1FE8A

Crystal structure of the von willebrand factor a3 domain in complex with a fab fragment of igg ru5 that inhibits collagen binding
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
190
structure length
190
Chain Sequence
PDCSQPLDVILLLDGSSSFPASYFDEMKSFAKAFISKANIGPRLTQVSVLQYGSITTIDVPWNVVPEKAHLLSLVDVMQREGGPSQIGDALGFAVRYLTSEMHGARPGASKAVVILVTDVSVDSVDAAADAARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTMVTLGNSFLHKLCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the collagen-binding site of the von Willebrand factor A3-domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords VON WILLEBRAND FACTOR
total genus 60
structure length 190
sequence length 190
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2000-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1fe8A00
1MQ8B 2VDOB 2XWBF 2I6SA 4HQFA 4Z7QB 1QC5B 1AOXA 1L5GB 3F74A 3K6SA 3K72B 3EOBI 4WK4B 3ZE1B 5E6SA 3GXBA 2NVOA 3VI3B 1MQAA 2QTVA 4C2BA 3HXOA 1IJBA 1BHO1 1JEQB 3T3PB 3E2MA 3NIDB 3EGDB 1N3YA 1T0PA 5E6UB 1JEQA 4UM9B 2ADFA 3IJEB 3PPXA 1RS0A 3HXQA 3EH1A 3T3MB 4PN7A 5LN1A 1XDDA 1SHUX 2ICAA 4CN9A 4XW2A 3F78A 2X5NA 3EGXB 1ZOOA 4UM8B 1JEYB 1ZONA 1FNSA 4JDUA 1M2VB 2XGGA 1RD4A 2VDPB 3QA3E 4FX5A 2VDRB 5KYWB 3NIFB 3TVYA 1M10A 1TYEB 2ODQA 4HQNA 4IXDA 1YVRA 5E6RB 4WK0B 3EH2A 4O02B 5BV8A 3FCSB 2VDNB 3VI4B 2VDMB 3EG9A 1MF7A 1M2OA 1CQPA 4G1EB 3HI6A 4HQOA 3BN3A 3BQMB 1MQ9A 1Q0PA 1M1UA 3K6SB 4MMYB 1QC5A 3Q3GE 1ATZA 4NEHB 4NENA 4M76B 3NIGB 1U8CB 1AUQA 2VDQB 3PPVA 1IDN1 4WJKB 2NUTA 4Z7NB 1RRKA 3EG9B 3ZDYB 1IDOA 4C29A 2B2XA 1BHQ1 3TCXB 1JLMA 1MHPA 5KYUA 1LFAA 5KYYA 1IJKA 1CK4A 3EFOB 4CN8A 5KYYB 2VC2B 3TXAA 1SQ0A 4HQLA 3RAGA 1M2VA 4HQKA 1PD0A 1NA5A 1V7PC 2NUPB 2NUTB 1YVPA 4IGIA 1FE8A 4NENB 5HDBB 2WW8A 4BJ3A 3M6FA 3K71B 5KYXB 2I91A 3V4VB 1ZOPA 1N9ZA 4WFQA 1PD1A 3BQNB 2VDLB 3ZE2B 4F1JA 1JV2B 1RTKA 1PT6A 5KYUB 1MJNA 5HJ2A 5ES4B 1U0NA 2I6QA 1DZIA 3ZDZB 3EOAI 3IBSA 5HGJA 2WINI 3PPYA 4C2AA 2O7NA 4G1MB 3ZDXB 3V4PB 1XDGA 5E6SB 5KYXA 4F1KA 4WK2B 1PCXA 1U0OC 2IUEA 1DGQA 3PPWA 1QCYA 4UM9D 4A0QA 4CNBA 3ZE0B 1UEXC 4MMXB 1JEYA 5KYNA 2M32A 3EGXA 2NUPA 4DMUB 2ODPA 4MMZB 1XUOA 2VDKB 1M1XB 5E6RA 3EFOA 3N2NA 4IHKA 2XWJI 3TW0A 5E6UA 1T6BY 4Z7OB 3ZQKA 1SHTX 3EGDA 1OAKA 5KYWA 1AO3A 3FCUB
chains in the Genus database with same CATH superfamily
3JD4A 1HG1A 5KQPA 4TYNA 2EG9A 1G5HA 2LDBA 3C3BA 3OT1B 4NU5A 4JP3A 5GIOE 3RHSA 1H6AA 3RIMA 3U3KA 4H1TA 4BV9A 2FW1A 2I54A 3O0DA 4AJPA 1C1YA 1E66A 2FZCA 3O8OA 1KQGA 1SXIA 1F7UA 3OPYI 3CX4A 1O96B 2R751 2J4DA 5CU7A 2CT8A 1ZRHA 2W98A 3EFEA 3EBOA 3K8ZA 4KAJA 3FY4A 4O4LB 1I13A 1RKBA 2RHJA 2G08A 4XW2A 2VJLA 3L0IB 4AZWA 5IVPA 4D41A 3U16A 3D81A 3DGEC 4R9VA 3HGMA 3WKAA 4BMXA 3KT6A 3WLKX 4C6TB 3E7WA 4KLCA 4S12A 3WDLA 2WP0A 5JC8A 2A9RA 1EIWA 1AMNA 1FQWA 1F2TB 1ODSA 2OFXA 4I5FA 3VPDA 1H2AS 5E6RB 3T9CA 1EH5A 5F9MA 3U3XA 1Y6GA 3EPLA 3EIUA 4NY1A 4E0BA 5CJ2A 1TU0A 3GRAA 4KRGA 3MGBA 2W71A 4BN5A 3GR6A 2VA8A 5AJYA 4C3ZA 1QHNA 3HP1A 4KVFA 5B53A 4QOHA 2OG2A 1DAFA 2WUEA 3BFJA 4OAQA 5EHNA 4CT0A 2JW5A 3B85A 5F52A 4Q9HA 1C0KA 4JWTA 1NF3A 3DVSX 3ORRA 3WLLA 2C03A 4B4OA 4PGFA 1W44A 1XB2A 5LZ9A 1IY1A 3T0IA 5JWRA 1HKUA 3GEDA 2G25A 1UWCA 4LYGA 4DS3A 2ZJ6A 3Q6MA 1DWPA 2JFWA 1CUBA 2FHSA 5TMBA 3X0DA 3AEQA 1Z6ZA 3OSUA 2XSZA 1DTEA 1K8ZB 1M8FA 3I34X 3NRCA 4OLHA 5F2KA 1WZUA 3IQIX 2WW8A 4L9SA 4A73A 4GBED 5HIKA 3IP8A 4I5GA 4U7DA 2PSEA 2Q29A 1M72A 1HL7A 1Z75A 1JLSA 1LB1B 1NRXA 1OI3A 2GTIA 3G2NA 1GL9B 3LC0A 3VR4A 1VIVA 1Q1NA 2ZYVX 2YRWA 3DHEA 4IIVA 4MTCA 3NTRA 2HBRA 1C1XB 1KO4A 3EMDA 4LV8B 3C4QA 4M0MA 4L4SA 4I4LA 5F7XA 1SVKA 4QGBA 4QGHA 1VJTA 3JPWA 1M54A 4WK2B 1ATIA 1R5NA 2D8MA 1WM1A 2WZCA 3OT1A 1HBJA 4B2IA 2IZ1A 3N3BC 1K92A 1QCYA 4XE5A 4ZANA 3SZ3A 4UNRA 3EXIA 2QUJA 4J03A 2QQFA 4KQWA 3WYGA 1C9EA 4G0XA 4K1XA 3O8BA 5BT9A 5L40A 3EWAA 1E3MA 3GA5A 3KOUA 4H60A 1RI5A 4WA8A 1ODIA 1UINA 5JCOA 1W34A 4ZREA 2A94A 2EEPA 4KO8A 1ZSVA 3KL2A 1NVVQ 1XFDA 3FAKA 3KKMA 5G40A 2WJPA 4WE3A 5LSAA 3SS7X 4B40A 2ZM5A 4RPJA 2HSJA 3GK3A 3CN9A 1QH8A 3OJEA 3ITEA 2C1EA 4FCCA 2IKQA 4H7JA 3FIUA 4MUEA 1LQUA 1UFOA 2N3ZA 3N2ZB 4QQ8A 1YD7A 3CVOA 3EEQA 4RK0A 5E1DA 3NIBA 4UVEA 5TIIA 3OKFA 4YMTA 4L8WB 4ETMA 1BE8A 5LBTA 1TEZA 3VH1A 2G17A 5HCIA 3D3KA 2QW0X 4QFBA 2REQB 4TMWA 1RWMA 4UUQA 1U9JA 4E30A 3MHPA 1RWXA 5LLTA 3HJAA 3WJ7A 5KNDD 1EX7A 4Q82A 3O4VA 1W2WB 5JBNA 3I1JA 5DLYA 3COSA 2BL4A 4QT4A 2VTVA 3F78A 2IYRA 1MX9A 1XD8A 3DBLB 5DMHA 4A2WA 1J25A 3OCVA 1DAOA 3CR8A 3DMPA 4U5XA 3CRVA 4DDVA 3QJYA 5HSGA 2YQ4A 3PVZA 1P1KA 2FK8A 4FFOA 3LUPA 4P92A 4Z7JA 5K09A 1A7KA 3L18A 1OI4A 3F7NA 2B20A 2IBSA 2TRSB 1RBMA 2EFYA 4B7UA 4E3ZA 2NU7A 3JR7A 4L3VA 2JPDA 4UUNA 5JIBA 1WXWA 3TGLA 2GPNA 4AKHA 1Z73A 1MQ9A 2HQRA 3DQZA 5BP7A 5GZ1A 1J7JA 1WDMA 1K5GA 3FM9A 3IQHX 3C98A 4JVLA 1IBSA 1Q0UA 4LSMA 4M7RA 4Q3BA 3OLZA 2VQEB 1EHCA 3JRXA 4I9GA 2FPMA 2W6IA 1Y8QB 3BXHA 4RZUA 3B2EA 2W42A 2O7VA 2Z4SA 1KAHA 3BWVA 4F97A 4CV0A 3ZGNA 2LBPA 5TARA 1SOWA 2JJ2A 4ZRDA 1SC6A 4W1SA 1N6NA 1DLJA 4XTRA 1AXEA 2P2SA 5KMGA 1U7DA 2P6RA 1VE1A 5CFNA 3B2QA 4D6YA 3ESXA 3Q9LA 5IVIA 4F3RA 2CKDA 4ZOAA 4IIHA 1NF9A 3G2OA 1KYXA 1Y4ZA 3WNQA 