1FE8A

Crystal structure of the von willebrand factor a3 domain in complex with a fab fragment of igg ru5 that inhibits collagen binding
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
190
structure length
190
Chain Sequence
b'PDCSQPLDVILLLDGSSSFPASYFDEMKSFAKAFISKANIGPRLTQVSVLQYGSITTIDVPWNVVPEKAHLLSLVDVMQREGGPSQIGDALGFAVRYLTSEMHGARPGASKAVVILVTDVSVDSVDAAADAARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTMVTLGNSFLHKLCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VON WILLEBRAND FACTOR
publication title Identification of the collagen-binding site of the von Willebrand factor A3-domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 60
structure length 190
sequence length 190
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2000-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1fe8A00
4UM9D 4UM9B 3F74A 4CNBA 1MJNA 1SQ0A 4HQNA 3T3PB 1DZIA 4NEHB 1PT6A 1CK4A 1YVRA 2O7NA 2WINI 4NENA 1IDOA 2VC2B 4M76B 1M1UA 3TVYA 2ODQA 3EGDB 1AUQA 5LN1A 1SHUX 1N9ZA 1N3YA 2QTVA 3IBSA 4HQKA 3K71B 1JEQA 3F78A 1YVPA 1U0OC 1ZONA 4DMUB 2NUTB 5KYYA 1MQAA 5KYXA 1RD4A 2X5NA 3T3MB 5BV8A 4O02B 2NUPA 4G1MB 3TCXB 3GXBA 2VDMB 4Z7NB 1Q0PA 4WK2B 3EG9A 3V4PB 3V4VB 3ZE1B 4C2BA 1PCXA 4F1JA 1M2VA 3ZE0B 1QCYA 1T6BY 3EOBI 5KYNA 1MQ9A 3NIDB 5HDBB 3EFOB 1OAKA 1FE8A 3PPYA 4IHKA 3IJEB 1ZOOA 4MMZB 1BHO1 1DGQA 1JLMA 2IUEA 3EH1A 3PPXA 1V7PC 3EGXB 4HQOA 1M1XB 1FNSA 3HXOA 4IGIA 1IJBA 2I6QA 3FCSB 1JV2B 3VI3B 3ZE2B 4F1KA 5E6RB 1JEYA 3HI6A 5E6SA 2XGGA 4CN9A 4CN8A 5HJ2A 3E2MA 5KYWA 2I6SA 3NIGB 3K6SB 2VDNB 4A0QA 2ADFA 1NA5A 2VDLB 4Z7QB 5E6UB 2XWBF 4UM8B 2M32A 4NENB 3TW0A 3EOAI 3ZDYB 3ZQKA 2WW8A 2ODPA 3PPVA 5E6RA 5KYUB 1TYEB 1QC5B 1T0PA 1IDN1 3NIFB 4XW2A 1IJKA 1M10A 1ZOPA 1PD1A 4C2AA 4WJKB 4C29A 4FX5A 4IXDA 4WFQA 3Q3GE 1JEQB 3BQNB 1L5GB 4MMYB 2VDQB 1PD0A 3EGXA 3EGDA 3M6FA 2VDRB 2NUPB 3PPWA 3BN3A 3FCUB 3EG9B 1MHPA 1AO3A 1MF7A 4WK0B 3HXQA 1LFAA 1M2VB 2NUTA 3BQMB 1M2OA 1AOXA 1XDGA 4G1EB 3TXAA 2ICAA 3VI4B 3K6SA 4MMXB 5E6UA 2XWJI 1SHTX 3K72B 3QA3E 1U0NA 1UEXC 3N2NA 2NVOA 1RRKA 2B2XA 3EFOA 1QC5A 5KYUA 3ZDZB 4BJ3A 1CQPA 4HQFA 4PN7A 4HQLA 3EH2A 2VDPB 4JDUA 1RTKA 2I91A 4Z7OB 1MQ8B 1JEYB 5KYYB 5ES4B 1BHQ1 1U8CB 5E6SB 3ZDXB 5HGJA 1XDDA 5KYXB 3RAGA 4WK4B 2VDKB 5KYWB 1XUOA 2VDOB 1ATZA 1RS0A
chains in the Genus database with same CATH superfamily
1IN5A 4XWYA 3S29A 3Q0IA 5FPHA 1NYQA 1Q0UA 3H1BA 5HTKA 4H59A 4BE9A 2Z5LA 1LVHA 2I87A 2R4TA 2X3UA 4NCAA 1Z82A 4B6EA 1CJKC 2RHTA 1KYTA 5JLAA 4K81B 2EERA 1F6WA 4FR0A 4D99A 1RQ2A 2BT4A 4D3DA 2DPHA 4ZYLA 2HF8A 1IVNA 2A0YA 1T6ZA 4MYHA 4P92A 3IX7A 3U4CA 4X60A 4EQ6A 5FBVB 4HH0A 4K6KA 4PG4A 2QLMA 1IMOA 1OD6A 3GBPA 1U8FO 1ZMBA 4O5OA 5TS2A 2NU8A 2PWPA 4LX8A 1Y48E 4XGIA 4HR7A 1RXIA 3ENZA 3DMTA 5CYFA 3ZCQA 2E85A 1ADBA 4I4TB 3ZHVA 1IN4A 2YQZA 1Q2XA 2BMEA 1C7EA 3SSOA 4BEWA 4ENSA 3T54A 2R87A 3LFTA 4JC5A 4DSAA 4CBVA 4HWSA 5FQNA 1U0SY 2D00A 4YCLA 3QU2A 4LY9A 3CLRD 2HJRA 3OPXA 4S3MA 1YJXA 3CKYA 3MG9A 1X7WB 1RQRA 1EFLA 2BGRA 3FGOA 4OP2A 3R0IA 4RD0A 5GADl 1TU0A 3G7UA 5J4KA 4AQ7A 4ABTA 2IS1A 1DRKA 5F5XA 1N6LA 1Q15A 1THGA 2IHVA 3EVCA 2FQYA 3UJ8A 1WMBA 4M99A 5DM4A 5YASA 2F1OA 4DEVA 2V8OA 1FYVA 2SBTA 2YWRA 1IK6A 1NUSA 2XGGA 4L2IB 1R6AA 5KHAA 3NHAA 4M1YA 3AT1A 3IUBA 3RYCB 1QVWA 1J56A 1RJDA 1NA5A 3NHKA 1G4UR 5K0FA 1JB1A 4DQDA 5JI3E 3QIAA 2PZMA 4X7BA 3OQNA 5T7BA 1NWCA 2Q3LA 1FRVA 4OAPA 1Y3BE 4LWZA 3UH0A 4DPKA 5JC1A 3C3KA 4IGAA 2R84A 4CV2A 1OKKA 2I7CA 1IU9A 1H42A 1MV5A 2QKYA 4QUHA 3SIPA 2Q3HA 1OLSA 2O0MA 2R8EA 3FHOA 3L8GA 2H0QA 2VF7A 3IOYA 4NRDA 4DM7A 1D5CA 4XD2A 1SNYA 2ERXA 1FZQA 2E0IA 1VC2A 1G98A 1MF7A 2QPOA 3FTCA 2BJWA 2H11A 1ENYA 3PRKE 4IVRA 4PU0A 4BU0A 4EM6A 2JBWA 4EZEA 1PGNA 3I61A 1OGJA 2FDRA 3OTOB 4D92A 1ENZA 4BAUA 1ZD3A 1GPBA 1S2NA 3DHEA 2P4SA 1E5XA 5L3QB 3JPYA 4I9NA 4OH1A 3X3HA 4TS1A 5BSMA 2YH2A 2O05A 3ANSA 4B7UA 5HKBA 3EFBA 2A4KA 4FNAA 8ABPA 5KOJB 1RRFA 4KYTA 2E4YA 5EJFA 5CB6A 1L7QA 3CWCA 3U7IA 2B7LA 3VHLB 3I0MA 2P30A 1FF9A 4NH4A 1Y9AA 1V5FA 3CH7A 3ECAA 4PRYA 2G7ZA 3LT5A 4TKUB 4C4PA 1W36B 1PP4A 1DEAA 3QIVA 4QAQA 3FTDA 5FBZA 1H1TA 2EKDA 3NGLA 2YWFA 2ZE6A 3I34X 1T0UA 3VPSA 4RWEA 1FFDA 4ZU6X 2HL6A 3OWHA 4MYTA 4K6CA 1P4JA 2HCRA 2FNAA 2UVQA 4LRYA 4MUNA 2I2XB 2FWMX 4IHJB 5ALFA 3RYHA 5TMDA 2PSJA 4RLQA 5FTJA 1N2OA 2HDOA 2KWIA 1PHPA 2NT3A 2P9QA 2Q2WA 3JRWA 3K8YA 3KQWA 1VP3A 4MYDA 1XMPA 4I5DA 4KYVA 3WSVA 1O94A 3IAXA 2H7VA 3PVCA 4DYDA 3UB2A 2J9RA 2PXHA 2KJQA 4HLUA 4GMGA 1YJBA 1E7WA 1ZSNA 2WHEA 2L2QA 5KNCH 4M9RA 2ECOA 2CSXA 1OGYA 1N34B 2G17A 1BHJA 3VHRA 4L5CA 2VRBA 3UB4A 1EWYA 4MGKR 4C2TA 2JVIA 4CMHA 4LY6A 1UJNA 5D7NA 3R9KA 3RVBA 2R0QC 4Q3DA 1CP2A 1ZK4A 4PAGA 1TIBA 4G5YA 1ZYUA 5SY6A 4B75A 2ZPAA 3SLRA 1FZTA 2XCIA 3ED5A 5I9LA 2O5EA 4UTNA 4LF7B 2QG4A 4F2WA 2YQ5A 2REBA 3N75A 1KO7A 2P0EA 3I42A 4JVSB 4COKA 2XNCA 4CETA 1GIAA 5KHLB 2H2WA 3NPMA 3JQRA 4XGQA 3H83A 1C3EA 3DZGA 3PQFA 2O52A 3V8QA 2RGWA 1YDMA 4L5JA 3DAFA 3JQAB 4HYEA 4IYJA 4BQRA 5K8TA 4OHYA 4IXMA 1UK7A 3V8MA 1HRKA 3HKBA 2NM0A 3EZNA 3PUWA 1R6VA 5FUYA 5AYVA 4HMOA 4M49A 4MR8B 5DLQC 2FPPB 2PIDA 1JI0A 3QPDA 1DCTA 9ABPA 1ZOIA 2JGKA 3UPTA 3WJAA 4CF5A 