQA 3ZW8A 1I32A 2CSUA 1WZEA 1YBMA 3QVWA 1JKIA 4PRLA 1M75A 2ZTMA 4LVUA 3LT4A 5JAMA 4MJLA 4E2ZA 2NVBA 3OQBA 4GMGA 4CJXA 1ADGA 3JQ9C 2DBRA 3PEFA 2DBQA 3CEAA 1BDMA 3ICCA 1PWZA 4NG5A 4YT5A 2BFOA 1KOLA 2HSDA 4GAEA 5B12A 1UDCA 2NADA 5T8KA 1JVSA 2GPTA 2Q1UA 3BMCB 1NQAO 2PD6A 3CKYA 1M76A 3KYCA 1ONNA 3DHEA 3T4XA 4E4YA 3JV7A 3KVOA 4WKGA 5U4QA 1W8DA 3DONA 5A4DA 4HKTA 4FFOA 1U1IA 1AHIA 1VL8A 2GSDA 4LGVA 3BMCA 1GL3A 3GHHA 3R6DA 5EPOA 1Y7TA 4DIBA 3WBFA 4EI2A 2X9NA 1R4MB 3NKLA 1ZO8A 3ZU3A 3TL2A 1V3VA 3WGTA 3RBZA 4AFNA 1QYVA 4EUHA 1YOVA 3JD4A 3VVCA 4YBZA 2P9GA 5JW6A 3GVPA 1GCOA 1GTMA 1H9BA 2FWMX 3GFBA 3QLJA 4MVJG 5I8WA 1V35A 4U6SA 3R3JA 4CLDA 2AQ8A 4IIVA 2EXXA 5T64A 4AJ2A 4CMCA 2AHRA 2PGDA 4Y6RA 4CLRA 3QHAA 1HLPA 3JQBC 4BNJA 4RDIA 4J1NA 4NMHA 4BGEA 2VWPA 2NTVA 2UV8A 1UZNA 3PJEA 2ZB8A 3F5QA 2X0RA 2R00A 1P1JA 1Q0HA 4CMEA 2ZKLA 3Q1LA 2AEFA 3OETA 4R1SA 2DTEA 1JKFA 2GRAA 5C5IA 3TFQA 5JSFA 4JJFA 2Y1GA 1LA2A 4JNKA 4UUPA 2EIHA 2GLXA 3FNFA 1U3VA 1EQUA 2P2SA 1E1LA 3GEMA 2H1SA 4FFNA 1YJ8A 5CDYA 2I66A 4XB2A 3FBGA 5IN4A 1LEHA 1K6IA 2WJPA 1XIVA 2FR0A 4ND5A 4E2YA 9LDBA 5DT9A 4D79A 3E9QA 2DQ4A 3EHEA 1HE2A 5U1PA 1JWAB 2EKPA 4PLTA 1KY5A 3LSYA 2QHXA 2AEMA 1C0LA 3TWOA 3PYXA 3F3SA 2BMAA 3HB5X 2EGHA 1F14A 1GR0A 2GDZA 3L4SO 1PEDA 1RJWA 2LDBA 2O2YA 5J23A 4BNXA 3ZWMA 3HDHA 4GLOA 3GA0A 3ETEA 1T4BA 2VUSA 1BW9B 4UUOA 2C07A 2E4AA 5DCYA 5KJCA 1KEWA 3EVTA 4GL4A 3WBBA 3PJFA 4Q3CA 5BSEA 1B26A 3D0OA 5DBGA 4RPHA 3W1VA 3AJRA 4K9DA 1T26A 3QWBA 4JP2A 3FCOA 1V8BA 4KQXA 4WECA 1GU7A 1AHHA 2C2YA 3K6JA 4CMHA 7MDHA 4M55A 1FMCA 3ZZNA 3ABIA 1T25A 3PJGA 4M87A 5IZCC 2C29D 1L1FA 4II2A 2WWRA 1U4SA 4ITUA 4NBUA 3DBHB 4U6QA 1TI7A 4RZHA 1MP0A 2O3QA 3ON5A 4RLHA 2E37A 4BO5A 2XXBA 3DR3A 2FPPA 5EN4A 3DBLB 1H6CA 8LDHA 4RF4A 3ANMA 3O03A 1PWXA 3WMWA 1M2WA 3SVTA 4J7UA 1ZCJA 2Q4BA 4NFYA 4AJ4A 3RUFA 4FFLA 4W82A 3ONEA 2P9EA 4RF5A 3OH8A 4CMAA 4BNGA 4TRNA 3OIGA 2NU8A 4FJ2A 4YEDA 1YWGO 4HFMA 2ZQYA 1P3DA 1TT5B 2TMDA 2FSVA 3O8QA 4PLWA 1SB9A 2IYOA 4Q3NA 4AJ1A 4QEDA 5I9LA 1DFHA 2PH3A 3IAHA 4Z9FA 3W4IA 5I7FA 2UUPA 1LSOA 1NX6A 3Q11A 5DCWA 1U9JA 3ZV5A 3JQ8A 3GPDG 4WLNA 1GYPA 1I2BA 2ZJ0A 3WIEA 3KLMX 3PWZA 1CDOA 3S1LA 3H2ZA 4L9RA 3O8QB 4BQRA 4H7PA 5CDTA 1MUUA 1O6ZA 2HQ1A 3OSUA 5DCUA 3V2UA 4E2WA 4IDAA 2HRBA 1D3AA 3JQ8B 3KO8A 4RQTA 3G1UA 5C7OO 4YT4A 3PI7A 1ZH8A 3C7AA 4OKNA 5DDIP 5EQDA 3AW9A 2O3RA 1UXIA 3QE3A 4F3YA 1SB8A 2YY7A 3ZH2A 2HO5A 3I83A 1T1SA 4NQZA 2V6FA 2GASA 4DVJA 4N5LA 3LDHA 5TLSA 1Y5RA 2GN4A 2X22A 1QLJA 4MVJA 2NTJA 4QO8A 1I10A 5TT0A 4CM5A 4XRGA 2ZATA 1RWBA 5G2OA 2EG9A 2Q3EA 4UVDA 3K92A 4YPOA 3ZN2A 4EJMA 4HUJA 4Z0PA 1Z82A 2GN9A 2YDXA 3I9JA 3MJSA 3PHLA 5FI3A 4Y98A 4CM3A 1BXZA 2OXIA 4XD2A 4UEOA 3UVEA 2CNBA 2J3HA 3JQAB 1Q0QA 1P1IA 2XAAA 1P9LA 1F06A 3A1NA 4UVHA 1B14A 2BFAA 2D5AA 1GQQA 1C1XA 3INRA 4PZCA 3U49A 4AJKA 2X58A 4R41A 1DJQA 1T4DA 1VKOA 3ROMA 4J3FA 4S1VA 1U5CA 4U0KA 5JXWA 2NVUB 1BXKA 1U3WA 2WDZA 3MWEB 4UUMA 1NHGA 3WGYA 1EUDA 1YS4A 1UP6A 2GD1O 2RHCA 1HDYA 2VTEA 2X5OA 3UF0A 1AUPA 3M2PA 3C1TA 4JJIA 5DZSA 4DLAA 3ZNQA 4PLCA 2G82A 1SCUA 3Q2KA 3WR5A 2W2LD 5FF9A 4YT2A 3FWNA 4DWVA 4X54A 4PLYA 4DL9A 4WOJA 3HG7A 2O4CA 2JCYA 3F46A 3R1IA 3A9WA 1VSUA 5L7TA 3RCBA 2Y67A 1WW8A 2C5EA 1E3IA 3NJ4A 4PG6A 3WSVA 4RVFA 2PZKA 1R12A 4RVDA 1E77A 1YDWA 1EZ4A 1P0FA 3DB2A 3WXBA 1MX3A 4LVCA 1XA0A 3PTZA 1HT0A 3MEQA 3ZU2A 4DYVA 1HZJA 4BKRA 4M1QA 3ZHBA 2FR1A 3CE6A 3W6ZA 1NR7A 3BTOA 1BGVA 2BHLA 1DIRA 3E8XA 4CV1A 2VHWA 1RM0A 4I5FA 4DBVO 2IXAA 4WLFA 1Y8RB 1PGPA 2GZ3A 3E1KA 3H9JA 2AQHA 1HEUA 4EUFA 2UYYA 4NH4A 4ALKA 5KTKA 1LSUA 4J9UE 5CG1A 3B1JA 4BUCA 5HWSA 4HX5A 1PS8A 1Y6JA 4CMBA 1KVQA 5I7SA 4KWIA 2GN6A 4AJLA 2Q99A 3IOYA 1E5QA 1DRUA 1JDJA 2JFFA 5TRTA 4YRDA 1E7WA 4YWJA 4OJNA 3LK7A 1EDZA 1NVGA 4RO0A 1C3VA 3BMQB 5F3RA 2AE2A 1G1AA 5C3MA 3BMOA 4BKUA 4CODB 5A02A 3JYOA 1BTOA 1E6WA 4CQLA 2WSBA 4ZQBA 1E3WA 4MVJF 4JJGA 1Z7EA 3EUWA 3K96A 4F6CA 