3MG9A

Teg 12 binary structure complexed with the teicoplanin aglycone
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
290
structure length
255
Chain Sequence
XXXXSMNGIRWIASYPKAGNTWVRCMLAAYITGKAPQVWNDIDAESLTLEAMLRFGDLPPAEPMEPVLVKTHLKADVPVLGLYGEATAKVLYLVRNPRDMLLSSMRMASISRDDVEKSRDFARKFIANEGLGWNGGVGLGSWPENVRSWTESSSDRFPNADVLTMRYEDLKGDPVARFSEIVEFLDLGGPVDIEDIRRAVAASTLERMRELEKRSEGRYDQSLSFLGEDIESDYQELLHGDSGFALYAKQYGYAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/antibiotic
molecule keywords TEG12
publication title Crystal Structures of the Glycopeptide Sulfotransferase Teg12 in a Complex with the Teicoplanin Aglycone.
pubmed doi rcsb
source organism Uncultured soil bacterium
total genus 92
structure length 255
sequence length 290
ec nomenclature ec 2.8.2.-:
pdb deposition date 2010-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3mg9A00
1E2DA 3QXSA 4KI0A 4TQ9A 2NMVA 1QVAA 4W5WA 2HV8A 1XTQA 1ZM4A 3LRPA 1XX6A 1OXSC 3I32A 5TV2A 3AVTA 2ASEA 5UKDA 3NDBB 3AVWA 3K70D 4DIDA 4TMXA 3QY0A 1RJ9A 1J7KA 2QQEA 5C1BA 1KZGB 1Z3IX 3OESA 3T15A 5HPYB 3QKUA 3P26A 2QMUA 5L3RA 2HYIC 4XIGS 1FOEB 3WNDA 4LJ5A 4UXIA 4LHXA 4RZ2A 1DO2A 2LKCA 2W58A 3AF4A 3T5GA 2WTUA 4ZKEA 2G1KA 4LC1A 2KBEA 1FUKA 1RC8A 3GJ4A 1FTSA 4EJSC 2Q9AA 1QDEA 4RKFA 4AI6A 4X8LA 4FXPA 3HYTA 1U8YA 4PO9A 4BQSA 2WKPA 5LBIA 3M0EA 2JDIA 2ZE5A 1KZ7B 1MO5A 3LAWA 4MQBA 3RAPR 2C9OA 4EPVA 2ZQ5A 4PPGA 2H7VA 4AC9A 3QBTA 4G5SA 3IHWA 1BO6A 1X8JA 1P72A 3BJIC 3WP0A 3UK6A 4L4UA 4J0QA 1RVDA 4JLKA 4CEIB 4D4KA 2O8EA 4Q4HB 1HH4A 2AKAB 2ZRBA 4RZUA 1SKYB 3TR0A 2MSCB 2WJYA 5CK5A 2B21A 1DTSA 4NHOA 2ERYA 1TF7A 3X1XA 3S1AA 2YC2C 4GOJA 2CJWB 4URZR 2AWNA 1S0UA 1G17A 3QKSA 2PL3A 1G19A 4JL6A 2NO0A 2ZRPA 2IYLD 3C7KA 5KTYA 4RD4A 4B75A 3VR5A 1Q0UA 1W36C 2ZSBA 2QZ4A 3BH6A 1Z8FA 5C18A 1TQ6A 5C4MA 2BBOA 4PZYA 1OLOA 4M4SA 2EWWA 1R0XA 2PEZA 1JJVA 2IXEA 3K0EA 3EPJA 2FZLA 2ZYTX 2QE7A 2IWHA 2OM2A 3TVTA 2YOGA 1D5CA 4V0KA 5TY0A 3LBNA 3R9XA 5ANRB 1W0KA 3T1TA 3IGFA 2BHRA 4MKFA 1DAKA 1IY1A 3SJAA 3TNFA 3BH0A 4DIEA 4QHSA 2ZRHA 1NY5A 2LWIA 2FGKA 1ZCBA 2LCFA 4DLXA 2DFKB 1S4QA 1MH1A 1R4AA 2J0UA 2NZJA 4LPKA 4MKIA 3UWKA 1T91A 5FTKA 1AKEA 3CF6R 4Q1FA 1GKUB 4M22A 1LFDB 1OFUX 4RFSA 4ZCMA 2FEMA 3EXAA 5FUYA 1CTQA 2O0KA 4K46A 4QGGA 4CT5A 1E2IA 4Q4JA 3ZD7A 1DPFA 2GXSA 3CNLA 2WJJA 1XTJA 2ZJOA 4LBZA 4MGKR 1O87A 1T5LA 3DM9B 3K0AA 4X8OA 1F2TB 1GRQA 4FCVA 2QMHA 2RKOA 4QBFA 5BXQC 2OCYC 2IYSA 4HAYA 4PFSA 3PQCA 2W2TA 4GNKA 3EC1A 5DH9A 4DDVA 1BKDR 5LD2C 3SI7A 3DZDA 2JLQA 4HLUA 3TUZC 3THWB 1G4AE 1QHHB 1Z0FA 5JSZB 5H70A 2YYZA 3BE4A 1IXSB 4EPYA 1ZUNB 1KOFA 2ZRGA 1EFUA 4V0ME 3GLGE 3B2EA 3HR7A 2QAGC 3L8YA 1BH2A 1N6IA 2I1QA 3HU3A 2JJ1A 3GLHA 5FBQB 1CKEA 5EE3A 4BLPA 4L15A 1E99A 4UNNA 2CE2X 2JGNA 2A7QA 3CNNA 1E2FA 1OJLA 3OEEA 3QIAA 2DBYA 3CRVA 2IW3A 2PLRA 4GZMA 4C0LA 2B6HA 1Z2AA 3BB1A 3U3KA 4KBGA 3W6NA 3A8TA 2HLDA 1WCV1 4NKRA 2A5FA 5JCPA 4XD7A 1F6BA 2H57A 4FN5A 1JPJA 1OF1A 1EX7A 3RHFA 5AUPB 4NCNA 3B1YA 2ZREA 1E2KA 1UKEA 4PQRA 1E9SA 2NIPA 3AVOA 3D7MA 3LWNA 3SC3A 2C9YA 4US0R 2FG5A 3IQXA 4TL9A 3IQWA 1GNQA 2P0EA 2XGJA 1PV4A 4OI2A 3KXKA 3BIFA 2BMEA 2EFCB 3UG7A 4AK9A 3QG1A 3SN6A 4DLTA 4C2TA 2IS2A 5KU1A 2B7CA 4Z1MA 3NC1C 2OE2A 2OFXA 4Q47A 5FTJA 1T6NA 1E2GA 3QVUA 1U2RA 4D0GA 3FE2A 1U0LA 5JRJA 2GKSA 1COWA 3WMEA 5HKKA 3KL4A 5DHAA 1HURA 1YR6A 3P4YA 4BLOA 1KK0A 2IYWA 1P3JA 1HE8B 3NG1A 3NBZC 4N3NA 4I81A 3NH6A 4P31A 4R98A 4Q9JA 1RRFA 2ZI4A 1YJ5A 2N1BA 4OK6A 3AB3A 1E0AA 3BWDD 1TQ2A 1ZNWA 1UBEA 3BFVA 4I99A 2C78A 3MLEA 3U7FB 4ZDIA 4JLNA 1SVOA 1U94A 4PAQA 5J4HA 3DL0A 2UZIR 1V43A 2ZI3A 5DI3B 1Z6GA 2WICA 2BDTA 4N1AA 3ZS9A 1P9WA 4LCBA 4QBIA 1JNYA 1ZP6A 2RGNA 4C0AC 2ZRNA 4LJ6A 1X6VA 1CBUA 2AD5A 1KK3A 1NIPA 4ZCLA 1MRNA 2OCBA 1Z0JA 2GEUA 1Z63A 1P2UA 4A1FA 1G8FA 4IDQA 1KO5A 1R5NA 4B48A 2WOOA 3ZIAA 3DMNA 5JCZA 3RSOA 4OHYA 1G7CA 2RGEA 4C0KA 4FINA 2ORIA 4CW7A 4HI0E 3LH5A 4MH0R 3AF0A 2QSZA 2VHQA 3VU9A 2Q21A 2V6IA 5DN6D 2PZFA 4OK3A 1T8TA 2QRNA 3NBXX 4XJXA 4MRNA 1XTKA 3U6BA 3B1VA 4QGAA 1CIPA 4HZIA 1MO4A 3K09C 2OXCA 4B74A 3LXXA 3QBVA 2WV9A 1J8YF 4TMWA 1NVUQ 2EFHB 2GJKA 4DZZA 1Q21A 3AGPA 2OG2A 2OILA 1R0ZA 3I62A 4JLBA 3MWYW 1S9HA 4ASUD 3Q5EA 4BZPA 2BBTA 4O25A 1FL9A 3RS0A 2FF7A 3U60B 4B3BA 2KJQA 1SXJB 3OE7A 3RANA 4D6PA 3VNVA 5J5CA 1E9BA 3GLHE 4O2RA 1S96A 1HY3A 1NN1A 1FNNA 3OF5A 2QM7A 4QL3A 1OXUA 2GK7A 3EWSA 2KBFA 4DLVA 1FTNA 1G3UA 3B82A 1KK2A 1KKMA 1T4GA 4XSGA 1JEEA 3VHLB 1AS3A 1D9XA 2BV3A 4TTPA 3FHCB 3B5JA 1OYYA 2J0VA 3LX5A 3ZDQA 1A82A 2F55A 1B0UA 1XJQA 3QF7A 1G8GA 4TLEA 3L8ZA 3EA0A 1N25A 3FMOB 3OIUA 4M9XA 4TQAA 4MRPA 2WBLC 1NKTA 2GXQA 4JJZA 4PPNA 4WOPA 3MWLA 5EP4A 2YINC 1KI7A 1DVRA 1T3LA 1AM4D 3DPUA 3PV0A 4UJ5A 2QEQA 1FQKA 3QXCA 1FNMA 2YWHA 2C5LA 3TUJC 1NP6A 2HUPA 1EFCA 1H8ED 2XEXA 3AV0B 3CONA 1VIAA 4D80A 4YDHB 3DEFA 5D3QA 4H1VA 2JJ2A 1QHNA 1PLKA 5FOSA 3B13B 4CVNA 2GBLC 4URXR 4TYYA 2XITA 3CWZA 5IHPA 3BXZA 4JMPA 1TUEA 2AK2A 2FZ4A 1E94E 3W6PA 5AUNB 1AA9A 2OO7A 3QE0A 4Q1EA 1OXXK 3FFBA 3CR7A 5CYPA 3GJ8A 4YONB 4A8JC 4DB4A 4IVRA 1AIPA 1P75A 1XD2B 3ZGXA 4YMVA 5IDVA 1OSNA 5EZ5A 1KTVA 3ICQB 2GVZC 3U3RA 3QXXA 3U5ZB 3MFYA 5L3SA 1VKJA 