1HSOA 3KXPA 3MF4A 4DHWA 1Y1KE 4LK3A 3Q8KA 3UK6A 3CISA 4IDCA 1W8DA 5B58C 1BJTA 4AFNA 4IHJB 3QE0A 4MZXA 2XMZA 3KSRA 4YRMA 1CB0A 1OLUA 2BWJA 4EQ6B 4QM6A 2HLDD 2VDLB 4MCIA 4COOA 3KQQA 3MYRA 2HTFA 4FILA 2WKQA 1A9XB 2FFHA 2QVCA 1NN1A 4QXRA 4AAYA 1CZKA 4TTSA 1PAUA 1AHHA 2PX3A 4DJ5X 1CRPA 2HCTA 1TVKA 3JYQA 1QHEA 4IJVA 3RSSA 1NM5A 3KQSA 2A3NA 4MLDA 4TRJA 4L4RA 5IT4A 3AH8A 3GRUA 2HF8A 4C01A 3U40A 4NXNB 5K01A 3EG5A 1Z35A 3B5JA 3P0FA 3DB1A 3LMKA 4MPPA 2Y1LA 4KBGA 4M53A 4I36A 4C7OB 4FJ1A 2EV9A 2DFTA 3GAMA 2B0JA 4ZI7F 4QYSA 3THYA 1MBZA 3OBIA 4P54A 1FNBA 4I55F 4XFDA 3E03A 4KWCA 5FNVF 2XYHA 3N2NA 1BOOA 1XWWA 3OFNA 4ITVA 4KAAA 1Y3BE 2IIQA 2FX3A 1I5OA 2BP7A 2WA2A 3P32A 3QLUC 4N7JA 4TS1A 1X38A 5E1MA 4B3SB 2HL6A 3K0EA 1C0IA 4DJTA 3NTUA 3D0KA 5K3BA 3AC0A 9LDTA 4BXOA 5K6AC 1JIXA 2GOYA 1BDHA 4QA9A 4ZI5A 3OLXA 4EYOA 3L7DA 2A5FA 1Y6QA 2BVNA 1OLOA 1KTIA 2VPIA 3A6KA 4BO7A 5K8UA 2I6TA 3N7UA 2ZXUA 3ILHA 2D5AA 3CPJB 2CXQA 4IFTA 4CMJA 3DMTA 4V24A 2GESA 5JATA 1QK3A 1HE5A 1N3YA 3KLOA 1L5SA 1N7GA 3E58A 3MRSA 3GDFA 4BRZA 5KOHA 1S4MA 4ZTZB 4D9GA 1Q14A 5JXWA 2QW1A 2A9KA 4HWPA 1QHSA 3V1MA 4GRDA 4IDBA 3AR9A 5C1IA 4WLOA 5ES3A 4LCBA 3UK0A 5B64A 3CLHA 4X54A 4GLFA 1A5ZA 1U1FA 3MCUA 4L8FA 1CP2A 2IYUA 2O4CA 4MVCA 2G77B 4KVAA 4F3KA 1QQ5A 1LS6A 4K0RA 1JALA 1M5UA 2ZRIA 4FGKA 1LDNA 2Q3HA 1V26A 2C83A 2OCBA 3LXUX 1GT6A 1ZD4A 2P0AA 4OGFA 3UKJA 2K6GA 3C7CB 3CIOA 4JEMA 1NGSA 2ID9A 1H4SA 2WHPA 3CX8A 1J0DA 3T12A 3WQSB 4Z6KA 2WTXA 3B5EA 1RYHA 4XDYA 4S1WA 2A9OA 3WK6A 4EF4A 5FNVB 5BVGB 1HRDA 3CG4A 5F5NA 2WHYA 4CIXA 5DI3A 3GD7A 3BE8A 4CGZA 3WAJA 2VTBB 3UOGA 1JDUA 3CINA 1S7GA 1ZVJA 1E0AA 3DHNA 2X2FA 1C1HA 5BPHA 4HZUB 1OIXA 1V1MA 4AMVA 5BUZA 3AERA 1VCHA 2G07A 3QLVA 4K8OA 4MGZR 1J8QA 1E1DA 1PJCA 3C74A 1XZBA 4ONEA 3OFKA 1F0KA 2JHGA 1WVIA 2RC5A 1ZD1A 1YZLA 2QPLA 3RIHA 3GLHB 3CRQA 2ZTVA 5DKFA 3M81A 3AVWA 2JD0A 5G4LA 2J3QA 1LPOA 2V6IA 3IOBA 4EFNA 1DIOB 1GEEA 1EVLA 1TKCA 1XRMA 3A4NA 3DTVA 3L0CA 4WGGA 4N5DA 3NHUA 4KYIB 3QKTA 2YH2A 5EFZA 4CR7A 4C89A 4WTOA 1U3TA 1SCUA 1R8YA 3JCZA 3DLHA 1CWUA 4GX5A 1Z38A 1P1IA 1NATA 1V8BA 2GF0A 1U7WA 2HRBA 2QE7D 4OGKA 4YI3A 2UYYA 5IJ0B 3OTWA 4KFRA 5HRUA 5FOUA 4DJJA 1Q5PA 3IGFA 4NNOA 3OPMA 4NBKA 2ID8A 1VMEA 4WBNB 1PJRA 2ZSAA 4HDMB 3EGCA 4FFNA 5K3DA 2NU8A 4EITA 4AZTA 1DADA 1LBHA 4P3YA 2QL6A 1IXZA 3CONA 2PX2A 5BUQA 2DCMA 5FO0A 3Q2KA 1WV1A 2IE0A 1TM7E 2PR7A 4UVGA 1M2EA 1SOVA 1SZCA 3SKXA 4FKBA 2XTNA 1GPH1 4G2TA 1NBWB 1JFFB 4EYSA 1SVWA 1OROA 5B4VA 4DMUB 1JQBA 1KSHA 4WOBA 4NQZA 1QLJA 3CPSA 3LDAA 1KGSA 3C3WA 4PLVA 5EZYA 3X1DA 2W22A 4QTZA 1E7YA 4KQ2A 5A6VA 2D54A 2P1DA 1RQ2A 3RVDA 1TECE 1YRBA 3A8TA 3DV9A 3H7IA 3OIWA 4EG4A 5A9SB 1WMFA 1XZJA 2HH9A 1PG2A 1Y81A 1Z3IX 3I5MA 3F2VA 3VR4D 2WVAA 4EEKA 3C3XA 1Z06A 3PFBA 4P58A 3IPRA 4Q4CA 5BSFA 3HRIA 1KPIA 1I24A 4QODA 1NW5A 1T26A 4F6RA 5I4IA 3IBFA 1K6IA 3EIEA 4PIVA 3WB2A 2VPXA 4GKKB 3HWSA 1F3OA 4BTEA 2EBWA 1G7RA 2XUIA 3W2HA 3M1YA 3WMEA 2AFHE 3KP1A 4NESA 4PFJA 1H05A 1WVGA 4YREA 3ZS8A 4DR5B 4RYLA 3BBPA 1UPFA 2AS0A 3P52A 5KNLA 4LYYA 1IZ0A 4HPWA 5K0ZA 5FO1A 3GFGA 2DERA 3I9LA 2ACVA 1VG8A 3L7IA 3QKUA 4HNSA 1KZ1A 2RIRA 3EAGA 3L8MA 3W5CA 2I7DA 3TS1A 2AEJA 4XYMA 4YP1A 3A4YA 4YJHB 3RUPA 1SA0A 2C5GA 2VAMA 3RU3A 1NI5A 3VBCA 3VTFA 4A26A 5JAHA 4HZIA 2UDPA 4MB0A 4IWXA 4IWNA 4K6HA 4R1LA 4XVCA 2ILTA 4LZOA 4XYBA 4JOCA 1RE1A 1XLVA 2C2MA 4BO5A 4AKIA 4P98A 4J0KA 4GZ5A 1OFUA 4WCVA 3SF0A 4EHFA 4MDYA 3JZFA 2FA9A 2ZB3A 4JITA 3OMLA 4RKEA 1VBKA 4UAVA 3W04A 1ZK3A 1H6DA 2PBLA 2WIDA 4P4GA 5I9MA 1GTSA 3DBRA 4RKYA 2VHYA 4OI2A 1XJQA 3RS4A 3U7EB 3TLZA 1U9YA 1O1YA 5ALGA 3QMVA 3IBTA 4HGYA 2CVFA 3LBHA 3E4DA 3OQOA 1HSZA 4FIZA 4BB0A 2WJGA 3NBZC 3FNBA 4BO9A 4NMHA 4EG8A 1P5ZB 3UTDA 4B73A 1X1BA 4KHPB 3Q8LA 3TX2A 1BDBA 3B7WA 1IDN1 4L6CA 4QGGA 2GTHA 4R7TA 4LDQA 1D03A 1YUMA 2MSNA 3TDKA 4EOGA 3VNUA 1NU6A 3UQYS 4EHJA 6YASA 5FWNA 2EVWX 4HTAA 2ZRCA 2Y1CA 1CK4A 5D1NA 4N76A 2JCVA 1WLYA 3EZXA 1E5VA 1KXJA 4JQZA 4EL0A 2HDHA 3VPFA 2AW5A 1NBEA 3C97A 1WU7A 2BONA 3TIGA 1RJEA 3OZCA 5FRDA 4D1YA 1V5GA 1N75A 4B3CA 1NA5A 7ABPA 4BO0A 4JXZA 1UBNA 1GPDG 3JRWA 4BRUA 2ZRNA 3NXKA 3FTDA 4B6JA 3GEBA 4ETIA 4BNNA 3NCHA 2VWGA 1QDEA 3FYCA 1W4CA 4B75A 3P26A 4RK4A 1VZ3A 2EKBA 2FFBA 2HEGA 1YU6A 4LRWA 2GRAA 4PGHA 4E12A 3D6UA 5LU9A 3WB0A 2BI7A 5DHUA 1JDVA 2OHIA 2UVPA 1U3VA 1VM6A 3NKVA 3H2SA 5JAOA 3LLMA 3EOAI 1RVV1 4KI7A 3P9IA 4OEHA 4XCQA 5H83A 3I0MA 4RHCA 1OT5A 1U4NA 3K0CC 4M8LA 4TVOA 3MMNA 5K6AA 2IUEA 3MWEA 1SXJA 4HKTA 4OOEA 1RPJA 1Y0BA 2JJ1A 3OLCX 3ICQB 3AR8A 4G0YA 4BNFA 1OGJA 3KVYA 1TVEA 4QAJA 5TV2A 4KXXA 5EPEA 3GHYA 4RIGA 4EZIA 2ZUUA 2II6A 2QNIA 5AFSA 5A9RA 2DBZA 2OGSA 2Y1EA 5LIRA 4BVKA 2H1OA 1KI1A 1X3SA 4MR9B 4UUOA 3A58B 1V3UA 2JGEA 2B8NA 4IHKA 5HIMA 1DAGA 2IXTA 3PTAA 3MG9A 1ORRA 3LM8A 3K0SA 1JH8A 2HN9A 3LA6A 1G3RA 3R4VA 1U04A 1UBOS 4AYXA 4B9EA 3AUXA 2L0XA 4O4IF 1D4AA 1TKRA 2W2LA 1DQPA 4N0PA 1N33B 5JQGF 1JDTA 2ZE5A 3HDTA 1U81A 3C1OA 3CVJA 3PQCA 3C87A 3TRHA 1JQEA 1WUJS 1JR4A 2NVOA 1EINA 4QJBA 4YPFA 3OQMA 2X7JA 5IAAA 2WUWE 1JKJA 5J1TB 5FEUA 3DWIA 2R6DA 3AM4A 2SCUA 1PEAA 3NM4A 4QJIA 4L0DA 1L7QA 4MR8B 3WP1B 2H5LA 3KKNA 2EQ5A 4C9BA 1WE2A 1NFQA 