2YV3A 3F6YA 2OP0A 5DULA 2P91A 1KBZA 3FSRA 4E3ZA 4XKJA 2Y1FA 1B15A 4D0SA 3NDJA 1C1DB 3HHPA 1D1TA 3JD0A 5G0TA 4YJHA 1N8KA 1DJNA 3SBOA 2FPGA 2GYYA 3PPIA 4ND1A 1QYDA 4XB1A 5HTOA 2RAFA 4XYGA 1QORA 4YAGA 1VC2A 1T24A 4LK3A 4FPXA 4CM8A 4M54A 2JJYA 3GC6A 2NU9A 3D3WA 3LT1A 5H82A 1XU9A 1J49A 4NR0A 1RPNA 2JL1A 1BWSA 1UP7A 5L4SA 4GWGA 3HQ4O 4YJDA 3NT5A 3KLPX 4Y6SA 5JPIA 2B0JA 3JQ7A 1NBOA 4K6CA 2ZTUA 4BB5A 4XYEA 4C4OA 3EYWA 4BNIA 1WDKA 2IEDA 3I1JA 1R4NB 4L4RA 5IFLA 5JCJA 2YV1A 4NJMB 4B3JA 3AK4A 1YL5A 1VJ1A 2WD7A 1SZJG 3V1YA 1CQJA 1NYTA 3BYZA 1PX0A 3VH1A 4RPLA 2XPCA 2PZJA 4XQGA 3SEFA 4AL4A 4L75A 3RWBA 3U4IA 4YCAA 4JQCA 4GSLA 4EEXA 4YRBA 4WCFB 5F1KA 5KVVA 1WVGA 4M49A 4R54A 3DAFA 3GUCA 1OOEA 5THKA 3HE3A 5JDCA 4U5QA 5JY6A 4B3HA 2JFGA 2IRWA 2OHXA 3S55A 4W9NA 3KM0A 1Q7GA 2OOSA 3DZJA 1K6JA 4FC6A 3GUYA 2GR9A 4I08A 1JW9B 4MP8A 2A92A 1PGJA 4FFRA 3GG2A 1Y5MA 3DBLA 4IDEA 3RBXA 1JVBA 1YDEA 3WYEA 1ENZA 2PZMA 3LVFO 4FOOA 4FCCA 1NPYA 3WNQA 4D3DA 4FB5A 5KNLA 3UHAA 4N54A 3AY7A 4KZPA 2C82A 1LC3A 3WGGA 3T4EA 1YQGA 3W4KA 1WPQA 4F6LA 4A73A 5L4NA 4FQ8A 4HBGA 1GPJA 2E6UX 3DWFA 3VTZA 1MXHA 1EK6A 1H6DA 4PRKA 4HV4A 2OZPA 3ZI0A 3TDKA 2GZ2A 4R9RA 2X9GA 1IULA 4L73A 5BNFA 3RAJA 3TRIA 2JCVA 2YJZA 3WFIA 2W90A 3ZHZA 1LRKA 3OIFA 1ZEJA 2X5JO 3I9KA 4L4XA 4YAJA 3DBRA 4NZ9A 4E5YA 2GN8A 1XGKA 5BNIA 4U8GA 4TRJA 2JD1A 1VM6A 3RJ9A 2PY6A 4BO1A 3UOGA 5F21A 1NVMB 2C2XA 3JQEA 1N9GA 1QMGA 1B7GO 1PJ3A 2VYVD 1JWBB 1QV7A 4OL9A 5A05A 5A9SA 5JO0A 4ZQFA 2B37A 5HBRA 5CEJA 2QRLA 4DIFA 3GOHA 3HDQA 1I01A 1PJ2A 2VYND 5LDHA 4PLZA 4BNZA 2J3IA 4D43A 3PGXA 4NU6A 3AWDA 4AJJA 4QUKA 5ADHA 2J8ZA 5TJ9A 2EW8A 3I9LA 4IXTA 2HMSA 3GF4A 4J1TA 4E5MA 4FOSA 1PR9A 1IPFA 3LT0A 3S2GA 3AM4A 3BA1A 1Y8RA 4WGGA 1F0YA 4BB6A 1GUYA 3A14A 1MC5A 2D59A 3X2EA 4EJ6A 1XQ1A 1XR3A 5DP2A 2PK3A 5L45A 2DFDA 4RPKA 4XDYA 3ENKA 4DUPA 4YXFA 3IKTA 1LLQA 4IS3A 3OM9A 1GY8A 4J9VA 3WLFA 5JDIA 4J0EA 2H9IA 2RH4A 3WJAA 5ENVA 2HDHA 2X7HA 1EVJA 1TVEA 4IBOA 3QSGA 1KC1A 4FD3A 3IS3A 2JD2A 1LUAA 1PQUA 1PU2A 3Q9UA 2OORA 4CR7A 5IXSA 5A06A 4UREA 3IP1A 3KTDA 4AVYA 4TZKA 3BHJA 2FP4A 5JDIC 3GZNB 3TZ6A 4EBFA 3DZGA 5JYEA 2EGGA 1ZEMA 1G6KA 3WMXA 1B3BA 3IUSA 4XX0A 1EBUA 3RD5A 4KQWA 4HNGA 1BSVA 3L9WA 3M2TA 3BHMA 5B4VA 5DF1A 2X0IA 2BFPA 3G49A 3RC2A 2Q1WA 1IYZA 4BGVA 4ZVVA 1E3LA 2A9FA 4PLHA 2AE1A 3R3SA 3FPLA 1ZSVA 3V5NA 2V65A 2JAPA 1IOLA 2JKVA 4PLVA 3KHUA 4MVJM 5CPBA 4TKMA 3DQPA 3PFFA 4RVUA 1PJCA 1NWHA 1SMKA 3I3OA 3A28A 4FBGA 3OP4A 1U3TA 4ZQGA 1BVRA 1ULSA 3NDRA 4BO3A 1YXMA 2HUNA 5IDXA 1LDMA 3JD2A 3AI2A 3A06A 3VZQA 4EZBA 4RL6A 5CFZA 4A03A 1HKUA 2H6EA 2NQ8A 3HZZA 3LC7O 4RVGA 2PV7A 2CVOA 3L6EA 2OBYA 2EWMA 4YJFA 4D7AA 4JK3A 4DXHA 1U7HA 2NVWA 5K6AC 4CR6A 1PJLA 3GDOA 2CD9A 1PQPA 4YJGB 4XYBA 4WLOA 5ITVA 1HE3A 3H3FA 3RVDA 4EYEA 1B3RA 3SJUA 2WEKA 1XDWA 3H9UA 5JBIA 4WOKA 1F17A 4B4WA 4BO7A 2Q2WA 3ZGYA 3JYLA 3S2FA 4DC0A 2DBVO 1E92A 4E5PA 3AUUA 3A4VA 3WGHA 4YAIA 1I3LA 5L9AA 5FEUA 1HDRA 5AXDA 4FJ1A 3JQFC 4QQRA 4ALLA 3CINA 5L7YA 1IHXA 3RI3A 1DB3A 4XCVA 5H83A 3AM5A 1S6YA 4XZ3A 4NFSA 3C7CB 1D4FA 1EUZA 3KSDO 1CJCA 3TPCA 3GVCA 3OEYA 3B6ZA 4XWYA 3JQAA 3WYBA 1A71A 2Q1TA 4PVDA 4J43A 3NGXA 2C5AA 2W2KA 1DC5A 3B1KA 2EKQA 4RV9A 4E13A 2IDZA 4EEZA 3N7UA 2YZ7A 4H15A 1GAEO 3B1FA 5B4TA 3ZHXA 3AU9A 1U8FO 4R68A 1QP8A 3ENNA 3UICA 1DXYA 4OHUA 2UAGA 3ZW9A 5CEFA 3D4PA 3UAGA 3OA2A 1UXHA 2V7PA 2EP7A 3INGA 4F45A 1E1KA 1O8CA 3BTVA 4Q3AA 4URFA 5IZ4A 1KERA 4RORA 2B36A 2WD7B 3VH4A 4FGSA 3LF2A 1P33A 4GX0A 3WWYA 1KS9A 3EMKA 1B8UA 2Y0DA 3AI3A 2VWGA 4OXYA 3ZWVA 2QRJA 3V2GA 3G1TA 1O95A 3LYLA 2V6BA 5JE8A 4OAQA 4M86A 1GZ6A 1DFGA 1GZ4A 4A27A 4NPCA 1YL6A 3RSHA 3Q9NA 3E03A 4UAGA 4OOEA 4DRYA 3GGGA 1A4UA 2DPHA 4KTVE 3Q2IA 1N1GA 1NFQA 4KUEA 3ETDA 2GO1A 2QG4A 3DDNA 4J4TA 2AQIA 4GGPA 4RDHA 4BO9A 1ZJZA 2YV2A 4DYDA 3QVSA 3IJRA 4BNWA 3JCZA 3K8ZA 5JS6A 5LDGA 1DLJA 1CEQA 1QRRA 3G79A 4CLRB 1P44A 3VAZA 2B4RO 4D3SA 4LRSB 