4DDUA 3E5HA 4QC2A 3I4LA 2BM1A 3Q3JB 4TLDA 1FUUA 1X1RA 5FFMA 4MA4A 1NY6A 1P2VA 4RD2A 1JBKA 3FMFA 2EVWX 2C2HA 2ZXUA 3GLFA 4ZIRA 4MUBA 4ARZA 4MRRA 5CIWA 2IYYA 3M4YA 3ADBA 1C4OA 2A5GA 2QL6A 3CNOA 4N0EA 1I2DA 1XEFA 1H8HD 3H4MA 5FPKA 1B23P 4B2PA 1RRPA 1JI0A 4KSCA 2FSFA 3CWQA 4L9SA 5GJCA 5KOYA 4Q5IA 3W8RA 2GA8A 2JATA 3R7WB 4B2LA 1CF4A 1Q1BA 3PUWA 4XVUA 1EFRA 2JLVA 3W5JA 3CX8A 2QM8A 1CR0A 5JI3E 3TE6A 4KSBA 3NXSA 4LI0A 4URUR 4B76A 4O3MA 2FE4A 4IDOA 3WYFA 1H8EA 1CR1A 4A92A 3EIEA 1OH6A 3T1QA 1KY3A 5A4JA 1WBDA 4EPRA 1XEWY 2ZAOA 3OHMA 1AS0A 3SHFA 2O8FA 1KYIA 2NOAA 2WAYA 3SFZA 2NO7A 4P4TA 4DJTA 4YQFA 5DYIA 1UPTA 1DARA 1IQPA 2QPOA 1QHXA 5FTMA 2ZRLA 3KQHA 2HDNB 3FMIA 4PQYA 1Q20A 4AIIA 1XPOA 4PPFA 3FHTA 4Q1CA 1ZD1A 1E98A 2CEAA 2X1VA 3QF4B 3TMKA 1E9FA 2QQ0A 1UKYA 1TU4A 4V02A 2IHYA 2OFOA 4C0HA 4C0JA 1W36D 3BB4A 4XTCS 2CNWA 1E4VA 2OLJA 4Y0VA 1OH8A 4B3GA 2HF9A 4K81B 1VECA 1XU4A 5M04A 4BGDA 3I72A 2Q6TA 2R8RA 3HDTA 4DVGA 3DZ8A 4XVRA 5IRCD 4LGMA 3N5CA 1KI6B 2XZLA 4QM6A 3MWJA 3FYHA 4JLMA 4OI1A 4ERNA 4QBGB 3C5CA 3MMPA 2FPKA 1Z0IA 1E0SA 3QEJA 4F38A 1VDZA 1SKQA 4P4SA 1N5IA 2QNRA 4JLJA 1IY2A 1Z6AA 1G8PA 3ND8A 2WAXA 3VKGA 4QFMA 1E2LA 2ZU0C 3FOZA 3F3YA 2D2FA 3T1OA 1RJ9B 3SNHA 5GADl 3L0SA 2YWGA 3GMTA 1JECA 1R2QA 1CJUC 1VIYA 5AJXA 4YXWA 5JLJA 4URWR 4ZDWA 4A0FA 4GP7A 1ZW6A 2VSOA 2OXRA 2Z43A 3UMRA 2WSSA 1US8B 5FPTA 1I4LD 4PHHA 2VTKA 621PA 3PUVA 1Z6TA 4JIMA 3KQKA 1XFAA 4KV9A 4OHWA 4B47A 4B2IA 5ELXA 3D3QA 3JVUA 3ADDA 5HZHA 2P5TB 2I4IA 4KFSA 3W3AA 2O52A 1JR3A 3A4MA 1E1QD 1NN0A 3DMDA 3MJHA 4PR0A 1UBCA 3EASA 4Q9IA 3RRNA 3THOA 3L2OB 2GAAA 4AYWA 1GL6A 4QHTA 4CF7A 4IHQA 2X8AA 5DO9A 2VEDA 2CL7X 4TLAA 5CK4A 2F6RA 4YLGA 5EJEA 4WA7A 3EPHA 2F3RA 2ANBA 2VHJA 3AKCA 2O8EB 1XMJA 2A5DA 2EYQA 2B7BA 2FSIA 4JYCA 2P6NA 5AJWA 2HT6A 1UJ2A 4TL7A 2F1HA 5CIQA 5TB5A 4TN1A 2FX3A 3K53A 3WBKA 3RNLA 5JBQA 3KZ1E 4MYCA 2P5SA 3CX7A 3S1AB 1CJMA 1EWQA 1G64A 1XXHA 2BJVA 3QKSB 1EFTA 4XWAA 4R9UC 5KDOA 3GLFE 3RLFA 1Z2CA 2R6AA 3U4QA 3ZVMA 2ZRFA 3W34A 2QGZA 3CZPA 4OQLA 3SYLA 3SYKA 1XZQA 1OW3B 5GVSA 2C99A 4BFWA 3MAAC 3QI2A 2WJIA 1QG2A 4NDZA 2IF0A 2O8CA 4N0DA 1R10A 1YZQA 3P20A 4KVGA 1UEJA 3V4FA 3IIKA 1ZBDA 2CK3A 2VHUA 2EFGA 3LW8A 3Q8XB 4PC7A 5AJZA 3BD9A 4R2HA 1CU1A 4KYIB 4Z8XA 3WP1B 4OHXA 3U3JA 1ETUA 1XMSA 2R65A 3KQUA 2J0UB 2ZJYA 4Q02A 3CUEF 2BIFA 3O8DA 1Q12A 4HYYA 1DADA 2Z4SA 4RFSB 2GESA 2J87A 3VR4A 2YZ2A 4H9GA 3ZJYA 3TW4A 3AEZA 3TRFA 4W9MC 3CF2A 2ZJZA 2F9MA 3W5IA 5HR5A 3PUZA 1E6CA 4JL8A 3DDCA 4HDCA 2AX4A 2QAGA 2ZRMA 3A58B 2H92A 5TVKA 2X2EA 4KLZA 5KO2A 2HJGA 5EE0A 5DISB 3FDIA 1JAIA 3K0AB 4AG6A 3BH7A 2JLYA 4QJ5A 1SZPA 2O5VA 4CT4B 4XSHA 3PIRA 1KJWA 1EX6A 1W4AA 3VTKA 2GETA 1M7HA 4DT1A 3KTAA 3WY9A 5DIFA 4TL8A 2R6GA 4W7SA 2Q3MA 2H16A 2FN4A 3BFKA 1NL3A 1YR8A 2GCOA 2A5JA 2G0NA 2YOFA 2REBA 1A7JA 1RPZA 2F43A 4G01B 1YZKA 2MSDB 4Q9LA 4LC0A 1IY0A 1YR7A 3TUIC 3K9HA 1KJZA 2ZSEA 5KUTA 4LYHA 4LHYA 3AKDA 3GFPA 4BWYA 5B30A 4WZBE 2AN9A 1X3SA 2WKQA 3GLHB 1DE0A 3T06B 1FP7A 3IDQA 4D82A 1YZUA 1G8YA 1SVMA 3DKVA 3KDSE 1BYUA 2ZI6A 2VBCA 2DCUA 4BFTA 5AUOB 1GL7A 4TT3A 1SXJE 1UFQA 2AD1A 1VCMA 3K0FA 4FD2A 2YVUA 2VRWA 3LO5A 5H68A 5J4LA 3VX4A 5GJBA 3BFXA 4LJYA 2GXAA 1KI2A 3ICEA 3A36A 3DHWC 2IYUA 2IYZA 3ZVRA 3NEJA 2V7QD 2J3EA 1GNRA 4O2LA 2YV5A 5JWHA 3U6KA 1E3MA 2I3BA 3KKPA 4ZDKA 3CRRA 2GCNA 2PMKA 3EZ6A 1KI3A 2DB3A 1GAJA 2H5EA 1QF9A 3SE0A 4FMCF 3W90A 3RRMA 2JLWA 2HCJB 1N6HA 4BECA 1OHHD 3HPRA 4HATA 2ZANA 1G7RA 1I4DD 3C15C 3V9PA 2IX3A 1JQLB 3OAAD 3C5HA 1NF3A 1DAHA 2AFHE 1P73A 3LXRA 2AK3A 4TLBA 4D0NA 1XXHE 2NGRA 2D7DA 2J46A 2O8DA 2OBMA 3B85A 2ECKA 4LY6A 4W5JA 5G41A 4BLTA 3KXLA 1YR9A 3WYAA 1W46A 2C98A 3L0PA 4OI4A 4PHTA 5CJPA 4EKDA 1BYIA 5L8VA 5BWMA 2IS4A 3CBQA 1II0A 3SZRA 3RWMB 1NBME 5TMPA 5KNCA 2BMFA 1EK0A 1R8SA 1U81A 3C41J 2IL1A 3WBJA 2J9RA 3D31A 3HU2A 3LFUA 4IDHA 4HLQB 1HTWA 2IYRA 3ECCA 2ZEJA 3KKOA 3CLVA 1EXMA 1W0JD 2ZIAA 4M2LA 2C96A 3PXGA 3OEHA 4V0LA 1G7SA 3PUXA 2ZJ5A 5A5GA 4LJ7A 4CDGA 3SU8A 4OQXA 4DEYA 1NJFA 3NEYA 1U0HC 5GVRA 1M74A 1N5LA 1LF0A 1KNXA 1WMSA 1TQDA 1N2CE 4QG7A 3QPVA 4CEHB 1VCOA 2V7QA 3EW9A 1DEKA 5G53C 2JLXA 4DLZA 1X8LA 2GXUA 5FBWB 2OAP1 2GHIA 1J99A 2YOHA 2ZYUX 2J7KA 3NBYC 1XEXA 3THYA 5K8LA 2ZYWX 3VU9B 1RRCA 3B9QA 4GFDA 3SQXA 1KIMA 1NVVQ 1WBBA 4JLOA 1KSJA 4KJZA 2TMKA 3UIEA 1SXJC 5AWFC 2VO1A 1KI8A 1Z6YA 5JEDA 4X8MA 4Z54A 2ZE8A 4EUNA 2QBYA 2NO6A 5JEEA 1GKYA 2XJ4A 4LBVA 5FUVA 2REXB 4AY2A 2PJRA 1DS6A 1TQ4A 1P5ZB 1KY2A 3ONWA 5B64A 4IFEA 1GRRA 2ZROA 3HJNA 1Q3HA 1EWRA 2VPPA 4S35A 3EX7C 2ZRIA 4E03A 4IOLA 5HTKA 4XWKA 1LS1A 1RYFA 1QG4A 2CLSA 2N42A 3A1UA 4KO8A 4U5XA 5DSZA 2AXNA 4F7WA 1OFIA 5BN3A 1G3MA 4BZXA 1GVNB 1SHZA 2ZE6A 4UNQA 5FH9A 1CXZA 1FZQA 3BBPA 2Z5FA 3C8UA 2WM9B 4MKHA 4PTLA 2BMDA 1NN5A 2YC4C 1WDTA 1E4YA 4FWTA 5G3YA 1PLLA 4B3FX 3AUXA 5FOXA 1GZSA 4RZXA 1KO4A 4TMKA 2IA5A 3U3MA 4OJQA 5BYKA 4A4DA 2E87A 3CB4A 3IIJA 3QPUA 3Q85A 4BUJA 1U8AA 4WVFA 2ZVPX 1MO6A 4QKQA 4BLRA 4OHZA 3JVVA 3UANA 5FL7D 4E07A 2FNAA 2CCGA 1G5RA 2RCNA 4US1R 1X8KA 3L82B 4RSGA 4FW9A 4DDTA 3CZQA 1FQJA 2VP9A 4I1UA 4EQ6A 3JZMA 3SDZA 2XTZA 4RD1A 1DAIA 5CDFA 4CIDA 1FP6A 1P61B 1CULC 4NL4H 4ZKDA 4M1MA 5JHGB 3VR6A 