1FE8A

Crystal structure of the von willebrand factor a3 domain in complex with a fab fragment of igg ru5 that inhibits collagen binding
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
190
structure length
190
Chain Sequence
PDCSQPLDVILLLDGSSSFPASYFDEMKSFAKAFISKANIGPRLTQVSVLQYGSITTIDVPWNVVPEKAHLLSLVDVMQREGGPSQIGDALGFAVRYLTSEMHGARPGASKAVVILVTDVSVDSVDAAADAARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTMVTLGNSFLHKLCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the collagen-binding site of the von Willebrand factor A3-domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords VON WILLEBRAND FACTOR
total genus 60
structure length 190
sequence length 190
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2000-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1fe8A00
2X5NA 4G1EB 5KYYB 3ZE1B 3RAGA 1AOXA 1XDGA 3ZQKA 2NUPA 5E6UB 3EH1A 2I6QA 2VDKB 3PPXA 4WK2B 3K6SA 3K71B 1JEYB 1M2VB 1RRKA 1XUOA 4IHKA 2VC2B 1JLMA 1BHO1 4WFQA 2VDOB 4Z7NB 1LFAA 4UM9D 4WK0B 1MF7A 2XWBF 3F78A 4NENA 2VDPB 4A0QA 5BV8A 1JEQA 4O02B 3EFOB 3ZDYB 3EGDA 3F74A 1SHTX 3T3MB 1U0OC 4IXDA 1SHUX 3HXOA 1MJNA 3QA3E 3VI4B 2VDQB 1IJBA 2O7NA 2XGGA 1M2VA 3ZDXB 3GXBA 1MQ8B 2WW8A 1UEXC 1L5GB 4C2AA 4PN7A 3K6SB 1QCYA 1IDN1 2NUTB 2NUTA 1RS0A 3EG9A 3ZDZB 1MQAA 3VI3B 1M2OA 1U0NA 4FX5A 3EGDB 1M1UA 1QC5B 3IBSA 3T3PB 5HGJA 4NENB 4XW2A 5HJ2A 1JEQB 4MMXB 4F1JA 4UM9B 1ZOPA 3PPYA 3Q3GE 4Z7QB 3M6FA 4HQOA 3NIFB 1YVRA 1FNSA 3HI6A 2ICAA 4HQNA 3TVYA 4C2BA 2WINI 4C29A 1CK4A 5LN1A 5KYXB 1ATZA 1AUQA 4CN9A 2ODQA 4JDUA 1U8CB 4BJ3A 3BN3A 4CN8A 4MMZB 1N3YA 4DMUB 1SQ0A 4IGIA 5ES4B 4HQLA 3EH2A 3V4PB 1FE8A 4Z7OB 2VDNB 5E6RA 1DZIA 1QC5A 1IJKA 1IDOA 1MHPA 2ADFA 1Q0PA 3NIDB 3TCXB 2VDLB 3PPWA 1PD0A 1ZOOA 1TYEB 2B2XA 3IJEB 3N2NA 1JV2B 1NA5A 3EOBI 5KYWA 1OAKA 1RD4A 3EGXA 5KYUA 3TW0A 1M10A 3FCUB 2VDRB 2I6SA 3ZE2B 1PT6A 2QTVA 2XWJI 3PPVA 1T6BY 4UM8B 3V4VB 4CNBA 1T0PA 3E2MA 1ZONA 2IUEA 3EGXB 3HXQA 3TXAA 4WJKB 4M76B 1M1XB 1RTKA 1XDDA 1CQPA 3FCSB 1PD1A 3ZE0B 3NIGB 4G1MB 5KYUB 3K72B 1AO3A 4F1KA 2NVOA 1DGQA 2I91A 5E6UA 1JEYA 1MQ9A 2NUPB 4MMYB 2ODPA 3EOAI 5KYYA 3BQMB 4HQFA 2M32A 5HDBB 4WK4B 5E6RB 5E6SA 5E6SB 5KYWB 1YVPA 1BHQ1 1V7PC 4HQKA 4NEHB 5KYXA 1PCXA 2VDMB 3BQNB 3EFOA 5KYNA 1N9ZA 3EG9B
chains in the Genus database with same CATH superfamily
4JCCA 1RLOA 4CL8A 4O4HB 3LU1A 4RE6A 4NOLA 2W6MA 1AKVA 4JJ8A 3WZLA 5I6DA 3ZCTA 4ZT6A 1E4EA 5TQ2A 3ORRA 1CQJB 1Y3HA 3VSEA 2Q5CA 2SICE 2DSNA 1SULA 3BRWD 2VF4X 4MYDA 2TECE 4MQEB 4QO8A 1Z82A 4CQLB 5GONA 1TEVA 1V5WA 3ENQA 1OYVA 4CDGA 3NHSA 5TMEA 1D1QA 4DOMA 4D4MA 4P4GA 3A3YA 1ESDA 3I04A 3FR7A 3LUPA 3MVEA 5U4XA 4HUJA 5HK8A 1YJCA 1MCZA 2V4ZA 4RV5A 2D2IA 1P8AA 1KS9A 5CM9C 5FUBA 3D1JA 4IDNA 3U48A 1XVUA 3RRXA 4CM7A 2REQB 1YRYE 3KTAA 1PUIA 4AUEA 3GLGB 1OQAA 1CP2A 1L4LA 3RLFA 5JV5A 3GLIA 2DWQA 1JW9B 4IMPA 4EBBA 3C74A 2PL3A 4R5MA 4TTAA 4MWSA 2BGKA 4UTPA 5JYBA 1DRJA 1Z4KA 1N2JA 1E94E 4C0HA 4CT4B 3IDAA 1ZL0A 1KMHB 4CMEA 1YDHA 2H1RA 4P7JA 1PS0A 2IIQA 4G3XA 1GKLA 3C97A 2YMQA 4OXYA 5I5GA 3DHEA 5TQJA 1U7UA 4NLLA 1EK5A 2ZRMA 2WIDA 4B6PA 5C1OA 2ZI4A 2ZE5A 1GRQA 1TYCA 2FTKE 3OPMA 3QJYA 5ETJA 2PV7A 1PYGA 2ZUUA 4IDCA 1ZM3A 3ERCA 3SY8A 2Z8YM 1XZPA 2IEYA 1EGVB 1AY0A 1UPAA 3K0CA 2FW0A 2FVXA 1HE4A 4FJ2A 1EA5A 4ZCSA 5BUCA 1IOLA 5AVTA 5CP8A 3Q3CA 1NASA 4KXVA 3TINA 4G5SA 2BHLA 1W2WB 1EGAA 1NZFA 4YJ3B 2LD4A 4GU5A 3FPCA 5AQ1A 3GV0A 3GAZA 2ST1A 2ZUSA 4IH1A 4KAXA 1J23A 4L9WA 4PLWA 1PD0A 1RMYA 4G26A 5DGXA 3ICCA 3ZPXA 1CFZA 1D7AA 2BEVA 2PKRA 3BJRA 2QIPA 3LXUX 4TMKA 4V0RA 4LMPA 1MZPA 2WTUA 1RWVA 4MRNA 5EMKA 1NP7A 5A2QA 5EHQA 4JI6B 2IW3A 3FMVA 4L7QA 1N6IA 4B79A 2JAQA 3SM9A 4HP8A 4XB1A 3T12A 3I61A 4CKWB 2DJ5A 4YCCA 1IG0A 3JQ6A 3JVUA 4BNNA 3K94A 2BI8A 3KEGA 3DMGA 1JWAB 1U3UA 1VC2A 1N0UA 3RRYA 5LJIA 1SUPA 1YU9A 2ZT6A 2W8ZA 4I55A 3PDIB 2O5CA 2JJMA 1KZHA 4BO3A 1NVDA 2WU4A 2NW6A 4M0UA 3ZW9A 3QFFA 1MHTA 2CF5A 1U4NA 3E18A 3FYDA 5F3WB 4UJ5A 2ZB2A 1G3MA 1P9NA 2DP4E 3DLPX 3N0WA 3PWZA 4M8SA 1GNPA 1C7QA 3DFFA 3WWZA 3U3XA 2Y3IA 1UBFA 2C2XA 1KERA 1JDJA 2EQAA 1AC5A 1MFZA 3RJZA 2CJFA 3X1JA 5EJAA 3CTPA 4QYSA 5E6SB 5KQSA 3SSOA 3BEOA 1HI9A 3A05A 2NPOA 4NCNA 5EJMA 2DFKB 1T43A 1PCXA 3U5TA 3HYLA 2Q3MA 4H31A 2PT5A 2W2VA 1TD9A 1Z4OA 2J3HA 2OAP1 3AUSA 3C5EA 2VDKB 4HYYA 3K6SA 4B6EA 1ISHA 2E4XA 2JCXA 4GKBA 4UAVA 4UZFA 3ETNA 4NOKA 2ZIEA 1NI4B 3E7FA 1BDJA 1KI8A 1MF7A 1NQWA 3GFGA 4PPFA 5EQTA 1RKXA 4U7JA 1AB6A 4YPOA 2Z4SA 2A5LA 1UWCA 1GCOA 4J0GA 1OLSA 3DAOA 3Q11A 1W581 4E5PA 3EDYA 1QBGA 2H9YA 4NE9A 3JAWA 2PQ0A 2W42A 4CZ2A 4HBZA 4HB0A 1VHTA 4FS3A 1URPA 5FBRB 1DV1A 5EMNA 1B1CA 2VUIB 3EEFA 3OSZA 4C5AA 1HF3A 2QUJA 4N7BA 4QJ5A 3LUBA 5EWMA 2EBUA 3F73A 4J7AA 2XZLA 2B2CA 2C4HA 3KYDA 3MOSA 3HCDA 4G24A 4J0CA 4WL0A 2ZBQA 4ZVOA 3P9QA 5EHZA 1I6MA 5DFAA 3PFHA 4BIMA 1QDUA 1RE0A 2P2CA 2XDQA 1PQPA 3A1TA 3C5HA 2EGGA 2GK4A 4HQOA 1E8DA 1XE3A 2VAVA 1OYOA 3GDHA 3F1LA 3I4LA 1Z75A 1KWGA 4NBRA 2W70A 4BNJA 3PIDA 3AK4A 4X41A 2HF2A 3N0VA 4KMMA 3VPFA 3CLHA 5CA0A 1LDMA 2A1TS 2ATCA 5DYIA 4B1FA 4E7PA 3UV3A 4FGWA 2P3SA 1E2PA 2QRJA 5C52B 4UHDA 5ELXA 4DA8A 1FJHA 1X1CA 1BGWA 2JBAB 2JGDB 6REQB 