3MG9A

Teg 12 binary structure complexed with the teicoplanin aglycone
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
290
structure length
255
Chain Sequence
XXXXSMNGIRWIASYPKAGNTWVRCMLAAYITGKAPQVWNDIDAESLTLEAMLRFGDLPPAEPMEPVLVKTHLKADVPVLGLYGEATAKVLYLVRNPRDMLLSSMRMASISRDDVEKSRDFARKFIANEGLGWNGGVGLGSWPENVRSWTESSSDRFPNADVLTMRYEDLKGDPVARFSEIVEFLDLGGPVDIEDIRRAVAASTLERMRELEKRSEGRYDQSLSFLGEDIESDYQELLHGDSGFALYAKQYGYAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TEG12
publication title Crystal Structures of the Glycopeptide Sulfotransferase Teg12 in a Complex with the Teicoplanin Aglycone.
pubmed doi rcsb
source organism Uncultured soil bacterium
molecule tags Transferase/antibiotic
total genus 92
structure length 255
sequence length 290
ec nomenclature ec 2.8.2.-:
pdb deposition date 2010-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3mg9A00
3PENA 1E2LA 4LJ4A 3IEUA 4NYJR 4BFTA 5DI3B 3N5CA 4DSUA 3FWYA 3SBDA 1W4CA 2JLSA 3IILA 4FW9A 2O8BA 5BWMA 1NVUQ 5ANRB 1KDRA 4OK6A 1AN0A 1BMFD 2IT1A 2FPKA 4LYAA 4IDNA 3I72A 1G5PA 3QEJA 4M2LA 1AJEA 4AY2A 4PC2A 1FX0A 1E69A 2R6GA 1E9SA 2JEOA 4P0TA 2ZJZA 2HCJB 3BBPA 4AKGA 3IIMA 3MD0A 4O25A 2FV8A 4QBFA 4D0LB 3WBKA 2XNDD 4Q18A 5DE3A 2Q3FA 3GJ3A 3K0CA 3P32A 2OLKA 3W3AA 3BERA 3VAAA 4Z54A 2CXXA 3NBZC 3RNLA 3WXMA 4PZLA 4BLTA 1AK2A 1OB5A 1OLOA 2AHOA 3FOZA 2Q3MA 5E7JA 2AFIE 1FQJA 3GLFA 1XZPA 2EWVA 1ZC4A 2HEIA 1NL3A 4IEIA 1L4YA 2OE2A 3P27A 4DEYA 2ZRMA 1FMJA 2HCBA 4LJYA 2DR3A 1JEDA 1UADA 4LGMA 1XD8A 3NH9A 4PSAA 2W2TA 5EP4A 2OG2A 1ZYUA 3EIHA 1T5IA 2REBA 2XAUA 3RS7A 5CITA 4XJXA 1OHHA 4KODA 1JXMA 3G5UA 2V7QA 1N0VC 2CJWA 3KKNA 3QPVA 1HQYE 4TLEA 1VECA 4LV8B 1P7CA 1OIWA 4HAWA 3LV8A 5C46F 4M9ZA 4CT5A 4WXRA 2BBOA 3LWNA 2YOHA 2GK6A 1TF2A 3FKSD 4IOKA 3V4FA 2DHRA 3T15A 2H57A 3CIOA 1IY2A 1I2DA 1IBRA 4I81A 2ZJAA 3M6AA 2PX0A 4ZKEA 5KNDA 3ZD7A 4LI0A 1KI2A 5AUOB 4HDOB 5L3QA 2C9CA 4WIAA 3BFVA 4F4IA 4NBSA 5A5GA 2Z4SA 1SVLA 3CR8A 1T4GA 5FL7A 3U4QB 3AVPA 5GJWC 2NMVA 4G0NA 2XXAA 3G0HA 4TQ9A 1C4OA 1N6PA 5EUMA 4G5GA 4YDHB 4Z1MD 3TR0A 3FYHA 4B2PA 4Q03A 1KI6A 2XITA 5G53C 1ZM3A 3IKJA 4V0NA 1VPLA 2GESA 2E87A 5EJEA 4Q4AA 3OEHA 1VYVA 2I1QA 4OK5A 4ZI2A 2WKRA 2JLUA 3D8BA 2ONKA 1NN0A 3OIWA 1UEIA 1KKLA 3ECCA 5EE9A 3OZXA 4A0GA 3SHFA 3K09A 1AS2A 3EZFA 5DO9A 4M9XA 5FOVA 1N6LA 2F1JA 5FOWA 2JJ1D 2IK8A 2QNRA 4HAUA 5E4FA 3WYGA 1EFTA 1IM2A 3E1SA 2VP0A 2YVUA 4AKHA 1II9A 1JXOA 2JAQA 2QP3A 3DPUA 1GM5A 2SHKA 2WMOB 4PR0A 1LF5A 1RRGA 1HV8A 3PR1A 1GFIA 4EPVA 1MOZA 3QBTA 1OPXA 3K0AA 4LJ5A 2QE7A 1ZIOA 4AYWA 1D2EA 3CF6R 4D0NA 5L3SA 2HLDD 3W3ZB 4DT1A 4UNRA 4ZIRA 5KSOA 1D2MA 2ZI4A 3ICEA 1MO4A 2REXB 1T9HA 5D3MB 1XCPA 2BWJA 5TV2A 2WKQA 1II0A 2VP2A 3I61A 2VRWA 1DAGA 3ADCA 1ETUA 4NYMR 3WP1B 2W6JA 4V0MA 4MGZR 5JS8A 2BV3A 4M22A 4JLDA 2P2LA 2JJ2D 4I4LA 4GOJA 4RD2A 2IYVA 4AI6A 3GFTA 3VNVA 2AWNA 1GP2A 2OT3B 4JJKA 5KSPA 2VSFA 1T8TA 1Z0FA 4D4JA 2ZE6A 2ZRDA 2CVFA 2QT1A 2ZRIA 3LH5A 4XSHA 3V4RA 1BYIA 4TMTA 3D31A 4A0HA 2GBLC 4HDCA 3IO3A 2HT1A 2CLDX 2QQEA 1CR4A 1P60A 1PZNA 1SVSA 1XEXA 4JMPA 4RD6A 4WBSA 2VSOA 5TARA 2FU5C 3ZDQA 1TQ2A 3S1AA 1G4UR 1ONBA 2KWIA 4JS0A 4NYIR 1GAJA 3IIJA 3RLFA 3GLHB 2B8TA 2NPIA 3FB4A 3B82A 5FTNA 1GSIA 4HI0E 3ZQJA 3IQXA 1N5IA 3ICQB 1DG1G 4LHYA 3QKRB 3B9PA 5FPSA 2P0EA 3GJ4A 1TADA 4H1UA 1TEVA 4JLPA 4KYIB 4D4MA 4OBEA 1N6OA 3FMFA 3MJHA 3HU3A 3I32A 4ACBA 1II8A 4PSVA 1ZIPA 3OFNA 4LC1A 2A5YB 4QKQA 5CDFE 3KQKA 5KNBA 5JHHB 1KI7A 1L7VC 3BS4A 3KJHA 3AVQA 4UJ5A 3BXZA 3W5JA 1JB1A 3VR5A 4EUNA 1QVAA 1IQPA 2F9MA 1GIAA 4ILEA 1E4YA 2AD1A 4TMZA 1TQ6A 4NTZA 3TRFA 1NG1A 2ZSFA 4RKFA 2W6ID 2WJGA 3TAUA 4LX0A 4HEJA 1Y63A 2OBMA 1KMHA 1RIFA 3ND8A 3Q5DA 2EYUA 4DXAA 1JEEA 2GXAA 3WNDA 4DLTA 4D80A 3U7GA 4CVNA 2VBCA 1QBKC 3BORA 1GNRA 1P2VA 1Q1EA 4KFUA 1YR7A 4C7OA 4DLXA 521PA 3QQ5A 1D6JA 2BCJQ 3BC1A 4NPHA 3T35A 4IFBA 4IDPA 2VEDA 4M9QA 4Q47A 1S4QA 4B3BA 2G83A 2C98A 2O8EB 1XEWY 4QJ4A 1PUJA 2B7CA 1Z47A 3VX3A 2DPXA 4RFVA 3KJEA 2ZUCA 2J0UA 4HZUB 1TX4B 2HDNB 3UMFA 1R10A 4LYHA 1XPRA 3R9IA 3HWSA 4Q1AA 4Q4JB 3O8CA 5DLQC 3IDQA 3TR5A 4B75A 3RYTC 5C18A 4CT4B 1KOFA 1Z5ZA 4B76A 2UKDA 1SVOA 1GOTA 2ATXA 4OYHA 2MSEB 1VCNA 3B85A 2ONJA 3B78A 4A0FA 5J47A 3GLGA 1E9BA 3VQTA 4LSGA 1RZ3A 2JLXA 4IVQA 1I4TD 3HR7A 2CLCX 2LKCA 1RE0A 2R8RA 2G0TA 3BAFA 3QJYA 1PJRA 4F91B 2O0HA 2P5SA 5JEDA 1CXZA 2C2HA 2IUSA 3LBIA 4Q7JB 4EJSB 3QNUA 3VTKA 4HUTA 2RGDA 3CRQA 2WPDD 4FD2A 3LXXA 1NI3A 4ZV4A 1JNYA 3WYFA 5BN4A 4M1KA 4ASUD 621PA 1KJWA 3AKCA 4XVUA 2IEZA 3AKYA 4LRWA 4OJQA 2OSBA 3O8DA 4R98A 1EGAA 4X8OA 5JI3E 2NO0A 4LZZA 1GDDA 4JVSB 2W0MA 1CEEA 2OXRA 5JCPA 4IVPA 2FNAA 2NO6A 3TNFA 5CLQA 2ZANA 3BFXA 3C16C 3IHLA 3CNNA 1G8YA 1XTIA 3QOFA 4KSCA 3WP0A 5C2JB 3AKDA 1IJFA 1JR3D 1TQ4A 4AYXA 4JLAA 1W2GA 1AKEA 3IUYA 1ZNXA 2ERYA 1DO0A 3NXSA 2YWFA 4BFYA 1WF3A 3CF2A 1UAAA 4MUBA 4EPRA 1F3OA 4TSFA 1FUKA 1XXHE 1Z6GA 4XD7D 1P3JA 4IOMA 3T12A 2XSZD 1KGDA 1KYIA 2FFBA 4AK9A 1M7BA 4UNNA 3FMIA 1YRBA 4CW7A 5DHFA 1M74A 3LQQA 2YYZA 1KJZA 3B13B 4OQFA 4TL8A 1CKEA 5K8TA 2VP5A 2N42A 4AURA 1FP6A 2OFOA 2ZR9A 4UXJA 2GXUA 4MYUA 4NH0A 2LWIA 1JPNA 2PMKA 3ZJYA 2G9NA 2FSHA 3AH8A 3AKEA 4RD1A 4IHQA 