3MG9A

Teg 12 binary structure complexed with the teicoplanin aglycone
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
290
structure length
255
Chain Sequence
b'XXXXSMNGIRWIASYPKAGNTWVRCMLAAYITGKAPQVWNDIDAESLTLEAMLRFGDLPPAEPMEPVLVKTHLKADVPVLGLYGEATAKVLYLVRNPRDMLLSSMRMASISRDDVEKSRDFARKFIANEGLGWNGGVGLGSWPENVRSWTESSSDRFPNADVLTMRYEDLKGDPVARFSEIVEFLDLGGPVDIEDIRRAVAASTLERMRELEKRSEGRYDQSLSFLGEDIESDYQELLHGDSGFALYAKQYGYAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TEG12
publication title Crystal Structures of the Glycopeptide Sulfotransferase Teg12 in a Complex with the Teicoplanin Aglycone.
pubmed doi rcsb
source organism Uncultured soil bacterium
molecule tags Transferase/antibiotic
total genus 92
structure length 255
sequence length 290
ec nomenclature ec 2.8.2.-:
pdb deposition date 2010-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3mg9A00
4PPFA 5KDOA 2P5TB 2X1VA 4V0NA 3MWYW 1OF1A 2YNMA 4TTRA 1OYWA 1TQDA 2OSBA 3CBQA 2WOJA 5KTYA 2J0UB 3ZD7A 3HYRA 1KO8A 3BOSA 4IFBA 1GFIA 3GFTA 4HB2A 1CJKC 2QY9A 4OHZA 3U3RA 2BKEA 4LHVA 4C2UA 1WMSA 1OSNA 4GZMA 4Z1MD 2B92A 2CJWA 4S35A 1UEJA 4C0SA 5KOYA 3N2EA 4PC3A 4TLBA 2VRWA 2JCSA 4PO9A 2FG5A 4US1R 1E2HA 3TGPA 2GXAA 2YJTD 1AA9A 3DOEA 4JVSB 2BHRA 2H8KA 1FOEB 3AF1A 3M4YA 4X8MA 2IS4A 1H8EA 3O47A 4KAXA 1ZUHA 3U4QB 1VYUA 1VG9B 1Z83A 1IY2A 3AEZA 1ZAKA 3LLUA 1O87A 1NG1A 5K8TA 1SXJA 2CVHA 1KO5A 3ZLJA 2F9MA 2FGKA 1TTTA 1F2TB 3K0CC 4XJXA 2JLWA 3GLFE 2ZJ5A 3BXZA 2IYVA 4L16A 3K0FA 1G1MA 1XTKA 1YZKA 3GEEA 1SQ5A 2ZRMA 2ZJ2A 5GVSA 1KO1A 4MKGA 4FW9A 2VHUA 4MRSA 1XPRA 4CEJA 2GILA 4KYIB 3U3OA 1WA5A 1QG2A 5FPYA 3TUJC 2V3CC 1D2MA 1ZNZA 3OEHD 3NBZC 1UDXA 1N6OA 5J4HA 1YRBA 2ZI4A 3FHCB 3QEOA 1NN5A 2VP5A 1KAOA 1NKSA 1W5SA 2RKOA 4XVQA 3Q5EA 3QG1A 4A0RA 1E99A 1GKUB 4PZZA 4PSVA 3ZYCA 3P20A 1JAHA 1U81A 3SR0A 1SXJD 2VA8A 2Q6TA 4PAOA 1DBSA 1OXXK 1GITA 2FWRA 2Q3HA 2ZS7A 3LWNA 3GLGE 4UXHA 3EAQA 3TIFA 3UATA 4BZXA 4NHOA 3SYLA 1MRNA 1OIWA 4BZPA 3RS5A 2ZROA 2YYZA 3QF4A 1CIPA 4JLAA 5JJLA 2GEVA 1N2CE 3D31A 4US2R 4UNNA 2IYUA 1E9AA 1JR3D 3NC0C 3KQNA 2QAJA 1LFDB 5JJIA 4ZCLA 4ZIRA 3ZZTA 4GL2A 1JQJC 2PEZA 4BRUA 2ZUDA 4ZDWA 4XWKA 5JI2E 2C95A 4FN5A 5L3SA 1R7RA 1XZPA 1ZW6A 3QPVA 4A15A 2XZPA 2QSYA 3FB4A 1ZBDA 2CLDX 1WB9A 2QTVB 1XXHA 2OILA 3DZ8A 1Y3AA 1E0JA 1S96A 3T5GA 1YZLA 4MRNA 5FBVB 2QPAA 4JLJA 1KJWA 1M1YE 3MWKA 1Z6YA 4LI0A 5DI9A 2HYIC 1Q1ZA 1G3RA 1TUIA 3AVQA 1AQUA 3RANA 1HYQA 1KIMA 3P26A 4ASUA 2ZANA 5B30A 3LFUA 4QM7A 3DHWC 4ZDJA 1GRNA 4B43A 1NLFA 3PEYA 2WICA 1T4GA 1VMAA 4MRPA 3BD9A 4ILEA 4AK9A 2R44A 4TN1A 4XIGS 2J1LA 3DKPA 5A4JA 4FWTA 1KI6B 4NH0A 2WAXA 4NBSA 1J90A 1IBRA 5GJWC 2H5EA 1AS0A 2OHFA 3HU1A 5JZVA 1CLUA 5AJZA 1I2DA 4HLDA 1Z08A 4CRWB 4RKEA 5C2JB 2DR3A 1E1QA 3CIOA 4I1UA 3X1ZA 1E0SA 1EK0A 2C9CA 4TL8A 2YHSA 4WIAA 1G20E 3EG5A 4H9GA 2OBLA 4FCWA 5TB5A 3LQRA 3S1AB 1KY2A 3LV8A 4JKIA 1G7CA 4RD1A 2GDJA 1VECA 3I4LA 2HT1A 1KK1A 4GPTA 1E1RA 2W6ID 4LHXA 1YR6A 4PSKA 3OESA 1Q57A 3GLHB 4ZDKA 3VKWA 3I1FA 1ZP6A 2FOLA 4C2TA 3WY9A 4DLXA 4URUR 1WXQA 1FMJA 4D25A 1SVKA 2ZRJA 2ZRIA 3CONA 4ZKEA 4TTPA 2BMFA 2A3RA 4K8OA 4V02A 2ZR7A 4IDNA 2O8EB 3IKJA 4KVAA 1PUJA 4JL8A 1E9FA 2IYTA 3CNOA 2RGCA 2EFDB 2CCGA 4MGIR 1E2LA 2BM1A 2Q3MA 1RC8A 2PBRA 4B2PA 4AYTA 3AH8A 3O8BA 4I1VA 4Q7KA 4PO1A 5FFMA 1L4UA 1RRFA 3N5CA 4P4UA 4JLBA 1I4TD 1ZM9A 3V9PA 1N5KA 1XB2A 4RD6A 4AKEA 3K8YA 3CW2A 1OJLA 3IIMA 1CKEA 1XCMA 2ODBA 2VHQA 4C0HA 2C96A 3DM9B 1Z0DA 4TTQA 4FIDA 4X8OA 4W5WA 4HI0E 1F3OA 3AB3A 2FA9A 2V55B 2WKRA 3LRPA 4PZYA 4M1KA 4AURA 2GCPA 4V03A 2ZI7A 1E79A 3I8XA 3LH5A 2DCUA 1XEWX 4AI6A 4D80A 4MKFA 4N1AA 2KI5A 3M1IA 4PHTA 1RE0A 1LNZA 3PENA 1XNJA 1KY3A 3CWQA 4Q4AA 3DKVA 1NBMA 2V9PA 3P1JA 2Z0MA 3RSOA 3UANA 4A8JC 3WBJA 2GVDC 1KZ7B 1QRAA 1DVRA 3B1VA 2JDIA 2HEIA 4F93B 4GOXA 3H4MA 4LJYA 3KQLA 3TQCA 1AZSC 4XD7D 2CJWB 5KNDA 1E96A 3MCAA 4DC9A 3RDPA 621PA 3EXAA 4M9QA 4X8HA 3C5CA 3SBEA 3KTAB 1VCNA 5FUXA 4Q02A 1FX0A 1UBFA 1RRGA 1UJ2A 2H57A 2GJSA 1VPLA 1Z0FA 2QM7A 3MUFA 4HAXA 1KGDA 4G5RA 4B74A 3EIQA 4PFSA 5CM9C 1SXJB 1P2TA 4RD3A 4KLZA 2DWOA 2OCPA 3VR5A 1W46A 3BFVA 2VTKA 4Q9JA 2GZDA 1P72A 3BRWD 3T1OA 3PEVA 3SQXA 2JEOA 5JWHA 2AWNA 4CEJB 1Z0AA 2H7VA 4FMCF 2VSOA 1IJFA 2W2TA 4CEIA 3OEED 1XD2A 2QA5A 3ZS8A 4HZUA 2A5GA 5FOSA 3T1VA 4A6XA 2R6CA 4EPXA 5DISB 4ZV4A 4FMDF 3A36A 4ESVA 3WRYC 1GNPA 1NRJB 3CKLA 3QNUA 1IQPA 4C0QC 4TT3D 1U0HC 4BZQA 3WYGA 2OM2A 1OFHA 2FFQA 1R2QA 1NSFA 3B1YA 4AIIA 1AS2A 1U8ZA 2QZ4A 4DLYA 1IN4A 2CLCX 1E9EA 1KMHA 2OO7A 3A8TA 3IHWA 4PC1A 3GMTA 1SKYB 2VLIA 1CJVC 4LBYA 3VNVA 4JMPA 3CH5A 5JECA 5B64A 2NGRA 3ECCA 1E9CA 1KKMA 1S3SA 1II8B 3QF4B 2ZSEA 4J0QA 721PA 1T3HA 2CL0X 1NF3A 2ERYA 4LJ4A 4IDPA 4L8GA 4MYCA 1UKYA 4ZI3A 1P6XA 4L5BA 4URZR 5C4MA 1U0LA 2Z83A 4AY2A 2GAOA 2ZI3A 2ZAMA 4LHZA 3UMRA 1Q1QA 3KB1A 1AKYA 2WV9A 1DAKA 5JHGB 2JLXA 2JLQA 1VIYA 2FSIA 2D62A 1GL9B 4BUJA 4WOPA 3THXA 3BGWA 2IS1A 2OAQ1 4LC1A 4DCUA 2F7SA 3RVBA 3X1DA 1ETUA 5KDDA 3OIVA 5J40A 1G4AE 4LYHA 3WHLA 2O8BA 2R6FA 5FTNA 3KZ1E 1TQ6A 3TAUA 4Q1AA 3K0SA 3AF2A 5F98A 4W7SA 4IDOA 1BH2A 2PJRA 4H1UA 1N6HA 4B3BA 4E07A 3CRW1 2GXQA 1M74A 4GBMA 2YWFA 4HAYA 4LJ6A 5KPJA 