3MG9A

Teg 12 binary structure complexed with the teicoplanin aglycone
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
290
structure length
255
Chain Sequence
XXXXSMNGIRWIASYPKAGNTWVRCMLAAYITGKAPQVWNDIDAESLTLEAMLRFGDLPPAEPMEPVLVKTHLKADVPVLGLYGEATAKVLYLVRNPRDMLLSSMRMASISRDDVEKSRDFARKFIANEGLGWNGGVGLGSWPENVRSWTESSSDRFPNADVLTMRYEDLKGDPVARFSEIVEFLDLGGPVDIEDIRRAVAASTLERMRELEKRSEGRYDQSLSFLGEDIESDYQELLHGDSGFALYAKQYGYAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the Glycopeptide Sulfotransferase Teg12 in a Complex with the Teicoplanin Aglycone.
pubmed doi rcsb
source organism Uncultured soil bacterium
molecule tags Transferase/antibiotic
molecule keywords TEG12
total genus 92
structure length 255
sequence length 290
ec nomenclature ec 2.8.2.-:
pdb deposition date 2010-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3mg9A00
1XTIA 1ZINA 5SZJA 4ZDJA 1JR3A 2WWHA 2JIZA 1ELOA 421PA 1E9RA 1L4YA 2C9YA 1KNQA 5GJWC 4YDSA 4CIDA 2VTKA 3ZLJA 3KKPA 3D6TB 2OSBA 1JR6A 4GZLA 1GKIA 2BM1A 1XXHB 4LJ6A 3GLFB 2YHSA 4DUGD 4LJYA 4I1UA 1M34E 4LBYA 4EQ6A 4PAMA 5FI1B 3EZFA 1RYHA 4LPSA 1HY3A 1F5NA 1HE8B 4GI7A 1Q12A 4C0KA 1E32A 4XIGS 2H16A 2XJ4A 1K6MA 3K0FB 3T61A 3ZVLA 4MYHA 5DSZA 4LV8B 4CT4B 2FSIA 2FPKA 3GLHA 2HYDA 2YOGA 2VRWA 1IOZA 1E6CA 2ZR9A 4HLUA 4DLWA 3M4YA 2GTPA 1ZNWA 3PXGA 1H8HD 3BAFA 3TK1A 3F8TA 4TN1A 4UXHA 2IUTA 4FD2A 4W7SA 3EZ2A 4YMSA 2P6RA 5DI3A 3HYTA 4E03A 2QAGB 1E2EA 2Z5FA 1W48A 1PUIA 5FTKA 3NVAA 5E7JA 1KSGA 1G3IA 2GJ8A 3AM1A 4Q4AA 2JLSA 5K8IA 1B0UA 2BVNA 1BMFA 4D4KA 3AH8A 4TL9A 1W47A 3CONA 2KBEA 3LDAA 4ZPXA 1KI6A 1O87A 1R8SA 4LX0A 3NXSA 4Q1EA 4ITRC 3VU9B 1F60A 1LNZA 2OFWA 3M1IA 3VKWA 4P3YA 1E2PA 3PVSA 3OF5A 2ZSDA 1IXSB 4EDHA 1BIFA 4OQMA 3K9NA 2EU8A 2IS2A 3T06B 2QG6A 2IYQA 1FQKA 4PHGA 3U3RA 2J0SA 3RHFA 3QSYA 5BN5A 1PV4A 4LHVA 3TBKA 2ZYVX 5KNDA 3R7WB 5GJVC 2F6RA 1PLKA 3LAWA 4F92B 1AGPA 1LTQA 3AF0A 4L8GA 1WB9A 1D9XA 2BV3A 2CL7X 2GBLC 4F93B 3L2OB 4GOKA 3F3YA 2AXPA 2MSEB 3BFKA 3RWOA 4MGZR 1ZCBA 1UKYA 2CLDX 4JZKA 1R5OA 4Y0VA 2V1XA 3UG6A 2D2FA 4QC2A 1EFCA 2CDNA 4G01B 1BKDR 1XP8A 1S2MA 2WAYA 4DLRA 1T3SA 1GNRA 2W0MA 4Z54A 1B23P 3KUDA 4DLVA 3AVQA 1GTVA 1AK2A 1G20E 4LK2A 3U3MA 2J0UB 4CEIA 1OYWA 1KMQA 3N5CA 1KJWA 2XEXA 5AJVB 2KJQA 4MKIA 4Q02A 1KI8A 1NLZA 3VX3A 5EE0A 2UZIR 4EPTA 1CS4C 4L15A 2O8CB 3KFVA 2WSSD 1DARA 3F5FA 3CF2A 2XTZA 4JLNA 5C4GB 3HDTA 4YC7A 2GJKA 4B33A 2FA9A 3KJIA 4IOMA 1YKSA 1X86B 2JJ1A 3EXAA 2IEYA 3CX7A 1NF3A 3KL4A 2JLUA 2QI9C 4HB4A 3ZZ0A 4NCKA 3P1JA 1OJLA 1P2SA 4WZ6A 1FOEB 1SXJD 2H8KA 2J1LA 3A58B 5DIFA 3SJZA 3SU8A 3TSOA 3GEEA 1UDXA 1G6OA 1U2RA 3DOFA 1CP2A 1P62B 3A37A 3GLIA 1W0JA 1L4UA 4HZUA 2DWOA 4HZIA 1SQ5A 2EW1A 1G7CA 1O3YA 3ZQ6A 4BGDA 3PJRA 3FTQA 5CLLA 2P6UA 1WRBA 2G1KA 1HYQA 3CWZA 3WYGA 5KHOC 1RC8A 1S3GA 3AP1A 3FKSD 2QAGA 1XJ0A 4PPGA 4XVQA 1VCOA 3SJCA 1ZD1A 4G5OA 4P4TA 3ZZUA 3OIVA 4TWZA 1V5WA 1QVAA 2PX3A 2XTMA 3K0AA 1N6OA 3UMFA 4TZ0A 4J0QA 3ZS9A 2ZAOA 4AKGA 2QSYA 3P20A 4QBFA 3IKJA 1XF9A 3LBHA 4DSOA 3QOFA 3QKSA 4RCZA 1E9FA 1OIVA 3SE0A 3OE7D 5D3MA 3VR6A 3QPVA 2EYUA 2YZ2A 3BXZA 1RJ9B 2ZJYA 2GCPA 4NONA 3HR8A 1E9EA 4DDVA 3B85A 2GK7A 1UKZA 2CHQA 5EQTA 3B5JA 3EZ9A 2E9SA 3MLEA 2V54A 3U4QB 1G19A 1Z0JA 3ADCA 4M22A 4C30A 4EKDA 4D4MA 4UNQA 1XWIA 5P21A 1F2TB 2ORWA 1H8ED 1OFHA 2ZJ2A 4US2R 3QEOA 4B3GA 1E9CA 4JT4A 2D2EA 3DHWC 1KHTA 1TF2A 2RH5A 4TTQA 2KBFA 2FFAA 3RANA 3WBJA 2JLRA 3FMFA 3SOPA 3LBIA 3R9IA 5LBIA 4UQOA 1N6LA 4BEJA 3AUYA 2QPOA 4R9UC 3FMOB 4OQXA 4TYNA 3CIOA 4LRWA 3B6EA 4RD0A 1ZM9A 2D06A 5G3YA 3CNOA 3N2EA 2CNWD 2F3TA 5JBQA 3NBXX 1VHLA 1I4TD 4QRHA 1D5CA 3SC3A 2DYKA 3C7KA 1D2EA 3SJBA 5J40A 2RGXA 3OESA 3OEHA 1XZPA 5GJBA 2FN4A 3AVYA 4MKFA 4DLXA 3EASA 4KU4A 1WBDA 1RPZA 3RSLA 1T9HA 3O8DA 3RRZA 4DLYA 1P2TA 5L3QB 2RGBA 2C95A 2J9RA 2CLSA 4KSCA 4EQ6B 1P9WA 1SVLA 2BOVA 4A0GA 3E1SA 4DDTA 3PG5A 1AN0A 2IYZA 4IDQA 3T1VA 4GP6A 2QQ0A 3AF3A 1BS1A 3THYA 3WP1B 2OM2A 4B48A 4F38A 2O8FB 3QF7A 2CCJA 2HLDD 2J41A 3KUCA 4BE7B 2B6HA 2R62A 4XSGA 2QEQA 1NKTA 1N0VC 1N0UA 4NTZA 3R9XA 3QJYA 2WJGA 2O8BB 4U02A 2W2VA 4KO8A 2WWIA 4LDJA 4HSEA 4B3CA 3H0KA 2QN6A 1PLJA 2C9OA 1IXZA 2XNDA 521PA 4QGFA 1DO2A 2W2XA 4M1TA 4BEBA 2EVWX 2AKYA 3NIBA 3QKTA 3Q5EA 4ZKDA 1WA5A 4ESVA 1XRJA 3OZXA 2WJIA 3IPXA 1VMAA 1N6HA 3B1ZA 4FCWA 4MKGA 1ZUIA 4LC0A 4Q66C 1IBRA 1TADA 2FEMA 4PQRA 4JL8A 2GVDC 1R0YA 4CEIB 4TQAA 1ZD8A 2NO7A 2YC2C 1FW6A 1W4AA 4JJKA 3CRQA 2OEPA 4IW3B 2YOFA 2C78A 3FFAA 3AF2A 4HB0A 2OBLA 1C1YA 1OXVA 1P7CA 3QXSA 4M1OA 1GKYA 1UEIA 3LW8A 2O52A 4WIAA 1F48A 1Z28A 5CYOA 3IGFA 1W0KD 3TAUA 1W36C 1U0LA 4I81A 4NDZA 4GBMA 3KJHA 4QHYA 3M6AA 4BLRA 5KYKA 4CYMA 1X3SA 4M9QA 4C0AC 4E22A 1VPLA 1R6BX 4F7WA 4JVMA 4HATA 1U8AA 3CH4B 3LO5A 3R20A 2O8FA 3O8CA 2G83A 2ZRBA 1GDDA 1A1VA 2QPAA 4KODA 1HA3A 2ZVPX 1JECA 1COWD 1E2LA 5FOUA 2JLQA 5E3HA 3C8UA 3TLXA 3VR4A 1OKKD 1RFLA 2BKEA 1U9IC 2QENA 3TVDA 2A30A 2CXXA 3VKHA 4DCSA 1XDBA 4N0DA 2IS4A 2OO7A 4FXPA 4QBHA 4CEJA 2QP4A 2QRZA 1VG9B 3CNLA 1DO0A 5CK4A 3K70D 5HE9A 3RC8A 3PUWA 2D62A 4MRNA 3W6NA 3CX6A 4X8MA 2DR3A 1KDTA 1R10A 1ZM2A 4ZO4A 3MMPA 3QI2A 3MWKA 2A5JA 2FG5A 2OCBA 1MRNA 3GP8A 2QL6A 1S9DA 5FPTA 