3SJCA

Crystal structure of s.cerevisiae get3 in the semi-open state in complex with get1 cytosolic domain
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
349
structure length
276
Chain Sequence
TVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAECKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for tail-anchored membrane protein biogenesis by the Get3-receptor complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transport protein
molecule keywords ATPase GET3
total genus 80
structure length 276
sequence length 349
chains with identical sequence B, E, F
ec nomenclature ec 3.6.-.-:
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3sjcA00
4JLOA 1HA3A 4IHQA 1W0JA 4OQLA 4Y0AA 4Q1BA 4F4CA 2AK3A 4ZDIA 4JLJA 2J0VA 1BMFA 4A36A 4TMWA 1OIWA 1GRNA 4DIDA 1KSFX 3TNFA 3A4NA 4QG7A 2XXAA 5JRZA 1UKVY 2PBRA 1QZXA 2CHGA 3Q3JB 1LV7A 4AG5A 5DSZA 5J4HA 4AG6A 2P5TB 5DHAA 1IBRA 2WM9B 1EXMA 3CNNA 3IPXA 3E5HA 1KDPA 4XJXA 3F3YA 2GESA 4NE2A 4FIDA 4HLCA 2JIZA 5J47A 5L8VA 1HYQA 1JXOA 4DSUA 2D4HA 1Z29A 1Z6GA 1YZUA 3AF2A 2KJQA 2C98A 3I73A 4PAMA 4RZUA 3U2QA 4L5BA 2R2AA 1T4GA 4GZLA 3TSZA 4P3YA 5DO9A 4WA7A 2WMNB 2BMDA 2O0HA 3O47A 4B74A 1TX4B 4BUJA 1CXZA 4HDQB 4MKGA 3T5GA 2P67A 1TNDA 1XD2B 2XNDD 4EQ6A 3FFBA 4XSGA 5LBIA 5FTNA 1DTSA 2BKUA 4RFVA 2ZU0C 2C77A 3MRSA 3HYTA 4JSYA 1W44A 4TTQA 2VO1A 3OIVA 4URZR 1E0SA 1SXJA 2HUPA 1ZM4A 4R71A 1J70A 1XF9A 4RD2A 4RD1A 1XZPA 2J59A 4LSGA 2JJ2D 4US2R 1PLLA 4EKDA 3B1XA 5GVRA 1Z0IA 1G19A 2RGGA 4AKHA 5EQTA 4B3XA 4DDUA 3GLGB 4D0LB 4B44A 4EJSB 4GL2A 5FBQB 1X86B 1YRBA 2O8EB 3HJNA 521PA 1U99A 1H8EA 3QXJA 4XVUA 2A5JA 3FMFA 3KTAB 5BXQC 4PHHA 2EWVA 5EXPA 1Q12A 3AGQA 5H68A 3VR3A 5IHPA 2AD1A 2FSHA 4FMCF 4EUNA 1WRBA 2XZLA 4MKIA 5E7IA 4KBGA 1GM5A 1DADA 1Q1ZA 3K0EA 2J3EA 3TR0A 4PAQA 2Q3MA 3RDPA 3TRFA 1A5TA 1OIXA 4NH0A 1I4DD 4NYMQ 4DLRA 2FU5C 3QENA 1WB9A 4RKFA 1GZSA 3LDAA 