1V8PA 5BPHA 4D0NA 3DXXA 3OQBA 5JPCA 4OL9A 4WLNA 5ALYA 3R8XA 4DB4A 1J6UA 3A9VA 2QUJA 4QREA 2O8CA 2AN9A 2JZOA 3MGAA 5ETJA 2HK6A 3NIFB 1KI6B 3H5NA 1NMEA 5EKTA 3LS2A 4WJKB 5EHGA 4KH0A 4NE2A 4C76A 1L7AA 3I73A 3NEAA 4BQOA 1YDWA 3OKPA 3ROXA 4NXNB 3RTGA 1CULC 4L3VA 4F8YA 4YRBA 2OESA 1NBMA 4W8GA 1JXOA 4HPWA 3C41J 1UXJA 3D4BA 4QXAA 2POCA 3X43A 2IGTA 1ZICA 2GM9A 2OAGA 3AQ4A 4PGAA 4WN9A 1WX1A 5FADA 4OSOA 1LGYA 3OX2A 3GJ0A 5REQA 5G41A 2J0UA 5AP9A 1G18A 1T34A 1KH2A 5AI6A 1NRIA 3OX4A 3C3MA 3C97A 2X41A 3DPUA 3MZ0A 3KV1A 4P58A 1KBQA 5I9MA 1QB8A 4GG1A 2DGDA 2JCGA 5DB4A 4ZZ3A 5HKAA 1TLTA 3QLEA 3QUBA 4GRDA 3EBPA 1V45E 3DEFA 4JVOA 4YP9A 3WV4A 5KCZA 3FI9A 5KTOA 3TZQA 1M76A 1W4CA 1M2WA 2FUKA 1XK6A 3JY6A 1XHEA 1PT7A 2Q1XA 3CSSA 2WLSA 1IWBB 3UZUA 5KUTA 1EXDA 4BRZA 1FJXA 2P5UA 4GZMA 1RSZA 3SY8A 3LQRA 2H1FA 3MQ2A 4CR7A 3HU3A 3TQFA 2C96A 4MQ6A 3F74A 1HMPA 1QO0A 1BS9A 4KWIA 5MHTA 2PX6A 3TLBA 1O0SA 3WKEA 3Q98A 3BB1A 5BW4A 1THTA 3C1UA 4E03A 4F8EA 3MWDA 2WYHA 5DBGA 1QQAA 5K3BA 2XNKA 4JD5A 2WYWA 1W5SA 5EMMA 2ZJ4A 1GA6A 3BMXA 4PRKA 2LR0A 4KLCA 3KVVA 3ZLBA 1BCSA 2FXVA 2BJVA 1ISIA 2VHYA 3LT4A 1XWIA 3OIGA 5DTQA 3LP5A 4I3GA 1GZ4A 4LK2A 4BFLA 5DIFA 2HN9A 3R40A 4HDAA 3C6KA 4AO6A 2X2OA 5DFAA 7ABPA 3WRWA 3EC2A 1U0TA 5J2TF 1UBMS 3VTFA 3OLCX 2Y1LA 2ZPTX 5P21A 3UCEA 3V1KA 4DR3B 1ESMA 1W1UA 1CUXA 2ZI6A 3EGCA 1K2VN 4HX9A 4WVFA 1E99A 5D7BA 5CDSA 3HNOA 5TV2A 4U5XA 1QQ5A 5KYNA 3LO5A 1MQ9A 3BE4A 3C74A 3EMDA 4J7AA 1VM6A 5K0TA 2IS4A 4AJ2A 1J0XO 2VK8A 3IJEB 4ETNA 4C20A 2BFFA 3THYA 1CZUA 1N0HA 4YT5A 3B3JA 3TG2A 3FDXA 2GN0A 2QVBA 2C5EA 4EB8A 4I99A 2SCUB 1ZHFA 4DREA 1B41A 3CRW1 3M6IA 4KDFA 2A5JA 2B36A 3GRKA 3KJIA 4G1UC 3KD2A 4M9UA 2PMEA 2B4TO 1EFUA 1HNXB 2FR8C 3QSYA 4L95C 3DOFA 4CEHA 2CK3D 5MFPA 4B82A 4H0FA 4KX3A 4LMBA 1CRWG 1LY1A 2P35A 3CN7A 1LNQA 4MW7A 3RF6A 1IM2A 3HKDA 3NC4A 4A0QA 2ZRQA 1TZKA 3UMSA 2ZJYA 3DXZA 2VKTA 2Z3WA 2ODPA 2E5WA 3EC7A 4HATA 3BRWA 1JA0A 4FI3C 4MAAA 3RYIB 4DXDA 5MF6A 3DZKA 2ZKIA 4X54A 4V1CA 3V2HA 3PD0A 1FVOA 2B6NA 2G8LA 3HSKA 4KIJA 4PLCA 3TW4A 3ETEA 1P44A 3EUWA 4Q3EA 4EFKA 4MV9A 1XO1A 3QWBA 1V39A 4MQLA 1LK7A 1V4VA 1V96A 3O8NA 2LKCA 1C3JA 1QCDA 2ES4A 3BJEA 2X8AA 1R3DA 5M3BA 3VPAA 1OI3A 4JSYA 2GRJA 1PVVA 3PPWA 3QLUC 5B30A 1P0PA 1U9CA 1XWWA 3D4OA 4PAWA 2GN1A 2OCLA 3ENQA 1GD1O 3PQ6A 5DRTA 2WIGA 3ETLA 5ENZA 3WBBA 1Z18A 5LQMA 5JASA 2HTFA 3MCVA 2G28A 5IM5A 4C6HA 1E61A 3FLMA 5KWEA 4RVFA 3HV0A 2A14A 2Z56A 4IINA 2GRAA 4MGHA 4EL0A 4CLDA 2OFXA 3QF7A 1HM5A 3FIUA 3DSRA 3G1UA 3NRBA 4N3AA 4P8RA 2X4GA 5L4LA 3ZHZA 1HLPA 2HA3A 4MR9A 1HL3A 4L6AA 4B8YA 4C0JA 4B87A 2G70A 2PS1A 2YV1A 3H6HA 4PO9A 3OCVA 5K8IA 1ORIA 4P93A 2Y6UA 3DH0A 1CZOA 3GLIA 2P3LA 4H7FA 3AJ8A 3PRJA 4IQGA 2E87A 3DKPA 3TIGA 1V9CA 1LPPA 4KSYA 1P4RA 3RSFA 3WGQA 2XX3A 1NUAA 2OTCA 4V38A 3WNZA 3RKSA 5SZIA 2JLUA 5B6PA 2B1QA 3GGOA 3PQ7A 1VJDA 3D1LA 3DLTA 1Y9ZA 5LLTA 4I5IA 4GKVA 2C84A 1ULAA 2HA6A 4HKTA 1KR2A 4ZQFA 2XTJA 5DDIP 4YALA 4MVJF 2DUMA 2IV3A 5I8WA 1SOWA 1CF9A 4GP9A 3FPEA 5BQ5A 1Q1EA 1U2RA 4BDSA 5B1SA 1Z6ZA 3R5XA 2L42A 1KAOA 4HS4A 4I7EA 2WC1A 4N8SA 4DLTA 1XOIA 1JFTA 3PCTA 4GXQA 4NMXB 4B6OA 4ZEVA 4MVYA 3BL6A 4ZI7B 2IYLD 5T57A 4BX3A 3KL4A 3O8BA 1E64A 3WLLA 4C7VA 1T9DA 3B8HA 5C1BA 1LZLA 2RHBA 4DKXA 3ORSA 1T2VA 1WCYA 4QYTA 4N5MA 1WMEA 3QWIA 3K4PA 2KW5A 1PCXA 2XF2A 4OGFA 4DSTA 5HM8A 2EWWA 4JZYA 1LDEA 3EE6A 3QLVA 4MQ4A 2QSYA 3T15A 4UM7A 2JCVA 4UHJA 4FOLA 2BP7A 4B6FA 3E84A 1MTOA 4G4IA 4B3JA 4KDRA 3S5UA 3FNBA 1H9BA 4OBBA 5K0LA 4D9BA 3MYYA 4DPLA 4ZDIA 1UWLA 3OFKA 3MAAC 1TEVA 2KPOA 1UAGA 4UFPA 3BF7A 5JWOA 4FEAA 1BS1A 5KC8A 1JJIA 4U2CA 3HABA 4DZTA 5A3JA 1OLXA 1Y8RA 4FE7A 3ZGLA 2GF0A 2QY9A 4YN3A 3RVSA 2QUBA 5HFNA 3Q2KA 4GBJA 2GK6A 1P5RA 4O2AB 3T4UA 5IVKA 4LF6B 1QZUA 1WPQA 2B37A 3EZYA 4FZRA 3T99A 4HAUA 4LDAA 4N0MA 4F91B 1ICIA 1Z25A 1ZD8A 5CYOA 3TQCA 4Q4CA 1ATIA 1ZOLA 3RASA 5BOVA 5IDYA 1GVNB 1VMAA 2K7FA 2UXDB 2HFJA 4TXLA 1ONPA 4K6HA 3LSTA 1EK6A 3B1ZA 4ZYYA 2C61A 3PJDA 5LZ8A 2IDZA 2HBZA 5GV7A 1JLSA 1YIDA 2JARA 2XNDA 3NNSA 5KMGA 3VQTA 5AHOA 1TD1A 4J1SA 3DDUA 1RU3A 4TWJA 5C9ZA 4OUKX 3PNVA 1E0AA 4MI6A 3N86A 2DBQA 1U04A 3N87A 3TTXA 1MB3A 3OQ6A 4F3YA 5K3EA 2EJWA 5FPQA 4QPDA 1DIOB 1ZS9A 4UBIA 1OT3A 4NYMR 2XT9A 4M3NA 3ZR4B 4KH1A 3JTEA 2GJKA 5JD4A 2AKAB 1GUBA 4I1UA 3HCEA 1TKAA 3QPWA 4JYZA 4XYEA 3OESA 3G9UA 2GZRA 5K1ZA 1G59A 4M1KA 3NVKI 5KX5F 1HEYA 4M89A 3PFBA 1ZNQO 2XUKA 1EE1A 1CR6A 2C2ZA 1A9PA 2E6UX 1UBEA 3LA6A 4WDQA 2NPFA 1AK2A 3AZPA 1V6AA 3FDZB 5AQ1A 3K72B 3N0XA 1R4NA 3R20A 3THSA 3U09A 3FJ1A 1E9EA 5DW3A 3O90A 1D6SA 1HOXA 2W4IA 2IX9A 1L1FA 4NF2A 2YR0A 3A3YA 1ZKMA 3W0LB 2Q8PA 2A0UA 1HC7A 4PQYA 1GGMA 3G9XA 5A06A 3JQ8B 4A1FA 2FPOA 3CUSA 3D5QA 1QR2A 4D4IA 3L7KA 4GYJA 1YCGA 4LJYA 4ZFNA 3EIXA 3P26A 4CMBA 4IUCS 3I4CA 2FW7A 3GLIE 4NE9A 1M67A 1E1RA 1LV8A 2JA2A 1S0UA 1GQRA 2LDBA 4WLEA 2DTEA 1BE0A 3A9CA 3ROKA 1IM5A 1Y3CE 1TYZA 1YVRA 3II6X 4YMWA 4UUOA 4NOJA 2PD3A 1YS7A 4JJ4A 4BZWA 2Q4EA 1K7SN 3V8PA 1FYFA 3RS3A 3CM0A 4XIJA 3VO2A 3C7TA 3H3FA 1EBBA 2UZ3A 4DUGD 3AVYA 5CA1A 3G6KA 3ISJA 3IBSA 1GU0A 1RYEA 2XUHA 3IO5A 4FEYA 4FSXA 4OK6A 2Y4NA 2H1SA 4R2HA 1E9BA 2R6AA 3I45A 3ROTA 3TRFA 1HKUA 1R16A 