1J99A 4XTRA 1W4CA 2HLDA 3OAAD 3EZ6A 4URXR 4QNMA 1Z08A 5DN6A 5G3ZA 4DJTA 1M74A 4M9SA 4GZMA 2IF2A 3CUEF 2XZPA 1OIWA 2W6JA 2B7CA 4PO8A 2ZSAA 3BB4A 1D8TA 2QGZA 3EIEA 2K5UA 2Q21A 1VKJA 4FIDA 4ZCLA 4IXMA 1JPNA 2BCGY 3PUYA 4C7OB 3MSXA 4FMCF 3GLHE 4PPFA 3U44A 4ZDKA 4CF7A 1CULC 5LB4A 5FOSA 4NYJQ 3K0SA 2E1RA 1X8LA 1U90A 1IY2A 3BC1A 2DHRA 1FUKA 1G7TA 4OI4A 5SZKB 4NL4H 4URWR 4W5WA 5JECA 1F2UB 1R5BA 3BFXA 3NDPA 2EFCB 3ASYA 4BFUA 2V9PA 4OQNA 3IQWA 2NTYC 4EUNA 3NC1C 2F43B 4P4SB 1Z0KA 1UBEA 4IEEA 4B3XA 3QXXA 3WHKA 2ZRFA 2ZPTX 4B3BA 4ZV4A 4H1VA 4A15A 2F1HA 2PEZA 1E9AA 3RLFA 4KBFA 4OHWA 1L2TA 2IYWA 3B1WA 4PSKA 5HZKA 2XZOA 3EC1A 4A36A 4E5UA 1N5KA 3HU1A 4BFVA 3TAHA 4FMDB 2AR7A 1HE1C 4A0HA 2OXCA 4DEYA 4G5SA 1XXHE 1EFUA 3IEUA 2JIZD 1A7JA 4GMXA 1Z6GA 1ZAKA 2VHUA 1GAJA 2BM0A 3T15A 2HCJB 3V4FA 2BJWA 5CJ2A 1NBMA 4NE2A 4RZ3A 4A1FA 4BLTA 2H18A 4QJ3A 2A5GA 2CEAA 2R6DA 1COWA 3LQQA 2Q9AA 5C1BA 3JZAA 4EFLA 3AP3A 2ODEA 3PV0A 1FX0B 3VHLB 1RIFA 1DAGA 1ZMXA 4BFYA 4ZCMA 5LD2B 1BYUA 1KO5A 4WBSA 3DZDA 2RCNA 3E70C 2N1BA 3R7WA 5FTJA 3VAAA 1MABB 5TDHA 2IYYA 3LVRE 4RZUA 1GNPA 4Q4JB 5FUWA 4OK5A 3LV8A 4WXRA 4MQBA 4Q21A 3VFDA 4JBWA 2NO0A 1DS6A 1XCPA 2H57A 5JFGA 1UF9A 4MYTA 1Q1ZA 4QXAA 3ASZA 3UXMA 3FDIA 3L82B 1TQ6A 4LYAA 4PAQA 5A4JA 3GCGA 2VYFA 3QXCA 1OFTA 3IHWA 4A8JB 4G5RA 4HLQB 2WJYA 1ZM4A 2AXNA 1U8ZA 2ZYTX 3NH9A 4M1SA 1SVKA 4Q5IA 2IL1A 4GFDA 2B7BA 4NCIA 2GXUA 1DG1G 3K9GA 3JVUA 4MGIR 2ZJBA 2ZS7A 1VCNA 2QM7A 4QHSA 3B82A 2I4IA 3Q72A 3AVWA 3IEVA 5HTKA 3NTUA 1R4AA 2R6GA 4HUQB 3QKUA 5JRZA 1KZ7B 4C3ZA 2JAQA 1Z5ZA 3SN6A 2CCGA 2HYIC 5E7MA 1U98A 1Z06A 2GHIA 4Z51A 4WZBE 1QZXA 2IWHA 4D0NA 3I32A 4Q9KA 4IOKA 4MUBA 2ECKA 4MYUA 3PIRA 2R6AA 3W8NA 4A6PA 2DY1A 2XSZA 5TV2A 2J3EA 4I99A 4AG5A 3I72A 1R8QA 2QU8A 1KO7A 1NN3A 2RGAA 4M1KA 4ILEA 1KI1A 5FOVA 2B21A 4KFUA 3X1XA 2Q6TA 5FPKA 3P4XA 4RD4A 1PZNA 4NMMA 5JCPA 1KI4A 5EXTA 2ZRJA 5B57C 2F1IA 2WSMA 2NPFA 2I1VB 1KOFA 2ZVQX 3IIJA 4NCJA 3QUSA 1Z0IA 4D2IA 3TUJC 5D3QA 4FWTA 2GJSA 2RAPA 2H5EA 2XJ9A 3DKPA 1WDTA 4DSNA 1TEVA 2PZEA 1MO3A 1E2MA 2B8TA 1RRCA 4DBLC 2RGCA 3QENA 2GRJA 2OE2A 4Q7LA 4BPBA 1NNEA 2C77A 5DNYB 1E2FA 2BJVA 2PLFA 2P6NA 3P4YA 3A1SA 3WRXC 4DB4A 3W3AA 1ZUHA 1N25A 4JIMA 3K53A 1II8B 4FCTA 3W5IA 1P73A 1FX0A 4PZLA 2GK6A 4GSYA 3KQUA 1YQTA 3B1YA 1DAIA 1OHHD 2ZUBA 2Q0HA 4KVAA 4XH9B 4CRWB 2H1LA 4PO1A 1DTSA 4IXNA 4B34A 4BFXA 5EZ6B 2DFNA 1H8EA 3W6OA 2WKRA 5JWOA 3GPLA 4NPHA 3DPUA 4RY2A 1EESA 2QY9A 2G6BA 2ZRDA 2QBYA 5CB8A 1JEDA 4LGMA 3U5ZB 1T5LA 3MG9A 2Q3MA 5C18A 2XNSA 1H8HA 3MJRA 3SBEA 2DWQA 1W46A 4URVR 2X8AA 4BFZA 2OBNA 4ZIRB 1KYIA 2KE5A 4HDOB 2O8DB 1UKVY 5BN3A 3IILA 4TQUS 3REFA 3GMTA 4A2QA 4H9GA 3U3KA 1BO6A 2XOKD 2CBZA 3QF4B 3ICEA 1HQYE 4C9BA 1TQ2A 3KKOA 3WHLA 1KGDA 2O0JA 2Z6VA 2NZ8A 2Q3FA 3T34A 5JS7A 3TGPA 4XOIA 5CK5A 3GLGE 5KUTA 1G18A 1GM5A 4MGYR 3UATA 4HAYA 5FFMA 4KITB 5G40A 4HAWA 4CEHB 1DOAA 2G0TA 3C16C 3FFBA 1BH2A 1XCGB 2OILA 1WCV1 4TT3A 2AD1A 3QBTA 2V3CC 1MR3F 2ZE6A 5JJIA 1CJUC 4C0HA 2OXRA 1TUIA 2QMHA 2O5VA 1CR4A 3QE0A 2G77B 1QHHA 4QG7A 1KK1A 1Z29A 2F3RA 1Q3TA 2IC5A 3L43A 3L8YA 1W5TA 2P5TB 4BASA 4IHQA 2CJWB 2V6IA 4DKXA 4YXWA 1TX4B 3LQRA 1OT3A 2WOJA 3HPQA 4KJZA 3TH5A 1OXTA 5C2JB 4CVNA 5GADl 4HAVA 5AUOB 3W90A 1AKEA 3IBGA 4FN5A 3D31A 2R6FA 1IN8A 1DPFA 2NO6A 3DMNA 4NU0A 3THWA 3VMFA 2BHRA 3DZ8A 1MO4A 2J46A 4R98A 1XTJA 2ZS9A 2GXQA 5JJLA 1ZM3A 2FGKA 3PEVA 2PT5A 4RFSB 4RD6A 2GXAA 4B6FA 3CRW1 1Z6TA 3MJHA 3CNNA 3S1AA 2BMFA 1TQ4A 4RD2A 3I4LA 4JLAA 4FWIB 2HF9A 1IN5A 3OEHD 3SHWA 3VR2A 1EFRD 2OCAA 3P26A 4DVGA 1S4QA 3L8ZA 3GLGA 2D4HA 3PQCA 4EIWA 1E1QD 3PEWA 1G4UR 3IIMA 3X2SA 4D6PA 3TR0A 4KLNA 3ZH9B 1E99A 2QE7A 3TMKA 4UNRA 4PZZA 1G6HA 2QRNA 1OXUA 1K5GA 2V7QA 2WIAA 1DAFA 4L9WA 5EZ5A 4TYYA 3U4QA 2AD5A 1R0ZA 1SGWA 1AZSC 1LW7A 1VDZA 4QGAA 3BERA 4TMVA 1CIPA 2YYZA 821PA 1VG1A 4O2RA 4NZYA 5DGXA 1XEXB 4AG6A 1W0JD 2L0XA 2D7CA 1AQUA 4Q1AA 4GOXA 4D80A 5ELXA 1NKSA 1XTQA 4ZIRA 3TW8B 2XOKA 5JRJA 3EIHA 3GJ3A 5ANRB 3UWOA 1GZSA 1E1RD 1JALA 2ZRAA 2IX3A 3QF4A 4CZ2A 3A1WA 2A5DA 5DI9A 3PUXA 3BJIC 3KQNA 4UJ3A 1W2GA 3RRMA 2ZXUA 3NBZC 2ZAMA 4B3FX 2GXSA 1YZTA 4B47A 1KY2A 2QAGC 1C9KA 1KDOA 1VIYA 2A7QA 2ASEA 3EZ7A 4YLGA 3WNCA 4JL6A 3ZYCA 4C4PA 2BEJA 1VCMA 1ZU4A 3BE4A 3EPKA 2O8CA 3K9HA 2PX0A 2ZRHA 4ZI3A 5KU1A 5L3SB 1EFHA 1G5PA 4HI0E 4MITA 4Q7MB 3KKNA 1NVXQ 2QM8A 1NLFA 4Y0AA 3GJ4A 5JI2E 2W58A 4YDHB 1JXMA 5KO2A 1G3QA 2WKQA 2P65A 4M2LA 2XNDD 4MDFA 4Q1FA 4BLSA 3IUYA 4TMWA 1LV7A 4NCHA 2CJWA 4XWOA 3AP2A 3FPAA 2QSZA 3KZ1E 3NBYC 3T35A 2VP4A 3CH5A 1GUAA 3GLIE 4C7OA 1GSIA 2YJTD 1E9DA 4JBXA 1OXSC 4RD3A 4D4JA 1T3LA 1GP2A 4MGKR 3H84A 2MMGA 4IJMA 5IT5A 4NH0A 1ZVQA 2FFBA 2PJZA 121PA 5F9FA 3RRYA 2WWGA 2J87A 1KMHA 2O0KA 3D8BA 5CM8B 4BFTA 3WBKA 2IXGA 3NC0C 4BLPA 3SDZA 4DT1A 5IF9A 3QIAA 4R2IA 2CVFA 2JLYA 2ZRPA 1NP6A 4BECA 3MCAA 3AKCA 2FNAA 4QBGB 5DYIA 1AM4D 2J7PD 2ZSFA 3AF4A 1EK0A 4IFEA 2DCUA 3TJZA 1W0KA 2JLWA 4ASUA 2GEVA 2N46A 2BBOA 3QXHA 2G9NA 3TIFA 4PSAA 4D4LA 2F9LA 1EGAA 2AFHE 1E2KA 1XCMA 2VLIA 5AUQA 4NBSA 3W6PA 4EFMA 3U3JA 3K0CA 4GRAA 1TAGA 3AVUA 1IN4A 4LI0A 5EJEA 1GILA 1UFQA 4HUQA 1W5SA 5JWRA 1JR3E 4NYIQ 1LF0A 5FH9A 4TLEA 1OSNA 5F2EA 