3MG9A

Teg 12 binary structure complexed with the teicoplanin aglycone
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
290
structure length
255
Chain Sequence
b'XXXXSMNGIRWIASYPKAGNTWVRCMLAAYITGKAPQVWNDIDAESLTLEAMLRFGDLPPAEPMEPVLVKTHLKADVPVLGLYGEATAKVLYLVRNPRDMLLSSMRMASISRDDVEKSRDFARKFIANEGLGWNGGVGLGSWPENVRSWTESSSDRFPNADVLTMRYEDLKGDPVARFSEIVEFLDLGGPVDIEDIRRAVAASTLERMRELEKRSEGRYDQSLSFLGEDIESDYQELLHGDSGFALYAKQYGYAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TEG12
molecule tags Transferase/antibiotic
source organism Uncultured soil bacterium
publication title Crystal Structures of the Glycopeptide Sulfotransferase Teg12 in a Complex with the Teicoplanin Aglycone.
pubmed doi rcsb
total genus 92
structure length 255
sequence length 290
ec nomenclature ec 2.8.2.-:
pdb deposition date 2010-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3mg9A00
5TDHA 4TL6A 1VG0B 3R9WA 2Q3FA 1FTSA 4CGZA 4M1MA 3UXMA 1S1CA 2RKOA 4PPQA 2X8AA 3I92A 4DWJA 3LLMA 3QBVA 4KO8A 3H1TA 3B9QA 4DJTA 1ZVQA 2W0MA 1XTSA 4XWAA 4O3MA 4QM6A 2P5TB 4ILEA 2Q9AA 3F3YA 3WNCA 2DWOA 2OCYC 2FPLA 2R6FA 2VP4A 2FGKA 3BRWD 5EXXA 2WJIA 1AQYA 4GBMA 4KLNA 5JS7A 1Z2AA 1WB9A 3ASZA 1BMFD 4AG5A 4JLBA 1OXXK 4L8GA 4E07A 1XZQA 4YDSA 1XX6A 4AG6A 5JBQA 4UNNA 4OQLA 5J40A 1GNRA 2NO1A 4WAUA 4DSOA 2ORWA 2XZPA 2H17A 2ZI4A 4OK3A 2G0TA 1VDZA 3EPKA 2X19A 4KFTA 4GP6A 2VF8A 2QBYA 3WP1B 5BN4A 1CRQA 2IYWA 5BXQC 1T8UA 2C95A 3FHOA 1ZM7A 1NY6A 4PZLA 5H68A 4OBEA 1U98A 3R8CA 1P9NA 2QORA 5DSZA 1XMIA 2XTZA 1JXMA 4UNSA 1PV4A 1JR6A 1N6IA 2F7SA 3I3SR 4KJZA 4RZ3A 1W36B 2YKGA 4IRUB 4FN5A 1FMJA 3CZQA 4TSFD 4JMPA 1MRSA 4GI7A 5BYKA 3T12A 5FL3A 4IHQA 3THYA 4PHTA 3AUYA 1KJWA 2Y8EA 2JLYA 1OHHA 3UKDA 3P32A 3VFDA 3WHKA 5L3SA 3IBGA 2FOLA 3AKCA 4H1VA 4NCNA 4TQUS 1KKLA 3EPLA 1L4YA 3E5HA 3GLGE 3BB4A 1N6LA 1E69A 1XU4A 4IXMA 4K81B 2OAQ1 5CIQA 3IEUA 3VR6A 2BKUA 5L3VA 3WMGA 3SJZA 2ZSBA 1UBCA 5EZ6B 2ZETA 3UMRA 1HQYE 3CNOA 2AK2A 2ZITA 3SFVA 2B21A 3W8NA 1HT1E 3AP2A 4Q7LA 4BLSA 2JIZA 2QSZA 2QAGB 3TK1A 4NPHA 1N0VC 1N6PA 4HUQA 521PA 2KB0A 1T6NA 2A5FA 1G6OA 3A1UA 5DISB 2FZLA 1KI1A 1NLZA 3PITA 2BWJA 2J3EA 3LW7A 3NHBA 4LGMA 2JJ2A 4S2EA 3AB3A 2REXB 1SXJE 3FMFA 2W2VA 2WHXA 1Z0KA 1GL6A 1XMVA 4II7A 1YZQA 1XDBA 1XD9A 4C9BA 1P60A 3OE7D 4EDHA 1E9AA 4HB4A 4Z1MA 4KFUA 4FCVA 5JCPA 4M8NE 1E99A 2EFDB 1Z6XA 4NYIQ 3CH5A 1P9WA 4PC2A 1ZINA 1NNEA 3LWNA 3KTAA 4RJLA 1KYIA 2OFOA 3K09A 1Q1QA 2QG6A 1TU3A 1NJFA 3AF1A 3MWYW 1LTQA 1RJ9A 3ADDA 3NWJA 2RGCA 2ZJAA 1CJKC 1G1MA 2IEZA 1D9ZA 2J0UB 3EZ9A 3IPXA 4TN1A 5TARA 1XD2B 3DL0A 4QBFA 1HH4A 3LX8A 4LBYA 2OCPA 3KXLA 4Q03A 3FFAA 3OEHA 721PA 2F43B 5JMTA 1U0LA 3QKSA 4QJ4A 1UDXA 2GKSA 1P73A 5CYOA 2W2XA 4M4SA 4AYWA 1GFIA 3OFND 5DGXA 3RRNA 1RRFA 4YMWA 3V00A 4K46A 1U0HC 2PZGA 2KI5A 2IS2A 4QJ5A 3H0KA 3KFXA 1E1QD 5JJKA 1E9DA 2ORIA 3GJ8A 5KNCA 4RY2A 3U2QA 4BASA 2AWOA 4LPSA 1P72A 2J45A 1KO8A 1NMXA 1COWA 1N3BA 2D3WA 2NO6A 1XD8A 4RFSB 3V9PA 4G5GA 1KIMA 3QY0A 5FBVB 2ZR9A 5JRZA 5EUQB 3O8CA 4LJ8A 2EYQA 4Q7MB 4B2PA 3PV0A 1G17A 2PEZA 1CTQA 4F38A 2A5YB 3SNHA 4DLYA 2X2FA 3LFUA 3W3ZB 1Z83A 1S96A 1KI8A 2C8VA 4MKHA 1KDRA 2RGDA 1WBDA 2NGRA 3NBZC 4L9WA 4LYHA 1Q1BA 3O8BA 2H57A 4RZ2A 1Z22A 1KDPA 2Q9BA 5EE5B 1I4TD 1GAJA 3A4LA 3THOA 3UMSA 1JJ7A 3TMKA 2HLDA 4C0AC 4DRZA 1XPRA 2WSMA 1DO0A 4GMXA 3VU9A 4MYCA 2ZI3A 2ZQ5A 2ONKA 1T3HA 2FV8A 5CB6A 2ZYTX 3EXAA 3SYNA 4CEHB 2GEDA 2YC2C 4B43A 2I3BA 3B60A 2AN9A 1M8PA 3FMOB 5E3HA 1QG2A 1CKEA 2GCNA 2R8RA 1G3UA 1TADA 2QENA 4MRNA 5IDVA 4EIWA 3K70C 4RFSA 3RNLA 2DYKA 1E2LA 3T1TA 1IQPA 1RIFA 4GOJA 4Q4JB 5E7MA 1UEJA 1UJ2A 5SZHB 3SJBA 4C4PA 3ZQJA 2VSXA 2WIBA 1XEXB 1M74A 1QBKC 1II8A 4N0EA 5UKDA 4ZCLA 3BORA 5DHAA 3PUYA 3B78A 4WBSA 3ZJYA 4DLWA 5TB5A 4LPKA 4DEXA 5DH9A 2JIZD 3HPQA 3WMFA 1W5SA 3AQ4A 4IDNA 1MO5A 4BLPA 3IQXA 4G1UC 4LV8B 3I32A 2CLDX 4B76A 3QI2A 3VR5A 4YLGA 1NN3A 1OYWA 2J0UA 3QF7A 2H1LA 2E87A 3WXMA 1E32A 3G82C 1E2HA 3SFZA 5K8TA 4PX9A 4BFZA 1GWNA 3H84A 5TMPA 1CF4A 1PLLA 4BPBA 1AIPA 1S0UA 3DZDA 3P26A 1X1RA 4NP6A 3PJRA 3F0TA 5J4YA 1PJRA 5HKKA 3O8RA 1KHTA 1NN0A 2QRNA 3GJ0A 4ZV4A 2WJJA 4MGYR 4TTPA 4Q4HB 2VPPA 1CR1A 1OT3A 3W5JA 2PZEA 3A4NA 1MOZA 2IYSA 4DDTA 2PT5A 2ZS9A 2W6JA 3NBFA 4P4SA 3PG5A 4KHZA 4XSGA 3UK6A 4D4LA 2BEKA 5DIFA 2NOAA 2J7PD 2QT0A 2UKDA 1II9A 1LF0A 3WRXC 4A2QA 4BGDA 2IW3A 5AWFC 3GPLA 3QKUA 3JVVA 5J4LA 3RS0A 1ZM9A 5HZHA 4ZPXA 2G9NA 4ACAA 4QNRA 4JVLA 2HCJB 1G7TA 3DMNA 2FSGA 2PJRA 2HCBA 3HYRA 4RD1A 1RFLA 4M9SA 3RANA 4QJ3A 4WA7A 3VX4A 4M1SA 4ESVA 1GDDA 1G291 1E9EA 3QXHA 3FMIA 4A6PA 2CK3A 2CL7X 1FQJA 4XOIA 2OBLA 4P4SB 5HCNA 1V5WA 1QRAA 1XD2A 3KXIA 1HT2E 3M0EA 3CF6R 3BIFA 2OLKA 1JALA 1XCPA 1ZM4A 1DO2A 4C0KA 3SI7A 2W6IA 3CKLA 2BBOA 2WWHA 4D25A 3H86A 5CJ2A 1GL7A 3GJ6A 3U3KA 1KJYA 1EFUA 1KMHB 4Q1DA 1KSGA 3CPHA 2ODWA 1KI4A 1T4GA 3AUXA 1KDOA 4YQFA 4Z8XA 3SN6A 3HJNA 4NL4H 1D9XA 1O87A 4OQMA 4US1R 5E95A 3SYKA 1TQDA 4PR0A 3ZD7A 3IHLA 3HU3A 2C9YA 3TGPA 4JLPA 2BOVA 4JBWA 3NHAA 3LW8A 3D7MA 3MUFA 1CRPA 4MYUA 1OFHA 2R6DA 2H18A 2IA5A 1EFCA 4OI2A 4WZBE 2IWHA 1MKYA 4G5OA 4I81A 1W4CA 1M7BA 4X8OA 3RVBA 2P6RA 2PZFA 5JLJA 1Z6YA 1H8HD 3C41J 3VX3A 4RVCA 3BWDD 