1Z75A 1KETA 1D7OA 2I76A 3GN1A 3IDSA 1XELA 4KWHA 1E1MA 4CMIB 1PJTA 3WQRA 3E82A 4FGWA 3KV3O 3OJEA 4TVOA 5TC4A 5TJHA 2YHIA 4NJOA 4HFNA 5EL0A 2F00A 3Q6IA 1B16A 3QY9A 4JLWA 3PK0A 2QZZA 3BZUA 2C7GA 4PLGA 1VL0A 4XRRA 2P68A 3I4CA 3UGKA 4CQLB 4KDEA 4Q39A 2PH5A 2PWZA 2Z5LA 4IXWA 1IZ9A 1FJHA 1E6UA 3NX4A 4FFPA 1N5DA 1NP3A 1TXGA 4NDNE 1P1HA 5A5EA 2PGJA 1FF9A 4D46A 1XWFA 2VHZA 1C1DA 1J5PA 1W4ZA 2GZ1A 2XXJA 3EDMA 3RC9A 3W8EA 4BV8A 4F46A 4YR9A 1TA4A 4XR9A 2YFQA 2CVZA 2YUTA 4IZHA 2B4QA 3ROPA 5KVSA 5TSDA 3ZDFA 1NR1A 3JD1A 5GZ3A 4IDCA 2NTNA 4J1QA 4L4SA 4B8ZA 3IKVA 1GEGA 4LW8A 4YVFA 3OEWA 1CRWG 3H9GA 3DTYA 1WAMA 4CQMB 4WEOA 1DC4A 4Z3KA 2D1YA 3KYDB 1HSOA 3GT0A 5K0ZA 4J0FA 4XDZA 2W2LA 3I9OA 4MP6A 5BNTA 5G0WA 4R1UA 1LDBA 1PSDA 4K6FA 4UVIA 5CHEA 3Q3CA 4HY3A 2JCXA 3LF1A 3MJ4A 4QECA 5GZ6A 1PGQA 3VPXA 1GV1A 1EFKA 2C59A 3TF5A 3KYCB 3GDFA 4E30A 1IE3A 2HRZA 3NTRA 1DIBA 4R1NA 3C3XA 2VZ8A 2UDPA 4BL5A 2JD0A 5AYVA 1UAYA 3HB4X 4BNVA 3PRJA 3KZVA 4TWRA 4RPGA 2VQ3A 1EEHA 1ENYA 1IY8A 3P2OA 5HS4A 3IIEA 1SPXA 4NFHA 4TRRA 1X1EA 3L0DA 4OXKA 2H63A 4P22A 4GMFA 4MVJE 1R16A 1QYWA 3GNSA 5ITWA 5ICSA 1T2AA 2JHFA 3B70A 3S2IA 2QQ5A 2QIOA 2X5KO 3N74A 4MIEA 3GZ4A 4OH1A 7ADHA 1KVUA 1ZK0A 2IZ1A 3AM3A 3BIOA 3ICPA 3MWDB 5F1PA 4OIMA 3AFMA 1ZNQO 3EW7A 5IDQA 3TZCA 3DZIA 4R01A 2OBNA 2VRBA 1AGNA 5CDGA 5DOZA 3EZLA 2NACA 2ZK7A 3H5RA 4C7JA 2Y1DA 2IYPA 1EUCA 5DOVA 1LTHR 1YH3A 3JQGB 3TZQA 1E3SA 1ZSYA 5IN5A 4BKQA 4IUYA 4BO8A 4YQZA 5JMPA 3RQSA 4DGSA 4ND2A 5A04A 4TROA 3WX0A 1FK8A 1ZMTA 1PS0A 3GN2A 4UVEA 1N7HA 4BKPA 4QXMA 4DIOA 4FFMA 4IJUA 1JQBA 5EERA 1EQ2A 4IQ8A 3GMDA 1DPGA 1H6BA 4A2CA 4DREA 3RBVA 4TQGA 1R0LA 2QX7A 3H8VA 5KJ1A 1KEPA 1TLTA 3GEDA 4Z9YA 1GYQA 1ZVMA 2DT5A 2EW2A 3ZWYA 1GD1O 2I67A 2FHSA 4FDAA 3CSDA 2O48X 2OFPA 3ADPA 3WFJA 1ZW1A 4P4GA 5C7LO 1BW9A 1DLIA 1KY4A 3GRKA 1OZAA 2OGUA 5TGDA 3ZWXA 1HDXA 4CLOA 2PKRA 3UXYA 4CM4A 2HAEA 5I8ZA 3MJEA 1BXGB 3BTSA 4XQEA 3VZSA 3NAQA 2PFGA 3FTPA 3TJRA 4BNKA 1C0KA 1YONA 1K0UA 1UXGA 2A35A 1LC0A 2VN8A 2X8LA 1VJ0A 3C24A 4IY1A 4GKBA 3V1TC 2Z95A 4ALIA 4BNLA 5G4KA 2HU2A 4DPKA 2GCGA 1GCUA 2Q45A 4BGIA 1I24A 1SBYA 3JQAD 1R66A 3DZHA 3K30A 3QJ5A 4OYRA 3RU7A 5I7VA 4ONEA 1AXGA 1ISIA 1CETA 4CQMD 4LMPA 2FY8A 3JQDA 4A5OA 2FPIA 3OECA 3DAPA 1Y9AA 1YB1A 5JMWA 1PGNA 1V0JA 1HZZA 3K31A 3L6DA 5LC1A 2W2KB 4KOAA 3HDYA 2Y93A 1LRJA 1TT5A 3NTOA 4XYMA 4JGBA 2Y1OA 2ZTLA 1G0OA 1R37A 3LC2O 1JLLA 1NPTO 5K6AA 1NQTA 4XJSA 1DOHA 5TQVA 4W9NC 4GKVA 4WCDA 1PR3A 4PCVA 3D3WB 1RYEA 2NM0A 2BD0A 2RH8A 3WJ7A 4JROA 3F1LA 1ISHA 2DKNA 4KUGA 4PG8A 3RKUA 3RC1A 2AQKA 1ML3A 4D42A 3SX2A 4ALMA 5TIIA 3HADA 4OGWA 4P8RA 1DC3A 2Y66A 4NBRA 2WYWA 2B83A 2PKQP 2ZYGA 4GBJA 1GFSA 4CV3A 3X2FA 1PJQA 2FOIA 3VH2A 1W6UA 1HDOA 3ZWAA 4XIYA 2PLAA 3TFOA 1DIAA 1PZGA 3FHLA 1J6UA 4MP3A 5JAQA 4IGFA 1F12A 1MXFA 1CWUA 2EEZA 3GGOA 1LBEA 4O1MA 5I9MA 6ADHA 1WZIA 4TMFA 4O6VA 4NJMA 4XR4A 2PA3A 4B7CA 4ESOA 3D7LA 3DHYA 3JQ6A 2GNAA 4B7XA 4Z3DA 5T6BA 4N5NA 2WMDA 1B8PA 3TL3A 4ND4A 3QVOA 4TRMA 1ARZA 3NEPX 2X23A 3H6KA 1LX6A 1FDWA 1MC4A 1PJSA 4I5GA 4Z9XA 1QR6A 3GLQA 4MINA 4YJFB 4QFDA 1ZJYA 3PHJA 5DP1A 2PD3A 2TMGA 3WG9A 2DVMA 1WLYA 1YB5A 3VPSA 1WWKA 4BGUA 4B3IA 1KC3A 3K2BA 4DBZA 1R0KA 3KXDA 4DTIA 3IQDB 1HF3A 4GSKA 2FRDA 1AE1A 2FZWA 2ZTVA 3DHNA 4B79A 3QWHA 2OL4A 4IJKA 2O3TA 4UEKA 4W99A 3V1UA 3PVZA 4BNUA 1MB4A 2RCYA 4MVJD 3KETA 2D5CA 1XEAA 4JBIA 4BMNA 1DAOA 4QX6A 4J7XA 1V3UA 2PD4A 4S3MA 4UUNA 3WNVA 2A4KA 4AJOA 1EVYA 3BAZA 3E5MA 3BMNB 2AA3A 3RU9A 1XYGA 3KSUA 2HK8A 1YGYA 2O7SA 4MO2A 3E9NA 5TNXA 1R4NA 1SOWA 3EK2A 2IZ0A 2LDXA 5GY7A 1OMOA 2VWQA 4UULA 1PQWA 3TNLA 4IMPA 3ZV3A 1HL3A 1X1TA 2H5LA 3O4RA 3DOOA 1NAIA 2C7VA 1N1EA 1ZXBA 4NI5A 3GNTA 1FDTA 4O63O 3U9LA 5GZ1A 1N7GA 3WICA 4NBWA 5T67A 1HDGO 3VZRA 4J7CA 4TZTA 4D45A 3KYBA 4CLXA 3GG9A 4HXYA 4BQPA 1ZUD1 3L9XA 4YT8A 1ID1A 5JY1A 2J5QA 1I33A 3TZKA 3ZU4A 5IXYA 3BTUA 5EJ2A 2Q4EA 2WYVA 3FF4A 3UCFA 3MJTA 1Z45A 2J5RA 4ZRNA 1LSJA 2HMVA 1BXGA 3AY3A 3NGLA 4GGOA 4CMKA 3SC4A 2VYNA 3GH3A 3U0BA 1M6WA 3HFSA 5G0SA 1BMDA