3ZVRA 4ZDWA 1NY6A 4URYR 4C0BA 3GLFA 1M7HA 1Q3HA 2QA5A 4M53A 5AJXA 3OEEA 5EE1A 2QT0A 2C2HA 2VSOA 1KI2A 1QHHB 4B43A 2ANBA 1KDRA 4N3NA 2IEZA 3B13B 4MKHA 4Z1MA 1SXJC 3CZPA 1US8B 5GJCA 3K0CC 1KO4A 2JJ2A 3EPLA 1E98A 4DCVA 2I1QA 2NZJA 2JDIA 4M21A 4A8JA 1YR9A 4LBWA 5J4HA 3E2IA 1HUQA 2BIFA 2FEOA 3C41J 2O8EA 4OHXA 3LH5A 3ZJYA 1JAHA 1QBKC 3ZS8A 3TUZC 2QTVB 1NJFA 3I5YA 2FZ4A 3RAPR 1HURA 5EXXA 5J4YA 5TB5A 3KQKA 5FOWA 1KAOA 4QJ4A 1Q20A 1GG2A 3T5DA 2XTNA 4CDGA 1Z22A 3BWDD 1JNYA 1TEXA 4LYHA 1Q21A 4RFSA 4TTRA 4U7DA 5IHPA 2GETA 2ATXA 4KFRA 1CEEA 1LFDB 1WXQA 3H4MA 3RS7A 2QROA 3K70C 4JVSB 5SZIA 3HU3A 3Q8XB 4H1UA 2EWWA 2F1JA 1VYUA 5EP1A 1TL7C 2EFDB 2OG2A 1FFHA 5TARA 2ZUDA 1UBFA 4EPYA 5H8WA 2Z83A 1S96A 5IK2A 3SR0A 4KVGA 2ZITA 4LY6A 3KX2A 2C9CA 4IDNA 2P5SA 1AS3A 2FFQA 4MUAA 1G16A 2W6ID 1Z3IX 4EFNA 621PA 4JKYA 1G5RA 1G64A 4WXPA 4KCGA 3QNUA 2QORA 4IOJA 5J4KA 2VIIA 3X1YA 4JSTA 1P72A 1UM8A 1QHXA 2AWOA 5EXSA 2GZAA 1QG2A 2X19A 2NMVA 3IIKA 2C98A 721PA 3HYRA 4DCTA 3UPUA 4B74A 3K1JA 6Q21A 2NGRA 1XEXA 5KTYA 1GWNA 1RRPA 3AKEA 3KFXA 3NDBB 1US8A 1XMIA 4DT1B 4BWYA 1Z2CA 4PSVA 2RGNC 1TTTA 2QBYB 3AV0B 4KV9A 2FGJA 4TL8A 3FB4A 3IBYA 2ZRKA 5AUNB 1XTKA 2WMOB 3LLUA 5L3QA 3NWJA 2ERXA 1W4BA 5GVRA 2ZI7A 4B35A 2WZQA 3S1AB 1LF5A 5AK0A 1CJTC 5FR1A 3DDCA 4TSFD 1SKYB 2BC9A 1OPXA 2EFHB 1W7AA 2JCSA 1XZQA 2IF0A 1KJZA 4JLBA 4KYUA 1MO6A 2OV2A 1G7RA 1YE8A 1OFUX 3PCRB 1VTKA 4OHVA 5J47A 1ZIPA 4UXJA 1KKMA 4TQ9A 4EAQA 2IYLD 4JJZA 4MRPA 1OFIA 3WY9A 4AK9A 2ZJAA 4B3DA 4YMVA 5AR1A 3P27A 2YWFA 2ZREA 2HT1A 4V0LA 2GF0A 1P2UA 1YR8A 1IQPA 4UNSA 1P6XA 1NN0A 4Z1MD 3K8YA 2AKAB 4NYJR 3SYKA 3BIFA 3NG1A 1II8A 2RGEA 3NEJA 4M1MA 1XPRA 4HEJA 1IAQA 3B9PA 3OEED 5L3RA 2GEUA 2TMKA 4WAUA 1TUEA 3EA0A 1XMJA 4AC9A 5TMPA 1SVWA 3Q9LA 1NJGA 2BBWA 4LBVA 4ACAA 4AKEA 4DCUA 3RNLA 1NIJA 1E4VA 2Z0MA 2ZTSA 3K0AB 5BW8A 1RW4A 2UVQA 3E5HA 1DVRA 4X8LA 3U60B 4JVNA 2CNWA 4X8OA 4QHTA 1NVUQ 2F7SA 4M8NE 4XVUA 5JSZB 4BZPA 3PEYA 1KMHB 4LWZA 1T8TA 4BFWA 1Z63A 2QMUA 4ZCIA 4WA7A 4D0GA 1SVOA 1SHZA 1YZUA 3AKYA 1XB2A 2J0QA 1E96A 4AYWA 4AKHA 1SHKA 1IJFA 1TPZA 3EIQA 4FMCB 3FKQA 2WTUA 3KTAA 2GAOA 1T4GA 2GCOA 4HDQB 3TUIC 1VYVA 2REOA 3LLMA 1NMZA 3MRSA 3KDSE 4DDWA 2XB2A 4GDFA 3KXKA 3H2YA 5JI3E 5KSOA 2ZIAA 2CHGA 2V7QD 2ZU0C 4BRUA 1W36D 4OHYA 2NIPA 4PANA 4TLBA 1CR2A 3KB1A 3OIYA 4UKDA 5J4VA 1YR7A 2CL0X 2QQEA 3R8CA 4V0ME 1NIPA 4N0EA 1U8YA 5F9HA 4KSBA 2MSCB 4P0TA 1A2KC 1U81A 3B2EA 3QBVA 4G5GA 3SI7A 4V0MA 1G4AE 3Q7QA 4D81A 2VP6A 5FOTA 1KK0A 3GFOA 3TQFA 2OFOA 2XGJA 4PPQA 1XD8A 2WVJA 1G8FA 3GFPA 1J8YF 3BH0A 4JLMA 5DLQC 4AYTA 4MH0R 3HJNA 2CK3D 5FBVB 1E2GA 5K8TA 1JAIA 4JVLA 3U7HB 1Q1BA 4O25A 2D7DA 2NO9A 3ZGXA 4DSUA 1E2NA 2ODWA 5EUMA 4XD7D 3CM0A 2JGNA 3HP1A 2JASA 3ND9A 3AGQA 2ZSBA 1EFTA 3V00A 221PA 5IRCD 3AVTA 1G9XA 2X2EA 4KBGA 4OK3A 3LXXA 3IO5A 4P33A 5BQ5A 4PPNA 1J90A 1Q0UA 4HAUA 3HWSA 1I4DD 2VL7A 3DL0A 4A0FA 4LSGA 1Z83A 2ZM5A 2GNOA 2HCBA 2P2LA 1AS2A 3THOA 4E09A 1G8YA 2EFGA 3OHMA 4D25A 2O0HA 3TR5A 4HDCA 1GRQA 2B92A 2HEIA 1NBME 3EARA 4JYBA 2WWFA 1SXJA 1II9A 2OLJA 2P3SA 5C46F 3KQHA 3CB4A 4B71A 2FZLA 1GITA 3AVVA 4QGGA 4TT3D 3VNVA 2UZ3A 3G5UA 2FMXA 3JVVA 2QP9X 5HKKA 3NH6A 4I1VA 1ZNXA 5LD2C 4GOJA 1MV5A 1N2CE 2YWEA 2JJ2D 5A0FA 4Q18A 4PC2A 5EUQB 1M2OB 1YJ5A 3AKDA 3M0EA 3OIUA 1D6JA 2I3BA 3I8XA 1V43A 3LA6A 1G17A 4Q9IA 1XU4A 2QMEA 3TVTA 4DZZA 3GJ8A 3TRFA 2P67A 1MKYA 4LZZA 3UKDA 3VX4A 4RSGA 5L8VA 1KSHA 1VECA 3B8HA 2ORIA 5DI3B 2VHCA 3T1TA 4AI6A 3K70B 3RABA 5E95A 2H92A 2AFIE 5KDLA 1F3OA 4XJXA 1HTWA 2ZU6A 3ECCA 2R6CA 3QKSB 2IUSA 2WWXA 5E4FA 2FU5C 2LWIA 4URZR 5B30A 1IJEA 3L0IB 4NHOA 1JR3D 1UJ2A 2D74A 4IDPA 2WOOA 1T8UA 1NMYA 1IY0A 4Z8YA 2YKGA 3BRWD 1CF4A 1NL3A 4TLCA 5CLQA 4ZI2A 4IRUB 5EXPA 1XD9A 2JJ1D 1G8GA 3EG5A 1MABA 2PL3A 4WVFA 2PMDA 1DAMA 2ZJ5A 1T6NA 1XEWY 2VP2A 1FNMA 1OIXA 1DE0A 1SKQA 4JT2A 5FBRB 3ZQJA 3U7GA 2DFKB 3T1QA 3GD7A 5CJPA 3WMGA 1XMSA 1GIAA 3UMSA 4JKIA 1FP6A 2OBMA 3AGPA 1E94E 1JQJC 1ZIOA 4PC7A 2VHTA 1FMJA 4DLZA 1E9BA 1R2QA 4C2TA 1XPUA 2PMKA 3BB3A 4DWJA 3THXA 2PCJA 1E69A 2ERYA 3QEJA 1J2JA 5FPSA 1P60A 1FP7A 4BZXA 4FINA 1KAGA 3VR3A 5DO9A 1UAAA 1AGRA 3SQWA 2GJ9A 1E2HA 1ZNZA 4LHZA 2OCPA 3OE7A 1D2NA 2F55A 3ZVMA 5B58C 2MSDB 3W9YA 3I73A 3THWB 4Z8XA 3VU9A 1TU3A 5H1YA 2HJVA 2BBTA 2PBRA 4RZXA 3PFIA 5FPYA 2HT6A 4KAXA 5FTNA 1E79D 4LOAA 5DHFA 3QG1A 2PLRA 1ZCAA 1I4LD 3LX8A 2ZI5A 5JHHB 3WP0A 4V03A 3FHTA 3UWKA 5KSYA 2VO1A 5BN4A 1DELA 3I1FA 4OQFA 5BWMA 1L8QA 2PZFA 5HE8A 2BEKA 5CDFA 3N2IA 2VF8A 1IXRC 5AJZA 1FNNA 1WQ1R 1H65A 4R7ZA 2C5LA 4PXAA 2EYQA 4PO9A 2FPMA 3NEYA 1OHHA 2IT1A 2VPPA 3CO5A 4S2EA 2XXAA 2DWPA 1SVIA 1XBTA 2AK3A 5KDOA 3C15C 4S35A 4V0OA 1WF3A 4NKRA 4V0NA 2ZR0A 4XWAA 2PZGA 4POAA 1ETUA 2KB0A 4AYXA 2ZYWX 3KJGA 4YXWD 2EWVA 2YWHA 5AJYA 4P31A 2J45A 4CW7A 1F2UA 2ATVA 5BYJA 2ZEJA 4RZ2A 5FR2A 2R2AA 1NMXA 1ZYUA 3QKRA 4IEIA 4JS0A 2WJHA 1Q44A 3GJ5A 4TLDA 5JS8A 1ZW6A 1YZLA 3VR1A 1NRJB 5CB6A 1CTQA 1Z0DA 3AF1A 1WP9A 1M6NA 1KNXA 3I8SA 4JMPA 3KTAB 4OL0A 5EP3A 3BGWA 3B7GA 4MYCA 4PC1A 1XD2B 4LPKA 3THYB 5JWHA 1T5IA 1OH6A 1Z6XA 1NBMD 4WZAE 4RJLA 4TMTA 1AA9A 2X1VA 4CGZA 1UDWA 4PQFA 3U44B 1LB1B 5FL3A 3WYAA 2RGDA 4NYMQ 4XVRA 