1Q22A 1IJEA 3OE7A 4FMCB 3NH6A 3TQFA 2EWVA 2WJGA 4JLKA 5J47A 4AYXA 3GEHA 4RFSA 4FMDB 1NVXQ 4D26A 2CHVA 2ZSAA 4M1OA 4D0NA 3KKQA 3WYAA 2JJ2A 2VSFA 3SS8A 1HE1C 2A9KA 2O0KA 5JEDA 1ESMA 3LDAA 3AVOA 4DSOA 4EPTA 2EFCB 4HUQB 2UZ3A 2J3EA 1MOZA 3E2IA 3P32A 4P31A 4H1VA 4D4LA 2HXSA 2Y8EA 1FUUA 2ZE8A 4NYIQ 2XB4A 3CZQA 1E2EA 3UG7A 2GJ9A 3QJYA 4M53A 1SVWA 2R62A 4C0AC 3BIFA 2NO7A 5E7IA 2XTZA 5DIFA 2XB2A 1RJ9A 4PAQA 2CL7X 5AUOB 5GADl 4OQXA 1IXZA 2IA5A 1N6NA 2BJVA 3MG9A 2Q9AA 2N42A 4Q47A 1AKEA 2OLKA 1G7RA 2IYYA 2W83A 2B8TA 3CR7A 221PA 2OT3B 3IQXA 1Z3IX 2HF9A 1OKKA 3I62A 1Z06A 4U7DA 1Q12A 4Y0AA 3OFND 3K70D 5AUNB 4V0MA 4LRWA 1JQLB 2PX0A 4DEYA 5AWFC 4NE2A 1KI8A 2VQSA 2XNDD 1C9KA 4DLZA 5CIQA 4DB4A 4TMVA 3Q7QA 3W6OA 1G8HA 1OFTA 2F1IA 4LY6A 2J59A 5CLQA 2C9OA 2ZS9A 1IY0A 2HLDA 1XX6A 3AP3A 3EC2A 4DHEA 2IT1A 2EYUA 4DDVA 4NCHA 4NU0A 3U44A 1L8QA 3EZ7A 3VQTA 1U8AA 2WZQA 4PX9A 5ANRB 2ZRCA 4W5JA 3E70C 1UADA 2WSSD 4EQ6A 4URVR 2GF0A 2GBLA 3FE2A 4N0EA 4DCNA 4BFWA 4WXPA 1GG2A 5B58C 2FH5B 2MSCB 2V7QA 1VG8A 4L9WA 2ZXUA 3AKEA 1DELA 3EWAA 5CB6A 1NLYA 3T5DA 2OXCA 2W00A 4ABYA 4JSYA 1TQ2A 1V43A 2D2EA 2D7CA 4C4PA 3SC3A 5H8WA 3NHAA 3R9WA 1ZM3A 2J45A 3DVLA 3H1TA 3P27A 1JECA 1IONA 3KXIA 2D06A 4D0LB 2FFHA 1Q44A 3UK6A 3EPJA 2ZYTX 2YKGA 2IYXA 3AGQA 3MFYA 3A4LA 5JSZA 5JCPA 1KNXA 3A6PC 1TNDA 1Z28A 4AD8A 4ZCMA 1Z63A 2IYLD 1AZTA 3AP2A 4M9SA 2QMUA 1GKYA 3LBHA 1XJ0A 4B3DA 3G82C 5IHPA 2ZE7A 1U98A 3GJ7A 3AVTA 3DL0A 1FNNA 3JVUA 4C7OA 4QJ5A 4P0TA 1LS1A 2A5JA 2PEYA 1KDRA 3B60A 4M2LA 2WWXA 2OZEA 4O25A 3PG5A 4R7ZA 3QPWA 3TNFA 3FMFA 3D7MA 1XTIA 4KFTA 2BEKA 5B2ZA 2IBMA 3A1TA 3QSYA 1J70A 1E2JA 4I1OA 2JIZD 4NCKA 4FCVA 4K46A 1CR4A 2GAAA 4Q4HB 2CHQA 1DADA 4MKIA 1D2NA 1AGRA 1FQKA 2VSXA 4V0OA 2W2VA 1L4YA 2ZRNA 4OJQA 4BPBA 2WJJA 4CEHA 5TDHA 1BS1A 3M6AA 1Z0IA 1WP9A 5CB8A 2Z5FA 2X2EA 1R0XA 4K81B 4G5QA 2FPLA 3UMFA 3IDQA 3C14C 2GXUA 3CF0A 3K09A 4XSHA 4BFXA 5HPYB 2XJ9A 2QRZA 3W9YA 3VKGA 5DLQC 1BOFA 5BYKA 3ZVMA 1A2KC 3ZIAA 1XBTA 2N1BA 3R7WA 4UNQA 3L0PA 1MR3F 4TLEA 2PCJA 4GNKA 1M7HA 3BK7A 3SZRA 3FHTA 4E03A 1EXMA 1IN6A 2BCJQ 3DO6A 4LDJA 5E4FA 3FVQA 1YZUA 4IJMA 4CW7A 2DWQA 5CDFE 4JLDA 2FFBA 3TRFA 3P4YA 2JJ8A 2MSDB 2V4ZA 1NVVQ 2W2XA 1T9HA 2QROA 3WNCA 1MV5A 3SEAA 1KO7A 1CR0A 4HSEA 4OI2A 2OFOA 2GESA 4DJTA 3FMIA 3LXRA 1E2MA 1SVOA 1KKLA 2CNWA 1ANKA 1N5IA 4IVQA 4Q4JB 4DZZA 5DN6D 2O8BB 2OG2A 1UF9A 2WPDA 2A7QA 2EWWA 4QNRA 1F48A 2BKUA 3DZDA 1FMLA 3SU8A 2OESA 4RFVA 5IRCD 4U5XA 1F6BA 3MLEA 2AFIE 5DHFA 1GWNA 2RHMA 1LV7A 2DPXA 2IWHA 2GZAA 4DSNA 4BFYA 1COWA 3K9NA 1UKEA 2C03A 1DO0A 4KU4A 3RWMB 1D9XA 4XTCS 2QAGB 3KFXA 3BJIC 2PL3A 4KITB 2ZJZA 4RFSB 1M34E 4B76A 5JWOA 3CPEA 5AJXA 3QBTA 1ZINA 2QE7D 3W3AA 4DT1B 1XTQA 5CYPA 3QXSA 1G8GA 3SOPA 4C9BA 3LBNA 1T3LA 4M21A 2NOAA 2WWYA 4GMXA 2CNWD 3FOZA 1NN0A 2WMNB 1NY5A 4OKSA 1YE8A 4EIWA 5TV2A 1J8MF 1XD9A 2EW1A 3EPLA 3GFOA 3GQBA 4MH0R 4QKQA 1KI7A 3TSWA 1F2UA 2XZLA 3RNLA 3K70B 3D6TB 4LV5B 4XWAA 2BC9A 3QG5A 4IOKA 3J81k 5EP2A 3EA5A 1KJYA 4KYUA 1CF4A 3NEYA 2VO1A 2ZS8A 1UDWA 5K8LA 4TQUS 2ODWA 2YOGA 3RRMA 2MMGA 2XEXA 1VYTA 3BS4A 4Q66C 1CR1A 3L0OA 1LTQA 2ORWA 5AR1A 1NSTA 1RJ9B 3MD0A 5HCNA 3EASA 3T12A 5BN4A 1GM5A 4TQAA 2I1QA 1HH4A 5CIWA 2HYDA 5IT5A 2VF7A 3KKNA 4F4CA 3FMPB 4HLUC 2HJGA 3K0AA 2ZEJA 4BRWA 2J7KA 1A1VA 3O8CA 3ADBA 1R5OA 3SJAA 1G5PA 4O0MA 4NYJQ 2A5FA 3CX7A 5IF9A 3T34A 3HR7A 3A37A 4DSTA 5A0FA 2G6BA 1OYYA 1QZXA 5EE1A 2BDTA 4LJAA 4C0BA 1HURA 4IHQA 5KNCA 3HP1A 1W49A 3JZAA 4A2PA 3UWKA 5D3MA 3ASZA 1WBDA 3THYB 3ZD6A 3B6EA 3RHFA 1RVDA 2IXGA 1HY3A 3TBKA 4OI1A 2P65A 3O8DA 2OCAA 5AJVB 1YKSA 3GLFA 1BIFA 5JRJA 1ZCAA 1OH7A 3U44B 1YR7A 3EC1A 2GRJA 5JI3E 1US8B 2FU5C 5LBIA 3U7FB 4KJZA 3MJHA 1ZNYA 1D9ZA 1PUIA 2JJ1D 1NNEA 4D2IA 2KSQA 2VHTA 3HDTA 1JR6A 1SXJC 3KUDA 4MRVA 4JKYA 1Q0UA 4MA4A 4TLCA 5KHOC 2K5UA 1AIPA 3QQ5A 4HAVA 4RZ3A 3AF3A 3KJHA 3WRXC 421PA 3LW8A 3QKRA 1F5NA 1VHTA 3GLHE 4DCTA 4QGGA 2W6JD 3RWOA 1YZTA 2Q9BA 2J41A 4MUBA 5FUWA 5HKKD 2G0TA 1LW7A 5EP4A 4RD0A 5JSZB 2WJIA 1GNQA 3GLGA 4FI3C 3EZFA 4OI0A 2P2LA 2ZAOA 3T35A 2F55A 3PV0A 1R5BA 1EFTA 2GTPA 4LJ5A 3K9HA 3RC3A 2O8DB 2Z6VA 1N6KA 2CCKA 2Z4RA 4ERNA 2EFHB 2XITA 2J7PA 1J7KA 2WM9B 3I3SR 4EDHA 2BCGY 3TVDA 5HZHA 1QVRA 3AQ4A 4AKIA 1EWRA 1X1SA 3H84A 1MO4A 3ZQJA 3AM1A 1NLZA 2AXPA 2J9RA 4G5SA 4QG7A 3LO5A 4ARZB 1P2UA 4NL4H 2B8WA 1JI0A 3FGNA 3AV0B 2LKDA 1M6NA 1KNQA 3C5HA 1QHIA 3Q72A 2WKQA 1GZSA 1T0HB 3L0SA 1H8ED 4BFVA 3U5ZB 3R8FA 3NEJA 4M9ZA 4TSFA 5TVKA 1NJFA 4JZKA 1A82A 1NMXA 3KJEA 4PC2A 3QPUA 2R6GA 3N2IA 2O8FB 4CEHB 2PLFA 5JLJA 5KSYA 5EP3A 3OIYA 3CF2A 5AJYA 4IXMA 2FSHA 3BORA 2R9VA 3GD7A 4Q7JB 1S9DA 4TMXA 2C04A 4TZ6A 2PMKA 2ZITA 1YR8A 2XSZA 3A1WA 2HCJB 2VEDA 4RCZA 3K0CA 2H92A 1GL7A 2VBCA 5GVRA 2WOOA 4ACAA 2ZE5A 5JHHB 4LJ8A 3IGFA 4I1SA 5JBQA 1EFRA 3BB3A 3VR2A 1ZM7A 1ZC4A 3ZVLA 4OJKA 5AUPB 4Q9IA 4UJ5A 5FR2A 3GP8A 2A5DA 2VIIA 1SXJE 4B75A 1W4RA 2I3BA 3AKYA 3FMOB 4BE7B 3CM0A 3OAAA 4QBIA 1UPTA 5C1BA 1YU9A 5FH9A 1YZQA 3W6NA 3NBYC 4B2IA 5J5CA 1VYVA 3B1WA 4A4DA 1XMSA 4BLSA 1N0WA 3QKSA 1EGAA 3AVPA 4LOAA 1T8UA 3KDSE 1YHNA 1TF5A 2CXXA 3GJ3A 1NMZA 2BV3A 3NH9A 3T61A 1JR3E 4OK3A 4U00A 2A78A 4JYBA 4DB2A 2QL6A 3UKDA 