chains in the Genus database with same CATH superfamily
2ZUWA 1SHLA 4KRFA 1VL5A 3SKXA 3ZY6A 2F59A 2HMTA 1FRVA 3ADCA 3PEWA 3KK0A 1FU8A 4HAIA 4F4UA 3SIWA 1B8VA 2IU6A 2II6A 3FWZA 4OSEA 1CTQA 4BO2A 1I4TD 1M1YB 3OMLA 4HJRA 2FX5A 1RCFA 1L5WA 3DBIA 1ETUA 3NOOA 4TL6A 3BC1A 5AM3A 2I1QA 5IAJA 1RIIA 1K7FB 4NBSA 5IX8A 1EUQA 4KR6A 5BQXA 4V0MA 2QRNA 4RZSA 2W8BA 3H17A 4R8MA 4II3A 5A4KA 1Y81A 1XTIA 3MXTA 3T9BA 3K73O 1CY7A 4QO7A 4MRAA 2QV0A 1KP3A 5AJYA 3KNZA 1UJBA 3VDRA 5SICE 3REGA 1QFXA 4BIMA 1OJ7A 4FVTA 2QZJA 1QRTA 3B12A 3FSGA 2QB5A 2IITA 4WZZA 5B58C 1NWCA 4EHJA 3KKLA 4P08A 3U0VA 1NJ1A 3A32A 1SCIA 4IMRA 5GV8A 1PNOA 5DO9A 3WGZA 1IK6A 2EYUA 2P41A 3FMFA 3FSEA 1IUNA 3NUZA 3WGVA 5GJBA 3KBOA 1D1SA 4IEIA 1AQYA 2XX3A 5HJ5A 1BG6A 5EJ7A 3UMJA 1C9KA 1HG1A 4LWQA 5EMHA 4TQAA 2HCTA 2FE1A 4PTZA 3LQRA 4UMFA 3V2HA 2XOXA 3KSBC 4CEJB 1NY6A 1OILA 4YMVA 5K8TA 3GGPA 3S2EA 4CEIA 2IXFA 4QXRA 2XXAA 1ECCA 3EXIB 2WTEA 3AR7A 3Q7SA 2ZIZA 1WHTB 2G7MC 1NDHA 3FETA 4XI9A 4MGKR 1TZKA 2OEPA 2F4NA 3CBGA 3CHYA 4P4NA 1PJBA 3ITDA 3R40A 1DCTA 3PIIA 4H7DA 2RGNC 1ADBA 4ZO7A 4ZVMA 4LY3A 4C43A 3SJZA 3OQIA 2V45A 4W5TA 2I99A 2VZ0A 5DNVA 1O96A 2GUGA 1OIWA 1E4YA 5GIOE 2ZRLA 1F60A 1TADA 1UXJA 1XWWA 1CR2A 3N2EA 4GIBA 4WK2B 4PR0A 1T9BA 1OKKD 5G4KB 5F33A 1L4EA 3BFXA 3ZD6A 1BRTA 1HUQA 3AGQA 2C4UA 5TV2A 4ZHSA 2V0NA 1CUEA 3UUWA 4R31A 2P11A 4LCJA 2G9QA 4D4HA 4KR2A 4JVNA 3AHFA 2GHRA 1NRIA 3H05A 1YRYE 4Q01A 4BB0A 3BJIC 5KNCH 2QUHA 3RFFA 2CVPA 4QPDA 3KJNA 1UADA 4UNSA 4YRQA 3VSDA 3OFJA 4RMGA 2ATVA 2WSIA 1HFWA 3HXKA 3OCVA 3S8MA 4IVPA 1JH8A 2QAGC 3H0CA 3MUOA 4UU0A 4CR8A 5B58T 4X8OA 5EHXA 2JLBA 2ZR9A 4LTMA 1XHEA 2CDCA 2PUDA 1HC7A 2QKYA 1YTLA 3C14C 2RGRA 1C1XB 1W25A 5KPJA 1C7IA 1TAHA 1MAHA 4GICA 3SIXA 4FN4A 4AS3A 4BP3A 2QZSA 3P94A 3SBEA 1EYZA 1PR6A 5M34A 2FPOA 1NF3A 2VLIA 2EW1A 4GVLA 4P3XA 2H65A 1NQ5A 1WUTA 5TPZD 2NVUA 3QOFA 3O9ZA 3TX2A 3KU1A 4E6PA 4FJ0A 2EKLA 5DYWA 2J9FB 2X9VA 2DUUA 4K3UA 2DY1A 3LYUA 1OFUX 3D6UA 4OV6B 4A2PA 3OQ6A 2A3NA 1R64A 1V3TA 2B6HA 2FPKA 2Z30A 3F8TA 4FTWA 1NT2A 2NU6A 4XD7D 2VRCA 3OOWA 3WHLA 3KUXA 5AM0A 3GLUA 3OP1A 1N2OA 1WMFA 1KNQA 3FPKA 2KB0A 4Q1VA 3EWSA 4Z99A 4WRRA 2C88A 4CLEA 2IGBA 1XRJA 2PZAA 1CY6A 3VKGA 2X7XA 4D4LA 2CFOA 5K0TA 4AQ7A 2FMHA 2HLDA 4O3FA 5DHFA 4P0QB 4FZVA 1UR5A 4HTFA 3R41A 3K9GA 4LOLA 4Q9LA 1VG1A 2I2XB 1GTJ1 4U7DA 1GFWA 2XSZD 3U7RA 3L40A 4KQ2A 2ZB7A 4RKEA 2WF5A 5KNDA 2ZRQA 1OJLA 3ZXYA 2ERXA 3HUTA 1YS1X 3OZIA 2C96A 1HQDA 1NHWA 2FV8A 2PRZA 4HB4A 4KIGA 4J90A 4QU0A 1PFYA 5DBIA 1P4HA 1S3SA 3KYJB 4MWOA 4FYJA 4IIHA 5JPCA 1WV0A 2IH5A 3M49A 1QAMA 4HXGA 1Q1AA 3BFVA 1H2XA 2V9PA 3CLTD 3R7DA 3PD1A 4ML3A 1H8HD 1XCMA 3BHIA 4WNCA 2AOTB 1O9BA 3HI6A 3SZMA 2MCFA 5CFQA 1P4JA 1CIVA 3U5TA 3V1MA 3T3GA 5EESA 3RC7A 4CMGA 1JHRA 5EPEA 2IS2A 3D6TB 5K8CA 1L7MA 3JARA 4JCOA 5IDYA 2NSJA 1W85A 3S27A 3WWZA 6REQA 3HYCA 4OXXA 4C1BA 4MHTA 4DUZB 2AR7A 2BISA 3GQVA 4QYTA 1Y63A 2ID7A 3OUZA 4IIBA 1EGHA 6LDHA 1U0BB 4RH3A 2PUJA 1NVKA 2DLDA 3OA0A 3TK1A 1FFBA 3KX2A 2WJAA 3UN1A 3RAEC 3NHYA 5TEVA 2KBEA 1QFZA 3L6BA 1B0AA 3IKJA 4CN9A 3WC4A 4CYMA 3QBTA 3WSWA 4UZSA 1CBUA 5IZCA 3COVA 4XFKA 1BN7A 2K2WA 5THXA 4IINA 1BFDA 1L7QA 3M6UA 1O87A 2H16A 1E20A 1HOTA 3C1OA 5G1OA 5G4LA 1ISGA 3HCRA 1PWYE 2MSLA 3WKCA 3WYCA 4ZGBA 1SC4A 1AKYA 3UV7A 3STHA 4CFSA 2WVAA 1KDZA 2QLNA 1TVMA 1IY2A 3WXMA 4C0LA 4YX9A 5HM8A 4JYAB 5ED4A 2EVWX 4ALNA 1LPMA 1GNTA 1OI7A 1KIMA 5FUYA 2WICA 1WDTA 4BAGA 3NCTA 4MITA 4U2EA 2SCUA 3ZWCA 2HF7A 1ZC4A 1S8AA 1U4OA 1ZFNA 4E2FA 4ZI3A 4YP9A 3UJ9A 1TYDE 2P7HA 1T36B 2EG5A 1PFQA 1NXSA 1X38A 4TTQA 3K9CA 5AOVA 5JNRA 4H7KA 2IJGX 1U4NA 2RGXA 2XRFA 4G9GA 1N2SA 4JB3A 3K6SA 1UXKA 3GP3A 4IG4A 4YMTA 3NT2A 1F0NA 1DQRA 3JU3A 4NBVA 1XVTA 2V5VA 1IY0A 5LVAA 3R7WA 5EJEA 1BRMA 4W7HA 3AWIA 1V16A 4AYXA 1EXMA 