4F5DA 3ZHQA 1YE8A 3GEGA 3Q6IA 3IJEB 4QNMA 4W63A 2ZRHA 1RS0A 2GD6A 4K46A 4PPNA 3RS7A 1WMBA 4M7WA 2RBEA 5CD9A 1NQAO 2O6HA 3GL9A 4PO8A 1ZUWA 1YVDA 3KHUA 1HEYA 3QOWA 1FDSA 3BVPA 1LPMA 4FJ0A 4I1IA 4LS3A 2ECKA 2Q2OA 1UK8A 5FUWA 2IY8A 2TMKA 3PNQA 1GFSA 4WKBA 3UJ9A 1KORA 3DMHA 1MO4A 4YRFA 2Y27A 3L8CA 4IDPA 4YAGA 16PKA 3KNZA 3C4JA 1SN7A 4DNQA 2AFIB 3OO1A 1WBJB 1YS4A 2G8NA 2ZUDA 2AHRA 5IF9A 2WPDA 4OAPA 3MWDB 2NZ8A 4D4LA 4QXQA 3W78A 4A2CA 1L5WA 4NMLA 4WLUA 5D5PA 4C2TA 1FTWA 3KAPA 1NXOA 3IP5A 2P2NA 1V3QE 3B48A 4BLRA 3AFHA 3IS3A 1LVHA 1TZMA 3OTIA 2LVBA 4J4HA 3K4PA 1P9RA 1GZ6A 3GIWA 1V3VA 4IEFB 1O5OA 4L5AA 4KV7A 3BXXA 3EEOA 3VR3A 5AJXA 1CE8A 4IIUA 3X1XA 4AIRA 4QBGB 2VKQA 3DEIA 1WA5A 2PMDA 4JZYA 3F6CA 3AEKA 4TXJA 1E9RA 1E3IA 1NI4B 1JIJA 1P91A 1UOEA 1XKLA 2VNIA 4IKPA 4K6OA 3AHIA 2GEFA 3B6JA 3LI2A 2OD9A 3MCWA 4XARA 1U8ZA 1ORIA 2FSSA 1UDXA 3JYHA 4XM2A 4DMCA 2P41A 5FF9A 5IBRA 4NBWA 4XX0B 5D7NA 1IXYA 1BWPA 2XYGA 4ZO7A 3HRKA 2H8GA 4HOYA 3GARA 3WIVA 1ODTC 1Z33A 3RB8A 4EZBA 1XRRA 5KHLB 1HK7A 3FRHA 2Z58A 4CM3A 4UDXX 5FNZA 4Y18A 3LF1A 5KYXB 4K9MA 3CR3C 3L4SO 1C7EA 4R1UA 2AZXA 1FVXA 1SBZA 3BQNB 4X1YA 4D9BA 2LGJA 4WX2B 2VJQA 2C9OA 2ZUSA 4FFPA 3HCPA 3EQ7A 5EJ6A 1DIAA 1XQXA 2AI3A 1NYLA 2XOKA 2GLUA 3ZDXB 4I19A 3A6LA 2HRRA 3LWZA 2UYQA 5AK0A 5AM1A 4WD3A 1YQWA 4X95A 2A86A 4B1FA 3RFFA 2IX9A 3QVWA 2FLWA 1TW3A 2VDUE 2P27A 1Y63A 2XJ4A 2XMCA 3PTZA 3HB7A 5JSYA 1DL5A 1UCFA 2GPWA 3UMGA 3L41A 3LOQA 1E3WA 1U2DA 4BFCA 4UNIA 3JATB 4GI7A 5TB5A 1A8HA 1U5BB 3NHKA 3TNLA 1PVOA 2ZYGA 4LRXA 1OC2A 3TI9A 1E5DA 4G5GA 1IM8A 4LOJA 1RHQA 3MWLA 3CZAA 3TOXA 1I1OA 1QYIA 4ZVMA 1H69A 3RUFA 1G5QA 1T9BA 2HKIA 2VAVA 2ZVDA 3LSYA 4RK6A 1QKJA 3T61A 4D8TA 1DWOA 2ZUCA 3BE4A 5INTA 5L3RA 2XB9A 2ZDGA 4L27A 4G36A 3H11A 3RK0A 3GGCA 1CS4C 1R0XA 4KX3A 1JWAB 1AKQA 5GPBA 1YL7A 3UPUA 2Z6AA 4DAOA 4GGOA 3T1TA 4FBGA 4FFBA 3QBDA 2XMBA 3B82A 4CEIA 3TF5A 2HHLA 3T99A 4BX3A 2P68A 3BGIA 2AFVA 3ZK7A 1IN8A 1XXHA 2XIQA 4Q37A 4U2FA 4UPVA 2CXSA 3RSFA 3ACBA 4DJDC 5FOWA 3GZJA 3ZHVA 1BNCA 4CLXA 3W8RA 2AR7A 4O4HF 5KYGA 2H1WA 4X00A 4FE3A 3DW1X 1A9RA 3KCQA 4KNYA 1TPZA 2DFPA 2IYZA 2OORA 3A9WA 3X1JA 3ETHA 3BIOA 4LX0A 4KX5A 1DIHA 2Z9DA 4GPD1 3SLKA 1KVUA 2WOOA 3W77A 3RNOA 3A4TA 5DLQC 5HS4A 5KCZA 5JSHA 1DRJA 3QEBZ 4O02B 2JVIA 1IN6A 4JLMA 4OSPA 1YQQA 2GCOB 3L49A 1SULA 4KRYA 1UPTA 2ZJZA 2YWFA 2WNSA 3MB8A 3OX4A 1I3OA 2CL7X 1PZEA 2OFOA 3BN3A 4JUFA 4RESA 2ZYIA 2BHTA 2HMAA 2GVNA 3BWMA 1TXGA 1QC5A 1WEHA 4M9CA 1WBBA 3GF4A 4W9RA 4JSTA 4M6WB 4R0NA 4B6SA 1YH3A 4LMBA 1DEKA 4OYLA 1NF2A 1EGAA 2OHHA 3RSQA 1BJRE 1NUSA 3M1AA 3O84A 2Q46A 1P29A 2VZEA 3CGWA 4ATNA 4R40A 1W48A 4B76A 3QNMA 4TYPA 4G67A 4DWJA 1R4MA 2A0YA 1LFAA 4TWAA 1H94A 4LCJA 5DIFA 5EWLB 1TC1A 4RY9A 5EAIA 1Q7CA 2EJTA 5EHXA 1RLIA 3AEKB 3IRVA 1P1CA 3P94A 1POWA 2H1FA 1MGOA 3VGPA 2G5TA 3LTNC 4DTIA 3OURA 3GXOA 1S3SA 3AOGA 3T38A 3WIOA 4AZ3B 1E61A 3SWWA 2RE8A 1KQOA 5KBYA 4NENB 2WMYA 5AP9A 4XWKA 1VE9A 1K2VN 1YZKA 1SC3A 2GSWA 2H1SA 2ZSDA 1EUCB 1OFVA 1TEXA 2OBYA 1XMIA 4LYFA 3MS4A 1XKTA 4F2GA 3AG5A 2HGZA 2WQZA 2X9NA 4FE7A 4NK4A 1KSJA 5IHXA 2VJAA 4YQYA 4A9AA 5JRJA 1GTVA 2Y8EA 3H5RA 1VJ1A 2GM3A 4I8DA 2PBZA 2FR8A 4MI9A 4EM6A 3RTDA 4YCSA 3T0FA 1FSSA 3GROA 4M1QA 2R79A 4JUAA 1XA0A 4Z99A 2AOXA 2CMDA 3EXAA 2GSDA 3DXZA 1WUHS 1PX0A 3EWNA 4HH0A 4NAHA 4QSHA 5L53A 4ID3A 1Z7YA 5DI3B 2OUKA 1GKYA 5BVGA 3DC2A 2ZJ5A 1QO0A 4EGSA 4M87A 1X42A 1XCJA 3E70C 2OO5A 5EJAA 1DEOA 4RHFA 1IHUA 5EE0A 4IICA 5DBFA 5CA1A 1CUGA 5IWCA 3DDNA 3ZBUA 3GIDA 4D02A 2ZCUA 3E2PA 3M4YA 4YO7A 4PZ9A 2WWGA 2WHQA 3PRYA 3X1MA 5DNAA 5GZ3A 3L6EA 1U8TA 1WMAA 3CQ9A 3F3KA 2VN8A 3W5SA 4F4FA 1FTSA 1P19A 3ECSA 2YL2A 5JO9A 4Q7EA 3WQBA 4D5EA 4Q7KA 3RG2A 4NI5A 2H07A 2A9VA 2QMUA 1UBMS 1DKOA 4NOKA 1W9MA 1ZK4A 4QOFA 3F49S 3H5LA 2VJMB 4RPCA 3UXYA 4B0PA 2WEKA 4CF4A 5I6DA 4QJ5A 1O6ZA 2VDVE 3ET4A 4U3JA 4XFKA 4YQFA 1E1NA 5L3SB 4W5TA 2X0IA 4M3NA 1P2DA 4M1TA 3EZLA 3I72A 5GZ6A 1WY7A 4YUZA 4LJYA 2ZBVA 1QANA 3OIFA 4I1RA 4P86A 3QSGA 1GG5A 2C88A 4H6XA 4NG4A 2FGJA 4YAEA 1VDMA 3W3ZB 3RGGA 4BP1A 1PR5A 1KXZA 3LK6A 1ZL2A 1QAMA 4Q3CA 5JMWA 2AKEA 4QHSA 5H70A 5J2UB 1QMPA 4J2OA 1NJ1A 4UHFA 4V1CB 3NI2A 1AX9A 1QX3A 5E9JA 2FVXA 1P6UA 1UKCA 3MWEB 1C30A 1XRSB 2D8AA 4AXBA 4C4OA 1TKBA 2OCXA 2WFMA 4GICA 3TVYA 4E5VA 2QZSA 2YY6A 1WCXA 3G88A 4MA0A 4CFSA 3OLQA 1RWBA 2I62A 3QPAA 4N0MA 1K86A 2XUDA 5E9AA 3BORA 3UMFA 4L5IA 3H2GA 2PM8A 3ZD7A 2YFKA 3LU1A 1ZM9A 5EHZA 3VO8A 4G1EB 3RRJA 4Z9XA 3UJ6A 1K7XB 2X40A 2PYDA 3MERA 3QEJA 5L3QA 3OIGA 3VHRA 3L6BA 5J63A 4B2PA 5I7WA 2C59A 4QPCA 3GHHA 1FX1A 1ZN9A 1MA0A 3SQMA 1OLSA 4RD3A 4ZGWA 3OX1A 4GWGA 2GBLA 4JJ7A 5D1HA 5BYBA 3O4HA 3TJRA 4ZEOA 2KS6A 2ODWA 4FHZA 4LMAA 4MH0R 5F3WB 4A36A 2C9CA 2G6TA 4QJ3A 4GWLA 3OQIA 1YIDA 5ESXA 2EG5A 3DFFA 3JQCA 4RTSA 3PE6A 4OB7A 4V0MA 4BO2A 1MFZA 2C3YA 3UC5A 1EK2A 2FDRA 3O03A 3PT9A 3KWMA 3EA0A 3KXIA 3SP1A 4EG0A 5LU8A 3D2CA 2W2PA 1YGPA 1XTBA 2NSLA 3AJEA 3N2KA 1DJLA 4Q4HB 4RAOA 4WWHA 1VKZA 1NFFA 3DDHA 4CMHA 4YXFA 1EUQA 1ZU4A 3GC6A 4YAUA 1HXHA 3TTWA 4YRAA 4N4AA 1PK8A 4IOKA 1B8VA 1N92A 1I30A 5CDFE 3LVFO 4RJKA 3IOCA 4TT3D 4KRXA 1PR3A 1L3CA 1WXEA 1FTNA 1C7ZA 2YC2C 3OUTA 