1P73A 1W48A 3FTQA 2QP9X 1G8FA 4LJ7A 1OH5A 2ZJYA 1A2BA 3TH5A 4AWXA 4EPWA 2D74A 5E7MA 1FTSA 1ZYUA 3U3MA 2YC4C 1NVUQ 4Q1BA 4N3NA 3H0KA 3RAPR 2JLUA 5G3YA 4B3CA 3GCGA 4W9MC 1U94A 1XEXA 4WAUA 2DB3A 1G5TA 1MH1A 1E2FA 1SKYE 3M0EA 4TLDA 2KE5A 2ZSDA 4EKDA 3W3ZB 5FOWA 3U60B 1SVIA 2ZVPX 3PUWA 4R2HA 5EXSA 1OV4A 4MGYR 3A1UA 1M2OB 1SKQA 4ASUD 1P9RA 2C77A 4YC7A 2FV8A 1A7JA 1AJEA 3FKSA 1T3SA 2R8RA 1G64A 1KJZA 2ZRGA 3IILA 4LHYA 5KSPA 3RS3A 3GLIB 2PJZA 1J2JA 3B78A 4DBLC 3AKCA 2DFLA 2AK2A 3BFKA 4DLWA 1E9DA 4D4MA 4YDSA 4TL7A 2ZRDA 3ZVNA 4RZ2A 2OEPA 3VHXA 4CGZA 1KTVA 2EYQA 4L4UA 2AXNA 1N5JA 1ZM2A 3Q8XB 2YINC 2ZM5A 4KVGA 5JEEA 1MT0A 2XTNA 1E1QD 4OK5A 3TW4A 1OH8A 4Q18A 3K0AB 1ZD8A 1GVNB 3U6BA 2FSFA 2WWIA 3ND9A 1P75A 3U2QA 3B1ZA 4KBGA 1E2KA 2BBSA 5K8IA 2VP0A 1R5NA 2R6AA 1E1RD 1R0YA 2BBOA 1QHXA 3NKVA 3Q7PA 3CRRA 4URYR 3C41J 4BFUA 1XPOA 5D3MB 4IDQA 1NIPA 4NZYA 2BBTA 2E87A 4BLTA 1TEVA 1MO6A 3QIAA 3BWDD 1OXTA 2DYKA 2KBEA 1EESA 4KSCA 4RKFA 3MMPA 3W34A 1S0UA 3LX8A 3SJCA 1MO5A 5FPSA 4O3MA 4Z54A 5FTMA 4A2WA 4L15A 5CK4A 1TAGA 4X8LA 1S2MA 3PCRB 4AC9A 1KYIA 1SHKA 4DLRA 1W36D 2MSEB 1S4QA 3Q5DA 1KK2A 2NZJA 3A4NA 4QXAA 2IX3A 2IL1A 3QKRB 1KI9A 3WP1B 1FQJA 4EJSA 1BKDR 4KI0A 3SYNA 3ZS9A 3UMSA 4MUAA 1CJMA 1E79D 2P6NA 2C2HA 2BBWA 4QGFA 1KAGA 4ITRC 2OFWA 3HPRA 4GMDA 2FN4A 1J99A 2BMEA 2N46A 3CPHA 4WBSA 1NBMD 1CR2A 1TX4B 3K0FB 1P2VA 3THOA 2VYFA 2CK3A 4B2LA 3CH4B 2GCNA 2JDID 3PUZA 4NYMR 1SVMA 2CLSA 1FPMA 4OQFA 3AGPA 3Q3JB 3ZJYA 1DAMA 2GK6A 3LBIA 1G41A 4OQMA 5AK0A 2B21A 2EQBA 4JBYA 4QBFA 3NTUA 5TARA 2QQEA 3RS2A 1CS4C 1T0JB 4PHFA 1U99A 4OL0A 4PXAA 4OQNA 4LJ9A 1E98A 3EIEA 1M7BA 1G16A 1GNRA 3BH0A 1OFIA 1RZ3A 1XU4A 4JLVA 4WA7A 4JL5A 2ZYWX 5H68A 1RFLA 4ZPXA 1G7TA 1U8YA 3KL4A 5F3WB 4JIMA 4D0GA 2KWIA 4MITA 1EWQA 2NZ8A 2O8CA 2KB0A 2WKPA 2NTYC 2GF9A 3F3YA 3LY5A 3AUXA 3NXSA 2ZPTX 2XZOA 3SFZA 1LVGA 3LW7A 1G4UR 3D3QA 4XWOA 4G01B 5FTKA 2JLYA 2QORA 1K5DA 1VKJA 4AG5A 3U3KA 1Z0KA 2JA1A 4DLUA 1ESNA 4RD2A 3UG6A 2YWEA 4ZIRB 5CJ2A 1XJQA 3QI2A 2IK8A 1KSFX 2JGNA 4Q01A 4OHYA 4KSBA 1XTJA 3WHKA 5L3SB 3NWJA 5FPKA 2ECKA 1JJVA 2GA8A 2QM8A 1XXHB 1P5ZB 3QXCA 5FOUA 2FE4A 1R4AA 1ZUIA 2QAGC 1DE0A 4IOJA 1ELOA 5EZ6B 3VX3A 2ZREA 3TSZA 3AVUA 4GI7A 4IVPA 3MSXA 2GK7A 1G19A 2WJHA 4US0R 3RSLA 4NTZA 1II0A 2ATVA 4JL6A 4PAMA 1NP6A 1T5LA 3EZ2A 2QP3A 1QHHA 1N6PA 4LYJA 4M1MA 1CBUA 1HTWA 2RGBA 3EIHA 1OXSC 2AD1A 2CVFA 821PA 2B6HA 4Q1CA 2VH5R 2O52A 3DDCA 2D2FA 4KBFA 3TLXA 3AVWA 4EFLA 1UBCA 3K70C 1W2GA 1CJUC 3DOFA 2EVWX 4OHVA 2RH5A 3FDIA 1XD8A 2QEQA 4YDHB 4NCJA 4KFSA 2IC5A 3GJXC 4M1WA 4GZLA 2OBMA 1CXZA 4UKDA 3PUYA 1PZNA 5DI3A 1DTSA 1N0VC 1VG0B 2F1HA 2QTFA 4URWR 2XXAA 4KO8A 3EZ9A 4QC2A 1OB2A 5F2EA 1SULA 4NONA 4LHWA 3CNNA 4BGDA 5DNYB 3WP0A 4B6EA 4W5HA 4P4TA 4OYHA 2FEMA 4BFSA 3I5YA 3AVYA 1B0UA 3OE7D 3CX6A 3KKOA 4ZCIA 4Q9LA 3HYTA 2YVUA 5EE9A 5EXTA 5KSOA 2EFGA 3PIRA 4QHYA 2QQ0A 1K5GA 1E4YA 4P3YA 4E09A 3UPUA 1XMJA 3L8YA 2ANCA 1G18A 2BJWA 4JJZA 4LPSA 2JJ2D 3B1XA 2ODNA 3B7GA 3WMEA 3FFAA 1KI1A 5FL7A 5HZKA 1JAIA 1RPZA 1LY1A 3GPLA 3THWA 4RSGA 1VCMA 2QBYA 2H1LA 1W36B 1KI4A 4YLGA 2G83A 4TMKA 2D3WA 2RAPA 4YMVA 3CB4A 2PZEA 1P7CA 1IOZA 2EFEB 1LF5A 2VP6A 5G40A 3B13B 4CVNA 2LWIA 3V4RA 1WDTA 3HWSA 4P4SA 1YRAA 2IYSA 4B3XA 1X8LA 4NDZA 4MDEA 3SYKA 2O0JA 1E2IA 2ZRAA 1JEEA 3EARA 2FDCA 1SHZA 4DUGA 2UZIR 5TY0A 2VHJA 2FZ4A 3VFDA 1NIJA 3SJZA 3GJ8A 4Q4AB 2CE7A 4HUTA 2IYRA 2OUKA 1E32A 1KK3A 1OKKD 1NI3A 4LV8B 4QGAA 1FP6A 3ZZUA 4B34A 3FHOA 1Z8FA 2V54A 3LVRE 2PMDA 5BN5A 1FZQA 2IEYA 4LGMA 3C16C 2AR7A 4TWZA 2FFAA 1BMFA 1L2TA 1E2NA 2XX3A 3GJ6A 4EJSB 1W4AA 5CLLA 4OK6A 1VHLA 1FX0B 4A2QA 1IN5A 1IM2A 1RW4A 2C78A 4KFRA 1UAAA 2WMOB 3CRVA 1VIAA 2FPMA 4Q03A 4G0NA 2HLDD 4M8NE 1OIVA 1G3UA 4YONB 1C1YA 1JPJA 3QOFA 2ZJ8A 3EWSA 1RRPA 3AF4A 3IBGA 1II9A 2RGGA 3QKTA 4M1YA 3TK1A 3C7KA 3U61B 2NMVA 3TKLA 4QOSA 4Z8XA 4LBVA 2QMEA 3TUIC 4TZ0A 4HDOB 3KFVA 2ZJOA 1SVLA 2V7QD 4JT2A 1MKYA 4S2EA 4TL9A 3SBDA 4CYMA 3QF7A 1B23P 3VNUA 1HUQA 4CEIB 5HR5A 3IEUA 1EG7A 1W0KA 4P33A 1XD2B 4F92B 1X3SA 4A0GA 1OHHA 1UKZA 1E9RA 2QENA 3LXXA 4HZUB 4UXJA 4WXRA 3U4QA 5EXXA 2F9LA 1DS6A 1D6JA 5IK2A 4DCSA 2IUSA 1VTKA 1XMIA 5CDFA 2BIFA 2ZETA 4PANA 2QP4A 2ANBA 1NG9A 3JZMA 3CF6R 1F2TA 1OLOA 2VP2A 3MJRA 5L3VA 2VL7A 4BLQA 2SHKA 3RC8A 3KQHA 2CL6X 2OLJA 2XAUA 2YOHA 1XPUA 1G8YA 1KMHB 1A5TA 2REBA 2V6JA 2PX3A 2W0SA 4HAWA 5FOXA 3L0IB 3W5IA 4KCGA 2ZRKA 4NKRA 3BBPA 1H65A 1QDEA 1IN8A 3EPKA 5HCIA 1G6HA 1S1CA 3VX4A 2ZU6A 5DGXA 1DAFA 1N3BA 4IVRA 1KZGB 3F0TA 1E2PA 1HT1E 2O0HA 4PHGA 2QPOA 1NN3A 2G1KA 2QTHA 5FR1A 4CT5A 2UKDA 3MAAC 4JBWA 4ZI2A 1GKIA 3ICQB 4BFZA 3WNDA 4LPKA 2HJVA 4JSTA 2BMJA 2F3RA 2ATXA 4QL3A 3UWOA 3I8SA 4I99A 1ZD9A 2P0EA 4GDFA 1GDDA 5EUMA 4M0LA 3THXB 1Z29A 3CPJB 1JXOA 1WRBA 3G0HA 2ZRPA 3B82A 3FPAA 1RYFA 4UNPA 4D4KA 4BEJA 2GJ8A 4QBGB 5KUTA 3KKPA 3ZH9B 3ZIAD 1W4BA 4PC7A 3VU9A 1ZM4A 1H8HA 3L82B 5GJVC 2RGNC 3IPYA 1AGPA 3TSOA 3AUYA 1BO6A 2A2ZA 1JALA 3U6KA 3CX8A 3W6PA 1FFHA 4TYWA 3R9IA 4IDHA 1U9IC 4EPVA 3ONWA 1OH6A 4JLPA 1XEFA 1U0JA 3ASYA 1JNYA 4MDFA 1LS6A 5CYOA 3W8RA 4MGKR 3NDBB 3RYTC 1R8SA 2H18A 3DMNA 5DI3B 2AHOA 2WPDD 2YWHA 3KJGA 3I72A 5EUQB 3TAHA 3G5UA 1SGWA 