3NBZC 4GMGA 1WPQA 2YV1A 2AHRA 1ZM9A 1OX4B 4FYYA 2WMOB 2COKA 3KJIA 2XSZD 4AQ7A 1IK6A 1J9ZA 3RS2A 5F9FA 3IAHA 3DNFA 5ADWA 5DHQA 3L6CA 4EZEA 4H2DA 5JARA 1T8PA 3ZBUA 1E2BA 4BASA 2AFRA 2BEVB 1DIHA 3W8FA 1W2HA 2A9RA 1FS6A 1UJ6A 3CH6A 3I2KA 3VR6H 1I6LA 2FKNA 4Q4AA 5IJ0A 2UZAA 4QT4A 3TM4A 1R9MA 1THZA 4GF5A 2FSVC 1YC2A 4FZ5A 2DYKA 4YONB 1VYVA 4EHIA 2Y0DA 2FLVA 3LOUA 1WXFA 4HKTA 3PC6A 3ULKA 3OD5A 4DDWA 4QFDA 5BSWA 2OBNA 5B7PA 4GECA 3WDMA 2Q4DA 2QT1A 2OAEA 1P33A 3V8PA 2CFOA 1KMIY 1MN6A 1MIHA 1OW3B 4ZYXA 5C8XA 4W5TA 4MUXA 1JEOA 1TE2A 1GQQA 2PAFA 1UXIA 2C3PA 4YRSA 3DLHA 4A6XA 2QW8A 2AN5A 4ZQIA 1ESZA 2FFRA 3EFHA 4N3CA 5T67A 2HRQA 3QW4B 3V2IA 1PVVA 3ELBA 5JCZA 1ZGCA 4RKQA 2H4JA 2ZYVX 1C3VA 4QD3A 4ZXPA 3ZEIA 2X22A 2JLUA 1H1DA 5ECYA 4B34A 3P0IA 4FQ8A 5HIIA 1KIMA 4LZJA 1S1MA 3A4MA 3DYBA 1R9GA 3D6HA 1YOVA 4KQMA 4EYSA 2DWPA 3CCCA 2N1BA 5C81A 3WRVA 2B82A 2OENG 3KBBA 1K98A 4KSCA 4JP5A 4QOHA 4E30A 4JMPA 1Y6GA 4JI7B 3BMNA 4DA7A 3S81A 3KTAB 2XBMA 4IZHA 1N57A 1SUWA 4KVZA 1XMVA 2H52A 4I9UA 1ZM4A 4QXOA 4BAUA 5KNCD 1XBTA 5FX2A 1X2EA 4CDRA 8GPBA 5EIHA 1Z5ZA 4ZVTA 2IBMA 5EJ9A 4PSAA 3UBTA 1HA3A 1TVEA 2OYSA 3SQOA 1JR6A 4RFLA 4IJ6A 4X64B 3R0VA 2NIPA 3ZDYB 3LPAA 2NUAB 2HSJA 3L2OB 1BJKA 2H4HA 4X6UA 3HBNA 2EBHX 4IVNA 4XIGS 2ORVA 2WZCA 2VZ9A 1JDTA 1WUIS 1F20A 2NO1A 2EP5A 2CDNA 4IJVA 4ZZ3A 4HLDA 4OJMX 2BZSA 1IDN1 1MEEA 2NYRA 1RWKA 2PGLA 3C8UA 4MWCA 3ROGA 4C4PA 5AYVA 2ZT8A 4D4LA 4L7VA 3VSAA 5JLAA 2JKYA 1NLZA 3AXSA 2VI5A 3VKGA 1N2CE 5K20A 4PIMA 5HFAA 3O21A 2F4NA 3I23A 3HR7A 1UDAA 3OX3A 4DR6B 3SVZA 2E4UA 3CX4A 2BZ1A 3G9UA 3DLBA 2HSZA 3ZU3A 4QUBA 1JEQB 2JJ1A 4L08A 2CD9A 3RRFA 4QKQA 4V2IA 2WIJA 3WTBA 2M6RA 2JI7A 4AJEA 4AJIA 1I2CA 5EMMA 5IVDA 1O6BA 1G9TA 1P0CA 1XJ0A 2AA3A 2VWPA 2XGMA 3NIFB 4BLTA 2A3NA 3AX6A 1GTJ1 1X9GA 4W9NA 2EWVA 1SIWA 5KOHB 2QYTA 4HWOA 3KSBC 4GPEA 1LBEA 1P1BA 1NUTA 4RMNA 3QVGB 3IESA 4DS3A 3P20A 3BB3A 4P3OA 1IHXA 1PG2A 2BGTA 4RTLA 3LYAA 3KQKA 1O8CA 4NK5A 1EE2A 2WILA 4D4IA 2QP3A 3HI4A 4B3GA 2D8AA 1OVGA 4KVFA 3BF8A 1BWQA 4YRJA 2ORYA 4PWZA 1JBKA 1KO4A 2HUPA 4XYMA 5DM4A 1O9GA 4KKXB 1HMPA 3ZNNA 4F6LA 3W7AA 2VDLB 4RF2A 4LPSA 3LCRA 2GBPA 5L3ZA 4BAZA 5KVVA 1QPZA 4HTAA 2ODNA 2PUAA 1L4MA 1ZI6A 2AFIA 3HH8A 2XCRB 2RHMA 3G8CA 2FETA 1VZ2A 3IKVA 1P19A 4UKDA 4YMWA 4CM4A 3PQFA 2QM0A 5JJLA 3ZW7A 4YAJA 2ZIFA 3AIKA 3E6AA 5FL7A 2I87A 5KYUA 1FFAA 1NVAA 1R4AA 2AS0A 2G06A 2ZYUX 3MMZA 4ATNA 4DIMA 4A0SA 3TOZA 1OGJA 4DQKA 3M5DA 3R7SA 5H3LA 1WZNA 5JSFA 3ROMA 5AKGA 3BK2A 3EWNA 5KDOA 2G9VA 3HL0A 1JHXA 1ZH6A 2HSWA 3IPAA 4PBSA 3UK2A 1GGNA 4EA6A 1DFIA 1N5RA 5FTJA 1GITA 1U90A 4BNIA 3N39C 2PZLA 3KXPA 1GDHA 3CSDA 3O9VA 2RK4A 1Z0AA 1WB9A 4WESB 2H2IA 4L57A 1DX6A 4LHVA 3I8SA 1YVUA 3T9FA 4EHKA 1YUMA 3QEOA 1LA2A 1PYDA 1CQJA 2GEBA 1T5SA 2A8YA 2YBDA 1WDTA 3A2NA 3U1VA 2JKVA 3HKEB 2NP6A 3GLFB 5EIFA 2JDID 4EHFA 4MULA 2JIRA 2FEOA 3SBOA 3MCWA 5AHXA 4LRWA 4ROSA 1ETUA 4CHGA 3R0IA 1DIBA 1Y4DE 5B3JC 1JI3A 4B7UA 3BKWA 4NFSA 2C84A 2VH2A 4MV0A 3SJZA 4FLMA 4IPTA 2HB6A 4IX9A 5FBLB 1QOZA 1FUIA 3BJIC 3U4CA 3V3TA 4C3VA 4LUCA 3D6UA 1LFAA 3V32A 1SD1A 2QZPA 3MT0A 1RQLA 4QHSA 2B5VA 4UREA 2HKIA 3KFLA 4OAQA 4BQOA 5IPFA 5D6NA 4N01A 1T34A 2FU5C 4A0FA 3HKDA 4FZ3A 3MWJA 4W5OA 3GA0A 4IGKA 4PXSA 1H2RS 4KBGA 1DT5A 4JASB 2BR5A 1S8FA 4LIPD 3DTVB 3IQWA 1KVSA 2NNWB 4Q19A 4C6SA 3CF4G 4K40A 2W6CX 4S35A 3B9BA 2Y05A 2H7XA 2P9FA 1GUZA 1TO2E 4CKXA 1KO5A 4QTUB 2UYQA 1QK5A 2CZCA 2NSJA 3FIJA 4KLRA 2J3IA 4MV6A 1RFGE 3VBCA 3VNBA 4ZN6A 1ZN2A 2P65A 1KMQA 2F3SA 2VWQA 4EABA 5KTTA 4M4SA 3UMGA 5JBNA 5KC9A 1DVRA 1A69A 5JZVA 1BS2A 1NIPA 5AKZA 1CDOA 3EN0A 4RCVA 2QSYA 1Y8QB 2XA1A 1XAIA 1XQYA 1SCIA 3AUFA 3BFJA 4OI2A 1XTJA 4Y9SA 1M34B 1YDMA 3VUEA 3R8FA 3R0QA 2EF1A 2NYAA 3OKCA 4W63A 3WXBA 5JXHA 2VAWA 3EIQA 4O8ZA 4CUZA 4MKGA 1R0ZA 1KZ6A 1WQ1R 1FFBA 2WHEA 3WP1B 2QJRA 2HJ9A 2YY7A 3F7TA 4MI3A 4D0LB 2WJ6A 4DREA 1C4WA 2X0DA 3K9FC 3PRKE 4R8SA 1MOPA 4UU1A 3OH8A 4H3HB 4DJEC 5BNIA 3QG5A 2LDBA 1XN4A 4I46A 1SU6A 4NYMQ 5ULLA 1E1QA 4Z1MA 4POAA 1AMNA 1GPH1 5SZKB 2BR4A 5HZMA 4EAAA 4J9UE 4CM1A 1I5RA 1JSZA 4RWZA 3IP8A 1G38A 5KWEA 1RYBA 2HJVA 2JLRA 4ED9A 2I8LA 3IJEB 5DTRA 1W73A 2FPXA 3QTTA 2G70A 5FPKA 1M0TA 1FNDA 1MX9A 2YWXA 4GLOA 5CM8B 1YZKA 3EZ2A 5KYWA 4LXQA 2Z09A 4KXQA 3AF4A 2JCBA 2GRUA 2R00A 2VDRB 3OCXA 4GYWA 3IUSA 1JA1A 1XO1A 1ZLXA 5T6MA 3EWAA 2MCFA 3VPXA 2F90A 5A06A 3DBHB 1KGDA 3DGFC 3CZ9A 5FLXA 2A30A 2QTRA 4M8IA 1GL9B 1QH1B 5ALPA 3TLGB 3TR5A 3O2JA 2D0DA 4XQEA 1NTRA 1NW7A 1XZLA 2QR5A 1G64A 3LF2A 2R8OA 3GD5A 4U2DA 1FJXA 2B8WA 3NQ41 4MRPA 3PDJA 3PFIA 4HN9A 1RXIA 1CEXA 4GH5A 4ZYWA 3OTOB 1AO3A 3JR3A 3L8EA 3O2NA 1J2RA 1LRJA 5K0TA 4HWRA 3GUYA 2PLNA 3I2GA 2QX4A 4IWXA 3DB1A 1US8A 4KRXA 3TQTA 3SDSA 4KHZA 4M0EA 4BNGA 3ZS8A 1ORTA 2UV8A 2ZK7A 3MJ4A 3PI7A 3QFSA 3U7EB 2CHVA 5E4YA 2GEKA 1UK8A 2Q3LA 3RFVA 2WT9A 1OLSB 4QQKA 4TT3D 4WKOA 4C2UA 2B98A 4ZYUA 4ZQHA 3RSHA 3SR4A 4FT4A 1DLIA 4KJZA 2F6RA 2RG7A 3UKJA 4YCDA 5KQPA 1YI8A 3KQOA 3H4MA 3N6VA 4LWPA 1A5ZA 5AK0A 5A5EA 1FJGB 1NJ5A 3BXEA 3KT6A 3DWFA 4CLRA 3TCNA 1JSCA 1TFRA 1QVVA 4B7ZA 4ZV9A 2AVDA 1DG9A 2OO5A 4FR0A 2BFDA 4E5NA 2VAXA 1JIIA 1N6HA 3QEMB 4TUYF 4GLFA 4FEGA 