1A2BA 4X8HA 5CYPA 5EE3A 3CKLA 3LX5A 1XXHA 4BZQA 1P3JA 2ZJZA 1NVVQ 3A36A 3FMIA 2GAAA 1G41A 3RVBA 3VTKA 4XWKA 1E4YA 2ONKA 3U7FB 3SFZA 3WNBA 2BDTA 1Z8FA 2JDID 1NG9A 3A4LA 4Q48A 2WJVA 2HDNB 4BUJA 3V9PA 1GKUB 5TVKA 3IQXA 5FBQB 4Q9LA 3RS5A 5LDDC 2EQBA 2O8DA 1MOZA 2DB3A 2FSGA 1J8MF 2FH5B 2KWIA 1R0WA 3Q3JB 4R71A 1GRRA 4M4SA 5AUPB 2CL6X 3GJ0A 4R2HA 2IK8A 3RS3A 2V6JA 4B76A 3U3OA 1ESMA 1XFAA 3G82C 3GFTA 5EE9A 4PFSA 1OH5A 4LC1A 4UNPA 4UXIA 1Y3AA 1GL6A 3BH7A 1W4RA 2OLKA 1W49A 2CHVA 1ZUNB 2A9KA 4LJ5A 4JYCA 2XB4A 3SHFA 1ZJ6A 3AB3A 3QVUA 3P32A 1CKEA 2GVZC 2VHJA 2Z4SA 4M0LA 2ZI6A 2ZI9A 5IK2D 4G5QA 2ZE8A 3NHBA 1P61B 4TSFA 5FOXA 1Z07A 2H7VA 4IVQA 3K9LA 1CR1A 1HQCA 3GJ6A 3GLFE 3SS8A 1ZBDA 2XZLA 5F98A 2VP5A 4JLVA 3A6PC 2RMKA 2VP9A 3K0EA 3MWLA 5E7IA 2ZE5A 1BYIA 4Q9HA 2C96A 2KSQA 2WHXA 3B1VA 1KK2A 1VG0B 2ZQ5A 4MA4A 4I1OA 2Q9CA 5JZVA 1M7BA 2UKDA 1RE0A 3CPEA 3I92A 3Q85A 2AWNA 3QXJA 5CITA 1Z6AA 1FMLA 4HLDA 5FUXA 3SJAA 4B2PA 1AJEA 4LCBA 2QUZA 1E2DA 3LFUA 1G5TA 2VSXA 4TTPA 3CF0A 3AVOA 4HAXA 4D0LB 4Q19A 3THXB 1X6VA 1HEIA 1A5TA 4GPTA 3RC3A 1II0A 2ZE7A 4ACBA 1E1RA 2R8RA 2YVUA 1YRAA 3W8RA 2A5YB 4KXFB 4DB2A 4HB3A 4Q4LA 2CE2X 4JSYA 4PR0A 1IN6A 4QM7A 2J0UA 4HUTA 2ZS8A 4Q7KA 4PC6A 1HH4A 4W5HA 5G41A 4MRRA 1KTVA 2W6JD 2QP3A 2X2FA 1CJMA 1FZQA 2ZI3A 1OB2A 2AHOA 1ZRHA 2IHBA 4AURA 1S1MA 3F0TA 4MDEA 4G1UC 4PTLA 1N5LA 2JLXA 5FTMA 2V4ZA 1VYTA 2PH1A 2VH5R 3NHAA 4IFBA 4QNRA 2GKSA 4A9AA 3I61A 2HJGA 5B2ZA 3UK6A 3G0HA 3ZIAD 1AIPA 5K8UA 4A4DA 3DEFA 1Q1EA 2ZROA 1DAEA 1M1YE 2CCKA 3D7MA 3RS2A 3SZRA 4B44A 2N42A 4EJSA 4LJ9A 4Q9JA 3PR1A 5KDDA 4ZKEA 1IHUA 1EX6A 1LVGA 1OW3B 4LHXA 3TKLA 2WPDA 1KO8A 5K8LA 3U6BA 1YZGA 1GL9B 4U00A 2BMJA 1RYFA 3O8BA 4Q47A 2D3WA 2HF8A 3PUZA 4Q03A 1OE0A 2ZETA 3DKVA 3HPRA 4F4JA 1TU4A 2F9MA 4QOSA 4QL3A 2CVHA 4TMZA 4CEJB 5H68A 3RS4A 3SEAA 3FKSA 3D3QA 3B9QA 1N6NA 1GNQA 3QKRB 3I62A 1AKYA 1T3HA 2WSSA 5FUVA 1IM2A 2RGGA 3PENA 2IW3A 3CRVA 5EE5B 3GLGB 3TE6A 1E79A 1P9RA 1MH1A 1D2MA 4URUR 1KSJA 2WWYA 2Q3HA 2HXYA 4DXAA 3O8RA 3DM9B 4RKFA 3A1VA 3H1TA 1LS6A 2QT1A 4O0MA 4EPVA 1TF5A 2IHYA 2NQ2C 4A82A 2X77A 3RRNA 2QE7D 1ZNYA 3ADKA 1TMKA 2IYVA 2FF7A 2FFHA 1CJKC 2Z43A 2ZRCA 3WRYC 3IHLA 4A2WA 3BOSA 3N70A 5SZHB 3CZQA 3LWNA 1UADA 3KB2A 1R5NA 4V02A 2IS6A 1CBUA 3Q7PA 2DPXA 3ZIAA 4US0R 1E2IA 1R7RA 4QGHA 5DISB 1F2TA 2OCYC 4DHEA 1W2HA 3T5GA 2XSZD 1AQYA 2RHDA 5HZHA 4DC9A 4EJSB 4IDOA 3LD9A 2AK2A 1YZQA 2OT3B 2WPDD 2J59A 4AD8A 2DBYA 4P32A 2FDCA 4W5JA 5IDVA 3U7EB 1U0HC 4JLKA 4A8JC 3EPJA 2G3YA 4LUCA 4Q00A 2JEOA 1QHNA 4LV5B 5LB2A 3BFVA 5J4LA 2VBCA 4RD1A 2IA5A 4O2LA 3SYNA 1KI3A 4K8OA 2J0VA 1KI6B 2ONJA 1NVWQ 3RDPA 2W0SA 4WOPA 4HYYA 1T0HB 4JLPA 4YMUA 3ETLA 1NN5A 1FL9A 1XEWX 2QNRA 2VA8A 5AJWA 1ONBA 2P0EA 1CXZA 1KDPA 3MGCA 3AQ4A 4IKEA 3GQBA 1JEEA 5LPNA 1WBBA 3MWYW 3RWMB 1VHTA 2JLZA 3CLVA 1ZC4A 5B64A 2ORVA 1UPTA 4PHFA 4DRZA 1CJVC 3OFNA 1PLLA 3BS4A 4RCYA 2WM9B 4M9ZA 4IOLA 3NBFA 2W83A 1JJ7A 1DG3A 1P4SA 2C03A 4E07A 4DIEA 4KYIB 5L3VA 1XJQA 4OI1A 4AIIA 3LW7A 1E0AA 1OV4A 2GESA 4NCNA 2CK3A 4DLSA 4EPRA 1OKKA 2FE4A 1XX6A 1GFIA 2WICA 1UKEA 4GP7A 4F91B 5HKKD 2W2TA 3I5XA 2XXAB 1TF7A 2QAJA 1K5DA 5G53C 4DLTA 1ZD9A 1SZPA 1SVMA 3BBPA 3FE2A 5FL7A 3A4NA 4RVCA 1RRFA 3X1DA 1P75A 2QMOA 2IXFA 5HCNA 3U6KA 4HAZA 4ARZB 4YMTA 4YONB 3U2QA 2NG1A 2F43A 3DM5A 4P4SA 5HPYB 5KSZA 2V55B 3SBDA 3W3ZB 1FQJA 3JZMA 1QDEA 2ZRGA 1TQDA 2OFXA 3CRMA 4PZYA 4PAOA 1U94A 1NSTA 3TSWA 4MRVA 5KOYA 1PJRA 4JBYA 4V0KA 1KK3A 5TY0A 3AEZA 3W5JA 2FSFA 2YV5A 3FWYA 4L4UA 3A4MA 1YVDA 2E87A 2G0NA 2ZI4A 2NOAA 5CDFE 2PEYA 4IVRA 1QHYA 3EC2A 3PITA 3A1TA 3K0FA 1S0UA 1VG8A 4II7A 4KFTA 3Q5DA 1RVDA 3B78A 4AKIA 1P2VA 2R65A 2BMDA 3L0OA 1U0JA 3H86A 2FJUA 5CIQA 1QHIA 2BKUA 1KKLA 1OH7A 1XTSA 4F4IA 1HV8A 1FTSA 2VSFA 4A92A 2WWWA 3ADBA 3A1UA 3KXLA 2VHQA 3KKQA 1FUUA 2MMCA 3ZVNA 3VR5A 1G8PA 2FV8A 3BK7A 2YNMA 3UG7A 1DAHA 2ANCA 2BCJQ 3QG5A 2V8OA 4OHZA 2YC4C 2ZRMA 4Q1BA 3SYLA 1BOFA 1DAKA 1MT0A 2PCLA 8OHMA 3ZZTA 5KPJA 4NP6A 1NI3A 1EXMA 1JQLB 1NLYA 1SKYE 2Z4RA 2ZR7A 3RYTC 2PJRA 5JSZA 5FBWB 2IS1A 3J81k 4A2PA 1YZNA 1GVNB 1EG7A 3MAAC 4DSTA 3FGNA 1ANKA 4KFSA 4PQYA 4LJAA 1FPMA 2ZJ8A 4B2IA 2FX3A 4G3XA 1OH8A 5HCIA 4C2UA 2OAP1 1IY1A 2WJJA 3WYFA 2QGNA 2BBSA 1SVSA 3UMRA 2IYTA 1LS1A 3KXIA 1G3RA 3ICQB 1NVVR 3CPJB 2JJ8A 4D26A 3V4RA 3K09C 1E0JA 3LVQE 2GA8A 4M1WA 5BXQC 1E1QA 1Z2AA 5JEEA 4DUGA 3CF6R 1YR6A 1E3MA 3FOZA 3MFYA 2OZEA 3IO3A 4Q4HB 1E2JA 2AN9A 3AVPA 1Z47A 1EX7A 1W36B 4YMWA 3VNUA 4B6EA 4B2LA 1DBSA 3UIEA 4TLAA 3WMEA 4NYIR 1KSFX 1W1WA 2QZ4A 5JHGB 4P4UA 1KI9A 1E9SA 2HXSA 3VQTA 3R9WA 2O8EB 4W9MC 2ZRNA 2OUKA 3K09A 5JLJA 4K81B 4Q1CA 4QJ5A 2WKPA 1G1MA 4GNKA 2R9VA 4ZDIA 2JLVA 3SNHA 4AWXA 4ON9A 4XTCS 2RGNA 1KY3A 2YOHA 3WXMA 1OF1A 3BB1A 4QKQA 1DEKA 2RKOA 4O3MA 1XEFA 1N6PA 1ZU5A 1G291 3I3SR 5CIWA 2OHFA 4GMDA 1R0XA 4LHYA 1EFRA 5FI0B 1QHSA 4LHWA 1N6RA 1G7SA 1N3BA 4ARZA 3BD9A 3VKGA 1NG1A 4HB2A 3CR7A 4UJ5A 3X1WA 4PC3A 1Z0AA 1E2QA 1G3MA 4US1R 3TSZA 2XX3A 5DN6D 3QY0A 1YHNA 1UEJA 4HLCA 1A82A 3IPYA 3NKVA 4IVPA 4C0QC 5L3SA 2CE7A 5UKDA 2EFEB 5AWFC 4CT5A 1U99A 1S8FA 3O47A 2A3RA 1M7GA 2XITA 1JBKA 4LYFA 4RFVA 4BLQA 2QTFA 1ZC3A 4M1YA 4RKEA 1YRBA 4U5XA 1JB1A 