1K5DA 1L2TA 5FL7D 4Q9LA 3SE0A 3GLGA 1TX4B 2ZIAA 3MRSA 4D0NA 3THWA 1SHKA 5GVSA 1UAAA 3A1TA 2WKQA 2HJVA 1R0WA 1GSIA 1ZNYA 2GJKA 5FOSA 4QKQA 5J4HA 3OHMA 1AKYA 4KBGA 1GKUB 1HE8B 1OFIA 2O5VA 3T35A 2G77B 1FOEB 2HJGA 2GZDA 2ODNA 2W2TA 3EX7C 1FNMA 4BFTA 1OFTA 3GD7A 5FUWA 4UNRA 5EJEA 2WPDD 4PPNA 3TLXA 4CZ2A 1P2UA 3AF4A 4TL9A 1IXRC 5GJVC 1NVXQ 2OSBA 1JR3A 1S4QA 2H5EA 2WJGA 3X1DA 3OFNA 5KSOA 4LRWA 4YMVA 1VCIA 4QFMA 4IEIA 1JPJA 5A4JA 1KDTA 5JI2E 3QXSA 1E1QA 2RH5A 4FIDA 3WBJA 2DFNA 2GRJA 2AL7A 4LV6A 5EP3A 5GVRA 3S1AB 1EX6A 2IUTA 3AF3A 5FOUA 1QHSA 2IK8A 3FPAA 1TPZA 4O2RA 4A4DA 2ZAOA 1VECA 2VHCA 4ZKEA 1KY3A 3FHTA 2ZJ8A 4Q4HA 4LBVA 1XCMA 2BMJA 4G01B 2AFIE 3SC3A 1P61B 3VR2A 4D0GA 1U94A 4NBSA 1C4OA 2RGNA 2CE7A 2HDNB 1X86B 1OYYA 2YWHA 3GLHA 3K9GA 4NCKA 4DLSA 4HUTA 2R6AA 4MGKR 1DEKA 3AM1A 1FTNA 2XB4A 2WTUA 4YONB 1XTQA 4BZQA 4URUR 1KNXA 4JLVA 1NRJB 2H8KA 2CDNA 4KU4A 2O52A 3FVQA 2XEXA 5EXPA 4DLZA 2IYTA 2UZ3A 3UANA 4ESHA 3QQ5A 1GIAA 1SVSA 4ITRC 4TLBA 2YHSA 4LK2A 1C9KA 1MV5A 2ZXUA 2PEYA 2ZS7A 3X1WA 1OFUX 4A0HA 4HB2A 1XTIA 4MKFA 5FOVA 3THXA 2FFAA 4MGIR 4MQBA 5C4MA 1G18A 1TF5A 1S9DA 1X3SA 1M1YE 2ZRJA 4BLTA 1FUUA 4A36A 1QHIA 4TYNA 1MT0A 4KVGA 1TNDA 2JLWA 3R9IA 3ZH9B 4Y0VA 3P4XA 2HXSA 1QDEA 1DELA 3A1VA 1NLYA 4LI0A 3CF0A 4TL8A 4LJ7A 4DLVA 5CITA 5FUVA 2O8CA 4Q7KA 4A0RA 5FBRB 3EW9A 3OF5A 1CR0A 1DTSA 4U02A 2BBWA 1G8HA 4AKEA 5EP2A 2NPIA 2Z6VA 1JNYA 3EZ6A 4OHVA 1WE2A 4FWTA 1W36D 1DAFA 2IUSA 2AWNA 2JJ2D 4TWZA 3A6PC 1IHUA 4FCWA 3I61A 2VQSA 3GP8A 1MRNA 4LJ4A 1RJ9B 1VCNA 1W2HA 4DSUA 4NTZA 4L5BA 2BM0A 4LV5B 2V9PA 1TU4A 1ZRHA 1VYTA 2ZRPA 3CNLA 3AVVA 5BN5A 2AK3A 3LY5A 1E96A 4LC1A 2VP2A 3FB4A 2QGZA 2QQEA 1IAQA 1OPXA 2GNOA 3RC3A 1NG1A 3O47A 3GLHE 2VHTA 2E9SA 1SVLA 2ZSDA 2ZJOA 4ZI2A 2B7BA 1G5TA 2HYIC 2QTFA 1TF2A 2WV9A 2WKPA 3OIYA 1CJMA 3AGPA 1E9RA 4KLZA 5L3QA 3TW8B 4JLOA 2QA5A 5E7IA 5JSZB 4B6FA 4DHEA 1QVAA 5H8WA 1ZCAA 4EKDA 1AKEA 1E2MA 1FNNA 3U60B 1OJLA 2OXCA 2OT3B 2WBLC 1U8ZA 1JPNA 1T8TA 3I4LA 2EFCB 2RGBA 3K0FA 4YMTA 5F98A 1JR3E 2BMFA 3VR4A 2FPKA 4LJYA 1J2JA 4JLKA 3K0AA 2C9OA 5FOXA 4B44A 4HDOB 3LXXA 3BFVA 3LBIA 1E9CA 1KMQA 3OAAA 1CR4A 4LZZA 1OLOA 4OQNA 3K53A 2WWWA 2V54A 3IUYA 3X1YA 1NSFA 2GK7A 5KTYA 1OIWA 4BQSA 5IK2D 4Q9KA 3TUZC 2REBA 4CF7A 2Q9CA 5FTNA 4KVAA 2ZS8A 2OXRA 1J70A 5DE3A 4URWR 4CT5A 2OV2A 8OHMA 2FF7A 1SXJD 5JEEA 4IOJA 4ZKDA 2OUKA 4QG7A 1AZTA 3K09C 2VHJA 1MO6A 1N5KA 2A2ZA 3PENA 1CR2A 4TMTA 3W8RA 1T3LA 4B71A 4W9MC 1E94E 3EAQA 5DI3A 1Q44A 621PA 4TZ0A 4FMCF 3TW4A 2VSFA 3BK7A 1Y63A 1ZD8A 2HT6A 3T1VA 1EWQA 5TVKA 4RCYA 5KNDA 5IHPA 4YMSA 1NKSA 2JDID 2QM7A 5FPSA 1I2MA 2QZ4A 3NEJA 1NIPA 2ORVA 1D5CA 3MD0A 3U7EB 4AYXA 3T5GA 4TQAA 3A36A 2C9CA 4EPRA 5FH9A 1KK3A 1YRBA 4HAXA 4WW0A 3TE6A 3PEUA 3OEED 6Q21A 2QN6A 3RHFA 4ARZB 4PFSA 1E3MA 1Z2CA 1FQKA 2CL6X 4Q4AB 4LCBA 1NVVQ 4BEJA 2YOHA 5LD2C 5GADl 3L8ZA 1YU9A 3B8HA 5JWOA 1IJFA 4D4MA 2J0QA 4WZAE 4TTRA 2J0SA 5JEDA 5KYKA 2RGNC 4A1FA 4D81A 1A4RA 1Z8FA 2JLSA 1G20E 4WXPA 1D2NA 4QGGA 1X6VA 1WP9A 2VIIA 3KKPA 4MRSA 4HLUC 1RYFA 3C5HA 3KJIA 3AF2A 3VNUA 1J8MF 3MCAA 5FBLB 5DHFA 3GLIB 4B74A 4AWXA 4IDPA 1FX0A 1OH6A 1W44A 3W5IA 3WNDA 4TLAA 1QZXA 3KKOA 2YVUA 1LVGA 3PVSA 4KAXA 3TRFA 4Z8YA 3BBPA 1E2PA 3MJRA 2OESA 5D3MA 5L3RA 5HTKA 4U7DA 2CVHA 1A5TA 5JWHA 2ZROA 3QF4A 1P3JA 3X1XA 2GAOA 1F2TA 2DR3A 2GHIA 2ZYVX 4TLEA 3UMFA 2XJ4A 3RWOA 1HA3A 4PC6A 2ZU6A 2PL3A 3PXGA 4E09A 1Z3IX 2PT7A 1SQ5A 2CEAA 4AD8A 1DS6A 1OIXA 5JHHB 5IRCD 2F55A 1ELOA 2NZJA 3NC1C 1A1VA 4WVFA 2ZI6A 2GJAA 3EZ7A 2A3RA 5JS8A 1XJ0A 1R6BX 5EE3A 2P3SA 3KJGA 4L4UA 2XXAA 2IF0A 4GRAA 1G7SA 3DEFA 2CBZA 3RRMA 1BO6A 1WA5A 4P0TA 2QEQA 3CRMA 3LH5A 1S9HA 2ZSEA 4XWKA 3B1VA 3KDSE 2G0NA 3KUCA 3SHFA 2XJ9A 1MO3A 4NCIA 1G8GA 2XITA 1RRGA 1IBRA 2ZRAA 2Q0HA 5FUXA 2AX4A 1A82A 1NSTA 3DM9B 3OE7A 1UM8A 5B64A 4N0DA 1UADA 3KUDA 3JZMA 2ZYWX 2LWIA 3L43A 3UPUA 1YQTA 4MRRA 4GMDA 1F2UA 2NMVA 2NIPA 1UBGA 1E2QA 3DZ8A 2HF8A 5EP4A 4PZZA 3VU9B 1E4YA 5F3WB 1DAGA 3E2IA 3CX8A 2BBSA 4TYPA 2A30A 1KAGA 3F5FA 1TEXA 4F93B 1D2MA 1OB2A 1W7AA 1ZNWA 5H1YA 2PCLA 3W90A 2O8BB 2IL1A 1YR7A 3PR1A 3CLVA 5DI3B 1SVKA 1T0JB 4NZYA 2QBYB 1W4BA 3NH6A 3L0PA 4GPTA 3BB3A 3FFBA 3Q9LA 4FMBB 3WYGA 4DB2A 1QG4A 4HZUA 4LHYA 1I4LD 3DVLA 1Q12A 5F9HA 3GLIE 4C0QC 3C15C 3FTQA 1IM2A 1CJTC 3Q72A 1E2IA 4ZI3A 2QTHA 3UG7A 4LDJA 2QT1A 4OJQA 3DO6A 4TZ6A 4IFEA 3M6AA 1XEWX 1IN8A 1KI6B 1RC8A 4A9AA 4B3CA 3HU2A 1BKDR 1U8YA 4QM7A 4PQYA 4HB0A 3SBDA 2WJHA 3HDTA 5CIWA 1G64A 2GJ9A 3ND8A 3QKTA 5JCZA 4XD7D 4C7OA 5C1BA 2IYUA 5B30A 4LSGA 4Q1BA 1PZNA 1AGPA 2ZR0A 1G3QA 2DY1A 1RYHA 2QAGA 2XSZA 4M2LA 4MRVA 4O0MA 3K70D 3QBTA 3P27A 3NDPA 1W46A 1KSFX 3N2IA 3BERA 2GAAA 5IT5A 1F48A 2ZREA 1KI9A 4E5UA 1Q0UA 1M34E 2PMKA 2CVFA 4P3YA 4AKHA 2QE7A 2ZUCA 4R9UC 1FW6A 2VP9A 4UXIA 1G9XA 1KI6A 1T5IA 5KDOA 2AKYA 4OHWA 1DE0A 5GJWC 3TKLA 2ZRDA 3K9LA 3SJAA 3WRYC 2IS1A 3QVUA 4JJKA 2BCJQ 2EFEB 4PXAA 2HV8A 4Q9JA 1CJUC 3LVRE 5FI1B 1EESA 1KAOA 4AIIA 5CB8A 3LO5A 4HLQB 3MWJA 3ZIAD 3AF0A 3WBKA 1X1SA 2ZSFA 3CZPA 2PX0A 3JVUA 3V4RA 3EC2A 3NBXX 1J8YF 2XB2A 2O8EB 5J4KA 3KTAB 2IHYA 1ZUIA 1KNQA 3BH7A 2V3CC 4JLAA 4R2HA 4EFNA 2BKEA 1J7KA 4BLRA 1JAHA 4CVNA 2FSFA 3LVQE 