4QNMA 3FMPB 4KSBA 4QL3A 4RFSA 1HTWA 5FOXA 2ANCA 3QG1A 4XOIA 4AYTA 4OI2A 5IDVA 1YZNA 4BPBA 4FMDF 4X8MA 4ITRC 1AQUA 4B71A 1VTKA 1Z6XA 1JPJA 4H1VA 4EKDA 2QP9X 5CK4A 2GILA 2NOAA 1ZRHA 2V6JA 4L8GA 1U8AA 1WE2A 4ERNA 3C14C 3H1TA 4HLDA 4EIWA 1E1RA 4PQFA 1F2UB 1OXTA 1XNJA 2ORVA 4OK3A 3TE6A 4G1UC 4YXWD 3QF7A 5LPNA 4U02A 5FTLA 1OT3A 3DVLA 4LJAA 1XU4A 2GKSA 4IRUB 4AC9A 3CRRA 3VHLB 2ZS7A 4IEEA 4CEIB 1F6BA 1KAOA 1TU3A 1ZBDA 1D2NA 1CU1A 3X1YA 1G7CA 1L2TA 3THWB 4HLCA 3LA6A 1KO7A 3R8CA 3Q7QA 4C0QC 4DDUA 1RPZA 2KE5A 3I3SR 3BWDD 2ZJOA 1N0UA 1SXJC 4NCNA 1XRJA 4OHZA 4MQBA 1CP2A 3K09C 4LJ9A 4AWXA 4KFSA 4QHTA 2ZSAA 2ZS9A 3NWJA 2PLFA 1OIXA 3I5YA 3HR8A 1P2SA 4KJZA 1NMZA 4L9SA 1OB2A 4DLYA 1OF1A 4IJMA 3CKLA 1EFHA 3TW4A 2QM8A 3NBXX 2J0VA 2KI5A 3N70A 3BB3A 1G9XA 2ZYTX 2Q0HA 3W9YA 4C0KA 4JKIA 3NDBB 1T0HB 2ZVQX 1SVMA 3SDZA 3X1ZA 821PA 3SJAA 4GP7A 3KKPA 3WY9A 3A1WA 3AVWA 4MA4A 1SGWA 1E2NA 4IKEA 5CB6A 1ZD8A 3B7GA 4A8JB 3K0FB 2IX3A 3GJ6A 5A0FA 3THXB 2XTMA 2ZRLA 3VHXA 2GNOA 2CLSA 4M1WA 5HPYB 1ZM9A 3U2QA 1MO3A 4M21A 1XPOA 1R6BX 1RKBA 3C15C 2A78A 3EPHA 1AKYA 2IXFA 3NTUA 3QKTA 4Q9LA 5D3MA 1KDOA 1G6HA 1UBCA 4FXPA 4KLNA 1VG1A 2GWHA 3ZH9B 3VKWA 3I62A 4URXR 2QMUA 3QY0A 2PJRA 1NLZA 5TXGA 2QPTA 3ADKA 3LX8A 1G41A 1G8GA 4JLVA 2Z43A 1KKMA 3U7EB 2GJKA 1MRSA 4QJ5A 3QXXA 2IS6A 4QOSA 4DCUA 4XWKA 2VHCA 4URUR 2I3BA 2J41A 1A2BA 4M1TA 1ZD1A 2BCGY 3PUYA 3PVSA 2JCSA 1DBSA 1KI9A 4Q1DA 4DDWA 4TQUS 2YHSA 1IY1A 1OH7A 3BFKA 5K8LA 1E2HA 1Z8FA 1ZM2A 3EPKA 2XTNA 4JZKA 3C5HA 3RWMB 3F5FA 3JVVA 2JIZA 3LXRA 2X8AA 4PAOA 2QAGB 4C30A 1NJFA 4K46A 1X6VA 2V4ZA 3UPUA 2IYLD 1DO2A 2Z4RA 3LW7A 4DUGA 2WSSA 4DKXA 5IK2A 3PV0A 4A92A 2QRNA 4TYQA 3I8XA 5KPJA 3G82C 3LVRE 1UFQA 3PCRB 5IT5A 4JLKA 2QENA 3W5IA 2XOKD 5FPHA 121PA 3H86A 1R0WA 2PH1A 4E5UA 3HU1A 2ODEA 3O8RA 1S8FA 2H5EA 3KDSE 4XWOA 2ORWA 5HCNA 1Z6YA 1MABB 3EAQA 4BZPA 4URZR 1X3SA 1P62B 4LOAA 3CPJB 1W4AA 1GWNA 4KAXA 2PZEA 3EWSA 1Z6AA 1XTSA 4NDZA 1R5NA 1WA5A 2R6AA 3WRXC 4RZ2A 3RRZA 1H65A 3AVYA 1OH6A 4O2RA 1E2FA 3LO5A 5HZKA 3PG5A 4QHSA 5DISB 4EFMA 5AJZA 1S1MA 2D7DA 4MDFA 5LBIA 1AGRA 1CR1A 2O8EA 1EK0A 1G17A 4NZYA 1SVWA 2CMKA 1OFUX 3EWAA 1Z22A 3OE7A 3C7KA 4HB0A 2YKGA 2GVZC 4UNSA 4Q1CA 5KPDA 3ZQ6A 4JJZA 2WJJA 2REOA 2VHJA 2NGRA 3AF3A 1G291 3CZQA 4DLRA 1H8EA 1E9DA 2CNWD 5IRCD 4Q7LA 1MO5A 1AQYA 2IYWA 4C3ZA 3EC1A 3OESA 4MRRA 4KLZA 3R8FA 1COWA 5KOYA 3CZPA 2PLRA 5DI9A 1GL6A 3KKMA 2WOJA 1ZINA 3U3MA 1A82A 1E1QD 1W0JD 2FSIA 4Q7KA 5HR5A 1ZCAA 2J1LA 4IDHA 4PC3A 2IYUA 2ZETA 2O8DB 4EJSA 2ZU6A 1JJ7A 2JDIA 3GJ7A 1F48A 1OH8A 2H8KA 3RAPR 1ZNZA 2AX4A 4FWIB 4L9WA 3T61A 1JALA 1M6NA 3I4LA 3IPYA 5A4JA 1QHGA 3AV0B 3SJZA 3A8TA 2O5VA 3Q5EA 1L8QA 3NHAA 3RRNA 4HB3A 5M04A 3AF1A 2X2FA 1HE1C 2RGGA 1UKYA 3HYTA 1X1SA 2BKUA 1J70A 4PHTA 2F6RA 1ZUHA 1US8A 2X2EA 1G8FA 1W46A 1A4RA 3CRMA 4DLZA 1ZM4A 3R9WA 1UEJA 5EZ6B 3LRPA 2O8CB 5E95A 2VHUA 1XTRA 2QP4A 4KHZA 2GCOB 2Q9AA 1Q3HA 1DVRA 5SZJA 3RS4A 1X8JA 2BIFA 2W00A 3VU9B 4DCTA 2J46A 4M1MA 4FMDB 5BXQC 4QJ3A 2O8FB 1B0UA 3GQBA 3LAWA 2IC5A 1WMSA 2ZJ5A 2VH5R 2CBZA 2DWOA 1ZCBA 3ADBA 2KB0A 1W0KA 3NBYC 5H1YA 3NEYA 4C0LA 1Z0IA 5H68A 1NBME 3EZ7A 4NKRA 3RS5A 3ONWA 3QVUA 1S0UA 2Y8EA 1NJGA 1OHHD 5EUQB 3A4LA 4BLRA 1LNZA 2V1UA 4Q9JA 4MKFA 3A4NA 3QEOA 4M53A 1KDTA 1NVVQ 4G01B 1GL9B 1QHXA 4TL6A 4TMXA 4P33A 1XWIA 3EPLA 4LHZA 3N2EA 5F9HA 3QXCA 4GDFA 3ZIAA 5L3VA 1TPZA 1YQTA 2ZRNA 3ASYA 3PUZA 1FTSA 4FN5A 1W36D 1UBFA 2MMGA 2GZAA 2YJTD 3OHMA 4G5SA 4EPWA 1LFDB 1OKKD 3BB1A 4IFEA 3RWOA 3A1VA 2FWRA 1VDZA 1QG2A 2NO7A 3TSZA 4LHXA 3JZAA 4WA7A 2FF7A 3KB1A 1E2DA 2N1BA 4JBWA 1HQCA 4TQAA 4ZPXA 1BMFA 3THWA 3LX5A 1DS6A 2ZYWX 1R5OA 4UQOA 3RSOA 2HJVA 2WWHA 2J0SA 2H92A 1IY0A 1XDBA 2AL7A 4JBXA 2A9KA 2KBEA 1G3RA 5GVRA 4CF7A 3KXIA 5HZHA 4BFWA 2ZI6A 2EQBA 3AM1A 2ZRKA 2BBSA 3IO5A 2WIBA 1FL9A 2W58A 3QIAA 4HUQB 4Q4LA 4L15A 3T5GA 4TYWA 1NN3A 5CJ2A 3UMSA 3JVUA 1N5KA 5FUVA 1Y3AA 1HE8B 3Q7PA 4NYMQ 2ZRBA 4HAYA 1XFAA 3AF2A 2GZDA 4MRVA 5FUWA 5FOUA 2OM2A 1P6XA 1YKSA 1F2TB 4JYCA 1Z06A 3EIQA 5JS7A 3W6OA 1G3MA 1NVVR 2ODBA 2OCYC 4O0MA 2CVHA 5D3QA 2WZQA 4B48A 1PUIA 2QE7D 1JQLB 3K0SA 3HPRA 1P2TA 3QXHA 4OQXA 3TVTA 3IIKA 1SXJA 2F43A 3RC3A 1ZD9A 2RGBA 2OUKA 3NVAA 2XZLA 2IS1A 3BH7A 2ZYUX 4Y0AA 4XVQA 1QG4A 3K53A 4YLGA 4NYIQ 5FBRB 1N6IA 1W4RA 2QTFA 5FH9A 2AXNA 1OW3B 3FHCB 1E2KA 4EQ6B 5TY0A 3X1XA 1TUIA 4BEBA 4FI3C 3E5HA 1E2IA 2W6JD 3RABA 1LVGA 2AK3A 2CDNA 4RJLA 2F1IA 1ZC3A 4IOLA 2ZEJA 1G7RA 1KMQA 1YU9A 3CWZA 2WHXA 4PZYA 4Q21A 3GLFE 2WWGA 5AJYA 1GL7A 4A2QA 2RB4A 2H18A 3GD7A 2Q9BA 4AD8A 3MCAA 5H8WA 2CL6X 1VG9B 3AF0A 1XD2A 1D8TA 5G40A 2B21A 3QUSA 4MRPA 4N0EA 3SE0A 4OHYA 3SYKA 1KNXA 5AUQA 3ZLJA 3TKLA 1E2QA 1LTQA 4F4CA 4TL7A 2BHRA 3ZYCA 2VHQA 5BQ5A 1G3UA 2G3YA 5F2EA 1QHNA 4M8NE 4LV5B 3SYLA 1IXRC 1E79D 5FR1A 3LNCA 4TLBA 1LW7A 1XTKA 5HKKD 4B3DA 1K8RA 3CH5A 5L8VA 4LBZA 1ZM7A 4F92B 3EZ6A 4Q19A 2FDCA 2BKEA 1NIJA 2EFEB 2V8OA 1HUQA 1VG0B 1P9NA 2QAGA 2XEXA 1XEWX 1HURA 4GPTA 3D7MA 2FFQA 3OFND 2IWHA 4F38A 2ZROA 1E9EA 2R6FA 4CRWB 4PC7A 5H70A 3K9NA 5TVKA 3FHOA 3M1IA 5GVSA 3QF4B 1ZP6A 8OHMA 2NPFA 4L16A 4JL8A 4B6EA 1KSFX 5JZVA 3TUIC 2QGNA 2BEJA 4TYNA 1U81A 2HLDA 4DWJA 2AKYA 1XCGB 