2A0WA 3HCDA 2ATVA 3PC4A 3PS9A 1W85A 2V0NA 4ZALA 4EHLA 1ZVKA 1IATA 4N0QA 3DLIA 4IXTA 4C7OA 3BFKA 3AR6A 3AEQA 1DAOA 1JAYA 4UNPA 4K7JA 5C1OA 2JGDA 4D3SA 1I3KA 4KO1S 4M8NE 2Y9PB 3A0RB 4JUDX 4DMGA 5HPYB 1XMVA 4EFLA 2VYNA 4XM0A 5F7ZA 3BB3A 1C4XA 4RZXA 1R37A 3L7CA 3IFSA 3ZV6A 1ZXXA 1CE8A 2B20A 4EAAA 3M3HA 3B51X 1SUFA 2FVXA 5E7MA 4TYNA 1P4AA 4FILA 4GO1A 5HMMA 2X0JA 4UMFA 4G0XA 4ZVLA 3VI3B 3ZE2B 3E0QA 3G2MA 5FRDA 4DXAA 1AQIA 3DOIA 3AF5A 1TK9A 1IB6A 1UR5A 3OC6A 1BQEA 3ASVA 1JHYA 3TFQA 1XQ9A 3A4IA 2CFCA 2WJZB 3SZGA 3WHIA 2ADFA 4G09A 1N2HA 4L0CA 3B9RA 5AHKA 2CJYA 1P60A 1CSEE 4H77A 1KZYC 1JYSA 2R6FA 2B94A 3EA4A 1P1IA 1GCAA 3A8TA 4RA9B 2NAFA 4CKWB 3D3WA 3GEBA 4WSOA 4G65A 4AECA 1QIDA 2R4UA 1O7JA 2HMAA 3AFIA 4OU4A 3GZ4A 3L6EA 1G38A 2Q8NA 3AR5A 4E3ZA 2GBFA 4Q7QA 3RSQA 2G36A 1N0VC 1TJNA 2VPXA 2Q0XA 2Q5CA 4RSRA 3NYIA 4QDTA 1OYOA 3A6DA 5HKLA 3WX0A 1L9XA 3I5UA 4BVKA 1MB9A 1XKXA 1Q0RA 2P79A 1D4ZA 3ETDA 4QFBA 4Y9RA 5DNVA 1JS1X 2DFTA 3F7TA 4IG9A 4M87A 3HL4A 1YFLA 5CG1A 1RBQA 1AX9A 1RLTA 2GF9A 2W43A 1B6GA 3UGTA 1JLLB 2I0FA 4WINA 4Z51A 2RI0A 2XWJI 3AIKA 4NCKA 2XUJA 5CX1A 3TINA 2WF5A 5JMPA 3HKCA 3SZUA 3VZDA 3I6ZA 1NSYA 4JHXA 2BFEA 1X1EA 5DMXA 5HIMA 4YQZA 3OOJA 4YWJA 4LZAA 1W4ZA 3TZBA 5KYGA 3I0NA 5IN5A 5K20A 4IGFA 4A5SA 2IYRA 3B6EA 1GTSA 1E59A 5E9JA 3N8KA 4FE4A 2HMUA 2AV6A 3C16C 3FFAA 2I7DA 1PJRA 2AG8A 3K9WA 1R88A 3USCS 3WLTA 4BE4A 2HMTA 2QOEA 2HIGA 1DI0A 1RQXA 3JWEA 4EKNB 5KNCA 2X4LA 1SUBA 1G20E 5MN5A 2BYTA 4LJ9A 4NARA 3JZMA 1PG5A 1NN3A 2XQIA 3DBRB 3AVTA 1ZM3A 3H4TA 4RSMA 1UJMA 4A4DA 2CXHA 3A0UA 4I9FA 2HDHA 4PS1A 5C5EA 1ZWLA 2B83A 1EXMA 1T1GA 4F38A 2VPWA 4CM8A 4WQMA 3WRXC 4R0NA 3AW8A 4P0PB 2CLIB 3NBAA 1IZ9A 1E6KA 1RI2A 3M33A 1P6UA 4QOJA 3VSDA 4YJ2A 3TW8A 1S3SA 1NVBA 5B6IA 3AVXA 3LVQE 3M83A 3WFIA 5TMBA 1E60A 2C07A 2ASVA 3EASA 5EI5A 2Z6QA 2ZYIA 2D1RA 2GDZA 1EZ1A 2NUPA 2XJ9A 2LIVA 4MCAA 3VH4A 1VYTA 5HMLA 2A86A 1YQEA 3ITKA 4ACAA 3CVWA 2Q3EA 3PTZA 2R47A 1UOPA 2PEYA 1MKYA 3KFVA 5AI8A 5EIHA 4TYMA 4YPFA 5LFAA 4RK6A 1M1YA 2RGDA 3N70A 3C8MA 5CPBA 4LHEA 3OBIA 4UTRA 4UCXA 1F2UA 4Q48A 2V6MA 4DB2A 3LTEA 3V8EA 5BSFA 4KLNA 1G5TA 3BWCA 2CMGA 5JQGF 4YLYA 4NZPA 4WTOA 3FZQA 4BV8A 4CHGA 2J8ZA 2QNBA 3A3NA 4ZRMA 4JU9A 3NV9A 1F9AA 4WCFA 3TJMA 2PUEA 3K6RA 1GP2A 3EQ6A 4ROTA 1Z5WA 1E1MA 4TXJA 3WGNA 5IASA 3PGA1 3KLNA 3VR4H 3DT6A 5DASA 3DDOA 2ZB3A 3ROQA 2WABA 4BKPA 5EMKA 5GAJA 1L7RA 3NAMA 1OPRA 5CR9A 3CWZA 2COKA 1D1QA 2CDRA 1RW4A 4AMYA 4EL5A 2JNWA 3EVDA 3SHFA 2WHQA 5SZKB 1QQTA 3EJWA 4DJAA 3BWBA 4F71A 1KIAA 1WAMA 1KWKA 2IZ5A 3INNA 4LCEA 5BR1A 3AXTA 2G5CA 4M1TA 2C2KA 2F1IA 4ERNA 3PTAA 5F1PA 1FSFA 3DNFA 4WNYA 2EBWA 2OEPA 2AG0A 2K2QB 4UOQA 4JI3B 4EG0A 3B2EA 1A9OA 5TEVA 3SKYA 4C01A 1BRTA 1Z2CA 1NXOA 2FCRA 2J7PA 2O8VA 2WWTA 3IESA 3A6LA 1IUOA 3RS8A 5CPFA 3UYLA 2WD7A 4TRMA 2ABWA 3X1YA 1KSFX 5DH9A 3SDBA 4NBRA 3TG8A 1FEZA 2V8BA 3A1WA 5TF4A 3OM0A 3LAWA 1F0YA 1EP2B 1DC6A 1QC5A 3H11A 3BXPA 3KE9A 3TUZC 1UMCA 3NBFA 3HTXA 3IDOA 2RHMA 3AGQA 3M0EA 4IX1A 2R1VB 3OU7A 4GT1A 4URHA 1VIVA 4AKSA 4CKEA 1E9SA 5HCNA 3WB9A 4OOFA 4RFLA 4WNCA 4ZV4A 1YQDA 5JD5A 3EXIA 3BFJA 3L3BA 5HQ3A 5L6MB 2FOIA 2FRDC 3PQ5A 1EUCA 1TCAA 2BGTA 3C5VA 4CMIB 2I6XA 4CI9A 4YAKA 1QVRA 3TLCA 1X1BA 1A69A 1CIVA 1SCAA 4H17A 4YB8A 4BCCA 3L7LA 1LBSA 5DYWA 1MLDA 1CP3A 3DV9A 3R3HA 5I7SA 4F2DA 1H05A 2JGRA 2AGVA 1O9HA 4JLKA 4PBRA 4B3GA 1M7BA 1P1FA 3Q3HA 2AEEA 1EWRA 4ZTUB 2W42A 4YYZA 2DFNA 5TX7A 2VTKA 2ARKA 2JFHA 2IXDA 3GLUA 4HLCA 4TWBA 5JT1A 2QNIA 3Q15C 2RGBA 3A10A 1E2PA 5JUWA 1SQ6A 1GPYA 2B2CA 2FXIA 1TQDA 1JEQA 3FAKA 2CFIA 2QAGA 4DMHA 1AQYA 4YRJA 4MQFB 3AY0A 3ZZMA 3RODA 1JHQA 3U49A 5T4FA 1AKRA 1I3MA 1OI4A 3COWA 1X1SA 4ID9A 4X7PA 4OI0A 3WB0A 3QF4A 1MAWA 1ZH2A 4L3WA 4X6LA 1NLYA 2YRFA 4FMCF 2MIIA 2OV3A 1B3RA 1P61B 2B9EA 2QSZA 2RGAA 1KC1A 2X19A 2X76A 1J23A 2XY4A 2FZWA 2JA1A 4TMXA 1OZ0A 1OC4A 2RC6A 3WDSA 5CJPA 2MSKA 3WLSA 1ZC3A 4TLEA 4ZOQI 2QM8A 1ZA1A 4UXHA 3K0AB 4GMFA 4P4GA 1KJQA 1S2IA 2JLSA 2IUEA 4X24A 2H0AA 4M1SA 1V95A 1I3NA 2DYKA 2JBAB 1VPLA 2VEDA 1E3WB 3L0ZA 1RAEA 3E5NA 3HU1A 4GIBA 4M8IA 5LA6F 6REQA 5DO9A 1W73A 2EP8A 5CBKA 2F4VB 1DX6A 3AR8A 1NT4A 1Z35A 2EBHX 1SAYA 3IEXA 2JAHA 1A4XA 1XZFA 2A35A 2CHUA 1VHTA 2LKDA 1VE3A 4M53A 3ZBUA 1X3LA 2Z95A 4Q3NA 3C24A 2IPNA 2O3RA 3EDYA 4FEGA 3N2KB 1N6HA 4I81A 3OQ1A 4KW7A 4NYIR 3OM1A 5C5DA 1QVZA 2XRMA 1Q5PA 4PQFA 5IWCA 2XNJA 4QBTA 4GOND 4Q03A 4X6UA 2OL4A 1FUYB 3VU9B 3MXTA 4ITUA 1RKBA 4QUKA 2Q5EA 1TI7A 3CUUA 3IDZA 4C2UA 2KBFA 2ZRCA 3X1ZA 1JG1A 4BVLA 3U60B 1RJ9A 2WWGA 4KRGA 4ZO7A 1YQ9A 3Q4GA 4ZQCB 4Z3DA 5IJ0A 4NYJQ 1SIUA 1TLLA 4RHXA 1JMKC 2PQ2A 1YS2X 2PXAA 3NC0C 4MRVA 4II2A 2QLBA 1USKA 1ZI6A 1Q7GA 4U00A 3RYTC 1LPMA 1YSCA 4QT4A 5BVGB 4J16A 2JW5A 4BTEA 1U0HC 4EW6A 1N6KA 4Q93A 1PK7A 3WGZA 4NV1A 1OXUA 4YNBA 4YJ3F 2P9ZA 1YAJA 3VI4B 5A9RA 2VQDA 3IT1A 3I01M 4M1WA 5FI5A 4Z9AA 4Z5XA 3EQZA 1L5RA 1WJGA 4NU5A 3WWOA 1T3HA 4L7QA 3LJKA 3UFBA 2P9GA 3PSHA 1A2QA 1F9EA 2B7BA 1NZJA 2OP1A 3DV0A 1QH8B 3ICWA 4JENA 5D2CA 1PW5A 3AWDA 3N53A 3ORFA 4NCXA 4R6XA 3T9CA 5C8DA 3IUEA 1XI2A 1Z2AA 4ND3A 3C45A 1X7GA 3N2ZB 1FRQA 5EHNA 3RG8A 4UQLA 1V7QA 1JXAA 1I0IA 1AE1A 1BXRA 1AZTA 3K9GA 