2Y4NA 2LV8A 2V54A 2ZCJA 2FRXA 1GPDG 1MFPA 1BXRB 4ARUA 3HVIA 3EE6A 3KHKA 3TW0A 1UMBA 2C9ZA 2BUAA 2V7EA 2ZBPA 3LOQA 1PR2A 4PQYA 4WCFA 1X1BA 2ZVDA 1MQ8B 2ZI5A 3TXYA 3LT2A 2GT1A 4ACAA 2D2IA 1N33B 4POAA 4LBYA 4QHTA 1SVSA 3DYIA 4X20B 1P73A 3EZGA 3R7AA 1U2DA 4QDOA 4DC9A 4PZLA 5BR8B 4WPGA 3QUBA 4Q4HB 4ZAFA 1SVUA 3FCSB 1F3OA 3JAWA 1RPAA 4LZPA 3ZKWB 1VI2A 2ZBEA 1YL7A 1F0KA 2FRVA 2GNPA 1TLFA 2AN3A 4DDKA 3AIMA 1M7BA 2IYZA 4MS4A 3FOZA 2FG7C 5A03A 3PQDA 3AB3A 3NYIA 1FMJA 5A7FA 1Z6AA 3AI1A 2Q2VA 1S2MA 2GPNA 5BRNA 3W2GA 5K8JB 3DKRA 3RRZA 1ISPA 3A3OA 1JDUA 1XN4A 3C6YA 4R8RA 1UBNA 3TZ6A 5EINA 5SY4A 4CM8B 3AHHA 4IL5A 1ATZA 4PG5A 4XIGS 5EWMB 3ZDDA 4CU2A 3PHIA 4GPIB 2JFOA 4G1CA 1KJ9A 3MWEA 5CHYA 4ZPXA 4IDPA 4V0LA 3NAGA 3SJCA 1KR5A 2A5FA 1R9GA 5I9BA 2ZBQA 3CH6A 3DE1X 1ZI6A 4GX2A 2A5LA 2Z2IA 5CT4A 4HN2A 1SIWA 4BQOA 1OSNA 1QH9A 2VAMA 3F5SA 2Q3CA 5J2UF 4DNOA 4RK4A 2CVQA 1HDZA 2YVAA 4Q66C 3K72B 4JUDX 2ZI9A 1U8YA 2O23A 1RZ3A 3A36A 3ICEA 2G9UA 4IDFA 2JLYA 3ND5A 3EULA 1BVYF 3TJMA 3KPJA 1FUUA 1Y5LA 2WIFA 2H29A 1DAFA 4PX9A 4RABA 3WLEA 2FPUA 2HA4A 2GEFA 2LW7A 4Q48A 5E7IA 2IEGA 4ZDKA 2RH5A 1IZ0A 5BSVA 2V7GA 1DWPA 2I8CA 1JQJC 2WYIA 3PXXA 1XHLA 1F8GA 2PL5A 2QJFA 2IYSA 1P5JA 3PGJA 3ZDRA 4F92B 4W7IA 1P45A 5ERYA 5JJKA 4WH0A 2PLRA 5JJBA 4CEJA 4PC1A 5D3MA 4XA8A 3LO8A 2ZVPX 3IHTA 2HA2A 4L07A 4DCPA 5BN3A 1GGHA 1U2PA 1CQJB 1CULC 5C53B 2H4HA 1X13A 2AVNA 3I1YA 2WF8A 4BNTA 5AK3A 4BHTA 4X44A 1RYZA 1K9SA 1U3UA 3RIMA 2YN4A 1IATA 1MPTA 4QPJC 5DSTA 2V7UA 4UM5A 2C2OA 3S4YA 3QI7A 2AZMA 4W8GA 1FTNA 4BV9A 5BSGA 1Q95A 4TLMB 2JIBA 1FFCA 3ZHRA 3FCYA 5EMKA 2B69A 2J85A 3VC7A 2QMHA 4LCBA 1HO3A 4HB3A 2FEXA 4HYTA 3EXG1 1IXKA 1E5XA 4XJTA 2DUWA 5E9QA 2KYRA 1BHO1 5FTJA 5M5BA 4EHIA 2ZRPA 3U5ZB 1JAHA 2HQSA 3OZWA 1N3BA 1IBRA 3U4HA 3QFFA 4QATA 4EA6A 4TS4A 1N34B 5IP5A 4Q3DA 2FZEA 4MV9A 4GWKA 5HMLA 1G42A 5EIAA 1D5CA 5KKAA 3AGPA 4L5BA 4L78A 3UWOA 4COOA 1BCSB 2IS4A 1W44A 2EBFX 3E9DA 4V2IA 4LF6B 2FHPA 5LJIA 2I71A 3C6QA 2YX1A 2ZJ1A 1A97A 2H3HA 4M60A 1NLYA 3C3MA 4QPPA 5TGTA 5JCOA 4A2WA 1KOFA 2DFTA 3A6LA 1D8AA 3G5LA 1YQDA 2H48A 2J3QA 1I7DA 2PZGA 2EJWA 1JDBC 2L69A 5C7IO 1PZFA 1OF1A 1WP4A 5BSTA 4N76A 3S81A 1IBSA 1VHJA 3PL1A 4NZZA 5G0UA 3QLTA 3L1HA 3R6LA 4OOFA 1OH7A 5D1NA 1GT6A 1WKBA 3ETJA 3ESAA 3PQCA 5NLLA 1N4AA 4AUMA 1EFUA 4IIJA 5KYWB 3BGIA 3MCWA 1QCDA 2G06A 2HI0A 2JHPA 3EQZA 4KDFA 4KN9S 3SD7A 4BVBA 1NFRA 3EASA 4B3XA 1O94A 3ZE7A 4MCIA 2A1TR 4GR4A 4R40A 2SKDA 4DBLC 2ZETA 2XZOA 2VNJA 2Z2JA 4LRWA 4MKXA 1FUKA 3ZD8A 3T4UA 4EGQA 5LQRA 3L4JA 4TVBA 3M6IA 2ZJ5A 4KYVA 4C4YA 3Q7EA 1NRXA 4I46A 4RTQA 1A69A 1LW6E 4CTOA 3BFKA 4YRMA 4OU4A 1P5HA 3CMMA 2PKEA 4ZVNA 4B40A 1H8EA 4M76B 4AICA 2XB6A 2XE8A 4WDRA 1OC4A 3D7RA 3SC2B 2UUOA 3HHEA 5J9FA 3R8XA 2ZZKA 3AL3A 5KJ6A 2OAGA 2WYUA 1L1RA 2WB4A 2PWYA 4IQGA 1OXUA 3AUFA 2WM9B 4YDSA 2GKSA 4KR9A 3UG7A 1SO8A 1NP7A 2D2VA 3QVTA 4BP1A 2G1JA 1X80B 4BMYA 4L8VA 3C8HA 5IT5A 3I01A 2UZAA 2JLZA 2H54A 2ZSBA 2AC4A 4PC3A 3KJQA 1A27A 1RAFA 3IYLW 2C20A 3BG5A 3IKMB 1W36C 3NIFB 1MRNA 3IQZA 4A10A 1THMA 4ZODA 2CUKA 3LPLA 3U26A 2DJ5A 3P9KA 2J08A 3V8VA 2CZGA 1OX4A 1QQ6A 3FYTA 4GOOD 4NV0A 2XDQA 4OYLA 4QELA 3IV9A 5CH3A 5CYFA 3N8GA 3KQNA 3INTA 1MENA 2CXTA 4F8JA 4DN6A 1I2AA 2ZXUA 2WDPA 5EP2A 5FPYA 4AMBA 3DOJA 5BSRA 2FWIA 1MC1A 3JVDA 2EP5A 1RM3A 4DILA 5ABPA 1X19A 1GKYA 2AEJA 1JKMA 2BSAA 4XJXA 4V24A 2AMFA 2FEKA 4PPFA 4A0SA 1USIA 2IX3A 1V8OA 4TV9A 4EJ2A 3S1SA 1GPNA 2GXSA 1E59A 3BJMA 4AJPA 4FE3A 1ZXLA 4RQUA 2J6IA 3C16C 1Z3CA 3CJRA 4LDPA 5DB4A 2HMUA 5JRJA 1G8GA 2PUGA 4DRXB 4CF4A 1NM5A 3FFTA 2VZLA 1PNQA 4OX9B 4FBLA 1HLDA 2NU9B 3TOCA 4YN3A 3QKRB 1EGQA 1QE5A 3FBTA 3FYUB 3NVDA 4EUEA 3G2KA 5F12A 3RUCA 4NPHA 3ZU5A 2E9SA 3TQSA 4P5DA 1TEZA 1ULZA 1NTOA 1VJDA 1VP9A 2F43B 4BVLA 3CPSA 2W98A 3OIDA 3MGCA 3GLFE 1GG2A 2RMKA 3PGKA 4YALA 5DGXA 4ECEA 1ECLA 2XWPA 2KLHA 1FNDA 4AS2A 2PR2A 3N2LA 1FDUA 2BLLA 3PDIB 5H59A 3DLAA 