1TK3A 3S55A 4B2PA 5KTYA 4DWWA 1E2GA 5JECA 2ZATA 4MW4A 5BPFA 1TUGA 2XE8A 3QUAA 4W99A 2JFGA 3M6AA 5CUQA 2HL6A 3ELUA 1E18A 5C7LO 3EEOA 2CEAA 2RI1A 2ADMA 4YRNA 3WK4A 1AG9A 4JLPA 4DUGA 3HO8A 3I1YA 4GAEA 4KDCA 1FA9A 2VJYA 1V11B 5H83A 1F4VA 2WUWE 4JL5A 4MWBA 2DY1A 5I9NA 4ZXFA 4F7DA 2IGBA 5LQCA 2VRNA 4PPNA 1R5JA 2HN9A 2O5RA 2V3WA 2VHQA 3MBKA 3C70A 3HYRA 5ARDA 5BSFA 4Z4IA 2M98A 1M0WA 1NF2A 3O1IC 5TQVA 3TTUA 5DLQC 2W2XA 4IIFA 2R79A 1KXZA 2D1QA 2H1WA 3BWCA 2NYVA 1LJUA 3WNCA 2H06A 1F9AA 2C20A 5AIAA 1AV7A 1S9DA 4C4ZA 3U16A 1RWQA 3SXPA 3PDHA 5D86A 1TEXA 3RLIA 2O7RA 4MPTA 3DEYX 3GGSA 2ID7A 1E5LA 4Q7JB 4ZO9A 4EX6A 1R4ZA 4NZ9A 4EUFA 4PGHA 4CFZA 1UMKA 1USIA 1X14A 4Z0PA 3ZCPA 3D3JA 4XOUA 1DSSG 3TGLA 4JCOA 5KNCA 1V4NA 2J7PD 3BMCA 1C3OA 1GA4A 1JMVA 3ONFA 3I45A 3TEMA 1XZFA 1L5QA 2QE7A 1RYMA 4YAUA 2JGAA 1QMGA 3WAKA 4K9PA 1B14A 1Y3CE 5J47A 4ZEVA 2H2AA 4Z7OB 3I6QA 5JJCA 1C7FA 4DLWA 4ZJUA 2JA1A 1V26A 3HFJA 3MHPA 3O31A 4N8SA 5JO0A 1SB9A 1KJYA 4IINA 3G9QA 1KAGA 2P9BA 1VJCA 1OXXK 3R23A 4QFBA 4EGAA 3WP0A 1APBA 4XGKA 2WF8A 2ZS9A 1VRWA 3L4JA 2X4LA 3IP1A 3KUUA 2IYPA 2WNSA 4Q3KA 4IS3A 3S6JA 2YNMC 4I1UA 2XQKA 2KJQA 1MPTA 2BKEA 4WZBB 3IMCA 1QIFA 4G5FA 1I4EB 3ZJTA 3CY6A 2COEA 4LCBA 3CLTC 5JS6A 4JGIA 2FLKA 4HJXA 1GADO 5DGTA 5ANRB 3EZYA 3RHFA 4KDRA 2GHRA 3I9KA 3NUGA 1A3CA 4MJLA 1NDQA 3KQSA 3G13A 4L85A 4Q4LA 5AI5A 2R00C 1QFMA 4AO6A 8AT1A 4YP0A 3QSGA 1XF1A 3Q3JB 3U0BA 3ZHTA 5C53B 1BX1A 2C8KA 2I99A 4F06A 4HYQA 2VUUA 3DDWA 4GX1A 4I4TF 4UEJA 5E7JA 5AW3A 1MZVA 1ZD4A 4HQFA 1FDSA 3O3OB 1EK2A 2JZNA 2H3HA 4A36A 1OBHA 1CUUA 3A9VA 2RHHA 3UAOA 3IEKA 3UHAA 2W93A 4UNSA 3GZTB 3UJCA 4C3UA 4ZQCB 2IOQA 1Y89A 3A3PA 3NBFA 3E5RA 3PJFA 5LR6A 3MIZA 4LRTB 1GZ5A 1JEYB 1SVLA 4KYUA 3B1ZA 4Z0NA 4PQGA 1G18A 2Q1TA 2YINC 3PFNA 4HMQA 4NTZA 2FOLA 1HO3A 2WG1A 4RXUA 1XDSA 3U4HA 3Q7TA 1BFKA 4IKPA 1E3WA 1I4OA 4LISA 1DQPA 3SR0A 4NEQA 4RSGA 1ESCA 4US1R 3ICQB 4KQEA 4WOCA 2D0OB 3IQIX 2WIAA 1OXKB 2BFFB 1WCIA 4I5IA 1VPTA 5ENDA 4KYIB 1T9AA 2GCNA 4DCPA 5DEOA 2VQ3A 4RU1A 1CZRA 5DOVA 4ENTA 1VL6A 3QX7A 3C3WA 4MNTA 4BNLA 1XC7A 1P31A 1V8PA 3NT2A 1U94A 4QULA 3UMJA 2C9CA 1M2WA 3JWEA 5EWJB 5IBCA 2CNDA 4ZGWA 1I13A 2RGEA 3ITEA 3N7TA 4O4IF 4R7ZA 4HBGA 3LECA 3VX4A 1UXKA 2AQIA 2FHSA 4DF3A 5JSYA 3RVSA 1UJBA 3K1AA 5KB3A 3LCVB 1DBWA 4Y2HA 2G1KA 4FDUA 4BZZA 2VP2A 3PGJA 4R68A 4F60A 1KZGB 1I4WA 5BMVF 4LF5B 2N47A 5KWJA 4B35A 3THWA 2OM6A 2EKLA 4OQNA 2HCBA 4Q34A 4QECA 5EUQB 3NV9A 4JX8A 5DB4A 2EX1A 2PVCA 2R4QA 4Q4JB 5BW5A 1KEEA 5ALVA 1Z4NA 3RD5A 3QVKA 1RR6A 1L4HA 5BVGA 1M8FA 1TO1E 4ENQA 4FD2A 2GUGA 2O1WA 3QVVA 1MA0A 4HX2A 5CFNA 1UBRS 2VEOA 4ZKDA 5KJCA 1DQYA 1OBVA 5FUQA 1KAMA 1G9XA 4NBWA 1QE3A 4MGIR 4P0QB 1QNFA 1GZ4A 221PA 1KK0A 3FZYA 2NYUA 4C88A 2QGZA 1ADGA 3HSKA 1Y8CA 2FEXA 2VQFB 3N07A 2FWNA 2ZQYA 4LDAA 1AJEA 3WNVA 2PGOA 5JZSA 4QOEA 1QWSA 2P79A 4PO9A 5I3CA 3T1HB 3A0UA 2O8EA 4KR9A 1QIDA 2V7VA 1H69A 4BFUA 3JQ9A 4L9SA 5CEFA 1G8MA 4MITA 2IYSA 3ZGYA 1JFSA 4QUKA 4ZARA 3TXYA 3ZCVA 1CXZA 4YUWA 4R9RA 1M10A 3FG9A 3EPLA 3VR0A 1JG7A 1KI7A 3D81A 4G9GA 1K6MA 3RIEA 1E3TA 2LE0A 3GJ6A 4WKPA 4J8PA 2NP7A 1N7JA 3UWKA 1U31A 1NHGA 2QAGB 9ATCA 1ISJA 1ZH8A 2K2WA 3O8OA 1GKKA 1W4BA 1YS6A 3HDGA 3IUYA 4TQUS 5C9ZA 5K6TA 2LCFA 2B4KA 4GZ3A 3H19A 3RUFA 721PA 2IEZA 3Q7IA 3LI2A 2YXBA 1RC1A 2JAOA 3MHTA 3EVFA 1MNQA 4FMCF 4KX3A 4QU8A 4GDMA 4FHGA 3R0ZA 1KTVA 1C7RA 2FQWA 3VSCA 4RHCA 1HYEA 3T4EA 5KTRA 3K0HA 1NKSA 4TS3A 4ZT5A 5ESRA 1COWD 1VGQA 5C34B 5LQKA 2P5SA 4OHYA 3IMFA 4MRRA 1KMHA 1BG6A 1RXUA 1BJRE 4KAAA 5IVIA 3PGA1 4C1NA 1R0YA 1YMQA 2IX9A 4REMA 2QTWB 1XJQA 3MG9A 4J4HA 3SD7A 3GEDA 2AR9A 1I4TD 3AVTA 4JSRA 3OQOA 1H2XA 4PLPA 3KB6A 3GLGE 3HK2A 2PT9A 1WXWA 2VVTA 3QKRB 4OYLA 4RUKA 3V55A 1FFHA 1YKGA 3ND9A 5FULA 3W2EA 4LOIA 2ZOSA 2XE4A 3F5QA 4K9NA 2Y1GA 4GPZA 3AVXA 2VJKA 1SQFA 3JATB 3S99A 2KE5A 5DOZA 3Q3EA 2ASEA 1IL0A 3JQAD 4FCCA 3UFXA 1UF9A 4TLCA 3ASYA 4URWR 2PYIA 4I66A 1P4RA 4YJ2B 2HBZA 2LVBA 3BSWA 3EOZA 1W34A 2V7XA 2X8JB 3UA4A 5F52A 5BW8A 2EEZA 3SKVA 2PKYX 2PYDA 3R7NA 5CM2Z 1QGUA 3KPYA 2FB9A 3N75A 4YUYA 3VR2A 5EZQA 4JLVA 1QGAA 4ZRDA 4FFVA 4X1YA 3RC7A 4I9NA 3FMPB 3VR2D 2PS3A 1Y1QA 1PSZA 1D4AA 1G21A 1A7JA 4CIAA 5ALRA 2D54A 3RWOA 1YBVA 1V9SA 2YYYA 6YASA 5JTUA 5JPDA 1F5SA 2PL1A 5K8IA 1VDMA 4Y9RA 3GJ7A 2Z56A 4YQYA 3CX8A 4EY8A 2X5XA 2IU3A 3D31A 1FP7A 4IP0A 1BW9B 1WULS 3PLNA 4O4HA 1EI9A 3KG2A 4LE0A 1W35A 2C8VA 1Z4JA 4EI9A 2W6IA 4C29A 1ULHA 3KKNA 1MW9X 3T7SA 3U39A 1MDFA 4QGBA 1Y6QA 4IXNA 4BTEA 4LC9A 3EA4A 2Z5LA 4Z4CA 2IHKA 2GCIA 5K3SA 3SMVA 4CKWA 5KQRA 4HAWA 4B75A 5U9CA 1HOTA 5F4BA 3TH5A 1JZSA 1U9IC 1FMLA 3L7KA 2X0EA 4PLHA 4KWHA 5ELLA 5C7IO 3TSYA 3AT1A 1YR6A 5AW6A 2HA4A 2MSLA 4BNXA 3CZ4A 3HR4A 1JYFA 1RI3A 2IEBA 2VA8A 3VKVA 2VJMB 5HNKA 2AOVA 3WADA 4DRYA 4L28A 2XHEA 3LTNC 5KSZA 3NWPA 5F7ZA 3ABSB 3OCJA 3ZBQA 4A4DA 4F6RA 4H3SA 1ZMBA 3KLBA 3R7LA 1W5TA 1XTVA 3V1KA 5KDLA 1OXVA 1XZQA 3VV3A 4UM8B 4K2HA 3SHOA 3A1WA 3R09A 1PTJC 4F8YA 3JYNA 3QFCA 3EC7A 5KYKA 1HE8B 4L0QA 1TVCA 3GJZA 2HMYB 1H4SA 3FPJA 2DULA 4L5CA 3DZIA 5DNEA 1NUAA 4G8BA 2Q7DA 4FQ5A 4BGIA 1RZRA 1D1SA 4GBED 5AHRA 4EA9A 3RGWS 4DLPA 2GN1A 1NRXA 4PLTA 4G0VA 1IOVA 