4K8OA 4OI4A 2A5DA 2AXPA 1Z63A 2JJ1D 4JBXA 1N25A 1VG8A 1EWRA 3BFKA 4H9GA 1Y3AA 2GXUA 3WY9A 4EAQA 1CIPA 3HP1A 4RCZA 4DT1A 1VCMA 2QTVB 4IDQA 4A8JC 2PMDA 2IYRA 2AR7A 4P31A 1PLKA 4LYAA 3K9HA 4JZKA 3KJEA 4GZLA 1T9HA 4HDQB 1SZPA 4MYTA 2O8CB 3N70A 5JECA 1VCOA 1ZJ6A 2ECKA 1CS4C 1ZM2A 1Z6GA 5L8VA 1PUJA 2X77A 2ZRFA 2WJYA 3BS4A 1GRQA 2CJWB 3X2SA 4LC0A 3IIJA 2ASEA 2CNWD 3ADCA 4I4LA 2YWEA 4UQOA 1MR3F 3D31A 3GLHB 4Q1CA 2IYZA 2IYVA 4NCHA 4DCNA 1IJEA 4QBIA 3H4MA 3LX5A 1VMAA 1KSJA 3ZVRA 2QGNA 1ODFA 3EA5A 1OW3B 1HUQA 1P2TA 2WJVA 5LBIA 2O0KA 1E6CA 3A8TA 4RKEA 5AUOB 5BYJA 1IY0A 1BOFA 1DADA 2C77A 3T61A 3X1ZA 2O8BA 2AFHE 4EPYA 2WOOA 3TJZA 3D3QA 4HAYA 1KO4A 4PO8A 3RDPA 3UG6A 2L0XA 1NIJA 1P2SA 1U9IA 2V6JA 4LJ5A 4OHXA 1VTKA 3ADKA 1Z0DA 3CUEF 3CX7A 1W48A 2DFTA 2IXEA 3B13B 3QJYA 4JS0A 4RSGA 4RD4A 1FMLA 3U3MA 4A8JB 1ETUA 2BIFA 3IO5A 5G41A 5C46F 1U9IC 2RMKA 4CEIA 4B3XA 1JBKA 2NG1A 3ONWA 4P33A 1XEWY 5DNYB 1GILA 1HE1C 1DAMA 2O0HA 2QP9X 3KQNA 3MLEA 4DVGA 4PO9A 4XTCS 2PX3A 2VHUA 1JB1A 3GJ3A 4UJ5A 3U3OA 5E4FA 4JIMA 4EQ6A 3GCGA 1G5RA 2DPXA 1CP2A 2IYYA 3U6BA 1JXOA 3Q7PA 2CLCX 2WMNB 2O8DB 4ASUA 1DAHA 1ESNA 2YOGA 3T06B 1JQLB 3Q3JB 3B9PA 4FW9A 5A5GA 4B35A 4LYJA 2EWWA 2FEOA 4C30A 3PUWA 4AYTA 2REOA 4RFVA 3M4YA 3U7FB 3QEJA 4PPFA 4GDFA 4QNMA 3QEOA 2NO0A 5L3SB 2RHDA 3R9XA 3ZGXA 1GKYA 1SVMA 2WAXA 4BFUA 1VPLA 4WIAA 3PQCA 3I8XA 2EFHB 3RS2A 4E22A 5FR2A 1ZUHA 2BCGY 5EXSA 1RVDA 4IXNA 4B48A 2IXGA 2F3TA 3QNUA 5FTMA 3UIEA 4IKEA 3OIVA 1SXJB 1E2EA 2ZE8A 3WYAA 2R6GA 5AR1A 1KI7A 1G3IA 1JI0A 3BD9A 1S2MA 2ZUBA 3OESA 1YJ5A 3B1YA 4M1TA 1N6KA 3GMTA 4I1UA 2JAQA 4M21A 1AM4D 5D3MB 5J47A 5B57C 3D8BA 1R7RA 3AVWA 1JQJC 4NHOA 2Q21A 1CXZA 3KQHA 3SBEA 1S8FA 4DSNA 5JFGA 1R5BA 1AJEA 3B6EA 1ZC4A 3K70B 3CH4B 3BJIC 3TSOA 4JL5A 1Z28A 4TQ9A 2G88A 3SHWA 1YKSA 1II0A 3G5UA 4KV9A 4EPXA 1N6HA 4DUGD 1HTWA 3E70C 2ZJZA 4M9XA 1AN0A 4OJKA 5KHOC 1ZC3A 1FPMA 4D6PA 4RZXA 4URVR 2J41A 5JHGB 4I1VA 3BXZA 1MABA 4OKSA 2IBMA 4D4JA 3MWKA 3HWSA 2EYUA 3K0FB 5FOTA 3EARA 1JAIA 3IEVA 4PSKA 5EUMA 3AVYA 1XMJA 3ZVNA 4DSTA 2CHGA 1L8QA 3IO3A 3ZS8A 4JSTA 2CHVA 1ZMXA 4KITB 1P7CA 2QQ0A 4N3NA 2J7PA 1MH1A 3UATA 1RW4A 1KZGB 2BMEA 3FHCB 1JR3D 1U2RA 1K6MA 1RE0A 1Z29A 3SOPA 5HR5A 3VMFA 5KNBA 4GP7A 2GBLA 2QPTA 3QKSB 1OH5A 3SZRA 1M7HA 1E79D 3MAAC 121PA 3ASYA 3B7GA 1LF5A 3OAAD 3FKQA 1OXTA 2B8TA 2DB3A 3C4JA 2P65A 2J87A 5JWRA 3PEWA 4MYHA 1R5OA 3ZVLA 3PUVA 4C0LA 1TTTA 2OBNA 3AP1A 1XF9A 3JZAA 2NPFA 3FOZA 1YZGA 4A6XA 1M2OB 2GVDC 4E03A 2ERYA 1E2DA 1W1WA 1S3SA 1WCV1 4F4IA 4Q21A 1Q57A 2YV5A 1GNPA 1N6RA 2IYXA 3QUSA 5EQTA 2OAP1 1GRNA 2VHQA 1SGWA 4KCGA 3K0CA 4B3DA 4DIEA 1VHLA 2CJWA 3ZZ0A 1IXSB 2GCPA 4YC7A 3U44B 2MSDB 4Q7JB 4C0HA 4BZXA 2R2AA 1LS6A 2VH5R 3IGFA 1W4RA 4G3XA 2IC5A 4QHSA 4PC7A 2OFXA 1P6XA 4XWOA 4AC9A 1EX7A 4HLDA 1PVOA 4AK9A 5F9FA 3TAHA 2WSSD 2ZR7A 3IIKA 1XWIA 3HYTA 4JT2A 2P6UA 2GK6A 3LAWA 1FP6A 1W0JD 3THXB 3PCRB 1NBMA 4M1WA 4XTRA 3U44A 1D8TA 2FN4A 2VO1A 3QKRB 5FPTA 2H16A 1OB5A 2O8FB 3AVQA 2EWVA 4BRUA 1NVWQ 1Q3TA 2V7QA 3DM5A 2IS4A 3GEEA 3WMEA 1W5TA 2GBLC 3BC1A 4Q9HA 3LV8A 1E9BA 1G19A 1E2NA 1S3GA 1CLUA 2D62A 2OBMA 2LKDA 3HR7A 3OZXA 3GQBA 4W7SA 1EK0A 3EZFA 3GFOA 1UF9A 1OXVA 2QNRA 2QPOA 2NTYC 4W5WA 5CK5A 1O3YA 2OCAA 5A0FA 4LJAA 1R2QA 3AEZA 2VEDA 1KO7A 5EE0A 4GNKA 5BN3A 2CHQA 4HAZA 2R44A 1UFQA 3L2OB 1KTVA 421PA 1B0UA 4NE2A 4XH9B 1YR8A 2JJ8A 4OQXA 4BFYA 4JJZA 2QM8A 5DI9A 2HF9A 5EE9A 4C0SA 2ZE5A 5GJBA 4B2IA 2JASA 1KO1A 4NYIR 1FZQA 5KSPA 2ZJ5A 3CO5A 4NMMA 5DO9A 2JLVA 4LHVA 3T15A 2C96A 4PHHA 2LCFA 2PH1A 2B6HA 3GFTA 4WZ6A 4JVNA 4DEYA 2FG5A 1DG3A 1R10A 1AS3A 1R8SA 3RABA 1OSNA 1BMFA 2OHFA 5CDFA 2JLRA 1W36C 1IN5A 3A1SA 3OIUA 4DLUA 4NDZA 4C7OB 1UBEA 4HYYA 3CPJB 2FU5C 3EPJA 4LUCA 1P5ZB 1JEEA 2V6IA 4ARZA 2R62A 4IW3B 2QMEA 1EFRD 1XTRA 4O2LA 2A78A 4Q66C 3VTKA 1XTKA 2ATVA 4HAVA 2ZE6A 5EZ5A 4POAA 4EPTA 1DAEA 4Q48A 4EFLA 2AHOA 5AUPB 4LX0A 3BOSA 5CK4A 2D2EA 3T34A 1UBFA 4DZZA 1ZUNB 2J9RA 2V1XA 5C18A 2GTPA 4NCJA 2WVJA 2JLQA 4Q00A 1CEEA 1ZW6A 3THYB 2VP0A 2ZI5A 2XAUA 2XTNA 4ZIRB 2PLFA 4DXAA 5B2ZA 3W6OA 5HKKD 1GUAA 4JVMA 2GA8A 2FZ4A 1RRPA 1G3MA 4OYHA 4Q9IA 1G4AE 4B3FX 3WHLA 1TUIA 4IOMA 2ANBA 2P67A 3VKHA 3U7HB 3RC8A 3N2EA 4EPVA 1CJVC 2FSIA 2W6JD 4BWYA 1B23P 1ZD9A 3GJ4A 3MWLA 4C3ZA 3VR3A 4JT4A 2QAJA 5BQ5A 4ZIRA 3KZ1E 1GZSA 1J99A 1AS2A 2VBCA 1KI3A 1VHTA 2RGGA 1DAIA 1LY1A 4J0QA 4ZO4A 4JLNA 4O25A 4DKXA 4PANA 3C5CA 1VIAA 4CDGA 2ZRLA 4HAWA 2J7KA 1P4SA 3VKWA 3AVTA 1ZYUA 3TSWA 2DFKB 1NN5A 1EFRA 1UKVY 2V8OA 2D7DA 1US8B 2XTMA 5KDDA 4AKIA 3WP0A 2XNDA 1N2CE 3W34A 2CXXA 2FFBA 2GEVA 4QGFA 2O8DA 2ZRIA 3KKQA 5AJYA 1W0KA 4TLCA 4JKYA 1SKYE 2PJZA 4CIDA 3CRW1 2BV3A 2VP6A 4BFWA 4NU0A 4I99A 5SZJA 4AI6A 1SXJC 3MFYA 5SZIA 3LDAA 1X8JA 2N46A 4MITA 4GOXA 5D3QA 1C1YA 4M53A 3SQXA 1Z08A 1HV8A 2WPDA 4DLRA 3EA0A 1G7RA 1ZIOA 3NKVA 4TMZA 3QXJA 2CL0X 2ZU0C 2O8EA 4BEBA 4D2IA 1TUEA 2QP4A 3K0EA 3QF4B 4PSAA 1NKTA 4MUBA 4PHGA 1IN4A 2FMXA 4FI3C 3T1QA 4NH0A 3AKDA 1H8HA 2FX3A 4DCSA 5LD2B 1TEVA 2WMOB 4PPGA 3CM0A 5E7JA 1M7GA 4KBFA 4QC2A 3A1WA 1E0AA 1ZIPA 2G6BA 5FPKA 5FPYA 1RKBA 3OEEA 5AUQA 2ODBA 2CMKA 3NIBA 5H70A 3IILA 4TSFA 4D0LB 1G21E 2O8FA 3I5XA 3QPWA 3GLIA 