2PJZA 2Z4RA 4M1OA 5DI9A 1L7VC 2IYVA 3ZS8A 4BFUA 1CRPA 4NCIA 1LTQA 2RGGA 3MWKA 4A0RA 3WMFA 3UG6A 2XZPA 1ANKA 4NH0A 3AVPA 2BKUA 4ZPXA 3SBDA 1D6JA 1U8ZA 3I61A 2CLCX 2QAJA 2V1XA 5K8UA 4NU0A 4PSVA 1HEIA 5J4YA 4YMWA 4HAXA 3PG5A 4AKGA 2EU8A 2GRJA 5CB8A 1EG7A 2C03A 2JA1A 2GDJA 2JAQA 4JBYA 4RY2A 3GLFB 4NYMQ 4JKIA 3DKPA 3T1VA 4ZIRB 3U3OA 4ARZB 5EUQB 2PLFA 4NCJA 4KAXA 3ASZA 1JEDA 2ONKA 2RGBA 3AF3A 1JR6A 1RKBA 1TPZA 3B6EA 2V6JA 2ZU6A 4Q4AA 1J70A 4D0LB 3H2YA 4NYJR 2G83A 2KWIA 1E2NA 4URYR 3CKLA 3ND9A 2G1JA 2DWOA 2V4ZA 3AQ4A 2ZI7A 1KI4A 4BFYA 2ANCA 4NYIR 1ZYUA 2QN6A 3ZQJA 4IOJA 4ZI2A 2FFHA 1KMHA 2D4HA 2O8FB 3EIQA 2X2FA 5FR2A 3V00A 4B35A 1L4UA 1A2KC 1GDDA 4C7OA 2HXYA 4P3YA 4DHEA 1ONBA 1XZPA 4B6EA 1A2BA 3AKYA 3GCGA 1MKYA 2X77A 1NMYA 1P4SA 1Z47A 2HYDA 4D4JA 1R0YA 2O8BA 4WIAA 4B33A 2EW1A 2WPDD 2ZM5A 4I1OA 2Q3HA 1BIFA 3E70C 1W49A 1DAFA 4PC3A 3QKRA 1CEEA 1PUIA 2IUSA 2WHXA 3QNUA 3RS2A 1E2HA 1E2EA 3ZZUA 4Q4HA 3UMFA 5JFGA 1I4TD 3ZD6A 2XSZD 5KPJA 3Q9LA 2ZETA 3TLXA 3AKEA 5K8TA 4MRVA 4M9ZA 5P21A 5CITA 2P6UA 3OIYA 1N6RA 2JLUA 1ZUHA 4UJ3A 4P4SB 4PQFA 3IO3A 1IN5A 4NE2A 1LNZA 2BBSA 5JMTA 5F2EA 4A9AA 421PA 5JWOA 1AS2A 2ZRDA 3MD0A 1YZGA 2G6BA 4I1SA 5KSYA 5EUMA 1K5GA 2CHVA 3DOEA 1N5KA 2XXAA 3R20A 4HEJA 3UPUA 2RGAA 2RHDA 1P2TA 4LV6A 2JIZD 4NONA 3PFIA 2D62A 2NQ2C 1E2PA 2FSGA 1NKSA 2WZQA 1U9IA 4LJ4A 4EIWA 4MYUA 4RD0A 2G9NA 4E22A 2LKDA 4G0NA 3RYTC 4WXRA 1NSTA 1KAOA 4D81A 5EE1A 3MCAA 5KDLA 4HUQA 3RS3A 5SZIA 3U2QA 1II8A 2C04A 1ZAKA 3P1JA 2DWPA 5GJVC 2OEPA 3SJBA 2DFLA 3B7GA 1N0WA 2J0SA 2FJUA 4M9QA 3DVLA 1IXRC 4II7A 4QGFA 1SGWA 1ZU4A 4FMDF 3SOPA 4LX0A 2GJ8A 3LBHA 1Z0DA 121PA 1TL7C 2ZR9A 3GLIA 1CJKC 2AL7A 3AM1A 1BMFD 1UDWA 4TMTA 1Z83A 4V0OA 2OAQ1 2RH5A 3SJZA 3WNCA 2EWVA 4A82A 2FFBA 1XJ0A 5DN6A 4B3XA 2V54A 3B1XA 1MT0A 5EXTA 5AJYA 3CPJB 2WWIA 1F2TA 2A3RA 1YZTA 3PEWA 4Q21A 4O0MA 1XXHB 1G3RA 4HZUA 4DCUA 3IIMA 3KJGA 1KSFX 4LOAA 1UEIA 1YZNA 2K5UA 3GJ7A 3AP2A 4Q1AA 5C46F 3U4QB 5AK0A 5FUXA 2PCLA 3N2EA 4IFBA 4IJMA 5B58C 1KMQA 1HT1E 2G3YA 4OQNA 3THWA 4KITB 2NG1A 2P67A 3I1FA 5L3VA 3Q7PA 5CLLA 4GT1A 1Z29A 5F3WB 4ASUA 1OIWA 2O8CB 1XNJA 3HYRA 4HAWA 4F4CA 3KXIA 2ZYVX 1OXTA 4DLSA 2QY9A 1OT3A 3TJZA 1F5NA 1W7AA 2FH5B 5A0FA 5SZHB 3TQFA 2UVQA 4Q7JB 3GJ5A 4AYXA 4B44A 3FHOA 1O3YA 3C14C 4KBFA 3TAHA 1K8RA 2VLIA 3NHAA 2DWQA 4F4IA 4GBMA 5EXXA 2ONJA 4PANA 3RDPA 1ZIPA 4JJKA 2XNDD 4X8HA 1MABA 3GJ0A 1Z0KA 3KQLA 3X1ZA 2ZI5A 3RVBA 4BPBA 5E7IA 5F98A 1E79D 3T61A 1N6OA 3G5UA 2QI9C 1WA5A 2HXSA 1HT2E 1QHSA 2NZ8A 4HLUC 4NMMA 4HB3A 1E9RA 5EP2A 3EWAA 1OB5A 3QEOA 4OBEA 4D4MA 1YQTA 5TDHA 2C8VA 4AYTA 1ZCAA 1TU3A 4JLAA 4US2R 2WWFA 1CP2A 1Z08A 4YMSA 1G9XA 1XJCA 3GEEA 1C9KA 1GSIA 1NI3A 1WXQA 3LQRA 1OFHA 2VYFA 5G3ZA 3W9YA 4DSNA 1N6LA 3REGA 1RYHA 5EP3A 3IPXA 4PZLA 4DUGD 1GFIA 3BB3A 1P7CA 3L43A 3H1TA 3PVSA 1VG0B 1E9CA 2H18A 2OESA 3BS4A 4I1VA 2QA5A 4DT1B 3KTAB 2BCGY 2MMGA 2ODEA 2IK8A 2WKRA 4FCTA 4M8NE 2FPMA 4QNRA 4YDSA 4PAOA 2W6ID 2PH1A 2GCOB 2GWHA 4XWOA 1XD9A 2QT0A 1JAHA 1SVKA 2CXXA 4EDHA 1SVLA 1KI1A 2W00A 2F43B 1GTVA 1R5BA 4LYJA 3X1WA 2GZAA 4QRHA 2HF8A 2P3SA 1HQCA 1S1CA 4HUTA 5CB6A 1QHGA 2GZHA 2R2AA 3VR1A 3T5DA 2EFDB 3ZZTA 4FWIB 4Q7LA 4B3CA 3AVYA 2VQSA 2GF0A 3FB4A 3PENA 4YMTA 4JLDA 4Q9KA 4WW0A 5FPYA 1TMKA 4LV5B 2XOKD 2AR7A 4IVQA 4NCHA 4TYNA 3AUYA 2Z83A 4PHFA 2XTMA 3U7GA 1SXJD 3U7EB 1FX0A 3CRQA 4WZAE 4EJSA 3L0IB 1YU9A 2VP0A 3WRXC 2CVFA 2GJSA 1H8HA 3K0FB 1G6HA 4HB0A 4LHVA 3WHLA 3CRMA 1E69A 2QT1A 1ZM7A 1WP9A 2BJWA 1YKSA 4U7DA 1T3SA 5IF9A 5B57C 4EPTA 4ESVA 8OHMA 1IXZA 3DO6A 1HE1C 1XMIA 2MMCA 3IILA 3MG9A 3G82C 2XTNA 3OFND 3J81k 2QUZA 1VCIA 1QBKC 4A15A 1S3SA 4OQMA 3CX6A 2KE5A 5KPDA 5FL3A 1XCMA 3GFTA 3ZQ6A 3U44A 1GRNA 2QMEA 2ORVA 5KDDA 3QG5A 5KHOC 2OV2A 3KX2A 2W6JD 1XP8A 4B32A 1IM2A 1KDPA 1Z06A 2IEZA 1PVOA 2GEDA 4ACAA 4BLSA 4V0NA 4YC7A 2CHGA 3UWOA 1UAAA 2VF8A 3AF2A 3X1DA 1NBMD 4DCNA 3AP3A 1E0JA 1NIJA 2R6DA 2GF9A 1M6NA 5FTNA 3TGPA 3FVQA 3IUYA 3U7HB 4QNMA 3IO5A 2IYXA 3L0OA 1NN3A 3I8SA 1W5TA 4U02A 4EPWA 1SVSA 2D74A 2OCAA 4MGYR 5DYGA 2CL6X 2R44A 1XB2A 4QHYA 4HDQB 4G5OA 4ITRC 2OT3B 1AJEA 4EAQA 1KNQA 1ESNA 1L8QA 1XCGB 3EZFA 4Q01A 1YRAA 1H65A 1F60A 3GP8A 5DNYB 2V1UA 4M21A 1KKLA 2J41A 3H0KA 5FI1B 2B8WA 4MYHA 2W2XA 3QKTA 3K70B 1FPMA 3PEVA 4KODA 4Y0AA 1K6MA 3PEUA 3SBEA 1KDTA 2OFWA 1ZJ6A 2W83A 2J59A 1E32A 1NMZA 1TTTA 3FWYA 1XEXB 3SJCA 2QTHA 3LLUA 2VHTA 3KQNA 4A2PA 3CRW1 4BEJA 4LJ8A 1D8TA 4LHWA 4GRAA 3UKDA 4GOXA 4QM7A 1DO0A 3KJHA 1NMXA 4BE7B 2IS6A 4Q66C 5LPNA 5JZVA 2X19A 3QPWA 1YZLA 4YMUA 5C2JB 3NDPA 4HLDA 1T3HA 1E1QA 1U99A 1WE2A 3E2IA 4QXAA 5K8IA 2PBRA 3KFVA 3PJRA 4FMCB 4TSFD 4DBLC 1Z5ZA 2V9PA 1SULA 4IDPA 3Q5DA 1F2UA 1KI9A 4Q18A 4Q4JB 4D4LA 4L9WA 1G3QA 2GEVA 5FOTA 4KU4A 3T12A 3A1WA 1R6BX 5JJIA 4WAUA 2D06A 3CR8A 3AVQA 4HAVA 2J7PD 1RFLA 3K0CC 3VKWA 2EYUA 5JJKA 4Q9HA 5BN4A 3LV8A 2GZDA 2W2VA 4URVR 4MKGA 3FKSD 5FUWA 1ZM2A 2A9KA 4GSYA 3QOFA 2XB2A 4DLRA 1AN0A 3IBGA 1HQYE 4R2IA 5FOWA 1IONA 3O8CA 1CRQA 2R6FA 3GJ6A 5FBRB 3AF1A 821PA 3GD7A 2NO1A 3VFDA 2P6RA 1CR2A 2QGNA 4BEBA 4LHZA 3T34A 1CR4A 1N0UA 2J45A 2QORA 3ZYCA 5E95A 1NVXQ 3KKMA 1Q22A 1I2MA 2ZJBA 4EQ6B 1KSHA 1Z28A 2EFEB 4H1UA 5DLQC 