3AP3A 3W90A 2GBLC 1S2MA 1G17A 2RKOA 3KKOA 2ZE7A 3CKLA 2ODNA 1VKJA 3TMKA 1YQTA 1PJRA 2QMUA 4KV9A 2WWHA 3A1TA 4XIGS 1ODFA 2YWFA 3FVQA 1QHNA 2WJJA 2VP2A 1E98A 4M1YA 2FH5B 3AVPA 3KKPA 1ZCAA 3LH5A 4IOJA 4WAUA 4MITA 4PZYA 3LLMA 2FWRA 1UEJA 1EFRA 1NMXA 5CITA 1CR1A 2GXAA 4XWAA 2OXRA 2NZ8A 4TLDA 3FOZA 1P73A 4LPKA 4TL8A 3M0EA 3LO5A 1HY3A 2ATXA 2EQBA 1WE2A 1MKYA 1N6LA 1IQPA 2JJ2A 4KYIB 5DLQC 4PZLA 4BLRA 1G4AE 2HJVA 3VR2A 1MH1A 2R6GA 1S96A 2ZETA 4KSCA 3ICQB 3B85A 3FDIA 4JT4A 3ADKA 5GJVC 1SHZA 3P4YA 1P72A 1RVDA 1Z83A 1UBEA 2OBLA 1KSGA 3ND9A 3H0KA 2QMHA 1OXSC 1OXXK 2GEUA 1E9FA 1S4QA 5CB8A 1Q21A 5IK2D 3KFVA 2IS4A 2WJIA 1FZQA 2YYZA 3K0AA 2BCGY 1G16A 3W34A 1UM8A 4F91B 4URXR 3ADDA 4QJ3A 3K0FB 5KTYA 2ZTSA 3KFXA 2V6JA 4LJ8A 1U8YA 1I4LD 2WJHA 2RGDA 3DVLA 4B32A 3U5ZB 3HP1A 2IYSA 4K8OA 3KXKA 4MUAA 1VYVA 1VPLA 1G7SA 2DB3A 1BKDR 3QXCA 3M4YA 2ZITA 3RS4A 4JJKA 3MJRA 1ZW6A 3LA6A 3B6EA 4Q7LA 1S3SA 3RS2A 1JECA 1Z0KA 5JI3E 4UNSA 2IYVA 2ZRPA 2BBWA 2O8CA 2RMKA 1UAAA 2VP0A 3AQ4A 5TXGA 1OH8A 2CNWD 1T0JB 3PIRA 2ATVA 2GXUA 4JVSB 2KBEA 4QBGB 4DLXA 4IJMA 1NP6A 1UBGA 2D2EA 2A5YB 4NYIQ 5EUMA 1E32A 5FUXA 3RC8A 1H8ED 4OK6A 2WBLC 3IKJA 1ZUHA 1E0JA 5ELXA 3IIMA 1E9SA 1FNNA 2Z6VA 3UG7A 4TWZA 4ZKDA 1O3YA 4PXAA 1Q57A 2ZQ5A 4IFEA 4JVMA 4C0HA 5SZHB 1DAMA 1F2UA 2CBZA 2X77A 4Z1MD 3ZZUA 2UZ3A 3L0IB 4D80A 4LJAA 1M6NA 5FTJA 3PCRB 1ZU5A 4CDGA 1W0KD 5G3ZA 4CT5A 4FD2A 2JLUA 2P5SA 4CIDA 5C46F 1G21E 4RZ3A 1VIYA 4YLGA 4QC2A 5HKKA 5JWOA 1NVVR 3NDBB 2HF9A 4I4LA 1NKSA 3IGFA 2Y8EA 3LX8A 2VA8A 2QA5A 1A82A 3CH5A 5J40A 4PAOA 4URYR 1TQ2A 4H9GA 2H17A 2F9LA 1NVVQ 5F9FA 3IPYA 4KO8A 4Z1MA 4OKSA 3GP8A 1AN0A 1XD2A 1F2TB 2C9OA 2RHDA 4L16A 4IVRA 3FFAA 4KXFB 2AHOA 4WZBE 2YOHA 4F92B 4HB2A 4QGGA 2RH5A 4N3NA 4QBFA 3MSXA 4JLBA 3MCAA 5FBRB 4H1VA 2JCSA 4GNKA 2V1XA 2X8AA 3OEHA 4D0NA 2ORVA 1E94E 4UNPA 2WJVA 1QVRA 4NCIA 1KDTA 2PLFA 2GXQA 3GCGA 3GFOA 5FOXA 1TQ4A 