1XN4A 2HDWA 4YUXA 3DCNA 2ZWIA 3E05A 4WFKA 2ZSUA 1GN9A 1PZHA 2ZWAA 1H8EA 4ZU3A 2AF4C 4ZT3A 4Z8YA 1ABFA 1W34A 3DR5A 4TTTS 5B58T 4CKBB 4R01A 3ZNOA 1JBEA 1QNFA 5IJ9A 2YIJA 3RSZA 2C8KA 4N0PA 1JJ7A 5JCZA 3U61B 4NEHB 3CFYA 1PT6A 3I9FA 4DJFC 5JADA 1I24A 4A3SA 2BAGA 1DWQA 2X1VA 1ZQ1A 5DM70 2JK0A 3CW2A 1JU3A 4HAYA 5FHQA 1JEAA 3G2JA 1L3CA 3DR3A 3N59A 2ATCA 2EU8A 3D7RA 4IH9A 5K09A 1L7XA 1BMFA 1PTJA 5HBRA 5ENDA 2VA8A 1PYDA 4LC9A 3UNXA 4X94A 3BT7A 4OU5A 3UMYA 4F3CA 1VIMA 1Z8NA 2B8JA 4PYIA 2B69A 1FFCA 2WKPA 3QPVA 1Z7YA 2P2GA 3MHTA 2J3IA 1TO6A 3D1JA 4K03A 5AR1A 4GWKA 2FW0A 1OA1A 1LBIA 4YCDA 2FRVA 4KYUA 4G0NA 4CQMD 3KT6A 1D2RA 4ZKEA 3ESQA 4R83A 4F1WA 1YO6A 3GGGA 5JFOA 3GJ3A 1V11B 3L0SA 4L51A 1H4QA 2IIVA 4A6EA 2WJGA 3PC3A 1KO1A 3HUDA 5KVQA 3R7WB 3SBDA 3KJNA 2O2EA 4JQZA 5JYDA 2BGGA 1C2TA 1PSDA 3LLUA 1ZLYA 4DDTA 2VO1A 3F7MA 1JKXA 2I2WA 1MIOB 1PRYA 2ZRJA 5FUXA 4CT0A 2CXOA 3L9WA 2O5VA 1M1NB 4EIWA 1RYHA 5FA8A 2C4TA 4ER6A 1ZL0A 4HXEB 4KN5A 5CXQA 5A0FA 4K9MA 3DDHA 1XEXB 3LM8A 3WWZA 3OM9A 3QEMB 3CURA 2W2VA 3WAKA 3MHPA 3OJEA 4LHZA 1KQFA 1XR3A 4TMWA 2R4QA 4F45A 2PT6A 1QRDA 1YZNA 5KTTA 1BMTA 3L1IA 2FUNB 3JSAA 1FRZA 1SQFA 3IYLW 4H3KB 2LCIA 1XTQA 2OUIA 2BTEA 3EQ2A 4MS3B 1XQ1A 2EIHA 4KVFA 3HA7A 4O5AA 1TC1A 2XUQA 3SM9A 1R5NA 3L7OA 2HGZA 4I08A 4W9NC 1RPJA 5ALNA 1WF6A 3BEDA 2W48A 1S2DA 1ML4A 2C83A 2FPLA 3WWDA 1R9JA 1J97A 1HZZA 2O7QA 3BD9A 2ZIGA 4JJGA 4QQNA 1FFYA 1MNAA 4L9SA 4N82A 1XJ5A 3WQSB 2FN4A 4C43A 5BMVF 4UCFA 1BE6A 1CS0B 4I50F 2HWUA 3NALA 1A9RA 2P27A 1W5AA 1DDIA 4M8KA 3THXB 4UTZA 2F8SA 3EDQA 4DR4B 1JG7A 3BG5A 2VXBA 2CN1A 3ZCTA 4I9GA 4CMEA 2HSWA 4ZOAA 5CA0A 4L50A 4D56A 3PL5A 2B2XA 2JIMA 2IP1A 2HSGA 3NTUA 2WNIA 4RY9A 5L3RA 1QFXA 1YBVA 3VTAA 5A5DA 4AJPA 5LP6F 2HADA 1L7EA 2OXFA 1G16A 2Q3MA 2R2GA 1FDIA 3H9QA 5H4HA 2FP3A 3CB2A 1SBNE 4MWEA 4PXAA 1MA3A 2VDKB 3F5SA 2NP7A 3EA5A 3KU4A 1JR4A 2QU8A 4MKIA 5I3CA 5JSZB 5E1MA 4L3OA 5F23A 1IRXA 2MSWA 5CDFA 2NO1A 2V7VA 1SN7A 1E6LA 1H2XA 3PXBA 2BGLA 4M0KA 5JE8A 3RJ5A 4YACA 3TTYA 4CNBA 2DAPA 3A3KA 1I30A 4PRLA 1AG9A 2ET6A 1Z4LA 4NE7A 5BORA 3TUIC 1T6YA 2PZJA 2XE4A 3DF7A 3IUMA 3KR0A 3EWIA 4HZUA 4IIFA 4QBKA 4DG9A 3U6KA 2YX1A 3B6ZA 1FS4A 3IEPA 1VI6A 3RVLA 4MA0A 4WFJA 1GFZA 4KHPB 3BL8A 4HK4A 2MYTA 1A5AB 2HLDD 4RZ2A 5HS4A 1QQBA 3IO3A 1ZL2A 5FAXA 3EIFA 3NM6B 1GGJA 1XFAA 3WISA 2JLXA 2CVHA 2UYCA 2CVOA 2FN8A 4RL6A 4NG4A 3DW3X 4JOCA 4BVFA 2XE8A 2LXNA 4XVUA 1K7EB 4C1NA 1HDXA 4TWAA 4WCDA 5HIJA 1XMOB 2OZEA 3NBZC 2FSGA 3G8AA 2I4TA 1NXSA 4TQGA 4JROA 4OMDA 4BVBA 5AKEA 3HXLA 1ZN9A 2CXSA 4HFNA 4I8DA 1BXKA 2FVYA 5L53A 2D06A 4EI7A 1IRIA 1DAGA 2O7RA 4M21A 5BY2A 3GJ7A 1PR4A 2BM1A 4QPZA 5IK2D 1GU7A 1TTHA 1R0LA 3EZFA 3GG9A 2ZTMA 3MTDA 4G24A 1R74A 3NJRA 4YGXB 5IBQA 3CXRA 1G3UA 2OCKA 3LU1A 1M74A 1SZJG 4P4LA 3QUAA 4YRRA 2WWFA 4JOBA 1JT2A 3BSSA 1NVXQ 3MQ4A 2OZKA 2QXYA 2W6JA 4MQUA 4PLGA 4GI2A 1GA4A 2AW3A 2GCEA 4JQYA 5IX8A 3Q2IA 2ZFUA 1N2CA 5FORA 1C0KA 1UXHA 4XIGS 5K4AA 1E3IA 3I2HA 1SWVA 1O95A 4CL0A 2WV7A 5SICE 3AR2A 3QSGA 2BISA 4FGZA 5ITZB 2Z5FA 4O2LA 3I1FA 2CE7A 2JI6A 4X95A 1JNYA 1MN6A 1TGYA 4H18A 5I45A 4RKEA 4BNMA 2A7QA 5TMEA 5BVHB 1I2ZA 2GXUA 1QZTA 4K9LA 2J48A 2EF1A 5EJAA 1ZMXA 3DYBA 1NURA 5C0OE 2VFAA 1TUBB 3K1ZA 1C29B 3NH9A 4JT2A 4TL6A 4HRYA 1BWPA 3NM4A 4IIJB 3RTAA 1PL8A 2Z9DA 2FF5A 3BMCB 3H2ZA 2YV4A 4ZVRA 4FHCA 4F7WA 1IY1A 4KDEA 4ZHQB 3DM5A 2GF2A 1DLJA 2Q3JA 2JJQA 2VNJA 1POXA 4ARVA 3RSSA 4LRWA 2FPMA 3RKUA 1T43A 4L8FA 3FJOA 2W6MA 5J2UF 2I6UA 2CV0A 4D0SA 3F5QA 3NHLA 4FQ8A 5DXJA 1R9NA 4OCZA 1QYIA 2WAOA 4EQ6B 4M1QA 1AKUA 3TMAA 3N8HA 2NU8B 4KGXA 2PYZA 4ZANA 1MGPA 3SJZA 4A6XA 3CZPA 2Q62A 5I4BA 4E3WA 3C7DB 1A98A 3GA5A 4MVJM 1U7PA 5D6OA 5E6SB 1XRMA 4JT4A 3HC7A 3M6AA 2O8FA 2ZWVA 4C0SA 1JVBA 2VEOA 3LBFA 4BFCA 3BIXA 5DHTA 4PLHA 1EAYA 1H8HD 2PNFA 3HUTA 1KVTA 4R8RA 1DEHA 4O4HA 3FRHA 1LRLA 2V5AA 1KHTA 1BHSA 3O3OB 1B8OA 3G9TA 1QHEA 4UAGA 4O29A 3PC6A 1ZVQA 2ZU0C 3H5AA 3FI0A 3O73A 3B12A 1EQ2A 1QG0A 2H06A 3NYQA 1C9KA 2C2GA 4Z9YA 1L5MA 5B3KA 2V6BA 4YJDA 3DLPX 5F98A 3QITA 5F12A 2VHVA 3JQAD 2V1XA 1U5AA 3MT8A 5B37A 1KKLA 2UYYA 3NR2A 2HWXA 3W9UA 1V8OA 2EKPA 1YH3A 4Y3UA 3FNRA 1R5BA 1DJQA 2N47A 3CUWA 3ICCA 1L8QA 4PQEA 3T0FA 3RDPA 3SOPA 2EFYA 4NBKA 1E9AA 4MCJA 4Y2PA 1EJBA 1MBZA 4P4TA 4D9NA 4KQEA 1VL0A 2JJ2A 4FNMA 4O63O 3L02A 2YN0A 3QE4A 4ALKA 5C7IO 1MOQA 5AJWA 1J9GA 3OAAD 1FP1D 4KPFC 1UF9A 1SIOA 2JI7A 1V41E 1E98A 1ZCJA 4KXVA 4L07A 4A6DA 5IBCA 1YHYA 1P0FA 2IUTA 1OCEA 4EBBA 5CVVA 1BX1A 1Z0ZA 1FE8A 4I6JA 1KFEB 2ZRMA 3D0RA 1HYQA 4G63A 1S3GA 5CT8A 3VR4A 2XT0A 3E15A 5M5BA 1NBAA 3K70B 3JQ9A 3PSAA 2O8BA 1RBZA 3L05A 3OQHA 4KB5A 4QLAA 1XZMA 2Q6KA 1YB4A 2AVDA 4OQXA 4IDFA 3VSCA 2VRCA 3ICPA 2P40A 3OJCA 3F5FA 3ILSA 3WS7A 4GBED 1MNQA 3ZWKA 3WA6A 3PX2A 3WFJA 4GZ5A 1RWNA 1X3SA 1ZD2P 4RH3A 4CMAA 4X66B 4D3FA 5A3QA 4RTRA 3SQLA 2O19A 3LE8A 1NUQA 4X1OA 1P3Y1 4P7KA 3SSMA 2VPPA 4ZYTA 1GN8A 2EW8A 4MGYR 4KIUA 3WMWA 1VE7A 2IPXA 3C3DA 4HLQB 3KOWA 4D9HA 5AKHA 1YBMA 1QQ7A 4BWVA 5AIAA 5LMNB 3TD2A 1O3YA 4YT2A 4EMUA 2VUIB 1UIRA 4IFTA 4O8ZA 4PAMA 4BP1A 1UMDA 4YPVA 2QN1A 4DSZA 3A1EA 3JD1A 1Z2NX 1E2QA 1QQ6A 1NBEA 3DFFA 4QGBA 2C9YA 4Y6LA 5I7AA 1Y6ZA 