1HDIA 4HXEB 3QVXA 1EU1A 1YQ9A 3QW2A 4MVJP 5E6RB 5ELLA 3LPNA 1UEIA 4A9AA 4CT4B 3O83A 2WRZA 4G0MA 4EHDA 1GDTA 2FFRA 5KQSA 4KFTA 4WE3A 3W6UA 1IBKB 1G98A 2AV6A 2Z2YA 4Y7CA 3U7EB 4B74A 1T9GS 2OD2A 3O38A 4HGPA 3Q98A 1JMVA 4I4CA 2ZRFA 3M3PA 4N7JA 4AZ0B 1TUBB 3WI7A 4CMJA 1CY1A 1RRCA 3KLNA 3TD6A 3DA8A 3I9FA 5HQTA 3PNKA 1WMBA 4ROSA 3KWMA 4HRXA 4PC2A 5AM5A 4H1WA 3EJ6A 2QTBA 5GM1A 2OSVA 2XNCA 4QDTA 1ZLXA 5J4LA 1UOEA 4DR2B 5AXBA 1ZVVA 4A6PA 2XT0A 4XWKA 3BQNB 3SWWA 3CWZA 4BQIA 2N1MA 2ZJFA 4O4JB 1J9GA 1LS6A 3QX7A 5ENZA 1V43A 1G3RA 4MIOA 5AVVA 1ZVJA 1TB4A 5JAIA 4YY3B 4A15A 1UFRA 5PNTA 3K5PA 5DISB 1DRWA 1MX9A 3RSQA 2ZE5A 3KEFA 1M9NA 2JH9A 2F1KA 3A4NA 4CKEA 1UDBA 4YMWA 2VT2A 3NTUA 4LTNA 3G2IA 4KCGA 1PL8A 4EITA 4W5OA 1GZ3A 1N25A 421PA 4XXHA 2AG5A 2HJSA 3RFTA 3EC7A 1K3UB 1N2EA 3TAUA 1KF0A 1FP7A 2CFIA 2OHIA 3SS9X 3TTTA 2PSFA 3AQ4A 3JWEA 3F74A 4A3SA 2GHQA 5THQA 4ZU3A 3CJTA 4ZIRB 3GUUA 1HQCA 2G6BA 1TKRA 2IZZA 3I30X 3RUAA 3JWJA 3SYRA 1YJQA 2FSSA 5KQLA 2XVZA 4B84A 5H0IA 2ZJZA 1BMFA 2VWHA 4EJ0A 1E8NA 1Y9JA 2BEWB 2O7NA 3COPA 1T3HA 1XAGA 1ZQ1A 3B78A 3E18A 2YYYA 5ESDA 4UE6A 4ZJUA 4M21A 3MZ0A 5LUAA 1XSEA 3Q3JB 1DCFA 2OYRA 4G85A 4CI9A 4HN9A 4FNAA 4HH0A 3DZCA 5ER6A 5IHXA 1Q83A 2J3MA 4IR7A 1T8RA 5AOBA 1GUZA 4GPD1 1J21A 2PMBA 3PIDA 5P21A 3S5JA 2V6IA 1FLNA 1Z22A 2WUDA 5EIFA 3RK0A 2BZ1A 4AZVA 1YCHA 1H2RS 4I8XA 4RHUA 1KY3A 3ROZA 4L27A 5JCOC 1FVXA 5DEOA 3R8CA 1X8JA 3NONA 3MUFA 2EJVA 1NXTA 3CWQA 5HK9A 1IM5A 2CUNA 1WB9A 3AHCA 4S1PA 1ZUNA 1SQGA 3N87A 5DVZA 4TM8A 4JITA 1HLFA 4YROA 5DHSA 4E5VA 1N8NA 2AFIB 2ISSD 2QNBA 2KWIA 2OMKA 3TXAA 1O6FA 4IGAA 4JEMA 3P27A 4M9RA 1EFLA 2PUBA 2XECA 1PEYA 1GADO 3T61A 2Z3VA 2VSFA 1SA0B 1DTEA 3CCFA 3FNEA 2HU5A 3AKZA 1A7KA 1JYEA 1PDVA 1XQ9A 4N7BA 1R6DA 1URPA 2XUHA 5AI0A 3RF7A 4A6XA 3ELYA 1B6GA 1AXRA 3L4EA 3O74A 4FIZA 1A95A 3CPEA 4BUJA 3F0TA 3H2YA 4QHSA 4X8LA 1YZGA 4AO8A 3HU1A 1SVIA 1G6Q1 1OHHD 5A6VA 1YIDA 1RLOA 2FKNA 3RUDA 1Q0PA 3IQWA 1DSSG 3OCYA 4O0LA 4PGFA 1MRSA 4YA6A 5KKCA 2RKOA 1SXGA 2YHIB 4GX1A 2WB2A 4JMLA 2YWFA 3RPEA 4YR7A 4L8LA 2OENG 4LOAA 2OSBA 2R8RA 1TQDA 4J75A 3N0VA 1IHYA 2IP1A 4CF3A 5FUQA 3CF2A 3KQHA 1ORRA 1ESZA 5ERGB 2JC3A 3MAAC 4IKEA 1EIZA 3KZ1E 2FSGA 2QMOA 5BXQC 3I6BA 4MJ7A 1FFGA 1HDCA 4YRZA 1KEVA 5BR7A 1R3UA 4E07A 4PF1A 1J8DA 3O8BA 1SQSA 1Y4UA 2R3SA 1YMQA 2CHQA 4X1KB 4YV7A 1RYYA 1WKVA 2FJPA 1YC5A 1VLHA 2QZ9A 4JYBA 1QIHA 1P5FA 4RW0A 2X0JA 2AGVA 2OZKA 3DMYA 4OQQA 5F5NA 2O2HA 1QVRA 1QK3A 3TCKA 1YB4A 2UXBB 4F4DA 1V7CA 2HYDA 3OZ7A 4KQ6A 1CR6A 4PAMA 1R0SA 3AT1A 1MJNA 2A94A 2GLUA 4ZT5A 3T9AA 4QT0A 1KO5A 4FC7A 1N92A 4F3CA 2WM8A 2NU7A 1AKWA 4XIJA 5HE9A 3OFSA 3EGXA 4AURA 1IJEA 1ABEA 1SHUX 2Y8EA 1EI9A 1M2KA 1MJGM 4MWDA 4R5HA 4RMJA 3VKUA 4B4KA 4HDRA 5HPYB 3A2KA 3ZS8A 1BE1A 1G7TA 1XTTA 2Y2VA 3U3XA 1XZIA 1CUZA 1TMKA 1KE1A 3FAZA 2HSJA 4HFRA 3U4DA 4KLZA 5TMEA 4HNHA 1Z6ZA 4N5DA 2Z6UA 2C0QA 3FG9A 2VTBB 4Y2SA 3WLRA 1M2VA 2VJDA 1DAPA 1DHTA 4M1KA 4Y2PA 4E09A 1D04A 2XA1A 4OHBA 3N5KA 4N6OA 3VDMA 4GPZA 1GVNB 1M67A 3G6KA 5J5AA 5KNBH 3ECSA 2E48A 4M98A 1BCRB 4WKNA 1E0DA 3EOAI 3KQVA 1EJBA 1WQ1R 2W11A 4KSBA 4JUFA 1TJ5A 5AO9A 3RS3A 3ZE2B 1EFPA 1SR8A 4DLBA 2CWDA 5EQFA 4EB3A 2VA9A 5I9SA 4WLEA 4UTOA 1OBOA 1FVOA 1KAEA 3UHOA 3ZWBA 4IDDA 4LHZA 5KYVA 4XDGA 3FR8A 1HR0B 3LQ2A 1YA4A 2P7IA 4FGJA 3L7OA 3FPSA 3MBKA 2B25A 4NYMR 4JQZA 3UMYA 2V3VA 3HYSA 5I47A 3VNUA 4U2CA 1NJ5A 3LUPA 2XMQA 1ZIDA 2HIAA 3LHIA 3R5FA 4WERA 4EPWA 2IDKA 1KZYC 3DGFC 3EQ8A 2YNMA 2ARKA 5CD9A 5LP6F 1FXSA 4OSPA 4RF2A 3D8RA 1K88A 1YULA 1KKLA 5IF9A 4AKHA 4IDGA 1E9DA 1LFDB 2PRIA 2TYSB 3L04A 4MIYA 3EPJA 4HMOA 1ZIPA 2O54A 4H16A 1WMDA 3RVRA 1AT1A 5JYCA 3DC7A 4QOFA 1N5MA 4WNIA 5DNUA 2XUIA 4QM6A 1MEEA 4DOMA 4EJSA 1KMHB 3OD1A 4Y9UA 4FNMA 3AOGA 2O2GA 1VXRA 3QKRA 2IY8A 1LD3A 1KYQA 2P79A 1Y8CA 3GVIA 2PTGA 1CY8A 4FUTA 1P0CA 4CG3A 2ZKIA 1U81A 2X15A 3HBAA 2EEPA 1CF2O 4WDQA 2VPIA 4YB8A 1LLCA 2ZWMA 1U8XX 