3T3GA 4PYIA 3GLIA 2X6RA 4G97A 3HZHA 3LW8A 3QVGA 2HSZA 4M1KA 4QIHA 1KQNA 4ZZ1A 1ZK2A 5A5VA 5JOQA 2L69A 3GNSA 1DGQA 2P9GA 2VBIA 2WICA 3EUWA 2DMRA 1IUKA 1NW7A 2A5JA 2DLDA 3EGXA 1RC8A 5DTMA 2ZWAA 2JAWA 5EIXA 4GM1A 2Y99A 3VC3A 2DCUA 3EXEB 1QKKA 4YMHA 2Y9PB 5AVTA 4QPJC 4DWOA 5JJKA 4EQZA 4LRUA 3WOHA 2X76A 1AQJA 3MFQA 4NDZA 4FFVA 2BMVA 1GLGA 2YNMA 2C3OA 3FZEA 4OFXA 4B48A 2XT9A 3SVTA 1DO2A 3SEFA 3NFYA 5IG2A 3PFNA 2BR5A 4KNVA 4U4AA 3WKBA 1OXKB 2P3LA 1NQWA 4YV2A 3VJMA 5ESWA 4Z5XA 4FEGA 2CCGA 3Q3IA 3LT1A 4EKNB 5M7EA 1C3VA 1THTA 2QAIA 2QRMA 3FN4A 1KEWA 1K6JA 2AYYA 4NV3A 1P0CA 3WRXA 3KQKA 1J2EA 2XQVA 4C4AA 4UHJA 5HW0A 3Q9NA 4YRLA 1YFKA 2GFHA 3BWEA 1DV2A 2ZU6A 1IVYA 1ZBDA 2DY0A 4CV2A 1YMVA 4JUCA 1OH6A 4FDAA 3AVXA 5E4YA 5A9SA 4HUQB 2PMBA 2PKCA 3OCXA 2C7RA 2VQ3A 4D8WA 5AK3A 2CY0A 5BUCA 3OOSA 1T91A 2EWWA 4RK1A 5FI3A 1LWNA 5LZ8A 2CDRA 1CEEA 1KEUA 1Z0AA 2F2TA 3CO0S 3S1LA 3JTMA 3ZGLA 3BHMA 3KOMA 3Q3VA 2GGSA 1E2GA 4ML3A 4LRYA 1JUDA 1X70A 4XJTA 3VDXA 4HQ6A 4HDRB 1Z4PX 4KQHA 2VPTA 3C3YA 2A9PA 2F62A 3A7DA 4IH4A 3JQGB 4W5HA 2OFPA 2P4UA 1UXGA 2QJOA 3CEPB 4BDSA 1W8IA 2I2DA 4ENSA 2OENG 1JHDA 1LC3A 1R4MB 4WBNA 1J8DA 1V11B 4HN9A 3NWEA 2DKNA 4Z0HO 4EVSA 3ROEA 3I2FA 2EF0A 4TOIA 1JG3A 1Z5ZA 1H2FA 1EBUA 1VKJA 2P78A 3UHPA 3OOWA 4BMOB 1DINA 1PEKE 4WOCA 2RJNA 2AOWA 3K1AB 4UTZA 4HTFB 1ZRNA 1X9GA 4XB6B 4N3CA 4LFBB 4S1NA 4RYDA 1E3QA 1PZNA 1IY0A 3I01M 3PE4A 2ZJAA 4UZEA 1MJHA 3UJHA 4KIWA 3UATA 2C5FA 3G5UA 3G1WA 1J0XO 4HGNA 4BV8A 4DRZA 3UAGA 1WPXA 4XIGS 3SVLA 2C9BA 3U19A 1VMAA 2P7HA 2YJ5A 2QHXA 1E7SA 4IZOA 3Q1KA 4JEHA 4CM8B 4MTLA 1SQ0A 3ZY4A 1FL9A 4IO1A 3SS9X 4RVOA 1L7AA 1QTIA 2SICE 3UICA 3AIKA 4EHHA 4ABTA 2A8YA 4MQ5A 1V8ZA 4DIBA 1TUBB 1CHNA 2G8LA 4MGEA 2GRUA 4ZHSA 1S1MA 4B43A 5BN1A 1ULSA 2YZNA 3Q0IA 3HXKA 1YB7A 2HO4A 3D6FA 3DEHA 4RVFA 3VPCA 4KDCA 5CHYA 3F6YA 4JA2A 4NR0A 1V45E 1U3FA 5TSDA 3SLRA 1JE1A 1ZEJA 1RYDA 4Y0NA 1XA4A 3EJWA 3RSHA 5E9WA 3BILA 1JI0A 2AOVA 3D59A 3EPRA 3GMIA 2HFKA 3FDJA 3K9LA 5EMHA 4Z54A 5I8WA 5ICMA 2VYFA 3T1QA 3KS9A 4MQ4A 4G5XA 3HCNA 3VYUB 1GN9A 2J85A 4UU7A 2F3QA 4CTMA 2BGNA 3L4JA 1LK5A 1YUBA 2I7XA 1EWKA 2H1HA 2QMOA 5F77A 3IEIA 3R3WA 1BX3A 3WK9A 4HWTA 1QRRA 3TSYA 4TYWA 3HSSA 5E6RA 3NM5A 1G6Q1 1R9MA 1OH8A 5JAUA 3SIRA 1KP9A 2QU8A 2WSYB 2YJ4A 3IPXA 5KTYA 1CUUA 2YHBA 1NT4A 1UFKA 2QG6A 1X7XA 2YYYA 3TNJA 4HT3B 1M2HA 2LTAA 1QRUA 3W6UA 1TJPB 1U31A 1IUOA 1LZLA 3HG7A 3IDAA 2YUTA 3AL2A 3PQ3A 3S27A 3J81k 3HM2A 1MAVA 5L6LB 1B76A 2Q3JA 5DHRA 4YRNA 1KKLA 2XITA 3HFJA 4FHEA 2BFFB 1F6DA 1E63A 1PJZA 3R7LA 2R65A 3UYLA 4KR7A 2IHUA 1GTRA 4IDAA 1ND6A 1WKVA 5CNKA 4H2DA 2AL7A 2R6CA 1GTG1 1JKMA 2AOUB 3BRQA 1D8AA 3QUSA 3ZWWA 3KKZA 4K6CA 4ARZB 2Y1DA 2Q0QA 4YV0A 1CVIA 1JAIA 3AX6A 4XR4A 2BKEA 4L4XA 1GXSA 4DCCA 4DYHA 3DF9A 2YKGA 3R0JA 1XDDA 1N5DA 1ZQ1A 2MOKA 1TYZA 1XXHE 4NAUA 3TM5A 3VZQA 2B1QA 3PGXA 2R7KA 3WK5A 1ZUNB 1OUMA 1QHGA 2I9PA 4Q00A 5JNRA 2ZI5A 3QF4B 2QJWA 3PC6A 5ER6A 3I39X 2PQMA 1CQIA 3RAEC 2XB6A 1QK4A 2QMZA 4KXLA 3QKSB 3SQWA 5TQ0A 1PS8A 1P5JA 2HWUA 3THRA 4DLNA 4CKBA 3LWNA 1UT6A 2YYZA 3BGDA 3D6TB 1D2GA 5GGYA 3U81A 1BVHA 2PS0A 2YFYA 3LUGA 2NN3C 4OJTA 4UZFA 2G5GX 3UW3A 2V4ZA 1TYBE 3HCEA 2VSNA 3ELYA 3PC3A 5JMPA 5A71A 1SFRA 3SU8A 5LDDC 3EQ9A 2HZ7A 2EX4A 2WLTA 2F00A 3FNFA 1XMXA 3L7CA 1SOAA 1T25A 3AR3A 1ACLA 1FCJA 3FPGA 3QXCA 4IH1A 3SJAA 2INGX 3U6BA 1GL6A 1W96A 3JQ7B 4N18A 1AF4A 4RF2A 1P2BA 2Q3BA 1LLCA 2BM0A 4P3OA 1ZCAA 2BD0A 3SZGA 3OPVA 4D9FA 3LV8A 2XB2A 3FNQA 1RJWA 1JHMA 2NPIA 3HBJA 4FKMA 4YDRA 2J45A 1NXXA 2AD5A 3H5IA 1RQGA 4GOJA 4IYJA 2OCKA 4CTOA 2O59A 4PRLA 1NV9A 2Y92A 2GNAA 3R0XA 3W34A 5BWOA 1XTZA 2V45A 4HGOA 4Q7MB 5IKMA 4XAQA 2ZJ1A 3DOIA 3RJ9A 3F5MA 4QKQA 3RW9A 1G2PA 3IQXA 3MBKA 1BN7A 4K28A 3TSOA 4YRSA 2XT0A 1EAMA 3PGMA 3V3KA 1E2KA 5AKJA 1Z0DA 2VHZA 2A0FA 2IVZA 2Y77A 4RVSA 3MAAC 1SXPA 2GAIA 3ULKA 2ZRDA 4YMSA 1EBBA 3IQZA 5KYVA 2R5NA 1WSWA 2C5HA 1QYDA 2CXHA 5THQA 4BDTA 3KQNA 3WP0A 4QG3A 5FR2A 2PG3A 5JSFA 1R7RA 3VHXB 1OLXA 4L76A 1QG6A 4J1QA 5JAIA 2FOIA 3U5ZB 4PSAA 4FXOA 4CQMA 4YJKA 4EF5A 3SOZA 3WISA 3A6HA 2RMKA 2EW2A 4HNRA 3PR1A 1KZ7B 3KHSA 5CMLA 5T64A 3P0EA 4HC4A 3GU3A 4KDFA 1YIOA 2E2WA 2QG9A 1W85A 3EFOA 5HF8A 4B3DA 4DIEA 3A6DA 3Q98A 4US1R 2ZPTX 3ERCA 1KMQA 4IXMA 4PX3A 1HZZC 5DK4A 3ZE7A 5F12A 1CZRA 3AI7A 3CSUA 4ZI2A 2R1UA 1ZVVA 3VNBA 1GADO 1NBMD 3NHZA 3R6TA 1JHUA 1XF1A 2JAOA 5K8TA 2REOA 3CJTA 3E9MA 5COBA 3K09A 4EP1A 1RZUA 3HEBA 3OA0A 4O4JF 2IP4A 1MOSA 1XCBA 3E9ZA 3HCAA 1SKQA 1UBRS 4LGYA 4MAFA 4ZXFA 5CA0A 3T7RA 5K8VA 2AJDA 1L7BA 3FYUB 1Y48E 2F67A 1U7TA 1CUEA 1M1YA 4QDXA 4HB3A 3UAYA 2PYIA 3AKYA 4PLCA 4ECEA 3ED5A 3VV3A 4R54A 3QKSA 1UAYA 1II9A 1R16A 1XTQA 2QK4A 2ZBRA 3BWDD 1VBFA 3JQFC 2A4KA 2X1MA 2R1VB 1QR6A 4G37A 2CJXA 4H15A 5DNYB 1P1HA 5DYTA 4DSUA 2E21A 1LPBB 5AXBA 3WO0A 1DG3A 1H8EA 1GU1A 2MYUA 4YJ2A 3THOA 1YB1A 4PPFA 1ZESA 4ZI7A 3AUTA 3FSGA 3VSBA 1WMDA 2PL5A 2DPXA 4IRXA 3ECCA 4O8CA 1AKWA 1AB6A 3K5IA 4P93A 2AOUA 5JEDA 1OJ7A 1OX6A 1QORA 1AHIA 1QZZA 3DZ8A 2G72A 3OQJA 4PX9A 1NV8A 1TPYA 4FYHA 3SM3A 2PZAA 5J5VA 4MI3A 5EXDA 5DHPA 4HD8A 1ZOSA 3EDCA 4L8GA 4Q4JB 2ZUBA 3HI6A 4BMNA 1RXUA 3H04A 1QS0B 1RCTE 2VHVA 1I6LA 1V96A 