4LJ9A 3KJEA 1WRBA 2KSQA 2ZVQX 2FOLA 1ZM3A 2OHFA 3SFVA 5JRZA 4RCZA 1CS4C 2JDID 2VP6A 1AGPA 2D2EA 2VL7A 2IHBA 1JR3E 5HCIA 3VQTA 4B6FA 3LVRE 2NTYC 3FFAA 1KAGA 2ZUBA 3GJ3A 3MUFA 3A6PC 1Q1QA 4F4JA 3QENA 2AFIE 3DM5A 3LD9A 1FFHA 4TMZA 3K9NA 2J7PA 5E4FA 1Y63A 3CPEA 4LRWA 1M2OB 2GCPA 5F9HA 2F3TA 5JHHB 3H86A 1ZU5A 2FMXA 1E2JA 2N46A 1KDRA 3FKSA 2ZUDA 2QSYA 1XDBA 1Q3TA 2WWHA 4Q4AB 3TSZA 3WXMA 5KYKA 1L2TA 5IK2D 4DCVA 3VMFA 1W2HA 2ZS8A 4TLCA 1GM5A 3KKQA 4V0MA 4GI7A 3LY5A 3GLGA 2Q9BA 1MRSA 2IXFA 3THXA 3FGNA 1Q1ZA 5CYOA 1DOAA 1G8HA 1UKZA 3TBKA 2FV8A 1OV4A 2QE7D 4NZYA 1DG3A 4KLNA 1KMHB 3F8TA 3LDAA 1LS6A 3B60A 3NKVA 2V55B 4JL5A 5J4VA 5J40A 1W0KD 1OFTA 3NWJA 2ZSAA 4B43A 2JLZA 4KYUA 1XTRA 4POAA 1US8A 2FA9A 4CEJA 2HT1A 2DY1A 4C7OB 1ZUIA 2IEYA 1LVGA 2WWGA 3CPHA 1G5PA 1E96A 1G16A 4MYTA 5EQTA 3IPYA 2QROA 3K09A 1QHIA 1SHKA 5L3QA 4JVSB 1XD8A 2ATVA 2O8BB 1NJGA 4ZV4A 2PT7A 2O0HA 4CRWB 2YWEA 1HV8A 3GEIA 1M1YE 4K8OA 3VX3A 4PHGA 3QKRB 2FPLA 2WJGA 3KKNA 3HR8A 4G5RA 5FBLB 4A6XA 4LBWA 4A2QA 1TX4B 3H84A 3EZ2A 3N70A 4BFXA 1L4YA 4Q48A 3RABA 1OHHA 1NLZA 3LLMA 1G1MA 1W47A 3OAAA 1AGRA 4P32A 1AZSC 1KO7A 1IN7A 4MUAA 5IK2A 4LSGA 3MJRA 1OKKD 3EG5A 4XOIA 4JZKA 4BASA 2B92A 2V3CC 3GQBA 1GILA 1G20E 1UM8A 3GEHA 4PXAA 1M7BA 1GKIA 4P4UA 2BKEA 3Q7QA 2BCJQ 2RHMA 2XXAB 1EESA 4PSAA 2AHOA 1IAQA 1FMJA 2BEJA 1AKYA 1TADA 2ZR7A 4L16A 1R5OA 1HA3A 1V5WA 1W4CA 2GTPA 2P65A 3NC0C 4Q7MB 2BVNA 5AJVB 1G291 1RIFA 4TL6A 4Z8YA 5FOVA 1CJVC 1ZIOA 1ZNZA 1W0JA 2JJ1D 4IEIA 4JT4A 3ZZ0A 3RS5A 4HUQB 5BQ5A 3BRWD 1II8B 2VP4A 4V03A 4AD8A 5KSZA 5DGXA 3BAFA 1XWIA 2OSBA 2SHKA 2QU8A 2GBLA 3OEED 4DB2A 2E9SA 4C3ZA 2QMOA 4Q1DA 2ODWA 2XB4A 221PA 1IBRA 2HLDD 4A8JA 3X2SA 4HAZA 4Q1BA 1Z6XA 2C9CA 4TYWA 4FI3C 4XD7D 5BN5A 1DG1G 5H8WA 3C4JA 5BW8A 2J1LA 4PSKA 3SQWA 3BGWA 3R8FA 5JECA 3PITA 3GLIB 4GPTA 1CLUA 2NO9A 4G5QA 2IS1A 3CH4B 1VG8A 2ZR0A 4PC2A 5LDDC 5JSZA 1UDXA 2ZJ2A 3GJXC 3TIFA 4D25A 2ZPTX 1Z07A 4E09A 1Z22A 1T8UA 3K9LA 1VTKA 2JASA 2ZJ8A 4KXFB 1J8MF 4HZUB 4IDNA 5D3MA 1NSFA 4Z1MD 1OKKA 2WWWA 2IF2A 2VSXA 3B8HA 1JALA 4IOMA 1S1MA 2R6CA 4HSEA 1KDOA 2HJVA 3AH8A 2ZSDA 1M34E 2KI5A 2YKGA 1COWD 5HKKD 1IJFA 4LPSA 5B2ZA 1ZVQA 3RRZA 1GITA 3TK1A 1J90A 4D2IA 4LWZA 4DWJA 4E5UA 1VPLA 2V8OA 1ZNXA 4KFTA 4B73A 2ZI9A 2ZS7A 5EXPA 5GJWC 3B1WA 3TH5A 3TSOA 5L3SB 5J47A 4NPHA 2FFAA 1KJYA 4AKEA 3FTQA 1G41A 4EFMA 1EGAA 1KHTA 4CGZA 4TYPA 5F9FA 1ODFA 3OZXA 4DLYA 3CM0A 1N3BA 3MGCA 1ZINA 3ETLA 3QXHA 4EPXA 2OLKA 3NBFA 3W8NA 1MABB 2VA8A 4QBHA 1G21E 1JPNA 1LW7A 1DBSA 3EPKA 3RSLA 4JVNA 2GVDC 2ZTSA 3ASYA 2ZUCA 1Q44A 1GL9B 2WSMA 4FIDA 3U61B 2GJAA 4RD3A 1XF9A 2AKYA 1PJRA 4WXPA 5AUQA 4ABYA 3SHWA 5FR1A 1OIVA 5FPSA 1D9ZA 2FU5C 3ZIAD 3VNUA 5FL7A 3I5YA 4R7ZA 5LB2A 3TVDA 1NLYA 2OZEA 1VHTA 1VG9B 4IXMA 1G18A 2HCBA 2PT5A 1ZM9A 2BM0A 2IWRA 3QUSA 2IC5A 1E9EA 1UF9A 1XCPA 2QPTA 4U00A 4EFLA 2A5YB 2XX3A 4DCTA 4S2EA 2CLDX 2ORWA 1GWNA 5JI2E 4UQOA 3HU1A 4FMDB 4GOKA 5E7JA 4TTRA 2NPFA 3JZAA 4F91B 2WMNB 1ZC4A 4UXHA 4IKEA 1U98A 4C2UA 1DAMA 3TW8B 3LVQE 2MSEB 3D8BA 3KB1A 2QP4A 1OXVA 3HP1A 4RKEA 5KNBA 2VP5A 1M8PA 2DFTA 5CLQA 1YVDA 3BC1A 4WZ6A 2ODBA 4B3DA 3UATA 4B71A 3IEVA 1T0HB 1W4BA 1WF3A 3IHLA 4DCSA 1IHUA 1TF2A 2DYKA 3IKJA 4UKDA 1ELOA 2WJHA 4OYHA 2JCSA 1W2GA 2F1RA 3AVVA 2G0TA 1VYVA 4BFVA 4CEIA 1NLFA 4C0BA 2VSFA 1JXMA 3OE7D 3RS4A 1FX0B 5EZ6B 4IVPA 4EJSB 1IN8A 1W48A 4ZCIA 1GUAA 4G3XA 4M0LA 2XZOA 4MDEA 3AVXA 3I73A 1ZC3A 4LYFA 3EZ7A 4MRSA 1JXOA 3WNBA 1QZXA 2PX3A 1A1VA 3SEAA 3CIOA 3IBYA 1E2MA 2CJWA 4M9SA 3TKLA 4F92B 4A2WA 2QP3A 2IBMA 2C77A 4UXJA 4AKHA 4KFUA 4CEHA 1FW6A 4C0QC 3QJYA 3P32A 4P0TA 4AWXA 1ZMXA 5G40A 5HCNA 5SZJA 2D7CA 1C1YA 5DHFA 3T35A 3AVUA 2XNSA 2QTFA 3BOSA 1TNDA 5LB4A 3U44B 5JS8A 3KJIA 2R9VA 1TF5A 4TZ6A 4TYQA 1CJTC 2A78A 2A30A 4G5GA 4IOKA 2IXGA 2JJ2D 4MGZR 4DSTA 2Z0MA 3A4LA 1OH5A 2W0MA 5FTLA 5CDFE 4PO8A 1W36B 5CM8B 4DRZA 1ESMA 3EAQA 2WOJA 4JSYA 4BZQA 1U0JA 2WPDA 3K70C 1D2EA 1UADA 3K1JA 1R7RA 2PZEA 4NCKA 3TR5A 4D26A 4DEXA 1A4RA 3EC2A 3TAUA 1T0JB 4KVAA 2ZS9A 4DLUA 4JS0A 2PZGA 3CW2A 3UXMA 2B8TA 5CM9C 3LX8A 4QOSA 2XJ9A 3NVAA 2NPIA 3EIHA 2XSZA 2GJ9A 2DPXA 3WHKA 1NG9A 2BBWA 3NH9A 2E1RA 4L5BA 1W5SA 4PO1A 1N6KA 3MSXA 5E7MA 1AQYA 2FEOA 4HDOB 1YRBA 2OBLA 1OH7A 1F3OA 1M7GA 2PCJA 2FGJA 1G7TA 2VIIA 1AK2A 4OI0A 2YWFA 2QP9X 2WWYA 2A2ZA 2I1VB 4TQUS 5HE8A 4LK2A 4C9BA 2FFQA 2JIZA 1QHHA 1KK1A 3KUDA 1AQUA 1E0KA 1E1RD 2QENA 4GP6A 4IRUB 4ESHA 5EXSA 1K5DA 1EFRD 4BRUA 5J4KA 2IYTA 1UBGA 3FPAA 5TARA 2BEKA 1Q1EA 3DOFA 4CYMA 1Y3AA 3K0CA 4UNRA 2YJTD 2JEOA 3OIVA 4KHZA 2CCJA 4TTQA 5JS7A 2Q9CA 4ZI3A 3TQCA 3WYGA 5LD2B 3HPQA 1N5JA 1G6OA 3EPLA 1JB1A 2IYQA 2ZE7A 2C95A 4C0SA 4GDFA 4LZZA 1GOTA 2BOVA 521PA 1XTIA 3QQ5A 4AURA 2DR3A 3F0TA 3SS8A 2HEIA 3O8BA 2BMJA 721PA 1F2UB 2W0SA 4MITA 6Q21A 4WBSA 2CNWD 2QAGB 4RD6A 1Q57A 2F9LA 2QRZA 1BMFA 3I3SR 2PEYA 5KNDA 3LQQA 3ZVLA 4R71A 1GIAA 3R9WA 2F1JA 1MO3A 2PMDA 2CCKA 1R8QA 1N6NA 2GK6A 3Q72A 1TAGA 2IUTA 3W6OA 1SKYE 5FOUA 5KSOA 3VR3A 1XTSA 2YNMA 1KO8A 2Z6VA 4Q19A 2GAOA 4DXAA 1E9AA 1LB1B 1E2QA 4OL0A 4G1UC 1UBFA 3CF0A 4GMDA 4LYAA 1E1RA 1LF5A 4HAUA 2H17A 2VH5R 4JSTA 3ADKA 2JLRA 4NP6A 2FDCA 4CZ2A 1R0WA 1P9NA 2FWRA 