4C04A 3FFWA 4XWOA 1Z4KA 1R18A 1CJUC 5A1TA 3EQ9A 1JSLA 1FNNA 3OUUA 1E1NA 3GLGE 1Y3FE 4XLLA 4DPMA 1ZZEA 4MIKA 1Z0AA 1DI0A 3FD8A 1DBVO 5MGNA 4BPBA 1G0NA 3NBZC 1MG5A 1AXEA 3UEOA 3A2MA 1ZVKA 2FQXA 3M1IA 5I9TA 3ZI7A 2QW1A 3FXAA 4C29A 1M8FA 1X0VA 2PZLA 2QJTA 1PJ4A 2VHQA 1EP3B 1YFZA 3LU1A 2F3UA 3TE7A 3G17A 2H08A 2R25B 1VIAA 3LHSA 1FOEB 4RHCA 5SY9A 1ZUHA 4R98A 1XVUA 4URYR 5KYGA 4Z6KA 2W58A 3EMBA 4KQHA 3LQ1A 3LQYA 3LXMA 5ALKA 1SK8A 3ICOA 2QTNA 4QAQA 5ILGA 1Y3HA 2HH9A 1XNGA 3HYLA 1QIIA 2EZTA 1R6BX 1Z4MA 3STWA 1JJAA 1JQAA 1JJIA 4AJHA 1OZHA 4NJEA 4XWGA 3FHJA 4QA9A 3T7EA 3OHSX 1UZLA 4HTAA 2WJHA 3VZCA 3N2IA 3ZCVA 4CM1A 4ES6A 2RHWA 5KMGA 1CKEA 1ECGA 1C5KA 2A7XA 1SNYA 1E62A 2OPBA 3C3EA 3L7DA 4Q3OA 3SVZA 2HMWA 3HDTA 3UCXA 3THXA 1H3EA 1EVIA 2CCJA 3RGWS 1J0BA 2EZ9A 3DP9A 1OLUA 3KSRA 4JENA 2HO4A 3OIWA 4IUDS 3DWGA 4CKCA 2REQA 4MO9A 4EDFA 1C3LA 2GO7A 4RIEA 3KE8A 2ECQA 1JE1A 2WMYA 2YV4A 2G4CA 3PWKA 4RF3A 3DDWA 5JNVA 5IPFA 1DAHA 4HQFA 1FMLA 4DMMA 2IBSA 1YNOA 1Z9BA 4R9SA 2Q1SA 1JLRA 1KVTA 5J1SB 4CMIA 1A9YA 4LJYA 2HX1A 2YWBA 1S2OA 5LUBA 1KOGA 5B6JA 2JGIA 1SC6A 2REQB 3LKDA 3JQFA 1V41E 2ZUDA 3IP5A 1G8JA 3U31A 3ZWWA 4DZZA 2FYTA 3MINA 4MUYA 1FDSA 4YUWA 2QU7A 1E89A 1MAUA 2PYZA 4ZYYA 5KU1A 4P38A 1IZYA 3C2QA 4HOYA 1JLSA 1H2YA 1W8IA 2MYNA 4LC0A 4R83A 2V97A 3KQSA 4G5HA 1F2UA 1UBFA 2GK6A 4WGFA 2R1UA 4M0PA 2X86A 5LQSA 4QKQA 4OMCA 3HGTA 5EIOA 4CL8A 5CD1A 1EA5A 3S2SA 2W2QA 1XRMA 5FDFA 3BF7A 3ET4A 3GIDA 2CSUA 4H77A 1DKQA 1WZEA 3DFKA 4OBBA 4YRLA 4CEHA 3A6FA 1CY2A 4K2HA 4G8DA 1WE2A 4YCJA 2ZTMA 4LVUA 5BOVA 3LT4A 1ADYA 4C01A 1VYHA 2I03A 4OH7A 2ZJAA 1M10A 2HBYA 2VDJA 2OECA 3JZDA 3RFCA 1FP4A 2XA9A 4JC8A 3JZMA 3HPRA 3S3TA 1CSEE 2GCOA 4CCWA 1PW7A 4D8YA 1G64A 4FIDA 1SG0A 1I94B 4L9SA 1FTSA 4NG5A 3HDVA 4HS4A 2BW0A 4QD3A 4HNTA 3PL5A 5IUJC 1K8RA 4MWZA 2QT1A 2ZAYA 3NO4A 2NADA 3DCIA 4JVOA 4R7TA 2EWWA 2W83A 1R4AA 2Q1UA 2WAAA 4JUAA 1EXDA 3EOZA 1NQAO 2ONKA 3PQ8A 4C20A 4E94A 2JGFA 3QVGA 3KYCA 1ONNA 3L6UA 4GLJA 4TSFD 2JGMA 4E4YA 2HCRA 3JV7A 4ZZIA 3CLSC 3DONA 5FI0B 1LVUA 4IV8A 3WK6A 1U1IA 1AHIA 1GSIA 2B4AA 4ARVA 2VF8A 3GHHA 2AUNA 3IHKA 3U16A 4WFJA 4IWNA 2RCNA 3RVBA 2XVXA 3EG9A 3L8GA 4NAUA 2ZSIA 5A5DA 1YQTA 4G0XA 1V8DA 1RWQA 5LYJA 3ZQ6A 2OYCA 3H2BA 3TL2A 3WKBA 1TVKA 4O4HB 1ECFA 3BAFA 3OE5A 1L5GB 1V3VA 5A6SA 5EKTA 3QE2A 5HFAA 4BTVA 5F23A 1F4VA 1NKTA 4EUHA 1SKMA 2WG0A 3DE3X 3VV2A 3GLSA 1YR7A 3SHTA 3G0IA 4EQZA 1BYUA 5C5CA 1ORWA 4B3TB 4H27A 5I8PA 3AF2A 4Z4QA 3S29A 1FMTA 2Q5EA 1H9BA 5ARCA 2BBWA 3AO0B 1N1DA 4I9GA 3R3JA 4C21A 4CLDA 1PR1A 1U1GA 5LZ5A 1UWVA 5ESRA 5KX5A 3I5XA 5T64A 3THWA 2XWQA 3D6AA 4Y6RA 1FFDA 4H3SA 1ZPDA 2H9YA 3JQBC 4RDIA 4NMHA 3X1DA 4OG2A 2VWPA 4CDGA 2NTVA 2HTEA 4LDRA 5FAKA 1R6XA 3P71T 4L2IB 2X0RA 4YP5A 2WHQA 1RMQA 2F7SA 3ZGVA 3HEAA 3Q1LA 4CMEA 4I1YA 2COKA 4MCAA 4ZVKA 3T1QA 5AQEA 1PV1A 1R5JA 2WOJA 2DY0A 4BGDA 2BGTA 3KELA 2DTEA 2VS1A 1XZBA 3KTFA 4RX1A 5BO5A 1J2EA 3EC1A 1FRQA 4NCNA 4DF3A 1AZLA 3W0LB 5CRIA 3MMZA 2AI3A 4UUPA 1Z16A 2EIHA 3FNFA 4NYJR 4C4RA 4CCYA 2PVCA 4GOLD 1R27A 2Q9UA 1S2LA 2PGIA 3T3OA 5LXTB 2H1SA 2PZEA 1SG9A 1YJ8A 5LBIA 1L4YA 3AERA 4HDNA 4MUFA 4BFYA 1EJ2A 2PX3A 3L1IA 1K6IA 2FR0A 4FD2A 4ND5A 3K4PA 2CXUA 2XTZA 3GNLA 3DE2X 4JDUA 5DT9A 4D79A 4WJLA 1L5MA 2C8JA 3PEEA 2BFEB 5DM0A 2BMJA 4G23A 5U1PA 2VH1A 3HA2A 2VPTA 1OU0A 1KY5A 4N8EA 4WVFA 1T9AA 3E53A 4ON9A 1E0JA 2C2GA 1T36A 4JB8A 5EVJA 3PB3A 4CKBB 4HDQB 1UPAA 2ZIAA 1MVLA 2DF8A 3HB5X 2OFXA 1VI5A 3PX3A 5LA6B 4FGLA 1F14A 4ME6A 5EIWA 1HOXA 4KE9A 5AMXA 5EZSA 3UXHA 4CHGA 2LDBA 3VJKA 5J23A 3WRYA 1B6RA 1THGA 2V8OA 2F48A 2BMDA 4GLOA 1T4BA 2I6QA 2C07A 3W9UA 5B5SA 3WBBA 5BSEA 1XNQB 3D0OA 3MM4A 2ZYUX 5DBGA 5CT9A 2YXDA 4D9JA 2QRVA 3UMSA 2J7PA 4UHEA 4EG8A 3QWBA 3TI9A 4JP2A 5B1EA 2GUWA 3FDIA 4WECA 4F1KA 1GU7A 3MHPA 2Y71A 4LDAA 1SKBA 3T3NA 2R84A 5JZ9A 4TN5A 2C29D 2PZ8A 3F5FA 5GJVC 5KDLA 4II2A 2WWRA 4OQNA 1E2UA 3M5WA 4NBUA 