1W36C 4GRIA 3HYTA 3S6JA 4EATA 4CL3A 2RHWA 2VDQB 3P5BA 3GVHA 5HRAA 2PXAA 3NEPX 4Q18A 2ZT7A 4PXYA 5KSYA 2P65A 1I8TA 2SKEA 3TUJC 5BOSA 1B3RA 1LH0A 4KKXB 4BWFB 1E2MA 1P4SA 3N2GB 1PR6A 1YULA 1UWLA 5E4FA 5KSWB 1P4GA 1U3GA 2QUZA 2Q1WA 2RHBA 13PKA 4F72A 4TV9B 4CEJB 1NJ5A 3FZQA 1PL8A 3MN1A 4ZOLB 4S0XA 3ZE6A 2AGVA 1F2UB 4NEQA 2W6JA 3K0FB 2EF1A 1U2SA 1U5AA 2PX0A 1SWVA 2ZBPA 2R96A 4GKAA 4H0NA 3SF8B 5JH7F 4QDKA 3ZU6A 3HCDA 4QXAA 3HPRA 4YV7A 1BGVA 4PRYA 1IONA 3PJRA 2Q1YA 4WCFC 1UWVA 4H59A 3K4HA 1YACA 2FPIB 4LY0A 5SZIA 3A6ZA 2W90A 3PI6A 2BDEA 3ANSA 3OIYA 4NDAA 2ORED 2RG1A 3A4MA 1U5CA 4E5SA 3O95A 3ZOZA 1FFWA 3P0HA 4C3UA 4WCFA 4EKGA 1OMOA 3D2AA 3PRJA 1M75A 4FKZA 4L9WA 4RV5A 3RFTA 5JEEA 2P75A 5FI0B 3ONWA 4JYPA 5TGTA 4PBRA 1JDPA 3DT9A 2VCHA 5LA6A 3MNFA 3ZV7A 2QTMA 2HPAA 4IIEA 5GIPE 1T6YA 4DG9A 1VSBA 1A7UA 1QKIA 2O6LA 1ISMA 2OXTA 1CY6A 4XM1A 1P2FA 1FB5A 1IZ8A 2QTGA 5FXMA 5BW4A 4O4LA 3ADKA 1FF9A 3HB5X 1RKUA 3HVJA 3QXGA 4L74A 4CGYA 4EGJA 4EW3A 1YAJA 3DDSA 2I4TA 1F9EA 1N6LA 1FUEA 4RJJA 3IJ5A 4WOJA 3TW0A 3E82A 1MT0A 2R84A 3O8OB 2C8JA 4ENVA 2ZIAA 2EP7A 1DDOA 5DASA 4JL5A 4HDOB 5FBWB 1RJ9A 4QELA 1L7NA 4AX8A 3EIQA 5AW1A 3FUXA 3D4OA 1PNQA 2AW3A 3K0AB 4EJFA 2XA2A 1Z34A 2E4XA 2IYLD 3IOMA 5EVJA 4ZO9A 2ZFUA 5DTIA 1KKMA 1GGNA 1MEJA 1XZNA 1YUNA 2BCGY 3EIXA 1CD5A 5JR3A 2BKUA 2E89A 3EYAA 3FFXA 2HXGA 3MGKA 3A3NA 2BF7A 4YO8A 3AP1A 4LQCA 4KR9A 5YASA 5B7GA 4G0QA 4L9RA 3GWGA 1IK4A 2IRWA 3KR1A 3R1IA 1FP1D 1TI7A 4GG1A 2WZBA 3VPSA 4EDFA 1XNRB 1E2JA 2PX4A 3U2QA 1PJBA 3ZI4A 4C0QC 3S55A 4D99A 4DV2B 3OPYA 421PA 3JQGA 4DSTA 1OYVA 4WZ6A 2JHAA 5KYUB 3KZKA 5LKRA 5MF6A 4FGLA 2GA8A 2YC4C 4EI8A 5LP6F 3CYFA 5AM4A 3IAXA 4RJTA 2Z6QA 4OI1A 4LGMA 1CS0B 3D7NA 1KAQA 2Z2ZA 3HSKA 4KFSA 2C4HA 2HJRA 1XLTC 1QYXA 3F2IA 4HADA 3BH6A 3NTXA 3L07A 5K51A 1CX9B 1XMVA 3LC1O 4JP5A 4UD6A 3UH1A 5AW0A 4PS0A 5DSTA 3HBAA 2BFOA 3NHAA 4TMKA 5IN5A 5BPFA 3EXG2 2NT3A 4DGSA 2Q1TA 3VU3A 3FROA 5TMPA 4RTNA 4LBVA 3SN6A 1HPLA 1YJCA 5HKAA 4OQYA 1G19A 5DN6A 3EDYA 3UK1A 2UZAA 3AY6A 4WT7A 1YQEA 3M6LA 1YCFA 3EQ8A 3IO3A 3F8SA 4GEGA 1P72A 4UCXA 3U4CA 2BFBA 2O19A 2ZITA 5DZSA 2IU0A 3HJNA 1AUQA 1K5HA 1HDCA 2BH2A 1E2BA 1NZFA 3DE3X 4O4LF 3WE7A 2TMGA 6AT1A 3H5VA 3F7OA 4CDNA 3OUZA 4KQMA 4A8TA 3JASA 5AVWA 1QE5A 4G8DA 1GPKA 1JQ5A 2W6NA 4UMDA 3ZHZA 121PA 5JDCC 1K4YA 5I45A 2AN5A 3SSAA 2OB2A 4DLVA 3AG6A 3G8YA 4KGXA 4P5EA 5IAEA 3K6RA 3QQ5A 2ZSBA 2WIJA 3O9MA 2FCAA 4I9HA 2HK6A 1VQ1A 2WT9A 1FU7A 1TADA 3PDUA 2C7QA 4HN2A 1D9ZA 3WWCA 3K1ZA 5SY9A 4J16C 1O7JA 2NO6A 1BCRA 3RBZA 1WDLA 1E69A 1E79D 1NPTO 4TXMA 5JSZB 2ISQA 3GLIB 1K63A 4JYMA 3WYBA 1GN8A 3S0JA 3H3FA 2M6KA 3KJIA 1AD2A 3UYKA 2QF7A 3A1DA 4G81A 3ZJUA 1U0RA 4G0NA 1QHHA 5B1EA 3V4PB 2D59A 2PQ0A 1PKEA 1ZCBA 5BNFA 1T36A 5JHHB 1P44A 4ZT2A 1AGYA 1T6ZA 3FUVA 4M0FA 4OQXA 5AHOA 3RK1A 2NXNA 1XRLA 4PQRA 4UPEA 4C0AC 4UEQA 3GCWA 4RFVA 3U56A 1LNSA 1JFLA 2QRZA 1CQXA 4R2LA 1MENA 3VC1A 2G28A 3PIRA 3KR2A 1G3IA 2O7QA 1CUJA 1D3AA 4WASA 2ZEJA 2ZVPX 3BMCA 1GGFA 3MMPA 3TZLA 4F92B 2ZLBA 4D4HA 3OOHA 2PLRA 4RGYA 1WZEA 3IAEA 5G4KA 4G41A 3R3UA 3RIEA 3TIXB 2QAGA 4D43A 2EBUA 1WMEA 1OLSB 5CH3A 4GSKA 5BRNA 4AJ9A 2PKQP 5A3SA 1V43A 3QV2A 5JMTA 3HZZA 3ADCA 2FZ5A 2R6AA 3PR2B 4AIIA 1HDIA 3UAWA 4CQNA 3LUDA 2Q4BA 3FHLA 1O95D 4MW0A 3CCFA 3ILYA 4YP7A 3WHIA 2C77A 2I3AA 4GPEA 4G3XA 4LE0A 1XT6A 3HHEA 3QM1A 3TLEA 2IYWA 1OB5A 1T35A 3V80A 1OVMA 4LYHA 4YJFB 4IHJA 1BXGB 3FVRA 5D3ZA 4BCBA 3E22B 4FNAA 1P7ZA 1E1MA 1ADYA 2H1RA 2OMEA 4DCUA 2OZLB 4V02A 5JI3E 4BNHA 4BMDA 3WGGA 2GEJA 1JEYB 4GMKA 1FYFA 4JDUA 2N1MA 1Y5NA 2ZUWA 5KOYA 1VPWA 4D9MA 1P4JA 3LRPA 3K30A 5CT9A 3NWJA 3G89A 5J4YA 3QU7A 4DTCA 5JH7A 2H85A 1GPBA 5JPIA 4C78A 3S2UA 3TKLA 3VSDA 3ZU5A 4DYVA 4GUDA 4YUWA 1FDTA 1OWNA 1QWSA 3EWIA 4XH9B 2J6IA 2YZKA 3FI9A 1GY8A 4DM3A 3QVVA 3QE3A 5DNWA 5KUTA 1AGXA 1Z6YA 2B2CA 4Y9RA 3LT5A 3R0VA 2YN0A 3W3AA 4IGEA 1VLQA 2F1RA 1O9BA 1M5TA 1S6YA 2BGLA 3RBAA 5CLGA 3E9YA 4LN1A 3IVCA 3KAQA 3ORQA 2IYYA 2NZJA 4TSFA 4V0LA 3T5PA 1SAYA 3PDIA 1OA0A 1OXUA 4IKEA 5B3KA 2X23A 4NCAA 2RGDA 3MEQA 2BMDA 2WWWA 2RGYA 2YZ7A 4AKTA 1SR8A 3TCKA 3NHJA 4YAOA 2MIIA 1CNMA 3H2YA 2NSYA 4DRYA 2J4CA 4Q66C 5LD2C 4RD6A 1Y5RA 3QNWA 1DC6A 4R8LA 2NXWA 1N2IA 4PN3A 2O52A 4RLQA 4ZJZA 1SHZA 3G9ZA 1LCIA 3BDVA 1QJ4A 2AR0A 3BMOB 3EE6A 4DYDA 4LHWA 4JC8A 4WK6A 4YVFA 1PW5A 2VYQA 2JVJA 2Q6TA 2XQIA 2R6JA 4UFOA 1GOTA 4W1PA 2ZR8A 3GGDA 3TOVA 1FU8A 4PZEA 2GYWA 3Q2OA 3T9BA 3QBJA 5HF9A 1XQ9A 4PY2A 2QPOA 2WSLA 2UUBB 1MTZA 4QO7A 4BIIA 2AXPA 1GUAA 7MHTA 2HA5A 4U8GA 1TQ2A 3TZKA 1M73E 4LZPA 5C2JB 4ND4A 5BQOA 2DTDA 3O4IA 4B4WA 4QYTA 5JD6A 4M54A 4JMLA 1UH5A 2CHQA 1X2BA 5A4DA 3GN2A 3NHLA 3U80A 4YLGA 4C4YA 4K87A 2Q3FA 2DBQA 2VJOA 3LNCA 4TTAA 3AXTA 4KR3A 3PG5A 3TR6A 3WNBA 1NMQA 5FTKA 3ICEA 3MLAA 5C34B 3K0HA 3MILA 5TT0A 3RT1A 5HZKA 3EVEA 1MQSA 3LLVA 5EWLA 1WHTB 5TF4A 3TI7A 2G09A 4MVYA 1DTWA 3I6BA 2WKSA 2NZ2A 3PUXA 3B20A 2XUGA 4K3UA 2AMLA 1SPXA 4IVNA 3ZBQA 4CXMA 1QV6A 1MQ8B 1VJ5A 1JZTA 3LCUA 1E0JA 3Q5DA 2DQKA 3RSLA 3DD5A 4AN0A 1QC5B 1FLDA 1ZM3A 4GPTA 3HZOA 5B2FA 3V2GA 4H1WA 2HZBA 5DSXA 1H22A 1MPTA 2N42A 3MAGA 5EMMA 4DSOA 3F0TA 1EQAA 2IU3A 2XSZD 2B6NA 2V54A 