2KI5A 5KSPA 3GLGA 4EJSA 2C9CA 3MWLA 5HZHA 2PT5A 2CJWB 1D8TA 1S1MA 2HXYA 3EIEA 4URVR 3OFNA 2QTVB 1W0JD 3N2EA 4G5QA 4M8NE 1AS3A 2OILA 4QGHA 5JRJA 2ZE5A 1KI1A 1UDWA 5EE3A 5JCZA 5SZIA 4FMCB 2W6JD 1NIJA 1II9A 4KYUA 1XPRA 2W6IA 4B2IA 3EA5A 1NVWQ 1Z6AA 3TAHA 5FBVB 1K8RA 5JECA 2GHIA 1TF5A 1OFIA 3QSYA 5JS8A 3N2IA 5AUNB 1TU4A 4OHVA 5LB2A 1L4YA 3EA0A 3CZQA 1XB2A 4R7ZA 1NKTA 1G1MA 5CK5A 821PA 3G0HA 1UKEA 1M7HA 2JJ1D 1HH4A 2A30A 4URWR 1IN7A 2J7PD 4EPWA 4MKHA 3K9GA 3TW4A 4QNRA 4RD3A 1G8FA 1U98A 2F9MA 4GRAA 4AD8A 4QBIA 2ERXA 4OI1A 3T61A 3VX4A 5CJPA 2XTMA 3AF1A 2D3WA 1N2CE 4LYAA 1RZ3A 3QE0A 1ZM2A 4GOJA 1ZNZA 5C4GB 3VQTA 5DGXA 1FMJA 2YOFA 1MRSA 2HCBA 2XAUA 1P2SA 4RJLA 1XPUA 4ZCMA 4EJSC 1TADA 5HKKD 1X8KA 1F60A 1TQ6A 2WWXA 5AJVB 4DLWA 3U4QA 5KDDA 3CZPA 1G4UR 3VNVA 1FTSA 1E6CA 2R6FA 1KJYA 1V43A 4ESVA 3TW8B 4BLOA 3O8CA 4Q9LA 3CWQA 3DKPA 2IEZA 3BH7A 2GJSA 3SYLA 4NBSA 3NKVA 1KO8A 3ZZTA 4HDOB 1PV4A 1TEXA 3BFVA 5FPHA 3U44B 1A4RA 2IW3A 1UF9A 2QGZA 3KB1A 4W5HA 2QP4A 4IVQA 2GEVA 4GOKA 3RWMB 4Q00A 3WNCA 1AJEA 1QHIA 2XEXA 4N0EA 4OQMA 3ONWA 3ZGXA 1CRPA 2FPMA 2QNRA 5FBLB 2VPPA 4H1UA 2NTYC 4JLVA 1JNYA 1BMFD 1LTQA 4LBVA 4D4KA 5JS7A 2G88A 2FNAA 2WAYA 1GDDA 1VYTA 2CLCX 3SYNA 3CF0A 4FMBB 4G1UC 1GRQA 2DWOA 4HB0A 5AWFC 3KZ1E 4X8MA 2QMOA 1MO4A 3H2YA 3QQ5A 4EPRA 3QKTA 1E79A 2XTZA 1CP2A 2YKGA 3GLFE 2FEMA 4JYBA 2DYKA 2WSSD 1LW7A 4KFSA 2Z83A 3Q7PA 1LY1A 4EPXA 4Z8XA 4GMDA 2J0QA 1ZNXA 1XTRA 3EXAA 1SVKA 1JJVA 4NCKA 3CX8A 2YINC 2IXEA 3BB3A 2G9NA 4D0GA 4MYTA 1NVXQ 1E2NA 2CCKA 4EFNA 1PZNA 3KQLA 3L0SA 1PUIA 4L8GA 2QQEA 4PHFA 1TPZA 2QQ0A 1G6HA 4O25A 4DLVA 1P5ZB 3W9YA 3FHOA 5KSYA 3MD0A 1E2MA 5H8WA 4A0HA 3KUCA 5AJWA 3EW9A 3K9LA 1P2VA 4NCNA 2QSYA 4KFRA 1R4AA 2X2FA 1P75A 2WOOA 2AXNA 3ND8A 3ZS9A 1Z0FA 1NL3A 2LKDA 2AR7A 3UK6A 3SQXA 4C9BA 5DI3A 1GFIA 4U02A 4MDEA 3SYKA 1NY6A 3UWKA 4Q9JA 4DCTA 1GL7A 4W5JA 2OLKA 4TT3D 1MOZA 2AXPA 4BZPA 