1XD9A 3RHFA 4BZXA 4URYR 1QZXA 5CYOA 1CJKC 3OAAA 3DM5A 4B44A 2QN6A 2QM7A 1V43A 4HLQB 2IBMA 1VIAA 3U61B 2BMFA 3AVOA 5HCIA 3GCGA 1S9DA 3EA5A 3PQCA 4AKEA 1GG2A 2YWGA 3AVVA 5FTJA 4Q01A 2FPLA 3L2OB 2WJYA 3DKVA 4BZQA 2WMNB 2KBFA 2OCBA 1NSTA 1G5RA 4A2PA 2G0NA 1QHSA 4F7WA 5CM9C 1CRPA 2CE2X 1RYFA 2PJZA 3CNOA 4HDQB 3PXGA 1P2UA 4JSYA 4MGIR 3DMDA 2CCJA 2NO1A 2JASA 3B8HA 2ZJ2A 3TGPA 2ZRHA 3QKSB 2V6IA 2JATA 4A0RA 5KDLA 5JSZB 1P72A 4ZI3A 3VR1A 2WTUA 1NF3A 4BLPA 2A5GA 1NSFA 2IWRA 3JZMA 3KKOA 4N3NA 4ZKDA 1SVKA 3P4XA 1QHIA 1TNDA 4EJSC 1DE0A 2R44A 2DWQA 4B74A 2YOGA 5B57C 4Q48A 3C8UA 5K8IA 4OHVA 4CEHB 4U5XA 3MWKA 2VL7A 1Q12A 2KSQA 3TQFA 4V0ME 4NL4H 1Q22A 1IONA 5AK0A 2D62A 3UWOA 3GLIA 1N6KA 1RVDA 2CK3D 5BW8A 5B58C 3F3YA 3GFOA 1IXSB 2J59A 4HAVA 5KTYA 1UBEA 1N0WA 3B1VA 1OXVA 1T91A 2VHTA 2ZUBA 3IPXA 3FTQA 2WJVA 1MRNA 1Q3TA 3B1YA 3BH6A 1XMIA 1DELA 1NIPA 1OV4A 4Q4HB 2VP9A 1AGPA 4LY6A 2VLIA 2IYSA 1G16A 221PA 2ZI7A 1G64A 4FMBB 4CIDA 2AK2A 1XP8A 5LD2B 4ZO4A 2H7VA 2E9SA 2ECKA 2J0QA 3FE2A 3Q9LA 1OYWA 3I8SA 2ZSEA 4KO8A 2DBYA 2JLZA 4UNQA 3SZRA 2GCOA 5DI3A 3HJNA 1P9WA 2ZJYA 2GXQA 2ZQ5A 3LBNA 4FINA 4DLSA 2Q21A 4MITA 3LW8A 4R2HA 5KU1A 1UJ2A 4P31A 4V0OA 5JWHA 5DH9A 4P32A 1T3HA 2BVNA 2PZFA 1XEFA 2IYYA 1I2MA 3B1XA 4KV9A 3TQCA 2G1KA 5AUNB 3A1TA 1U8ZA 3U3OA 2QUZA 4JKYA 4C4PA 1Z08A 4GOKA 3K9LA 1ZJ6A 4WZAE 5JRJA 2A2ZA 1WDTA 4Q9KA 1ESNA 4X8LA 3VMFA 4MH0R 1OXSC 4IOJA 2D2EA 2C78A 3QE0A 2JLWA 2RGAA 5EXTA 3U3RA 1R8SA 4DDVA 4PQRA 5JFGA 2YC4C 1G21E 4AG5A 2P6UA 1HY3A 1XB2A 1CJUC 3WMFA 4TT3D 1E1RD 2NO9A 4JLNA 2IEYA 4MYCA 5DN6A 4P4UA 2GEDA 3FFBA 4US2R 1T0JB 1VG8A 4P3YA 1Z29A 2CL7X 3X2SA 3THYB 3RDPA 5JEEA 4TMWA 2IHBA 1R0YA 2GK7A 2ZRAA 3OEEA 4E03A 1YJ5A 1OXXK 2EYQA 3KXLA 1M34E 4JLMA 4ASUA 1QHYA 4KU4A 1MH1A 4LBYA 3PUWA 2DB3A 3SFZA 1ZNWA 1FX0B 1DAEA 3B2EA 5J4YA 3AVXA 1UKVY 1ZUNB 3DDCA 2GEVA 3P4YA 3CRW1 2V9PA 2B8WA 1OFHA 3K0EA 1E2JA 2D7CA 3E2IA 4M0LA 2QORA 4Z8YA 5HTKA 1EFRA 1JR3A 4K81B 3ADDA 3BRWD 1XF9A 4GMDA 4M1SA 3GLGE 5LB4A 4XSGA 1ZU5A 4EDHA 1F5NA 4NONA 3R20A 2IXGA 3U7HB 4QM6A 1N6NA 3GLFB 5B30A 4XD7A 4WOPA 5DHAA 1RRFA 3I92A 4DB2A 2WBLC 3KUDA 3CONA 2ZRJA 4V02A 1YZUA 1UKZA 4UJ3A 4FMCF 1CIPA 1GKYA 3NG1A 4PSKA 3MLEA 3EXAA 4KFTA 3NC0C 3VR2A 4FWTA 2ZRPA 4XTRA 2GTPA 3KXKA 1WB9A 1XCMA 2WIAA 3RS3A 2IYQA 1GTVA 4BFXA 2IYRA 2OBLA 4US0R 4BLSA 3U4QA 1V5WA 1E9AA 3T34A 4D4LA 4PHHA 1G19A 4ARZB 1GUAA 4LJ6A 3TW8B 4TZ6A 2MMCA 4I1UA 3OIUA 3ZS8A 1IN5A 1WRBA 4BFUA 4DB4A 2EVWX 2F55A 4F93B 5EE3A 1ODFA 3SQWA 4TN1A 2FG5A 4QBIA 1S3GA 421PA 4LV6A 1VCOA 3LY5A 1IHUA 4LYJA 1W36B 1WXQA 2ODNA 1GNQA 3TJZA 4FCVA 1Z3IX 4HZIA 4PTLA 5G41A 3UKDA 1G18A 1OIVA 3SU8A 5JMTA 1NNEA 3MUFA 2DYKA 1NN1A 1Q20A 2WM9B 1KIMA 3MMPA 2EFGA 5B64A 1ZU4A 5L3QB 2GEUA 4URVR 2IA5A 1Z63A 4XVRA 2IUUA 4JBYA 1OSNA 3A4MA 2F3TA 1XMSA 5DIFA 2C5LA 3RS2A 1MR3F 1GRQA 3GJ8A 1F60A 4I1OA 4LBVA 1SULA 2D3WA 3NC1C 3ZVMA 5ELXA 1GVNB 3B9QA 5HE9A 2OFXA 2VP4A 1KI6B 3MWJA 4C2TA 3R9XA 3WNBA 3KTAB 1XTQA 4Q4AB 2QAGC 1XTJA 3LBHA 4QGGA 2Z83A 5CYPA 4DCNA 2XJ4A 1FNNA 6Q21A 1AA9A 4P4SB 1EESA 2YINC 1E2GA 2GCPA 1DAKA 1YR8A 2PMDA 1E98A 3C4JA 4JVMA 1E3MA 3NHBA 3I1FA 2Z6VA 4QHYA 2WAYA 5K8UA 3TH5A 3T1VA 2WSSD 5IK2D 1CR0A 2ZJ8A 3CUEF 3A36A 2WWXA 3BOSA 4KXFB 3L0PA 3P20A 2EFCB 3RRMA 2GHIA 1LB1B 1M2OB 1ZW6A 2QROA 5FBWB 5LDDC 4D4KA 1Z83A 4YMUA 2CHGA 2JGNA 4YMWA 3GLHA 4Y0VA 3WHKA 4BLOA 5JWRA 4OHXA 3SI7A 1C1YA 2QQ0A 4KVAA 5L3SB 3CX8A 4ABYA 3DL0A 4KI0A 4BUJA 4DT1B 1EX6A 2J7PA 4AG6A 4ZIRB 5JLJA 1X8KA 2ZREA 3BD9A 3PIRA 3QKRA 1ZUIA 5J4KA 1XMJA 5TMPA 2P65A 2LKDA 4JT4A 3LD9A 2HF8A 4QG7A 2YWHA 3M4YA 1UDXA 1Z07A 2I1VB 4JVLA 4OI0A 1ANKA 2BOVA 4B3FX 1EXMA 3KQUA 1G5TA 4E09A 2UZ3A 1U2RA 3DOEA 2ASEA 3DOFA 4ACAA 2BJVA 2QRZA 1NBMD 4HAXA 5EZ5A 2BJWA 1G20E 2FA9A 4Q5IA 3T5DA 5EP2A 2DFNA 2XTZA 1HEIA 1XJCA 3NH6A 1GILA 4Q02A 5BYJA 2BMJA 2ORIA 4D2IA 1XEXB 3OE7D 4NMMA 4LPSA 2FFAA 2ZI5A 3THOA 3EG5A 3DZDA 3KJGA 2HV8A 1W4BA 4RKEA 1JJVA 1H8ED 2QTVB 3WHLA 3MFYA 3IQWA 4B6FA 3PUXA 4I1VA 1R2QA 3PUVA 1VHTA 3DKPA 2NZ8A 4BE7B 4W5HA 1FUUA 4ZDKA 1COWD 4AIIA 3WYAA 1HA3A 3BH0A 2JLQA 2TMKA 3CWQA 3IBYA 4PQYA 3SN6A 5GADl 2OV2A 5FUXA 1IOZA 1J2JA 1M7HA 3CPHA 1G6OA 4PXAA 4LDJA 4B34A 5BN5A 3DEFA 2P6RA 4JIMA 1WBBA 1OFIA 4C0BA 1E4VA 4CEHA 4B43A 1II8B 4HZUA 1SQ5A 5GJVC 1SKQA 1TL7C 4Z8XA 1KO8A 4YQFA 2JDID 5EE0A 3VKHA 2QZ4A 1YR9A 4QGHA 3V00A 4Q4JA 3BGWA 4GT1A 4YMSA 1YHNA 5AWFC 1T3SA 3BK7A 3K70C 2JLYA 2ZS8A 4DIDA 4MGYR 4MUAA 1R0ZA 2DY1A 3DM9B 3GJ5A 1XXHB 1KMHB 5J40A 2ZTSA 1VCMA 3OIVA 4HB4A 4DHEA 1KI3A 4F4JA 3SNHA 2HUPA 2VPPA 2GAAA 2K5UA 3PITA 1IXZA 2Z0MA 4DLUA 2XGJA 4RCYA 3UXMA 4Q00A 3SC3A 4B3CA 2V55B 4C7OB 1I4DD 5C1BA 4U00A 3U60B 1FNMA 1HT2E 2CL0X 1KSHA 2PT7A 1IAQA 3LVQE 2QPOA 1R4AA 2J3EA 2ZR7A 4A4DA 1LY1A 1E32A 1YZGA 2A5JA 3FDIA 4OL0A 4YDSA 1YZKA 2ZM5A 2IYTA 1T6NA 1QHHB 2W2XA 1N6HA 2AWOA 4G5QA 1OE0A 4OJKA 4B2LA 2ZSDA 5AR1A 1H8HA 4R7ZA 4A36A 1E0AA 2EW1A 3EPJA 3U6KA 2WAXA 1W0KD 1Z2CA 4YONB 2GCNA 3PEUA 4NU0A 2D74A 4QGFA 2VF7A 1N5LA 3QKUA 5TDHA 4RCZA 5KNCA 2GZHA 2OHFA 2RGXA 4B47A 3A58B 4D6PA 3NIBA 3UG7A 2JA1A 1TQDA 3W34A 1E96A 2BMDA 5C4MA 1WBDA 5KDDA 3BB4A 3ZIAD 2AKAB 2G88A 1XMVA 