3F5FA 4IW3B 1WQ1R 5DE3A 3PUYA 4A0GA 3RWOA 1VYTA 4PC6A 3A1TA 4TMVA 4KFRA 2RGDA 2IUUA 1KSGA 4XTRA 5E3HA 1NRJB 4NBSA 4PPQA 2H1LA 4YXWD 1SVWA 1A5TA 5DI3A 4DSOA 1U90A 1GG2A 2WSSD 2WIBA 1T5IA 2EQBA 2CMKA 2XNDA 3GPLA 4JKYA 2DHRA 3V4RA 1OIXA 3VR2A 4BFZA 1UKVY 1E9DA 1E79A 1P60A 1KO1A 1QRAA 3CO5A 4JLPA 3GFOA 2PX0A 1MV5A 4P33A 1G5TA 3C16C 1JR3D 1YE8A 4RZ3A 5KSPA 4W5HA 4IXNA 3B1ZA 3I8XA 2J0QA 1SVIA 3UMSA 3K9GA 2DFNA 1XPRA 2ODNA 1D2MA 4JLVA 4GL2A 3VKHA 2RB4A 4ZO4A 1WB9A 4DUGA 4JYBA 1DAEA 3PR1A 3REFA 3QXJA 1NVVR 4HB4A 5EE5B 4KCGA 3GLIE 3I5XA 1II9A 1GP2A 4OKSA 4RJLA 3VAAA 4PZZA 1IJEA 1T9HA 2ZAMA 5JWRA 2VHCA 3RC8A 2G77B 3BORA 2W6IA 3VHXA 5HZKA 5FI0B 1NVWQ 1P62B 1XRJA 1ZRHA 2O8DB 1TEVA 2RGNC 3LW7A 2R62A 4PAMA 1MR3F 3K0SA 3GLGB 4XH9B 1P2SA 4GMXA 3FMPB 3THXB 2REOA 3RC3A 3A37A 1GNPA 4NYJQ 5FBVB 1DELA 1OYWA 2QG6A 2WMOB 4QJ3A 1TUIA 1G3IA 2ZSFA 4UNSA 2F7SA 4GZLA 4BLQA 1G4UR 4ON9A 2J5XA 2ZRKA 4NYIQ 4Q4LA 1NNEA 2CE7A 2ZRAA 3ZLJA 2JJ8A 1VG1A 2CK3D 1VHLA 2XOKA 2XAUA 4JVMA 4DC9A 4RFVA 4CEJB 3ZH9B 5EP1A 4A36A 2WJVA 3A1SA 1SXJA 4JBWA 1FMLA 3AGQA 3KB2A 3W3ZB 4MGIR 2BC9A 5CJ2A 1AZTA 2Q3FA 2CL0X 2ZRJA 4A0HA 5L3QB 2UKDA 2G88A 2WIAA 4RVCA 1RZ3A 2RMKA 4M1TA 3P27A 4UNPA 4HB2A 3RS7A 4B34A 1YHNA 1Z0AA 5C4GB 4DLWA 4OHVA 2WWXA 4F93B 4LBYA 1JJ7A 1XBTA 4RCYA 3OFNA 3P4XA 4EFNA 1VCNA 2OUKA 2RAPA 1XPUA 1IOZA 3A1VA 4I4LA 3EARA 1NG1A 1X86B 3MRSA 1S3GA 1U9IC 4DKXA 3QSYA 2QTVB 3LA6A 3THYB 1DAGA 2OCPA 3PEYA 2VF7A 1PLJA 3LBIA 1S9DA 2W6JA 1X1SA 2KB0A 4M1KA 2FSHA 4JVLA 4Q00A 4ILEA 3AP1A 2GNOA 2QBYB 4ZDJA 1P9RA 1S2MA 3A4NA 4LDJA 4LUCA 4M1SA 1ZD9A 5EE9A 1BOFA 1N0VC 4M53A 1NBMA 4XVQA 3SYNA 3SR0A 1OPXA 2VP2A 1XD2A 2Q0HA 2CDNA 2L0XA 3I92A 3RRYA 3NTUA 1IN6A 2CVHA 2H8KA 4BFSA 3NIBA 3O8RA 1OE0A 3K8YA 2GILA 2ZITA 3BERA 2F1IA 3EZ9A 1S8FA 1JQJC 3M1IA 5IT5A 1EFHA 4JBXA 4NYMR 1P6XA 4OK5A 4LJAA 1XMVA 5BYJA 1PZNA 4QGHA 4TWZA 3ADCA 2CBZA 1LY1A 3E1SA 4TT3D 3WRYC 4A8JB 1MOZA 2ATXA 4HLCA 5HE9A 2QPAA 4M1WA 3B78A 4LV8B 4NTZA 1VYUA 1PUJA 4DDWA 1VMAA 4OJKA 4Q03A 5SZKB 3OIWA 1ZD8A 4TZ0A 5FPHA 4PC1A 3CH5A 2RGCA 3R7WA 1HYQA 3R9IA 4FCWA 4BRWA 1OB2A 2WVJA 3WMGA 2ERXA 1KGDA 2ZJAA 3ZVNA 2ZRCA 3KUCA 2IT1A 2YHSA 3TSWA 5D3MB 1N6PA 3KFXA 1XEWX 2UZ3A 4JT2A 1W4RA 4FMBB 1LV7A 4C30A 5TXGA 4PX9A 1W1WA 2D3WA 4DSUA 4MDFA 2BWJA 4Z51A 1IN4A 3LNCA 3IEUA 3QVVA 3N2IA 2OBNA 2P2LA 3QF4A 4TSFA 4AKIA 2AWOA 3EA5A 3O47A 3G0HA 2Y8EA 4ACBA 4Q7KA 1TEXA 2RGXA 3NHBA 4OQFA 2O0JA 1ZNYA 1RW4A 4AG5A 3HWSA 1RE0A 1J2JA 3FKQA 3X1YA 1BS1A 1D2NA 1HUQA 1RRGA 2CHQA 5H1YA 3M6AA 4QJ4A 1QHYA 1QVRA 2JLSA 1KI6A 5AR1A 3PCRB 2AXPA 4M1YA 1F48A 3BK7A 3D6TB 4L8GA 3OEHD 3R8CA 1W44A 4A6PA 1SQ5A 4C4PA 4IEEA 3B9PA 5JJLA
chains in the Genus database with same CATH superfamily
5KIAA 3QXSA 4RTJA 2NMVA 2ODPA 3OZ7A 1QVAA 2NSHA 5E9WA 3PI7A 3ROZA 2HV8A 4N9WA 4XZ3A 3I32A 4NZOA 1T13A 2OZVA 3GXBA 3AVWA 1JH8A 4DIDA 2A9PA 1CFZA 5JW6A 3H5WA 1JU9A 3B1KA 3QY0A 2H08A 4L4RA 3V8VA 1J7KA 4E1VA 1XMOB 1DAOA 2QXTA 1Z3IX 3ED1A 3FZQA 2A67A 4J1TA 4MQ6A 3T15A 2BR5A 3B48A 1YBMA 2QMUA 4IYJA 4O1IA 3SIWA 1F7UA 1BEUB 4LJ5A 1TM4E 4LHXA 2LKCA 4L3VA 4RAOA 5F1PA 2WTUA 1QCCA 3HJFA 2G1KA 5HVNA 4HQ6A 1FUKA 1F6DA 3GJ4A 1VKHA 3K7EA 4EJSC 2Q9AA 3A2MA 2JIQA 1R88A 4X8LA 4FXPA 5CEFA 1V4VA 2HQOA 3UA4A 4B4KA 4MKRA 1NJ5A 3QEMA 3ESXA 1V95A 3I28A 4I50A 3GY0A 8LDHA 1WPGA 3LAWA 3RAPR 1NRXA 1DRVA 1DAPA 2ZQ5A 4PPGA 5IMBA 1RTTA 4IHKA 4GM1A 1Z7WA 1DI0A 1X8JA 2IZ1A 2WFLB 1R8JA 2G40A 3DOJA 2X76A 3LT1A 3GLSA 1Q2UA 1FRQA 4Z7JA 4D4KA 1YNOA 5ITVA 5JY1A 2P1DA 1HH4A 3HKBA 1AB5A 4RZUA 5GGYA 3TX2A 3WX0A 1OLUB 2XGOA 2Y2UA 2MSCB 5ALTA 4PYIA 4QU8A 5CFOA 4FYHA 5CYGA 4B4UA 3F8SA 5BSTA 3R6TA 1NNI1 5F4BA 1ONSA 2V65A 3E2PA 1BMTA 3X1XA 3HXPA 3IBSA 4GGPA 2CJWB 2AWNA 2OAGA 3EZGA 4JEMA 4MUJA 3TB4A 4DPLA 3IV7A 1XK7A 3FW1A 1G19A 1UODA 1Y9AA 2KQUA 2ZRPA 4MP3A 5AKJA 2G8LA 3PYXA 4XRGA 3PTAA 1RQRA 4IF6A 2EZUA 2C00A 1NOKA 1KBQA 3AJEA 4N7MA 2Q07A 5FNVF 4L50A 3BH6A 3H4TA 2B4AA 4PX5A 2ZBUA 4Z99A 1XHEA 2RHGB 5HSGA 1SQ0A 1TQ6A 1QHFA 1VCHA 1FFGA 1OLOA 4HX2A 3NGLA 1A96A 2EWWA 4M4SA 4NK4A 3EPJA 2XMCA 2ZYTX 1BJRE 1UXOA 2D5CA 4TPKA 3VR0A 1ILWA 1M75A 3E9EA 2CKMA 4HY3A 4MPPA 3WLTA 1I5OA 2BHRA 4UZFA 5IYZF 1DAKA 5BNWA 3ZE7A 3UM9A 4GLJA 1SBHA 3EVDA 3A6KA 4QGBA 3SJAA 4C4AA 4DIEA 3FDXA 2GN4A 3CINA 1F17A 3A4TA 2C2ZA 4X6YA 4AO6A 5JAQA 2BDEA 1Y6FA 2FGKA 3INRA 3KD2A 3P9XA 3ZWPA 2DFKB 1S4QA 1ZIDA 1F51E 3ILSA 4KMSA 4TKVB 4W8OA 1MH1A 1ZJYA 2J0UA 5DTIA 3GRFA 4MKIA 3PNKA 3ZH2A 5FTKA 2PPLA 1IPFA 2H4YA 3I37X 4YNBA 3OJ0A 4IQ8A 3N3BC 5F2NA 2Z1NA 3AMVA 1AKEA 2LIVA 2X7JA 4M22A 2XQKA 3GJTA 1M0WA 5FRDA 4YT4A 2BTQA 4EB3A 2FEMA 4F9TA 3G8DA 3NEAA 1HMYA 3MYYA 4OH7A 4K46A 1L5GB 3UJAA 4D02A 3FNRA 4OHOA 3CA8A 4X91A 3ZD7A 2JRCA 4I9FA 3C3AA 4KDRA 2GXSA 1SO8A 1XTJA 4QA9A 1GYQA 4F4DA 4LBZA 2OHIA 3DG9A 2INGX 4KO2S 4MGKR 4NFSA 4MW6A 2OD7A 5K3EA 3QHAA 4IV0A 3K0AA 3D2BA 3G13A 5CVVA 3TEJA 1S3FA 3D2AA 4AF7A 1FTQA 3GROA 1YIOA 5FO0A 3RW9A 3ZHXA 4FNGA 3R8XA 3B1FA 2A0FA 4H7KA 4L8WB 4F72A 3TOSA 1QKJA 3PQCA 3AY3A 4PN3A 4KUHA 2QD1A 3HDYA 3N0VA 1O57A 1H4TA 3BKXA 1F8UA 5HHTA 9ABPA 4YJFB 1JUDA 1PNQA 4YRZA 3THWB 1KEWA 3OECA 1M8FA 4XCXA 5JSZB 3HH8A 