3O0TA 1OAAA 3OJFA 4LI0A 4PSVA 3ZDEA 3WLOA 3SC6A 3KYBA 3FW1A 1ABBA 4JLBA 4JI8B 4RD2A 3BJIC 2P9FA 4KXLA 3U4HA 4E13A 5KI6A 4BO0A 2C77A 3F6BX 1QV6A 3LP8A 5JEDA 4FC6A 3IOBA 3OLQA 2OKGA 2VSFA 5CCBA 3AF1A 3QYPA 3BDAA 4ESOA 1E2JA 4KBFA 3R9WA 2JIZA 8ATCA 3R76A 4B3IA 5BW5A 621PA 1NU6A 1A96A 4PVDA 1SOAA 5HJ7A 1CQPA 1GXSA 4NCNA 4NI5A 3QNUA 3MOSA 1RWWA 2O1WA 4P3OA 3OPYA 1YQTA 4X5OA 5FEMA 1ESEA 2XVXA 1S4QA 4Q39A 5BQOA 1DADA 2XUPA 3BSYA 3T8YA 3GW8A 2PKQO 1Q1QA 1B14A 4DOMA 2OORC 3NRJA 4ZQIA 3CCFA 1YDHA 4KU4A 1E1NA 1C7RA 3BXOA 3GFBA 1MABA 2YVKA 4P32A 1YMUA 2GS9A 4JB3A 2YNMC 3JVDA 5CMLA 3E9RA 3L7DA 5KCMA 4ER7A 3CNEA 2YS6A 2W6OA 3JYPA 4OUDA 4CV0A 1C1YA 4QOIA 1D8TA 3OM8A 1RLOA 1DT3A 1SC1A 2FH5B 2M6KA 3PF8A 1O03A 1NJ2A 3ZJVA 3QLVC 2ZI9A 2QQEA 4AULA 2QTGA 3DZJA 5JZOA 4GLBA 3RRZA 1AUQA 5DTRA 3HKBB 3U17A 4FIZA 3G2HA 1J8MF 2ZQ5A 2XCLA 3LX5A 3ZGXA 3LWDA 4JP3A 4ZK6A 5J1SB 1LU9A 2H51A 2WU1A 4YLEA 5A4JA 5TQ0A 4LA4A 4DIOA 4YY3B 4QULA 4KXXA 2VA9A 2ZAIA 1AZSC 2JFZA 2XGJA 3GMTA 2GERA 3HB7A 3MCTA 4OXIA 5KAPA 3UH1A 3U9SA 3ZI4A 4J0QA 4W7SA 2O8CB 1HV8A 1D3AA 2NGRA 4Q4LA 1VCNA 1TCVA 4OFWA 5JECA 4N76A 3R3ZA 1E8DA 1E2KA 2R6JA 4JBXA 4RE5A 5K0CA 4L85A 4OD0A 3R0QA 4MV6A 4J2TA 2X0EA 1QPBA 821PA 2I3AA 3QPBA 1D0SA 4Z7JA 2VYQA 1YBAA 2Y99A 1LRJA 1LLCA 2O48X 2ZSBA 1TMKA 3GFQA 5A3RA 1HMYA 2VUSA 1Y4ZA 5DBHX 2W2LD 5DHUA 4WN9B 4LQDA 3WK4A 1K89A 3LDUA 1ORRA 2WMYA 4F6RB 5INTA 2ZK7A 4Q1BA 5REQB 2J0UB 2ZRIA 3GGPA 1Z73A 2R7KA 5FB3A 4CU2A 1ZAKA 2P6MA 4C07A 1OAOA 1DELA 1K27A 3E1GA 4BB6A 2ZRHA 3P19A 3D4NA 4IS2A 5DIZA 4DLWA 5KQPA 4XX1A 1QGUB 3MYRA 3QKRB 4YI5A 1Z6AA 5KNDD 1QVAA 4PO8A 1T2DA 3ZUGA 3JVUA 3A4MA 3H1EA 4WXEA 2O0LA 2Z57A 1KORA 2A67A 1BRMA 1LJ8A 3K4QA 2O5CA 3WDLA 3AF3A 3ER6A 4MVJE 1BC5A 4DDMA 5AVXA 1NF3A 2GPWA 1P4HA 3DFZA 2XDQA 3BD7A 4WZAA 3OZXA 5AFSA 2YJ6A 2EOAA 1OXMA 4MDFA 2YW9A 2F3TA 2QL6A 2QE7A 4G9EA 3BN3A 3DBHA 4RTKA 3T5DA 2R96A 5EHIA 2NUTA 1U1IA 3WL8A 1CVLA 1C4OA 2XQGA 3DQPA 3KXIA 3PNQA 3TCKA 3JRNA 2QLLA 5LR6A 2IQ5A 4R68A 5BWBA 3HQ4O 2IW3A 1GJRA 1FB5A 3KAQA 5CIQA 1IQ0A 3KSZO 2ZT7A 4IMIB 4GR9A 4MMXB 4AZTA 4ZKDA 5CVCA 3VMFA 4LUCA 3R5KA 1X87A 2HD4A 5A9SA 5KTYA 1TW3A 1BCSB 3EMVA 4HGRA 4C5BA 1WW2A 4TLMB 1I7LA 3CQ9A 4BLUA 1E18A 2O3QA 2X40A 4LGVA 1MVOA 3EBOA 2H2DA 3WYGA 4BPRA 2EQAA 2Q7OE 3W5CA 3GGDA 1RRPA 1X1QA 4Y9SA 1X14A 3ZLUA 4HS9A 1VCMA 2O2IA 3K7EA 2M98A 4C9BA 1J06A 1G5QA 1LW7A 3H4IA 5I4CA 3H2IA 2PH3A 3OIFA 4B84A 4CV1A 4Z0HO 4DILA 2PD4A 1CERA 4UASA 5ARCA 2MR5A 5B7PA 1YJ8A 3ZWBA 4NKRA 2GETA 2FEOA 5BSTA 1EP1B 2I7TA 3CRNA 1ADCA 3GH1A 3V00A 4GVLA 2HT1A 3KAKA 1PK9A 3OEED 4G5XA 1C80A 2BFFB 2QD2A 3T7AA 3UK1A 5JOQA 5CG2A 1FQJA 2IV2X 5AJUA 3UJCA 1L9KA 1Z7GA 1NW5A 4CIYA 3U44A 2JAWA 2V7QD 4H1VA 2PWYA 3FMVA 1J2EA 3WL3A 5JVDF 3UWPA 5LLDA 3WAJA 5AVKA 1AMNA 1N6RA 5BSHA 3WHLA 3NWJA 2PAFA 1HG1A 3CUYA 2IYXA 5TEWA 3IVXA 4UEOA 4HH1A 1TZMA 1Y6JA 3G8CA 3K0HA 3M5CA 5EJ4A 3CX3A 2P4EA 4OQFA 2AJ8A 2NNWB 5BYBA 5ELXA 2VJQA 1XDWA 4RAQA 2PS9A 4TTSA 3LX8A 2V58A 2QD5A 2Z2IA 1O0CA 3KVOA 1UOOA 4Y2YA 1X42A 1K6IA 2BMDA 1G5PA 3QBVA 2GVZC 4EG7A 1JDVA 1KH3A 3FXAA 4TT3D 1H6AA 4XWGA 16PKA 5I5EA 1K92A 2Y92A 3SLKA 4V1CB 4D6XA 2IVFA 3EHDA 5LKAA 4OXQA 2V7PA 2ZCUA 3KYJB 1NW7A 3HUUA 1T35A 3PPXA 1TO2E 4OPMA 1ISPA 1CDDA 1Q7BA 4OQLA 4PLTA 2ZT8A 1UBTS 1Y98A 3DYIA 3UV3A 1LNSA 1HTWA 5IAJA 1DJOA 3AB7A 3L7AA 4HYYA 2A59A 1A9XA 2ISQA 5CTJA 2Y77A 3WE7A 4HEQA 4NTZA 5IRCD 1GL6A 3QE0A 3QGMA 3R3XA 2EL9A 2VN8A 4KOAA 2IHNA 1GZUA 2FW6A 1OFTA 4HQ6A 5E3HA 5B1IA 4CN8A 4G0UA 5KWVA 2F8MA 1YB7A 4LWOA 3DD5A 3GQBA 2OV1A 1SRRA 3E4DA 2M32A 2W8BB 5EE1A 1BYIA 2P5YA 5BN1A 4FONA 3R5HA 1S2OA 2FFBA 3IODA 2HRDA 4R3UC 2IHJA 3REOA 1IAQA 1MAAA 3REQA 2IBSA 1T3LA 4PVCA 2B6HA 1KMMA 3D8RA 4QDZA 1OZHA 4MR9B 3ZHUA 4C29A 3PGMA 4YFYA 2C9OA 3LFUA 4HGOA 5LJIA 2QZ9A 3L84A 2BF7A 1C8BA 1V1RA 4OLJA 5E0OA 3SP1A 3W2FA 5C53B 3QKTA 3GLIB 4TSRA 3CF6R 3RIEA 1YGPA 4IJMA 3EODA 5I7OA 5PGMA 2OAQ1 4HOYA 2JLAA 3L46A 1A5SB 1VJ0A 1O08A 4D8YA 1E4VA 3KHTA 1ODFA 4I4TF 1JEJA 2DWOA 1U65A 3VNRA 2PS3A 4PHTA 1LJLA 1E2FA 2PRZA 3E8SA 1J5XA 4G8DA 1PWZA 1TM4E 1D0VA 1CG6A 1KK1A 2G71A 4HDCA 2D3WA 4OSPA 4QUBA 3TTTA 2QK4A 4QEDA 4QX6A 4EPWA 3D3NA 3GYGA 5I47A 1WXGA 2UZIR 2P67A 4RIHA 4ND8B 3OMLA 4Q15A 4TYQA 4YK7A 2WVGA 1ZUWA 5E7JA 3NB0A 4QSHA 4ZQBA 5HIKA 1HO3A 3GVIA 2XUFA 3A1DA 5ICSA 5M29A 1G8PA 2VPZA 4D0GA 2AW5A 4WFIA 5BV2P 4Q4JA 3TAUA 1HI9A 4PNHA 5DCYA 2POQX 4RIGA 4X6XA 2A92A 1HWYA 1Y8AA 4QYIA 3WO1A 4M1OA 5K0NA 2BGUA 4MNTA 2BP7B 2JLQA 1RZRD 1NLMA 1KEUA 1VKJA 3L0YA 2OBBA 3ZEIA 3ZX5A 1I2AA 3D31A 3FTQA 1WNFA 1U3DA 3O4GA 4XTRA 5AI0A 2JJ8A 4YAJA 1W9MA 3T7TA 4E7OA 5B5SA 3NVAA 5E4YA 4PQRA 1M2HA 1QFMA 4JZKA 2ZUBA 4UCQA 4QJ4A 5IARA 4CI0B 4U3JA 2WSMA 1L4MA 1NJFA 1Y8RB 5FP0A 4Z4QA 3ZWPA 4RZ3A 3OUTA 2PRJA 1NIJA 3B1YA 5JATA 3ZU4A 1Y42X 1QOQB 3AJAA 3B13B 1TC2A 3NWEA 3OIVA 4G89A 1LBQA 4P22A 1BD3A 1FTSA 4U0JA 2FLVA 5KSZA 1FMLA 4UVGA 3TOXA 2OLKA 3GLTA 1U0EA 1ZGGA 1VL2A 5FFNA 3RFUA 4M0CA 1V3UA 1XNJA 2JFWA 3RLIA 4RTMA 1B8UA 3I52A 4Q9LA 1QCYA 5E3IA 2WE8A 4JP2A 1SXHA 3BAZA 4HJRA 1AKTA 5KVAA 1EMDA 3P0JA 3QLTA 4BZQA 1ZU4A 3OZDA 4NZZA 1J2JA 4AP5A 3EXG2 4LNUA 5KMGB 