1GKIA 3AGQA 1P75A 3HR8A 1YZUA 4V0ME 2VLIA 2VF7A 1LV7A 4PC1A 1U0JA 4ZDKA 2DHRA 2A9KA 3TIFA 4KYUA 3GJXC 1R8QA 2ZE7A 3IQWA 2P2LA 1ZAKA 1WMSA 4V0OA 3TAUA 4A0FA 1E1RD 5FBWB 1E0JA 1V43A 4PQRA 4UXJA 2IHBA 2DWQA 2JDIA 3P4YA 5KSZA 2WWYA 2IUUA 4V03A 3THWB 2Q6TA 4ASUD 1R5NA 3TVTA 1BYUA 4V0NA 3SYLA 4TT3A 3U4QA 1NL3A 4Q19A 3IBYA 4KI0A 1HY3A 2B7CA 4MUAA 1QHXA 3K9NA 2ZYUX 3RS4A 1Z0AA 1VKJA 4IEEA 2HXYA 4IVRA 3CNNA 2IYQA 3FGNA 3GLGB 2F1HA 2XNDD 1GITA 4G5QA 4XIGS 5C4GB 5LB2A 3W9YA 5FBQB 2JEOA 3B82A 1G5PA 5CJPA 1FP7A 1JECA 4CEIB 2NO7A 3REFA 4AURA 3TH5A 2ZRKA 5P21A 2QAGC 5FR1A 2KWIA 3OEHD 2DCUA 4FINA 1NBME 2WOJA 3L0SA 3ZLJA 2YINC 1G7CA 3KQLA 1VYVA 4X8HA 3TR0A 3M1IA 4BRWA 1N6NA 1KK1A 4EJSC 1LB1B 2X2EA 2ZRCA 821PA 4LHXA 3DKVA 3NH9A 1F2UB 2ZJ2A 1H65A 1IN7A 2FFQA 4F91B 4G0NA 1IONA 4QHYA 4U5XA 4DLXA 4G5RA 1VIYA 1HEIA 3FE2A 3AKEA 4LJ6A 4Z51A 2F9MA 2A5GA 1IY2A 1XP8A 2W6ID 2ZPTX 4BFVA 1YZKA 3CWQA 4MA4A 4P4UA 3HPRA 2W0SA 1L7VC 1X8KA 1YZLA 3U6KA 1UPTA 4F4JA 2XZOA 5HE9A 4HATA 1ZBDA 2GXQA 2N42A 4PAQA 4URXR 2I1QA 1EFTA 3I73A 1QHGA 4QOSA 2BMDA 1R4AA 4IOKA 4TTQA 1N5JA 1T3SA 2GEUA 1KO5A 4UJ3A 1U90A 3R7WB 1UKZA 3VKGA 3H2YA 2VYFA 2KJQA 1VG1A 1NLFA 4QXAA 5AJWA 3RAPR 3ZIAA 1GNQA 4Q4LA 1GOTA 2QPAA 3IIMA 1E98A 1OHHD 1CU1A 2F43A 2N1BA 3BH0A 3DHWC 1PLJA 5KDLA 4S35A 4WOPA 3AVOA 3ND9A 4JL8A 2XNSA 1OH7A 2CK3D 1MO4A 1XXHA 3LA6A 2ZRGA 1ZP6A 2PCJA 3A37A 1ZCBA 4TT3D 4TYYA 2G1JA 2WM9B 3SS8A 1XJCA 2QMUA 2C78A 4B73A 5KSYA 1DAKA 4DB4A 3LLUA 1EGAA 1XMSA 3FKSA 3U3RA 3K0SA 1N0WA 4M1OA 4CEJA 1TF7A 1W49A 1YE8A 1TMKA 3ICQB 2HLDD 4DDUA 3AV0B 5HCIA 2KSQA 1QHNA 4DCVA 3ECCA 5LPNA 1SKQA 4LY6A 4JVSB 1GRRA 4HLUA 2G83A 4NYJQ 4LHZA 1G16A 1S1MA 3NEYA 3W3AA 5JJLA 2FJUA 2ZRBA 3VHLB 3EG5A 3CW2A 2J0VA 2JATA 1LW7A 1Z6TA 4V0LA 3DPUA 2HEIA 1NBMD 1ZD1A 4M1KA 4ABYA 3WNBA 4DCTA 4Q4JA 1N0UA 2ZANA 3GJ5A 5FTLA 3IHWA 1KKMA 3KJHA 4CT4B 2ODEA 1FL9A 1Z6AA 3L0OA 1XEXA 4KXFB 2ZEJA 5FL7A 1AS0A 1TQ6A 4KSBA 5KPJA 3PIRA 4EJSA 5K8UA 1GM5A 1WQ1R 2F9LA 3CRVA 4OK6A 2D06A 3CPEA 4F4CA 1ZU5A 3BE4A 4Q4AA 5CM8B 3GLFA 5M04A 2QMHA 4NYMR 5CM9C 2C99A 1Q3HA 1G6HA 1W0KD 4QHTA 2ZVQX 3VNVA 3CIOA 2G1KA 3MJHA 3QOFA 4R98A 5HPYB 3TUJC 1WBBA 5G40A 4LJ9A 4DDWA 3MGCA 5IK2A 5DYGA 2KBEA 2C03A 4QGAA 3V4FA 3LXRA 1UDWA 2A7QA 1TQ2A 4PAMA 3PUXA 3LBNA 1SHZA 3SJCA 1WF3A 1GL9B 2I1VB 2ZRMA 4AY2A 1BS1A 4KYIB 3TSZA 1IXZA 2IT1A 2BEJA 2H7VA 1E1RA 3TBKA 4D4KA 1K8RA 1SVOA 1EFHA 1M6NA 4EFMA 2SHKA 1F5NA 4JLMA 4A2WA 4Q1FA 1ZNXA 1FFHA 2ANCA 5K8IA 4M0LA 3RSOA 3ZVMA 3KKMA 4XVQA 4R7ZA 4CW7A 2FA9A 1KGDA 1NY5A 5FTKA 3KXKA 3CR8A 1FX0B 3QE0A 4NKRA 3EIHA 4MRPA 4RD3A 1TL7C 2OLJA 1II8B 2GF9A 2MMCA 3A4MA 2J5XA 2GF0A 5JRJA 3QPVA 2A5JA 4HZIA 5KOYA 3EZ2A 3C14C 4FXPA 3R7WA 3KQKA 3PEYA 4B2LA 1KZ7B 3LBHA 1ZU4A 2VA8A 3ICEA 1NF3A 4JL6A 1OXSC 4I1SA 4QRHA 5AK0A 5TXGA 3I5YA 2ZSAA 3SR0A 4JLDA 4B33A 4A15A 3PUZA 1KK2A 4URZR 2YYZA 3AH8A 1YVDA 2BBTA 4RD0A 5TY0A 1UKYA 3ZDQA 4I1OA 1GVNB 2YNMA 2RAPA 4PZYA 5CYPA 1A2BA 4JSYA 2XX3A 4MDFA 1T91A 1I2DA 1K5GA 3C16C 3K0CC 3PEVA 5DN6D 2JLZA 2FSHA 5JZVA 2TMKA 1A2KC 3KQUA 4LBZA 2QRZA 2IYLD 3CR7A 3Q8XB 3K1JA 1TQ4A 2QY9A 2J1LA 2JLUA 2FNAA 2D7CA 2G3YA 2OILA 1XNJA 2ZTSA 1KSHA 3EWAA 3QSYA 4QL3A 4A92A 4BZPA 4DUGA 1QHHB 1Z5ZA 3ZQ6A 1R0XA 3FMPB 4PQFA 1DBSA 1UEIA 1XRJA 2EQBA 2RCNA 221PA 4MDEA 3LQQA 3WYFA 2ZJBA 4HB3A 3U7GA 1E2JA 2V1UA 1SVWA 1XB2A 4MH0R 3I62A 2P6NA 3GLFB 1P62B 3TVDA 1EXMA 3CF2A 2Q3HA 1TAGA 4OK5A 1GP2A 1F3OA 1E2GA 1D2EA 4JYBA 5KO2A 1N5IA 3EIQA 3PFIA 3K8YA 4TMWA 1UKEA 3KKNA 1WXQA 2XSZD 3BFXA 5G3ZA 4BECA 4ERNA 2WWIA 4ZDJA 2AKAB 2ONJA 1XCGB 2QP3A 2WICA 3MMPA 3QVVA 2P0EA 1KI2A 5G53C 4B75A 4CYMA 3AVXA 3P1JA 4YXWA 4H1UA 1G8PA 5EP1A 2GCOA 4ZDWA 2IF2A 3GJ7A 3CRQA 5LB4A 2VTKA 1Z06A 3DMDA 2C98A 1YHNA 4PTLA 3Q5EA 4JLJA 2ATXA 1OH8A 3ZZUA 4F7WA 2OM2A 4A82A 2UVQA 2GXAA 4DLTA 2ZM5A 2HYDA 4L16A 3LQRA 3BH6A 5EXTA 4OL0A 2XXAB 2P5SA 4GL2A 2RHMA 3C8UA 1EG7A 3NC0C 4AKGA 3GEIA 1AGRA 2CE2X 1G3RA 1YZTA 4PHFA 4CEJB 1IOZA 3NG1A 3J81k 3Q7QA 1KJZA 1HQCA 2KE5A 2OCBA 4XVUA 1ESMA 2V55B 4C0JA 5FUYA 4NYMQ 2WWFA 2PLRA 4V0MA 4B3BA 2WWXA 5DN6A 4XVRA 2MMGA 4CEHA 4R71A 1U8AA 3O8DA 5K8LA 4D26A 2QSYA 4GOKA 4LBWA 2OFWA 4UKDA 1LNZA 2JGNA 2OZEA 1QHYA 3TNFA 4EPWA 1XZPA 1NN1A 2RGAA 2YWFA 4UNPA 2CCKA 2HT1A 1DVRA 4P4TA 4TMVA 1ONBA 1F6BA 1LS1A 3Q85A 4ZDIA 1NVVR 2GWHA 4GSYA 3QXCA 3RLFA 4A2PA 1IY1A 1J90A 2C5LA 2OG2A 2V4ZA 2GZHA 2YWGA 3GEHA 3OIWA 3QIAA 5G3YA 5HZKA 2FH5B 1NG9A 1OE0A 2FEMA 4L15A 3EIEA 1G8FA 2FDCA 3MSXA 1OXUA 3U4QB 1Z47A 5C2JB 3QKRA 4W5JA 3QPUA 2KBFA 3FDIA 1L4UA 1RPZA 5CDFE 2FE4A 2V7QD 1Z0FA 4URYR 5EE1A 4Y0AA 1G4UR 2CCJA 1QF9A 3U3JA 3NBYC 1IN6A 4BLQA 2JLXA 1AA9A 3DOFA 2QL6A 4HAUA 2GXSA 4PC3A 3SQWA 5TV2A 2I4IA 1W4AA 4A0GA 1NMYA 3RS5A 3DOEA 4GT1A 1ZNZA 2VP5A 5FTJA 2IWRA 3I1FA 4DC9A 3EPHA 1HYQA 2J59A 2AD5A 2XOKD 1E9FA 1A7JA 4YXWD 3NTUA 2ZVPX 4US0R 2YJTD 4Z1MD 2GZAA 2J46A 3L0IB 3L8YA 4Q01A 4IOLA 3I72A 4Q5IA 2W83A 1PUIA 4XJXA 5KU1A 1YR6A 4EUNA 2R6CA 1P9RA 2JJ1A 3CB4A 4G5SA 4RZUA 1Q20A 1XBTA 2FGJA 2WKRA 1ANKA 3C7KA 1LFDB 2VSOA 3FWYA 4PSVA 1SXJA 2BVNA 2Z0MA 2BM1A 2GVZC 4MGZR 2VRWA 3IPYA 4KFRA 1WDTA 2MSEB 4FCTA 3CRRA 4IVPA 1YZNA 4M1YA 