1U0SY 2J0VA 3QEKA 4ZVLA 5L3QA 2QL9A 5CH3A 4YCJA 5DDIP 4HVLA 5F7XA 1TT5A 1QQBA 3NTOA 1X39A 3WL4A 3FGPA 1QYVA 3IQGX 5DKFA 3R76A 1ZRSA 3SNHA 3PIIA 4HATA 5LNK6 1QO9A 1XKLA 2V0GA 5ESWA 1JIQA 2O5VA 4OHOA 1DC5A 5I9LA 5DCLA 4KK3A 1XPRA 3AR2A 4MVJF 1F0PA 4XM1A 3ORQA 1N9GB 5KOYA 1ZZEA 4M1YA 2ON6A 4TRMA 1HL7A 1QTRA 2NZJA 2XQVA 3Q72A 5AKKA 3FBTA 4OGLA 4D5EA 2HPZA 5B7NA 1KKUA 1GA1A 2QQ0A 2PX2A 2HD4A 2H5JA 2GYWA 3A27A 4B80A 5FQOA 1DP4A 1OGIA 3G0DA 4IZ6A 1HYGA 3L84A 4PZPA 3I05A 2ZYWX 3UOAB 4XPIB 1I7PA 2ZYIA 5DXAA 2VK8A 5AM5A 3L7MA 1P29A 1AQNA 3BERA 5DPMA 4DKXA 4PS0A 5DCYA 3PC8A 5FWAA 2QRMA 4D8UA 4F4FA 4G0XA 1TZMA 1WY7A 2GZDA 1X3LA 2J4DA 2RH4A 1ZKDA 2FQYA 3GJTA 3JARA 4W9NC 4D9JA 4DSUA 5HUJA 5HSGA 1EWQA 4ER5A 1T2EA 1BRTA 2OVFA 4NPAA 4F9GA 2IS6A 5B57C 4G8DA 3U56A 4RIIA 4X44A 4KXMA 3OT5A 4PZCA 4LYGA 4PZYA 1C7ZA 4NECA 1ZSYA 3L4EA 4XZ3A 1H0SA 1CS0A 4DGQA 2BIFA 1EGQA 2WZQA 3DWEX 3PS9A 1KI4A 2VEDA 3CF4A 4CMKA 5TIIA 3AKCA 3ZXXA 4QG3A 1LNZA 1WU7A 4LY3A 5KQLA 5DE3A 1T0IA 3UHOA 3W3AH 4J07A 4E08A 1RBMA 1F14A 2F8MA 4WKNA 1OI4A 2IELA 4ZI3A 4C4RA 2R1VA 3SEFA 1ZUD1 1I7QB 3BA1A 1XMOB 3A37A 1Y1LA 2JFQA 4RGVA 5HKKA 1K8YB 3IV6A 5L4SA 1K2VN 2JGLA 3KHKA 3IUEA 3PHHA 4HDAA 4L0MA 5AM4A 4BNKA 5H4GA 4KV9A 2FK8A 1PJ2A 1RQRA 1M54A 4HQ0A 2DX7A 3JQBA 4JXXA 1AUVA 3DZKA 3NT4A 2WOOA 3AEKA 2CXSA 2QZ4A 1YR1A 1W4CA 2ADFA 3QVMA 4GMDA 3SC2A 5HM8A 3KEOA 4R1LA 1EU1A 3NBUA 1DCFA 2R44A 1MX5A 1O0BA 3GRYA 2WHQA 2C92A 1K5DA 4P0PB 3DJYA 4MP6A 3RTEA 2IHBA 3OOWA 5G1PA 3GUZA 1ONBA 3T7AA 4M1MA 4V0SA 3T4UA 1NI3A 3NUQA 5EE9A 2WUVA 5FEUA 4B81A 1E5XA 4TXJA 3W78A 3IVRA 3ELYA 3BXPA 3IDOA 2EFGA 3KLMX 5D87A 3O3NB 3RF7A 1Z5NA 3W5BA 1OD6A 3S2EA 3WGHA 4Z86A 4ERNA 5JAPA 2ZWMA 5KHLB 2UDPA 1G7SA 4WFKA 3TS1A 1OH5A 2GEUA 4HH0A 4NC9A 1E2KA 3UATA 3I1IA 4ALMA 2W6QA 3O03A 5EXTA 2JIOA 1C0KA 1ULSA 1JUDA 5J43A 3KETA 2IS2A 1IZYA 1XK6A 1DWUA 3F67A 1GUFA 3G8DA 4HHEA 2I3GA 3L7OA 3NFYA 4OHBA 2FPOA 1KJWA 9LDTA 5LQMA 4BO2A 3IUBA 3H4TA 5LBIA 5ESXA 5JZOA 2FSVA 2AZXA 3IMEA 3LBHA 1CSEE 1JI0A 2OO7A 3IRUA 3SR3A 2JAHA 1CY4A 3ZU2A 5CDUA 3MTDA 2X5NA 2YWHA 2B99A 3KSZO 3RUCA 5TF0A 5LP6F 3DCIA 5A04A 4DILA 2AXNA 2OBFA 4DNPA 4BE9A 2BLLA 1Q0HA 3DVSX 3H87A 1VBNA 4B32A 4DXHA 4BXOA 1Z5PA 2CNNA 2O6LA 1AHNA 2OV3A 2GN8A 4MEBA 2OQRA 4LV5B 3SBEA 2HEIA 1TKRA 1DJPA 3NJRA 1V5IA 2ZWIA 2PRJA 5CK4A 5F73A 4HZGA 4XJVA 4PC7A 4BL5A 1QOPB 2PXHA 3UK6A 1B8NA 2OV1A 2QE7D 3K2IA 1AKTA 1ZXLA 4FYXA 4JBYA 3T4PA 1A8QA 4P35A 3H2KA 4DIUA 4NARA 4IYRA 1P0MA 2C7GA 4JWKA 4A5OA 1QH8A 1FP1D 1KI6A 1O2DA 4EG1A 8ABPA 4NR0A 4AKGA 1WE2A 1JEJA 5FI0B 4WFJA 1PT7A 4AN4A 1BH6A 2AV6A 4M9ZA 1YONA 4S1PA 4XFKA 4BGVA 1I3KA 5ED0A 2CD7A 1N6LA 2H7VA 2YUIA 4I5GA 4TT3A 1U0JA 1XNHA 1SFRA 3A6HA 3EY9A 4MGHA 5IJXA 4XSHA 3RSZA 3T5CA 5LM3A 2B6HA 1DKOA 1DKNA 4TVSA 3QV1A 2QLJA 2NO5A 1SUCA 2C2KA 2WFAA 4ZVNA 1C4XA 1Z3IX 2DBQA 3HJTA 4NAUA 4RHTA 4TZ0A 5J4YA 2PU7A 4CF5A 3LVBA 1QIEA 3WR5A 3QM1A 4F93B 5IEBA 2QRHA 4UCQA 1CS0B 1XXHE 2X9GA 3RR2A 3T38A 3X44A 4C14A 3U61B 3L7BA 5DTJA 1E3MA 1U8ZA 3INYA 3IEMA 4QHYA 1EBUA 1XTKA 4BU0A 1VKHA 1C9YA 1QG4A 1XCBA 1Y1PA 4ZVSA 4CIDA 2PT7A 1E7YA 1NI5A 3ECAA 3FSGD 4J1QA 4JVSB 2VJNA 4OOFA 4F8JA 4D8WA 3K1JA 2AZTA 3I37X 4PG7A 2Y4NA 1CUSA 2JFHA 4C6TB 2ODWA 3DCJA 3GJ0A 3ISJA 3GF4A 4FSXA 1IN4A 2OFWA 3LJKA 4LXUA 4R6WA 1R3DA 2ZWPA 4HTFA 1QHYA 4PZDA 3ZQ6A 2JGIA 3KWLA 1VCMA 4EVQA 3HO1A 4HGZA 3SS9X 1F06A 2OAGA 2P68A 5DM2A 1SWWA 5TMPA 1E1MA 3OEED 4P36A 7ADHA 4I1RA 4L5BA 3B3FA 1P2SA 3AEZA 4LX8A 1JJVA 3DL4A 1EK1A 3FI0A 2JGEA 5FPPA 4C5BA 4BP9A 1AX9A 1Z2AA 1Y34E 2QN6A 3OQ6A 3EDQA 3EEBA 3OT4A 3HRIA 2V97A 2O2SA 3QHPA 4A1OA 1O6FA 2QY6A 2VRCD 1S2GA 1QONA 1GNLA 2QVYX 1KETA 4K86A 4URUR 2PS1A 2D5BA 3JWPA 3PE6A 1FMTA 5HJEA 3H1AA 1QS0B 3E03A 1YE3A 4AQDA 5IAAA 1UANA 4UUBA 4WOJA 1BU5A 1G8GA 4FPXA 2PS9A 2NZWA 5A7GA 5IUJC 2XUHA 3ENNA 3PB3A 1PD1A 3H99A 4ZQFA 3L06A 3T0GA 3VNQA 4AVYA 1GAWA 1NUUA 3RK1A 4MS4A 3MILA 1Z26A 3QLUA 4JYPA 1AK1A 3A0RB 1KSHA 4GXRA 4GNKA 1H3FA 3SF0A 1Q3HA 5PNTA 2FUEA 4KI7A 3KQPA 1M5UA 4DWOA 1P2VA 3OOSA 5GV8A 3B12A 1ZMXA 5L4LA 3JATA 3QLJA 4R16A 1EVQA 2UAGA 4F4DA 1GFWA 1WDWB 5FOXA 5EJ4A 1BEZA 1B8UA 3M3PA 1D2MA 4IW3B 4DMLA 1YGYA 3U4DA 2ZUEA 2CUKA 1DARA 4TUYB 5AKYA 2PPLA 5CJPA 2W2LA 3BXFA 4MYRA 5CU7A 3VPHA 1ZPDA 3IQEA 2RHGB 2GTPA 3FVWA 3FNEA 1TGYA 5CXUA 1A7UA 1A04A 5JUWA 3BT7A 1YD7A 2YY6A 3FOCA 2O3TA 3DSRA 1NC3A 3LL7A 2HLNA 5LSAA 4RY0A 4BMVA 1ZWLA 2RHJA 3DE0X 1CEYA 3A9CA 2ZXEA 4NICA 3REOA 5IAOA 2BGUA 1P6UA 3VR4A 3EAGA 3PUIA 1FXUA 1TQHA 2IUFA 5G0UA 4M0KA 1CUCA 5IT5A 3RAEC 1Q74A 2RGYA 2KI5A 2XUJA 3EGEA 4MR9A 1EUYA 3N0TA 1WXHA 2EFHB 3WO1A 3ET5A 1BIFA 3DT6A 2I9PA 2VA9A 4MB6A 4JI0B 2WTNA 4CM9A 3TL6A 1FCJA 1PFKA 5A4IS 5IYZA 3PDCA 3HLTA 3VC1A 4R3WA 5HUQA 4XPZA 3VTFA 3GJRA 3E5NA 4FTWA 1OUMA 1GUAA 2BH2A 1HKUA 3E9RA 2XEXA 3FRJA 1GILA 2VBIA 2AG0A 3PFCA 2MT9A 3Q98A 3H5OA 1SXGA 1FK8A 4FWIB 4IFEA 2ZWVA 5I9BA 3TEJA 1AD2A 4QM6A 4F5ZA 4U8GA 1RDFA 2ATVA 2Q6IA 4HB2A 3BB1A 4CT5A 2RHBA 3GLFA 2VRBA 4IHQA 4C78A 2H0AA 1WD5A 3MSCA 3QI2A 1CX9B 4JH0A 4R8VA 2FV8A 1KMMA 2ANBA 4FINA 4RQBA 5LQNA 1Z5GA 1NF9A 2AI3A 3NO4A 1X7YB 2C9ZA 5TPZA 1O8BA 1L5HB 1U0TA 