4C30A 3I73A 1E2GA 2Q3FA 5TXGA 2ODEA 2C99A 5FBWB 3PR1A 4EAQA 1U2RA 1RRCA 2REXB 2QI9C 3VR6A 1KI3A 2JATA 1KK0A 5H70A 4G3XA 1KI6A 3K0EA 1COWD 3CRQA 1OIXA 1XCGB 5CITA 4C0JA 4TMZA 1QHYA 1G291 1W5TA 1XJCA 2REOA 2GHIA 3T1QA 2I4IA 4LCBA 5FPTA 3R8CA 3BH6A 2C98A 4DIDA 1D8TA 3IHLA 1N0UA 2AKAB 4CDGA 4YXWA 4P32A 3W90A 2XOKA 4QHTA 2YZ2A 3PQCA 3S1AA 1L7VC 2NO6A 4RD4A 3E1SA 1X6VA 4NCNA 1A4RA 3SN6A 4BLOA 3THWB 3SQWA 4PPGA 2IXEA 1I4DD 1XRJA 2ZU0C 3DM5A 4JJKA 4RZUA 1T5IA 3GLHA 2GJAA 2D4HA 1JPNA 2XJ4A 1Z47A 1Q3HA 2ZSBA 3H86A 4B32A 1Z2AA 3C8UA 5D3QA 4V0KA 2O8EA 1ZRHA 4ZKDA 4LWZA 1JEDA 4Q9KA 1IXSB 1G21E 3CZPA 3IPXA 1G3MA 4MGZR 3A1VA 2XOKD 1P9NA 4DEXA 2QPTA 2WBLC 3NDPA 4EQ6B 5JFGA 1E2QA 1NMYA 3TE6A 3QKUA 4PQYA 1KO4A 1UBGA 4Z1MA 3VTKA 4JT4A 4B3GA 5EJEA 2XGJA 2JASA 4GOKA 4Q00A 5FUYA 5J4YA 4TL6A 3T15A 2YWGA 4A92A 1XF9A 1OT3A 1TU4A 4JLOA 1UEIA 4Q1EA 1W44A 3ADCA 4O2LA 4HLUA 4YMSA 2ZI6A 2E1RA 4DVGA 3GLIE 3B85A 4UXIA 3QBVA 1D2EA 4AYWA 2BOVA 1YVDA 2GNOA 2ZRFA 1QHSA 2J5XA 2J46A 4OI4A 1NY6A 2GWHA 2ZUCA 2PLRA 1ZJ6A 3B5JA 4B6FA 2GEUA 5KSZA 4C7OB 2G88A 2RCNA 3HU2A 3I5XA 3OEHA 4PPNA 3IEVA 1M8PA 4B35A 1E4VA 2BVNA 3KTAA 1Q3TA 2F1RA 4YMTA 2J87A 3QE0A 3U3JA 4I4LA 1CP2A 1XEWY 3MWJA 4YMWA 1OB5A 1W4CA 4QNMA 5FBQB 1XCPA 2HF8A 1XZQA 3K1JA 4V0LA 1XWIA 2AFHE 4BLRA 1KSJA 4LYAA 1EFUA 4GRAA 4Q1DA 5HTKA 5L3QA 2QSZA 3NC1C 2DFNA 5L8VA 1S8FA 2YOFA 2PZGA 2HXYA 4DKXA 1KOFA 4CF7A 5H1YA 2J7PD 5E95A 4F38A 4EPRA 1ZMXA 521PA 3U7GA 4IW3B 3BB4A 2ZUBA 3LX5A 1JR3A 2IYWA 4PZLA 5JCZA 4JLMA 2RB4A 3FKQA 4B71A 1PLLA 4HAUA 2OXRA 3R7WB 1CRPA 3EA0A 5C18A 4N0DA 1GAJA 4CZ2A 4QFMA 4XOIA 1T8TA 4A0FA 1ONBA 1Q20A 3MRSA 3C15C 4BASA 4TSFD 1P9WA 1X8JA 2WWWA 4R9UC 5DYGA 4NYIR 2QU8A 1VCIA 5IDVA 5TMPA 5LD2B 3ADKA 4B33A 2ZRHA 3JVVA 2BMDA 5CK5A 1Q1BA 1E2DA 4FMBB 4DXAA 4EFMA 1NJGA 3REGA 4TYPA 4D6PA 3NVAA 1II8A 2DWPA 3A1SA 1Q21A 3EX7C 1AS3A 3Q9LA 2JLZA 2G77B 1LB1B 5F9HA 1SVSA 1OXVA 2F6RA 4Q5IA 4POAA 2NG1A 2PT5A 1W2HA 1TPZA 2XSZD 3VU9B 3AF0A 3K53A 4ZO4A 5SZJA 4ZDIA 2ZYVX 2W58A 4A82A 5AJWA 2FX3A 1G7SA 4HB4A 1EFRD 2J0VA 1ZD1A 4IEIA 3L2OB 4LYFA 3RRYA 1N6LA 2AN9A 5FBLB 5HE8A 4NP6A 3KX2A 3QXXA 3A4MA 3WMGA 5KYKA 3OAAD 3TR0A 3B8HA 4A6PA 3DMDA 2JLSA 3GJ5A 5JRZA 3PXGA 1AK2A 3ADDA 1ZNXA 4IOLA 5J4KA 5EE5B 4HDQB 2W6IA 3CNLA 3F8TA 1MRSA 5LDDC 2YV5A 1F2UB 1WCV1 2P6RA 5CM8B 1XTSA 3PUVA 4LK2A 1N6RA 3R20A 2XTMA 3PVSA 5UKDA 5M04A 3V00A 4CIDA 1W36C 3ZVRA 4HLQB 4A36A 3P4XA 3B2EA 2F1JA 3GJ4A 3BB1A 1ZC3A 2OAP1 1HEIA 1TL7C 4D81A 4Q19A 1XDBA 1XXHE 1IY1A 2OV2A 2ZIAA 4Y0VA 2ONJA 3TMKA 5BQ5A 1RYHA 4HYYA 4A0HA 1DAIA 1I4LD 1RKBA 4HUQA 4M9XA 2EU8A 4L9SA 1GRRA 4TLAA 5B57C 2CDNA 2GKSA 1YQTA 2F3TA 4Q4LA 2WWHA 4LC0A 5FOVA 2YC2C 3PEUA 2RGEA 2PZFA 3FKSD 1G8PA 3RLFA 1PV4A 5JS7A 2WSMA 2NO1A 3W8NA 3VMFA 2VP9A 4OQLA 4IXNA 2E9SA 3U7EB 2OE2A 4KFUA 1N25A 1OXUA 3GLFB 1CULC 4EJSC 1PLKA 1YJ5A 2FF7A 3TJZA 1KDOA 2R2AA 4QBHA 2IUTA 2W0MA 4XVUA 4XD7A 4AG6A 4HATA 1HV8A 4R2IA 3I92A 3LNCA 1DPFA 5G53C 1CU1A 1DO2A 2HV8A 2HCBA 3CUEF 4C0LA 4DWJA 2ZRLA 4Q21A 5DH9A 3V4FA 5JWRA 4C0KA 1EFHA 1HQCA 1JB1A 2F43A 4HEJA 3X1YA 2JAQA 3GLGB 4XSGA 3OIWA 2GETA 1DAGA 1GIAA 4LSGA 1ODFA 5LB2A 2ZR0A 3NHBA 1KSGA 2CCJA 3K9LA 3QXHA 1MABA 2J0SA 3GEIA 4PC6A 1NVVR 2DFKB 4IRUB 1R10A 3OEEA 5E3HA 4QM6A 2OCYC 1Q1EA 2ERXA 4NMMA 4DLVA 3ZQ6A 3BC1A 1Z2CA 1ZIOA 3B9PA 4F4JA 4M1TA 3WXMA 1BYUA 1JXMA 1Z6AA 1V5WA 5SZIA 4JVNA 2QT0A 4KLNA 2PCLA 3R9XA 4A8JA 4TT3A 2PT7A 3L43A 3SE0A 3SHFA 1K8RA 4UJ3A 4DIEA 2X2FA 4JLNA 4OHWA 2AK3A 1MO3A 2C8VA 2C9YA 3NBFA 3HU3A 5EXPA 3IO5A 5L3QB 2QGNA 4GSYA 2LCFA 1X1RA 2X19A 4ESHA 1NBME 3VAAA 4UNRA 4YMUA 4TMTA 4FINA 1OE0A 2CK3D 2AD5A 4UNSA 1RIFA 1DAEA 2AWOA 2DFTA 2WWGA 1KDPA 4FD2A 5JMTA 2IHYA 4Q4HA 4KXFB 1TUEA 5FTJA 3W5JA 4URXR 4LZZA 3BH7A 3ND8A 3TR5A 3TW8B 2IEZA 2ORVA 1G3QA 1O3YA 5C4GB 4GT1A 5DE3A 5EQTA 3CR8A 1JBKA 1K6MA 1S1MA 5J4LA 2V1UA 4LUCA 3I32A 1EX6A 1P4SA 3X2SA 2CEAA 1TF7A 1E0KA 2L0XA 1SZPA 1GTVA 1ZNWA 2Z43A 1ZVQA 2G9NA 4NCIA 4DDUA 4HAZA 2FGJA 3QKSB 3LQQA 2HDNB 4DCVA 1E94E 3X1WA 1Z6GA 3AVVA 3VHLB 2A5YB 1VDZA 2FPKA 1DEKA 2QMOA 2GCOA 1G9XA 1UFQA 3IBYA 4NYJR 2CE2X 4TYYA 1GILA 1Z07A 1G17A 2R6DA 2BM0A 2ZR9A 4Q7LA 4IFEA 3Q85A 2FMXA 3QUSA 4WVFA 4DLTA 4GP7A 4JVLA 3KUCA 4PSAA 2FNAA 4JVMA 3IUYA 2IYZA 4G5GA 5DSZA 1TEXA 1UKVY 1IAQA 4B48A 4KHZA 1WQ1R 1N5LA 2C5LA 4F91B 1XEXB 1HA3A 4Q4JA 1R0ZA 4B73A 1P61B 2FSGA 1QVAA 5KU1A 2OBNA 4M4SA 4PTLA 2D7DA 4HLCA 4QGHA 2WWFA 5SZHB 2BWJA 1XMVA 3RS7A 1CEEA 2V8OA 4Q1FA 1P62B 2ASEA 1HQYE 3QVVA 2IUUA 2ZI5A 1W47A 4I81A 5BWMA 2NIPA 2QMHA 3VR4A 3A58B 2B7CA 5KO2A 1X86B 2UVQA 2QAGA 4Z51A 3C4JA 3TUZC 2VHCA 3BE4A 3SNHA 3KB2A 4XVRA 2JLVA 4WZAE 4DT1A 2AKYA 1EX7A 3KQKA 4A1FA 5JJKA 5AUQA 3X1XA 3ZDQA 3HPQA 3OF5A 4MQBA 4U02A 3DEFA 4GFDA 1HE8B 3MGCA 3N70A 5EE0A 3QEJA 3PUXA 3EPHA 4MKHA 5EP1A 1F60A 2VP4A 4TYQA 1FL9A 4DSUA 5L3RA 4PO8A 3OFNA 1W7AA 4R98A 2ORIA 3NBXX 2CBZA 4RVCA 4PR0A 3WMFA 4DDTA 4IOMA 2XNDA 2GBLC 5J4VA 2NPIA 2V1XA 5G3ZA 2B7BA 3T06B 4ACBA 2ZVQX 1GRQA 5DHAA 2IS2A 4D4JA 2WAYA 2RGAA 3LAWA 4ON9A 1TADA 2P6UA 1R6BX 3LLMA 1LF0A 4II7A 1Z22A 4Q7MB 2WSSA 3IO3A 4IKEA 2FJUA 2G0NA 1YR9A 1S9HA 1G5RA 4GP6A 4UQOA 2WVJA 