5F3WB 3DOEA 2FWRA 4N1AA 4DIDA 4Q01A 3KJEA 2GWHA 2VF7A 5KNBA 2A5FA 1OXXK 2ODNA 4I1SA 4WW0A 1NN1A 1GRNA 2WV9A 2VQSA 2H17A 3C4JA 2FSHA 4GT1A 3ZDQA 3GLHB 3DVLA 3EWAA 4B32A 4JL5A 1Z6YA 1G21E 1XJCA 4JLOA 3GLIB 3VHXA 5DYGA 3GEHA 3L0PA 3LBNA 3DMDA 1VCIA 1P5ZB 4A6XA 3UANA 1EWQA 2G88A 2QPTA 1MRSA 4Q1DA 3CX8A 4FMBB 1LY1A 4BLOA 4PHTA 3KQLA 1MO5A 1QRAA 2W00A 4D82A 3TNFA 1I2MA 1AZTA 3GEIA 5CM9C 1CR0A 2WIBA 4JLDA 4QM6A 1Q22A 3FHOA 2PT7A 3A8TA 5HR5A 4BFSA 1Z0FA 1X8JA 1JXOA 5DH9A 4FI3C 3MUFA 2BMEA 3WMFA 2CLCX 2GEDA 3BH6A 1S9HA 2ODBA 5EP4A 1OYYA 3T1OA 3CWQA 3AVXA 2GZHA 1PVOA 2J7PA 4K46A 2WBLC 4L5BA 1X1SA 3SFVA 2FOLA 3HU2A 1QG4A 3ADDA 4TYQA 3RSOA 3RS0A 2FPLA 2OESA 2GF9A 2HV8A 1QF9A 2IUUA 4Q4HA 3ND8A 4CEHA 2Y8EA 3OFND 3REGA 3CW2A 2JATA 2WMNB 5EP2A 1N5JA 2IYXA 2ZUCA 5C4MA 4TL7A 1CRQA 4FMDF 1E0KA 1T91A 3L0SA 1ESNA 3ONWA 3B60A 4LV6A 2AX4A 3IDQA 5A5GA 4OJKA 2XAUA 4FW9A 4EJSC 4EPXA 3EPHA 1A4RA 1WMSA 4OBEA 2REBA 1G8HA 1JI0A 4B73A 4OQLA 2F1RA 2GBLA 5FPHA 1N5IA 2C04A 1CRPA 1U9IA 1S1CA 1T0JB 5DE3A 4F4CA 4PHHA 4M9XA 4DLUA 3HR7A 4XD7A 1JPJA 3KKMA 3LXRA 3CR8A 1F6BA 1KZGB 4A0RA 1K8RA 2IYSA 1RZ3A 4XSHA 1QHGA 1J7KA 4BRWA 3MWJA 4DCNA 3EAQA 3EW9A 4PX9A 5JEDA 1G3UA 2B8WA 2RHMA 1YZKA 2ZRIA 3MD0A 4C0JA 1NSFA 2GCOB 1RKBA 2DFLA 2AL7A 3FYHA 4ABYA 3W34A 4QBIA 1XNJA 5M04A 2J7KA 2NO1A 5TXGA 2IWRA 2A78A 4ASUD 3QQ5A 1N6KA 3ZD6A 2IBMA 4JLJA 1KIMA 5BYKA 1TNDA 4NYMR 4ESHA 1CU1A 4KI0A 4B75A 4OI0A 2RB4A 1SXJE 5KPDA 4OK6A 2GCNA 1DADA 1WE2A 2A2ZA 4L16A 1AS0A 1C4OA 1UBGA 1KO1A 1FTNA 4OKSA 1N6IA 2ZSEA 3QPUA 4G0NA 4OYHA 3C14C 1OB5A 1M8PA 1UBCA 3FVQA 4UNNA 3QPWA 2LKDA 4AY2A 2O8BA 3X1ZA 4IDHA 1SULA 4MRSA 2GJAA 1N0WA 1ODFA 4HLUC 2ZYUX 2VEDA 1P9NA 5FUYA 2LCFA 4LJ7A 1W44A 2IYUA 3BORA 4Q4JA 3GJXC 5FL7D 4BQSA 1ZM7A 2KI5A 4HZUB 1Y63A 3ZD7A 3DO6A 3EWSA 4LJ4A 2G1JA 2REXB 4YQFA 5JCZA 3U61B 2ZJOA 3T12A 1XTRA 1JJVA 4C0SA 1OLOA 5KNCA 3TW4A 3GJ7A 2YINC 4OI2A 4DEXA 1XPOA 3CRRA 1PUJA 2R44A 5J5CA 5KSPA 5H70A 2NPIA 3AUXA 2IYRA 1X8KA 3LNCA 2C99A 1IONA 4LYJA 5FTLA 5JMTA 5JJKA 2YWGA 4KHZA 4Q7JB 3OIWA 1RJ9A 3EA5A 3C5HA 3LY5A 4LBZA 4QFMA 1Q57A 4GL2A 2C8VA 4DDUA 2IXEA 4TYWA 5D3MB 1SXJB 1S3SA 2WAXA 1X1RA 1XD2A 2QTHA 1I2DA 1YU9A 1VIAA 1RRGA 5GVSA 1HT1E 1QVRA 2GDJA 2GILA 3B1XA 2VP0A 3CPHA 3FHCB 4TMKA 3TQCA 3QVVA 3CBQA 1D9ZA 1EWRA 2DFTA 5DHAA 2W6IA 2HUPA 2BWJA 3R8FA 4TYPA 1Q1QA 4TL6A 4ERNA 5FBLB 4TMXA 3FMPB 2JA1A 1GOTA 2J5XA 1IN7A 2GZDA 4TZ6A 1KJYA 1ZP6A 1HT2E 1E0SA 4LJ8A 4OJQA 4C0LA 2Q9BA 1XMVA 4FCVA 4L9SA 4Q4AB 3C5CA 1GL7A 1KI7A 1NY5A 2LKCA 2ZRLA 3WNDA 4KLZA 3SQXA 3LRPA 3EX7C 1BMFD 3OAAA 2OAQ1 3PUVA 2SHKA 4EPWA 2ZANA 4I4LA 2V1UA 1CLUA 1J70A 2CMKA 1L7VC 3PEUA
chains in the Genus database with same CATH superfamily
3VUFA 2ZVDA 4CKZA 5IBPA 1L4YA 1NW5A 3UJHA 2C9YA 5DTJA 5HDQA 2R7MA 2IEGA 2VDRB 2Y2VA 4YALA 1I4OA 3MWDB 2OSBA 3HB5X 1TIPA 3C1AA 1XXHB 3B36A 1OXKB 2QRVA 3HXOA 4U8GA 3U48A 4DYDA 2YHSA 2H2AA 4DUGD 3C8MA 1H0KA 1N2OA 2BE9A 3OOWA 3OZUA 4Z0PA 1SELA 1PR1A 3EZFA 4KW7A 1HY3A 4GI7A 1BXZA 1SC1A 2X9VA 2WU3A 1L5MA 2ZCUA 3DW1X 4D4IA 4L0DA 4C0KA 2O50A 1XLVA 2PA0A 2XJ4A 3K0FB 4GKVA 2DUJA 3MJVA 5JXIA 1KEKA 1M72A 4XFKA 2D59A 2OXIA 4UHBA 4LV8B 1E7SA 3GELA 1SRQA 2FEXA 4YUAA 1XKTA 2HYDA 2ISCA 3MRTA 1R6DA 2YOGA 2AR0A 2R11A 3FTEA 3L0CA 1VE6A 4P9NA 4S0ZA 4DLWA 3PXGA 2TSYB 1N2JA 2P78A 3SAJA 3GRZA 1NVBA 3M2PA 4UXHA 2IUTA 4FD2A 1H3EA 4I55B 3K6KA 5E3IA 1U7XA 5DI3A 2EP7A 2HRQA 4RTPA 1G2IA 4CKCB 2QAGB 4C6SA 3G0CA 4E88A 1E2EA 2X5JO 2OHGA 2Z5FA 1L5LA 1XAIA 4IVNA 6AT1A 5FTKA 4OATA 1G21A 3RIHA 1AGYA 3VNQA 3FKJA 5K0TA 1G3IA 2OHIA 2ODTX 5J2TF 3NVMB 1TB4A 4MWDA 2VS1A 4N7RA 4CBVA 3AM1A 1EJ6A 1T8SA 4YRKA 2EARA 4MW9A 5K8IA 1G63A 1B0UA 4D4KA 3WGLA 3AH8A 3WK9A 1YJCA 3DQPA 2IDMA 3QLJA 1W47A 2BZ1A 4OQEA 3T7TA 2KBEA 5IG2A 1ISPA 1JZSA 1C7FA 1SB8A 2ZOSA 3ETGA 3GB9A 4J2OA 4LX0A 4ZPXA 1OMOA 2AZDA 3Q7EA 4Q1EA 3EGDB 4ITRC 5GP1A 3VU9B 1F60A 3ZGVA 2NV6A 2HC9A 1D6SA 2P1RA 1GFWA 2HWYA 1EDZA 2OFWA 3VKWA 3WZ2A 1JT2A 1ZHHA 4I4CA 4P3YA 5B1IA 1ECJA 1OGIA 3QE9Y 2C5HA 4MKRA 4I19A 4IYJA 2IS2A 1YFZA 2GT1A 3JTMA 1LWOA 4RF3A 4D8YA 5C7OO 3OLYA 5EGNA 3OE1A 3RUPA 3U3RA 2YY5A 3G85A 5WRFA 2FMUA 5BN5A 1PV4A 2X6TA 3TBKA 3RC9A 4NR0A 5C5IA 3IQGX 3Q87B 3RJ5A 3VR0A 2DPYA 4L8GA 4OSOA 1D9XA 2BV3A 2CL7X 3IPCA 3ZLUA 1GGKA 1V3TA 1T8YA 4L9RA 4RKRA 3F3YA 4WV3A 4MDHA 5HEKA 4D41A 2DTXA 2WF5A 5F12A 5C8YB 3H4TA 2IX9A 5A05A 2J3HA 4CIYA 3A4VA 1IVYA 1LBSA 1ND5A 1R5OA 2J32A 3EF3A 3ORQA 5DEOA 3R3HA 1J1ZA 3ZV3A 3KAQA 1YNOA 4QC2A 1EFCA 1SY7A 2D7JA 1XP8A 1S2MA 4GZ5A 2Q6KA 1T3SA 3ROQA 2CFTA 3KUDA 3MGGA 1A50B 1UBTS 1NQXA 3AVQA 1GTVA 3N3AC 3TLKA 1R74A 1D1PA 1TZJA 4XGQA 4BQPA 2B1RA 2ZT8A 4FQ8A 1JFTA 5AJVB 2IGBA 1SQ0A 1SZCA 3PF9A 2PKRA 1NLZA 3MCTA 4MKIA 4Q02A 3KZCA 4QPDA 4P4LA 2BGIA 2UZIR 5EE0A 4EQZA 1HDYA 3A9VA 4L15A 3KFVA 5C5EA 4FXOA 1U7PA 4TXLA 2JG3A 3CF2A 2VAMA 2O48X 1PG5A 2P40A 3ELYA 1L3IA 2KHZA 3VH3A 4JLNA 1BX0A 4BBZA 1F2VA 4NZ9A 2X42A 4EJ6A 2CXUA 1ZUD1 2C9MA 4OUDB 4YC7A 4F5WA 5GIOE 5EJ7A 1WHSA 5I7OA 3HSSA 2XCOA 5KX5A 1DZ3A 1X86B 4BCBA 4UPVA 3CX7A 3KL4A 4F11A 2QI9C 4GX0A 1UFKA 1RZUA 3AL0C 3IHTA 3P1JA 4FC7A 4WZ6A 3TSOA 3T3DA 4PS0A 2H2DA 