4N82A 2PVPA 1GA6A 4FJ0A 4BC0A 2O8BB 1U7PA 1ATZA 1AUQA 1N8TA 3EF0A 2AOUA 3CPEA 3OIGA 1N7HA 4IEEA 5JSHA 1U7TA 1GYQA 2K5UA 3VZBA 1HYBA 2G88A 2Y76A 1ORIA 1XQ9A 3NNSA 3PSHA 3QPCA 2FG6C 4DUZB 3EZXA 1L3IA 3C8DA 4MKXA 3CNHA 1HNWB 1L5YA 4DRXB 2CXUA 3A8TA 5FFFA 1IN7A 1FUYB 5ALQA 4AYWA 3MJEA 3MTEA 1RI4A 1SC1A 2AG6A 1K4KA 4MYCA 3D6VA 1SM4A 2RMKA 1B8VA 4J4BA 1RYFA 2DUWA 3UMVA 3OM0A 1NNUA 1P7ZA 1JQBA 4JA2A 4YRDA 4X8HA 5BSVA 1BZYA 1F0KA 1O1YA 1OXUA 1TMKA 3DP9A 4P82A 4UXHA 2OZEA 4WK6A 4YMSA 5G3ZA 4TKVA 5GTDA 4NOMA 3L4KA 3TW0A 2EJCA 1EHCA 4FI3C 4HDRB 4LWQA 4QBFA 4YHHB 1MLDA 5E1OA 4EB6B 5UKDA 5D5QA 2VBGA 3GCGA 4ND6A 4P86A 4WY2A 4KL8S 3V7WA 2FJUA 2NM0A 3X1ZA 3ZE6A 3DD1A 4BFLA 2ISQA 4CM3A 1NR5A 2OBXA 1VKNA 4RLHA 3GLIE 2ZYRA 1RM5A 2C5FA 5JDIC 2GKSA 2ZM5A 1E5TA 2HDWA 5KTSA 5A5DA 3AYXB 4UMDA 5TMBA 3K6KA 4KXUA 1G3UA 4NCKA 1OLXB 2K87A 1PJRA 5I4KA 4WZAE 4HLUA 3E5HA 3T99A 3NWJA 1VIYA 1RI1A 2A0XA 3V8RA 1PDWA 3SZUA 4XQCA 3PCRB 3JVVA 1MRSA 2PFGA 4K3VA 3X1MA 4EF5A 4WAUA 1VE3A 3GFRA 4BKUA 2ZDHA 4DMKA 4ER0A 1XDGA 1X94A 5FI1B 2CNLA 1RQXA 1A5BB 1VJDA 2G0NA 2GTIA 1LVHA 2QDKA 4KQCA 5CX4A 4RM2A 4Q6WA 4C06A 2QAJA 4V1CI 3FAZA 3BIFA 1QP8A 4MRMA 5CIYA 3Q1KA 3FOWA 5HFNA 2KX7A 1S96A 5HG0A 3BVPA 2QQEA 1O9BA 3M6UA 1K06A 1RHKA 3SSMA 4I55F 1I3OA 1MR3F 5LOVA 1I1NA 4W7HA 5I7HA 3KZKA 2C77A 1QRRA 1ZG3A 3KC2A 2AE1A 2NU6A 4HN2A 3HJBA 1YQXA 4B2LA 5F1PA 2JLAA 4RZUA 3VO2A 1M2VA 2DFPA 4F4IA 3U09A 2X58A 2ZVDA 1PGJA 2ZAOA 3EGIA 4IMIB 4LZNA 1A1SA 1VLQA 3A3KA 3MWKA 3ODGA 2J6IA 3PT5A 3FJOA 2EXXA 3EBPA 4RNCA 1ACMA 1CU1A 5E1MA 4AJJA 4DV7B 3N9IA 1TM3E 4TV9A 4IV5A 3UT0A 3HE3A 4HQ6A 4EIWA 1KYTA 1ORWA 3PF9A 3PUVA 4NSNA 4YMVA 3PNQA 3UCEA 2HJSA 3W7BA 1Q91A 2X23A 2IIPA 2P1RA 5CNIA 1IJFA 3PTLA 1O5TA 3TOVA 1PJZA 3AKYA 1JAYA 3LE8A 3OX2A 3OZ7A 1KH3A 1SMKA 4MGKR 2OBLA 1KIAA 4TLEA 3FTDA 4HNAB 1QFXA 2ECFA 1N5LA 4UXJA 1J2EA 4A8JB 4J43A 1K63A 2BDEA 3ROZA 3ZNQA 4XAQA 1LC0A 5HQTA 1GY8A 3K9HA 4CMIB 4N9QA 4MQ6A 2XYPA 1AKQA 1SOVA 3EHEA 5IABA 2HY7A 1QR6A 4TSFA 4TSKA 3ITKA 3EXEA 3TNFA 3LL4A 4HS9A 1MD9A 3HU5A 4IGIA 3BHMA 2EX4A 4JYMA 3STHA 2HFJA 1HURA 2UVQA 2ZS8A 3PFKA 2BM0A 1S2LA 3ZV6A 2QLMA 3BXXA 3W9BA 1X7YA 4N5HX 2QTGA 2WKSA 5CYFA 5BRJA 2FRVA 1RYDA 3LT1A 3KV3O 3AKZA 4I50A 4DCSA 2AZDA 3EXG1 1NUPA 1NNI1 2AYZA 2P35A 1PEYA 2I4MA 4X92A 5CFLA 1NPTO 1NOIA 1RYYA 2B21A 4HDMB 4IDGA 4UUAA 1SBZA 3W4IA 3UB4A 5EA2A 2D74A 4IUDS 4ZI2A 2P2LA 1M2FA 2LCIA 5AMXA 1V8DA 3MNFA 1GAQA 3L0OA 1ETHA 2H11A 2IHJA 4B43A 1BTOA 1VPEA 2ZU0C 5AT1A 2YS6A 3KR0A 4WXMA 1MOZA 2WP0A 4Q3CA 3VYTB 4LQLA 4I1PA 1L0BA 2GKGA 2NVWA 2OFPA 1CBUA 2AXEA 5B1DA 2F17A 3BULA 4RAQA 3LQ1A 4FGUA 2GJ8A 1EM8A 3EXHC 4GQBA 5THQA 2OPHA 4CEJB 3HA5A 1OTXA 3SFTA 5LDDC 2PKQP 3SYKA 1RPAA 4EG7A 4OY3A 5SY9A 3F9CA 1G8HA 3BTVA 1D8AA 3SCZA 3CNNA 1TQ2A 1FFXA 4TQGA 1DO0A 2JCGA 4CEHB 3P2YA 2Y0PA 3ND8A 8ATCA 1YA6A 5LYJA 1NJ6A 3VJLA 1GT6A 4BMNA 1P62B 4I3GA 3ZV5A 1V16A 5F35A 3THYA 3CLKA 1GPMA 4I36A 3VZCA 2AXQA 1JDBB 1EJ6A 3CX6A 2C29D 2OEPA 3QENA 4BVBA 5DASA 2PX3A 3UJ8A 4G5HA 3HB7A 4GI7A 1L1RA 1M1YA 3WLNA 4WFQA 3OEHD 5TGZA 1BFDA 4BVFA 3KT8A 2QG9A 4P7BA 4WZBA 4X84A 3PEFA 3G2PA 1Z18A 2F9MA 3LUFA 3ZDQA 1ZJYA 5FBZA 3SDBA 3HRHA 1SHTX 3K5PA 4EMUA 2G72A 3GJSA 3LYHA 1MJNA 5JALA 2O4CA 1XK7A 3DHWC 3D3KA 3L7DA 4YGXB 4P8RA 5AJTA 1V8OA 4OP3A 3AOGA 4MCJA 1UQUA 4IDAA 3NTLA 4PSKA 3R7FA 2OK8A 3WA6A 2ZQZA 1S5PA 3EG9A 2AR7A 3QQPA 2BI7A 2ACWA 4PRYA 2YZKA 3W3AD 2D8MA 3IE1A 1OC2A 2L82A 2XQJA 3NOVA 5K0SA 1U0NA 4GYJA 3G02A 5DWVA 3TG2A 1MO5A 2H0RA 3FCOA 4LSZA 5D00A 2ZJZA 4L74A 1HDOA 1OLUA 1RHJA 1X7HA 4R51A 3CNQS 1WPRA 4BNWA 4ABYA 1W48A 4MX8A 4CG3A 2F3QA 1NUHA 2FFHA 4AWXA 3OOYA 3O38A 4IDDA 4J7UA 4A8JA 4PNEA 5HIAA 2P5UA 4N49A 1QGZA 2QENA 2DTDA 3MW8A 2WINI 2VWGA 4OP2A 3QX9A 2H0QA 2CZGA 2ZSBA 4MS1A 4B17A 1PJQA 1PV2A 3ELDA 4KYVA 4CLOB 5BSEA 1NMQA 2EGUA 4YIKA 1LK5A 4QNNA 5IBPA 1XRSB 1NAHA 3ZDRA 4D96A 5CDFA 4RQTA 5KYTA 3HU1A 1P18A 2BGLA 4OM8A 4BLVA 1K6IA 4EY3A 5AI8A 4MDYA 3M7IA 4ND5A 2H2DA 2ZIAA 4CBVA 1T9DA 3VR4D 1GFZA 3N53A 1LSOA 1R50A 3O92A 4NFYA 1HWYA 4UM5A 2WJAA 1TJ3A 3NDBB 1R5NA 3U44B 1FDVA 1NDHA 4WOBA 1N1DA 2RHDA 1YI1A 3I92A 3L5KA 3TB4A 1MFPA 2VLBA 1E9VA 3DS8A 3KUKA 1CZLA 2JIDA 3LG2A 4YAGA 5KVCA 1W85B 1HEIA 4MVJA 3T8YA 2XT0A 5C8ZA 4DMFA 1Z8FA 3HXKA 3J7AC 1AQIA 3FAKA 1XRLA 3BRWA 1Z2PX 3NBKA 3UPDA 5JZBA 2FYTA 4PFSA 1Q7RA 4ZRNA 4DGSA 5IZCC 3DW1X 1D6SA 2FMKA 1VKZA 1Z0ZA 3OMWA 1IOZA 1A4IA 2X5JO 1TW2A 1UDBA 4WZZA 3OVMA 4Y67A 5DF1A 3BD9A 3UPUA 2F1OA 5AXBA 2EJWA 3P4UA 1Y3DE 3MBOA 4FFNA 4M98A 1HOXA 1EVZA 1Y0BA 4WCFC 3LVQE 2RCNA 3MK31 1QHNA 2NO7A 4QAQA 4YRMA 4X1IB 3AEXA 1SZPA 3PFFA 2O8CB 3RG2A 1AGRA 5T57A 5LYJB 3R9XB 4LXYA 3T3EA 3EFOA 4TLLB 1GSOA 5HCNA 3FETA 1VMEA 1X86B 2I6TA 1GZVA 3O47A 3PC8C 4FNAA 3LLCA 4JJZA 3K6RA 5F3DA 2C3OA 3O8CA 2O8FA 3R77A 5T4FA 4DIOA 5CGZA 5JISA 1YQUA 1KY5A 3HB0A 2VNAA 4LYJA 4F2DA 2DPLA 2PGJA 1MB3A 3DDNA 3DZHA 3BPSA 1P5FA 5HDQA 2BMWA 1KZ4A 1AKYA 2JK0A 1DOHA 1BN7A 1KNQA 1UT6A 3COYA 4RGQA 4AP5A 1SKBA 1LSUA 4RY9A 4YROA 4DVJA 2Q49A 4L4YA 4O6VA 1XFAA 3I9JA 3WS7A 2O0KA 3O4HA 4GRIA 2H07A 2XCIA 4EJSA 4ND7A 2NAPA 5JS8A 4R3NA 1RXSA 4QRIA 1Z15A 