4PO1A 1E2FA 3KB1A 4R2IA 1JEDA 1Q1EA 3RS7A 2ZI7A 2IEYA 2WAYA 3EASA 3FYHA 5KUTA 2Z4SA 2ZUDA 4FD2A 4QBGB 4C0BA 1N5LA 4TYQA 3S1AA 1AZSC 3CWZA 1U81A 3RSLA 3RWMB 1Q22A 2BDTA 2WWGA 2Z5FA 4WXRA 1Q21A 2DFLA 4D80A 3IDQA 1GG2A 3MG9A 1OKKD 1N6OA 3QG5A 4KFSA 4M22A 1XXHE 2QE7D 2ERXA 4IFBA 5DYIA 2C04A 4HUQB 2FPMA 1NMZA 1Z0IA 2EFGA 2QU8A 2BHRA 3B85A 3QXXA 4HEJA 1MABB 2ZJYA 2F6RA 4FWIB 1XJQA 3VR1A 4BFXA 4FMCB 2X1VA 1OKKA 3P20A 4XD7A 2QROA 1NP6A 4TMXA 3F8TA 2D4HA 2YC4C 1F2TB 2RB4A 4BFSA 4TL7A 4DT1B 2NQ2C 4V02A 4Q02A 5L3QB 5IF9A 4BUJA 1W0JA 2Q3MA 3RYTC 1NI3A 3L82B 4ACBA 5AJVB 4TYWA 3ZYCA 4ZCIA 2GILA 1WRBA 4YDHB 2OE2A 3B5JA 4LHWA 2GETA 2D2FA 1DOAA 3ZD6A 2GJSA 2R9VA 1XPUA 2AXNA 1KMHA 5J4VA 4DIDA 3U5ZB 4B6EA 4B47A 1E0KA 2E1RA 3QENA 5FPHA 2F3RA 4PAOA 3AP3A 3SEAA 4JYCA 1FUKA 1DG1G 3SU8A 5SZKB 1NJGA 2CCGA 2NZ8A 3GLFE 3VQTA 4MKGA 5HE8A 3K0AB 4EJSB 1KOFA 2PBRA 4HSEA 3IKJA 1E2KA 1OF1A 2AD1A 3D6TB 1Z07A 3DKPA 3QG1A 3T5DA 1G41A 1Z0JA 4NONA 1E0SA 4P32A 2F1JA 1ZM3A 2F1IA 2Z4RA 1YRAA 3B1ZA 4MKIA 5AJXA 5KPDA 5JJIA 3KX2A 2XZLA 1XEFA 5J5CA 3EC1A 4HLCA 2XGJA 1R0ZA 4OQFA 4OHZA 3SDZA 4HI0E 4UXHA 4C2TA 1R0YA 2QMOA 4JKIA 4UNQA 3LRPA 2UZIR 4GFDA 1RRCA 1KY2A 3CONA 4EQ6B 4QGHA 3VHXA 2BJWA 4V0KA 4C2UA 4LWZA 4RKFA 4IVQA 2B8WA 2EVWX 4KODA 2R65A 1KK0A 3NVAA 2GJ8A 3T1OA 3AKYA 2VL7A 2C2HA 1YR9A 1U99A 1D6JA 4OI1A 1H8EA 3AVPA 2QUZA 4HZUB 4TMKA 3Q5DA 1VG9B 4RD2A 2ZI9A 4YMUA 1BIFA 4F92B 1XXHB 3BGWA 3B1XA 1SVIA 4Q1EA 5B58C 4U00A 2ZRNA 5DLQC 1JJVA 1BYIA 5FFMA 3KB2A 2K5UA 4TLDA 4X8LA 4M9ZA 4DCUA 2LKCA 4M9QA 3G0HA 3E1SA 2O0JA 3RRZA 1QHHA 4D82A 4B3GA 2OEPA 3I8SA 3RRYA 4Q47A 2IX3A 1W2GA 2EU8A 4NYJR 3AVUA 2WZQA 4B34A 4LOAA 1X8LA 2DBYA 2OO7A 1NVUQ 3R20A 1CBUA 5BWMA 2NO9A 3UWKA 3FKSD 5JI3E 2HUPA 3GFPA 4QBHA 3ZS9A 3B1WA 4Z54A 3TQFA 4L9SA 1I4DD 5GJCA 3ZZTA 2F1RA 4HDCA 4OHYA 4ON9A 2W58A 2H92A 1COWD 3TUIC 1Q1ZA 1F60A 2IXFA 3HU1A 2XOKA 5ANRB 2ZAMA 1P2VA 3KL4A 1E9SA 2GCOB 1SKYB 1GTVA 4FMDF 4BLOA 2FFHA 1HURA 4B32A 3U61B 4OI0A 2JCSA 4X8MA 1RZ3A 5JSZA 2ZRHA 1AK2A 2CLSA 3EWSA 4LYFA 5F2EA 3REGA 5ELXA 3A58B 3KFVA 2Z83A 1DPFA 1XTJA 1US8A 4JBYA 1W47A 2BJVA 4Q1AA 2WIAA 5BW8A 1VYUA 2B92A 1BH2A 1G8YA 2Z43A 2D74A 3NXSA 3CBQA 4DDVA 2DWPA 1AQUA 3TQCA 3R8FA 3DDCA 4US2R 4KSCA 3W6NA 3RS3A 4IDHA 1CULC 3W6PA 1XPOA 3VAAA 2IS6A 3N5CA 5FOWA 1E4VA 2EW1A 2GDJA 2FWRA 4DBLC 2GESA 1QVRA 4A8JA 1H8ED 2W00A 1OIVA 1E79A 4RD6A 2YOFA 4Q18A 5CLQA 3TR5A 5LDDC 3LNCA 1SULA 2CNWA 2QI9C 1XFAA 4IDOA 1T0HB 4IJMA 1OV4A 2RGXA 4W5HA 3CX6A 2MSCB 3ETLA 3UWOA 2JA1A 4GZMA 4N1AA 3BB1A 1DARA 4ZCMA 2BC9A 4FMDB 2YZ2A 5FI0B 5AJZA 3LD9A 3ADBA 4XSHA 5CLLA 3NDBB 2RGEA 4CRWB 4BE7B 5AUNB 1T5LA 3B2EA 3BAFA 2WSSA
chains in the Genus database with same CATH superfamily
4UARA 2AN1A 5FO1A 3C0KA 4G4IA 3C8MA 1JFTA 4BGIA 4KMOA 4M1MA 4BV9A 3T3NA 4ZMSA 4FGJA 5ISMA 3KDAA 3QBVA 1MZVA 3H1TA 4YAWA 4A27A 2WLTA 4L5AA 3ET4A 1XTSA 3CF4G 4GC5A 2FPPA 2P5TB 5JANA 4O3MA 1XKTA 4Y9RA 4QM6A 3F3YA 4NLLA 3WNCA 1SBHA 2EAUA 3W77A 5B1EA 1M5UA 1IJKA 2FGKA 4HQ6A 5I3CA 2PL1A 4DMMA 4DIBA 4KLNA 5JS7A 5JR3A 1P7PA 5JARA 2HNKA 3EYAA 3RJ5A 3ROMA 3VGJA 1PJAA 3BE6A 2EJBA 3VOBA 1CJCA 4L8GA 3ED1A 5FO0A 1T6ZA 4YDSA 3OHSX 4OKNA 1D4ZA 4F4FA 4N6NA 3CCBA 5JBQA 3KKZA 4UFOA 3RT9A 3HKEA 4ENRA 1NT2A 1TPYA 3E3MA 4ZJUA 2ZB7A 5IW8A 5ALLA 3LBFA 2B2NA 1Y80A 3O83A 2VWPA 5G0SA 4E6EA 4PNEA 3R3SA 4IM7A 3W5DA 3EPKA 4KPYA 2VF8A 1CW2B 1RC0A 2IYWA 5BXQC 4BV3A 1T8UA 3X3HA 1B2RA 4Z9YA 2GPJA 1U98A 2JNWA 3TI7A 3V1YA 1P9NA 2RC6A 1ZAYA 2QORA 5AVTA 3BKXA 2CSUA 2I29A 5DSZA 2XTZA 2W4QA 3TFQA 5BWBA 1MFZA 4BNYA 3PNYA 1PV4A 2YMMA 1M6EX 4UMDA 3GK3A 4W5TA 3UHOA 1IULA 4LXQA 5F1KA 2AQ8A 3ON5A 4FOTA 4JJEA 5FL3A 3T12A 5LYJB 2PWBA 1L4FA 1GPLA 1KJWA 1FYXA 2GKGA 3P32A 5TMBA 4BMOB 2R6JA 4UU0A 3U4AA 5I51A 1ZK2A 2FOLA 2FEAA 3MTGA 4ZA2A 1Z5OA 1KKLA 4FOPA 5CCBA 4PAGA 2PK3A 1Q7BA 1BHSA 4WKNA 2XLBA 3NDIA 1L4YA 3E5HA 3GLGE 3BB4A 3VAZA 3IVXA 1DDGA 2VJMB 2ZWAA 1CUHA 3C2QA 1XU4A 1GZHB 4K81B 2O7VA 5H82A 5CIQA 4ZRMA 3VRHA 2I7DA 5L3VA 4HJXA 3SJZA 3OJXA 3UMRA 2AS0A 2W6NA 3FSGA 3INYA 3G1TA 3NYQA 3AP2A 4MKZA 3SFVA 4ZTUB 3M82A 2JIZA 3EAFA 2QAGB 4RA9B 4E12A 1N0VC 521PA 4XRGA 1C7FA 1PV2A 3LOUA 4L7VA 1OLXA 1YC2A 4Y2XA 1F5SA 1H6CA 3K30A 4CT0A 2A5FA 3W7VA 1G6OA 5HJEA 1LRLA 3HCWA 5DISB 1U5BA 2MT9A 3CS3A 4RVDA 5IWAB 1VM6A 1DC6A 1BN6A 3PITA 3LW7A 4RV9A 2JJ2A 1QGZA 2CN1A 1UMBB 4S2EA 1G21B 5EWJA 1PJBA 3N2GB 5EHZA 1Q77A 1TLFA 5JAUA 2PRJA 4YRCA 1L5QA 1XMVA 3ZDCA 4AFNA 4KE6A 4LYDA 4LZJA 4LWOA 3TRKA 5I01A 2X8JB 1JFFA 3DWFA 3IVAA 4HB4A 1ENYA 4EA8A 4Z1MA 3V3KA 2QQGA 1S6YA 5JCPA 1TC1A 2EERA 4M8NE 1KYTA 5FEUA 3D9QX 5JVDF 3T0IA 1CRZA 1YTUA 2IYPA 1Z35A 2G67A 3CH5A 1NC1A 4HYEA 4PC2A 4J7CA 3R5HA 2DUWA 3KTAA 3GGDA 3LWNA 5K6AC 5IAOA 2QG6A 3TB4A 5HKOA 1TU3A 3E27A 2WHEA 1A8SA 3AF1A 1RJDA 1WUJS 3B12A 3BXGA 3R44A 4WZZA 4TUYA 5A4AA 1RMQA 1ZIXA 2H1FA 2PO5A 5CFOA 3K6SB 1AXRA 1CJKC 1G1MA 1YDWA 4TN1A 5AYVA 4F12A 3EYWA 1K9VF 5BT8A 2V5AA 2OCPA 2BKAA 3K73O 4OBBA 4OFZA 4Q03A 4CFSA 4R41A 1M1ZA 3QH4A 5EHNA 1LV8A 1OY1A 1WMAA 1CJBA 2MYUA 1JA0A 3DD5A 1DQPA 3V1MA 8ATCA 4QJ4A 5JMTA 3FDJA 3Q2KA 1Z5GA 4LDRA 2FE1A 1JHXA 2XQKA 3Q12A 1DKPA 