3SE7A 3LSYA 5C18A 3MINA 1S5PA 4O4IF 4RANA 4BUZA 4HB4A 4F97A 2HRBA 5FUWA 1J90A 2DUJA 2PZAA 3INGA 3NTRA 2CHQA 3E7PA 4DNPA 5EQTA 1XJWA 3AKZA 3LCCA 4GZ3A 2XUGA 3R23A 2D13A 3GD7A 1QGAA 3PF9A 3NGMA 4EHDA 2QMOA 1SBTA 1Y0BA 2H17A 3B36A 2P7IA 3CIFA 3VU8A 1L7BA 3PFGA 1JFLA 4PONA 4DC9A 1OASA 2QUIA 4MEJA 1UPBA 2QIPA 1XQ6A 5BYJA 1EX6A 4Q9JA 5HUJA 2FKAA 5FYQA 3PDUA 2CXRA 4IHJF 1PR6A 1R4NB 3LVRE 1GRRA 1KXJA 4DNOA 1TJ5A 3Q5DA 1RHUA 1Z17A 2ODNA 4BXOB 3KZKA 1S7CA 3LUKA 2GCIA 5ED4A 1TXGA 1E3TA 2XWPA 1AXRA 2ZDHA 2D0PB 1NXVA 5SV2A 4DFDA 5JARA 4RULA 3NGXA 1IUPA 4MOWA 2AR9A 4MUIA 4QTUB 5ERXA 5JCJA 5TPZD 4D8UA 3VA7A 2AN4A 3TTUA 3VJRA 2APJA 1ZCZA 1ACJA 1KY3A 2XOEA 3L0DA 5LCXA 4U9UA 5IS2A 1QPZA 3GNSA 3RTBA 5KNBH 1UM8A 1W48A 3QA3E 3PUXA 1SBYA 1UBSB 2BWJA 2QB5A 2CXUA 4AZ3A 5LQKA 1YFZA 3L6CA 4LWQA 1WWKA 4LJ7A 5H7XA 1IXRC 1W8DA 4PLVA 1C50A 3BHMA 4NCIA 1ZW6A 2WZCA 1KYXA 2GLUA 1U5CA 2EQ5A 3F7OA 1BNCA 3AWIA 3IMGA 4K9PA 4TTVA 2I91A 5EIXA 1I1NA 1FJHA 3WHKA 2WQ6A 1J24A 1W85B 3GJ6A 4L4YA 3KCNA 4N49A 3LVBA 7YASA 2X14A 1T8TA 4JBNA 4TTJA 3IR6A 3T7IA 3TOVA 3AEQB 3BZUA 3K1JA 3OZGA 1S02A 2K6GA 5IC4A 4EFDA 3IUQA 3O7WA 3R6GA 1NVVQ 5EXPA 3RADC 1T8UA 4I9HA 1GAXA 3L77A 1BDJA 1V1MA 4L4SA 3CUEF 3C3XA 1FOEB 3A9WA 4C0BA 2O7NA 4A7PA 4RIEA 4BFYA 1Q1NA 2FR1A 2YJ5A 1WDKA 3KFXA 4JP5A 4YCJA 2WIKA 5KJEA 5TPWA 2IH5A 3QVKA 4PYRA 1DUVG 4Z8XA 4OSEA 2AFHE 1CUYA 4IVQA 4AICA 2I78A 3HM9A 1YUMA 4JLAA 4BKMA 1XDUA 1N8TA 1IQPA 1R5OA 2GVNA 1ZONA 1ESCA 4YIHA 2X9GA 4DLRA 5KYYA 5G53C 1D9XA 2DR3A 5CFMA 3DS8A 4QODA 5BV1A 2C54A 1OBOA 4HGPA 3TTWA 3ZBPA 2P2NA 3K6JA 4QGAA 2VNAA 4ARCA 2PL9A 1ETHA 1Q0QA 3FNHA 4GH5A 3UMFA 5CB4B 4NHOA 1KJIA 1YCDA 2ODBA 4EPYA 1KJ9A 2GCOA 3L8MA 4BECA 4BLQA 3ONNA 3WL4A 1DX9A 5JPIA 3SYKA 3D3WB 2NIPA 5FWDA 2XITA 5G1NA 1SZPA 2GM5A 2W0MA 1PR0A 5DYYA 3MELA 2P9HA 2MCFA 2VNIA 4AXBA 4KR9A 3K9QO 5HKKA 2PSDA 5FJIA 3FZGA 5ALTA 5ER6A 2Z6AA 2QJRA 3GLVA 1JV2B 2GK7A 3HCRA 3V6LA 4G0WA 1DEXA 1BJTA 2JH9A 4KWEA 5IFKA 3WL7A 1UP7A 3DFKA 3KALA 3G5TA 1NUPA 1Q7RA 1T8PA 3X1WA 1DXYA 3HCPA 2CNBA 5JO0A 1Y6FA 4TZTA 2YMPA 5G0UA 3ZG6A 1TJ4A 2J3MA 4KNVA 4UHFA 2C2YA 2FOXA 4LRUA 4UM8B 3AHFA 3SJUA 3WGJA 4D4KA 2XOXA 2ZIAA 3WQRA 4HFMA 3H4VA 4IQ8A 1U7XA 2WA2A 4J16C 2ZYDA 4YRDA 1T0PA 3T3DA 1GUYA 3HKCB 1XRQA 3ORHA 3HDGA 2P75A 3C6BA 3PGVA 5F4ZA 4JWKA 1VMEA 3UB3A 2DUNA 1Y5RA 2IYVA 1D2GA 1H66A 1K7YA 1XZAA 1PVDA 1SQGA 1X7HA 1Y80A 1XPJA 3A1TA 4MLDA 5ECGC 1KDVA 2I2CA 2PH1A 1AMOA 2BBSA 3H6KA 1U6JA 4UE6A 4FW8A 2QL7A 4MDHA 1P4SA 4FZ3A 1GUFA 1XXHA 2BCEA 3WYDA 1D7AA 4I5EA 5JSFA 1OJLA 2W22A 3AHHA 3S2YA 4P9NA 3VHQA 3HJUA 4ZHSA 1TYCA 4B4UA 3U37A 2FZLA 2KLHA 2DERA 1XDGA 1XC7A 2OCIA 2B2NA 3GCZA 2XA9A 2QHXA 3IUPA 3TD9A 1Y8QA 3O1JC 3U3XA 2GA9A 1XJ0A 3ZZNA 1U0GA 5FUVA 2WSSA 4BYGA 5EPEA 3WYFA 1VB5A 3H8SA 3K5IA 2FK8A 3H5TA 3TQIA 1MJGA 1NW8A 2BFNA 5GPBA 4PX2A 4TTPA 4CM8B 4CF7A 4KCGA 1XZGA 3KKKA 1QCCA 1VKOA 3PVSA 4CR8A 1T2UA 1O0BA 3EDOA 1A97A 1MEEA 2ZTSA 1C7IA 3ZCRA 3PJRA 2PO7A 1T10A 1QUEA 3QU9A 2ZYRA 3LT0A 4GX5A 1ZK3A 4IWNA 3RUCA 4UZEA 2WAMA 4Q3CA 4HGYA 4R7GA 3ZHRA 1IBKB 2Q1UA 1PDWA 1PL6A 2DRIA 3ZGYA 2Z43A 5EHZA 2JGEA 3VDNB 1SQ0A 1CEYA 3I9V1 4YMIA 3NWPA 1MB4A 2J0VA 4L76A 5AOAA 5F52A 3ZDBA 2TSYB 1COZA 2F8TA 1SVWA 2SHKA 3PWKA 4JJ8A 5B4TA 3JAMA 1T5DX 4XQCA 2W5UA 1TL7C 3B1VA 1QFYA 3AEYA 1NRWA 4RZIA 4LDNA 1HYEA 4WOPA 1GZHB 2JAQA 3G8BA 5ALLA 5HTOA 5U9CA 4CLOA 3UJNA 2A9OA 2O2GA 5F1YA 4JL8A 1XTRA 3W06A 2UU9B 4E33A 2EZ4A 3AOEA 4WCFB 1HE2A 3PE3A 2XGSA 3K3PA 2QW0X 2WJAA 2XSZA 5FOVA 2FQQA 2EP7A 3MWGA 4L72A 1PHRA 1TO1E 1XTIA 2G04A 2I2FA 1JG2A 3IP1A 1NULA 1FDUA 2CGEA 4FLEA 2KYRA 3TB6A 5IEBA 3ZDCA 4JL6A 4HGZA 4NESA 2GZ2A 1QDEA 3VKGA 2RB5A 1N2ZA 4LSWA 4C0HA 4MDEA 1N32B 3UQZA 3O8RA 3H5RA 3UFXB 3ZVRA 3JWPA 4LHYA 5EZYF 1U6KA 1TVEA 1ZOOA 2NN3C 1LDBA 4REMA 4XRRA 5GJVC 3ZWAA 2HLNA 4IJUA 4XZ3A 3GLGE 2J32A 2QV0A 3BWXA 4AJNA 5JRZA 2VJPA 4Z9XA 2B98A 3FGZA 4ZYZA 1W93A 5I7EA 3ZUPA 5LOVA 4BATA 4YXWD 1I36A 3KWLA 3QEOA 2X4IA 4FJ2A 2VUHB 4QVKA 3JW8A 1N5DA 1LZKA 1V2HE 3DQZA 3DYVA 5FFMA 2FFAA 1F6BA 5JS6A 1XYYA 1RHMA 3LLCA 2I22A 4DV4B 1I51A 1HOTA 5BWOA 2WUFA 1N7HA 3A11A 1KA9H 3MS7A 1Y4SA 2D1SA 4OMFG 3OP1A 2C03A 2H85A 4ZAYA 3VAZA 1OFVA 1NN5A 2QVGA 1QC5B 1KI2A 1VLJA 2Z4RA 4HWKA 4KAAA 4M0PA 4PLYA 4WA7A 2GPSA 1UMCB 3MCZA 5K3AA 1DIRA 1YIAA 4RJKA 4PN3A 5LMCA 5CDUA 2C82A 1YR2A 3D0QA 4X71A 4CFYA 2G9ZA 1L3BA 3UMRA 1QP7A 1P2TA 4MV4A 4CKEB 2QEQA 4IQFA 1YNOA 3NZEA 5F51A 5TARA 5B12A 1OXKB 3EXIB 4CUKA 2AQ8A 1EUCB 2CNKA 2VDRB 2WNSA 1NTRA 4BN0A 3C4QA 4ZI7F 1H6BA 2R8XA 2HQBA 1UC8A 3CZMA 4HWOA 4Q7LA 5LDHA 1R5JA 1EFPA 3ZQ4A 2JK1A 2REOA 3NW9A 1EM8A 4NK5A 5DNDA 4JVLA 4QQ8A 2OBNA 1WETA 5JRDS 1QOPB 4EOGA 2A84A 2H7CA 3ACCA 2N0SA 4BMZA 2WG1A 1DRWA 1AS3A 2FSFA 2JHFA 2DXIA 4PS0A 4AQDA 3KK0A 3ADKA 1PNVA 5FCDA 2R8OA 2AJTA 4IDEA 1LVUA 5LNK1 3PLAE 4L0QA 5FWYA 1VI5A 2EAUA 2WVJA 3LZ6A 4JR2A 2FF7A 5AH0A 3H8WA 4WZBA 2EFDB 5C4GB 1IN8A 1O8BA 3OI7A 3V4LA 3V48A 4ZCTA 5ADHA 4QGSA 2HRCA 5AIBA 2R7LA 4AAYA 1LPOA 1AKYA 3RS4A 4CMJA 1UFQA 2JFYA 2OILA 3KQTA 3VR5D 4J2HA 2O8DA 2ATEA 3MMSA 7GPBA 4CYMA 1WA5A 3H4MA 4XD7D 4YMHA 5JAUA 1JEDA 5KYWB 1NF9A 4YUYA 