1KQGA 4KRFA 1K4YA 1NVKA 1VLVA 3EMKA 4JFAA 3L0IB 5J58A 4DVGA 1RJ9A 4ER7A 4W1PA 1XMJA 3H2SA 5DLYA 2OFFA 1WSWA 1E6EA 2J7KA 1AMOA 4L6AA 2O0LA 3VR5A 4BNHA 3NNNA 3MWFA 1HR0B 1E32A 1G6OA 4S1WA 4Q48A 1NJ2A 4N3NA 3GRCA 3JCZA 3QEJA 3R3YA 2XDQB 3DHYA 1KI9A 3ZU4A 4INAA 1XAHA 3T3GA 3D6MA 1VL8A 2UXDB 4H1HA 4OHXA 2AJDA 5EJ6A 3R3HA 2IZOA 3IKJA 5L3VA 3L5OA 1RQNA 3E23A 4FOOA 3GMSA 4CN9A 3OT1A 2X5OA 1FVFA 2VIIA 2X5KO 2O2YA 3OF5A 4LRUA 2PMCA 4TWJA 3KOMA 3E1GA 4HWSA 2QN8A 5B2EA 1JJ7A 1UKYA 4B31A 2W6JD 3JSXA 2B35A 2DBVO 4YREA 3IEVA 1HE3A 2XKJE 4TM7A 1X7XB 4N5IX 3WQHA 5EY5B 1DBSA 2H4FA 2XTJA 1U0LA 3VDMA 5CRIA 3TTTA 4LG1A 2ZTVA 2PRZA 3QELA 5CHEA 3O84A 3RIMA 4NCBA 5A9RA 4UFPA 3H9BA 5HM6A 4TXMA 1JV2B 4RK1A 3C7KA 5FWYB 1UP4A 1K7CA 1G2IA 5JRZA 3T54A 3EVNA 4U7TB 5GWXA 1QV9A 5BV7A 4PCVA 2F2TA 3PNVA 1JKMA 5LB4A 4XRGA 5AVQA 5CURA 3GGCA 5A1TA 4OFXA 3WGOA 3IAM6 4EGFA 4R0VA 3OZXA 2X9LA 5E0OA 4NPHA 2C5SA 1PG5A 1P2TA 3B82A 4KXXA 3BJZA 4NG5A 1QP7A 3OO1A 1IB0A 1DKQA 1TZKA 2QJFA 3GZJA 1N0WA 1ULZA 2O57A 3ER6A 3FPLA 4IG9A 1D0SA 4QPZA 5E8JA 4EK9A 5LB2A 5KAPA 1G2QA 3MBIA 4RL4A 4ASUA 4KE8A 3H3FA 4PRLA 3S7TA 1EWRA 3EZ7A 4LJLA 2OCXA 4OQXA 1BDIA 3N86A 5AOCA 1Q19A 4AKEA 4G2NA 2C5EA 3BGSA 2FW1A 4O25A 1ADJA 1YVPA 3I0NA 4MV7A 4IH4A 1YS7A 2PRYA 2XYVA 1OZ0A 4ITUA 5I7SA 1FP6A 3I5AA 2B5OA 1DAPA 2WTXA 4IQGA 4B8WA 1G20A 4DLYA 2B61A 1WLYA 2Q6TA 1DKUA 2V7EA 1XVIA 2PMBA 4DC1A 2XUFA 3TXXA 1PJBA 2NT4A 1T4MA 1JHOA 2PO5A 1JQKA 4KQ9A 2IEIA 1S6YA 3ZIDA 2SECE 5K8TA 4C05A 2P3QA 5A03A 4TL6A 4GPAA 4UHFA 4YT5A 2D6FA 1P3JA 4S0ZA 1PEDA 1ENOA 4DLRA 3U3ZA 4ZHSA 1EJBA 4QT0A 3SXUA 3V48A 2QAIA 2FWIA 1ZAYA 4EVIA 3IILA 2TSYB 3T35A 1NN1A 1SUBA 2QRKA 3ZHXA 1RI2A 3L1IA 3URKA 1B3RA 1T9KA 2O7NA 5ALJA 3WLKX 4D4HA 4E6EA 4C2AA 1XU9A 2MTBA 1VQ1A 2J5RA 2V4UA 3PUYA 2RKBA 5BXYA 2UYHA 1R0KA 1SBHA 4H7IA 2DF8A 4JOCA 4Z7JA 4I81A 3FUXA 4C3OB 4C2TA 4LWZA 2YVKA 2B0CA 5F51A 5DLEA 2H1HA 4FR2A 5HFJA 1DC7A 1NW8A 1WQ3A 2VOEA 3VPCA 1SC4A 2Z8YA 2FA9A 2O2GA 2D7DA 3SC2B 5DHFA 4EW6A 3GVPA 3EGVA 4KR0A 1PQ4A 2ALJA 3TGPA 4Z7QB 1QHEA 3G2QA 2ES4A 3GG9A 3GOHA 2O2JA 4HNSA 5ICFA 3UMCA 1Z45A 4HV4A 2OOKA 5K1ZA 3FSJX 2HHAA 1NBEA 4DZRA 1ZJWA 2X7HA 4BP8A 4XKJA 1II9A 4R1PA 4LBZA 4ECEA 2WV7A 3RADC 5EPOA 2HWYA 3DV0A 4BJ3A 5JHHB 1JIVA 4LVNA 2NSYA 3JALB 2F00A 2RIRA 4EG3A 3KE9A 2HDHA 3CR7A 1Y98A 5KTKA 1H8ED 1OXBB 4Y0AA 1R6DA 1CCWA 5CA1B 1CIPA 3TAUA 1TF7A 3PX2A 1BJTA 3DTVA 5EXPA 2P9TA 1NUQA 4OMDA 5FQNA 4AAYA 1A4RA 2O14A 5A02A 1H8HD 1OIXA 3AM3A 3C3KA 1B7GO 1QYDA 6AT1A 1BDHA 3MC1A 4JYZA 4QJ3A 1OLOA 2HU7A 3K0AB 3IP3A 4FU0A 4B44A 3K70C 1XF9A 2V65A 1RXVA 1OX6A 1J22A 2H3EA 4X91A 3L7NA 4HX9A 2Q27A 2XECA 4Q47A 4X1IA 3AY7A 4J94A 1U3FA 4CMEC 3G17A 4XFJA 4G4SO 5CLGA 4OMCA 4C4SA 3VPBA 4IIVA 4AZVA 4RWEA 4A10A 1Z4IA 4ZOEA 2I7CA 5HBGA 4A8JC 4ENRA 3N58A 1G5RA 1M34E 1FQWA 1UADA 2J45A 3DAYA 4GC5A 5ALDA 2WWRA 3SLGA 4EGJA 2WLTA 5DU2A 5FWYA 2FSIA 4DNXA 3LHDA 3SJ7A 1KGSA 4MJXA 3RC3A 1AH2A 4YK7A 3M6WA 4JP8A 4EUEA 4ZEOA 1E0AA 1H2FA 1PGQA 3GRPA 4PGAA 5EMJA 4DPLA 1X8LA 3ZWDA 1CY2A 3OPVA 5IAJA 2XCOA 3NM4A 1PR4A 3I12A 5C51B 2BT4A 1Z2OX 2WPNA 4YCAA 4WBNF 3FUUA 1YBMA 4NCIA 4NNPA 2QLTA 1L5VA 4QYIA 5H8WA 1FW8A 4QA9A 2IU4A 2XMBA 4P4SA 3TEFA 8MHTA 3RAGA 1P5JA 1D4OA 5CB4B 5LQAA 2OQ2A 2VL7A 2XVZA 4EECA 4BAGA 3VC7A 2A7QA 3RTCA 2UZ1A 3Q8MA 3N8HA 4LYDA 5BN5B 4B33A 4ACBA 3BL8A 4CKYA 1X8JA 1YRQA 3QVXA 1HEYA 1WCWA 2Z9BA 3R44A 5B6JA 2HA0A 3QF7A 4EHDA 1DAGA 1QH1A 1CFJA 1ULUA 3QNMA 4EKGA 1J21A 1UPCA 3BAFA 1R3UA 5CLIA 4AF6A 4GOLD 4LEIA 5EZ5A 5CGQB 5IJ9B 1UL1X 3EC2A 3I8XA 4PN7A 1O96B 5JSZA 1CUEA 4QWWA 3FBGA 3G7NA 1T3HA 4RMJA 4CG2A 2BM1A 3GLHA 3L1KA 2BDUA 4S1OA 2W0SA 2QEQA 3HCAA 2DR0A 1NVUQ 4UHCA 1MP0A 1ZDMA 2UVDA 3F9IA 1LTQA 1G5IA 3DZJA 4JUFA 4KRYA 2IJGX 4HTFB 4OK6A 5AP9A 4EKIA 4ZZ0A 3WLLA 1NOKA 1R0CA 1ZA2A 5CIWA 2P6PA 1K75A 4ZO4A 4GP7A 1MAVA 5MN4A 3ZWQA 1U2ZA 3OCWA 4CRWB 2CVPA 4H77A 1A97A 4ILEA 4B3DA 3DL2A 3QXCA 2C00A 3K8ZA 3KK0A 3AZQA 1JBQA 3S3TA 5SICE 1IXYA 3NKFA 4BMPB 1ACLA 4KPFC 4KMSA 1C3OB 5EZYF 4BLUA 5KOJA 4HQRA 1QO0A 2IPNA 3DLTA 5J2UF 1JT9A 1VE7A 3D59A 3DJFA 3T06B 1PT9A 1UKAA 3V8NA 4BKPA 5IF9A 4L4XA 4IDFA 4M37A 3S44A 1V5EA 5L95A 2CCJA 4BLSA 3FMGA 1XZAA 4P6VF 3H2IA 4KIFA 1IRXA 1B23P 1ILWA 3GRRA 1VLJA 1FVHA 4I1VA 5KMGB 1J4AA 3I0MA 4QDUA 3ETHA 4F3CA 3S1LA 4YAIA 4MARA 2ONYA 2QZ9A 3A6ZA 1X80B 2HRCA 1YB1A 3O8QB 1A88A 3I73A 5B5SA 2F48A 2AN4A 3FY4A 1QYRA 1U0FA 4Q7MB 3L8YA 4LQDA 1V2HE 1SQGA 1OA0A 1RRGA 2JGFA 2XUQA 3GLRA 4XIYA 4AFNA 2QS9A 1DV2A 4GPTA 4RXTA 2HO4A 2OPBA 3UICA 4F96A 5CFZA 3E0XA 3EMDA 3EWSA 3PHGA 4XWAA 3I04M 3JV7A 1RIIA 2I71A 5TB5A 1AXGA 1KJJA 4EBFA 4D98A 1K7SN 2YICA 3JSAA 1I4DD 3QWFA 3SQLA 4IICA 3F2IA 3UOWA 5KEIA 2QVXX 3DZFA 3IOCA 4TTIA 4DEVA 4PTLA 3OJWA 3KVVA 3AP3A 5IDVA 1T0JB 4B84A 1RYEA 3TK1A 3EGXB 2A86A 4RPLA 3COZA 3H5AA 1PFYA 1VIAA 1FFGA 2Z95A 3CONA 3OLXA 3A9WA 2E9SA 3JVEA 3C3CA 3RV4A 4NBSA 4D2IA 2XTZA 4EUNA 5KCMA 1SBNE 2XUDA 1WUTA 3PRYA 1FVOA 3TOXA 3ZD6A 2V1UA 5TR9A 1V7CA 2XBUA 3VBEA 1COZA 3I5MA 2QUAA 1J20A 2P3LA 4ZVMA 1G5FA 4DQXA 1ESNA 3R75A 4BBZA 3F6YA 4LBVA 4RH1A 1M1NB 4F1WA 4MQEA 1N5DA 4O8CA 1P9LA 3R5HA 4H0CA 