5CJPA 5ELXA 4F4IA 5FL7D 3PITA 1NVWQ 3RRNA 1WE2A 2RGDA 3KKMA 1DAHA 121PA 1AN0A 3FFBA 3L8ZA 1J8YF 2AL7A 1IHUA 1QHGA 1C4OA 5KPDA 3RS4A 1DG1G 3THYA 5FPHA 1G3IA 4TYNA 5LPNA 2GEDA 4Q9HA 1E3MA 3PJRA 1FNMA 1QBKC 2WIBA 2F43B 4RZXA 3NIBA 1CRQA 3WBKA 3O8RA 4DRZA 1US8A 4QRHA 4FWIB 1JJ7A 4DUGD 4BECA 2Q9CA 3ZZ0A 2P3SA 2J0UA 1XTRA 1GP2A 4O2RA 4BLPA 3D8BA 2P67A 5FBRB 4FCTA 4AKHA 2X77A 1MABB 1OW3B 5C46F 1CTQA 4JBXA 1E9SA 1TQ4A 3K9GA 3QY0A 2ZQ5A 4DLSA 4GOJA 2FEOA 1NL3A 3AP1A 3REFA 5BN3A 1N6IA 2IW3A 2Q21A 1GL6A 1P2SA 2I1VB 2IHBA 2JIZA 2ZJAA 4V0ME 2KJQA 1I2MA 3VR3A 4OHXA 4A9AA 4EPYA 5HE9A 1BMFD 1KDTA 5GJCA 4A8JB 2NO0A 3K09C 3WYFA 5FTLA 3PEWA 3OZXA 4PPQA 4G5OA 3WNBA 4XH9B 1DG3A 4LV6A 5DO9A 2O8DA 2H17A 4B3FX 3FWYA 1D5CA 4LBZA 2O8CB 1T6NA 5F9FA 2ZE6A 5GJBA 1UBEA 3AVXA 1ZIPA 1KI2A 5E7JA 4E5UA 1NKTA 1T91A 1FW6A 4ARZA 5LD2C 1E69A 3H2YA 3OIUA 2H16A 3LVQE 1CJTC 1OPXA 2MMCA 1P3JA 1IN7A 1W0KD 4EFNA 1G6OA 4Q48A 2IS6A 1OHHD 5FUVA 1PVOA 3LA6A 1Z5ZA 5IK2D 1DARA 4KV9A 2O8FA 1AM4D 2TMKA 3KXLA 1KMQA 2PH1A 3HJNA 3CRMA 2NQ2C 1UM8A 3RABA 6Q21A 2WHXA 2J0QA 1YZNA 1ZU4A 1GSIA 2KBFA 2O5VA 2WIAA 2ZTSA 4JYCA 2JLRA 2ZJBA 2GVZC 1ZUNB 2G3YA 3F5FA 4B47A 3E5HA 2ZRBA 1WF3A 5DN6A 5BYJA 3IIKA 2IXFA 5P21A 2ONKA 1Z6TA 5BXQC 2IYQA 3ZGXA 1GUAA 1VG1A 3BAFA 2IF0A 1PJRA 2FZLA 4IEEA 2LKCA 5FOTA 4MYTA 3KQUA 4BQSA 2VPPA 2QUZA 4R71A 4RJLA 5DYIA 5G41A 2GCOB 2GJKA 2IWRA 1QHHB 2QRNA 3U7HB 3SJBA 2CHGA 4KODA 1P60A 1Z0JA 1TMKA 2QT1A 4LBWA 1Z6XA 4WZBE 2X8AA 2A30A 3T1TA 4WW0A 2DHRA 2QE7A 2RGXA 4HB0A 3I61A 4NYMQ 3PFIA 3CLVA 3RS0A 2XNSA 4HDCA 4AKGA 4FXPA 2BEJA 2ZSFA 2Q0HA 1E6CA 1QHNA 3BERA 3CO5A 4RCYA 5LB4A 2WTUA 4M22A 1W1WA 4MYHA 3FYHA 1BYIA 3HR8A 4WZ6A 1IXRC 3EZ6A 3QENA 2WJYA 4TMWA 4PHHA 2RMKA 3SHWA 3UXMA 1PLJA 2GZHA 1KSHA 2XXAB 4BEBA 1FUKA 2IF2A 1H8HD 1TU3A 2HUPA 3ICEA 3UIEA 2WJVA 3AKDA 5FL3A 3BFXA 3EW9A 2NPFA 3NG1A 4QJ3A 4QJ4A 4PQRA 2NO9A 2OFXA 2QN6A 1VCOA 2ZI9A 3SDZA 3SFVA 2QG6A 4YQFA 1W0JA 5A5GA 3IIJA 1GOTA 2DY1A 2RHDA 2DBYA 4F7WA 5JS8A 1R0WA 4MYUA 4DDWA 8OHMA 2AX4A 3TVTA 2RGNA 3MWLA 4LX0A 5EZ5A 4PQFA 2P5SA 3GFPA 1QF9A 4G1UC 2OCBA 3IQWA 3QVUA 4OBEA 5FI0B 5KNBA 1U90A 4HB3A 2QNRA 3SI7A 1QG4A 1OFUX 2R65A 1YZGA 2VF8A 5K8UA 2QBYB 1X8KA 1U9IA 1M7GA 4B44A 1XP8A 1Y63A 2QGZA 4E22A 3GLIA 2Z4SA 4MRRA 1ZCBA 4HZIA 1NN1A 3VKHA 4XTRA 1HT2E 3QXJA 3ETLA 1ZU5A 2G1JA 3VR1A 4C3ZA 1S3GA 3KJIA 1W0JD 4M1SA 2V6IA 1E9BA 4NPHA 5FI1B 2HT6A 1FP7A 4CT4B 4P4SB 1EFCA 1TF2A 2GXSA 3GJ0A 4QHSA 4D82A 3OHMA 5EE3A 2JJ1A 4YXWD 4RY2A 4BWYA 4EUNA 3B9QA 1WBBA 3RRZA 4Z8YA 3DPUA 1FTNA 1KHTA 5BW8A 4TQ9A 3LD9A 5KDLA 1XFAA 1E0AA 1AQYA 1DOAA 3CWZA 2W6JA 5SZKB 2ZYUX 5HKKA 4JS0A 4BFTA 2CMKA 1R8QA 3KXKA
chains in the Genus database with same CATH superfamily
3B3JA 4IJUA 3ZH2A 2V74B 3DOIA 1VRVA 4PPFA 5KDOA 4V0NA 1A7KA 2RSLA 2OSBA 4GVXA 5KTYA 4GG1A 4B9EA 1Y3HA 2J0UB 3BOSA 3VPAA 5CH5A 2Y68A 3COVA 2IOYA 1ZOOA 4N9WA 2IDKA 4LHVA 3V5NA 1XQWA 4B7UA 2O20A 1U9YA 1USGA 5T4HA 4MQ4A 1OSNA 4GZMA 4Z7JA 1MIOB 4Z1MD 4EUHA 1ICIA 4GAEA 1UEJA 5BUQA 1VA4A 1FSFA 1GEGA 3AR6A 2VRNA 3PXAA 4P82A 2V5AA 3TGPA 1YOBA 2JGDB 3KSUA 1Q92A 2BHRA 2DPYA 2H8KA 1XHEA 3M4YA 5CD1A 4Z3OA 1H8EA 1RXCA 1ZUHA 5FUMA 1ZK3A 2WTBA 1Z83A 1XTVA 1NW4A 2IGBA 1NYLA 3BULA 3PGVA 5AFSA 4ZICA 3WLLA 2P91A 4Q7EA 1FSGA 3TQTA 2VUHB 2XCIA 3GRPA 2QRMA 5A9TA 1JR4A 3QA9A 1AF7A 1JAYA 1ML4A 4Q39A 2UZAA 3ACDA 4C08A 3DE2X 3K0CC 4XJXA 3HACA 4ESHA 3Q2OA 4OMUA 3N28A 3TB4A 4IMIB 1FDRA 3GEEA 2ZJ2A 2EIHA 4RTSA 4RMJA 4FW9A 4FYPA 4YRZA 2V5VA 1YJXA 4CEJA 2GILA 3C3WA 4KYIB 2Y1FA 5DRTA 3U3OA 2CFIA 2FPOA 4TTJA 5DT2A 1ZRSA 2ZSUA 3OEHD 4HDRB 1FEZA 2QX9A 4OAOA 4P84A 3AINA 1YRBA 3HKCB 2AQ8A 1NQ5A 1H1TA 1NKSA 5L6MB 2ZBQA 3BDIA 3QG1A 4L3OA 4XM2A 3C1TA 2JANA 1NTRA 2MR5A 4KDEA 3QVOA 4PSVA 3AEKA 4OP1A 4TV9F 1EGQA 4G1EB 5IBRA 1OGJA 1QCYA 2AI1A 2VA8A 3PTLA 4HDSA 4RZQA 1DBSA 1RWOA 1ONSA 1S2DA 5A05A 2FWRA 1A88A 3AHIA 2QRVB 3W3AH 3C8MA 3LUCA 4M38A 4ZODA 1CCWA 4BNFA 4EGJA 3QV2A 3MHPA 3S0JA 1ACJA 3QFCA 4PZEA 4YRKA 3OPXA 4MR8B 2IITA 2QZPA 2XADA 4H7IA 1I3KA 4GXQA 4NHOA 4Y9TA 5ENZA 3UATA 3PUZA 4KAJA 4WFIA 1BQ4A 1CIPA 3BSYA 3N39C 4RVGA 4BC1A 4MHTA 1OI3A 1BX0A 2EIXA 3M1YA 4UNNA 3SLGA 2IYUA 4BO2A 4EELA 4D92A 3ELWA 1LFDB 1SA0B 1M75A 4WN3A 4ZCLA 5JJIA 4DJDC 5I4KA 1BRTA 3W5BA 4RYLA 3P0RA 4E4TA 3T7JA 3KQYA 1QGAA 1U5CA 4ZDWA 2C95A 4FN5A 2H7YA 2IXDA 1SBYA 4NNPA 1KORA 4GM0A 3OBBA 1R7RA 1T2NA 1K27A 1ZW6A 4A15A 1R00A 2QSYA 1WB9A 3HVJA 2QTVB 5DF1A 1Y3AA 4XIIA 1VDMA 3ZKAA 2GMWA 3BWYA 3NHKA 3JSAA 4K6OA 4JUBA 4MRNA 4JODA 2QPAA 4JLJA 5MDHA 4V3BA 2Y1CA 4P34A 5DI9A 4EHIA 4R9NA 3IUEA 4CG2A 1RHMA 1V25A 1G3RA 2P77A 2CN1A 3H9BA 3BCSA 1O89A 3K5WA 3KSRA 1B0AA 5A7HA 5B30A 3LGXA 3K71B 2GPJA 5KNCH 1Y6JA 4PV7A 4QM7A 3NHMA 4ZDJA 4R1UA 4B43A 1NUQA 1QAOA 2Y0BA 1BGVA 1QH1A 1QGOA 5CVJA 2I4OA 4TKVA 3RIHA 3Q0TA 2R44A 2Q1UA 3WK9A 4PZPA 4XIGS 4MMZB 2HLHA 3L79A 3NRCA 2IYOA 3NWOA 4KWIA 1IBRA 4NBSA 3CXUA 3GVCA 3GXOA 4L6CA 4OB8A 5JZVA 1U7HA 2AJCA 2NTJA 1IB0A 1T9AA 2ODAA 2XIJA 1Z08A 3KQTA 4D9KA 4RKEA 3LWBA 1ZZGA 4E88A 1I36A 1GZUA 2NPOA 5C2JB 2DR3A 2G9UA 4OB6A 3X1ZA 2K2WA 1EK0A 2YHSA 4WIAA 4G26A 3A4YA 3E1KA 1FXSA 3EXHC 1QE0A 