4MDEA 1E9RA 3A1SA 4GOXA 2J5XA 1E1QA 1KY3A 1U90A 2BM0A 3QPWA 4K8OA 1NRJB 2QG6A 4BASA 3THYA 1P73A 1PLLA 2VO1A 4OQMA 4QBHA 2QT0A 4LUCA 3TSOA 4GL2A 4QC2A 4A9AA 4LJ8A 3KQNA 1G3IA 2GF0A 2OLJA 3IBGA 3B1WA 1CJVC 2YV5A 1KO5A 3QSYA 2V7QD 3FHTA 3QXJA 1VCIA 5JJLA 3IHWA 3QG5A 2VYFA 3GFPA 2EWWA 4NHOA 4FMCB 4S35A 4DJTA 1N5JA 1Z2AA 1WCV1 1K6MA 1Q57A 2QY9A 3BE4A 4RD4A 2CCKA 4W9MC 4HLUA 2V1XA 1WQ1R 3U3KA 1G7TA 5JHGB 1OYYA 2ZAMA 1F2UA 3GEHA 4NCIA 3X1DA 3IEVA 2EU8A 4EAQA 2CCGA 3B5JA 4A6XA 1XZQA 3ZVLA 3LDAA 3GJ0A 1O87A 1BIFA 1YZQA 2AR7A 2L0XA 4PC6A 1BO6A 5KHOC 4PAQA 2RHDA 1LF0A 5CB8A 4CEIA 5BN3A 1JBKA 2N46A 2EFHB 2Q6TA 2DFTA 1CULC 2GVDC 1N3BA 3N2IA 1FOEB 1NVWQ 4YC7A 1PV4A 2DCUA 2HYIC 5FL7D 2ZITA 1MV5A 2R62A 4M1YA 2FN4A 5AJVB 4DZZA 3MGCA 1Z0DA 4DLVA 4PPGA 4FIDA 4TZ0A 3EW9A 4JL6A 2RH5A 2XNDA 4DCVA 3U44B 1G1MA 4CEJB 3PEVA 3CBQA 3OEHD 5DYGA 2QSZA 4A2WA 1KK1A 2VP6A 3AP3A 1J99A 1SXJD 4RFSB 5UKDA 4ARZA 1KK3A 4E22A 2OILA 3O47A 3VR3A 3QXSA 2FSFA 3W90A 3CW2A 4PPNA 3WMEA 4JT2A 2GXSA 1NN5A 2PEYA 4D82A 5IF9A 1E99A 4KBGA 3KFVA 4PO9A 3A37A 5E7IA 1DOAA 3M0EA 4EFNA 3I5XA 3AEZA 3W8NA 2QBYB 1AS3A 1D9ZA 1UDWA 1Q1QA 2R2AA 3L8ZA 4MKHA 4P4TA 3C41J 1RJ9B 4BECA 2OAQ1 1XPUA 1OKKA 2GJ8A 4A8JA 1FQKA 3K0FA 1YZLA 2X19A 3SR0A 4QFMA 3SJBA 2QU8A 1CBUA 4IDQA 1R8QA 5CM8B 3THXA 5EE5B 3H2YA 3LFUA 2ZRFA 1LS1A 2KJQA 3W6NA 1GNPA 2F7SA 4B2IA 3HU2A 4IXMA 2RCNA 4DEXA 2HXYA 4KFRA 4O2LA 4W5WA 2C99A 5EXPA 4CDGA 2HYDA 2O0KA 4NCKA 3HP1A 1W49A 1NKTA 4W5JA 4XIGS 3PJRA 3TUJC 1NMXA 4WW0A 4TLDA 3PEWA 1Z0AA 4PAMA 1A5TA 1U8YA 2PT5A 1EWQA 2FPMA 3FKSA 4RVCA 5J4LA 1E94E 2ANBA 4HATA 3KTAA 2GF9A 1E9FA 2FX3A 5FL3A 2BMEA 2PZGA 1JI0A 3CB4A 3ND9A 3CF0A 4QXAA 4XWAA 5CDFA 1BKDR 3REGA 2IS4A 3T06B 2W0SA 2ZJBA 4P4SA 2H1LA 4BEJA 3Q3JB 3E70C 2OESA 3GEIA 4FCTA 1CRQA 4B35A 1EFUA 3ZZUA 1E0SA 1PLJA 2JJ8A 1T8UA 4MRNA 1P4SA 4Q7MB 1S9HA 3U6BA 3V9PA 3BIFA 4TLCA 2Z5FA 3EIEA 4A6PA 5FOTA 4MKIA 3D3QA 3SS8A 1EFCA 2IYXA 4B3GA 1JAHA 2NZJA 4Z1MA 4X8HA 2HT6A 2FSGA 1VMAA 1G3QA 4PZZA 1G7SA 4BLQA 1EG7A 4RY2A 3QVVA 1HH4A 3J81k 1R5BA 2DFKB 1G8PA 4J0QA 1CJTC 1JQJC 3H84A 2GJ9A 2FGJA 4TMVA 5E3HA 5FBLB 2NQ2C 4Q1BA 2IW3A 3OAAD 4WZ6A 2JJ1A 4QGAA 5KUTA 3WRYC 5KSYA 3A6PC 3ZVRA 3Q8XB 4PANA 3TUZC 3LLMA 1GKUB 1T3LA 1IN6A 1GZSA 3SEAA 4GI7A 1KO1A 5GJCA 2ZXUA 1K5DA 3RS0A 2BM1A 2I4IA 3EARA 3OF5A 2QA5A 1Q21A 3VX4A 4M1OA 2XZPA 2ZE7A 1J8YF 1KI1A 2BDTA 5JJKA 2A30A 1X1RA 4M9SA 3CM0A 4QBGB 3X1WA 4TWZA 2VSXA 1BS1A 2CEAA 3LLUA 3CO5A 1RW4A 1AZSC 3AGPA 3GEEA 4WVFA 2AD5A 4JLOA 1G8HA 3QBVA 3UMRA 1MABA 1A2KC 1MT0A 1NMYA 2FMXA 4PPQA 4KBFA 3B6EA 2YWEA 3EC2A 3QPUA 1TU4A 3ZD6A 3NBFA 3AGQA 1DAFA 2OXCA 3PEYA 1DEKA 4MKGA 1SXJE 1E79A 4KVGA 4B73A 4H9GA 2P67A 3FKQA 5JWOA 3K9GA 4PHGA 4PFSA 5HKKA 2ZVPX 1OH5A 2PEZA 2JJ2A 5DSZA 3L0SA 3W8RA 1AZTA 2IHYA 1YZTA 3QENA 4N1AA 3UG6A 2WWFA 2RMKA 4II7A 2IL1A 3VKGA 4BRUA 721PA 1D9XA 4D25A 3L0IB 4JL5A 1QDEA 2H16A 1U9IA 3MAAC 1KNQA 2WVJA 3FVQA 5KYKA 1SZPA 2QGZA 3F0TA 1ELOA 2QMHA 4QNRA 4GRAA 1XBTA 2GJAA 5SZIA 3RANA 4W7SA 1XX6A 3SJCA 5LD2C 3TLXA 3H4MA 4KCGA 1OXUA 4EPTA 2QL6A 2QMOA 5SZHB 4DSNA 1Q1ZA 4JYBA 3GP8A 1R0XA 4Q66C 4BFZA 1NKSA 1TEXA 4MYHA 1DPFA 4D0GA 2FEOA 1XXHA 3DO6A 4DLWA 2BEKA 1E2MA 1OFTA 1O3YA 3K70D 2G77B 4BRWA 3TK1A 1NY6A 1W1WA 4HYYA 4WXPA 4NCJA 3AP1A 2PCJA 2F1HA 5HE8A 3FMOB 3KQLA 2O8DA 3K9HA 2RGCA 4D26A 3VNUA 2GA8A 4OI4A 1B23P 3RVBA 5CK5A 2ZI9A 4XH9B 1DTSA 4XTCS 4QM7A 2RGNA 4NCHA 1P61B 1TUEA 3K1JA 2C77A 5J4HA 2C9YA 3IGFA 5AUPB 4B32A 4TLAA 3CLVA 2W6IA 2UVQA 1QHHA 1WP9A 2ZR0A 4OI1A 2WWIA 1J8MF 3MG9A 3MSXA 2FH5B 3KKQA 3KQHA 3RSLA 4ZCLA 1ZNYA 3KJIA 2QTHA 4JLJA 3T1TA 1I4LD 4C0HA 2O8CA 4TSFD 1S2MA 3R7WB 1L4UA 3CX7A 1IJEA 4C0JA 1XJ0A 2ZAOA 5FUYA 2J9RA 3MWYW 3VU9A 1W48A 5SZKB 3SYNA 2ERXA 5JCZA 4ZDWA 5DN6D 2O8FA 2C8VA 3DZ8A 4S2EA 4IDOA 1IN4A 1Z0KA 3EASA 2P6NA 1U98A 1AIPA 3FFAA 4Q9IA 4JVNA 2DWPA 2MSCB 3OEED 4TTQA 2QSYA 3KX2A 2CK3A 1TTTA 5KDOA 1YRAA 1NVXQ 3UANA 3L0OA 1FMLA 3L82B 1MO6A 1GRNA 5DGXA 4HLUC 2Q3HA 3RC8A 3WBJA 1RYHA 3K0CC 2O52A 2VF8A 2ZPTX 2WKPA 4GFDA 2FEMA 2AXPA 1S96A 4G3XA 4ZDJA 1US8B 2YNMA 3UIEA 1S3SA 2YOFA 3TBKA 2GRJA 2ZRCA 4ZDIA 1EFRD 4WZBE 1JR6A 1KY2A 2WPDA 2XB4A 1E0JA 3DMNA 2O8BB 5KSZA 5G3ZA 1IN8A 2IUTA 2GETA 2ZSBA 1RRCA 2F3RA 3VR4A 1E0KA 1D5CA 2ZUDA 5JI2E 2WJHA 2XJ9A 2ZU0C 4TMKA 2OBNA 2IS2A 5FFMA 4DCSA 1CTQA 3AQ4A 1NG9A 4PC1A 3GLIE 2OO7A 1GRRA 1KI4A 1TF7A 2IF0A 3DHWC 1KSJA 1P75A 1VHLA 3MJRA 2EFDB 1P5ZB 2BC9A 3CR7A 2O0JA 3U7FB 3CRVA 1SKYE 5CJPA 2OCAA 3KFXA 3SOPA 3UK6A 4GMXA 5FI1B 1RC8A 5TB5A 4DRZA 2J45A 3C5CA 3U44A 3KB2A 3CNLA 2GAOA 3EA0A 4CEJA 5J4VA 3KZ1E 1VIYA 2FGKA 5J5CA 3SHWA 1KI8A 2NTYC 1W36C 2PBRA 2R6DA 4HUQA 4LJ7A 4UXIA 1ZAKA 2A5FA 2NIPA 4A8JC 1QRAA 5FPYA 2XSZA 2VTKA 1J7KA 1UF9A 4ZCIA 5KO2A 3AUYA 2QBYA 2V54A 4TT3A 1A1VA 3UWKA 1NLYA 2ZIAA 2PCLA 1F2TA 4PPFA 1RJ9A 4DVGA 4DDTA 2YZ2A 3A1UA 4BGDA 3EZ2A 4BQSA 5FPTA 1AS0A 1X8LA 4DIEA 4Q1FA 2QAJA 1DAIA 5FTMA 4JLBA 3B60A 3ZZ0A 4EPYA 2CJWB 5DYIA 3KUCA 4HSEA 4ON9A 4BFVA 3NKVA 4I1SA 1KZ7B 4D81A 3T1OA 5FPKA 4L4UA 2ODWA 1W47A 1X86B 2A5DA 3AP2A 4UKDA 3L43A 3Q72A 5EE1A 4DBLC 2XZOA 3U5ZB 4AKIA 1IN7A 2CHQA 2ATVA 4HAZA 4UNPA 5E7MA 