2VDWA 2ZULA 4QX6A 4E1VA 3GEEA 4ZFNA 3DOFA 2XUGA 1CP2A 1U28C 5B7PA 1UBJS 1PK7A 5BN5B 4HZIA 1DEXA 1G7CA 2ZB7A 4GKJB 2OC4A 3CHYA 5IHXA 5LMCA 3JATA 1T6YA 5FYQA 1BS9A 4OXXA 1WRBA 2G1KA 1HYQA 1FLAA 2GOYA 3EYAA 1WBJB 3PQ4A 3FKSD 4KPUA 3VKFA 5LLTA 2XRYA 2IW1A 1OLXB 3ANSA 3PSHA 4PPGA 4C0XA 1VCOA 4JFAA 3SJCA 1ZD1A 4GX1A 5E9QA 4MPRA 3KOOA 3Q0TA 2ZSUA 2XTMA 3BTVA 3WZMA 4EB3A 3UMFA 4TZ0A 2HBYA 1N9GA 3PHIA 4OHMA 4LEIA 3W2HA 4OP1A 1X7XA 2ZAOA 4AKGA 3ENNA 3H18A 1JT9A 4JBHA 3GFGA 4REQA 4DGSA 5K9ZA 4D45A 1GO2A 4EVIA 1XF9A 4FGZA 4PLFA 3QKSA 3TBFA 2O5CA 1YVRA 3RE1A 2J85A 3G2QA 1HZZC 2OSVA 1U2GA 3SE0A 2FR1A 3ZEAA 3IA2A 1UZAA 2X8LA 3SC2B 3CCBA 2YZ2A 2JFQA 3BXZA 4GBED 4WK6A 1QF6A 1LTKA 2OD7A 8MHTA 4JCCA 2CHQA 3B5JA 3EZ9A 3FMGA 1UBRS 3IUPA 1L7BA 1QQ6A 4M9RA 1L6RA 1DCTA 5DHRA 4M46A 1YDEA 3K5PA 5BSFA 5P21A 1F2TB 2ORWA 3P9KA 1ORDA 1L4FA 3OKPA 1OFHA 2ZJ2A 3B5EA 5ALTA 3RREA 2ZBEA 1ABBA 5HNKA 3H3XA 3HN6A 3UK1A 1G0NA 1U0EA 2AMYA 3BMXA 3LKDA 3QEOA 4H15A 3CYFA 4HUJA 2RH5A 4TTQA 2EKLA 2KBFA 1ZRNA 3F9IA 1GG8A 3FMFA 3PDCA 3HCDA 2XT6A 4C21A 1E4EA 5LBIA 3HBLA 3A28A 5FQNA 3AUYA 4B5LA 4PZAA 1GDTA 3FMOB 1NOIA 1M76A 1OWNA 3KPUA 3JVIA 3X2EA 3CIOA 4WL0A 4EJMA 3S2EA 2Y92A 5F1KA 4BO0A 3CNOA 4R51A 3VR5D 3NBXX 2VJMB 3R41A 5JBQA 1ODCA 1I4TD 4J16C 1IOWA 5B12A 3K1AB 3W06A 1JHDA 3T3PB 5CG1A 1XAHA 1XE3A 2QMYA 5AM3A 1GQYA 3SJBA 1P6QA 5J40A 1LU9A 1D2CA 1FJXA 3FUCA 1KZYC 1XPJA 3BMQA 4P35A 1N8SA 5GJBA 3D6AA 4KACA 2Z8YA 1AQIA 2VAWA 3TLMA 5L3QB 1QQTA 1PWHA 4ZXPA 3KYDB 4KSCA 2BOVA 4QYIA 1W35A 5ADUS 4DDTA 1ISSA 1FCJA 2J3KA 2UAGA 3DDHA 3E8SA 4TVKA 2QQ0A 4FJ0A 3VVBA 2NVBA 3THYA 1ZK2A 3IDZA 1CT9A 2CCJA 2HLDD 3ITEA 5DXFA 3PDIB 3ENWA 4XSGA 2QEQA 4BOYA 1QZUA 4OG2A 1KF0A 2XUDA 4TKUB 1VZ3A 1QH8A 4NTZA 3R9XA 2O8BB 5CDHA 4U02A 2IDZA 1K8XB 1ZIDA 2OZKA 2AX3A 3KZKA 3KZMA 3P9QA 2IIVA 2HSEA 2WWIA 3AQIA 4HSEA 5BRAA 3HDQA 2NXJA 1I3LA 1UC4B 2HHHB 4BB5A 2VNSA 2HI0A 2XNDA 4ZAWA 1KQ3A 1L4BA 2BF4A 1XKQA 1QRDA 2W2XA 2HTEA 1XELA 3GROA 4ND1A 4M1TA 3RTDA 4BEBA 1O58A 2VDLB 3D2LA 1Q0RA 1E3TA 3LUGA 2XUKA 3JQAD 3OSUA 4QLBA 3BSYA 3UQYS 3X2FA 4PGMA 5HXAA 5C53B 4PNZA 4ZKDA 1WA5A 1RQ7A 4PVCA 1H93A 3SJUA 2HIMA 3BJZA 2I2FA 4HRYA 3INNA 1Y8CA 4U1RA 3JZDA 3RC2A 2YCLA 5I6DA 1ZUIA 4Q66C 5HQTA 3H0EA 1MGOA 3LC7O 1IBRA 3PGKA 4E6PA 2FEMA 3P45A 5HMMA 4PQRA 4JL8A 4NJEA 1UL1X 4HYEA 3OPYB 1QB8A 2FOIA 1JLSA 3NBAA 1KERA 2CXTA 1WIWA 4M0UA 3N86A 5ESXA 1RACA 1ZD8A 1FW6A 4JJKA 3CRQA 2FWJA 2HMAA 3B12A 3FFAA 5DLPA 3R2JA 3WK8A 4IBOA 5KTKA 2P0AA 4C4XA 4JJ6A 4HB0A 4TSKA 5D1NA 3WS7A 5JQGB 2OBLA 1RYZA 1ZI8A 4KC0A 2AV6A 3ONVA 2FF5A 4LOKA 3CUUA 1K3TA 2O52A 5CYOA 3TAUA 3UWSA 3ZJUA 1IHDA 3C48A 2VPIA 5I4CA 5JSKA 3FWHA 5BVHA 1EZZA 1U0LA 1LPSA 1RWKA 2IPMA 3KJHA 3ND5A 5CA0F 3SQMA 4CYMA 3B3AA 1X3SA 5JASA 1P33A 2NNLD 3N2LA 3NYIA 2CDRA 4F7WA 1K4MA 1A4XA 2CXNA 4HATA 1U8AA 3WAKA 4OBWA 3OJ0A 2ZQYA 1OC4A 4LWQA 3LO5A 5EN4A 5TEVA 1CEXA 2DHCA 2VT3A 1V1JA 2G83A 2ZRBA 4PLWA 1GDDA 5ICGA 1U6JA 3R0VA 2GZ1A 1R4ZA 4R3WA 5TQ2B 5E3HA 1K5PA 3V1LA 3TLXA 2VEOA 5LA6A 1I3MA 3RQIA 2XADA 1CUIA 3R44A 4V39A 5CAEB 4L5AA 4OVKA 3VKHA 1ZJWA 5DCWA 3F7MA 3GNTA 4EHBA 1EB9A 3BHNA 4UFOA 3SEQA 3Q8LA 1XN1A 2C00A 2A84A 1PNRA 1G4HA 3L6BA 1UPUA 4XLLA 1L4LA 2ZUFA 4B7AA 2X0JA 3GRPA 2D62A 4LY0A 3W6NA 4JXXA 3T3OA 2IV7A 1N3IA 2DR3A 1I6LA 1KDTA 2ST1A 1BE1A 1B73A 1YD7A 3HVKA 2IODA 1AZLA 1GSOA 1C8KA 4GYYA 2ZK7A 1YDFA 2FYTA 5HIAA 3OQJA 2V7VA 2Q1TA 2A5JA 4BNYA 3MWEA 3LHIA 4WN9A 2JVIA 3A4YA 3B7WA 1OZAA 4FLEA 4V3CA 3OAAD 3AOEA 4CIXA 5FAKA 5K51A 3GIDA 1PFQA 4C5CA 3WFJA 3F4KA 1IAVA 3L4BA 3A6ZA 1M74A 4M9SA 3ETCA 4JMLA 3O8QA 4ZVMA 3HFRA 1MG0A 2W6JA 4PO8A 4ROSA 1D8TA 4UAUA 4AJPA 3GT7A 4FIDA 1TXGA 3GJRA 2HA0A 4IXMA 1Y4SA 2BCGY 3PUYA 4H31A 3RUCA 2BISA 1SIWA 1J8FA 3U44A 4ZDKA 1FE8A 2WB4A 5FF9A 4DV6B 1AK1A 4FX5A 3H5LA 5BN3B 3NBKA 1IY2A 5LNK1 4NK5A 1H3FA 3F71A 1SC3A 3VBEA 1Q7CA 4E7OA 3KS9A 1AX9A 1MJGM 5H16A 4F21A 1XNHA 3IMKA 4W5WA 1JG7A 3D8TA 5JECA 2CKDA 4MPJA 1E66A 3LT5A 2H1VA 3UJ7A 5CB4F 4TLLB 5ALXA 2AN5A 5JZOA 5C51B 3USES 2TRSB 3DUFB 5JYCA 5AKGA 1DDOA 1I36A 3NC1C 3MPOA 1B93A 4OOEA 2OB1A 3RK1A 1QCYA 1UBEA 2FQ1A 3PNLA 1IQUA 3UEOA 1F1JA 2JNWA 3H42B 4B3XA 2EDCA 3V3TA 5G1NA 2PEZA 1E9AA 3RFUA 3AJDA 2IYWA 3B1WA 5HZKA 2DWCA 3A25A 5CLHA 3VBCA 4IGIA 4JHLA 4CETA 3DDNA 5KTTA 2I91A 5J5VA 4I1PA 2Z56A 3SWWA 3V1MA 4E5UA 3RG2A 3OQBA 4EW3A 1N5KA 5I8WA 2E3JA 2QIOA 3A31A 8ATCA 4BFVA 1YC5A 3HZHA 5J58A 3IUMA 2EZ4A 4BO5A 3V7FA 2AR7A 2E37A 2ENWA 2JHCA 4DEYA 1ZD5A 3M1LA 1NJ1A 1W5FA 1C30B 3IEUA 4Q4CA 1EEXB 1JUDA 1GAJA 1ZAKA 4O0LA 4OY3A 3HKCB 1YNSA 1WUYA 4Y3UA 1JYSA 3FGZA 4QJ3A 4C05A 3TJRA 2AW3A 2IP4A 2R6DA 1COWA 2CMGA 5K0JA 1PEDA 3UFBA 4ND7A 3AP3A 3EMBA 4LHEA 4ZCMA 3VYWA 1RJFA 1QH8B 5IEBA 4O2BF 5BOSB 4DCGA 3FI0A 4RDIA 2RCNA 4NLLA 3VHXB 4A8HA 1KVSA 1Q14A 3UNXA 4Q12A 2J9FB 2IYYA 4DIFA 3WKCA 3GUHA 5FUWA 4Q4JB 4OK5A 4PYLA 4MQBA 1YFJA 4Q21A 2PRJA 3O4RA 4JBWA 1W581 4B6JA 5IC5A 4RTMA 4NXMB 1RU3A 4P4NA 2NYUA 2GCIA 3P0EA 1W9HA 2PMFA 4QXAA 5GIPE 4E21A 3L6RA 1YZYA 3GCGA 2RDMA 1LLFA 8ADHA 3WQHA 1UXIA 4DV0B 5IJZA 4JBLA 2LIVA 3RJZA 1XU9A 4Q5IA 3WGZA 3WYEA 4DEVA 1P74A 3N75A 3LYLA 1HBJA 4NCIA 