1I7SB 2E5WA 3THWA 3B9RA 2VKTA 1S01A 2XZDA 3E27A 1KJ8A 2ZR0A 4G63A 4O5OA 3CUKA 2MSWA 3P9XA 4C03A 3M6MD 1XMQB 3I64A 2GYYA 1E64A 2OBFA 2J9GA 3LTEA 1KOJA 3G2JA 3NH9A 5IU6A 5IRCD 4RKRA 3C3PA 3DDWA 3TQRA 5KB3A 1GFZA 1R88A 3NPMA 4JT4A 2Y3IA 1PK7A 1NVXQ 1Q2XA 2BCJQ 2J3HA 2JKYA 3A04A 2VH5R 3ETCA 3GVCA 4HQNA 3H18A 4PO1A 1D1QA 1LDEA 3F4LA 3RSZA 4WCFB 3JQAA 3TNDA 5ALMA 2JLZA 1FS4A 3R3ZA 3F5QA 2FE1A 3KB6A 1UEJA 2HK9A 3DP9A 2OVFA 4Z53A 4GECA 3HQ4O 1JQJC 3QRWA 1RKVA 3RNLA 4YASA 3WHLA 1JJ7A 4KN6A 1NAHA 3W2TA 3SF8A 1J8VA 3KXKA 2C4KA 2GXSA 5C8DA 2O9JA 3FUCA 4G5HA 2FR8C 4NJEB 4U7TB 1L5NA 2OCYC 3TD6A 4CEJA 2CUTA 5IH3A 4MUGA 1EFVA 1OD6A 2Z9BA 3NEJA 3ZLVA 2W37A 1WLSA 5EEHA 1URPA 3NUGA 4MS3B 5ARDA 2EJVA 1HKHA 2FRDC 3E5RA 4NJMA 3BGSA 1RHUA 2X2PA 3KFXA 5FB3A 2CLIB 3ITNA 1MNAA 3MJEA 1YJ8A 1Z8NA 3WV4A 5CXQA 1V5FA 3T5CA 2O8CB 4KXQA 4Z9FA 1MA3A 10MHA 2PIDA 2YBEA 9LDBA 1ECLA 1OU4A 5AOBA 3WAGA 2BEVB 1E2UA 3DKKA 3PNSA 2LCQA 3P9RA 1BDMA 1QV7A 1TGVA 1FUIA 1XD2B 4PYNA 4WIAA 3L8DA 2DGDA 3V4VB 1BGXT 3KR0A 4Q4JA 3ZHTA 1GFIA 3FPJA 1M1ZA 5G0VA 1OTYA 2YIJA 2ZWOA 4AXXA 5FI5A 3PLAE 1FQKA 4U1RA 3VYSB 2HWYA 1XVAA 3LX5A 3C5CA 2J9ZB 5AESA 1Z2NX 4GYWA 4GHWA 5G3ZA 3O3NB 3CW8X 3BFVA 2OAEA 1LF0A 1PWHA 3U44B 5KYXA 1P6QA 4BNMA 2Q1UA 1EE2A 5CNMA 4YH1A 1OV6A 4JP8A 2YXEA 2FJUA 1CETA 1Z8DA 1CRZA 3AY0A 4YJ2B 3P2EA 2FDCA 5T67A 3W8FA 1OSNA 4BV2A 1XK6A 1Y7HA 3NBYC 4GOLD 1YB4A 2REXB 3GBVA 2EGHA 3KVRA 1I2MA 3OFJA 3IVXA 4RZ2A 2C7PA 3KJXA 4E94A 1EIZA 2HDOA 4LJ7A 2YUIA 5G41A 3ZQJA 1DX4A 3I9MA 3Q11A 1ZOLA 2VG8A 3STUA 4NMMA 1E92A 3FKQA 3I6IA 3UF0A 4D82A 1VLJA 1E3JA 2HSGA 9GPBA 2YWHA 3J7TA 4B8ZA 1ZZEA 2HXSA 2V6GA 4FFDA 3PUYA 4BU1A 2VPWA 1M2NA 4Y9UA 5CA0B 4ZYWA 1SVMA 4PE5B 4Z7QB 3HXTA 2OXIA 1XROA 1PHPA 1Z7WA 2B8TA 2HY7A 3Q7EA 2IYNA 4HRAA 5C8YA 4DDHA 5E6SA 4ROSA 2ZIXB 4U2BA 4PTYA 1WO8A 2BFDB 4KITB 2BW0A 1L8LA 4MGIR 4RWEA 1UDRA 2WM3A 3T7CA 4PYRA 3V48A 3L06A 3WLEA 4CT4B 5JQWA 4E08A 2OAGA 2ZJOA 2B4YA 3UH0A 4UXIA 4DLPA 1QP7A 1GLNA 1TMYA 3CRMA 1D1TA 1C80A 2WRZA 1BQ3A 5LZ7A 4YALA 5HJ7A 4M49A 1US8B 3AV0B 1ZGBA 5CVUA 2O8BB 3QBVA 1JT9A 3VPXA 2IDJA 4S1PA 2FWMX 1CIJA 3MQ2A 3QH4A 3DT8A 3E2IA 3FGNA 5ILOA 4CBVA 4DKJA 2ZSFA 5KNCD 3KELA 1PQPA 3AUSA 4YJ2F 2OO7A 1FTGA 3M9XA 5IJXA 5TGDA 2YIVX 2I78A 5LA6F 3H9EO 3ZY2A 3L82B 1ZEMA 1DJOA 1Z6GA 4PLHA 1RADA 3HBMA 1SUSA 4M22A 4ZV4A 2YXBA 2JJYA 1B26A 3GY0A 4GT1A 1M1UA 3JQPA 5DX0A 3U4AA 2C07A 3A9CA 2D1RA 1SKUA 3P2MA 4CRWB 1M1NA 1D5CA 1WZCA 4JK3A 1CSEE 5IM4A 2QQ5A 4HV4A 3TZEA 3V1LA 4XQCA 2UXDB 1MN6A 4EUKA 1QQ7A 9MHTA 4O4JA 4MGKR 2OO5C 2I67A 3ZWOA 2V03A 4BFUA 4UJ3A 1OW3B 1SELA 2EQBA 1W0CA 4W1RA 4MQLA 3VKHA 1OREA 2GZDA 2ZRQA 1P7VA 1EWVA 3GPDG 4NRDA 4UUMA 4Z2AA 2H3EA 4I9NA 4ETNA 2JI7A 1U7OA 2VHXA 2PRIA 4NICA 3UJDA 2JLUA 3GH3A 1TMGE 3QHAA 4J90A 1T2NA 4DCGA 2BUBA 2FAXA 3CLKA 5G2OA 1U3UA 4B81A 3P2OA 4M8IA 1OWLA 1Z7BA 2W2VA 2I6QA 3QXSA 2E3JA 5A3QA 4C2AA 1IVSA 1FMFA 5DGIA 3WJ2A 5MFZA 4IPTA 4TQ9A 3Q8WA 1KU0A 1EXMA 5JAMA 2Z56A 4FZVA 2RHMA 2VHTA 2C57A 3KZVA 3B8HA 1FDWA 1E3TA 2CMKA 1XAGA 1SVUA 1USWA 3CXUA 1G1AA 1EX1A 3QF4A 1XK7A 3KYDA 1LTKA 4GP7A 1UM9A 2OWDA 5FIUA 3HY4A 3I3SR 3V42A 4AUKA 2UAGA 4RANA 2FQQA 1G8PA 4YUYA 1FMJA 1XHEA 3K96A 1QYWA 3LT2A 4GKVA 4QC2A 1VXRA 1U6KA 1IQPA 5CG1A 1CRWG 1M1XB 1Q1EA 1PS9A 2PH7A 2BFEA 4ARZA 1BN6A 1UP4A 3LY5A 3NOVA 3QX8A 4MRMB 1VC2A 1U0FA 1Z0UA 3V8MA 3G0IA 4IG4A 4DRXB 2A1UA 4JLPA 4F93B 3IEUA 1YR3A 4HXYA 3CBGA 4RA9A 4ZALA 3SNHA 3CA8A 3G7NA 2WG0A 2VTDA 4GEKA 3ZWYA 3FGPA 4UAUA 3RVMA 2PHZA 3T4XA 4ZHQA 4ZDIA 4DLTA 1UPCA 3CMCO 2RHCA 1B16A 2Z2IA 4OIFA 4MRAA 3VOTA 1M1YE 5A0VA 4LXIA 6LDHA 3V7WA 3QK7A 4X20B 2GMWA 1TYDE 3DZDA 3DLIA 1B0UA 4FWIB 3FUTA 3QU4A 3SC2B 3QU9A 1ESDA 5EI5A 2Q7XA 2CLFB 2OV2A 4EGQA 1QH1B 5LZ4A 1C50A 4I3GA 4LPKA 2FN9A 1OA1A 2FEAA 4V38A 3KSZO 4BHTA 1OC4A 1K2WA 2WYOA 4O59O 4E70A 5JNUA 2QVGA 1O54A 4JAVC 4B6QA 1TJ5A 3PQ2A 4NL4H 4QVIA 3A26A 3VHLB 2QI9C 3HADA 2O2EA 4IJ6A 1N2CA 1V9LA 1SKAA 1U9IA 1E3DA 8LDHA 1O0BA 1VPVA 2JDID 5JQGB 5C1PA 1FZTA 1W49A 2V4MA 3L4BC 4YRQA 1YQ9A 4GBGA 1JU3A 3GUYA 3OETA 2YN4A 4C0LA 1IQRA 1KRWA 4R8MA 4V2IA 3SQXA 1DJPA 1K4MA 4G8BA 4RPLA 2PSDA 4DJAA 3NXSA 2WD8A 1I7DA 2HMSA 7MDHA 3GNQA 1EFUA 1Y1LA 4ZZIA 2G1PA 1PWEA 4C06A 2QAGC 1QG0A 3H86A 4IMPA 4ZIRB 4RDCA 3QOFA 2IDZA 4KMMA 4RABA 2H9YA 3N5CA 3HJGA 2PUWA 5DBHX 3KYJB 3FOCA 5IT0A 5BV7A 1R4ZA 1X1EA 3AKDA 3H13A 5H3LA 4GE0A 2Y67A 4F9GA 1Z0KA 1U2GC 3NASA 3BAFA 5ECDA 2MINB 4ZCPA 1XTJA 3UBMA 4C88A 4DA7A 2X4IA 4PU0A 3QI7A 1DARA 4EKYA 5EWMB 4MQUA 3OE1A 2NUAB 1JFFA 1OPRA 4LV6A 4JLBA 5KNBD 1P1JA 2ECFA 1Z8FA 2RHGB 4UQOA 3VGJA 1J5EB 3HEMA 4D0RA 4HDMA 4Y2UA 4F9EA 2W6ID 2MDTA 1MU0A 2XKJE 5AIBA 1L5HA 4CV3A 1QTQA 4BP3A 1JMVA 2W0SA 4RETA 4ED9A 2E1PA 3IAUA 4F5WA 2YOFA 1GPUA 2B7CA 3A9UA 3ESAA 3AETB 1JN0A 1B4DA 2A5GA 2F3SA 3RFXA 3RRZA 2J9YB 4AWXA 1C9DB 3IKTA 3F98A 1DCTA 3VUEA 2JH3A 3C2QA 1U0OC 4RJLA 3CX3A 1FDVA 3QUAA 2OG1A 4C22A 4G0VA 2HW8A 4MARA 1CTQA 4ZZ2A 3VOAA 4O63O 2VHQA 4QGSA 4HH4A 1WB5A 2HAEA 1T8SA 3GVXA 2FF7A 1RCFA 4G26A 4ZAZA 5HEKA 2AF3C 3AQIA 3X2FA 3HN6A 2HXYA 5L9AA 1VKNA 3O1JC 5SYAA 2F55A 2XV1A 3PUHA 4TSRA 1SZPA 2XX3A 1U02A 