2RGXA 4UNQA 1Z6XA 3VKHA 4XVRA 5GVSA 5IF9A 4IVPA 2RB4A 1DARA 1Q1EA 3ETLA 3K09A 3L0OA 5FTKA 1F2TA 1ESNA 1DAFA 1D5CA 2JLSA 1NJGA 3RANA 3TE6A 1J8YF 1Z07A 4DCNA 3W5IA 4E07A 4PC6A 4QHSA 4YDSA 1E1QA 3DKVA 3GLHB 3W3AA 1FOEB 2BJWA 1E9DA 3CLVA 3G5UA 5EUQB 3PEUA 3CX6A 2W6ID 4ARZB 4DLYA 2R65A 4A0RA 1XEWY 4QM6A 1T91A 2FGJA 2ZJ8A 5E7JA 2XSZD 1JPNA 2YOGA 4P4SA 4TL7A 4HAXA 1LNZA 3IO3A 1KAOA 1ZRHA 3WHLA 4TL6A 1YE8A 4GZMA 4G0NA 1KKMA 4M4SA 1NN0A 1BYIA 2GK7A 4PO1A 5J5CA 3OFND 3SZRA 4AYTA 5JFGA 2YWGA 4ILEA 1ZAKA 1E2LA 2BM0A 2GILA 4LCBA 1XNJA 3K70C 4QFMA 1R5OA 2G3YA 3RAPR 2RGNA 1G41A 5E4FA 2P65A 3ASZA 1RRPA 4JLDA 3OHMA 3B60A 2Q0HA 4KODA 1XTSA 3QF4A 3U3KA 1ZNWA 4CGZA 1XEXB 2BBTA 2CVHA 3CO5A 1XP8A 2GCNA 3O8RA 1OH6A 1VYUA 3RLFA 5D3MA 1OXTA 3GFTA 3QVVA 1GUAA 4C2UA 1CLUA 3QI2A 1N6OA 2J46A 5JJKA 3X1WA 3K70D 3GJ8A 2OFOA 5HZKA 1DS6A 1KDRA 4C7OA 4IDHA 4B76A 3SU8A 5EE5B 2DPXA 3NDPA 4Z51A 2NGRA 2VL7A 1Q3TA 3QKSA 4A1FA 3A1VA 4BRUA 1OE0A 3SNHA 4YONB 4OHYA 1OV4A 4PX9A 2J87A 3BOSA 3B8HA 1OW3B 1MO6A 1KZGB 3QKRB 4M1MA 1KOFA 2RCNA 1ZU4A 3I92A 3TUJC 4M9SA 4RY2A 3NEJA 2BM1A 2C03A 3B2EA 1PVOA 1A1VA 2ZJ2A 1Z47A 1N6PA 4B3CA 3BRWD 3B13B 5DI9A 1T9HA 5FBWB 3UPUA 1Y63A 3PUYA 4A15A 3LX5A 3X1DA 4LOAA 4GI7A 3KJHA 1ZC3A 1OIVA 4LV8B 3B82A 2ONKA 1SVLA 1DAHA 2EYUA 5FPTA 2WSMA 3FHCB 2DY1A 4M9ZA 3ICEA 4MDFA 1D2EA 4AKGA 3TSOA 1YZNA 2ZYUX 2AKAB 4PPNA 3SI7A 5KUTA 1R5BA 1NNEA 2QRNA 2XB4A 1TAGA 4U00A 1OYWA 1A7JA 1ZM7A 3GJ0A 4LBZA 5G41A 5EE0A 3AVYA 1XCPA 2OUKA 1YR6A 2J1LA 5EZ6B 5L3VA 4LV6A 1Z22A 1CKEA 3GJ7A 2WSSA 5CK4A 5SZKB 4QM7A 3A8TA 4GP7A 1SVOA 4B35A 4L4UA 4TSFD 2ZRIA 1GKUB 4TZ0A 3U7GA 1MABB 2WMOB 4B71A 2ZE6A 1NI3A 2F1HA 5FOTA 4LV5B 4RFSA 8OHMA 1HURA 3DPUA 2B92A 2CNWA 5AJYA 1SHKA 3QPVA 1L2TA 2V4ZA 3GMTA 2WVJA 1E2QA 5K8LA 1E2PA 4ZIRA 1G3QA 4P4TA 2BMFA 5TARA 1VDZA 4YMWA 4BZQA 1N6IA 4V0LA 1NBME 2X1VA 2BBSA 2BOVA 1BS1A 1U94A 4FINA 4N1AA 