2GXUA 1LPNA 2A1UA 1HE3A 1SD5A 1AUVA 2YZ7A 3GAZA 4TROA 2ZS7A 1PFVA 4AMZA 3NWEA 4QHSA 3EIFA 4FYYA 3RBZA 4C89A 2V6FA 1RMQA 1VPDA 3IEVA 4BGIA 3EOBI 1R4AA 2ZP1A 1IXKA 2OTCA 3EXIB 1CYEA 2MR6A 2C2YA 4OX9Y 2VK2A 4I9HA 5JRZA 2C5BA 1ETHA 2JAQA 3UV7A 3HJHA 2YVQA 4N76A 4YRFA 1WQ3A 3KEFA 3LOQA 2Z3WA 3CEJA 5CGQB 2ADOA 5E7MA 2IUFA 1J2TA 2DF8A 3QOXA 5EHZA 2CLLB 3U4MA 4QWWA 4MYUA 4M49A 4AJKA 4GM4A 2R6AA 3W8NA 4F5ZA 2DY1A 1X74A 2YMQA 5DOVA 5HUJA 5IN5A 3ZE0B 4AROA 2JFPA 1WD5A 5JY1A 4RK1A 4MV0A 1BHO1 4RJJA 4AUNA 4EJ0A 4L3WA 4L7VA 4DVJA 1XZMA 3KBBA 4N49A 4GXRA 5I9IA 5DASA 4M38A 2A57A 2H85A 1PFKA 4KFUA 3X1XA 5FPKA 3OA0A 3AZQA 5IAEA 3RUDA 1JKMA 1NQUA 3P4XA 4LF4B 5CXSA 2RHJA 1PZNA 4LE0A 5JCPA 1C41A 2CDBA 1JEQA 3L7IA 5B57C 2Q49A 2IZ5A 5C7IO 1XAJA 3I05A 2ZUTA 3VOAA 2EFYA 4RK7A 3FNBA 2G17A 4H7DA 5A5VA 3TUJC 5D3QA 4FWTA 1NF2A 2GJSA 4G25A 5E2AA 3AR9A 3HBAA 4PNHA 3ZI0A 1U2DA 4NMLA 1JFSA 4WOKA 2GSWA 3V2GA 1WDTA 4DSNA 5ELLA 2XUFA 4HVAA 4CLOA 1QS0A 4KZKA 4NNPA 1XQ1A 1SH7A 1NVEA 2AQHA 4LE2A 1N1MA 4OIFA 4R5HA 2QR2A 4KE8A 2YIVX 1E3SA 1GCOA 3YASA 4Z7OB 3CA8A 5FT9A 1R5JA 4XVCA 1KDYA 3TD9A 2VHYA 2OE2A 2Z1DA 2JGJA 4LWPA 1J6UA 4MB6A 4YRTA 2PUFA 5A5GA 1UT6A 3CX3A 4FOPA 4PG4A 5BRJA 2IHJA 4AW9A 3WICA 5DYNA 3GLVA 4JIMA 2FPWA 4INZA 3K53A 1AKMA 1KU6A 4F84A 4NJOA 5CU7A 3TWOA 1BN7A 3V7WA 4Z3KA 3STXA 3P96A 4G56A 2GK6A 2XMCA 4PZLA 1UJBA 3SJ7A 3GX1A 5KU7A 4I5IA 3H8WA 2HDHA 3D02A 1KQNA 3B1YA 2QJTA 2ZUBA 2OFFA 3UAOA 2PGOA 4Q3KA 3SXUB 4CRWB 3WWEA 2H1LA 1YZVA 2ZJ0A 2UZAA 4IXNA 4OQPA 3ZIUA 4B34A 5EZ6B 2DFNA 2JJYA 3BT7A 2AG6A 2WKRA 2F2TA 4W1PA 4HDRB 5MFPA 2FMKA 3O4GA 1EESA 4QDOA 1KDVA 2QUJA 2QJWA 1Y5LA 3PCXA 1YBVA 3PE6A 2YXBA 1OXBB 3BQMB 1YOVB 3C1OA 3EQ7A 1ZL0A 4XYMA 4DPLA 3U5ZB 4DMRA 1T1SA 3MG9A 5BWBA 5F7XA 4S1WA 4H18A 5EWJB 2DWQA 3DE2X 3NHUA 1C3OA 1W46A 2VOEA 2ZZMA 4ZIRB 3ELBA 1KYIA 2FEWB 4YXFA 1UKVY 2R5FA 3KLNA 2FEKA 4TRNA 3OFSA 1Z33A 1QSGA 4TQUS 3REFA 4BB9A 2LTAA 4H9GA 3U3KA 4MQEA 4C4OA 3ICEA 2CBZA 5F51A 3O0TA 1WVIA 3WVNA 5JANA 1XZAA 4YCNA 1PUXA 2ZJFA 1AU9A 1YBMA 3VSEA 1YIAA 1YI1A 1KGDA 1PR9A 3ZWKA 2Z5VA 4F97A 4HVCA 2B30A 3KDAA 1SC4A 3U7RA 4XOIA 1EVYA 5CK5A 1LK5A 2FMTA 4EBFA 2OQVA 5KUTA 4ZZ1A 5A4FS 1OI7A 2H4YA 5FORA 4ZMRA 1MC4A 2IYPA 2QVLA 5G40A 4UTOA 1L4GA 4HAWA 4CEHB 2G0TA 3C16C 1KFJB 4Q1VA 1BH2A 1D4FA 1XCGB 4BEVA 2X76A 1MR3F 2ZE6A 1QXSA 3WLKX 2CUTA 2OXRA 3ELUA 1KTIA 2GRAA 2IDJA 4PRLA 2Q50A 1P2DA 4PX3A 1P5RA 2W8BB 4DS3A 1W25A 3CVXA 1CYDA 3C3EA 5JVDB 1EB8A 1Q3TA 1QRSA 1KQOA 4BASA 1WQ4A 1JIKA 2DXIA 4AWAA 2CJWB 3UC5A 1R66A 1WW2A 3KAPA 3QKIA 2FSPA 4KQFA 1FZTA 2CHFA 3HYSA 3HPQA 3FR8A 1ISRA 4KJZA 5F5NA 5AOVA 5TPZD 1JVBA 2P2DA 4OAQA 3TXYA 3WMRA 5AW6A 5FEUA 3WE7A 2TMGA 3BL8A 4DQLA 4Y18A 4FN5A 1G38A 3D31A 2RHBA 3HNOA 3THWA 3T7DA 4U2FA 3VMFA 4P92A 4WESB 1MO4A 1YTLA 3NUQA 4AZSA 2Y2UA 2GXQA 1ZM3A 3D2AA 2QW1A 3I9OA 4MVXA 4HD8A 3PEVA 2XCLA 1T43A 1ZI9A 3NTXA 2GXAA 3CRW1 3OUUA 4UTXA 1C1DA 2AC2A 4EMSA 3GG2A 5B6JA 1Q7BA 3SVTA 3K16A 2WDZA 2Y99A 3OO0A 1QRTA 1TQ4A 2F48A 4RD2A 2IH5A 1IHXA 1KVTA 3FMVA 5JUWA 2PVPA 1YUBA 2X41A 3GEGA 3PRHA 4X61A 3SHWA 1RWQA 4NBVA 1FYWA 4MYRA 3VR6H 3IAEA 3P26A 3L8ZA 1WKVA 4FQ7A 5TGDA 4ZVSA 1TT5B 4BVEA 3TNLA 3R5XA 4EIWA 3PEWA 3FAZA 1G4UR 3IIMA 3MWGA 4UUMA 3X2SA 3SSNA 4AG3A 1FFYA 1UXHA 1Z0UA 3MT9A 1CUFA 2VHEA 3TR0A 4R9RA 5SYMA 1GL3A 4PZZA 5EQJB 1OWPA 2BGKA 1MZVA 1WV0A 3WB1A 2CXPA 3EBPA 4J0KA 4H17A 1K5GA 2V7QA 2WIAA 5TPWA 4IRMA 1SPBS 3KR0A 1QLHA 3JVEA 2DG2A 3VU1A 3GZJA 3U4QA 1R0ZA 4XCQA 1UQUA 4G0MA 4EAAA 2QDXA 1TQHA 4IMRA 3BERA 1FA9A 3MC1A 3L4KA 4TMVA 2BMVA 3GAFA 1HEUA 4TTSA 2ZATA 1LBQA 2YRFA 3V48A 821PA 1A8SA 4JBNA 4NZYA 5KTSA 3EDOA 2QXTA 3ZDDA 3EIUA 1UIRA 2GD2A 2JGEA 1PGJA 4D80A 3PQ2A 3FWNA 4I8DA 1Q92A 4ZIRA 1L8XA 3IUSA 2QNBA 4AJOA 2XOKA 4F6LA 1SB9A 1JJAA 1XV5A 4ZYWA 2NTNA 2DHQA 4N40A 5C8XA 4N3BA 4HR7A 2KLHA 2ZRAA 4J3FA 4BCCA 2GLXA 4AJJA 1FDSA 2GZ2A 4CZ2A 1KC3A 5DI9A 2GBGA 3G2OA 1ZA2A 1NASA 3CUYA 1XZJA 1ZITA 5KOIA 2AH5A 4UJ3A 1EBFA 3SC2A 2JFGA 3NBZC 5EESA 4D79A 2IU0A 3T4XA 5DGIA 2QM0A 4INOA 1C9KA 1VIYA 1K3FA 1W30A 2ASEA 2INGX 5AMXA 4OH1A 4JL6A 3IDFA 4HS9A 2B6NA 1I3NA 1JZQA 1VCMA 1WMFA 2BEJA 3BE4A 3IUQA 3LF1A 3NDRA 1ZSNA 3OQVA 2PX0A 4BNIA 1BQEA 4F0JA 3WGUA 2P9GA 4ZI3A 4JOBA 1EFHA 1G5PA 3HHEA 3MJTA 4HI0E 4Q7MB 1Z2NX 4WZZA 4RELA 5J1TB 3BEOA 2VTBB 1JLLB 1NLFA 3GJ4A 5LP6A 1L4NA 5JI2E 1T9ZA 1YL7A 3KR2A 2I6XA 1ULUA 4YDHB 2DPLA 2Y9PB 5TR9A 3ZY4A 3NWBA 4JJAA 3BXFA 4RMJA 3SSMA 1BDHA 3FGOA 4FT4A 4N3GA 4MDFA 4ZOBA 4Q1FA 2GPYA 1GGVA 2P4SA 3X1JA 2FR0A 5ALFA 1RBQA 3G7SA 3QFFA 4TMWA 2EKQA 3STWA 1YRLA 1GQOA 1U5AA 2VH1A 3ZU2A 4W82A 2F17A 3JQBC 2VP4A 4TV8A 4DR6B 5CVCA 1GUAA 1YE3A 2IXTA 4AP6A 3ZY6A 1JHPA 2XUQA 1GSIA 1B8PA 2QRGA 1AUOA 2FP4B 4MWCA 4PRYA 2EP5A 4M8SA 3NAZA 3W79A 3UUGA 2D8MA 2ZBPA 3DHYA 2IYAA 3HCBA 4UUQA 1H4QA 1GV0A 1HDXA 2MMGA 5IT5A 4B80A 2G1AA 4K6MA 3F49S 3QW4B 2P3OA 4U3JA 3AJ8A 3HDGA 4S2UA 2AXQA 2O0KA 1KMHA 2R6HA 4BFTA 4CLOB 2CLFB 3H2JA 3SKVA 2IXGA 3WYBA 3GH1A 3NC0C 3HXLA 1OQAA 1I0IA 4RVHA 1N5DA 2XKAA 3Q0EA 4GKBA 1QCZA 2CVFA 2JIDA 3AXTA 2Z2ZA 5H3CA 4B84A 3AKCA 2PR2A 1KYTA 3DKIA 2J7PD 3AF4A 3FSEA 1JFVA 3DAYA 1EK0A 