1KSGA 4N0DA 1PLKA 4TL9A 1FTNA 4EQ6A 1Q0UA 4E07A 1BOFA 2NG1A 2W2VA 4OKSA 4RZUA 1DAMA 3NDPA 2ZYVX 1MKYA 5FTKA 4YMVA 4POAA 1R7RA 5B2ZA 1N6RA 4YXWA 4B3XA 1S1CA 4EFLA 4BWYA 4ESHA 2CE7A 1K5GA 1UM8A 4OQNA 2AN9A 5AJXA 1E2PA 1U0JA 1KAGA 2E1RA 4DC9A 3ETLA 1GKIA 2X77A 4RSGA 5FOSA 1E2EA 4TTPA 2B6HA 4CGZA 2HJGA 1Q44A 5CIWA 3OIYA 2QEQA 2VIIA 1VYUA 1DG3A 4LPKA 3NEJA 4LK2A 5LB2A 1U99A 3VFDA 1KDPA 2WWYA 2XXAB 2WSMA 3LQRA 5CLLA 5G3YA 4IVRA 2OCPA 1CLUA 2XNSA 3CPEA 4PX9A 4C0AC 1SXJB 2F43B 2C03A 2WOOA 4GP6A 2IYZA 2J7PD 2OFWA 3CH4B 4LC0A 2CHVA 2JIZD 4G5OA 5L3RA 1FZQA 1U94A 3WMGA 3ZGXA 5F3WB 2D2FA 2XX3A 4V0KA 4A82A 1E9CA 4US1R 1SHKA 5IHPA 4I99A 4C0SA 3ZS9A 5P21A 4DUGD 1JR3E 3CX6A 1Z0JA 3K8YA 5BYKA 1YVDA 1KZGB 3REFA 1Z6TA 4PO1A 4PO8A 5FBQB 1CR2A 4FCWA 1UBGA 2B7BA 2P5TB 2R6CA 4WAUA 4CYMA 2QPAA 3L8YA 2UZIR 1LS6A 3K0AB 3D6TB 3QF4A 1DADA 4LHWA 4GSYA 4OHWA 1XD2B 2XB2A 1W5TA 2R65A 1KJYA 4A1FA 3AVUA 1DARA 4HB2A 4B33A 2JLVA 2IF2A 2HXSA 1ZMXA 5JBQA 4IW3B 5JRZA 4LBWA 4C9BA 3QI2A 1ESMA 4O3MA 5GJBA 3W6PA 2RGEA 2BBTA 2D06A 1CS4C 1TMKA 2LCFA 1W7AA 1NP6A 2B92A 1EWRA 5EP1A 1VYTA 2WICA 4JSTA 1W2HA 1PVOA 4NE2A 2X1VA 1W5SA 5F98A 1GITA 2C95A 2FZLA 3GJXC 3P26A 2OEPA 1U9IC 4GBMA 4KYUA 1KO4A 1G4AE 1KK0A 4RD3A 1JAIA 1FP7A 3TAHA 1BYUA 1M1YE 4Q1EA 2G1JA 4R9UC 1E6CA 1RFLA 3AUXA 2BBWA 3P1JA 3WNCA 1U0HC 1HYQA 1P9RA 3TIFA 3S1AB 2DFLA 4Q9HA 4BFSA 2WV9A 4RD0A 3VR6A 5JJIA 1BH2A 1M8PA 3MWLA 5JECA 4QRHA 3QKSA 2GBLA 5JSZA 3ZZTA 1J90A 2RHMA 4U7DA 1C9KA 4Z51A 2RKOA 4TTRA 4IXNA 4LCBA 4EPXA 1N25A 1SHZA 1JECA 2FZ4A 2IXEA 5F9FA 1HT1E 2C9OA 4CZ2A 4DSOA 2RGNC 3I73A 3H0KA 2G6BA 4URWR 4TYYA 2QMEA 2YC2C 2VQSA 3FPAA 4MRSA 2HF9A 2QI9C 2GJSA 1M7GA 3SQXA 2FOLA 1ZVQA 3KL4A 2XOKA 2MSDB 1T5LA 2W83A 3Q85A 3ASZA 3U3JA 1NLFA 3EX7C 1NBMA 1CJMA 1UPTA 2ZE8A 2RAPA 4GNKA 5FR2A 2PX3A 1KHTA 5EP3A 2Q9CA 3HDTA 4C2UA 1KTVA 1NY5A 3HPQA 4NYJQ 4R2IA 4Q4HA 2D4HA 2V3CC 1H8HD 2VA8A 4GZLA 2C04A 1KK2A 2GDJA 5EQTA 5EXXA 5EXSA 1Z28A 1FW6A 2H17A 1YR6A 2J7KA 4M4SA 5AJWA 2AFHE 4GZMA 4A15A 5C4GB 3GLHE 2PL3A 2P3SA 3SBEA 3AF4A 3GPLA 5FI0B 3MRSA 1EX7A 1UKEA 2FJUA 1OJLA 4G5RA 4OQLA 1RRPA 4MYTA 4DSTA 4UXHA 3GMTA 2ZE5A 4MGKR 3R7WA 1QVRA 3SFVA 3T1QA 1FPMA 2C96A 1U0LA 1VKJA 2R9VA 3TMKA 1AM4D 4LHVA 5DNYB 2OAP1 2J0UB 2FE4A 2F1RA 2A7QA 2FFHA 3FGNA 3TVDA 4KITB 3GLIB 3AVTA 3HYRA 1Q1BA 1LV7A 3BJIC 2WJIA 2F9LA 4RZXA 4RZ3A 4LYFA 3RRYA 4YMTA 1SKYB 1YE8A 1XJQA 2ZI3A 2CNWA 2JLRA 4R71A 4TYPA 2OZEA 1A7JA 3PFIA 4NP6A 4LWZA 3GLGB 1CF4A 3ZVNA 2WWWA 3O8BA 3TSWA 3UATA 1TF5A 1TAGA 4ZCMA 5FBVB 2J87A 4PHFA 2ZRGA 3AB3A 4V0LA 2A3RA 1SVIA 1DAHA 3B1ZA 4L5BA 3K70B 4V03A 1W0JA 1N2CE 5CIQA 3EZ9A 1FFHA 3F8TA 1QF9A 1W44A 4ESVA
chains in the Genus database with same CATH superfamily
2JHPA 3H6KA 2ACWA 5BWBA 1JT2A 3GVPA 1GPDG 2DE0X 3FWYA 2QYOA 1W4CA 3DHNA 3IILA 5AICA 1ARZA 2F59A 3NASA 4XXHA 2LCIA 5AI0A 4DQXA 4X1YB 1NQOA 3CSDA 4ROTA 3ST7A 4LYAA 1BMFD 1VFNA 3TMAA 1QGED 1MQ8B 4BNHA 5JT1A 4KQMA 3I72A 2VT6A 5F64A 4M2LA 1JZQA 4QSMA 4PC2A 1NJ5A 1R18A 5CB4B 2R6GA 1E9SA 1Q3KA 2DR2A 2VFAA 3LC1O 1Q0LA 2FI1A 4KMOA 3C39A 3IIMA 2XWPA 2GZ2A 2FV8A 3DTYA 4ZPJA 2GBFA 3UBMA 4D0LB 3WBKA 1H3EA 2B1GA 1CJBA 1UZAA 5CGQB 2QZJA 3QA3E 3P9KA 3P32A 3GP5A 2X42A 2OLKA 2Z2YA 4H2DA 1BJKA 1T9ZA 3BERA 2OFFA 4Z54A 3V8VA 5KYUB 4WNAA 1RAGA 4TM8A 4DSZA 5JOQA 1WUJS 4O5AA 3WXMA 2QVGA 1TFUA 2X5KO 1LBEA 1ZMTA 5J63A 3LOQA 1EK2A 5CT4A 2J6HA 4G0QA 2EWVA 1ZC4A 4REMA 3I9JA 4D4GA 3P27A 1YZFA 3LDGA 4BGIA 3DPIA 2HCBA 4OMDA 1SB8A 2W2KB 3P9SA 3Q7IA 5DTIA 2O7QA 2Q1UA 5U9CA 1EUZA 4PSAA 2VTBA 5EP4A 4Z3OA 4HX9A 4G09A 3U26A 5CD1A 1QIMA 1ZYUA 1BDIA 3NWBA 4NDAA 1X13A 4IWYA 2XAUA 3DEIA 4OJYA 5JS2A 4Y2UA 1N3YA 4ZQFA 1XRRA 3WLAA 4G0WA 1L4HA 3HN6A 3ZI4A 1R6VA 3DXZA 2V7QA 1N0VC 2YWJA 1HQYE 1NXTA 3NAQA 3B2NA 4TN5A 3FF4A 3LT5A 4LV8B 1DBRA 3VPXA 2BN4A 3G0IA 3LV8A 4J4TA 4WECA 4B9EA 1V3QE 2JFPA 2QVYX 5ABPA 2BBOA 3ZWBA 1AXEA 1HE3A 1WSAA 3OQBA 1PFUA 1TF2A 4FFLA 1R6TA 1R27A 2DQYA 2DHRA 2NUPB 4O4JA 3UMBA 4LJSA 2H57A 3CIOA 3ESCA 3G68A 1I2DA 5EJ7A 3K6KA 3U56A 3FXAA 4KOAA 4MQEB 1F4VA 3OQNA 1BC5A 4ZKEA 4E5SA 2HWUA 1A9XA 2RIPA 1VE3A 2AN5A 3VNRA 4LI0A 3M9XA 5AUOB 1V5EA 2QRHA 1H1TA 2OGSA 3DWFA 2C9CA 3R5SA 2GYUA 2X4LA 4UZSA 1DC4A 4N9QA 4D43A 4NBSA 4NAHA 2Z4SA 5A5GA 3HSSA 2FSPA 3DB1A 1T4GA 3C6YA 3UXYA 1VGVA 3AVPA 1MX5A 1VJRA 4WN9A 4Z9FA 1VI6A 4JQZA 1C4OA 1E92A 3AHDA 2Q1SA 4KN5A 2EX0A 5BW6B 1ZM3A 3Q3IA 2DFPA 3E6AA 2I1QA 1I1QB 1KYTA 2WKRA 4QODA 3D8BA 1A8SA 3UMGA 5BT8A 1K08A 4KQ2A 1NN0A 4OQYA 2Z3VA 1UEIA 1KKLA 3D3EA 5DKFA 3FWZA 1XMOB 1LPMA 1LI7A 4GLJA 4A0GA 5JCOC 3K09A 1QAOA 1MORA 1WUIS 3H2BA 3AZOA 4M9XA 4RV5A 3M34A 3RUIA 3TN7A 4JH0A 2ZDHA 5DFAA 4TXHA 1EFTA 1EKXA 4ETWA 3BDVA 5HM8A 3DE3X 2YVUA 4AKHA 1II9A 2FQYA 1UDCA 1MB3A 1N0HA 2D5IA 1GGMA 4I4TF 2I87A 4CIXA 3BEDA 1T1IA 2SHKA 5AXCA 1LX6A 1YL7A 3V5NA 1LF5A 2OGZA 1BU8A 1RRGA 1HV8A 3PR1A 4IS3A 1GFIA 1VGRA 3PPIA 3QBTA 4NENA 3K0AA 2A1UA 2MHCA 5A6VA 2JRLA 5LMNB 2B34A 2D5BA 4D0NA 3CC8A 2VUUA 4N8SA 4F7DA 3L4BC 3LZDA 3SX2A 5KSOA 3JQCA 2HRQA 1C1DB 1D2MA 3KOXA 1HOTA 1BEEA 2FWNA 2QW8A 2NSLA 3UA4A 2REXB 1T9HA 2X76A 5D3MB 5IBQA 2BWJA 1C3EA 2WKQA 2WR8A 4RH0A 1PJLA 