3IXMA 4YJGB 2C9MA 2EARA 2HLDA 1N8TA 1I80A 3Q85A 2BFMA 1L1FA 3X1KA 2H1LA 3T0GA 1MH1A 2DR0A 1U1DA 5FPTA 2GH1A 4UXHA 3EVBA 5B4UA 1G4UR 5I8ZA 7GPBA 2FKAA 3D7LA 4UARA 1FRQA 1O77A 3UK7A 4LE2A 3SK0A 1K7EB 3V00A 4ER5A 3O74A 3EOBI 4OLAA 5J4VA 4ND8B 2QN9A 1UT5A 3QXXA 3PQ4A 5F7OA 1N6HA 1UJ4A 2RB5A 3D1LA 3IULA 3ZQ6A 3GMSA 3AF6A 3R9KA 5B2EA 2WUFA 2B4RO 2XNHA 1CXZA 4NC9A 3AF4A 3QVTA 2YXPX 3TZHA 1P74A 2IUSA 1T2EA 3QFSA 3WWZA 3S2IA 1O3YA 1JIUA 4HMOA 5IX8A 1RLJA 4U2DA 2GPSA 5CX1A 4YRTA 4MNTA 4LECA 2CMGA 4IGFA 4E2FA 1A5SB 3SPXA 3WL8A 2FWAA 3B8EA 3LQ1A 4AP9A 4CTKA 4WDRA 3ZWPA 2JJ2D 5AOVA 2XUQA 3Q8XB 1KPHA 2WJYA 3WSVA 4FOPA 1G55A 2PK3A 5DNEA 4ZT5A 2C5LA 2WU8A 2IPMA 4NBSA 2GNPA 3AEXA 3BCHA 1OBOA 2J46A 2ODQA 4B3RB 1IJFA 3R7WA 1ZJ6A 4IAOA 4UE6A 4Z9YA 1I7LA 2WAXA 1NQTA 2ASVA 1RKXA 3GFOA 4XTCS 1M66A 3TPFA 3INGA 4CQMD 4CHTA 3LDGA 4W7SA 2XNDA 3TL2A 4DILA 1VSUA 2X7HA 3HXMA 1GAJA 3G0HA 1RYYA 8AT1A 4C5CA 4TZ0A 4NEHB 1THZA 1MAHA 4BXOB 5K20A 1R6UA 4IIBA 3HCCA 2DR3A 1T5TA 2W8BB 4OHPA 4US2R 1N6KA 2A33A 4BZWA 3UGJA 4OL9A 2G9VA 2KWIA 3W6OA 4UEOA 1XLTA 2B2XA 1ENYA 5LQUA 3UJBA 3EXHA 4PTZA 3GLVA 3B52X 4KIUA 4AJKA 3GLGE 1I32A 2JIDA 2ZBEA 4I81A 4U00A 4XLZA 1YMUA 3FFTA 4MJXA 4OJQA 4B6RA 2QY6A 2VLBA 3LDFA 5MN5A 4RTQA 1OF1A 4HEJA 3DMFA 1XPUA 2A30A 5ICCA 2YVLA 2WQ6A 1WU8A 1DVRA 1Q0QA 2QTRA 3BT7A 2VXCA 4PQEA 4ESOA 1M0TA 5BY2A 3BWYA 5IJWA 1IXKA 3K9WA 3KX2A 3RTBA 1I94B 4RWZA 4H3KB 4NPAA 3IMGA 3W6ZA 1NSFA 4RF4A 5HIAA 4P34A 3CC8A 3PX7A 3L5OA 1FC0A 1ZR2A 3HN7A 4RO0A 1YZGA 2VA9A 3E9CA 1V8OA 3ZVLA 4F1KA 4U7JA 3HY3A 1Y3IA 3MVEA 1QYVA 3AIIA 5EXPA 1FU4A 2B1GA 4E2WA 5KQLA 3JALA 2QVLA 1TCCA 4QO8A 1Q50A 3SI7A 2GBFA 2EHJA 1NDUA 3H5OA 2IH2A 1E1CB 1QZXA 3QW2A 3G8CA 3IX7A 2JFPA 1SVSA 2BPOA 3L1VA 3G7UA 5K0GA 1L5YA 2ZRAA 1INLA 4IMJB 1RPZA 1FFXA 3UBTA 4RS4A 2QTFA 3CWZA 5HNKA 4UHHA 1Q84A 1EXNA 1OYWA 3CU5A 2Q6KA 3M2PA 3GVIA 1O5TA 2QX9A 1NASA 3OMWA 4FMDB 5DGDA 3VTAA 2JZCA 3WFZA 4RA6A 1M34B 2ZUFA 2IY9A 4PQYA 1YL5A 3S81A 3FZYA 1G8SA 5ERYA 3QKWA 1I9GA 2XWBF 5BUSA 1B8UA 2BTQA 2X6TA 1FIUA 3HLTA 1NY6A 4HNAA 1GA1A 2CN1A 2YFQA 4B5KA 2GHRA 3DMGA 5IDYA 3LP5A 4F86A 3LK7A 2ACKA 1UC8A 3NAZA 4UD2A 5PGMA 3H8SA 5TPZD 5AI6A 4EJ6A 2WMOB 3UV6A 3A1WA 4EPVA 1PR9A 3Q41A 5IZCC 2SECE 2ZU0C 2Y68A 5D5HA 2IOQA 3FE2A 2NT4A 2A0WA 4OAOA 4YNBA 3PEYA 3KVVA 5E2IA 4F1WA 3N2LA 3BJZA 1JXMA 1DBWA 1EVIA 2FEOA 2G0TA 2OYSA 3CCCA 4ZVVA 2FFAA 5AXAA 4A0FA 2VJBA 4RZIA 1K3FA 4L5YA 4MV0A 2WJ3A 2J5XA 2QZPA 3IKLA 1MPXA 1FNSA 3UXMA 3WHKA 4OH1A 2PAAA 1PYGA 5H3HA 5LZ2A 1CPYA 5CJJA 4OI4A 1Q92A 1JKIA 2O1WA 3B6KA 3FA2A 4KFUA 3ND5A 1E2NA 1N7HA 1TQHA 2I4LA 2WAYA 1K75A 1W4ZA 2WUDA 5DTEA 2AJTA 1ZRSA 4PC2A 3BQ9A 3VPBA 3TQHA 4X92A 3NV9A 4YT8A 4P4TA 3LIPA 2PRKA 1UJ6A 2WZDA 5JECA 3EMKA 8GPBA 1UC4B 2L17A 4MV4A 1KF0A 1LTHR 4NFSA 1NP3A 2I6XA 4TWRA 3ZWKA 1WUIS 1RE0A 4BUCA 4D46A 2DWCA 4A6DA 3N59A 4IOMA 1JSCA 1OT3A 1U8CB 1V4BA 5ALRA 5CBPA 3AETA 1AKVA 5IFKA 1Y7PA 4ZQEA 2WIFA 4CLOA 1XU7A 4QUEA 3H2ZA 4A1OA 1VCNA 2ZATA 2VRCD 4KLAA 4N3GA 2JG3A 1KIAA 4KXVA 2ZSKA 3IKJA 2XNSA 2PX8A 2W4QA 4Q9KA 4MDFA 2OAP1 3HNRA 4C07A 2ZVJA 4HMPA 4TV8B 5BN4B 5AW3A 1IBCA 3GW8A 3TNYA 3PDHA 1OBFO 2BM8A 2V7TA 4R84A 1DQSA 3T4PA 3KK0A 4YRDA 1X39A 4BE9A 1VL6A 2XMDA 5CB4F 4LDAA 2GJSA 4ZO6A 4A7PA 2PZFA 4ZU1X 1P1BA 5LM3A 5IM4F 5KTTA 1HE3A 3H9GA 3BD7A 3VU0A 4EG5A 1G7TA 1BH6A 2Q5HA 3M6IA 3HU3A 3NHFA 5ALZA 4BE4A 2JGNA 1UXJA 2D2IA 4CLRA 4TMZA 1SIUA 1IXRC 5BW5A 1EXVA 2BBSA 3MIIA 1ZJWA 4D8XA 4BJHB 3TQOA 2ERCA 4OXQA 1KJZA 3EVZA 3LCMA 4DXDA 621PA 2WTNA 5JT1A 3EXG1 1K8YB 3OJ0A 5P21A 2SKDA 3PXEA 1NNLA 4F5EA 2AFIE 2VSXA 3D7RA 3Q0TA 1NR5A 5CLIA 2NVUA 1F4VA 1MMFB 5D84A 2BBWA 3DCIA 5CCEA 3MTQA 4WNAB 4YBRA 5BSVA 2O8DB 4R8VA 1YTUA 1T4GA 1V6AA 3WI7A 1N2CB 1NVMB 4IVQA 3Q10A 2RAVA 4FYPA 4XDZA 1DOZA 2QX4A 4I2NA 4AY6A 2WM9B 1N6IA 1I7NA 3UCFA 4YPOA 1U9ZA 4M1SA 3UJNA 4QL3A 4OJMX 2RBKA 4KHZA 3BWBA 2PUBA 4HQFA 3IDSA 3RC2A 1I0IA 3A9TA 2L18A 2V5UA 3F74A 3ZDFA 3ZNQA 3EDRA 1D9XA 1I3CA 1QH1A 4INZA 4K81B 4BUJA 1BYUA 5IASA 3LVRE 4FB4A 1ILEA 4YI5A 4AQDA 3GJ7A 4Z2YA 4CM9D 3GJ6A 4PFKA 4N03A 3OF3A 1P8AA 3EUEA 3PJGA 3QUBA 2YXNA 5K03A 3RQSA 4AY2A 3L93A 5JY1A 4L02A 1BWSA 3HWX1 3JATA 4EARA 2EU8A 3HBNA 4LE1A 2SBTA 5DEOA 1EG2A 1KFEB 1WW8A 3SIWA 4G0ZA 3RTGA 2ZJYA 4DLLA 4MUNA 3QEKA 4Q3KA 1SU8A 3HA3A 1SQFA 4IXNA 4GSLA 4I1PA 4ZAWA 3RDPA 2ONYA 3U39A 1H0SA 1Q0ZA 1VGVA 2BFEB 2R87A 1R5BA 3PQFA 4MQFA 1T2FA 4EJ0A 3EVGA 1B3BA 1FZQA 2QTZA 2VK2A 3RYHA 1ZH6A 4BNWA 3MUEA 2F8SA 3QVUA 3TPCA 4IDOA 2GM9A 1ZA2A 3NVDA 4AMBA 4TX1A 4X1YB 4Y2HA 1ZD8A 4FZJA 1LTQA 3VBEA 1PW7A 5A2GA 2CFOA 7REQB 4GI5A 3GT3A 3K31A 1F2DA 4QDZA 1ZG3A 1MAWA 5ALJA 1E0DA 3NWPA 2C3UA 1WW2A 3W7VA 3C3MA 2JKVA 1VP9A 4OIMA 2Z3WA 4NYJR 2ZBDA 1I6KA 4DIDA 4CLEA 4F5YA 5LOVB 1IDOA 3MA0A 3UMYA 2PV0A 5C9ZA 5A9TA 4BL5A 9ATCA 2G4CA 4K2AA 5FBZA 3ZXUB 2CUNA 1LW7A 5JMOA 4OGGA 1I10A 1F6WA 1O0SA 5TGZA 1AB5A 3T7TA 3TDNA 2PL9A 3N53A 4LQLA 1RU3A 5TPWB 1OIWA 5JANA 4JD5A 5CW2A 1E6CA 1B6GA 2XNKA 4HGQA 5EZ6B 4QREA 4N8SA 3GGSA 3CZQA 3RVQA 3IUSA 4BNLA 1ZY2A 2H31A 5KVSA 2FMIA 3EISA 2VK4A 4B3XA 2E37A 4IFIA 4EPWA 4P0QB 1Z4IA 2XVZA 3OSZA 2WNIA 3U37A 3CVWA 