3PX2A 4HWTA 1W34A 1W0KA 1K7EB 4ZHQF 5CA1B 4RY8A 3SEFA 4ASUA 2UXBB 5ALSA 3NMUF 2H4FA 5C0OE 1X80A 4D4LA 1XCMA 5AUQA 1RMTA 4PQEA 4KR2A 2CN1A 4EFMA 1OCEA 3K0CA 3LG2A 1TAGA 4HP8A 2GUWA 4HS4A 4HYTA 1X39A 5JWRA 4HUQA 4LQCA 2OC9A 3HJUA 4W5NA 1JR3E 1V35A 1HDGO 1PL6A 4MR7A 4H4CA 5ULLA 3MLAA 4TLEA 1JS1X 1OSNA 3ZVRA 2J5RA 3HKCA 3FYUC 1UFOA 2QDKA 3JAKB 3AOGA 2IIBA 3A1FA 1Q3HA 1O6ZA 3BX1A 3K1YA 1PP4A 3OEEA 4M53A 4UBKA 5EE1A 2QT0A 4FMPA 4B43A 4FKBA 3P5SA 2C4NA 1KDRA 1YAHA 1ZWLA 2BFFB 1X1CA 2R1VB 3B13B 2IE0A 3A27A 3WLRA 1PJ8A 1Y8RB 2G04A 1KO4A 4WECA 5BYAA 4IO1A 3EPLA 1H5NA 4DCVA 4L3OA 4M21A 1RRMA 2BKAA 2OB2A 4FUTA 4TKMA 1DINA 4LBWA 4ENPA 3C74A 3E2IA 5AI8A 2BIFA 1M1UA 3LC0A 5IWCA 1J07A 4FFNA 3LH5A 4ZAYA 1AA6A 3IXMA 1RYNA 5F5LA 4C6RA 1Z38A 3HVHA 1VKNA 4LSMA 3ZQ4A 1V2HE 2O14A 3DD5A 2BLNA 3GMSA 4QAJA 5TB5A 5I45A 2XOEA 1WCIA 4DMFA 2JCYA 3D8UA 1P1JA 1AN9A 5FUQA 1J97A 3O3NB 4LYHA 1TEXA 4RFSA 1Q21A 5TMDA 4CJXA 1FP2A 4U7DA 2WTBA 2DHDA 1XL0A 1J33A 4KFRA 4RMGA 4Z2YA 1IUOA 1UFVA 4ZAFA 1CEEA 3H4MA 4EGJA 2AQ8A 1A27A 3G9UA 1RPAA 5C8DA 4LYDA 3WQRA 3R23A 4R0VA 3ZHTA 4IO0A 4TZKA 5HUQA 2H0QA 2F1JA 3ZJ5A 3FETA 4CXMA 4EYGA 3KXPA 5TARA 2H59A 3FPJA 3JQ7B 5BSGA 3DP7A 3ZKWA 1POWA 3GK3A 2FETA 4QOIA 2O2DA 4HQOA 5A0VA 3I58A 4MW6A 5IK2A 5LIPA 4KVGA 4MPPA 2ZITA 5HJ7A 4Z53A 1P7WA 3KTFA 1JIJA 4FNGA 3CB2A 2I6FA 2CFCA 4K0KB 4MUAA 1S3FA 3ZX4A 2W6ID 4EFNA 1YS6A 1Z3IX 4YJHA 4PW0A 1B1CA 2PUWA 2WFLA 2XVYA 3OQIA 5ALWA 4KO4S 4L50A 2DLNA 2P77A 4NZZA 2QORA 2HADA 3A3KA 3E8XA 4PWZA 3ZZ1A 3S40A 4F3YA 4MR7B 1M1XB 3UWDA 5J4KA 1CDEA 1P72A 1UM8A 1QHXA 2AWOA 5D00A 3FPFA 4A91A 4N5MA 5KHLB 1X8XA 1VRCA 1KOGA 721PA 1NVGA 2BRUC 5DYWA 4DYVA 4DCTA 2DT5A 4ZYLA 4B74A 5JAZA 1TUBB 3K1JA 2D00A 1XEXA 4M7WA 1GWNA 2QXUA 3M49A 2BZSA 4G86A 3DMHA 2H5LA 1Y8RA 5L7YA 3ESRA 2QBYB 1I1QB 3MM4A 4PICA 1J5PA 1DJNA 3PWZA 2HGSA 3MTGA 1BW9B 2HU5A 2ZRKA 1XZCA 3QV1A 2ZPUA 4H7PA 5AUNB 4RY0A 1NJ2A 5L3QA 4OHRA 2O54A 3VKUA 1E8MA 1W4BA 5HM6A 2WZQA 2ZT5A 3OA2A 1CJTC 4DARA 3DDCA 3JYNA 4CV1A 1OPXA 4OXRA 2FSVA 3JD0A 4QOEA 1W7AA 3D3EA 1A77A 3CINA 3NLLA 1XZQA 2O0MA 3S29A 1NR7A 1KQFA 1ONOA 3S8YA 4JLBA 3ST7A 4KYUA 3OBIA 2GS9A 3VTFA 1YE8A 4AMVA 2HNBA 1QB7A 3IXLA 1VTKA 2E1PA 5CVDA 1NTOA 2QV0A 2YFYA 4AJLA 2WM2A 5CB0A 2DZDA 5J47A 1KKMA 4TQ9A 2JHFA 3IEMA 5FHQA 1EKXA 3NHWA 4M9UA 4CCYA 4EAQA 3QQPA 3WY9A 4AK9A 2ZJAA 3GJYA 3IVMA 3ZE2B 5HP4A 5FADA 3KQOA 2PZAA 3WL6A 4V0LA 4QUHA 1YQQA 5EWLB 1IQPA 1YR8A 5HDBB 1Y7PA 5A6SA 2C58A 5ALMA 4K05A 3Q7SA 3SYKA 1RYDA 3ETHA 3O2SB 4ZEVA 4M7PA 3RFFA 3HC7A 5A4DA 3QUTA 2GEUA 1XDUA 2JIRA 4RETA 5IJXA 5EEGA 3JYPA 3KSMA 1TUEA 3A10A 1Y5NA 1ZH8A 1HOXA 1PFWA 1Q0SA 1P2GA 4CMCA 3I9NA 4EZEA 2X7JA 4ACAA 2I66A 4BO2A 3AK4A 4OJYA 4AKEA 1X7GA 2Z0MA 3LL7A 3NHKA 2A1TR 2UVQA 3EG9B 3L4JA 1DVRA 4EW1A 4R2XA 4X8LA 3U60B 1A2QA 1LA2A 4K2AA 2GGSA 4OHUA 4L8FA 4MKZA 2CNWA 4X8OA 2F7SA 4RKQA 3X1MA 4DM3A 4BZPA 4XVUA 4Z49A 3PEYA 1QQ7A 3S28A 1SCBA 4WBNA 5U9CA 1T8TA 3QYAA 5A9SA 3EVDA 5M3BA 4ZCIA 1TK9A 2AHRA 4TTIA 2G09A 4DTCA 3N59A 2JKVA 4P2BA 2PQ2A 3JPWA 1GNVA 2BPOA 1E5TA 3AKYA 3GJTA 4BJ1A 1ZJ4A 1U8XX 4MMXB 4AYWA 3EIQA 4FMCB 4AP9A 4XRRA 2GAOA 3HS3A 5FFNA 1WXFA 3SC4A 1T6ZA 4U6QA 5ALUA 3I04A 2GCOA 3EUFA 4HDQB 4HQ6A 3AHIA 2WD7B 3QM1A 3JTEA 4QYTA 3PPVA 3R6GA 2BFBB 4J03A 2QTBA 3H2YA 1NVMB 2JJMA 2V7QD 4Z86A 1R64A 1U63A 3GR6A 3T4PA 3KB1A 1QHFA 2YZKA 1CY0A 4S3MA 2VF4X 4MEAA 1TEHA 1BROA 4V0ME 4YCDA 5ERYA 4I4NA 4D9EA 1NIPA 4N0EA 1U8YA 3AFNA 4KSBA 3KQPA 4ZOCA 3E48A 4H6XA 5ELMA 4EDFA 1I4WA 2CHUA 1G4AE 3Q7QA 4ITUA 4D81A 5KREA 2VP6A 4AJHA 4MR8A 1M2WA 1KK0A 3GFOA 3UICA 1BCSB 1E6UA 3PQDA 3RSFA 3KE8A 2XGJA 5IT0A 3GFPA 3FNRA 1MOQA 4I14A 2BDUA 3M4ZA 4MH0R 4UHKA 1GFZA 1AVTA 5CA0B 4EGFA 4MJ7A 3OZTA 3KYIB 2CK3D 3QTBA 5K8TA 5KYNA 1JAIA 3U7HB 2GWRA 3DVQX 2D7DA 2NO9A 4XGKA 4DSUA 1C1DB 1XZGA 3HP1A 1ESCA 4DG5A 3SGLA 1Y42X 4F2HA 3AGQA 3VPSA 5E8JA 2WPNA 4HFJA 4Z5XA 5LQAA 3SIPA 4X1OA 4DC1A 3CS3A 4XFDA 4XWGA 2QTZA 4ANFA 3GRFA 3LXXA 3N2NA 4OK3A 4P33A 1FLNA 4RJIA 1Y0BA 5BQ5A 3REQB 3D7RA 2AOUB 4PPNA 7ABPA 1IIBA 2HA6A 3C3DA 2H3HA 5AHXA 3PFCA 3HWSA 2KS6A 3LU1A 3RVQA 1WSWA 1JPUA 3MQ4A 4OCZA 4A0FA 1FXSA 2Q5LA 1SBCA 1S8OA 1Z83A 3GXOA 2XTJA 2GNOA 1BAPA 1AS2A 1HWYA 2WF7A 4G1CA 1X7YB 1WDKA 2GEBA 2GYUA 3NTLA 4K6CA 4LKOA 3V32A 1IHYA 1AKTA 3NHMA 4KL8S 3AUFA 4HDCA 1BCRB 3EARA 1F0YA 4CQMB 2WWFA 2HJHA 1Y1LA 5KB3A 2OLJA 3KQHA 3NASA 4DA9A 2PRYA 1Q1NA 3Q7RA 1TAHA 2Q3EA 2FZKA 2UZ3A 3G2LA 4C4RA 4QSHA 4AZWA 3JVVA 1L7RA 1A5AB 1QLWA 1ZXLA 1CF9A 3HEAA 5TIIA 1ZNXA 3CLTD 5D01A 5LD2C 3L06A 5FI3A 3O38A 3PD0A 3OZGA 3VI3B 4GPEA 1N2CE 5ALVA 1C7JA 3OUZA 1NDUA 2JJ2D 1NE7A 3ZHZA 4D9NA 4H1HA 5KYWA 5F7JA 5EUQB 1YJ5A 3TLZA 4BFCA 3T3EA 2HLHA 2I3BA 2I7XA 3LQ2A 4Y2VA 2IUYA 4ZOQI 1ZRSA 5E2IA 1G17A 2XDYA 1XU4A 2QMEA 3DZIA 3E9EA 3GJ8A 5U4QA 4DUPA 4O59O 3TRFA 3F6YA 1BX1A 3KOXA 4DZZA 1PWXA 1NLUA 1YJQA 1GAXA 2ZUUA 3A05A 3JQAB 1MKYA 2B4YA 4LZZA 1I7DA 4HNQA 4BNLA 3MELA 4WLFA 5K0ZA 5KQGA 2IEAA 4Y2XA 4AI6A 2H7XA 2HQBA 4K88A 4TX1A 2NO5A 4NY1A 1NRXA 1RZVA 2CZCA 1T3GA 3GRUA 5KDLA 4G5FA 3AHCA 1C3OB 2ZU6A 1ZBQA 5KTNA 3W05A 2R6CA 4HTFB 5JDIA 3PC8A 2FU5C 2LWIA 2Q4EA 4URZR 5F2OA