1GFIA 2PV7A 3DHNA 5ALPA 1U7TA 1Q1AA 5BMOA 2KI5A 5HOEA 2ZWPA 3U0VA 1BEEA 1G38A 1DC4A 2OO5A 3T95A 1SCUB 1F4VA 1I80A 2F1KA 3FPCA 3WAJA 2OD2A 3GJ8A 2D13A 3IDSA 5CCXA 2X76A 1SKMA 4IIFA 3F98A 1H23A 1PW7A 3HWX1 4LPSA 4QLAA 1I1QB 1O58A 2J45A 1KO8A 4ITVA 1EUDB 3WOHA 1ORIA 1COWA 4DR1B 1N3BA 2D3WA 2YN4A 3EGDB 1V1MB 2NO6A 3K3PA 1XD8A 4RFSB 4AJ1A 4K9NA 5FUBA 4UZFA 1NMSA 2VNHA 2UZ1B 1VMKA 1J8VA 4LJ8A 5EUQB 2YYYA 3PHJA 1SG6A 3PIDA 2XTAA 2A5YB 3SNHA 5HFJA 2X2FA 1T2EA 3ZWDA 1E4EB 4Z49A 1IHPA 1KI8A 2JHAA 2WG0A 4TKUA 1JLRA 3BXXA 3L7LA 3K1AB 1PGNA 4LYHA 1EDEA 2PYZA 4GQIA 1C81A 5EN4A 3O8BA 3S40A 2H57A 4N49A 4L2IA 3HMKA 1I4TD 4R7GA 1EVZA 1GAJA 1LBTA 2I33A 1JJ7A 3DXZA 4H4CA 4KWHA 4OB7A 3THOA 3TMKA 2WSMA 1FMTA 4UE3S 1GU1A 3KHSA 2BT4A 2ZQ5A 1O0BA 3DZGA 2B5OA 2ZYTX 2H2HA 3E9YA 3EXAA 3SYNA 3J7TA 4KQMA 1C30A 3AEYA 2XQVA 4OHBA 1XNQB 3NWPA 1ISGA 2I3BA 1HNWB 2AZXA 1UZMA 5KVAA 1IDN1 4MQ4A 2JFBA 5E3HA 2XDYA 1P2GA 1QG2A 1PUXA 3CUSA 2GCNA 3EGEA 4IZ6A 4MRNA 2JS7A 1JZSA 2WUFA 5IDVA 1JZTA 3K70C 2Y77A 3O1JC 3TLJA 2AMYA 2Q28A 1QYIA 1E2LA 3DVAB 2ZZMA 2AH5A 2WEKA 1X1TA 1ZN9A 1NI5A 2FZVA 3ORSA 4OHCA 2PUHA 3ENKA 1UAGA 2CD7A 1IIBA 1WNTA 1N8SA 3MRVA 3PFKA 2CUNA 4UULA 3SJBA 4B4KA 4NMWA 4C4PA 4YUAA 4PLVA 2O4CA 1QBKC 4Z9FA 4ZU1X 3F5QA 1V47A 3ESBA 4PCLA 1U1GA 1GGKA 2AVDA 4UUAA 4BMDA 3VO1A 3IA7A 5K5EA 5KEIA 1K7CA 5DLEA 1DWQA 4NC9A 3IAFA 4XCXA 1QGOA 1XOIA 4LPKA 1W85A 5DH9A 2JIZD 4XA8A 1DC8A 4IDNA 1NVEA 1MO5A 3GA5A 5FULA 3I32A 1OU4A 2CLDX 5HS4A 3HCOA 3REQA 1Z37A 2BFOA 4UBMA 3N6VA 3N86A 2J0UA 3CVJA 2I65A 2E87A 1ADYA 2R751 3WXMA 1XLWA 4Q7EA 3BSSA 2BTQB 5K8TA 4BFZA 3VKVA 2BGNA 1PLLA 4PYIA 1NUSA 4CKYA 2CLMB 3C6MA 3L6DA 1P7ZA 1ZICA 1FNBA 1U8CB 3GRYA 3AMVA 1NWCA 1YS4A 3KWMA 5THQA 4PS1A 2Q0SA 3OA0A 1KHTA 2QRNA 3UKJA 1YSCA 1V8PA 3JWJA 2A92A 4HRXA 3VM6A 5K03A 2BGMA 3WGKA 3LL7A 3W5JA 1U5BB 2IYSA 2YUTA 3NHJA 4MLPA 4QPCA 5JMOA 1YGYA 3HRHA 1U2GC 3AV3A 3OMXA 2PZAA 3P9RA 5TLSA 3V8VA 4G4GA 3DMPA 4D4LA 2V0GA 2BEKA 5DIFA 3I23A 4AJ2A 3WRYA 3UFXA 4OD0A 2IW3A 4U2KA 2OENG 3LBAA 3MJEA 4DA0A 4GLLA 3RS0A 1ZM9A 4NE7A 4V3BA 4ZPXA 2D8AA 4X24A 1DSSG 5C37A 3TOVA 3HCRA 2O7RA 2P4EA 2I22A 4DQVA 1G7TA 2VTDA 4ZD6A 1O5OA 2FSGA 4TXNA 5AM5A 3COSA 2E89A 2ZYSA 3IEXA 4E1BA 5JSFA 1B0PA 2A4MA 4XEHA 3TFOA 2FK8A 2FMHA 4WA7A 3RANA 1XZDA 1VE1A 3HB5X 2PD3A 4KACA 2R7NA 3NO4A 5GONF 3H11B 2YWJA 5DF1A 3T0FA 2AI1A 4A91A 1FQJA 1WPRA 2DETA 4XOIA 2POQX 1T8WA 4AT1A 1V5WA 3I6ZA 3M0EA 3P97A 3CF6R 3IT1A 3V42A 3BIFA 3DVQX 3AY6A 4YCNA 5CVJA 4LMBA 1XO1A 4CLHA 2W6IA 4E7OA 5LP6A 1IZ8A 2ODTX 4E46A 3EDYA 1H0RA 1GL7A 1Y8QB 4X97A 1WMEA 4KXYA 4WK4B 2HZBA 3IDFA 5ITWA 1TCBA 3CPHA 3WIOA 1Z17A 2ODWA 1KI4A 1LC0A 4B2YA 4YPOA 2NP6A 1SQ0A 1T1SA 1P91A 4NMLA 3JALB 1PS9A 3HJNA 4OQMA 3CUKA 3L7AA 1DAPA 1VL5A 5AOBA 3LCUA 1TQDA 5D2CA 1HQDA 3SYKA 4PR0A 3MJVA 3ZV4A 1PR3A 5CTAA 5TGDA 4JLPA 3L4KA 3PPYA 5HP4A 3OCWA 3D7MA 3KVOA 4A8TA 1CRPA 2H18A 2IA5A 4D9MA 5DYNA 1OROA 3GZNB 4YRJA 3KPYA 2VQFB 1SVUA 3RVBA 4MVYA 2ZOSA 1MPTA 3CEJA 1SO8A 1X80B 3VX3A 4KQCA 1JEAA 1L2TA 3G2HA 3ZWMA 1QGAA 2EKBA 2ST1A 3T38A 4NWIA 2ZIZA 3L06A 1AOXA 2WKQA 4FFBA 4MHOA 2GJKA 3QHAA 3BGSA 5FOSA 2EP8A 3T7JA 1OFIA 1G2QA 4M9CA 5B58T 1FOEB 2BR5A 3RO7A 3EXG2 1Y8AA 3UK0A 3TD6A 4HPWA 2ODNA 1ZONA 3O74A 1DWOA 1OFTA 4UNRA 2BGTA 3R9XB 4H77A 3PF9A 4PPNA 7ABPA 4P35A 5CBPB 3L1HA 1NVXQ 4R8MA 4ZU3A 1SWVA 2OSBA 2RHRA 1JR3A 4ZICA 4B31A 2H5EA 2IHKA 5B7GA 5KSOA 1E1CB 3ANMA 3MZ0A 1K4YA 2A0XA 4YMVA 4QFMA 2JFHA 4Z4CA 4D3YA 1B14A 1EM8B 3V4LA 5A7GA 2PKYX 1MT3A 2GPNA 1NDUA 1Y9AA 3V34A 1SBQA 3LHFA 2Q3BA 3HMQA 5DNVA 2GFHA 1XMXA 5FOUA 3VO8A 3A2NA 1DBIA 2VJAA 3ZEAA 1GLNA 2ZAOA 3U16A 2A94A 2IX9A 1ULTA 4IG4A 4IRXA 4OKIA 3DHVA 4RPKA 4ZKEA 3H2SA 1MO2A 3U62A 3KSBC 3K05A 3ZDBA 3O8LA 3ZNPA 3TGWA 3DCYA 2BMJA 2VDUE 1VFPA 4G01B 4HNVA 3D4OA 4UBJA 3BFPA 3D2LA 1PJSA 5JCXA 4TKLA 5F2KA 2RGNA 4HDNA 5BR4A 4KRYA 4XUEA 1OYYA 1PL6A 4EWLA 3CJRA 3DLCA 2GF2A 3A1NA 3WV5A 1HE2A 3F6SA 4B7ZA 5KX5F 3WNZA 1U28A 5A03A 2ZIVB 1QGED 3C5VA 4HWKA 4X9XA 5EKXA 2XB4A 4JJFA 1M2WA 5TPZA 1XTQA 2H59A 3QFCA 4Q9AA 5JCOA 2JI7A 4QOIA 4YLYA 4HQKA 5DTMA 3SSOA 3DTTA 2Q29A 2E18A 2O52A 5EXPA 3BMXA 2IYTA 4ESHA 1HE4A 2W70A 1W85B 3QW4B 3ZCSA 2YHSA 1Z5VA 2ZXUA 2IU6A 1S3FA 1EFVA 4OXXA 1OFUX 1R88A 1U2ZA 2B30A 4A0HA 5FOVA 2V9CA 1E0DA 2UYOA 4IYRA 4EBFA 2II6A 1S9DA 2WVHA 2XCIA 1FUUA 3UMMA 2DQSA 1J24A 2PX4A 4TYNA 4X6XA 4F2WA 1QX4A 2HAEA 5CB0A 3R9IA 1OLXB 3ELYA 4Y0VA 2HXSA 4KQKA 1DELA 3A1VA 2HRQA 3LOPA 3NFRA 1F51E 1UT6A 2OO5C 1EE1A 3G8DA 2G1AA 3CF0A 4LJ7A 4NAVA 5F5XA 4DLVA 2O8CA 2ZJ7A 4TVBA 3EW9A 1DTSA 2R8BA 1OR8A 1UBNA 1NYQA 1NC3A 5L3ZA 1YRYE 1AMNA 3RG8A 3EZ6A 3ZXUB 2ZB2A 2E37A 4OHVA 2WD7A 5LMUB 4DSAA 2R8YA 2YV3A 2P2SA 2I5PO 3VTZA 2BFFB 2IUSA 1FS4A 2AWNA 1H2ZA 2V96A 4ZHQA 1MRNA 1A4UA 4ZO6A 1G6Q1 4D5EA 4KBYA 5KI6A 4L5BA 3IV6A 2ZCUA 4QUDA 1JN0A 1XDZA 4AKTA 2D1YA 2Z3ZA 4EB3A 2ZBDA 1SUCA 1T1JA 2AK3A 4D46A 2VAWA 3RTCA 3Q7TA 1I94B 4EECA 3D4LA 1KHHA 4RTKA 4JQZA 3NUQA 2BFFA 2GLTA 3FB4A 1R6AA 2I8CA 3E1GA 2EZ8A 2HK8A 3F6YA 3HWWA 4QRDA 1NG1A 4K6KA 4LWQA 3SIPA 2HIHA 3VZSA 2E9SA 4ND2A 2RH4A 2Q7OE 2G8LA 3SAJA 5GGXA 1T34A 3QSGA 1I1OA 3R74A 1VGRA 