2NUPB 1QB8A 4P32A 5B53A 4U6QA 1L5YA 1ESMA 1TI7A 2F8LA 3VU0A 2YICA 3A9VA 4A2CA 3ON5A 4PV7A 3L7YA 4RWEA 4BO5A 2QTAA 5A0FA 4OM7A 3DR3A 3Q7PA 2Q9BA 1HNXB 1C4XA 2D1RA 5EN4A 3T41A 2VJMA 1NN1A 1H6CA 2R4TA 4DLNA 4DWOA 5FOXA 5BNWA 3WMWA 1DBWA 4JBWA 5B1DA 4J7UA 3GJQA 3P4XA 2HA7A 1VSBA 2ERYA 2LPMA 1FP2A 2JDID 2MSDB 3RUFA 1WTAA 1H3FA 1YZKA 1T5SA 3H11B 3ONEA 2YJ3A 5CTJA 2GZDA 4IIXA 2XVYA 4CTKA 3OIGA 5AKYA 4HFMA 1F1BA 3WRXC 1PVOA 1M2FA 2R6DA 2TMDA 4WXYB 4DRZA 3V4LA 2HJGA 4MAFA 2DXIA 5DHPA 2ZR8A 1SB9A 4Q3NA 1L7BA 4HZGA 1Y4ZA 1JR3E 2GA9A 2ZT7A 4UC0A 3VA7A 2PH3A 5I7FA 3W4IA 3PC7A 5FD8A 4A0QA 2H0RA 2JVJA 3GPDG 3IAFA 2WWIA 4DNFA 4DZTA 3PWZA 1CDOA 1G7SA 1NQXA 3CR3C 4L9RA 5JALA 1B23P 3UYKA 3O8QB 3TI7A 3NRBA 4TXNA 1UPUA 3DQZA 3L93A 3AJ9A 3B53X 3KHSA 3MRXA 3Q8XB 1UBCA 4R1OA 1OBVA 3GFOA 1N6PA 4I55F 1QE0A 1WJGA 2FCAA 4IDAA 5TXGA 3SMQA 1YC2A 4N0EA 4BZWA 5EIEA 3CB2A 4W8HA 2QD3A 4MLPA 4YT4A 3B6IA 1IN6A 3FUXA 3C7AA 1HT2E 2GBPA 3KT0A 3EG9B 5DDIP 4F5EA 4P31A 1UXIA 4OJYA 4F60A 2NYUA 2YY7A 5CTAA 3M9LA 2MHCA 2R6R1 4MW1A 1T8WA 3COYA 3BXHA 1JE0A 5CFPA 5JQGA 3ETHA 5AI8A 4KRYA 3HCWA 4NQZA 4DJDC 3C15C 2PS0A 4DVJA 1X7ZA 3PFGA 2N47A 2GN4A 1VE7A 2X22A 1C80A 3CX6A 3QU5A 5A5VA 2O14A 3V6LA 4KW7A 3QEKA 3ZE9A 4QO8A 4JGIA 4AK9A 2ZUCA 2MR5A 1VIYA 2PA0A 2XRYA 4QOSA 4B71A 4R05A 2PJUA 3NLLA 2ZATA 1RWBA 2BM0A 3A4LA 4LRXA 5LB4A 5IC5A 1K86A 5FWXB 2HSZA 3ZGNA 4LWPA 1IXYA 4HTFB 4M88A 5GTDA 1Y7IA 4YPOA 2QUKA 4W1PA 4RYDA 3HH8A 3RAGA 1JQ5A 1Z82A 3H84A 2GN9A 1UBSB 3PHLA 4WXEA 3TECE 3BE8A 4F96A 1KA9H 3G88A 3ZIAD 3M4NA 4GC9A 4UQOA 3W1EA 5LYJB 2CNBA 3O91A 4DMHA 3TUJC 2A5GA 2PGXA 5J3JA 1Q0QA 3HVKA 1QIDA 3ROGA 3WB1A 4F38A 1RC8A 5DHUA 1F06A 3A1NA 3O73A 4Q1BA 3REOA 3IERA 1ONBA 4H6WA 3LLMA 4AUEA 2IVFA 5F52A 1C1XA 3U49A 2RGAA 1DJQA 1T4DA 1SOMA 4BQSA 4CRWB 2VNKA 4J3FA 1KYIA 3TBHA 4XIFA 4BCBA 4MB6A 3IURA 4X6XA 4BBPA 2OAP1 2NVUB 1BXKA 2WTMA 4PAWA 4X71A 3A4IA 3IIMA 3WGYA 4DM7A 3DVAB 3L0IB 2GD1O 2RHCA 3A1VA 2X5OA 2H51A 3C1TA 4PLCA 4B85A 3RVPA 5LOVB 2J45A 1SCUA 2C99A 2ZAIA 2W2LD 4DWVA 4X54A 1ZA2A 2P3LA 4PLYA 4AF7A 7REQB 4Q3LA 4J0JA 5BMVA 1K97A 1VSUA 3A9WA 1WHSB 2OTCA 4Q4AA 5CH5A 4M7OA 4DV0B 2ASVA 1WW8A 4IEFB 3FA2A 1SKAA 1DG9A 4R6WA 4L85A 4RVFA 5B3JC 2HPHA 2AN9A 2OHHA 2IEYA 2ZUTA 1R12A 4TQ9A 1E77A 1CT9A 4DCJA 3DB2A 4D9BA 3F5QA 1CQIB 1LBSA 4M9XA 1HT0A 4RENA 1HT3A 4HQRA 4J0HA 3OTIA 4L57A 3ZU2A 3NQ41 3ZHBA 3IEVA 4P7GA 2B5OA 4PTYA 2O0MA 3V4ZA 4HEJA 3MK31 3TLCA 1KFCB 3VPBA 3MTEA 1XF9A 3E8XA 5MFZA 2HA3A 1GLGA 2F1RA 3NHPA 5FAXA 3KJIA 4TLCA 1DMSA 3W9SA 2MSKA 1TK9A 1XVVA 2IXAA 1JT2A 3MWJA 1VCOA 4DLZA 1M5UA 1Y8RB 1PGPA 1CQXA 1U0TA 2GZ3A 2AQHA 2IYWA 2B8NA 2BGUA 1YK0A 2UYYA 1FDRA 1TEXA 1VCIA 2WNIA 4NH4A 1UBRS 5IAKA 5KTKA 1RWOA 4I6JA 5IVDA 3R8FA 1LSUA 2B1IA 1NYRA 2I6SA 4BUCA 1FYFA 4CG2A 3D2BA 1Z28A 2CKMA 4HX5A 5CT5A 3M83A 5K1ZA 5BPHA 5JQGF 3THYB 3Q10A 1YB6A 5EZYA 4CEIB 5F3DA 2I54A 1Z38A 2Q99A 5KYUA 2YUIA 3C70A 2VJKA 4ZGGA 1V8ZA 3T38A 1NVUQ 3FZGA 3H6HA 4KHZA 4NV3A 1VMKA 3MFYA 4HNAA 4OJNA 1XVLA 3LK7A 1NVGA 4MUEA 1VB5A 1KFKB 3DMDA 1YASA 3D0QA 2D4HA 3ZBTA 3G9TA 2ODNA 4MZDA 4BKMA 4BLWA 1C50A 3GU3A 3MC1A 3JYOA 1PUIA 5A02A 1E6WA 2HU7A 2B1RA 2ENUA 2WSBA 3IAXA 3PRYA 3GA5A 3LL4A 3Q0TA 4X6YA 5FQNA 4TYWA 5SZIA 2IUUA 4D4IA 2DR3A 4DJTA 3UJDA 4LQCA 2IBTA 2XD9A 5DULA 2H07A 3N2NA 2Y1FA 2LCQA 3I2FA 1QQ7A 4DA8A 4JJ4A 1UJ2A 3KC2A 5G0TA 3MIIA 4YJHA 3HFSA 1N8KA 3SBOA 3COWA 1C4KA 2FPGA 3MERA 4ND1A 4V03A 3HJRA 4Y7DA 5DFAA 2HXYA 4QGFA 4NYIR 2ODTX 4LWZA 1T24A 2GX6A 3CKKA 4FPXA 2REOA 1M8GA 4M54A 3UNXA 4L0MA 2HL6A 5G1NA 4CM8A 1RQGA 3HSSA 3QVJA 3BM5A 2ZPAA 2HHJA 3K9WA 2OHOA 1KFEB 2JFBA 1BOOA 1J49A 3H16A 2G07A 2PXCA 4C6TA 3KOYA 1H22A 2VIIA 4KSYA 5AI5A 3IIIA 1TC2A 3HQ4O 1NXOA 3P4UA 3VBCA 5C0OE 3T34A 4FEYA 3VNVA 2PYIA 5E8JA 3IA2A 3K4QA 2O7RA 4M7PA 4MGIR 5AK0A 2BLNA 4O4IA 4NS1A 1YRAA 1QK4A 1YAHA 2FUNB 3VMFA 1A77A 1PD1A 5DHQA 5F7XA 1ZCZA