1NL3A 3RFTA 2E48A 1GYPA 1N0UA 4W8OA 4LW8A 1P81A 4WACA 3CX7A 4DZRA 1UUFA 2OPHA 5BRJA 2VDWA 3KC2A 1JILA 3B3GA 2YFQA 4PHFA 4GX2A 3PEVA 3RABA 3ICVA 3UUFA 4EBFA 2ZIEA 1MOSA 1XU7A 2K2WA 2PUWA 3QVGA 5DMHA 2ZREA 5DULA 1IHXA 4LCBA 2B3DA 1I1HA 1DPFA 1R6UA 1X15A 2VSYA 1SUDA 4IICA 5IJZA 5EVCA 5MN4A 4ZVUA 3UKOA 1BIFA 3IULA 3TR0A 4LVNA 3N9IA 6REQB 1CUZA 4FCVA 5C8ZA 2CVQA 4R1TA 2GAOA 3TLAA 4U2BA 2UYQA 4ASUD 5JV5A 3VNQA 1TCCA 3KBBA 4OV6B 1GUZA 3S3TA 3T3MB 4O02B 4R1OA 2J9ZB 2PMFA 4ZO9A 3RWOA 5AOCA 1P2SA 2FX3A 2J5XA 1QX4A 3EZXA 3HDJA 5J9FA 3KPJA 5TQVA 4FFBB 1JIXA 3RHFA 4KV7A 4EJFA 3KP1A 2OQVA 4CUZA 4ITRC 1IOZA 3C3JA 3LG2A 4GPTA 3GJTA 4TLBA 4N6NA 4ESEA 5IF3A 2GSWA 2QQ5A 4BNVA 1NAHA 3OPQA 2J31A 1BXZA 1J5PA 3LZCA 1RJ9B 2CKDA 1Y7IA 2GHIA 3X2EA 3ETHA 1WBDA 1Y1KE 4H1TA 5B58C 4I0WB 5AVVA 5FI3A 4CG3A 1E62A 4JEHA 3CZ5A 1LX7A 2CJPA 4C3UA 4ENVA 4DRYA 1TRHA 1LDGA 2GD0A 3MD9A 3SGLA 4PANA 1AUVA 3BTUA 3TR6A 4EGCB 5ILQA 1ZJ6A 1DX4A 1H2EA 4KG7A 1D4OA 4F96A 1E2DA 2HIHA 4UCWA 3KLMX 2AOWA 3TKAA 2K4MA 3ER8A 5KC9A 3TEJA 4HMPA 3NBKA 3JQFC 1MO6A 3FG9A 5H5JA 4FGUA 1VBKA 4BNGA 1SUCA 1XL1A 4TRJA 1WM1A 2UZ1B 1YDEA 4KODA 2JH3A 4TV8A 4EYKA 4RV4A 3ZJUA 3DV0B 4BTLA 3WAGA 4DV3B 2PKQP 1R18A 2X5XA 3R5JA 4IQ4A 3UUGA 3B6KA 5T64A 1J8DA 3LXMA 5EYPB 5HCUA 5J5VA 3IRVA 1NNSA 3CN9A 4I4NA 1QANA 1TOAA 3C14C 3MOIA 1G64A 2YHAA 3AUXA 3GWZA 3IOMA 4D9IA 1XWFA 2OAP1 3RVOA 5AW0A 3T4EA 3LQ4A 2PKWA 5I4KA 4GHWA 1XRSB 2IH4A 2Q0SA 3IKLA 4KXMA 4EA9A 2RHCA 1E9CA 2C2BA 2D6FA 1LSSA 1PZEA 1OQAA 2QMQA 4F3TA 1GA1A 1Z36A 2ZRPA 4RORA 2QT9A 4M88A 3WLIA 4QQFA 4ZD6A 1O6FA 121PA 4BLOA 2AS0A 4URXR 3KUDA 4M8SA 1BEZA 1UM9A 1LB1B 1HYBA 1PUJA 1QDLB 1YZYA 2UDPA 4GF5A 4DLBA 4DYVA 1UKEA 4B9AA 4EMBA 3QBJA 1YZTA 5C31A 2FRXA 1IPEA 1ISSA 1KYYA 3FYUA 4FD3A 2QTBA 4J2OA 4KO8A 5EJ2A 2NUAA 1X8JA 1OFHA 2VNSA 3I9KA 4L08A 4QC2A 3GFSA 4RJLA 4XUEA 3UYKA 4KEAA 1UKCA 4K88A 4QDOA 1GZVA 4TKZA 3G6WA 1FVFA 3SJCA 1TTTA 1ZMTA 3FCYA 3RAGA 1RYFA 2YJ3A 4L0DA 1X7XA 1WUJS 3O95A 4FI3F 1NV9A 2E4VA 2NO7A 3INTA 4IS3A 3G88A 4AJIA 2J5BA 1LI5A 3TECE 1MW9X 1TAGA 2ZRDA 3PXUA 3HVRA 2C42A 2D1TA 4EGJA 3NP9A 5IZ4A 4DMCA 1BG6A 1T6XA 4CKXA 1SVKA 3FFBA 3RT1A 2WOOA 1D4FA 2QRHA 4OP3A 3LUDA 4O0LA 2YJGA 1NBWB 3EIUA 1KEEA 1HTBA 3ABIA 1O4WA 4PXYA 4QGFA 3PE4A 5AVZA 4QU8A 2QUHA 3EY4A 4MKHA 1DFHA 1ELOA 3ZS9A 4F4JA 4BRUA 4LBWA 4ZPJA 3VX4A 3UT5A 2B4AA 1FQWA 2G76A 3CPEA 5TJ9A 3I0ZA 3T5GA 5F2NA 1BOOA 1RD4A 2JI8A 2PYDA 3JQ9C 4ESVA 5DI9A 1UJ6A 2E7ZA 5K0ZA 5MGNA 3HHPA 3WNCA 1T1IA 2C3PA 2GSDA 1U5BB 3S27A 1YMQA 4PBTA 5IUNC 1QSGA 1O58A 3SIXA 4Q9IA 1G2QA 1Y4DE 3K96A 3TEMA 1E5TA 3U4QA 5JC8A 5HSGA 3CF4A 2PL3A 5HEKA 1IE3A 4P83A 1KMHB 1JMYA 2WK1A 4AZVA 1PFKA 3N8DA 1M1XB 1WUYA 3G7SA 3EEFA 3TLGA 3A2KA 3QFRA 1DXQA 1VJCA 3FYSA 2HXYA 3K09A 5FOTA 3PNSA 1NGSA 1REQA 5ADUS 5CD1A 4CN9A 3SZLA 4XSHA 4PZLA 5IT4A 1EVLA 4FHZA 4X0EA 3ZYZA 3I8OA 2J41A 3A31A 2ZR8A 5CFZA 2I6FA 1OX5A 4MVXA 3SEFA 1GM5A 4P7BA 2BZ1A 5CA0B 5FQOA 5CCXA 2Z98A 3PUIA 4QHSA 2D4HA 1KRWA 1I14A 3MOGA 3B2QA 4A23A 4FX5A 3ESRA 3EXFA 1ESNA 1H5QA 4IDPA 3C8UA 3PNPA 1PX0A 4LXXA 2FUCA 3BGIA 3OEYA 4Z0TA 5KKAA 5KNBA 4GYYA 4ENTA 3LDHA 1EVJA 1DFIA 2OLEA 2ID4A 2D2EA 3JASA 3OZSA 2YHBA 3LO8A 1CUFA 4BQQA 5EP1A 5KTKA 3PHJA 1P1CA 1V16B 5TQJA 2WU8A 1H4VB 1AN0A 5I48A 4EJ0A 2P0AA 4PC1A 1UC4B 3O8OA 3P0FA 2BFMA 3L07A 3HJAA 4IM7A 4M0UA 3KPYA 1PNQA 4R4JA 4ENWA 4LOLA 3BXXA 3H2YA 4BEJA 4HZUB 2ZUDA 3VUFA 1E1CA 2OBXA 3GVCA 4DIMA 1BE8A 2J67A 3L4SO 1PI3A 3CO0S 4IDBA 3S99A 1TTPB 4YVFA 1TVMA 3TSAA 4EI9A 3EFOA 3H3JA 3I04M 2IBTA 3HJCA 3MT7A 4GGOA 3R09A 5GONA 2O3TA 1YVUA 3UJPA 3W5SA 2AVNA 1B2RA 1JYEA 4KQHA 5AKIA 2GTIA 3O31A 3TMKA 3WLRA 3L0IB 2XQVA 5ICMA 5JMOA 1JVNA 1J39A 4PIMA 1MX3A 5AM1A 2CV2A 3STVA 2FMHA 2WVHA 4ZC1A 2H3EA 3UBMA 2W98A 4MV1A 4M38A 2JATA 2IYAA 4UM9D 3MSCA 3KJQA 3NHPA 1VLZA 3PDHA 1L4BA 4Y2GA 3WGMA 3P5BA 5L40A 3RIMA 4US2R 1I01A 1YQGA 4KPUB 4N7MA 4EKIA 3W5AA 2OC4A 5EFOA 4GI3A 5THKA 3LK7A 1JUDA 1OKKD 2DCUA 2VPTA 1A77A 2ZCVA 5ESRA 3W8FA 4EHHA 1SBZA 1MEOA 1Q0ZA 3LLSA 3K70D 1M2NA 2CMKA 4BMOB 4XARA 1N9ZA 1ZRHA 2OM2A 2P68A 3OLYA 5FI0B 1H2AS 3HV2A 4BQNA 1NLUA 2IP2A 1HF3A 1ISRA 5EKDA 1K1EA 4BNTA 2AZXA 2G80A 4FLMA 3RK0A 1PBNA 2R1TA 3P1JA 4WE3A 3C3CA 4MJLA 1KS9A 2IDMA 2ZUSA 3BHIA 4UNIA 1J0AA 3CF4G 3VFDA 3DTYA 3G1TA 1ZI8A 2PWAA 3DL0A 2HJHA 2PT9A 1YB1A 3C5HA 4BNZA 4R31A 2XB4A 4E1VA 3A4LA 1E6MA 1LNZA 1FXWA 2GEUA 4BQEA 2JHGA 5EJEA 1P0CA 3HDQA 1DJLA 4M9ZA 3VUEA 4EJ6A 1JJFA 3D9QX 3DVAB 3EAGA 3CPHA 4AY6A 3F7NA 3RE1A 4JQCA 4MWCA 1K68A 5DHFA 5J2TB 4R7ZA 4XJSA 3T7JA 4R81A 3CLRC 2CLMB 3E3OA 4G25A 1TM7E 2WQZA 4G26A 5L4SA 2WTUA 3AK4A 4CM4A 3H9GA 5EMJA 3DDZX 5ECYA 4NHEA 1MAUA 3L41A 2ECQA 3HRHA 3TW0A 1G17A 1GRNA 1ZRMA 3IE1A 4Y2UA 1O94D 2RHLA 1RKQA 3EUEA 3MK31 3NAZA 1ZJYA 3TL3A 4F3KA 3Q6IA 4OG2A 3OO0A 3CRZA 5JNSA 1K8ZB 4LVUA 2E82A 4HB0A 4Q21A 2HU7A 1WMDA 4J6EA 4YP0A 3FDJA 2HIMA 1SQSA 1C7ZA 4HDQB 2Q07A 1GCOA 4D41A 1JSZA 4WXYB 4DRZA 4FOTA 1KGDA 4AC9A 2UAGA 4HUQA 2XUDA 1SXQA 1M83A 3F90A 2J6CA 1M2VB 4MI9A 1DG9A 5JANA 2JCSA 4O4HB 5IVHA 3VJKA 5BQPA 3SEQA 4UHCA 2OOSA 2WF9A 1JHOA 1PQYA 3G0OA 3P94A 3IB3A 5FXMA 4A26A 5K4HA 3PX7A 