3KYIB 2FPIB 2A1TR 3PZBA 4Z7QB 4MWGA 4BBJA 5EEHA 1QU3A 3FUUA 2QLMA 3UH0A 1O96A 4MTLA 2PSHA 1HMYA 4KLZA 3VDQA 1E3WA 2GN9A 3W1VA 4AJ9A 3ISJA 3V4SA 2HDWA 1PVDA 2QA5A 1H94A 1L7AA 3IIEA 1T0BA 1AKEA 4IUYA 1CVLA 3JZDA 3U60B 4HH4A 5JROA 2OXCA 2WBLC 4L75A 3IAAA 1JKIA 4YCBA 4P3XA 2EFCB 2RGBA 4RNDB 1GCIA 4FR2A 3W2GA 1HSZA 2EX4A 1DBQA 3VR4A 1SMKA 1SOMA 4LJYA 1TZJA 3OZIA 4I4IA 4I55B 2AC2A 1M2NA 1RD4A 1Y1QA 2C9OA 3K0AA 5FOXA 5HJ2A 3RIEA 4B44A 4YPVA 2Q6LA 4L50A 1ZOIA 1GG9A 4G1CA 3BFVA 3LBIA 2I4NA 3SKYA 1KMQA 2PN1A 4OQNA 3R6GA 4P6VF 1YMQA 2V54A 3DUFA 2XBLA 3IUYA 2PX2A 1QYRA 3H8JA 1NSFA 1EJ2A 2G28A 3UT0A 3IQHX 5KTYA 3OT4A 2FR1A 2OAEA 2ALJA 3ZPXA 1L4HA 4Q9KA 2O1SA 4BZWA 2REBA 5AKXA 1L5OA 3MILA 5FTNA 5HK8A 1PK8A 3SIXA 5L53A 1JG1A 2OXRA 4X92A 4G0XA 4CKBA 2R1TB 1UXHA 1CNMA 4URWR 3KV3O 1LEHA 2Z8XA 4AX4A 4CT5A 2FF7A 4G8CA 4IOJA 4ZKDA 1DJOA 2XMBA 3ZGVA 3PD7A 4QG7A 4ZREA 1ECBA 3HUEA 4N4AA 2AFHA 4MV0A 2OQVA 3ZKWB 5DM70 3K09C 2F48A 3VA7A 3I1JA 1MO6A 1N5KA 2WF6A 2A2ZA 4MPTA 1Z2EA 3MMNA 4H6XA 4MS4B 4TMTA 4KR9A 3T5CA 3W8RA 1E94E 5JTUA 2NN3C 1Q44A 4A16A 5AI5A 1PJ8A 2VSFA 3BK7A 3KXPA 3WKEA 5GZ1A 2HT6A 4CCWA 5KQMA 2FKNA 4CODB 5KNDA 5I7FA 1E89A 1EH5A 1EKXA 1Z5PA 9GPBA 4YRQA 1I2MA 3KZOA 1NIPA 4DNQA 1ZQ9A 2IV3A 2M98A 1Q6YA 1QFSA 2C9CA 2O48X 3A36A 3KDPA 1ARZA 3MNFA 4WW0A 4ZQBA 3PEUA 4JB8A 1N4AA 4C4ZA 4ARZB 2XF8A 1YE5A 2W2NA 5EKDA 2CL6X 4QODA 4YXFA 3WWZA 4LCBA 3WL3A 3PE4A 3WB2A 1SHLA 1YUMA 1VKZA 3V2IA 3D4BA 4BEJA 3JYHA 5C34B 4RTSA 3PUKA 2UU9B 3JR7A 5EWLB 1QTNA 1YU9A 5JNUA 2XI4A 1Y5IA 4OHPA 1IJFA 4I50F 3OPVA 5C80A 4WZAE 3RJZA 5KYKA 5DCUA 4A1FA 3D6FA 2GRAA 2HOQA 4CKCB 1GGJA 1A4RA 3CURA 4QUKA 5DTQA 4YP1A 5ED4A 2ZSHA 1HNNA 3IQIX 5E9AA 2JZOA 1D2NA 4FYXA 4R6XA 4KQHA 1WP9A 4HLUC 3KJIA 1NOJA 1HZZC 3TLZA 1J8MF 1XCBA 2VS1A 5DHFA 3GLIB 2GO7A 4B74A 1DJMA 2A33A 4WCFB 1RBMA 3DLHA 4I5DA 5JSKA 3KB8A 3S2FA 2BGLA 5TC4A 1PJLA 4D7AA 4N12A 5LYJA 3T9AA 1NFRA 1QZXA 2XWSA 5J2UF 1ZX1A 5BSGA 5AVQA 1RQGA 3TRFA 4IQFA 4CKWB 1MXHA 3BBPA 3C6BA 4D44A 1HFJA 1BW9A 2VNKA 5HTKA 3C97A 1FEZA 2YTZA 4LXUA 1TCUA 2AZMA 3I5UA 1XALA 1FRQA 3PB3A 3QF4A 2GAOA 3JPYA 1JHUA 2J09A 5DGHA 2BCEA 1IRIA 1SN7A 2ZYVX 1CQJA 5JG7A 5BMVF 2QD4A 5C4IA 2PL3A 4Z99A 3SXUB 2WHPB 3I2JA 3NJ8A 4TS9A 1H3EA 2O2JA 1JAXA 1Z3IX 5THXA 2GUWA 4B84A 2YL2A 4M38A 5DHTA 5T4FA 4RHTA 5JHHB 1L5RA 4UW9A 3GEPA 2F55A 4DBZA 4ZZ1A 4MHTA 1A1VA 1GPYA 2IE0A 2YIMA 5CNMA 4L02A 1NRWA 2A3RA 5JS8A 3VH1A 2GEBA 2DWUA 3OI7A 1XJ0A 5K8JB 4BCCA 2HA3A 2P30A 2P3SA 1AE1A 4L4UA 1X1BA 2B98A 1G7SA 1OX5A 3DEFA 4GRAA 4BBZA 3Q5GA 1BO6A 1WA5A 4Q4DA 1PZMA 1XMPA 3T7AA 5IABA 5LDHA 4PSCA 1G8MA 5FHRA 3G5AA 1ZWKA 2O2ZA 3HH8A 4NDNE 1QK3A 3C74A 2XJ9A 2OA0A 2XITA 3CHYA 2XA1A 2OHJA 2Q0HA 2ZRAA 3KPVA 3OHPA 5B64A 3JD0A 1GQSA 2E5LB 2PUFA 4KJXA 3UMJA 1ZLYA 2OV4A 4U6NA 1EWYA 2WFZA 3GVIA 2CWDA 1ZMBA 2A9FA 1SXGA 4RL4A 1KEPA 3VPCA 3MYRA 1VIVA 4HDRB 5AKIA 4X1KA 3H9BA 1PFWA 1AHPA 1PI3A 4Z2AA 4GOMD 1M8JA 4P84A 2YV4A 1DRJA 4PS0A 4UVIA 4W6ZA 3RAGA 4YAIA 2C5EA 3VU9B 1J07A 1D2AA 1E4YA 1N2OA 3H99A 5BWNA 5ALHA 2WAMA 2PZBA 2QGFA 1QGDA 3CX8A 3VZDA 4CR6A 4QQNA 3RYIA 2A30A 3K9FC 2P90A 3L6CA 1SHJA 3F5FA 1TEXA 3OMLA 1U3GA 2TECE 2X23A 3FLBA 1RZVA 2NU7A 2EWMA 2CVQA 2IL1A 2QU7A 1YR7A 3PR1A 4HKTA 2ZAYA 4EKEA 2ASVA 3I9NA 4GPTA 1OMOA 4G5FA 1FMCA 1TI7A 1P5FA 1TT5B 2VRCA 1U4OA 1QG4A 4LHYA 2Q6OA 1EYZA 2XUFA 5BOVA 4Z2YA 1Q12A 1ZK4A 4FK8A 4F96A 3CZCA 1HDIA 2XUHA 3IAS1 4NEGA 1CUVA 4C0QC 1WV1A 1NNLA 3FTQA 1CJTC 3Q72A 5TEVA 4B3SB 1E2IA 2HKIA 5CMLA 5EJGA 2VRBA 2VT3A 4FSDA 1HKUA 4TZ6A 3T7RA 4IFEA 3I53A 3M6AA 4QQFA 3T1HB 3LG2A 2RDMA 1KI6B 3T1NA 3F78A 1NR7A 4KW7A 1K8ZB 5FKJA 4DLPA 4ECAA 1NP3A 1BJTA 2Y1GA 2X9LA 1GPJA 1A5SB 3SBDA 3WIUA 2AOUB 5B53A 2OR3A 1N36B 1O6ZA 5JPDA 1ZN7A 2GJ9A 2BRUC 4A23A 4C7OA 3OTWA 2IYUA 1RMTA 1GZ4A 3FDXA 4BLUA 2QD1A 5B30A 3ROKA 4CMCA 3TVYA 1Z7GA 4EMTA 1RHKA 2G36A 5I9SA 3VYWA 5LLTA 3OOJA 4G2NA 1PWXA 1M0WA 1AV7A 3QBTA 4Z4HA 4MK4A 4PG6A 1W46A 1TD9A 4AZ0B 5K2MA 2CYBA 3BERA 5JQGA 3ZR4B 5IT5A 1EVKA 1TLTA 1TZBA 4E5UA 4BZZA 1M34E 3OBIA 4AKHA 5DM0A 4P3YA 4LCJA 2FZEA 3GF4A 4EOGA 1FW6A 2Y71A 4YR9A 1G9XA 1T5IA 3O3MB 5AVVA 1EK1A 4MWEA 3PUIA 1KR2A 1DE0A 2BKXA 4LY9A 1TIBA 5IJXA 5GJWC 4ALIA 2ZRDA 3K9LA 1U8TA 4KRFA 4PXAA 3ICOA 2PMFA 3PE6A 4FX5A 4ZFNA 2XXJA 5DBFA 5F77A 3HG7A 4MKRA 2VOJA 5FI1B 4NOMA 3OE5A 1VL0A 5BSWA 3O4GA 3LO5A 3O93A 5KTKA 2I6GA 3EVFA 2Q6IA 3ICVA 3B7PA 5U1PA 3OZAA 3CA8A 4PLGA 4KLCA 1V45E 2RBEA 2LV8A 3RJMA 3V4RA 1UXOA 4JUFA 3QLVA 2HDOA 1X7WB 3WJAA 2XVZA 1PT5A 1VJ5A 3BH7A 1Z3CA 1NURA 4RESA 1CHNA 2BKEA 1HOTA 3H5TA 3D8HA 4RWZA 3ZXIA 2FSFA 2PBFA 3NBAA 4XUGB 1Z74A 2J6BA 2JJ1D 4JBXA 3K4PA 2Z09A 5KJ1A 2HK7A 4MVWA 5FAXA 2PM8A 1JUDA 4JXZA 1CIPA 2WINI 4RCZA 1U04A 1PX0A 2PH7A 4JR1A 4P2BA 2JFWA 2QTVB 4ZOEA 1ZR2A 4ZQIA 3QU7A 4IDQA 1EXVA 3G7NA 4TTJA 3VHRA 3K1YA 1N5DA 4IF4A 2AR7A 5D3ZA 3ZDYB 4D97A 2A9OA 2H3EA 3C45A 3D1LA 3D5QA 1Y42X 1YTLA 3ISTA 3NRJA 2XRYA 2PKWA 3NT2A 4NH4A 3S7ZA 3DMFA 3MS7A 1KEWA 3NALA 5FXMA 3G2KA 2UZ4A 2Q8NA 5EUBA 2O8CB 3AETA 4HFJA 4ZGGA 2DP4E 1VCOA 2B9VA 4C06A 2ECKA 4BX2A 1PG5A 1ZM2A 2VFAA 5F51A 1X7ZA 5T8KA 2W98A 2X77A 3ZHQA 4IJ6A 3KQVA 2ZRFA 