3OHSX 3VR6A 4RTPA 3LKZA 4B33A 5E0OA 4ERXA 2P8JA 3HL4A 2HSEA 3AM3A 3HO6A 1JJAA 4M36A 1GZDA 4FK8A 4WZBB 3O26A 1MRSA 1E6UA 1GITA 4FGUA 4UBOA 5D7BA 5H59A 5B3AA 3SHVA 2UZ1B 4QARA 3ZZMA 4GDFA 5A4JA 3C5EA 4IGKA 3QBTA 2AUTA 4BJ5A 1UEXC 2R9VA 2VI5A 1QG4A 3G2HA 4FCTA 4X3OA 1CJBA 1X8LA 5T4BA 1LDBA 2OP0A 2W70A 3DEJA 3HO8A 3K9BA 1U0JA 2J3LA 4RL6A 3U1VA 3E48A 4DR3B 2BKVA 4JNCA 3VR5D 4WOPA 4A0HA 3TB4A 1Q77A 4HFNA 3OHPA 1BCSA 1JU9A 1YZFA 1ZXBA 5DN9A 2P7IA 3ZWCA 1Z0SA 3PTLA 2GKOA 3QI2A 3TN7A 4RD1A 3QFRA 1MC1A 2SCUB 1ZNZA 1Y8CA 4TTVA 1JDBC 3D2LA 4DDUA 5SICE 4DQXA 5T4EA 1X87A 3K9NA 5EIEA 4DIFA 1BA3A 5TRTA 3OH8A 1RQLA 2FUCA 1TLLA 5A1TA 3D3JA 5AICA 2OXRA 5IJZA 2FN4A 1YBMA 1CFJA 3NP7A 4WZBA 4BYGA 2YICA 4RKWA 1YS6A 1WXFA 2I80A 3AYXB 1RR6A 4MP3A 3TIVA 3ZC3A 1MG5A 1BOFA 3W05A 2PU7A 4H16A 5ABPA 3O3OB 1UF9A 1YOVB 3TD2A 3PB3A 5EJEA 5E7MA 1Z2CA 1N57A 4IDHA 3GOHA 4PZUA 2IXEA 2BYTA 3ANMA 4DA9A 1QU3A 1EKXA 1O9GA 1YFZA 1RI4A 2QDXA 3O0TA 1QIMA 3WL7A 1D04A 3G2KA 4R1TA 1ID1A 3O4RA 2FJPA 5I48A 1AQUA 4DWWA 1N36B 3TLGA 2A6PA 1EGMB 5KOJA 2CNNA 3FUUA 3KPYA 5EGNA 1X7YA 1KS2A 2NNLD 3EXHC 1QO0D 5TMEA 1ZS9A 1COZA 4ROTA 2VDMB 2V7GA 3KJQA 2PT7A 4L3WA 3RU2A 1QFXA 3OZEA 2EYUA 2RJOA 5FAXA 4OHBA 3N87A 2RGNA 3BMNB 3T3HA 4A0GA 3D8HA 1N6RA 4B84A 3Q0EA 4PICA 3HKCA 2E82A 2HLNA 4UOEA 1P1RA 2ODNA 1CUAA 1VI5A 2JCBA 2A35A 1ETUA 1H6BA 1UXOA 2FX5A 2RK4A 3LKVA 1L9KA 3MM4A 3PA6A 5DDIP 4AJIA 4OV6B 5DISB 4BMSA 4YCLA 2WR8A 2FH5B 3FDFA 1KKUA 2BHRA 4BGUA 4D4KA 1NX9A 5LC1A 1LV7A 3TXAA 2PA3A 5HM6A 4S05A 2QX6A 4JBGA 5HQ3A 4JKOA 1D2CA 2QD5A 1JIKA 3DOFA 4U7WA 4WZAB 4TM7A 4UTVA 3KEMA 4TLLB 1UC5B 2YN2A 3RU7A 5BR1A 1PRYA 4JJIA 1JMYA 4NNJA 2RFLA 3KV1A 3TLCA 2HT6A 4C0XA 3CO5A 1COWA 3LNTA 4D3SA 1A5AB 1G6HA 2H1CA 5A02A 3K71B 5FBVB 1AO0A 1DFHA 5ALHA 3LXRA 5K3CA 1RTKA 3JQFA 3B1KA 1GNPA 1N2CE 2QMHA 3GRPA 3KUDA 1WXGA 1CZHA 1GEGA 1VJ0A 4YT5A 1F8GA 2ZP1A 1ZIOA 2QVYX 1TKAA 1YDHA 4AQ7A 1KI6B 2P9CA 4XIFA 5CAEA 2VRCA 4Z4GA 1UBHS 2BKAA 2FPPB 1GQOA 3EEBA 4HATA 4YK7A 3AP2A 3ZE8A 3PCRB 521PA 1G20A 1VP3A 1SA0B 4L7QA 2HK7A 1N5RA 1Z5UA 3X1ZA 5B4TA 2DP4E 2IY7A 3DAYA 3LCVB 3MAJA 4HLDA 1ZGCA 3HJHA 4B47A 3NC4A 2VHWA 1NUAA 4FN5A 4AS3A 1PR0A 3ONEA 2PL3A 2QMQA 5L7YA 4WECA 1ZH8A 3GLIE 1WCIA 2EJCA 2OGTA 2LPMA 5ADWA 5FOQA 1R6TA 3O1HB 5CXXA 4RHEA 2I03A 3CE9A 5GVSA 2O2IA 2RGAA 3W79A 4Y0AA 5EP3A 5KINB 1Z6TA 3S5UA 1QFMA 3DOEA 2C5AA 4PANA 5EMJA 3UT5B 4EX6A 3VX4A 1JB1A 3K1TA 1XTVA 3LSTA 4HGRA 4RF3A 1KFBB 3MSCA 4D5GA 1G38A 3LUHA 1Z16A 1UMDA 2DBRA 1BD3A 3TK1A 1F48A 1A9OA 1SBNE 2W6OA 3AZOA 4F06A 2G9QA 1E4EB 5E1BA 2YWXA 4M1OA 2EWMA 3JQ8B 1V1RB 3FLEA 3FG9A 2FPGA 1ISSA 3A1CA 2GCEA 2H4ZA 4H3VA 4IP0A 4MJLA 3TGWA 5DHFA 3BE5A 4C76A 4U39A 3KQVA 3EY4A 2Q5CA 4D9CA 2PUAA 3PHLA 3PU6A 1K6MA 5IK2A 4K6FA 1YJXA 2C5BA 4FLFA 4D4GA 3R20A 1GVHA 3CH6A 1U7HA 3CM0A 1KEPA 4PYOA 1NNUA 5P8WA 3REGA 3BA1A 1UXIA 1ZDMA 3WICA 5IVKA 3ZK8A 1RWWA 4N8DA 2V1UA 4CDRA 4LVUA 1LSJA 1IBMB 3ADDA 2LNDA 3KCNA 3LCJA 1R4NA 3GUZA 2CJWA 1B43A 3AEUB 5DIZA 3VNRA 3OZGA 3A6PC 2AI1A 3HZRA 4LYJA 2UZ3A 4DUPA 2PS9A 5E3HA 5CT6A 4QVGA 1A97A 4G2NA 1IQ0A 3A9VA 4HAIA 1VPTA 4J6EA 5AKZA 4LFCB 1H1LA 4YCJA 4DMFA 1GCGA 1TAUA 4G0MA 1NC1A 4I1UA 2AZTA 3JAMA 1BYIA 1JBQA 4D80A 1B93A 1LDMA 3IVMA 3GLHA 3MJFA 2X8LA 4KFTA 1TUIA 4IIJA 2XE7A 3L8YA 4D25A 4Z1OA 4LF9B 4Q9IA 5ED0A 5LQDA 2OAQ1 3IEPA 5AVYA 1TF2A 3EEYA 2CNWD 1UADA 4R1SA 2YBDA 4BZZA 2HA0A 3L4BA 1P9NA 1D0VA 1V6SA 3GWZA 3BIFA 3C3JA 4OK3A 4ZCRA 1NMYA 3T3NA 4TTIA 4OCZA 1IBKB 5CDSA 2NACA 2XW6A 1PP4A 3NYIA 2ONCA 1MAAA 2BGRA 4OM8A 5LD2B 3I12A 4L4YA 4KAXA 2BEJA 3K20A 3R8CA 2XUFA 1CY4A 2PLAA 3UKDA 4HXFB 1M33A 4UUAA 4DBZA 4I99A 1E9AA 1W9HA 3DDUA 3FOBA 4X97A 4V0RA 1PYDA 3CRW1 1E9BA 1GQ2A 3L0BA 3R7NA 4DA6A 1EPUA 3ETJA 5DXJA 3TBFA 4A82A 5AM2A 3L01A 1RWOA 2LWIA 3FHJA 1F3LA 1WXXA 3IQGX 5DYGA 1NNI1 2O5VA 3QXJA 4JSRA 1ZHHA 3KE9A 1SB9A 4LSWA 2RHLA 4DSZA 2BIFA 3IYLW 4MJ3A 2ZI7A 4MMZB 5ARCA 5K3SA 1L5MA 4G8JA 1LPNA 2HRZA 1XLWA 3V4SA 3DKVA 5HFJA 5C8YF 4LIPD 5B36A 3K70B 3NVKI 2CFIA 2YXLA 4J0HA 4UTRA 1ORTA 3M8KA 3QSYA 4EPTA 3BXOA 5KYWA 1H8ED 4L5CA 4QUAA 1R15A 3U7HB 2WU4A 2ZI3A 3CF4A 3EASA 3IT1A 4QT0A 1NVBA 1RYBA 2OD7A 4OQFA 5WRFA 2BBOA 3JALB 4NFYA 4J7XA 4LVCA 5CB8A 2X7XA 4RSGA 5IDXA 2W2MA 4JQCA 1GD1O 5IKXA 2JFOA 3W0LB 1B1AA 2GVDC 1D6JA 1JQLB 1XD9A 2WZQA 1OKKA 1UAGA 2ECOA 3PUZA 5E4TA 1TZJA 4DVGA 3OPQA 4X3PA 2GO7A 2WV7A 4DREA 3MJVA 3OICA 4LDJA 4QPDA 1UFQA 3DTVD 2PXCA 4JI6B 4ADSG 4II3A 2LR0A 4JV5B 2GN1A 3NDBB 5DRYA 2NSDA 4QBTA 1X80A 4BKRA 3WLAA 4KRFA 2XCOA 5FHQA 5EQFA 1N0HA 3LUAA 4TWBA 4YMVA 4IBOA 1E2EA 1HQCA 4GSYA 4PNPA 4ANFA 5M2QA 1JQDA 1SEPA 1W2HA 3HDJA 4R7ZA 4TYYA 3WIDA 2CXNA 4DT1A 1B74A 1J22A 1UFVA 2C4NA 1MHTA 3AJRA 5F9FA 3O3MB 2BFCB 2HU8A 1ZCJA 3RSCA 5A4IS 2KMLA 4D26A 1NYTA 4MIEA 3B3GA 3DC7A 4OJYA 2W58A 3C8UA 3LHIA 4R4JA 1EMDA 6ABPA 5C8ZA 1D8TA 5CVDA 4EYGA 4RTMA 1K3UB 2AZ4A 3O75A 3CWQA 3W9UA 4UXJA 4RIIA 2DC1A 1DV1A 3FCOA 5H3CA 2UZ0A 4YMIA 3EZ6A 4H6VA 3SHQA 1X92A 2H57A 2PD6A 5TQJA 4F2DA 1AK1A 4JP1A 3ZBPA 3DVAB 3PNLA 5B7NA 2WD7A 2Y1WA 2ZDQA 1CYEA 1Z9BA 4QQNA 3L6UA 4E13A 4DMLA 3TEJA 1N2HA 1A2KC 3F6BX 2Q1XA 2GJ9A <