1KY2A 2OZPA 4RD1A 2YQ4A 3QKIA 1BXGA 2VJDA 2V96A 3I4LA 2HT1A 4IHJF 4JI0B 2FEXA 4RC9A 2BFDB 3R3VA 2NSJA 3R6DA 2FXIA 5FNVB 4GX0A 1WF6A 1Q57A 3FZEA 1L7OA 1GG5A 2AMJA 1D6SA 3VKWA 4BDSA 1DPGA 3WWYA 1X74A 1NI4A 1QRDA 2XQFA 3WY9A 10MHA 4EW2A 1J20A 1WXQA 5KTMA 1FMJA 2ODQA 5EHXA 4MTCA 1KE1A 5DCLA 4K8OA 3RUHA 1YTUA 4XM1A 4FOLA 4MJLA 2O8EB 1P44A 1YQEA 2AS0A 1PUJA 2V65A 4KVAA 1GPDG 2I4LA 1K98A 1E2LA 2Q3MA 1SKMA 2I7DA 3WOHA 3AESA 1R0KA 4FI3F 2P9GA 3PF8A 4HPJB 4Q7KA 5FFMA 1L4UA 1R4ZA 3KDPA 5F2NA 4JLBA 5B2EA 3CG0A 2RBGA 3V9PA 3HV2A 2OAEA 4B84A 1FDSA 3IIMA 3CZ5A 1EUZA 1CK4A 1CKEA 1NQUA 1NP7A 2ODBA 2VHQA 3H4VA 3INYA 3OJLA 4G4SO 4ER7A 2C96A 4JI7B 3G6WA 2OC9A 1Z0DA 3DYVA 1N8NA 5ITZA 3AB3A 4G5HA 4RANA 1TU0A 2V55B 4DXDA 4RDHA 2CDAA 2WKRA 3ENKA 3LRPA 4PZYA 3TNDA 3I6BA 4KP7A 1E1KA 2GCPA 2X9LA 3O92A 2GK4A 3ORYA 5D86A 3WWZA 2DCUA 2NZVG 1CERA 2ZJ3A 3PYLA 5YASA 4E5DA 4PG4A 1XDSA 4GYYA 3PKJA 1LNZA 1LCIA 5H4HA 4Q4AA 4EW6A 1VA5A 2B0CA 2O3RA 1TZBA 2I4RA 2QRUA 1SCDA 3H1GA 3P1JA 4QEDA 4XYBA 3ZWOA 2GVDC 4U5QA 4JWKA 5EWLB 3DTNA 4ZQHA 3VNQA 5FJJA 2JDIA 3ZHUA 4F93B 2JH3A 2C54A 3AI3A 5FWXA 1EXVA 2AJTA 4XD7D 5EHQA 2CJWB 5KNDA 1E96A 2OK8A 1M0WA 4YMGA 4RTQA 4YRPA 1GZ3A 4FIZA 2WYHA 3DHYA 1CQJA 4IDFA 3ZXSA 3E9QA 2OYSA 4OQDA 5AW1A 3SBEA 1DJPA 1N2OA 3KTAB 4MS4A 1RKUA 4PSCA 4TZTA 2YBEA 1UBFA 1MN6A 4ROSA 3D7RA 4F3TA 4NOJA 2DZDA 1KGDA 1D1SA 1ZMOA 3N6VA 1XAIA 4XPZA 3Q3CA 4GVPA 4PFSA 4LOHA 3OBIA 5JY6A 1SXJB 4PYJA 4RULA 5COAA 3K8OE 1INLA 1ZJJA 3WYBA 2OCPA 3M6UA 2ZDHA 3IKLA 4BVGA 4GX5A 4DMMA 1STOA 3O3NB 3PPXA 1GSHA 3HDVA 2VTKA 4QG3A 3T1OA 3SQXA 3PEVA 2A88A 2D5CA 4HNAB 3ILXA 1W5EA 4TMFA 1SKBA 3QVSA 2EP7A 2E6UX 5KSWB 3TFWA 4O4HB 1X7ZB 1WG8A 4FMCF 2P8JA 4XVCA 1W2WB 2WZCA 2GPBA 3WFIA 4EZIA 2NP6A 3R77A 2PR2A 3EVFA 2C07A 3VMMA 1MGOA 2MSWA 2H52A 1J06A 2VCYA 2QPLA 3ICOA 4ZV4A 4FMDF 3QPAA 2Y76A 3WGYA 4F12A 4RPJA 3WRYC 4J0FA 1GY8A 2GKGA 3RQIA 1AKTA 1GSAA 1VJRA 1P39A 4A6DA 4OOFA 4E30A 2BTQA 3IPRA 1AS2A 4AIIA 1NYQA 4KH1A 4DLYA 1KQ3A 1IN4A 4CFZA 1FDIA 5D1NA 1H3EA 1VHQA 3A8TA 4PC1A 3RAEC 1L3IA 4I5IA 3QHQA 4YO7A 5AKGA 3GHYA 3Q0EA 2ZSHA 3CH5A 4C6TA 1VLMA 1E9CA 4HK4A 1II8B 4N01A 4ROTA 5FDFA 3PNPA 4CQJA 2ERYA 5FWNA 1RJFA 3L7CA 4FVTA 4M7OA 4M9UA 4GXNA 1OI4A 3C24A 1EBBA 3T7TA 1E63A 1Y9JA 2HRBA 1X80B 2GRUA 4URZR 4Y9RA 3SLRA 4OFZA 5KJ1A 1U0LA 1QZZA 4EZEA 3QLVA 2FHSA 5CHYA 2H1SA 2J9ZB 4IG9A 4XD2A 1EWTA 2GAOA 4YP0A 3KLPX 1Q1QA 3AEXA 1AKYA 2Y6VA 1JG1A 3K7EA 3NM5A 4I66A 4WZAA 3PX3A 4NRDA 3FPGA 2A3NA 1R0CA 5JHGB 4E2WA 1IEWA 2JLXA 1XZCA 4EG7A 2GN1A 2QZ9A 4L8WB 3P2JA 4JB0A 3BGWA 3RRJA 4L4XA 2JEYA 2OAQ1 4G1VA 3W2HA 4DEVA 5K8VA 2C4UA 4DCUA 4UDNA 3RUIA 5KDDA 1R6TA 1PR1A 3VPGA 3OIVA 1MJGA 4LYHA 4LXIA 2V6GA 3WHLA 4D9FA 4G4SP 1C3EA 2Z1NA 1PWHA 3KIPA 4J7XA 3OZCA 2IV7A 2BELA 2NUPB 4HWSA 1N1EA 3TAUA 1F9AA 5F98A 4J2TA 1DJNA 1UQUA 3L4KA 1GCGA 1Y6QA 1W5BA 3DDUA 5REQB 1H6CA 2P6PA 1M74A 4ENUA 2YWFA 3GVHA 4OGKA 1Q22A 1ZOLA 1WDWB 1TM5E 1IJEA 2DPMA 2AUNA 2BGNA 2PUVA 3OOHA 4LS3A 3TQFA 3TYXA 2W2KB 5KWEA 2WJGA 3BBLA 2CD9A 2VDKB 3BZBA 5DULA 3SXUA 2H1VA 3EF1A 5AVUA 5EKXA 1D07A 2Y92A 4XI9A 1CIJA 3ILVA 4ERXA 1F1JA 3O31A 5E1MA 3E3LA 2O5CA 2IXTA 2L17A 2ZSAA 5BSRA 4D0NA 2O2DA 5CMLA 3WYAA 2VSFA 1RXEA 3GW8A 4QBTA 3WLEA 2O0KA 4MVJI 1ESMA 3LDAA 3PNYA 4Z6KA 4IZHA 3D3EA 4I1PA 3IAUA 2IHTA 2Q6KA 2EFCB 4HUQB 5ALYA 3KT3A 5IT9A 2B2NA 3E2IA 2LP4Y 4D4LA 1XO1A 2C2GA 4PCUA 3GI1A 4EYOA 3QU2A 1JLRA 3DMPA 5B3LA 1UM9B 4EJFA 1E2EA 4RXMA 3VR4D 3O9MA 1T8WA 1U0RA 2BKXA 2CXHA 4LY0A 4LY3A 3LUJA 4WLVA 5FUQA 1V16A 1XRLA 1T36B 1T5TA 3LWZA 4UMEA 5JZMA 3DWGA 2PGAA 2Q5HA 5DIFA 2XB2A 3ZDEA 1PZFA 1XMXA 1TIPA 3VOTA 5AUOB 2A9VA 1IXZA 5J2UA 1EM6A 1EAMA 2Q41A 4PIPA 1E1CA 1H94A 2FTKE 4UD6A 1J0XO 3RU2A 3ZGLA 1EUCA 1GTMA 1UH5A 3VAZA 2P2DA 2GEJA 2B8TA 2VZLA 4BGUA 2OT3B 3IQXA 1Z3IX 2ZIXA 3C6ZA 1OKKA 1B15A 6LDHA 1PNTA 3EXFB 1Q12A 5LC1A 1F17A 1U8UA 2XDYA 5CXXA 4NFSA 1EP1B 4IHKA 5AHRA 1JQLB 2SCUB 4L6AA 3DGEC 1U31A 3TCNA 4D9CA 1RRVA 3OMWA 3OCWA 4CCSA 4ND5A 4Z4QA 1U80A 2DBRA 3EVAA 1Z8HA 2Q4DA 5CIQA 4ZJPA 1Z9BA 3BKWA 3I58A 2F1IA 1VBFA 2EKQA 3BIXA 5CLQA 4N18A 2W2QA 3KQOA 2HLDA 4ER3A 5JS6A 3EC2A 3GO4A 3OA2A 1MAVA 2IT1A 1JBEA 4NCHA 4NU0A 3GRRA 3GVXA 3BCUA 1U8AA 3DTTA 2WZQA 3V7YA 5BV1A 2GOYA 3E70C 1UADA 4HYTA 2WSSD 4EQ6A 1ML3A 1QM5A 2GF0A 3ZWMA 3LQ2A 2E4ZA 3F78A 4JR0A 4WXPA 4O29A 4EF6A 2I6FA 1XROA 2MSCB 2V7QA 1VG8A 1DG9A 1FLDA 1PG2A 4HN2A 4X45A 5K0TA 3IERA 4CG3A 1AV7A 1UBLS 2EJTA 5HUQA 4PRZA 1V43A 5EZSA 4C4PA 2WJ6A 3MVEA 1CEYA 4MUGA 3H1TA 1E1NA 3MWEB 3O4FA 4DMRA 2FKAA 1IONA 1U2GA 2GX6A 3KXIA 5I48A 3PYXA 4Y0NA 1PT9A 4OBXA 1P4RA 2FFHA 3PI7A 1U9CA 1W35A 2UVPA 2IYXA 2ZYTX 3AGQA 2WR8A 3JVDA 1YZVA 2FOIA 3A4LA 1KNXA 2VVTA 1TNDA 4XOUA 4ZCMA 1Z63A 1RZRD 1JEQB 2IYLD 4UVEA 4JV5B 4FCCA 4FUQA 2OQRA 3LBHA 1Z2OX 4EYKA 2VAMA 1ISHA 1HFJA 4CQLB 2X13A 4C7OA 3IQEA 3SZ3A 4D9NA 2P9BA 4FNGA 3R4VA 3B60A 1SR8A 4HNRA 4MWGA 2JIBA 5HVNA 4GSLA 3BMNB 1L1FA 4YT2A 3GN1A 4R41A 1SPXA 2VUIB 2PJDA 1GPBA 1ODLA 3HI6A 3H1EA 2IBMA 3FOWA 4IQFA 3M1AA 1E2JA 2GWRA 3VXKA 2JIZD 1VJCA 3G2QA 4BNNA 4K46A 1D5WA 5B1EA 1T4BA 3HBAA 1TM2A 2IY7A 2ZULA 1YBHA 5ITVA 1V9CA 3I5AA 4EG1A 