2Y1GA 2JHCA 2YYZA 5EMHA 1WVIA 3PWTA 4BYGA 4EPYA 3TPZA 4TS9A 4L57A 2XGGA 3LP6A 1KOFA 1R74A 4U0JA 4CKCA 3IAAA 5GP1A 3E53A 3B2EA 2AIRA 1PG2A 1HYEA 3L8YA 3PGA1 3E4CA 4P34A 4BQFA 3J7TA 2IYAA 5EIHA 2EFJA 4YFVA 3WZMA 2JJ1A 5FBQB 5L4NA 4IJWA 3R1IA 5YASA 1UWLA 3AHEA 4I2NA 4BLPA 1BKSB 1E99A 1U1GA 3DLTA 1EHIA 2VATA 3ZGYA 1Z4OA 2P4EA 2BZ1A 5K0EA 3CT6A 3PE6A 4CM1A 1UP7A 1PTJA 4BNKA 1E62A 3OOEA 3L1KA 4YRLA 2IW3A 3FVTA 2BELA 2B6HA 1MU0A 1U5CA 2AXQA 1PEDA 4KBGA 1D7AA 3W6NA 3OZSA 3A8TA 4JP1A 4BKOA 4NKRA 1EFDN 4Z4HA 3QK7A 1F6BA 2H2HA 4Q82A 1JPJA 2BHTA 3NUGA 4L72A 1VE5A 5KKCA 1X2EA 2ZREA 2VCHA 3EG9A 4BBPA 3KWFA 5DX8A 3VYRB 3U4MA 1E9SA 3AVOA 3SC3A 2W11A 4S1VA 5KOJB 3TSAA 3IQXA 4TL9A 4IQGA 3VR4H 3URKA 1NM5C 3HKCB 2AMFA 2CW5A 1XMXA 1LBEA 3F96A 1JG2A 1SJ9A 2QMQA 2WIFA 5LIPA 1PV4A 4BQRA 3BIFA 3CUVA 5IG2A 1MJGM 1AXRA 3QG1A 1MC1A 3GRCA 4FFRA 4P80A 4DLTA 1N5OX 2G72A 3IULA 4UEQA 3WL6A 3H9CA 3N87A 1IXKA 3TNDA 3OQPA 3PJEA 1P45A 5FTJA 4EATA 1T6NA 3WRXA 1DUIA 1RHQA 3HA3A 3KQOA 3C3DA 3UMJA 2GKSA 3F6SA 4KWCA 5CRIA 3URMA 3WE7A 4DXDA 2WZBA 1H1DA 4TZTA 3VBEA 1A7AA 1C1DB 1HURA 2EX0A 3P4YA 1KK0A 2IYWA 4BLOA 1HE8B 3H5NA 3NBKA 1EVJA 3A1EA 3NBZC 3R6WA 4N3NA 1RI1A 3NH6A 3LDFA 4V2IA 1ISRA 1W6UA 2CFRA 4X9XA 5FA5A 3VTFA 4BV2A 3PDIB 2N1BA 3I04M 3ROXA 3AB3A 4PYMA 1CQIB 1Q83A 1J2TA 3BWDD 3LC7O 4I99A 3KDAA 2C78A 3MLEA 1PJ4A 2AFRA 3U7FB 2V97A 3KR1A 1BQEA 4YRNA 3JALA 1L4NA 3E7XA 3M6UA 3REQB 4NNOA 3D4NA 4BB0A 1G1AA 1QM5A 2M1ZA 3DL0A 2ID4A 3FHLA 3MWDA 5DDIP 5K20A 1UBSB 2HNAA 4IZHA 1PVVA 1SZCA 3HXKA 4MA0A 2QN8A 2C2KA 4Y2PA 3QW4B 4LCBA 4C01A 1LX7A 3ZKWA 4PWZA 2PDAA 3FNBA 4IS3A 2KMLA 4PVCA 4N3BA 4LJ6A 1X6VA 4H27A 1N33B 1YB6A 1NIPA 1JYFA 1MRNA 1QH1B 2AOTB 2OCBA 4KXNA 1ZN2A 3S2UA 3KBOA 4FYWA 5IVIA 2ZUEA 4IDQA 2IZ0A 1KO5A 3KALA 4D6XA 5KTKA 2HA5A 5K4AA 1WSBA 2WOOA 3DMNA 3ER9A 1IJBA 4HUJA 3IQFA 4MGEA 3WNQA 2NQTA 2E5LB 5JISA 2RGEA 4PLFA 4FINA 3PVCA 3UJ8A 3V8MA 5H83A 1JE1A 2ZVJA 2VHQA 1G2OA 5DN6D 2Q21A 2YH2A 3IJPA 5A4IS 1KP9A 2X2OA 4OK3A 5EINA 1K6IA 4PS0A 4O4IF 3UV7A 4CKXA 2QRNA 2IODA 3IQZA 4XJXA 3ZKAA 1O58A 3ML1A 2QKYA 1O5IA 4Z4QA 5CVCA 4B5KA 3B1VA 4HZIA 1MO4A 1NI4B 1SOAA 1G0NA 3QE2A 4CMHA 2FZVA 1VJGA 3LWDA 3LXXA 4FDVA 4HH3C 2NYUA 3UV6A 2EFHB 4MEBA 1QLHA 3OM9A 3DWFA 3IUSA 4IUCS 1R0ZA 4RU1A 4ZOBA 5ICGA 3I62A 3MWYW 1EFPA 3M6VA 2O1EA 5I7EA 1NW3A 1LRJA 3A1NA 5CFQA 3EJWA 1ISIA 2PX4A 1MX3A 3P9PA 4GOND 3K5HA 1U2ZA 1FB5A 3D6AA 3KKEA 3KLNA 4DV2B 5JV5A 4RCVA 3ZR4B 2DUWA 2KJQA 2JIOA 2W43A 4KVZA 2FRXA 3AHIA 2QRVB 5I8PA 2PUCA 2PVCA 1S96A 1T2FA 3U7RA 4JJ4A 3M2TA 3VNSA 4ZVPA 1FNNA 3O90A 4FU0A 4KRYA 1L8AA 4X64B 3MB8A 3IJ5A 2JL1A 1OXUA 2GK7A 2OO5A 3CVWA 1YJ8A 3OOSA 2WB2A 4QUIA 4YJGA 8ABPA 4KPUB 1GZVA 1T4GA 4XSGA 3FTFA 1JEEA 2OBBA 5GMOA 2BV3A 1SBZA 1U02A 2HU2A 3OCZA 4YX9A 3F6BX 4KQHA 5CDTA 1A82A 2GRAA 1B0UA 2X8LA 4L9AA 4U2BA 3I2FA 5HKBA 4FM9A 2X9QA 2DSTA 3ZE8A 4PPNA 4IWYA 5EP4A 4DBZA 2PQ2A 1T3LA 3DPUA 3MTEA 3PV0A 5B1IA 2QEQA 3I0ZA 1FQKA 4Q12A 2C5LA 3FRHA 3TUJC 1KR5A 1JW9B 2OECA 4FEYA 5IC5A 2IU4A 1NU6A 3LQKA 1VIAA 5E1MA 1QOPB 2JJ2A 4GBED 4JJ8A 4FB4A 4H18A 5FOSA 1JQEA 1VQ1A 4F11A 3IODA 2GBLC 2ZRQA 3EUAA 2QXUA 2DGDA 4URXR 2XITA 3LL7A 3OPNA 3KPYA 4B3MB 3IUBA 1DJQA 2FZ4A 3MJSA 3F3KA 3KJFA 4LIPD 1AA9A 3W6PA 3LIIA 5A6SA 2V58A 3CR7A 3ZPXA 2PGNA 4O1MA 1QIKA 1K6XA 1NUHA 1YZVA 5GV8A 1P75A 3ZU4A 4DB4A 4MMZB 4N6OA 1C8LA 2A88A 3JQ7B 3MTQA 1WB6A 4YJKA 5IDVA 2BEVB 1SVNA 5DHPA 3TJRA 1AHHA 4YP5A 1XAJA 3KWLA 4F46A 1LDNA 1LWNA 4DDUA 3E5HA 1LDGA 4REMA 2IV7A 4LK3A 4JI8B 3BFPA 3M33A 1X1RA 3WFJA 2FTKE 5B7PA 1C7RA 3H2HA 5FFMA 3Q9UA 5DW0A 5K0ZA 1NVBA 3O4VA 3GMSA 3U9TA 2O57A 3ZHVA 3VSEA 4EHBA 1SXGA 2C2HA 1NWHA 1YS6A 2FUG1 4ZAVA 4DG5A 1PQYA 5BR1A 3KCQA 2KPOA 4Q3BA 5KX5B 1C4OA 3MPOA 2XB6A 4IGEA 4N0EA 1I2DA 4ALKA 1F1BA 5BMVF 5LKAA 4NJMB 1U3GA 3MGAA 4L9SA 2IKQA 5F73A 2AE1A 3B3GA 4AB1A 3G2NA 4TVBA 1XVAA 1Z4JA 3EGCA 5CMLA 1Q1BA 3NWOA 3K1AA 4NBKA 5D5HA 3NIDB 4XVUA 1U8UA 4YJ3F 4E5MA 4FZ5A 4EFDA 2QM8A 2PUAA 4EI7A 3TE6A 4URUR 4B76A 1WDWB 4XFJA 3WYFA 1CR1A 5EIBD 1OH6A 3LUKA 4ZVRA 2OHVA 3UB4A 3MS2A 3M49A 1T0PA 4CCAA 2X8WA 1ECLA 2REQA 1AS0A 4MRAA 4EGCB 3OUZA 1PKEA 3MRTA 2NO7A 4MUEA 4YQFA 5IUNC 4EYGA 5JSQA 4CM8A 3FHJA 1IQPA 2XW6A 4NV0A 3GFFA 4ENSA 2HDNB 2JA2A 3FHTA 4CQJA 4JJEA 4OUDB 1JIKA 2O50A 3KKKA 4YPOA 1FVFA 3VJKA 2Q2VA 5AXCA 2IHYA 4ZT4A 1BXZA 1W36D 4EX6A 3BB4A 1MB4A 2JGRA 2D1YA 2WV7A 4XEUA 5AKYA 1ZGJA 1E4VA 1V7ZA 2CNWA 5DSXA 2G80A 5CB0A 3TECE 1K98A 2HF9A 1OH8A 3IR5A 3QUCA 5CDUA 4B3GA 3MLAA 2IXAA 1VECA 5M04A 4BGDA 1M33A 3I72A 4HTAA 2R8RA 4YAJA 1CY4A 4YBRA 4I55F 4JR2A 3ACDA 4XVRA 5FXMA 3N8IA 2QW1A 1OX6A 3FJ1A 3IXLA 4RQTA 3FYHA 4EJFA 1ZONA 1KC1A 3TD9A 3ZE9A 1KQNA 2NXCA 2P41A 3ND5A 4HWKA 3MMPA 1ZY2A 1Z18A 1JHZA 1AKMA 2MDTA 1X7YB 1PW5A 2J9ZB 2VUTA 3AONB 3H2BA 3WYDA 3SFTA 2HCFA 3NANA 4MVJM 4P4SA 3RYCB 1D09A 2ZBGA 4LTDA 1IY2A 1HYHA 3RRXA 3T7JA 1HTBA 4X7MA 1G8PA 1JRLA 1YD7A 2CYCA 2FQ1A 3GFBA 3PXCX 5EIFA 3W2IA 2VCYA 4RDHA 4YGXB 4OEHA 4AS1A 2ZU0C 4ANFA 4KXLA 1RJ9B 1X70A 3TEFA 5GADl 2IX9A 3L0SA 2G8NA 2WHPA 3K4QA 5ALSA 3DD1A 4LZJA 3JRWA 1JECA 1R2QA 1V8OA 3CLRD 3QSGA 4ZZ3A 2EW8A 2P91A 2O7QA 