2IZ7A 2VRWA 3CRNA 4XWWA 1L5GB 1Y1LA 1ULSA 2W6JA 3P2JA 5JS8A 1QMPA 1YB6A 1LLUA 1UJMA 1Z25A 3KOMA 3OBIA 2DOKA 2P2LA 4JLDA 5K8JB 3TOVA 2GPBA 1UUFA 1WP4A 4NOMA 4EGAA 2AWNA 1GP2A 3KHKA 3Q2IA 2A1TS 4L8FA 2C4KA 2VSFA 4HWPA 4EB0A 3JQ8A 2OLEA 1U2EA 2ZE6A 4LYEA 1EXVA 2D59A 1JAYA 1HE4A 2O7VA 2VH1A 5TE9A 1E59A 5AESA 4DV1B 4KPYA 3MGGA 4NK4A 2RH9B 2ZYSA 5CP8A 3LA8A 4IQGA 2HT1A 1VHJA 1J24A 2CMDA 2G82A 1UEXC 3GL9A 1GN9A 2EKPA 1CR4A 2H2AA 4GX2A 4KIGA 4YRIA 4WBSA 3X1MA 4ER5A 4BLVA 2FU5C 5COBA 4PLZA 3VUFA 3ZDQA 2OYSA 2WD7B 1PZEA 3TZCA 4YPVA 5K3EA 1UBRS 2R1ZA 1N75A 2P9HA 1Z33A 5K0JA 3E7DA 2QTVA 3IIJA 3IV6A 2AQHA 3GLHB 4WBXC 5BVHB 1H4QA 3TDKA 3H2KA 2DKFA 3FB4A 3OLWA 5FO1A 3ZWVA 5DEOA 1GSIA 1TCVA 2F4NA 3IAS1 1C3VA 1PVVA 2BFNA 2Q8PA 2VT3A 4FYIA 4I9NA 1L1EA 5AK3A 4S0XA 1J5XA 5L4LA 1G5IA 2AT1A 4B6QA 3B9PA 2VSNA 2I66A 3GJ4A 4OA8A 4PTZA 4D4MA 4OFZA 2JAXA 1OXMA 3IJEB 1N7JA 3AM3A 3UUGA 1CDZA 1DC6A 1HYGA 2Y6VA 3DXYA 3HU3A 3I32A 3MIZA 3BIWA 4DBLE 5K4HA 1NQTA 3OEWA 4LC1A 3ZGVA 5CDFE 4CQNA 3H18A 4JGBA 4OATA 1UBOS 5BSUA 5LMUB 3ANTA 2GS9A 2P6PA 1WXIA 3KJHA 3RTDA 3JAWB 4PPYA 4G81A 1QVAA 1O6FA 1CFZA 1XLTC 3CVJA 4XWYA 1W52X 4Q7QA 1TVCA 1TQ6A 1E62A 1NG1A 2IXAA 4KPEC 3V97A 1UAYA 1L7OA 4F1JA 5IZCA 2C1XA 2H1RA 1RIFA 1ISJA 3HCWA 2JI6A 4K26A 1RI1A 1RLOA 2B36A 4EI2A 4HVCA 1O6ZA 5SYMA 5J58A 4DLTA 1N8NA 5BW4A 1RAIA 2BF7A 3JASA 1G21A 3P52A 1K92A 1FNDA 1MFZA 4L0DA 4ECAA 3U7GA 3JQDA 1O03A 1X70A 1YBVA 2IKSA 2VBCA 4XJTA 4C4ZA 1QH8B 3C1AA 4MVJH 4TS3A 3N6XA 3TCXB 1CZKA 2QRJA 4XDGA 1T5OA 2QT9A 5GMOA 4PN3A 2NN3C 5E8RA 2PO5A 4Q47A 1S4QA 4B3BA 2G83A 7GPBA 1FDIA 1H0KA 2C98A 5IXYA 3GLUA 1Q17A 1P9OA 3G0GA 3NALA 1PUJA 2EKQA 4IGIA 5DHPA 5T3YA 3UQYS 2O8EB 3BMCB 2DPXA 3L7LA 3CUTA 4RFVA 1E6EA 2ZUCA 3D0KA 4RBNA 2HDNB 2C0PA 4A26A 1PGQA 1H2HA 3A26A 3ZDAA 2YWCA 1U4OA 3FGPA 2IYNA 3I28A 5L53A 2QTBA 3R9IA 3HWSA 2EZ9A 4ZT6A 3OJEA 3MJCA 4NG4A 4RVUA 2X4DA 4YUVA 4HWOA 3L40A 3PD1A 3NOXA 4PBRA 3UICA 3LP6A 4GKBA 4B6PA 4C5BA 2WU3A 5GONB 5IN5A 1KOFA 1X15A 2O2EA 4B76A 2UKDA 4MUJA 5DHQA 1ZRMA 2X22A 2JAUA 2BLLA 2J09A 1VCNA 2G9VA 4J1NA 3B78A 2ONJA 2PKXA 3VQTA 4B8YA 4N5MA 4TWJA 4IVQA 1I4TD 4DG8A 3DB2A 5DYYA 3G59A 1K8ZB 4IIGA 4EY8A 3RJ5A 1COZA 4PW0A 4BB9A 4F91B 4UHDA 2PUBA 4W4TA 1CUJA 3FYUB 2G36A 1MIOA 4BDSA 4F6RA 4EY5A 4HUTA 5JZBA 1DHTA 2RGDA 3PRKE 3CRQA 4IRXA 4EA6A 3RSGA 3JWIA 3LXXA 3RBAA 4ZV4A 1I51A 1ZN8A 5BN4A 4IFTA 4M1KA 1LPPA 3CINA 4JLWA 3HYLA 1YDEA 4AT1A 1TGVA 2PWBA 2BHNA 1NVKA 1PR0A 1WXEA 2K2WA 3OZFA 3FTPA 4J1SA 4NAVA 4R2MA 4R98A 1SUPA 3CX3A 1EGAA 3K31A 2NO0A 3MK31 1M2HA 4LZZA 4QELA 5ITSA 4CUZA 3FUVA 3KQMA 1ZJ4A 2OXRA 4HPXB 1QQ6A 1SCUA 5TT1A 2QVZX 3Q0IA 4HEQA 1JHYA 1B8NA 1RPAA 5G4KB 3BFXA 4E33A 3IHLA 4IHAA 3OM8A 4KSCA 1NRWA 1XYVA 1MZVA 1IOLA 1E3JA 1DKPA 1CVIA 3GRPA 3NUZA 2H08A 5FEUA 2BGNA 1AKEA 1MBZA 1T4CB 1W6UA 4C03A 1DO0A 4HNUA 3W78A 1WF3A 1JZSA 3AFHA 5FI3A 4B1FA 2C4TA 1V37A 4EPRA 3IPLA 3KSUA 2UXBB 1C30A 1RLUA 3O2SB 1XDGA 2Y0CA 3P0IA 4O4HF 4XD7D 5INTA 3OO1A 2PH7A 1BJRE 4DLPA 1USUA 2OPBA 2XSZD 4PU0A 5DTQA 1WLYA 4JEUA 3I30X 1YRBA 2JH3A 3UT5A 3VR2D 4GGMX 4MRMA 4L57A 1M74A 1BG6A 4K0KB 4CNBA 1ZMBA 2XAAA 1BKYA 3ABQB 1KJZA 3HO8A 3KRTA 1R37A 3QY9A 1MENA 4MPTA 4OQFA 3U31A 1Z7YA 1I36A 3VH2A 2VP5A 1R74A 3KYDA 4AURA 5C32A 1T5HX 3V1MA 2GXUA 4KNWA 1YKGA 2RHGB 4MYUA 5K3BA 5PNTA 4X5OA 1A8UA 1JPNA 2PPVA 1AKWA 3V48A 4JITA 1N5OX 3AKEA 2N0SA 4QNMA 4KSBA 3CUWA 3K2QA 3QNMA 1FNBA 2FCAA 1NC1A 2IOFK 2CNOA 2E5LB 2FVXA 1PWXA 5DNAA 4IHKA 5IKPA 4PM4A 4AYTA 3HJTA 1XIVA 1YZNA 2I6XA 3GH3A 1RXIA 1PGPA 1YS1X 3MT8A 1A2OA 4L3WA 5G0SA 1A5AB 1PL6A 1ORTA 5CK4A 2V7PA 3QHAA 2YHBA 4LN1A 4N4AA 1PJQA 4GU5A 4CKBB 3GJRA 4ZTBA 3C14C 4HLDA 5IVDA 1E1RA 4PQFA 5IYZF 2GPNA 1LPAB 2AW5A 2QRKA 3WK5A 3IH5A 4OK3A 3TE6A 4G1UC 4YXWD 4ZEWA 5AKJA 5FTLA 2P8JA 3DVLA 3WG9A 4N7MA 1XU4A 1Q16A 3KSZO 3ONFA 3CRRA 4UUBA 2JIDA 5BWOA 5HA5A 2BLNA 1KAOA 1ZBDA 1CU1A 1G7CA 1L2TA 3WJAA 3O4IA 3TQOA 3LA6A 3RQSA 4C0QC 3QEAZ 1EU1A 1U7DA 3R0XA 2KE5A 3I3SR 4BKQA 3WK6A 2TSYB 4BN5A 4MI6A 4UUNA 3IP1A 3ZCPA 4TTAA 2PY6A 3B8EA 4RS4A 2Z2IA 5F73A 1E6UA 2XE8A 2EJVA 4L7QA 3AHGA 3SR3A 4LFAB 1F5SA 1YNOA 3EDRA 5AOCA 4M36A 4AWXA 4KFSA 5HQ3A 2ZSAA 2ZS9A 1O94C 3NWJA 2VBGA 4BYGA 3I8OA 3JQAD 1Y42X 1I3OA 4JJ6A 2OQIA 2QRMA 3BRWA 3LF2A 3HR4A 1O4WA 1QKJA 1IVYA 3LY8A 4KJZA 3ZBTA 1IWBB 3G8CA 2I1WA 2NZUG 2ECFA 5DYTA 4IJMA 4DLYA 3CKLA 1EFHA 3N8KA 3O6VA 4HDKB 4CU5A 2QM8A 2KI5A 5FUQA 4DR5B 2PWAA 5IASA 4BP3A 2ZVQX 4Y98A 1UBKS 2PRJA 4PGGA 821PA 1TUBB 3SJAA 1Q0RA 3P2YA 4GP7A 4X3OA 5A04A 4YREA 3E9DA 4FT4A 3TIIA 1SGWA 4KREA 2IH2A 3HLTA 2BGWA 4A8JB 1XLVA 4UASA 5GPBA 2P75A 4CI9A 3U1BA 4NU6A 1NAHA 2V65A 2V3VA 2XUQA 2ZBQA 3VO1A 2DQZA 2AEEA 2FRVA 4IMRA 4BNUA 2A1TR 2XTMA 3E5MA 4I55A 1Y5MA 3TIXB 1Y4AE 1SG6A 4IG9A 2XVAA 2P77A 1ZM9A 4DAEA 1MO3A 3ZD8A 2VNHA 3RSZA 3VGPA 2V96A 5BMVA 4F5EA 2B30A 5EMKA 4QXPA 4UFNA 2GDZA 5FAXA 4HADA 4EYEA 4F4FA 2PMFA 2NP6A 1ZDMA 2VNJA 3PC4A 3V33A 1S2NA 3GJYA 1EGMB 1PZMA 3MYYA 2WFLA 1KDOA 1XQVA 3IQZA 4GPEA 2QLNA 5AHWA 1G6HA 5C7LO 1BQ4A 1KRWA 1DV1A 1L5QA 2ZIZA 3G9XA 3H5VA 3V4VB 5JCOA 3ZWAA 4EX7A 1XZDA 4PNEA 4ZYVA 2PJRA 2ZIVB 1A4XA 5TXGA 3WWYA 