5TLSA 3G2KA 5AW3A 1V4BA 1OY1A 1SUEA 2W2VA 1C1DB 3SF8B 3BEOA 2I76A 4AXXA 3TXYA 1BS1A 2VXYA 4TWJA 4L4RA 3O82A 1WP9A 3CYFA 5CB8A 2Z5FA 4LYEA 4K81B 1Z36A 1MA0A 3BQ9A 3H87A 1DBWA 1R27A 1Z4QA 2WVHA 4R68A 2QIPA 2V7EA 3K09A 4BB6A 2BISA 9ATCA 1KVSA 1V3QE 2ID8A 4LZOA 2RIRA 2IDZA 3O91A 3QTTA 3HUDA 4OBBA 4KAFA 1OGIA 3AJAA 1A2KC 3DDZX 5FBZA 3N9IA 3ZIAA 1IWOA 3N8NA 4J1TA 4UNQA 4XYEA 4EA6A 3MINA 1MR3F 4M76B 2VZ0A 1RLIA 2Z9CA 1M7HA 4GPZA 1E1LA 5IC4A 3BK7A 1WL8A 1KP9A 2BCJQ 1DLJA 5E4FA 3HXOA 2EHDA 4IJMA 4CW7A 3UUWA 3EPJA 4JLDA 2C2OA 3DBHA 1N33B 3RS8A 1I24A 4QXRA 3EGIA 1I7PA 1MA3A 4QUJA 3HXMA 2IRWA 2QROA 4U6SA 4YJKA 1KO7A 4HSEA 1MEOA 3LKZA 2GESA 3FMIA 3LXRA 5I4BA 3CW9A 5KTSA 3IESA 4MHOA 1N5IA 1QV7A 4IVQA 4XJSA 4IXWA 3AU9A 4G81A 1V3TA 1UXIA 1F48A 3NCTA 4JQYA 4MNTA 3MT9A 3DZDA 5LZ9A 2B5VA 2QTLA 2Y27A 4RS3A 3SU8A 4NBVA 1ULZA 4I1RA 2G9QA 4RFVA 2R7MA 3O2SB 4W5QA 3ZBUA 4MS3B 2JZOA 4L57A 1GWNA 1NQVA 2RHMA 3K30A 1Z4IA 1IAVA 4IKPA 4OFXA 2Q7DA 1UKEA 4KU4A 1Y5MA 1IUPA 5BW4A 4K6KA 1EP3B 1GHTA 5DX8A 4F8JA 2OVBA 4KITB 1BW9A 1L7RA 3ENZA 3FR7A 1M34E 2OD2A 4KK3A 4WA8A 5AKIA 2FZWA 4BNJA 3L8FA 3E48A 4G24A 4JWTA 4XFDA 4C9BA 4CT0A 4MWSA 3SOPA 1PYGA 5LQMA 4FDTA 2G67A 4QDJA 2BR5A 2CNWD 3ZTTA 3AHEA 3QELA 3OP1A 4L73A 1NY5A 2Q29A 3HK2A 1YE8A 3QWHA 1XD9A 1QO0A 1Z2NX 1P2FA 1ZQ9A 2HB6A 4WQMA 1EKXA 3PICA 3RTBA 3UK1A 1KI7A 4MAAA 2F3QA 1OX5A 4EM6A 3DEAA 5CTAA 4EF5A 4P81A 3IRVA 2BC9A 3SSNA 4OYLA 3MEQA 4KYUA 1MAUA 1QYVA 3A6EA 3FRHA 4D79A 2OCGA 5ESWA 5GAJA 5IMBA 2DJIA 1BCRA 1C3OB 4Z4CA 4CBVA 1KEVA 3HY4A 3HSYA 2QG4A 2I8AA 3HZHA 4B3JA 2MMGA 1NUSA 2V9ZA 3BS4A 4GGOA 1PVOA 2WMYA 2R97A 2ORWA 3K5PA 1OI7A 4GRDA 1LBIA 4QATA 3TEMA 1Y1RA 1GADO 2DEUA 1ESDA 4FJ0A 3S55A 4BFLA 3LS2A 2I1QA 4G0ZA 5CIWA 1GXSA 1TT5B 3KKNA 1RAIA 1N2HA 2N9UA 3KTDA 5I9SA 2Z6AA 2OL4A 3I53A 2ZB3A 4HLUC 3K0AA 3PWZA 2EHJA 4YLEA 3EGDA 1JFFA 3E5MA 3OU6A 4FYYA 4F9GA 4N76A 3SJAA 3ZI4A 1F14A 4HNTA 4NYJQ 3KR9A 4PGMA 3L1UA 3LMKA 4CE6A 2G40A 2CKDA 4FZRA 3T34A 3A37A 4OU4A 2G6BA 3SP1A 4CF5A 1C2YA 2BDTA 2OGSA 4XJTA 5LZ4A 3U48A 1SBZA 3UJ9A 4LVUA 5ES4B 1Y3DE 3F8WA 4A2PA 2WW8A 3ZYZA 1B93A 4F11A 3ASZA 4IDBA 4E33A 3ZD6A 3B6EA 3OPNA 3PC3A 1YQXA 3HZRA 1RVDA 1CB7A 3O7MA 2IXGA 3QE2A 5DGCA 2JAWA 2OCAA 3NM4A 1G4HA 5AJVB 2F1OA 5EQDA 5JRJA 1ONOA 1PJLA 1ZCAA 5IWAB 3U44B 1M83A 5D5PA 2JCXA 4ZHQA 2EERA 3GDHA 1T0UA 1US8B 3A6FA 4BTVA 3TIFA 3TCKA 1BU5A 1ZNYA 3GAZA 2JJ1D 1R74A 1ORRA 2Q5OA 2KSQA 1JJIA 1LGYA 3HDTA 4U8GA 2J08A 3KUDA 1HLDA 4I1YA 4UBOA 2X40A 2Z04A 2BFEA 4J90A 4OP2A 5DTQA 5HDBB 1ETHA 4TLCA 2K5UA 5KHOC 3DVRX 4RZ3A 2AOVA 3FPEA 4F4UA 3DT9A 3KJHA 3WRXC 5BMVF 5JH7F 421PA 4HKTA 4PRKA 3H11B 2I7VA 1VHTA 1Q1GA 5BN3B 2W6JD 3OC6A 1YZTA 2O57A 4YRAA 4MUBA 1P7ZA 1G5IA 1T8RA 2NU6A 2C8JA 2X6QA 1Z25A 5EP4A 1OLXB 5AKZA 1GNQA 4KR2A 2Q3CA 5LP1A 2JFOA 4FI3C 1ND5A 3EZFA 2P2LA 4HWTA 2YFHA 1OTXA 1E3WB 1F0KA 5ALMA 3AEUB 3PV0A 3T35A 3FNEA 2QLMA 2M6LA 3DKKA 1A5BB 1CQPA 1N6KA 1USUA 2IHKA 2Z4RA 4HAIA 4PF1A 1MX5A 1ODJA 2J7PA 3KOUA 4J7CA 3P0IA 3USCS 4EDHA 3A9CA 2DSTA 7ABPA 3PFFA 1CZLA 2X14A 3A2LA 1CY8A 1EWRA 1X1SA 3W5VA 5JW6A 2O7VA 4AKIA 2ZBRA 4RDCA 2LCIA 3AM1A 1JU9A 4L75A 1UK7A 2LV8A 3JRWA 3FCUB 1P2UA 2VNHA 3OFJA 3ETJA 2YIJA 4KIJA 1M6NA 2H1HA 4OGFA 3C5HA 3K6RA 1Z45A 1SHTX 3OWOA 1PVVA 3X2FA 1SXQA 3LCRA 3HY3A 4YFYA 6REQB 3NEJA 1NJFA 1WTCA 4E2FA 4O2BA 3EB9A 3DBLA 5TF0A 1UAYA 5KSYA 4NATA 5EP3A 2Z8YA 1VL2A 1E7SA 5CP8A 3CF2A 1W581 2FSHA 3JD3A 2FPUA 3DGFC 4N48A 3LUHA 1UJNA 5CB4F 4P58A 1TD9A 3E84A 3WKEA 4TMXA 3R44A 1L4HA 4TZ6A 4NCAA 1CUCA 1JGTA 2PMKA 6GPBA 1N2SA 3PNMA 2G04A 4AUMA 1C30A 3DAOA 2ENWA 2XSZA 3A1WA 4RCZA 3T9CA 2VH2A 3V8RA 4RDXA 2WOOA 2VFAA 2V45A 3LO8A 4CUJA 1ZH0A 1F12A 1I2CA 2BP7A 4LGCA 1FRFS 1V9LA 2FN9A 3GFGA 3VR2A 5AVVA 1H6BA 2ECPA 1WOMA 4ZAZA 3MRVA 3ZVLA 3KZXA 5JVDA 3GP8A 1WUIS 3ELDA 3M82A 1JLSA 3LXUX 2A5DA 2VIIA 4LA4A 2K6GA 4TX1A 3TRDA 5JQGF 1W4RA 3FMOB 3IOMA 4FS3A 4FGZA 5JISA 2ESRA 3HLTA 2PUWA 4HOYA 3P0FA 4QBIA 1UPTA 4OJTA 3S7ZA 5BVHB 3ZJTA 3D0OA 3NBYC 3RBAA 5J5CA 2HTEA 1C29B 1U2EA 3V7NA 2QE6A 4E21A 4DQVA 1QC5B 4XQEA 3QKSA 3OZAA 1EGAA 1HBJA 2PUGA 3M81A 1RR6A 3AB8A 4YA6A 1W4ZA 2DLDA 1YHNA 2CXXA 2QHXA 2YRXA 3EQ9A 3GJ3A 1NMZA 4H16A 4IVNA 4QYMA 5TGDA 3T61A 5K0FA 2DHEA 3M6VA 5AVOA 1E3IA 1P73A 3JAWB 5JPIA 2XTJA 1Z37A 2Z98A 4CQMD 2GO7A 2QM3A 1RD4A 2E4XA 1NUUA 1K4MA 4AWXA 4EPWA 1VE6A 3WAJA 1LX6A 3ZBPA 2D74A 5IDWA 2NXWA 3UMJA 1FTSA 1IMOA 1NLUA 4G0XA 1Z62A 4N82A 3IVMA 4HRAA 2JLUA 4D43A 1IHPA 4D8TA 4OUDA 1XEXA 4J3FA 1G5TA 2OCKA 1XMQB 1E2FA 4AQYB 1S8OA 3EXIA 4BNVA 5LUBA 4UHFA 4FNOA 2YZMA 2P90A 3R5TA 5AKXA 1O5OA 1WDMA 3LSTA 1OV4A 2DG2A 4IEFB 1W30A 4CL0A 1R1DA 2P2GA 3ASVA 4AICA 4XSVA 1NOIA 1E3JA 4ASUD 1E8DA 3AW8A 1KVQA 1UXHA 5C8VA 1QE3A 4FSHA 4HXEB 4V0RA 3ZJ5A 2CDCA 3I0NA 2IPMA 4Y6PA 4GMFA 4CTMA 1DC4A 1KJZA 1NMSA 3C3MA 3P8ZA 4FOPA 2X8JA 2C2KA 5H16A 1PGQA 1U3FA 1ATIA 1ULBA 3B78A 3DV9A 4AY5A 4G86A 3BFKA 2FCAA 1E9DA 2QVBA 1PDVA 4Y7CA 4L2IA 4YDSA 5KQGA 1M0SA 3NO4A 4L3VA 4N0QA 3WBJA 1XYGA 1PR6A 2I65A 2OEPA 2WZBA 4RZ2A 5L51A 3ZVNA 3VHXA 3UMMA 1KTVA 2EYQA 2WU0A 4GHWA 5D85A 4GECA 1N5JA 4FUTA 5IAJA 4H18A 3TOVA 2YINC 3BE6A 4KVGA 