3OZTA 3DV9A 3UVEA 4G1BA 2DX7A 4JUIA 3X2SA 4V0SA 1E18A 1ORDA 2ASEA 1B76A 4W8GA 4I4LA 1RQRA 4I9UA 4R54A 2EBFX 5H3LA 1MA0A 1MR3F 2GPWA 3CLKA 2J48A 3JVEA 4GIBA 2IYZA 1MAAA 2IYVA 4ZC8A 5IAEA 1BOOA 1YWGO 1IJEA 2GMWA 3WO0A 1G55A 1UXGA 3H4MA 1VMAA 1KSJA 3AUFA 1A9OA 3GLTA 4ROTA 4XGRA 3ZVRA 3DOIA 3UJ3X 3G59A 1IUKA 1AT1A 1YC5A 2P0AA 2PFGA 1LU9A 2PL9A 2WJVA 4QQKA 2GZSA 5J5AA 3S2ZA 2NWQA 4C43A 4RKEA 2BKVA 1EWVA 1T6BY 2JGRA 1IY0A 1DADA 1SCIA 5HA5A 3T61A 5KC9A 3TJZA 4C0XA 4EG1A 4LI3X 3D3QA 3OT1A 4R31A 3RDPA 4FYPA 3I9FA 2G7MC 4M49A 4X1YA 5KJCA 1YHYA 1NIJA 1U8UA 4LE1A 1VMIA 2HBYA 3LC7O 3F47A 4MHSA 4KR0A 2DFDA 3ADKA 4JS0A 2DFTA 2IXEA 2Q5OA 3B13B 4INAA 4BGEA 4FOSA 1I2BA 1ETUA 3H2KA 3IO5A 5G41A 3JQ9A 2EKDA 2Z5LA 1EGQA 4Y67A 5DNYB 5IT9A 5MFZA 3ZIDA 3QTBA 5KVSA 3DLTA 1N78A 3R3XA 3GCZA 1R27A 3AEXA 3FGZA 4GI2A 1CNEA 2VHUA 3V7WA 3PXEA 4XYEA 2JJYA 2DH5A 2XMSA 4EQ6A 1O94C 1G5RA 3TZCA 5TT0A 4EFDA 2HRCA 3V7UA 1JXOA 1PZFA 1AUVA 2H1VA 2WJ4A 3Q7PA 1A7UA 4MUNA 2WMNB 4Y7DA 1RXUA 4FFDA 1E1KA 3GT0A 4UTZA 4D9HA 1Y5MA 4D4GA 3B9PA 3OU6A 5A5GA 2GSWA 4QSHA 4LYJA 5IMBA 3H2JA 1C1HA 4AYTA 3PUWA 3QVOA 4HWTA 1BHJA 1W75A 5KWEA 4KXLA 1M9NA 2HL6A 2L18A 1JVSA 4CCYB 1EM6A 4RSRA 4GDFA 2XTJA 2Z2IA 4HY3A 5AI0A 3R9XA 4JEMA 3ZGXA 3MM4A 2DQYA 2WNHA 4XGNA 2FOIA 1QDLB 4WIAA 3PQCA 1B1CA 3ME5A 2W2KB 1JIIA 3FNIA 4OQYA 3TKYA 4B48A 4IXNA 1MUUA 1QFXA 2F3TA 3FWHA 2ETXA 1NYRA 1PQ4A 2CMFA 4KZPA 3L7IA 1NVBA 1SXJB 2RAFA 4J0JA 5AR1A 1G3IA 4I4NA 4FILA 3T4EA 2EZUA 1E6MA 3B1YA 5FI3A 5HS6A 2JAQA 3IQDB 3WNQA 1ZMRA 4LISA 1M2VA 5CU7A 5D3MB 2HMUA 4YB8A 3H7AA 4RVGA 4DQ0A 2J3MA 4PZDA 4EH1A 3ZCVA 4EYSA 1Z8DA 4FFSA 4JC8A 4NHOA 4R8LA 3H1AA 1RRKA 3AVWA 3PXDA 5F1OA 1Y81A 2Q21A 4HQOA 4AAYA 3AHIA 1FFAA 4DSNA 5DRTA 1AN9A 2C84A 4WTOA 3FRHA 3SK0A 2CFOA 2FRXA 3D64A 1PFKA 2GZ2A 4D6XA 3B8EA 1UMDB 4B3RB 4L1KA 2G88A 1JG3A 3RNOA 3QI7A 1NJ5A 1YKSA 2VHEA 2IIVA 5JD3A 3G5UA 2H0RA 3F6BX 1UODA 2ZJZA 5DB4A 1AN0A 1R4NB 1ZC3A 3W1EA 4J94A 1RXIA 4IX1A 1ESCA 3GPCA 1DWPA 1U2TA 4G0WA 4M86A 3EEIA 3T9EA 5JHGB 1NWHA 3EZNA 3LTEA 2MSKA 3H4IA 2CXOA 3DEYX 3HWSA 3IPRA 4DWVA 1ILWA 1JAIA 2UV8A 4Y6PA 5DN9A 2HWKA 3GNSA 3KJZA 4W9NC 4YP5A 1N92A 2Z5VA 3E4DA 1CF9A 1GEEA 1JKXA 3T9CA 4Z1OA 1ZMXA 3JWHA 3PCXA 3MLBA 2ODAA 3KU4A 1J1UA 3MRTA 3DEZA 4C5BA 1RW4A 1JZQA 3RIHA 1KZGB 1GUDA 1P3DA 1FYDA 3G8YA 1AG9A 1UPFA 3LIIA 4JROA 5DX0A 3PKZA 1K6MA 3VYSB 2A86A 3OM9A 1DRKA 3HXPA 3E5MA 1CFJA 3DO5A 4FYYA 3VMFA 4CTOA 2X0RA 3R6DA 4EG5A 3FYTA 5KNBA 4JC0A 3QKSB 4N8EA 5IUJC 1JLMA 1RJGA 5T67A 3WG9A 5IAKA 3ASYA 1VMEA 1VLVA 4QULA 1GNSA 1L4NA 2P65A 5DM1A 4F7DA 3ZVLA 3PUVA 3OZBA 4GPBA 1TTTA 4EHJA 2G4LA 1XF9A 3BHMA 3GHHA 3F4BA 4JIGA 2QR3A 5F1PA 2NPFA 1KH3A 4BKPA 2RK6A 2X8LA 2IOFA 4RELA 1YZGA 1JIQA 2WHYA 3LT1A 4A6XA 2V5UA 2PU7A 5FCDA 1H2BA 4IIUA 5D3KA 3MWEA 3FYUC 2BI8A 2QTTA 4J0HA 3E9RA 2HPVA 5JCJA 5BYAA 5HQJA 3VGPA 1XPJA 4UD2A 4MRAA 5J43A 4I36A 1LBQA 1GGMA 4F4IA 1Q57A 1ZEMA 4FVTA 3V4OA 1M5RA 1GNPA 2IYXA 3K5WA 5EQTA 1K08A 2OAP1 1RHJA 2CJYA 1GRNA 1MGOA 3DOHA 3KBBA 4U7PB 1T6XA 4KCGA 3RYHB 4DFDA 3K0CA 2YIJA 1WDWB 1M2HA 4DIEA 4KYTA 2LRHA 4CL2A 4M0CA 4HRVA 5I9IA 2VEOA 3MB8A 3L8CA 3ZN2A 5LA6B 2RKBA 1K27A 1LS6A 4PZUA 3SY8A 1OAAA 2FDXA 4Y9TA 4CM4B 5ALFA 1L5WA 3NATA 8GPBA 4PC7A 2OFXA 4F8YA 3NKFA 3LP5A 3U4CA 1XTVA 2WSSD 4GHWA 4GYWA 4EEXA 3D0RA 3CNBA 4HVLA 1MJHA 4O63O 3KM0A 4HD8A 3NDJA 1T25A 1W0JD 1Y7TA 2CMGA 3TCKA 3THXB 2P62A 3LYLA 3PCRB 1NBMA 2FZGA 4XTRA 1Y0BA 1D8TA 2VO1A 3QVJA 4BTVA 1N1DA 4Q15A 2WFMA 1LLCA 1SBZA 4QOHA 3AI2A 3L40A 1Z7WA 1X80A 3AVQA 4HR7A 4RANA 2O8FB 3K8OE 1BXGB 4PZAA 4OGLA 2IS4A 4L22A 4V2UA 2BHLA 2QN3A 4PSUA 1AK9A 4TQGA 1Z34A 3LDFA 3W0LB 4EA6A 1E9BA 2VYCA 3BK1A 5BOSB 2ZIEA 2EARA 2LKDA 3HR7A 3ZQKA 2AOTA 4M1QA 1G63A 4P93A 1EK0A 1JQDA 1P4AA 3A1FA 2I2XB 2ZPAA 4UEOA 1OGIA 4DMHA 3VKFA 4EG0A 4W5WA 1W6RA 4K2AA 4YY3B 1LNSA 1DBVO 2CHUA 5DNDA 5A0FA 1YR3A 1HNXB 4HFMA 1EWTA 3AEZA 8LDHA 2JAXA 2PD6A 5HTOA 1TAHA 5EE0A 1FNSA 2FSSA 4GNKA 4HAZA 2QPLA 2R44A 3S1LA 3L2OB 3OQBA 1B0UA 2RI6A 1T3ZA 2QN2A 3MMXA 2AF4C 4LZOA 4BFYA 2GN1A 2QM8A 4JJZA 5DI9A 5EE9A 1LBSA 2I91A 1K8QA 1OI3A 3JYNA 3DE3X 4LXHA 1KO1A 2PQ6A 1IK4A 5HZMA 4IYJA 4KVZA 1RWKA 3PNSA 5KHAA 3HR4A 4E51A 2IDMA 3UJPA 1W88B 1YONA 1DTWB 4PHHA 3RUPA 1KFCB 3KOZA 4R0MA 4JVNA 1V26A 1OI7A 3Q7EA 4YLEA 3GUZA 2FG5A 4PICA 4W7IA 4DY4A 1AS3A 5JAQA 1R8SA 3AWDA 3RABA 1HDYA 3SQNA 3VZRA 2JLRA 3WL5A 3U09A 4L8YA 5JZMA 2FTKE 3OIUA 3P45A 2B37A 1AF7A 4NDZA 3PFFA 3J7AC 5HBRA 4AF8A 2E4VA 3WBBA 1RAEA 1SZCA 2WM8A 2Y0EA 4ARZA 4UUBA 5JYCA 4QO8A 2QMEA 3I39X 1XTRA 1T15A 3HCEA 3Q0TA 3EH1A 1KGSA 5JXGA 3D0KA 5KYNA 2JPDA 3ZWAA 3QUQA 2HHJA 1E7SA 2O6HA 1L5VA 2YFHA 1DAEA 2AHOA 3B6JA 5AUPB 3L8EA 3K9WA 3PI7A 3M6FA 4G1FA 2RBKA 4RAOA 4EUKA 3H04A 5KBYA 4MP3A 2CZGA 2J9RA 2V1XA 4IIHA 3HTXA 3CZ4A 1MV8A 3ZGNA 2XTNA 4TROA 1B6GA 3OE4A 4HGOA 5HKKD 5B2ZA 5EIEA 4EF5A 2AUMA 1GUAA 4R9SA 5CDYA 2GA8A 2B34A 2FZ4A 1KH1A 1JDBB 1TK2A 3MSCA 4QUEA 4M3NA 3RC9A 4FUQA 4Y2YA 3VKHA 1Q1GA 5G4KB 4LFCB 2OQ2A 4K28A 3N2EA 1JWLA 5IC6A 3VNAA 3O75A 5CEJA 3ETEA 3MPUA 2NXNA 3HBNA 3PWKA 2IXAA 4W5RA 2RGYA 1FZTA 4HQNA 4RGYA 3VR3A 2P7HA 1SUBA 2QAJA 3RH0A 4AY6A