4S1WA 1U0TA 9LDTA 3LX8A 2BFBB 4X7RA 1G41A 3VYWA 1WTAA 3I9LA 3IDZA 2C2BA 4DMRA 2LP4Y 5U4QA 1TCCA 2O2DA 1KPHA 5AW7A 2QS9A 2C61A 1FU4A 2I33A 3UAGA 4M60A 4XWKA 2VDKB 3KZKA 3KT3A 4URUR 3L02A 2HSEA 3LQ4A 2W2LA 2PXHA 3G1WA 4P2GA 3E3AA 1M8FA 3CE9A 2PR7A 1GQ2A 2X7JA 3BD7A 2JCSA 1DJLA 4TV9B 1AMOA 4Q1DA 2YHSA 1YL5A 2WA1A 1M8KA 1RP1A 3BFKA 5JTUA 2Z8ZA 3FWPA 1ISPA 2P9EA 3KJNA 3F5SA 5REQB 4GX1A 1OI4A 4DAOA 2LE0A 1RWQA 2O1XA 2B82A 3RWMB 4UAJA 1SA0A 1L3BA 1MVNA 3W4KA 1GNTA 5IDXA 1P4HA 2X8AA 1G8SA 2X13A 3VOAA 2JAWA 1U65A 3PGXA 4EM6A 4WJLA 4K46A 3N74A 3QLJA 1XZIA 4EI7A 1DO2A 4NWIA 4I66A 4TSKA 5EIXA 5IK2A 2NVOA 1TA9A 1LUAA 1JXAA 2QN3A 4DARA 3I8XA 4WLUA 2A6PA 3G82C 1YRLA 2PX6A 5KPJA 4NZPA 3A9TA 3QX9A 4AJ9A 4EQZA 3RS8A 4M7RA 3H86A 3RTEA 3W4JA 5B36A 1R0WA 5JXIA 5FLYA 1FP2A 3F6BX 4YJ2B 4QYWA 1GSHA 1L5MA 5TJHA 3DGEC 5TGZA 2H5EA 3B9RA 3I9KA 4Y2YA 2PSJA 4H59A 4MB0A 4QREA 2DXIA 1P62B 2Y1KA 3V8RA 3CPJB 4OVKA 2D1RA 2GN0A 4E4YA 2OBFA 5KYVA 1A2QA 4URHA 4EHNA 1XTSA 4NDZA 1ID1A 1R5NA 3C45A 1FVHA 3OFJA 3PI7A 3RRZA 2HMUA 1CQIA 3HYSA 3LO5A 3ESRA 2I2FA 4QHSA 3LUCA 4F06A 1YGYA 4G85A 5DISB 4EFMA 3UBTA 1CVLA 5JANA 1XVIA 1L5FA 5AJZA 3SMVA 5GGXA 4BLWA 1KEUA 2BKVA 3HCDA 4DA6A 4MDFA 1L4KA 4BMVA 2PV7A 4MLPA 3VKVA 1XZEA 4AUMA 4HQ0A 2Y1GA 4OA5A 1Z22A 5DW0A 1THTA 3N8DA 3C7KA 4HB0A 3SY8A 4BKUA 2GVZC 4UNSA 4Q1CA 3L7MA 3T7EA 3ZQ6A 4JJZA 2WJJA 4MR9A 5J43A 1RHUA 1TZKA 2ZB3A 3AUTA 4EY7A 4DLRA 1E9DA 1K7FB 1V2HE 1E5TA 1XEAA 5FLKA 3RCBA 3K05A 3L9XA 4B4WA 2G5PA 4FGLA 1QIHA 1E2BA 3AI7A 1DOHA 3KYCB 3DCYA 1H5NA 5A4FS 1LRJA 1MO5A 1GPWB 1AQYA 1XCBA 2IYWA 3RIXA 2X41A 3EC1A 3OZGA 4I3HA 3SEQA 2L18A 3ZCTA 3C70A 4J03A 1YQUA 2P78A 4CFYA 3R8FA 2OYCA 1HDIA 4GBGA 4A03A 1KPIA 4EB6A 2HEGA 3IAUA 4FUQA 2WOJA 5EJ9A 1BH6A 3DBLA 2VTEA 1E1QD 1YDFA 1E61A 1ZCAA 2BZSA 4M98A 2FWAA 3W4IA 5GZ6A 1MQAA 2DULA 5ALVA 4XUGB 3RF6A 3WOVA 3LT4A 3RBXA 1JEOA 3L7JA 5I9LA 5CX1A 4DIBA 3ZXSA 1JJ7A 4W9RA 1PKXA 3F3MA 4JUDX 4Q3DA 4UM5A 2AX4A 3OH8A 3W5BA 4XQ9A 5M29A 1B14A 2GGSA 1I3NA 3JAKA 4G0MA 1O95A 3AV0B 3O9VA 3M33A 5ALNA 2J48A 3SJZA 3OKPA 2HDWA 4JFAA 3AL2A 3Q5EA 4FKBA 5THKA 2CWWA 3RRNA 1BXRB 3Q1LA 1X7ZA 5ALTA 3SEZA 1JHZA 4ZQIA 2WC1A 3SKYA 1WXGA 9GPBA 3E8SA 3LS2A 3HYTA 2DUMA 4CU2A 4W5OA 1ZUHA 1MDFA 3HJHA 1US8A 4YECA 2X2EA 1N2SA 4LYYA 4XPIB 3CRMA 4C76A 1I2AA 4MVJI 5HNKA 1XNHA 4R9SA 3LRPA 5EZ6B 1PEAA 2CYCA 3AJEA 4CCYA 2MSLA 3L7YA 3GCWA 4ZN6A 1EFPB 5A4AA 4K86A 4I8DA 2OZVA 4BMXA 1DJPA 2Q9AA 2PU5A 1JFFB 4NIMA 1V5FA 5KTKA 1I2ZA 1Q3HA 1T1SA 2O2CA 3OJWA 2W00A 3VU9B 3WLSA 1BAPA 2FPSA 4DCTA 4DYDA 4UPDA 2W2PA 3P4UA 4EKIA 2O20A 1EGVB 1N1EA 1NGSA 2I4MA 2YN4A 3H1GA 5EYPA 2EBUA 3H17A 4QJ3A 5BXQC 4DR3B 2O8FB 3LAWA 2MIIA 4JB3A 4R9VA 3NGMA 2HU5A 3BX1A 1TJ4A 4HFNA 2AG5A 3PNPA 1WMFA 3DMPA 1FQWA 1SUAA 1SQFA 2ON6A 5DM1A 3RFXA 4HH0A 5CBPA 5ALDA 4RW0A 5AKXA 3A11A 5DLPA 2IHZA 1S0UA 4J1QA 4GQAA 4BX9A 4GG1A 4S04A 5FQNA 3HWX1 2V1UA 1XRMA 3A4NA 1SHUX 3H6HA 1IHYA 4M53A 3NVDA 1GGHA 4OHKA 2OA0A 2XMZA 4AIRA 5H4HA 1FSGA 1UMBB 3FYCA 3UJ7A 1GL9B 1DWPA 2IDZA 5KEIA 4N3GA 1BCSB 1GPMA 1C80A 3IEIA 3TZHA 3ZIAA 5L3VA 4O3FA 1TPZA 2I29A 1YQTA 2G80A 2VSQA 5HJEA 1T4BA 1XDZA 2TMYA 1FTSA 4B6RA 4COOA 2MMGA 2YJTD 1IG3A 3PRJA 3RUPA 3I0NA 1SELA 2Z2JA 3HQ4O 1OKKD 1EG2A 4IFEA 5CXUA 2Q4TA 3EFEA 3RWOA 3A1VA 3CHYA 2FWRA 4UHJA 2IU0A 3AY0A 2ADFA 5A9SA 2LVBA 1DUSA 3H8SA 3PEEA 1QFZA 4Z99A 4K6GA 2C9BA 4L4SA 4F1KA 1UKBA 3ZE8A 4F4HA 1ZRNA 4LHXA 4HJXA 4WA7A 2R5FA 5LDHA 1E2DA 3PHBE 1QZ3A 3A6LA 3JD4A 3T1YB 4ZPXA 1FSZA 1WU7A 3CNHA 3GAMA 2M6KA 3UMJA 1KC1A 4ZYTA 5HVNA 4O2BA 2YWDA 3BSFA 3LX5A 3F78A 3KHTA 1Q0QA 4INJA 4KLAA 3ZHXA 4G8DA 2FWBA 4E5DA 2UXDB 4DV5B 4NS4A 4ZC8A 3R7DA 2HJVA 1PL7A 4IGKA 3RSOA 3TMYA 4E7OA 3HY6A 2H92A 2XHZA 1NXPA 2A9KA 1I8TA 1NNLA 3KXIA 4BFWA 1WHTA 2YJGA 1VRCA 4WGGA 3WLJA 2EQBA 1OC2A 5B6IA 1QH0A 3B7WA 1QPZA 3AM1A 5MN6A 4ZOLA 2DHCA 1B7GO 5T57A 1GQOA 2VCEA 2W58A 2EBFX 2WIBA 5IULC 2EAUA 2HIAA 1JSXA 5JMPA 1HE8B 1TM1E 4FE3A 2A4MA 1O0SA 3SM3A 1BVYF 4HAYA 4UM9D 3QX3A 3TGLA 2A58A 2JZCA 3LUPA 1J9ZA 4I2VA 5EJ2A 2OM2A 1P6XA 4EFDA 4EUKA 1F2TB 3FTNA 4NICA 3TEJA 3ESQA 1KQPA 3I2IA 4WLVA 1G3MA 2R8BA 3A25A 4WLFA 3R74A 4FFBB 1BEUB 2OCYC 4O0MA 2Z2ZA 3IMCA 2BMWA 2CVHA 2WZQA 5J23A 2A9RA 5AJHA 1PUIA 2FR0A 5ELLA 1EUCA 1OFVA 1P2TA 1LFAA 3QXHA 2YX1A 1TA4A 3TVTA 2P91A 2F43A 3RC3A 3UW3A 2IP1A 4QUJA 1DCFA 2OUKA 4AS1A 2IS1A 3KR9A 5EIBD 3NM5A 2PD4A 2ZYUX 4KIUA 1QG4A 2P6OA 2ACKA 1KIFA 1VB5A 2EL9A 4NYIQ 5HOEA 5FH9A 3WGUA 3NHPA 1X7YA 2FPGB 1JX6A 2AXNA 2B2XA 4B81A 2F9FA 3CQ9A 3SS9X 2GLXA 4Y2PA 3ROFA 3E5RA 5CR9A 1DMSA 2HA4A 2XHEA 4YDRA 5F5LA 7ADHA 5JNLA 4G0ZA 1EDZA 2W6JD 5CUQA 3RABA 3MBKA 5DBHX 1S3IA 3WL5A 1IYZA 1P3DA 3T7SA 3L93A 3CWZA 4AP9A 2V7XA 2WHXA 3KU4A 4DR2B 3NUGA 3GLFE 3PC7A 4A2QA 1KVQA 1HEUA 1KZ1A 2H18A 2RB4A 2XTJA 4HMOA 1SO8A 3COPA 1VIDA 4BV8A 2CL6X 5J3JA 2ZB2A 1D8TA 4Z9YA 5G40A 3TLMA 5KWEA 4MRPA 1IULA 1N4DA 3AEKA 3LBFA 5B5SA 3ZLJA 2VAVA 4CLRB 1E2QA 1D2AA 1LTQA 3ZYCA 2P2YA 5LNK1 2OAEA 5BQ5A 3RRXA 2CXRA 2G3YA 5ESDA 4R81A 2AKEA 2PSEA 4O4JF 3SYLA 2LTAA 1ZD2P 2Q2OA 3TSYA 4TLBA 3ED1A 5L6LB 4NH4A 5JD3A 1AMUA 5HKKD 5BSWA 4B3DA 3C8DA 3DLPX 3KJZA 