1ZGGA 1GTSA 1UZAA 1JX6A 3DH0A 2UYCA 2V1XA 2ZTSA 4DTIA 4C7OA 3ESDA 4O4LA 2JFUA 2QN3A 3DF9A 1L5LA 4GGPA 5FWXB 1CUYA 1CZKA 3K09C 1W6RA 3JWGA 3K3PA 1E0DA 3AU8A 4YCLA 4ZAVA 5F5XA 3W8RA 2AW3A 3KU4A 4ZMBA 2VJAA 3ZUPA 2IYTA 2O48X 4NQZA 4O1MA 2WWHA 2H5LA 4L8WB 5CLFA 4BRSA 3MPUA 4KK4A 1EMDA 2W2TA 3H5WA 5T41A 1SVKA 4ZCPA 1ZQ1A 2JIMA 2FPLA 5DYTA 5K0NA 4BNYA 3DO5A 3EZNA 3PXXA 4G9BA 5IAKA 1TM7E 1QAOA 3ZH2A 3MFYA 2QWXA 3TI9A 1A50B 2JH3A 1FDUA 3WX0A 3WYBA 3TIFA 1I6KA 4FW9A 4CEIB 1Q1QA 3RVPA 3MWLA 4EPRA 4U2CA 2NXNA 3S0JA 3CKYA 4QDOA 1YBFA 5BV2P 2C2BA 4I9FA 3OUTA 2BI4A 4UOZA 2GJKA 2IT1A 3H5VA 4XD7A 4QDXA 3PDIA 2N3ZA 3I4FA 2QGNA 4N7MA 3AR6A 4LOHA 3EK2A 1Z7GA 2HRBA 3OOJA 4UUPA 5EFZA 1O96A 4UNQA 4E31A 3ZD7A 2X6QA 5LDGA 3VNRA 4PO8A 3GFQA 2P9JA 2NXEA 4MUBA 5ALGA 3WGUA 1KAOA 2BZ0A 5HP4A 1LKZA 5L53A 2I1QA 2FPRA 1EA7A 1YBAA 2IV3A 5K6AC 2R8EA 4FYVA 2C9DA 1P9OA 1G7RA 1LS6A 1NMYA 1ZICA 4OQQA 4ZMSA 2A0KA 1ID1A 3B1YA 3IVCA 2PBZA 5T3YA 3FVVA 2QU8A 3NBMA 3TYXA 1T8TA 4HG2A 3P5SA 2BN4A 4PTZA 4H4CA 4L8VA 4EW2A 2CK3D 1N0HA 5J5VA 3UGJA 5CB8A 3JQAB 4PYJA 4YRGA 2D2FA 3DAFA 2HIGA 3LUJA 3ZOZA 4CCWA 5TX7A 3L41A 4RA9B 1FQOA 4L6IA 3ELWA 1ODCA 4QJIA 4F4CA 2PAAA 4AD8A 1G2OA 4OGGA 3B6EA 2XOKD 4HMPA 2OCLA 2C0PA 4LHZA 1GN9A 4XLZA 2LBPA 4GSLA 1DXQA 3TD6A 3WC4A 1CWUA 5AVWA 3C1TA 1NY5A 2Y6UA 1OZAA 5LL6P 4BPBA 3CCFA 1Z9BA 1U8XX 4UDOA 2WZDA 1Y42X 1WDKA 1MENA 2QVBA 3IIMA 1Q1NA 4ND8B 4MV4A 3A2KA 3CVWA 3RSFA 4RCZA 3W4JA 4S04A 2DHDA 3KQTA 1FMFA 3K35A 3JZIA 3GN1A 3MCTA 3UXHA 3W6NA 4DV6B 3IB3A 1OFUX 1Q7BA 4B73A 3HBMA 3SPXA 1X1SA 3BWVA 5ABPA 2F3TA 4LYFA 2A9VA 3UC9A 2PU5A 4BMDA 1XDWA 4BO0A 4GX0A 1IAQA 3LQRA 3KJZA 1N9KA 4UPEA 2FPGB 1SJ9A 1WVIA 1YNSA 4LGCA 3SYNA 3PGVA 1ZUWA 4B6FA 5FTLA 1IULA 3EUFA 2WF5A 2M32A 3BL5A 4CNQA 4CM5A 4DV0B 3RT7A 3GZNA 4M9SA 2RGWA 1TAQA 4IIEA 2VFAA 3O3CA 3DBHA 3BIJA 1PFQA 1FNCA 2ZBEA 5THXA 2VPTA 1MOSA 3Q10A 5IAEA 5AUOB 3FUTA 4B2YA 1XVVA 2BE7A 2YVQA 4PANA 3O1LA 1X15A 1XUOA 5JFTA 3E05A 2VH5R 1R8XA 2A5JA 3WLQA 4AKHA 3IEPA 2OFXA 4HPXB 3FF1A 4LZWA 4CV3A 4U0JA 4IRUB 1JLSA 1JNXX 1ZITA 2J3KA 2YKGA 2JIQA 2WICA 3A1EA 4UATA 5JW6A 5LMUB 2MYTA 5A3VA 3H4IA 4GWLA 4JMLA 5H9VA 1ZVKA 2R87A 3D7KA 3K96A 5G4LA 1F8UA 1EFDN 3T1OA 1IC6A 2RHLA 4KPUA 1KWKA 1WMBA 1ZOIA 4U39A 4ZYLA 2OCKA 3JWHA 4OHCA 1QCYA 2WYIA 3HBLA 3W7VA 1J06A 3L8DA 3PL1A 2G67A 3NIBA 2GCGA 2HNKA 3OZDA 4TX1A 2VAMA 5FUVA 4E2FA 1PV4A 5JBQA 1A9XB 4CKEA 2OV4A 3T5TA 2HMTA 3AI2A 3A3OA 1KJ9A 1JSLA 5CFMA 3AHIA 3GRZA 5HF5A 3RYCB 1L7QA 1SA0B 3THXA 1YZHA 2W43A 3D6NB 3W2TA 1ZD8A 3S5UA 1XJWA 2GBGA 5HOQA 5DTIA 1JTFA 5L4NA 2YJ3A 3MT7A 4BX8A 5IK2D 1Q22A 5TJHA 3GRVA 5IK2A 2HNAA 3MJSA 3ZYCA 3E8SA 4EJ2A 3GGJA 1C9EA 3IVAA 4M1OA 1BEEA 3ZE8A 1E7SA 2GSDA 1TVKB 1JXMA 1VJTA 1EVYA 1XD8A 3USZA 4RTRA 3EUEA 3WYAA 2I2CA 1U8CB 5JYDA 4NCAA 1H1LA 3LO8A 2DFTA 2WWIA 4YRLA 1RHMA 4TZKA 4CLDA 1H22A 2ZSFA 4KFSA 2CLIB 4OH7A 4O2BF 4TKUB 4KAJA 1XTIA 1V71A 3QMVA 1SXJA 2W2QA 3NM5A 1IY0A 4AJLA 3G85A 2POCA 2X2EA 3H13A 1EM8B 1UKEA 2J3DA 3LLMA 1Z12A 1R4NA 2W6PA 1LVGA 5IF3A 3LAWA 1VE9A 2ZSAA 5LKAA 1T36A 1H2BA 4XIFA 1EFTA 2O1XA 5AXAA 3L0CA 2PH3A 4CMHA 3I01A 3AEQB 1VRVA 3NTUA 1GG8A 4MKFA 3KSAC 2VHUA 3LC0A 3S8MA 2BFAA 3VH4A 3T3NA 2VT7A 5AR1A 4V2UA 3OPXA 3N8IA 2JIBA 1I7SB 4IEFB 3OURA 3VPSA 3NBQA 2QV7A 4KE6A 1T1RA 1DAKA 3DC2A 1N2ZA 3I09A 2YXEA 3MT9A 4R4JA 3REQB 5J3JA 2IVFA 4V39A 2HBYA 1QO0D 2A2ZA 1H23A 1OYWA 3LBYA 1YZTA 2HH9A 3H9CA 1IEVA 3DHVA 3F6BX 4B48A 2W37A 4X20B 3HJAA 1L4YA 4G4IA 3AL2A 5CH8A 5JCJD 2FP4A 4YMUA 2FJ0A 2H59A 2ZRCA 4YV0A 1J7JA 3GBSA 3IQZA 1E4EB 2C2GA 2HJHA 2WB2A 1A9YA 2WA1A 2ZRNA 4CIXA 1Z62A 2XVXA 4ALIA 3ZDBA 3LPCA 2Q1YA 4NEHB 3ZLUA 4MKZA 3AR9A 3IVGA 5KYNA 4JBXA 2ZTLA 5GP1A 2CXHA 2FGJA 4GDFA 3IIKA 3BWBA 2XCTB 2I03A 2HTFA 3A1SA 2PKXA 3BXHA 5LWQA 2QZZA 3RM3A 3ZV3A 1T4BA 5JNUA 4L0CA 5LUBA 2GHQA 1USVA 4LJ5A 3W9YA 3ZVNA 1IN8A 1ZD1A 1ZRHA 3B6JA 1HE2A 2XTAA 2VP5A 2XWBF 2VT6A 1JHAA 3IURA 4AULA 5JDIA 3GLKA 4Y6SA 2F3PA 2HMSA 2VZEA 2ZB4A 1ZS9A 4Q3EA 5ENVA 3RU9A 1Z63A 4OLFA 5KNBH 3T1YB 4MA0A 1NBAA 4QTXA 5F98A 1B4DA 1TUIA 2Q2VA 4GOND 5T64A 2PXCA 3A6EA 4KO3S 2VUSA 1Z0FA 2XQFA 2EP7A 3WGVA 2AYXA 4CI0B 4KPGA 4JNKA 3ZW8A 7REQA 2OK7A 2NUTA 3CHYA 4YHBA 1DTSA 4MAFA 2HF8A 3A9RA 1VGRA 4H16A 1ZQ9A 2P69A 3K4HA 1Z36A 2GETA 2NWQA 1A9SA 1E2IA 2UUPA 3KDAA 5LA6B 2GJAA 2I1VB 1ND5A 2XGSA 1N2BA 3DE5X 4HB3A 3IBFA 3I6YA 3LM8A 3MGBA 3IQHX 3P0EA 4JX9A 3L6OO 1BA2A 3W90A 2ROQA 4JC4A 4MUGA 3FHTA 1WMFA 3I6BA 4HGOA 3Q8XB 4L50A 1HLDA 3W79A 3BHJA 5KMGA 2GT1A 1PWYE 3GEIA 4FMBB 3W2HA 5C3UA 1XA3A 2AD5A 3RT9A 4K46A 5CB6A 3A2LA 2GM4A 3DFIA 5K5EA 4RKYA 4DT1B 2GDZA 1OA1A 3A4NA 3HJNA 3OE4A 4HDNA 4NAVA 5EI5A 3VNSA 4AWAA 4ABTA 4PG4A 1LI4A 1P5ZB 1VJ1A 4M1EA 5FL7D 2JS7A 2EFJA 2J0EA 4DJFC 4E2XA 3GEEA 1EP9A 3NTQA 3S2GA 2DXIA 3DTTA 4GXNA 5C4MA 1G16A 4G0UA 4XGIA 4OIMA 4W1RA 4E94A 4LGYA 1UP6A 4KKVA 3T1QA 2IYOA 2MYUA 4E03A 3G6WA 1TJPB 1YR8A 1GV0A 1J56A 1P0FA 1RACA 3KELA 5EXSA 1N4AA 4ZI7F 1JLKA 1L9KA 1VJRA 1HRKA 2ZULA 3CEJA 1JYEA 2I7VA 1MB4A 4G8CA 3WWOA 3KJHA 5SZIA 3V4ZA 2H18A 2D1YA 2QP9X 2FR0A 3ZGLA 1V48A 4P2BA 1QHHA 2VF5X 3IV7A 4P4NA 2VSQA 1EQUA 2XXBA 1F51E 