5U1PA 3RRFA 1MT0A 1AQLA 3HBNA 2BEVB 3O21A 4OK5A 3TW4A 1O97C 4DW8A 1BXZA 1VM6A 1OH8A 3R41A 4Q18A 4CU5A 3U6BA 4UD2A 4ID3A 1M8GA 1TVKA 1WS6A 2X86A 3B1ZA 5JS1A 1E2KA 1PBTA 2XKAA 1R5NA 3M3PA 5DGDA 5B6IA 2VK8A 2VJNA 1M2VA 1E0DA 1E1RD 5BOVA 3G5AA 1OU0A 3QVMA 2AOUB 3JS5A 2R4QA 3QBJA 3WL4A 3JYHA 3K8QA 4P98A 5EQJB 2PL5A 4JJ8A 9LDBA 3O73A 2AB0A 1NONA 1T1GA 5D3MB 1V5FA 3G7SA 3KEGA 1E5TA 1NIPA 3ZK7A 1H66A 2BBTA 1YKFA 2NSYA 4NFYA 2RD2A 4LZLA 1ZWLA 1P0QA 4TRNA 2KBEA 3L01A 3WDMA 5JSQA 4XWTA 2LCQA 1RZVA 3DEKA 3GLUA 1TYZA 4DLPA 1GPKA 1AQ6A 3W34A 3SJCA 3EOAI 3EH1A 3IB3A 3OOEA 5FPSA 1KEKA 2DM6A 2XCQA 4HQFA 2P3LA 5E9AA 4ZVNA 3PCRB 3QVWA 5JATA 5H68A 3HCCA 1W36D 1B00A 1J00A 4QPNA 5ALUA 3WIEA 4KO2S 1UJMA 3Q5DA 3O8LA 2WAAA 4X95A 3S7TA 2QXYA 4DF3A 2GCEA 4QD3A 1QIMA 3A4NA 3UA4A 4B9AA 3HXQA 2XLCA 3QKRB 1N34B 1KI9A 1IATA 1TO2E 2E5FA 3EXEA 2Q50A 1WD5A 4I14A 3T5MA 3ZS9A 5I7EA 1CJMA 1QKJA 1YNOA 3CLSD 4QXPA 4ITRC 1GKKA 1I3MA 3GHHA 4AFNA 4GMDA 1CVIA 4G4JA 1G59A 1JKMA 3C97A 1IG3A 3P96A 4KWTA 5BRNA 3TDKA 4ARCA 1GQYA 1J99A 4YJFB 3PQ4A 2I34A 1NBMD 3U0VA 1PQPA 1V3UA 1B2RA 1P2VA 1NVEA 1PT7A 1QHEA 1UJBA 4QYIA 4LRUA 1F8YA 5F23A 2A1UB 4DR7B 1QH8A 2PA0A 1V5EA 2ZT7A 4DBLE 1O58A 4UEJA 4D02A 1P5HA 5JXHA 1DAMA 1GZHB 4JUIA 5M29A 2HRQA 5CDUA 1L5RA 5AK0A 5LXTF 3UMBA 3V4LA 3AK4A 1C9MA 1RMTA 4DNQA 5BWNA 4X24A 3WGZA 2RKWA 2YHUA 3NTUA 4LYGA 5AVQA 2GB4A 3C1UA 5E38A 2F62A 5JCXA 4LJ9A 1E98A 3P9CA 3S4YA 4YRBA 1G16A 3HXLA 4ZVTA 1WVMA 2FP3A 3BH0A 3OKPA 3AEKB 4UHHA 5DGHA 1LSOA 4C4YA 2A0XA 2ZYWX 4HDSB 2D2IA 1JHOA 1DAOA 1RFLA 4ZPXA 1U8YA 5L9AA 4JIMA 4L5CA 3A6DA 4MITA 4D0GA 1NGSA 2ROQA 4Y9UA 2NZ8A 3VR5D 5BOSA 2I03A 2WKPA 3C6XA 3F3YA 2ZWAA 1L4EA 3U1VA 5ELLA 3JYLA 5A3JA 4BVEA 2H9AA 4GE0A 3D4OA 3U13A 1CD5A 3TGWA 2B30A 1SBNE 4AIRA 4PE5B 1AXEA 2JLYA 3ACBA 1U28A 4CL8A 2QLTA 3S70A 3Q8MA 2YYSA 5M3BA 2D13A 3U80A 3DTVD 3JVIA 1TTPB 1UK6A 4DLUA 1ESNA 3ZCUA 1FQWA 1JDJA 2IK8A 3PVZA 3IV7A 1JA1A 2JGNA 4BKRA 4G5YA 4OHYA 1QYWA 3WHKA 5K0NA 3H16A 4B3IA 1MD9A 3VYVA 4TPKA 4TN5A 1QP4A 3ZDAA 1BROA 2IVFA 5MF6A 5FPKA 4YS6A 5FF9A 2A14A 2X5OA 1ZUNA 1JJVA 2GA8A 2QM8A 3HP4A 4O1IA 2JK0A 3HYNA 1BD4A 3COPA 3LYLA 4MLPA 5I7WA 1O6BA 3SIWA 4KUGA 3VX3A 4B1FA 5ALPA 1OLSA 4GI7A 2E2WA 1IE3A 4AMBA 2F67A 2JFYA 4PZ0A 3UJBA 1QIKA 2KS6A 1N9GA 2XVAA 3FJOA 4G36A 4PAMA 1EZ4A 4M1MA 3W2FA 4HGNA 3Q8LA 2HGZA 3HZOA 1UJ6A 1I5EA 2XYQA 2NU8A 1HTWA 2RGBA 5IKPA 1TW3A 4MP8A 4RA9A 3RYHA 2AD1A 1FNSA 1NPYA 3SFTA 3DDCA 3FNBA 2NNLD 2PZAA 2VDLB 1SU6A 1W2GA 1CJUC 3DOFA 3QVJA 2NTVA 5EMKA 3T99A 4ZI7F 3DWEX 5MFZA 2O3UA 1SG0A 3DP9A 2YMPA 3TOZA 2CYCA 3GA7A 3NZEA 3CVXA 4M1WA 4DLKA 5B37A 4DHWA 9LDTA 4BMPB 2D3TA 1CXZA 4NCXA 3QW4B 4HYQA 4D74A 1PZNA 2B94A 1OASA 5KREA 1ZMTA 2CY0A 1G5HA 1Q0ZA 4URWR 2XXAA 4KO8A 5FWYA 1H2FA 1OB2A 2GHRA 1SULA 3R7DA 2QR2A 5GPBA 2X0EA 1FYFA 4AZVA 2XMQA 3DE3X 4GOLD 1UZUA 3HADA 2APJA 3R3UA 2WT8A 1XJWA 1KEPA 1SBQA 3OE7D 3CX6A 4IMJB 4KYTA 1NI4B 3KKOA 4YBRA 1XCOA 3GEDA 2O3TA 3RASA 4ARSA 5HWSA 4WKCA 3ZWKA 3FGPA 3VISA 2WHRA 2F8LA 3BT7A 1E4YA 3J80A 4UZSA 3UC5A 1XMJA 2AJBA 1G18A 2Q6VA 3F7OA 3IDFA 3K9WA 3AIIA 3DVAA 1RQPA 3JQGA 4JJZA 5KQSA 3OX1A 1T5OA 3H2IA 1EDBA 3CUTA 4X92A 3AESB 2NZWA 3B7GA 1VJGA 4W4TA 3FFAA 3WMEA 3O4VA 1BWPA 5HZKA 4IJ5A 3THWA 1OV6A 4RSGA 5I4CA 5DIZA 3RROA 4JQSA 2H1LA 1KI4A 1QNLA 4KW7A 2WHQA 5C4IA 5IBPA 4XDYA 4Q9DA 4Z53A 2RAPA 3JQ9A 3CB4A 4EW1A 4YMVA 4CXMA 1H0KA 4PAWA 7MDHA 1P7CA 1SOAA 1LF5A 2EFEB 3BGSA 2OY0A 1IEVA 5EQFA 2DH6A 4CVNA 2LWIA 3O83A 3EXHB 1I0ZA 3KLMX 3L6BA 3E5NA 1FDOA 3IS3A 3V4RA 1SU8A 3WYDA 1TI7A 3LA8A 2IYSA 2V7WA 5AW4A 4KXQA 1OBFO 1Q2XA 1X8LA 4NDZA 4R8RA 2C2BA 4FGWA 4NBKA 3SYKA 2O0JA 2ZRAA 2B35A 5JD3A 2FDCA 2DTXA 2ECOA 2WMDA 2VHJA 3R2JA 4HZGA 1NIJA 2YUTA 3MTJA 2HA0A 1RHQA 4Q4AB 1SC9A 3SX2A 3FCEA 2BFCB 3ZWBA 3AL0C 2IYRA 2OUKA 1VXOA 5GZ1A 5D2CA 3WLRA 3ZE2B 4CEHB 2X0RA 3A2KA 1CLEA 2FDRA 1FP6A 3E4CA 1A1SA 4HEHA 2IOQA 3Q87B 2V54A 4REMA 5FWXB 1JHMA 3I28A 3OM8A 3TZQA 3S5UA 5TQVA 3T9BA 3Q7TA 4M54A 4F5DA 3QPDA 5K2MA 1CQJB 3X0DA 3C16C 4XWGA 4TWZA 4G84A 3PFGA 3PRHA 3GJ6A 1BHQ1 1CRWG 3AKZA 2C78A 4KFRA 4FDVA 4UUOA 3CRVA 4HL6A 1VIAA 5IJAA 4CN8A 4N12A 1BHJA 3B3GA 4P93A 3A4IA 4YONB 4EECA 1LI4A 3NV7A 1JPJA 2JBWA 3QOFA 3ZE9A 3EWSA 2IU4A 3RFFA 4AKEA 2MSLA 1II9A 4M1YA 4QARA 1GYQA 3SJUA 3U61B 1I6KA 5TQ2A 1GTRA 4QDUA 3D02A 3BTUA 1JG3A 2FI1A 5LZ5A 4JFRA 4LBVA 1PHPA 4KZKA 3TUIC 5K0GA 5EJ6A 3DXFA 1J6UA 1JPUA 2ZJOA 3NETA 3T9DA 2ETVA 2GBGA 1J9EA 4CYMA 1B23P 2L82A 4XCXA 2PWZA 4YRSA 3OQHA 3QY9A 5CA1F 4A0GA 1UKZA 2UVDA 4D0RA 1TC2A 1WEKA 4L5JA 1DS6A 5IK2A 2YZGA 1D2CA 2JF0A 1K2VN 1QIEA 1F8FA 3P9NA 1T2DA 2SICE 5FTWA 1XMIA 2BIFA 1Y7PA 1RKXA 4JGBA 1XMPA 3JZMA 4I08A 2D8AA 4AS1A 3CF6R 3EIWA 3G2NA 2I3ZA 3S2ZA 3ZHOA 2VL7A 1EUQA 5LU8A 4BB5A 3RC8A 2OLJA 2YOHA 2QR5A 2VZEA 1E1DA 1DTWA 1EVKA 1RXIA 3EDCA 1C7IA 3BFJA 3C6BA 2V6JA 3JZIA 4FX2A 5DCUA 5FOXA 5HFAA 1ZO8A 1QH9A 2B1JA 3IBCA 2ZRKA 3MTAA 1IN8A 5C53B 3INGA 2AFVA 4YFVA 4C6TB 2ZU6A 1LXCA 1YS9A 1ZUWA 4TSRA 1NW3A 3D3NA 4H60A 3DAPA 3F0TA 2B98A 4Q4DA 2C84A 4NBNA 2O06A 3BDVA 4H7DA 4PHGA 2QPOA 1CZRA 5K09A 4M0CA 2QTHA 5FR1A 2UKDA 5K6TA 4BO6A 1RP1A 3MAAC 4RORA