4GXNA 5L8VA 5KIAA 3G89A 2CNLA 1BXZA 3DZJA 4UVIA 2BW0A 4OFWA 4DC0A 5CFMA 3BPSA 3LX4A 3EZ6A 4Q19A 2FDCA 1DC7A 1QP7A 1YDGA 2EFEB 2PR2A 5K4GA 4JR0A 2Y0BA 5JIBA 4JI4B 1RTTA 4G1VA 3LX6A 1E4EA 1VG0B 4KAJA 4I4CA 3U7JA 3USES 2Q4OA 2XEXA 1XEWX 4RVDA 1HURA 4H35A 3D7MA 5C34B 3EAGA 1RQ2A 3MYRA 2I76A 1Y5IA 3OA0A 5JNVA 3KLBA 3NFRA 5FX2A 3SIPA 1JKJA 4R8LA 2AOTB 3MJSA 4G4SO 2PGAA 3JPWA 3E1GA 3QMMA 1ZP6A 2RAUA 2NPFA 4RX1A 3IRUA 4JWTA 3S2UA 3KZOA 2FG6C 3ZC3A 2H4HA 3PXEA 3RYFB 1QK5A 1TT5B 4LYGA 5J1TB 5LKAA 1FMFA 4GDMA 4F8EA 3IURA 5CIYA 1QVVA 4BMYA 2AIRA 1D07A 3E48A 2AKYA 5CU7A 2H2HA 2JGAA 5EIFA 1FFAA 3PGKA 4ZVLA 6NULA 1QZXA 1XTUA 4P98A 4MUFA 1L4GA 1KTIA 4B44A 5IJXA 1AKQA 4W1PA 4D3XA 1V43A 1JLLB 5IP5A 4PFQA 2KLHA 2DTXA 1SVUA 1H22A 5CLGA 3RGWS 5HCIA 3C43A 4I4NA 4AKEA 1Z6ZA 1JE1A 3EGVA 2YWGA 1KOLA 5FTJA 2B3DA 4AZ3B 1Y1TA 5K4AA 2WJYA 2EDAA 3DKVA 4MJ7A 5BNTA 1EVKA 1MC4A 1CQXA 1OXBB 1NSTA 2QTTA 3I9V1 5B53A 3T9FA 5KTTA 1XKQA 4A2PA 3GRFA 1MHPA 1A95A 3DKRA 5CM9C 3UGQA 4D45A 3WA7A 1RYFA 4HX5A 4M0KA 3CLUD 2SCUB 1HX7A 3OZCA 1NFRA 3AT1A 3B9BA 2PAAA 1P2UA 1I3LA 3ZXXA 1Y48E 1AXRA 1JHAA 2R2GA 2JATA 1R8XA 5TPWA 4A0RA 4DCGA 5A05A 2QTAA 1XMQB 3Q5GA 3BN3A 1EWYA 1NSFA 1QZTA 4DXHA 1SVKA 2R751 4AZ0B 4AQYB 4CM1A 4NQRA 3TLYA 1KXJA 1WPXA 5BXYA 2GTHA 1QHIA 3QFFA 3FYUC 1JJBA 1KR5A 1VXRA 1HDEA 3EN0A 5B2FA 3PF9A 2NYVA 3AYXB 5KC9A 1QWOA 2GD1O 1ZVKA 2BONA 3BTVA 4U5XA 1XDUA 1XA0A 2JFWA 1Q12A 4AL4A 3TQFA 3SD7A 4ZAYA 3AMVA 2JJYA 2QU7A 4W7IA 4DMUB 1Q22A 4L0MA 1QCDA 1IONA 1HLPA 4IH9A 3GLIA 2A9VA 3DVQX 5DYWA 2FXVA 4QYTA 4QA9A 4YWJA 1PCXA 3EGWA 4PFJA 3K9BA 2Q5EA 2ZWMA 4HAVA 2G76A 1UBEA 1G59A 4DPLA 2EBWA 1SB9A 1GU1A 3VPGA 2HI0A 4F4DA 1SH7A 2FR1A 4OJTA 1VIMA 3RK1A 4CDMA 1Z16A 1NKVA 4KXLA 2XBMA 2RK4A 3AWIA 4ES6A 5BSFA 1FSPA 1NIPA 2ST1A 3GB9A 1VKNA 4KGXA 3LCRA 3LK7A 2FLVA 3I9FA 2VLIA 3ZCQA 5LXTB 2ZI7A 5FNVF 4FMBB 4XYMA 1P0CA 2XMCA 3DOHA 1L4EA 4S1PA 4U3JA 3UTDA 4EY3A 3SVZA 3ZE7A 1ISSA 4RLSA 1K6XA 1PW5A 3EXEA 4R8VA 4JXZA 1U9ZA 1JNXX 1NPDA 3KOOA 1G6KA 2PIDA 3Q9LA 4RANA 2J0QA 4HV4A 1J23A 2DBYA 3DZKA 4EVQA 2AZ4A 1O8BA 4J4BA 1DXQA 2Q3BA 2IZ5A 3AI1A 2ZAYA 1A3CA 1ZEJA 1AHIA 1OZHA 2V7BA 2RBEA 3AR5A 1KPGA 3AJRA 5KU1A 4X1YA 1V6SA 1X1EA 2CC2A 3OZWA 3PVCA 5DH9A 2BVNA 1C4WA 1G5HA 1Q11A 2E4YA 3UT6A 1R15A 2HRZA 1CY0A 1Z5GA 3GLQA 3QSGA 1IZYA 3UH0A 3TQCA 2HRRA 3RRJA 3U3OA 1Y37A 4QDKA 2J6CA 1DSSG 4WZAE 4CIVA 4F5DA 1A9RA 1RJEA 4GM4A 4CQMA 4HC4A 3MB8A 4QUBA 2AW3A 1UJCA 3SKXA 5BT9A 4IXTA 4AJ4A 3E3LA 5IJ9B 5KYUA 2V45A 1LSOA 3TBFA 3O82A 4NZMA 1JMYA 2J08A 3PQDA 2RGAA 5EXTA 1HORA 2QQFA 1YUBA 2O7NA 3L8FA 1JQ3A 3GJTA 5JFGA 1E1LA 3QFHA 4NV3A 3RNOA 2OB2A 4AG5A 3H9UA 3MOGA 3U40A 4TT3D 1E1RD 4HLNA 2OXIA 4EYKA 3VKFA 5A5DA 2VT7A 1UWLA 4G8CA 4O4LB 4GKJB 3FFBA 4QPCA 4KIJA 2I2DA 1OASA 4TMWA 2P8SA 2GK7A 1OXXK 1TJYA 3FSEA 4JLMA 4ASUA 1IBKB 1NQAO 4HCJA 1SC1A 3SM9A 4GI2A 1GG9A 5M2QA 4XUDA 3MWFA 1YJ8A 3R44A 4LRTB 1MJGA 1F9AA 3B2EA 3EFOB 3WIDA 5B1DA 2Q3LA 2XNKA 3P4YA 3ZK9A 5KVAA 5AHKA 1KAMA 3ZWYA 5AI5A 1IAVA 1OFHA 1W73A 2AZMA 2XOXA 2ZVDA 1VXOA 3RV4A 3SIWA 3N5KA 3RT9A 4Z8YA 2TS1A 1EFRA 1B1AA 1JR3A 2Y67A 4GSKA 3BRWD 4ZVSA 2NUPA 1Z4MA 3PWSA 4GMDA 5HFJA 5BUSA 4P2BA 4L2IB 4I8XA 3D4BA 4Y6OA 4EGCB 4MQEA 4NONA 3R20A 1NPTO 3Q8LA 1N6NA 2P40A 5B30A 2BH9A 2O7RA 1RRFA 3OCCA 5DHAA 5B1HA 4ARCA 3IMKA 1YQQA 3T7RA 5ICFA 4DB2A 1B0AA 2WBLC 3QYFA 3KUDA 4QFDA 5FRDA 4D3SA 1IG0A 3B6ZA 2IH4A 1DX4A 4AN4A 5ENVA 4U7WA 4PSKA 4FWTA 1CLEA 2VDWA 3K1AB 3NC0C 3CEAA 3UENA 4M76B 4RV4A 1QDLB 1WB9A 5JVDB 2V03A 4BLSA 4EHLA 2IYRA 3GT4A 3BIXA 3KLPX 4DXDA 4X7BA 3GDHA 1CZNA 5JCXA 1KWGA 4D4LA 3FZGA 1FJ2A 3OZAA 4H7KA 1BCRB 4PHHA 2NPOA 3YASA 3DNPA 1EWKA 3RODA 4TZ6A 1SY7A 1WPGA 3UF0A 4EAAA 1ABFA 3BXOA 4GHWA 1W8IA 3EDCA 4IH4A 1V11B 1MA0A 3RVPA 3FGZA 4IM7A 4OLAA 2P4QA 3ZS8A 5BV1A 3QPAA 4BFUA 4CL3A 5EE3A 1ODFA 1W5FA 4W5RA 2IIBA 2Y71A 1VSUA 3G1TA 3B20A 3FROA 3QLVC 4KQ1A 5AKYA 3TQHA 1NUQA 4LYJA 3LIPA 4GI1A 5CBKA 1WXQA 3TJZA 3ZU6A 4ZVRA 1AB5A 5G41A 3PFBA 5H83A 1YI0A 3HWRA 4KQKA 3ZY4A 4ZMBA 3WWPA 3SU8A 3BWCA 5JMTA 5IZ4A 2CYBA 2XDQA 1RQPA 4PLPA 1NN1A 1Q20A 1FDTA 2WM9B 3MMPA 4G1EB 2JKYA 2I62A 4BGUA 2VUSA 3NNDA 3VAYA 2Q5HA 3PDUA 4OHRA 1KDYA 1J49A 4DR1B 2SKDA 1ZU4A 3PQEA 2FUEA 3RJTA 2VJMB 5L3QB 3EEOA 3WYCA 1YCFA 1M33A 5ALXA 4ZVNA 2BR5A 2W2LD 4XVRA 4UDOA 3RSQA 4QDOA 1C1DA 2QDKA 1VL1A 4IF6A 4R68A 4YP9A 2LCQA 3VJKA 2I65A 1F60A 2Z56A 1SULA 2OFPA 1FJGB 4GIBA 1WPQA 4ZYXA 3B9QA 1UZUA 2VP4A 1KI6B 1OUMA 3MWJA 1OWOA 1PQPA 4FS8A 3WYDA 3OBBA 2NU6B 5F7ZA 3KSRA 4Q4AB 4HQ6A 3TKYA 2BGGA 3LBHA 2XCUA 5DBEX 3CLKA 3HNPA 1YZYA 2XJ4A 3K73O 1FNNA 2YQ5A 3OQ1A 2XXJA 1KVSA 4F0JA 1QQBA 2F48A 2GCPA 2XLCA 3OOYA 3E7PA 2PMDA 4TTVA 4JVMA 1X7XB 1E3MA 2RCYA 3NHBA 4ND8A 2HJRA 4IGEA 3TRDA 3ZDXB 2ZSIA 1CK4A 3TH5A 4R69A 4ZK2A 5LYJB 1RQRA 5IK2D 2HPHA 4HGYA 2ZJ8A 3CUEF 5A0VA 3VZDA 2WWXA 2Q4EA 3ZDBA 4CR6A 3B52X 3GWGA 3P20A 5KYXB 2BUBA 2X0FA 4CQLB 3RRMA 3KZNA 4A6DA 1LB1B 1XKLA 3C6BA 1UC4B 2HO5A 1AY0A 2NT3A 2QROA 2WD7A 5FBWB 4D4KA 5HUHA 3F8SA 3GBSA 3OCXA 5LN1A 4S1VA 3TLAA 3GLHA 5D3KA 5IJ0A 2J32A 5AVQA 5JWRA 2OQ2A 2CMHA 5L3SB 2YW2A 3CX8A 1F8XA 2PJUA 2R11A 3GDGA 3O3OB 4ABYA </