2V7XA 1E9VA 2FETA 4EYSA 5BPFA 1QHHA 1U3VA 3NDPA 3D7KA 3OY2A 4CFZA 3LD9A 2EDAA 2V98A 1F8UA 4HQLA 10MHA 1NW4A 1GLNA 1WVIA 1D6JA 1P1BA 3B53X 3UPUA 1Y3AA 3INRA 4OIFA 4RK4A 4Z1MA 3ZKWB 1XQYA 2AHOA 2VATA 5ELLA 4Y1RB 2C4MA 4BP3A 1JG3A 1X9GA 3MS4A 3ZNPA 5KTPA 4Z7QB 2C5LA 2WV9A 1FA9A 1XRRA 2RHHA 3IP8A 4RIIA 1CETA 4GMKA 3S70A 4PHGA 2QTWB 3ZNNA 2J59A 1EK0A 4JC8A 4QZVA 4MKFA 3JVIA 3L6UA 1XNRB 2LE0A 2BFDA 3KKOA 3VH2A 2C78A 4C0XA 3GFGA 2NVWA 2WINI 1MEJA 4FYYA 5IAOA 1K6EA 3AKCA 1N7JA 4JBWA 3IDSA 2ODQA 2O8BB 3D2LA 3L1UA 2BFCB 4MWOA 3O83A 3HB4X 4RESA 5F3DA 1NBMD 3TBFA 5KVCA 3E22B 4IJWA 5DNUA 2C31A 1T36A 2ORWA 5L3SA 4FR2A 1YVPA 4HVAA 1GKUB 3PKZA 2BELA 2I1WA 3FBGA 3S4YA 2IBMA 2C2HA 4EARA 4V39A 1QFJA 1C3VA 2HSEA 2AZMA 3L18A 3EVNA 3D54D 1MXFA 2SICE 3IVCA 1AHNA 3NBYC 3SBEA 4PZCA 1JDUA 2O8NA 1MORA 2VI5A 3GFTA 1S4MA 2KX7A 4IBOA 3TQHA 3E9DA 4KXNA 4C0QC 4F84A 1X9HA 4W5OA 1NDHA 1F6DA 4JUIA 2I7VA 4G0MA 3WK8A 3URKA 4E14A 4N7JA 1W9HA 5FPSA 5EIAA 1P7ZA 1DC8A 1XKQA 4O4LA 1FBTA 1UMDB 1ZK1A 3K8OE 4ZDJA 3AKDA 4YUAA 5HS6A 4TT8A 5HRCA 3EQ9A 3OTGA 2WHRA 1IL0A 4CODB 2G63A 4ZGGA 3PDCA 5IU6A 4ARUA 2HA5A 1WQ1R 3DV2A 4D8XA 4QDUA 1QO0D 4P3NA 1J2UA 2Q9AA 1PBTA 3JYLA 5TGDA 1DIBA 1ODTC 4YA6A 5JY1A 1G9TA 5JWHA 2PU7A 3ZZUA 4DLXA 4U6QA 2YZNA 2WPNA 2VDNB 5LMUB 4XFDA 3O8DA 1EFCA 5ITWA 2QBYA 2XWBF 4NEGA 1IN6A 3S7ZA 5KEIA 3I1JA 1KIMA 2QZ4A 3DFUA 1KP3A 3FOEC 2ZM5A 1JECA 5AHXA 3FKSA 5AKXA 2L69A 1CQZA 1I6MA 2XD9A 3G2NA 4H1HA 1GXSB 1N75A 1YUBA 1OZGA 1ZOPA 3P9QA 1ZH8A 1OT5A 4PO1A 3TSZA 1JU4A 3IAFA 5F35A 5FV4A 3OPYB 2RAPA 4MPJA 3GZNB 3HJRA 1AZWA 2YIVX 4A92A 4K3UA 4HBZA 3G0HA 1UFKA 4ZCPA 2JGAA 1I32A 4GQBA 2VZLA 2YXPX 4RVOA 1W75A 3L8EA 4YAEA 1PEYA 1IM8A 3NQ41 3FCUB 5E2AA 1MABB 2RHGB 1IBLB 1QV9A 2FB9A 3QNWA 3D64A 3L93A 3OICA 3UEOA 1O96B 3WBFA 1EUYA 5AW5A 3H2BA 1G8GA 4GU5A 3FRIA 1YQUA 5TE9A 1NVDA 2CLKB 2OG1A 1P91A 4H6XA 1C9MA 2ALJA 1X13A 4WA8A 3KOMA 4KIGA 5DM2A 4HN9A 3S81A 4XEHA 1KO8A 3OF2A 2I8AA 1YB5A 3WGLA 2Y2UA 4EY6A 3EPHA 2ZITA 1E3LA 1WKCA 3ISVA 2WPDA 3JS5A 3KKQA 1L5SA 4S24A 4U2DA 4KXFB 2YMLA 5B1EA 5GM1A 5M04A 2A5GA 4BQIA 5TQ0B 1NYRA 3SXPA 1IEQA 3MAJA 4ZVQA 4JBIA 5FBQB 2ZRLA 2DR2A 8ADHA 8AT1A 4R9VA 1X8XA 3ADBA 2CY0A 2H4ZA 4WZZA 5KX5B 3AB3A 1ZC4A 1ZISA 3K5WA 1KMNA 2RGXA 4KQWA 1FQOA 4XB1A 3P7MA 2ZIFA 3BRWD 4N7RA 2Q41A 1CD5A 4BTVA 4U7PB 4WVLA 5B1HA 3W79A 2FZEA 2PH7A 1QBGA 1JSLA 3ICOA 1Q6ZA 4IUDS 1WTCA 2GDJA 1RQGA 4MS1A 1MZVA 2Y0PA 3VSEA 1QTIA 1Z22A 2GBPA 3UAOA 4EGFA 4OKIA 4J90A 3AM5A 2NX2A 3AY3A 3AMVA 4PZYA 5LYYA 3T0GA 2XCOA 1J00A 1ZM2A 1YZGA 2PJZA 1AS2A 1LLDA 4MUGA 4DMUB 4RTQA 5LSAA 3PYLA 1FRFS 4PZEA 3MERA 5DGHA 3REGA 1LI4A 1W1IA 4JUAA 1K8YB 4CZ2A 4HNVA 3RS0A 2XB9A 4G5HA 3STWA 4F7DA 3VBCA 4W5WA 5LU9A 1N5MA 3L7YA 2F3RA 2PGNA 1VYHA 2EKLA 1A5ZA 1S8AA 2XDWA 1W0JA 3GPCA 4QTTB 3RRYA 5FTLA 2V5VA 2C7QA 1XPOA 2ZR7A 4NLLA 1YR3A 1HXHA 4WJLA 1IPFA 3MJHA 1DL5A 1E0JA 3WTCA 5L45A 4BO6A 1HEIA 3G2QA 4OLHA 3LYHA 4A6PA 2OXCA 1QGED 3IAHA 1WZIA 2YOFA 3NT5A 1APBA 3GFRA 1YF3A 2W2MA 1P45A 3IUJA 2H2FA 2XDQB 3LOUA 1WB4A 2ZB8A 1JLKA 5B7GA 2VYFA 3VGPA 4CQNA 1LSJA 3U2QA 1JIKA 3DBHB 3U4AA 1KS2A 2PUDA 3P20A 1SCBA 1DE0A 2G1JA 1NWHA 2ZR9A 3HVHA 1MG5A 3I64A 3HGTA 1SJ9A 4UBOA 4YP7A 1GNLA 2J6HA 3FETA 5HWSA 3KDSE 3O6VA 2D59A 4Y1FA 5HE9A 5ADWA 2PJRA 2P3OA 2QD4A 3OJLA 3W90A 2OP0A 6Q21A 3JQBC 3MIIA 2NVUA 4NMWA 2B99A 4BX8A 1WV1A 1QWOA 4I3FA 4JYPA 1FMTA 4KVAA 5ALKA 2BEJA 1DC7A 1IBRA 3X1XA 3T3OA 1KU0A 4EZIA 2D0OB 1V4NA 1V3QE 2RGYA 2B5VA 1XLTC 2X0IA 3MRTA 4URUR 3B3QA 5K3FA 1FVXA 3KYDB 1QUFA 2DBVO 4HQ0A 4XIIA 5TVKA 4OI1A 5IKOA 1UWCA 3EB9A 3MLAA 3KEMA 2XAAA 3WLHA 1YE3A 1WCWA 3B9BA 3I92A 4KE8A 4MV5A 2QQ0A 4RZQA 2C2MA 2NLOA 2GN4A 4OGKA 2GYWA 3IIJA 5G02A 3MRSA 4K9NA 2ZYHA 5I9IA 5JDCA 1YACA 1M2OA 1N7GA 1RQ7A 2WUEA 3RB8A 3HPRA 2CLHB 4KR7A 1SG6A 1H0SA 4Z4GA 1P5HA 3HEBA 3N3BC 3WYAA 2FHPA 1XTKA 3H05A 3T5MA 2UZ4A 1QHXA 2WJ6A 3E23A 3GP5A 1H0KA 2BE9A 2X2EA 4HNGA 4P4UA 1KFJB 1BDMA 1RM5A 4UW9A 3ZKAA 4M37A 2XLBA 2RAVA 7REQA 3DBVO 5K03A 2QZSA 4C89A 1F5NA 3K6KA 4Z2YA 2D74A 2BSQA 1XTZA 2QRJA 4RVSA 4LMAA 4R9SA 2PX8A 2I67A 4OMCA 1WW8A 4BN5A 1C3OA 3HB9A 4Q9AA 2RC5A 4O0MA 2X15A 1S2MA 1EDDA 1QE3A 1W1WA 4LV6A 3IOEA 1PD1A 2BMVA 1I7SB 4H08A 4RE6A 1FXSA 2J9FA 4Y2VA 3TEFA 2CL7X 4COOA 1OH7A 3KYCA 2JANA 3I2KA 5EUMA 2J3QA 1LH0A 2FA9A 1C5KA 1KE2A 3E9CA 4OK3A 1M7GA 1NF8A 1USVA 4JEUA 1UWKA 2Q7DA 1AA6A 4U63A 1U2DC 4GE0A 3TRKA 1AXGA 1PG2A 3ROEA 4BV9A 4GI7A 1YA6A 5F1KA 1GNTA 1OVMA 1SHUX 2CLOB 2PLFA 4DIUA 4HQKA 2VCHA 1SC4A 1TF5A 4UVDA 2IU0A 3RU3A 4BVGA 3W5VA 4D9EA 1U0OC 1E2LA 3T1NA 5K8LA 4CG2A 4JJEA 4KPEC 2Y1EA 2BKUA 1FS5A 3G5AA 2YIDA 3GPIA 3I32A 6CHYA 4GDFA 1MQAA 5F78A 3E9NA 4Y9DA 3WK6A 2GKGA 5JZSA 4NECA 1K9VF 4XYMA 5JXHA 1E6CA 1X7YB 1Q0PA 2O0HA 3EG9A 3H5IA 3FROA 2WKRA 2JHCA 2O1XA 1Z9BA 4IIJF 4IGKA 4REOA 5JW6A 5CB0A 3DWIA 3Q88A 2HK8A 3WIDA 3U4DA 3TD6A 4YR9A 5I4IA 1TPZA 2Y76A 1GAQA 4OQ4A 3OZAA 3RUDA 1P7PA 4URVR 3DNMA 4OA5A 4TQ9A 3K15A 2GI4A 1AGPA 3TNJA 4ZMSA 1V1RB 2VWHA 2JFGA 1F8YA 1Q57A 2C29D 2J46A 2JI4A 3A6ZA 3R9XB 1WNTA 4ZXFA 2AQHA 1WVGA 2L17A 3INYA 3NG1A 3O91A 5IVPA 4NNPA 1IIBA 4Q3LA 2A9KA 5DI3B 4XDZA