4WJKB 1IBMB 1LV8A 1LUAA 4BNZA 1B8UA 4A0FA 4IH1A 1ZW6A 3EBOA 5JTTA 4N7JA 3RYFA 1U8XX 2ATEA 2X40A 4OA8A 2DQ4A 621PA 3BREA 3L4BC 4IYRA 1X1QA 2FP4A 2II6A 2GO7A 3CMMA 4K9KA 4KV9A 2C0QA 4OHWA 4F1WA 3OJXA 4MVWA 4PU0A 5KS2A 4X90A 4JC5A 3W3AA 4XB2A 5GOTA 4OCZA 1UBCA 3EASA 1EA7A 1HLGA 3HZZA 3L2OB 4XYBA 3THOA 2WC1A 4NBWA 4BNFA 1O4WA 2VDWA 2E18A 3AB7A 3MRVA 4FEGA 1SG6A 5DSTA 2VEDA 1Z5GA 2CL7X 3BCRA 4WL0A 5CK4A 1O94C 4ARBA 4YLGA 4WA7A 1FDOA 2F3RA 2ANBA 5IBCA 3IHTA 2O8EB 1XMJA 4TKUB 5AJWA 3ANSA 2B6NA 4R6WA 4TL7A 4RGBA 2WIKA 4WCDA 5CIQA 5DGTA 2CNLA 4D9HA 2FX3A 3CCCA 2XRYA 1NTRA 3WBKA 3W1WA 1JJFA 1RXYA 4CV3A 1H5UA 3T3HA 3KZ1E 4Z0TA 5EIAA 3TLBA 2P5SA 4FOPA 3S1AB 4U2FA 1CJMA 1C30A 5LU9A 1XXHA 1N2HA 3DZBA 2LCQA 4R9UC 4MB0A 4Z3DA 2R1UA 5BR7A 4EMUA 3ZVMA 4R1OA 4BO2A 3CZPA 1SMKA 4OQLA 4AF6A 1OW3B 3SNKA 4D45A 3OX3A 2C99A 4H59A 4BFWA 4BL5A 3LK7A 4NRDA 2WJIA 3MA0A 5EHIA 4BNYA 1OI2A 3LGAA 5T5QA 1SXIA 1R10A 1YZQA 3I23A 1UXGA 1CRZA 2QL5A 2XCQA 3AFOA 1HFJA 1FFCA 3KPWA 2VHUA 2CK3A 4HWSA 3TDMA 3KYCB 4MLZA 3Q8XB 1J0EA 1UMBA 4R2HA 3CCFA 1CU1A 5ADHA 1VSQA 3SZUA 4OHXA 3SSAA 4RK4A 1GAWA 4QVKA 3UHFA 1L3BA 3KQUA 1ADBA 1JQKA 2O7NA 1RWOA 4GZ3A 5T3UA 2D4AA 3KOOA 3L06A 3N6XA 3VVBA 4UTNA 3ZJTA 1Q12A 1M1YA 1EUYA 2OCDA 2H4XA 2JARA 2GESA 2J87A 1TLLA 2YZ2A 3ZJYA 1MPXA 3PCXA 1T36B 2XKBA 1RPZA 1GEGA 2PS1A 4II3A 3RROA 4UU0A 1JV2B 2R6R1 1E63A 2J33A 4E5VA 2X0DA 4R01A 3I83A 2AX4A 1TZ2A 3VYVA 3D43A 2HMTA 4G63A 3C5EA 2ONYA 3TQSA 5DRYA 4I50F 1D2RA 5DISB 3KKLA 4HXEB 3CZCA 3FDIA 1NVMB 1NYRA 3ISTA 4MWTA 4J1SA 4RGQA 2I2CA 4B2YA 2DBVO 1SZPA 2H7CA 4QJ5A 2AOVA 5J2UF 3TZKA 1KJWA 2QE6A 1EX6A 1W4AA 1XU9A 3VU8A 2EKPA 4UC0A 1W85A 2VPTA 3K72B 4REQA 4L5AA 3HGTA 2A1UB 1CC1S 4MKZA 2NXWA 2R6GA 4N8EA 3SBOA 1LDEA 2C3UA 4BHTA 2CLFB 4OXNA 3B3QA 3C24A 2RH9B 4RMGA 3AI3A 1Z73A 1YR8A 1DUSA 2A5JA 1X1TA 4U4AA 3IMKA 1M1NA 1H22A 1A7JA 3TLZA 1YZKA 4X61A 4Q9LA 4A91A 3DLCA 1KQFA 4Z7NB 3TUIC 1K7SN 2WG1A 3K9HA 3TTYA 3V1NA 2HU7A 2QL9A 1O89A 2I2BA 3D6JA 3QH4A 4AICA 3ZE0B 1JFFA 2GM3A 4LHYA 2ALJA 2WMYA 4LX8A 4M6WB 4MWGA 4MRMB 4WZBE 2AOWA 4BWYA 1JDBB 1V8ZA 2WKQA 3WGZA 3IDQA 3TXXA 2RE8A 3PL1A 4RABA 1SCUB 2ZYAA 4OAQA 1JHAA 1WUJS 2XWPA 1HLFA 3JU3A 4B3TB 2R4UA 1V45E 3WIDA 3KDSE 2X6TA 3IMCA 3IP8A 4H3SA 4LWOA 1L5HA 3L41A 4O4JA 3G2OA 2YW9A 3IC5A 4AM8A 4NV1A 1PIWA 2QYOA 4OO3A 5DHTA 1CY7A 1WDMA 1ZD2P 2YNMC 1SXJE 3F7NA 4DY6A 5C32A 5BUQA 1O6BA 2AD1A 2I67A 3K0FA 5EI5A 3ICVA 4IJ6A 3FSRA 2EJUA 5J4LA 3VX4A 1A8UA 2XHZA 4MJ3A 2GXAA 4RHUA 3PEFA 2C5HA 3A36A 3DHWC 4ID3A 1J0DA 1GT6A 1GUZA 1QYIA 2E89A 2EX1A 3KJXA 3NEJA 4Y9TA 3KQQA 4BKPA 4Q34A 3SSMA 5B6PA 1IOVA 2AC4A 1GNRA 1GNVA 1Y3HA 2YV5A 3DLBA 1WZNA 3PSHA 1YWGO 1J5EB 3KKPA 3DAGA 4Y30A 4GXTA 3A4VA 3OCUA 4FHFA 5CDYA 2B9EA 1AF4A 4FMCF 4M87A 3W90A 5JY6A 3W7AA 4LXGA 3CW9A 1FS5A 2YZMA 3H8JA 2Q4BA 3ROEA 4I5IA 2HXGA 3HPRA 4YK7A 4LYDA 2AOXA 1G7RA 2ZANA 3PPXA 4XX0A 4YFYA 1MZVA 2DT8A 2RI1A 1NF3A 1DAHA 1P73A 1QTQA 1IRXA 3L5OA 5PNTA 1M0SA 2P62A 1WHTA 1D1TA 2YMPA 1JU4A 3P0HA 3SXPA 5D85A 3VPBA 1EINA 2H1RA 3C3YA 2TMGA 4HPXB 1X87A 4EG1A 5AVUA 3R9KA 3ADPA 1PZMA 3UUGA 3A0RB 5THXA 1Z8NA 5BWMA 3ZU5A 3QLUA 4BJ6A 3CBQA 5M3BA 3SZRA 4G1EB 4U7PB 5EVJA 4CETA 1NULA 5GGXA 4H0CA 1C3XA 2BD0A 2I62A 2IL1A 3MC1A 1NJ6A 5G2OA 3WRWA 2J9RA 1WMFA 4QUJA 4ZXPA 5ICMA 4N6NA 2H2DA 4IG4A 2R1ZA 4HLQB 1HTWA 4IDHA 4UTZA 3U7JA 2WT8A 5J4YA 4BZWA 2G28A 4LOHA 1W0JD 1KRHA 3S70A 2J67A 3EYAA 1JLRA 4GQBA 4HFNA 4HTFB 4YV2A 5K8VA 2ZJ5A 5KQLA 5JXJA 2XBMA 1IYZA 4HH1A 1C5KA 4KO3S 3DT8A 3BJZA 1RZRA 3DTYA 2Q6KA 3PB3A 1KNXA 4BNMA 1WMSA 2CB9A 4ZHQA 4HDKA 3QY9A 3OZDA 1JHUA 1VCOA 5AK4A 1DEKA 5G53C 3B9BA 4EKNB 2VWGA 1AKRA 2OMEA 4EGAA 2I66A 1DQYA 5K0TA 3BXOA 2B8NA 3A11A 1XJ5A 3Q7SA 3SHTA 2JHAA 4UTVA 3HJAA 4ZJPA 5IMSA 1NW5A 3RK4A 3LG2A 5K0SA 2ZYWX 1RRCA 1DFHA 4CFSA 1LPPA 2TMKA 4N8DA 1YQUA 2VWPA 5K45A 3E81A 5AWFC 4OGWA 3U1TA 3P9SA 3Q3HA 2HU8A 2BHLA 4D8XA 1DWQA 1WVMA 1KI8A 3BXGA 1QLJA 3E22A 3OT1B 1Z6YA 5ALGA 2DF8A 3OZEA 4X8MA 3TM4A 5IVKA 4Q16A 2IUYA 5ARCA 3VKVA 1YJQA 2EATA 4LBVA 1O96A 2X4DA 4UBJA 5AM3A 5FUVA 4ETWA 2REXB 4JI4B 6LDHA 1LQUA 1HORA 4M83A 4CQMA 3WK9A 4RE5A 2ZCJA 2VYCA 4LY0A 4MR8B 1P5ZB 1EFLA 1KY2A 2AMJA 2Q6VA 1CS0B 2XKAA 2ZULA 3ANYB 3DJFA 3JYOA 3K35A 3ONWA 3AYZB 1V48A 4JYPA 5E6RB 5TVGA 2ZROA 5HUQA 3MTBA 2JBWA 4LOKA 4UAGA 3OLCX 3EX7C 2ZRIA 5E9JA 1JB9A 1N7GA 1N1EA 2AJTA 4MCHA 1LS1A 2CFTA 2CLSA 2I2XB 4XUGB 5DBHX 1Y7TA 4WXMA 2N47A 3RVSA 2HOQA 4EL0A 3QVGA 3B53X 5FT9A 1E5QA 5CW2A 4RA6B 1GVNB 2ATCA 1WXFA 1D6SA 3NVDA 5KTPA 4XI9A 4FPXA 3R7SA 4MKHA 2WM9B 2VNHA 2FQQA 2BMDA 4ZPJA 5AW4A 1JEQB 4TWAA 5AIBA 4LE1A 3HVRA 3EEBA 1PLLA 3L7JA 2J3HA 1EQUA 2O5RA 3WL8A 4B3FX 3P2JA 3WLKX 3KXDA 4ENRA 1ICIA 3GZTB 3U3MA 3VYUB 2WF8A 4U2KA 5WRFA 1CERA 5BYKA 1YQWA 4EEZA 4EUFA 2DKOA 4BUJA 4EL5A 3Q85A 3EFOA 1W9HA 2ZVPX 4P2GA 5DTJA 4LZNA 4P3XA 2CXOA 3HWX1 1ZHOA 4MHTA 2ETVA 4NY1A 4E3ZA 5FL7D 1FJXA 3EBLA 3ZGLA 1NQWA 3OZVA 2DTEA 4DABA 2FNAA 4RAQA 3F5DA 2K4MA 2RCNA 3O92A 1A5BB 4MUXA 2VDLB 4Y2JA 2GWRA 4CMGA 2V5AA 2UUPA 1C0KA 3GLQA 3A6GA 3SDZA 4QDZA 3A6DA 4MYRA 2ZIXA 5LA6A 1RAEA 5DI9A 3W6ZA 1Y6RA 3Q87B 4N9QA 2Z98A 5AM5A 2IYVA 1KVQA 