3UFXB 2HLHA 1DC6A 2KW5A 3FB1A 3VC3A 1XEXB 4ZI7A 4MWGA 3KJEA 4COKA 3J81A 5IKPA 1OROA 1I01A 3ED1A 4D4JA 2V98A 1XJCA 3U17A 4OQMA 2AD1A 2HM7A 2CJWA 4DLUA 4PCAA 3Q0TA 4AX8A 2Z5FA 4F91B 4BY9E 3D02A 5LMCA 4ZDJA 3KCQA 3W6UA 4B85A 4Q7EA 2Q3BA 3TQFA 4MJ7A 3L9XA 4DADA 4MRAA 1VBMA 2XZTA 4F84A 4RJTA 2OYRA 4RFSA 4I8DA 1IHOA 2IYWA 3P19A 5T4EA 1L9XA 3P1JA 1QZTA 3IPYA 1RLUA 3H6KA 1FRNA 3QPVA 4MXDA 3ROKA 4B6OA 1PE0A 2HPHA 3OOEA 1Z68A 3IODA 4Q9LA 3JPYA 1UT8A 5MF6A 1FF9A 1OIWA 2H57A 4LV8B 5AKIA 1E59A 1YZQA 4IH9A 4R01A 3FZNA 4BPRA 4E12A 1H6BA 1VE1A 1NJSA 2CL0X 3OZUA 2OD7A 3QX8A 2D7JA 1R00A 3JQ8A 3GPDG 1VL0A 2VDJA 4NFLA 2B4TO 4UVDA 1SAYA 3TR0A 1K7XB 3MRXA 3V1LA 2GCOA 4KQ6A 1DO2A 2NSLA 1EQAA 3A1DA 3KT3A 1ZNZA 1FPQA 1N2SA 2VQSA 3OQMA 1Q0SA 1UZLA 1X0VA 2JFPA 4KQGA 2Q8NA 4N18A 4ZTBA 1T4GA 5HGXA 4GKJB 2A59A 1BN6A 2FPWA 2GBIA 3WGGA 2OP1A 1PWEA 3CE6A 4JOBA 1I30A 3D6FA 3DONA 3DVQX 1QFYA 5EERA 3KSDO 1AF4A 2CKDA 1AS3A 2XGGA 5JXJA 3IKLA 5K9ZA 2HREA 3MGGA 4ODIA 3I1JA 3KQVA 1EBBA 3QOFA 4GVXA 3RBXA 1R27A 1WHSA 1CUWA 1SR8A 4L3VA 4I6EA 1I14A 4PG6A 4Q1DA 3VI3B 2PS0A 1COWA 4TTQA 2WM2A 1JIKA 5DI9A 4F0JA 2WM3A 2PZEA 5DCUA 1FTSA 5M04A 1YC5A 4BNFA 3UB2A 3N2LA 3Q8LA 3EUWA 1W36D 1L6RA 1P4HA 1AGYA 2FF5A 3G79A 1JQAA 2ZYGA 3H5NA 4BO6A 3WB9A 2PSDA 3SHTA 1MT0A 4KN8A 2II6A 3GUUA 4GT1A 1Q57A 2R7LA 2DQSA 2W6NA 2RSLA 2G82A 4I2VA 3AM4A 4JYBA 1VRCA 2I76A 1JDNA 2JFZA 2BDTA 2FPPB 3SYTA 1CR4A 1TZCA 2DTEA 2I7TA 2PJDA 3B5JA 4AMUA 3HTXA 4RPGA 4HMOA 2PY6A 2VTDA 1GNRA 1PRYA 2XKBA 2ZJ3A 1WMEA 4LAFA 3BMOA 3ZWPA 3W6OA 5KC8A 4D3SA 2E55A 4P58A 2P6OA 1DUIA 3HKBB 3IIIA 4AT1A 3MJHA 3R2JA 3RAJA 5DP2A 2PNJA 3KV1A 2PR7A 2E7ZA 5LPNA 1Q0PA 3EIOA 4GRAA 4RQAA 3TSCA 4KQ1A 4RABA 1D2NA 4ER6A 4GPIB 1NULA 3T7KA 4ZCIA 1S3FA 1WX1A 4D9BA 5C8VA 4RO0A 1X2BA 2YY5A 3MXTA 5CW2A 2OBMA 3BDAA 2A33A 1C2TA 1NA5A 3MT8A 5JS7A 3ME5A 2QHXA 2ZE8A 2PPVA 3ESAA 3MQ4A 4HDSB 4S24A 4TM8A 3SS7X 5C37A 3FKSD 3OCUA 1C7EA 2G83A 1UFOA 3LRPA 4YJFB 4C3ZA 4DQDA 3TE7A 2HCJB 3CYFA 3K0CC 3ZJYA 3C3XA 4OSEA 3UKOA 4DDVA 5J2TB 3JQ7B 2IW1A 3ICOA 3JZMA 4G67A 2N9UA 4AG3A 2OLEA 3OCZA 4HWKA 1FYVA 5IDQA 1U2DA 5J63A 2GRAA 5AM3A 1ZH4A 2CJXA 3LDGA 3RU2A 5JAMA 4CMJA 5DHSA 3SAJA 2ZPTX 1O0CA 2H1CA 1OI7A 1XDZA 4M99A 3BG5A 3RO7A 3V6LA 4C7JA 2V74B 3O4JA 1XTPA 4BP3A 1BNCA 3BZUA 4M22A 4GS5A 4RGBA 4X8LA 5KVQA 4OFWA 5AH0A 5HRUA 2GM5A 2NVUA 2XAAA 3IOBA 1Y4ZA 4G5OA 1PGOA 4YLGA 2V7WA 3PT9A 4JLMA 4WXEA 4QATA 3LK6A 3PX7A 4L27A 2X4GA 3OAAD 1O94A 3ETLA 5IVHA 2AMFA 2WJZB 2QZJA 3BICA 4W7IA 2C94A 3DWIA 5YASA 2DB3A 5LXTB 3I9MA 1NBME 1C0IA 3RS4A 3K20A 3MTIA 4NAHA 1EP3B 1P7PA 3UWPA 2UKDA 2XE6A 4IS2A 3MD9A 4MYHA 2CXXA 2O8DB 1ULAA 4O2BB 3HXMA 2VDWB 3GQVA 1X0XA 4L3OA 1VSTA 1BA3A 4YP5A 2BISA 1NBMA 1J2TA 1J09A 4NYIR 2V54A 2IZ0A 1W7AA 1ZHFA 4EOGA 4S0XA 4PAGA 3CN9A 3G49A 4MCAA 4UBIA 1Z8HA 1EX6A 3A04A 3D3EA 1AURA 4JC0A 5DNDA 4JJ7A 1NXTA 2Q5QA 1JJBA 1P4AA 1JHDA 2ZAYA 3LC2O 3MXOA 4F92B 4AI6A 4YLEA 3ANTA 3DUFB 4D8VA 1GRNA 1ZKMA 4YY3B 1M2EA 4U0KA 4CU5A 3K9NA 3IHWA 2PKWA 3E1KA 3AY3A 2OOSA 3EEIA 3IPCA 4I4CA 1Y3FE 2OCYC 1GPYA 4XEUA 2H1VA 2JBAA 5C8YA 6REQA 1RWPA 5HKAA 3E82A 1E9EA 2YV2A 1V6AA 2YOHA 1BKSB 1E60A 1GP2A 1Q3TA 2Y2UA 4I4TB 1XFDA 4PLZA 4MI6A 4BMSA 2OMEA 1WDMA 3AFNA 3FF4A 4JJFA 5LBTA 1EWKA 2DAPA 4XWGA 3C16C 3HEBA 5CW1A 2JFYA 1EESA 3IYLW 3CRRA 3GDOA 2OKCA 3NYQA 1ZUNA 3RVDA 2EF0A 1EFHA 4XWOA 3R9XA 4TV9F 1KYIA 4EKYA 3VNAA 2LXNA 2V8OA 3B60A 3SXJA 3TQIA 5LN1A 1NNSA 2OO3A 2RCYA 1QH0A 4G1VA 3S70A 1E3IA 1EVKA 3G3EA 5FJJA 2A5GA 4ZI5A 4QVKA 3E1SA 3AG5A 3CIFA 1BQ4A 3GXOA 1VYHA 2WKPA 3KYJB 5HIJA 4P81A 4YAWA 2M6KA 1RLIA 3L05A 4RANA 4AICA 2C5AA 5EJ8A 1R12A 1R4MB 4RH0A 4F7WA 1H2ZA 3OG9A 2HWKA 2XOEA 4FDMA 4YC7A 1FTWA 1PR0A 2QJOA 1ITZA 2HWWA 2YDXA 5DEIA 1IXSB 1GTL1 2Q2OA 5EXXA 1TF2A 1N6RA 5BORA 4BNVA 1PUJA 4DV3B 4B4VA 4AY2A 1OWPA 3NYIA 1DIOB 1R6BX 1Z33A 4R1MA 1T6YA 3BXOA 5CNKA 4QOFA 1RXCA 4PHHA 1Y7LA 2P77A 2R5WA 2BFFA 1ZBQA 3N28A 5BQFA 3HZOA 4UEKA 9GPBA 3CH4B 1X19A 4OL0A 3F6CA 2BKVA 3ZE2B 5FTNA 1B73A 1CJBA 3A7DA 2AK3A 4AS2A 1DFHA 1QIGA 1NXVA 3WSVA 1UFRA 3VSBA 2CCKA 2OZKA 3DOFA 1C1DB 1UDCA 4MAMA 1KY2A 2DHEA 5LQRA 3HEAA 5HTKA 2GSWA 3DMDA 3MWDA 2HFKA 1JDVA 5LA6F 1U5BB 2JFOA 4AM8A 4Y1EA 3H6HA 2I65A 4XVQA 4RTPA 3AU9A 5H0IA 2B7CA 4ZT7A 1Q92A 1ZESA 3GDFA 4ZIRA 4AY6A 1AIPA 2W5UA 4S1TA 1WBJB 1ZC4A 1V7PC 1NSTA 2K6GA 1AN0A 2VS1A 6PFKA 2ACKA 2X9QA 1TCCA 3RNLA 4YR9A 2XOKA 5D3ZA 1BOFA 4GMHA 2I33A 5E1BA 2CMFA 1GDDA 2GNOA 4PZLA 2JK1A 1YKSA 3LDFA 1CB7A 4XCQA 2E6UX 3V9PA 3KBOA 4RTOA 2YWRA 2YWCA 2BY4A 1N8NA 3E7DA 1R0RE 4IQFA 1TW3A 3NGLA 4L9RA 4UU7A 1YS1X 4TWIA 4YJGA 1IMOA 3CRNA 4YP1A 1H9AA 3OCYA 1OX5A 3GMDA 4HXYA 3UVEA 3SZRA 3HXOA 4NBVA 4JT9A 4MV8A 4JT2A 3HDQA 5DIFA 4TKMA 1TRHA 2JHCA 2Z83A 2A9QA 5LIRA 3TN7A 3GRUA 4TOIA 3B1JA 1EJ2A 2ZJAA 4MYTA 1I8TA 2RGGA 1XD9A 2X76A 1RS0A 2BEWA 3OCCA 4ZTZB 2WIKA 3NZEA 1JFVA 3AWDA 1VL5A 4JJKA 4ESVA 5BN3A 3KR2A 4DRZA 2QAGA 3M5WA 5A7FA 2QV0A 2PX6A 1JKFA 3M6XA 1F2VA 2DY0A 4RSMA 5L8VA 1D6JA 3RW9A 5IRCD 5HCUA 1OXTA 4XW2A 3TNYA 4Z2AA 5T8KA 3DVAB 1KI2A 4RIFA 3HEMA 3OWOA 1XAJA 1BCSB 1FNSA 2P6UA 4PC2A 1R0BA 3UWSA 4ZRMA 2R5FA 4Q9DA <