5AJTA 2XVMA 1LTQA 3D0OA 4EITA 2P2GA 2JCVA 3T7KA 3D6UA 3B3JA 2XZPA 1A9QA 2ZTMA 4NH0A 3RFTA 4GEGA 3A6FA 3SBDA 4MZDA 1J07A 1YK1A 4BMSA 1U8ZA 3ISJA 4LXQA 1JXAA 4ZRNA 4NU0A 2HBYA 1O0SA 1U8CB 3OLWA 2YVKA 4WLNA 4MV9A 1NVEA 5EHZA 2GRJA 5AOAA 3P4UA 2O7RA 5CB8A 5LLSA 5IABA 3KYDA 4JBYA 2FSVA 1ZSYA 3GFSA 4PM4A 3LOPA 3SQWA 3PFFA 4NYMQ 1KAMA 1M2OA 1ZFNA 4BN5A 3OZGA 1ORRA 4HXFB 4QUAA 4MS4A 5HWSA 5FPPA 5K3AA 1F8FA 2ONKA 2RGBA 1RKBA 1WUIS 1TT7A 2J5BA 1PEKE 2PH5A 2ZU6A 4M0DA 4Q4AA 3LNTA 5BXYA 4HLNA 1REQB 4GKJB 1A9XA 3H1EA 4LXUA 4D0LB 5JXIA 4OJNA 2NTNA 5J9FA 3DKKA 3A9SA 5TSDA 4ZI7A 4KR7A 3CKLA 4W5TA 4I46A 2VHVA 3FKJA 4PVDA 4WOKA 4FB5A 2XEDA 3DAOA 3HBLA 3L4SO 1KI4A 4BFYA 2C29D 3V7YA 4NYIR 1Z37A 3JPWA 1ZYUA 4RK5A 4IOJA 4D9BA 4ZOLB 2XGMA 5CG1A 2BPOA 3PDJA 1L0BA 2O8FB 2X2FA 3REOA 4PNPA 3R09A 4LMRA 5KOHA 3EQ8A 1GDDA 1ODKA 3VNBA 4AZ3A 3GUHA 3KHUA 5CLGA 3LGXA 3ONEA 5JDIC 2SNIE 1HWYA 6AT1A 1ZK2A 2BKAA 3KDPA 4GG1A 1XZPA 2YJ5A 3SVTA 5K09A 4GR5A 4RACA 4TXMA 1YRLA 2HYDA 3RD5A 2GCEA 4PGAA 3EGOA 2E0IA 5IEBA 4D4JA 5AJHA 4QTXA 4KACA 3WLMA 1HFWA 1S01A 4BVKA 4GOMD 4J7UA 3W78A 3ZCQA 2WP8J 3IB6A 2BKLA 1PKXA 2W7TA 4OQQA 3RIXA 4BB9A 2C9MA 4DNQA 2XMSA 1PUIA 2IUSA 2WHXA 4M9RA 4FCCA 1A95A 2NUTB 3H05A 3QVSA 3ZZUA 1T1EA 1SCIA 2NUPA 1DV2A 3IELA 3R5HA 5DPMA 4YP7A 5KPJA 4YJ2A 2ZT7A 3ZD6A 5K8TA 2A0WA 1DIRA 2W2NA 1I8TA 2P6UA 2OD9A 3OIYA 4M9ZA 4QBKA 1N6RA 9MHTA 3EDQA 1RMTA 2I87A 3IO3A 1D07A 2JIMA 3B6MA 3E35A 3WWOA 4DR6B 1H9BA 3S2YA 2JANA 4UCQA 4A9AA 4CM4A 5FFFA 1QH9A 1YZGA 2WSYB 1LBQA 1BWQA 3RFFA 4WZBB 4G8DA 2VRNA 3Q0TA 1V4BA 1YI0A 4HEJA 1WXXA 1YQGA 1VXOA 1ZRSA 2JIZD 4NONA 5CNMA 1B73A 1TM5E 4MUKA 5K0GA 3ZWMA 2FSGA 2TMDA 1UEXC 2VWHA 4EH1A 4JVOA 1BWRA 2LKDA 3CEMA 4C78A 1DOZA 2HHAA 3KR9A 1ZMBA 1VSVA 4CR6A 4WNIA 3FUCA 4J6EA 5A7HA 4D81A 4X92A 4MO9A 4WZAA 4OHPA 2O3SA 1MX9A 4H7FA 4UOEA 4ZVUA 4HUQA 5B3AA 3U2QA 4WRRA 1D4OA 2B1JA 2BFCB 2C04A 3GW8A 3P1JA 4P3PA 4QUEA 5GJVC 5IAGA 1L5KA 1UWKA 4CIYA 2WILA 4HVCA 4FSDA 5K99A 1XALA 4RX1A 3SJBA 1K4MA 3B7GA 1N0WA 4BGUA 4Z7OB 2GKOA 5FBHA 3DF7A 1SPBS 3LHFA 5C7OO 1THGA 1FRNA 2B3DA 1WW3A 1SGWA 1T1RA 2P2NA 4GRDA 4ZYZA 3SOPA 4NFYA 2P2YA 3FLBA 4LX0A 3L7CA 4PXYA 3G23A 121PA 3G0IA 1DFIA 1M3SA 3D2LA 4NC9A 1V8PA 3PNLA 4BP3A 4TMTA 1MNQA 2OAQ1 3AC0A 2RH5A 3PX2A 3WNCA 4UEKA 1L3IA 2FFBA 1XJ0A 4A82A 4B3XA 3PC8C 5EXTA 3R6LA 3TLMA 4J1NA 3CPJB 1S4MA 1N78A 1QKKA 1CUCA 3KZOA 1F2TA 3ORYA 2EBUA 4P98A 5BYBA 1XKXA 3X3HA 3PEWA 3AXSA 3QU5A 4GF5A 4DA7A 4DLLA 5K6AA 1VBKA 1EM8A 3O4FA 1NAIA 2JD1A 2R8EA 2K5UA 4Q1AA 5C46F 3U4QB 3GLRA 3VR3D 3T7RA 4HDNA 2VRBA 5ALXA 5ULLA 3WSTA 3DOUA 1U28C 2E7ZA 2FLKA 2I1WA 4IJMA 1PWEA 1TYCA 4RTMA 2G3YA 1HT1E 1HETA 2YIJA 3BHJA 3CEJA 4L0MA 2QRHA 4OQEA 4Q0MA 4QVGA 1UPCA 5CB4F 1X38A 5PGMA 2NG1A 2WT4A 5KTRA 3Q7PA 1Q0LA 5G0SA 1OYOA 1YVEI 3VV2A 3ZCRA 4G0QA 2X0RA 4HAWA 5BNTA 5AI9A 1K97A 3D3KA 2QY9A 1J06A 4DLSA 3DOCA 2FPPA 3E18A 5F35A 2FH5B 3L7YA 4GIBA 1YE5A 3HBAA 4D9EA 2UVQA 1SOUA 5JARA 2L42A 4B44A 2FUEA 3FHOA 4M49A 3C14C 4XGKA 3I42A 4OH1A 1UBUS 4ZOAA 1K8QA 2VLIA 1SHTX 1SOVA 4KIGA 2PSDA 3OU7A 3I6BA 3ABIA 1PFYA 2OXFA 4LWPA 4D41A 4Z5XA 3G7UA 3N2KB 3EF1A 4PANA 3X0DA 1IRIA 1R9NA 2ZPAA 3IVMA 1U2GA 2QWXA 4J0JA 1MABA 4JJKA 4KMMA 2OXEA 4Y9DA 4F3NA 2O8VA 2F3SA 1PJSA 3MLBA 1TU0A 3JY6A 3VR2D 3VBCA 4CL3A 5IM5A 3RVPA 3G5UA 2GSDA 3IYLW 2QI9C 3VU1A 2HXSA 3DEAA 1QHSA 3Q2OA 1E9RA 1TCAA 2XODA 2YZNA 3PC7A 3EWAA 1RXUA 4YR7A 4D8WA 4D5EA 3UBTA 4D4MA 3CE9A 4H60A 1C4WA 4M36A 1ZCAA 1M2GA 2ID7A 3PIDA 4JT9A 1I30A 2IGBA 1L7OA 5IT0A 1WXHA 3DE0X 1VB3A 4X6LA 2ZIUB 1PNTA 1CWUA 1PX2A 2HRBA 4KDFA 3BTVA 1JDBC 2A35A 3KT3A 1RYHA 1U2DC 4G1VA 3PC6A 5CR9A 5EP3A 3TFQA 1ZH6A 1P7CA 3L43A 2QZPA 3F6RA 1IWOA 2AOUA 1NDUA 2H18A 2QA5A 1DRKA 3H5IA 3G2HA 2BF7A 2I76A 3KTAB 4P7KA 4DT1B 2MMGA 5GZ1A 2JCBA 5HDQA 2B4RO 3W9BA 3HM2A 2BGNA 2XY4A 4FCTA 3NM6B 1OAOC 2FRDA 4ARCA 1CZNA 2J9FB 3AIOA 3TGWA 2W6ID 2GCOB 2GWHA 1MXHA 1Q1NA 1MAVA 2QQGA 4BX2A 1XD9A 4FT2A 1HSOA 3DNPA 1SVLA 3QLJA 3C0KA 3R3YA 4B3RB 1RI4A 3JYNA 1U3TA 2WUEA 1R5BA 2QQ5A 3FH0A 3IUMA 4LYJA 4LW8A 2IPAB 3T9BA 1Y80A 4C6HA 4ERXA 1AO0A 2YFQA 3OO1A 1U9CA 1FLAA 1Y5NA 2GZHA 2R2AA 2X5NA 3PK0A 3VR1A 4Q7LA 3UC5A 2VQSA 2HMVA 5HX7A 1BVRA 2NTEA 2PMFA 3IQGX 1I80A 3PENA 1DNPA 2CGEA 3C70A 5FPYA 1YB1A 3O4JA 4AXXA 2XOKD 2AR7A 2YWJA 5C53B 4TYNA 3AUYA 4DA4A 1OA0A 3DB2A 4PLHA 5LKRA 3CTMA 3GGOA 4I6JA 2OZLA 3U7EB 3CRQA 4RGYA 3MXOA 4BVHA 3ONVA 4S1OA 4EJSA 5JASA 4RVHA 5I5GA 1YU9A 2I6SA 4PG5A 3RAGA 3U4DA 1XZNA 5CGQB 3EGIA 4E5YA 3V8QA 4AAYA 4IMIB 2BJWA 1WP9A 2R5FA 3JYPA 4PZDA 4DYHA 1GYRA 3GD5A 4Y6GB 4N48A 4GVPA 2ORYA 1OCEA 1IHPA 4EPTA 4ESVA 1IXZA 1GU1A 4O33A 5BWOA 1NUQA 2GA9A 5D5QA 4WK0B 3G82C 2XTNA 1F06A 1JDPA 4D6YA 4JROA 1UL1X 3QMPA 1HDXA 2RGRA 4A15A 2VSYA 5AVZA 1TVEA 2AFVA 1CZUA 2R87A 1W88A 4UBNA 1I6LA 4D9JA 1V6AA 4F1JA 4MPRA 2W2PA 3BZUA 3PVZA 1XCMA 1AQIA 1YCHA 2GZ1A 3S28A 2YFHA 4E4YA 4N41A 3IV9A 3TG8A 1M34B 1RLMA 4GZ5A 5K3OA 4AZ0A 2FZ5A 2AEMA 1KH1A 3DUFA 3E8XA 2DX7A 2OV2A 5KHOC 2XUGA 1D2GA 3KX2A 2WK1A 4KLCA 5IC4A 4B32A 3O0DA 2IEZA 3IOBA 5JXGA 1IVNA 2UYQA 3EF3A 3PF8A 1QCYA 3RV3A 4L51A 1EE2A 1K92A 3ZXUB 3D0KA 5LSAA 3H04A