2QSZA 4MGZR 1SVSA 2YHSA 5L3SB 4I1OA 3RRZA 1DO0A 3CRVA 2IS6A 2IX3A 2C5LA 4Q4JA 1M34E 3B1ZA 1IY2A 2ODEA 3T1QA 4HYYA 5FH9A 2VHTA 3KQNA 3UMFA 3ZZ0A 3BH0A 5JCPA 4G5GA 3W8NA 2NG1A 4I99A 2C9YA 4XWOA 1VCMA 3FHTA 4V03A 3AVQA 3LD9A 4KVAA 3QG1A 4TMXA 4M9XA 1FL9A 1ZD9A 3R8FA 1CF4A 4HUQB 4LY6A 1M7GA 3HYRA 5IK2A 2ZU6A 2OZEA 4ZKEA 3A4LA 4UKDA 2GA8A 2BCJQ 4DB4A 2O8FB 2W58A 3T35A 3THXB 4D25A 4M1OA 5J4KA 4Q9IA 4DKXA 5BN4A 1DG3A 1A2BA 3DMNA 3TKLA 4I1VA 1EESA 3A1WA 4HLUC 1ETUA 4Q5IA 3MUFA 5H70A 4HB3A 2FG5A 2ZAOA 2CHQA 1YZTA 2QTFA 4J0QA 4ARZA 5ANRB 2ZRAA 1EFTA 4NCJA 3DL0A 5FPYA 4QNMA 1E9EA 3NEYA 4GDFA 3CPHA 4LC0A 3L8ZA 4UQOA 4NDZA 2OFWA 4KITB 3I62A 1OT3A 4QRHA 4E03A 4HAWA 2ORWA 3OESA 3SQWA 3EX7C 5JEEA 3SN6A 1ZD1A 1NLZA 1VCNA 4DDWA 4DB2A 3U6KA 4GSYA 4XD7A 5B57C 4FWTA 4BLTA 3GLIB 3U61B 1KK3A 1ZM9A 4JKYA 2DCUA 5KYKA 1I2DA 4EPYA 5FUWA 2GAOA 1OH5A 5JSZA 3DEFA 3P4XA 1US8A 1R0YA 1XEXA 2Q6TA 4A9AA 4B6EA 2HYIC 4M1SA 2ZRMA 4BFVA 4A8JC 2XXAB 2BMEA 4A4DA 2G77B 1OSNA 2V6IA 1FUKA 4PPFA 1NG9A 1W36C 2G0NA 4YXWA 5CDFE 2KWIA 2JAQA 2QT1A 1P7CA 4B2LA 4GOXA 4OQXA 4PC1A 3DDCA 3WHKA 1LVGA 2JA1A 3ZQ6A 2HT1A 4A82A 4TLEA 1WA5A 4DC9A 2IF0A 4JYCA 1UJ2A 3P32A 1IXSB 1CS4C 2IK8A 4UNRA 1IM2A 3EC2A 2V8OA 3OEHD 2ZSFA 2ZI3A 3AKYA 5FUVA 3P20A 4QHYA 5DI3B 3KQUA 2O8DB 4BFUA 1HE8B 3RSOA 2OBMA 4A0GA 3GLHE 2IXFA 2CK3A 5BQ5A 1DBSA 2C04A 3LQRA 4MGYR 2OLJA 1JR6A 4NP6A 2ZRHA 1E9BA 2ZRJA 2NO0A 2PJZA 4Q1EA 1SXJD 5CIWA 3GJ6A 1GL9B 3PG5A 4RD0A 4WZAE 4A6PA 3GLHA 1NRJB 5DHFA 1KK0A 5JZVA 5BYKA 3W6NA 2WIAA 4A2WA 3MLEA 1JXMA 1N5JA 5AUOB 2GNOA 3VR1A 2BEKA 4BE7B 1G3IA 2BKEA 3B78A 4G5OA 1T8TA 3CNOA 3AGPA 4V02A 4IOMA 1JJ7A 2IHBA 4HSEA 2GJAA 4OI0A 1HT1E 2OHFA 3THYA 3GJ3A 5LDDC 2JLZA 1ELOA 3RHFA 4AIIA 1SVWA 1HTWA 2FSGA 4QBHA 2F1IA 2N46A 3KDSE 1ZM3A 2WPDA 1U8ZA 4TMVA 1RRCA 2VIIA 1ZVQA 4KFUA 5HE9A 2B8WA 4PFSA 4M1KA 2W0MA 1SXJC 3B7GA 2GJ9A 3ASYA 1AGRA 1E3MA 2OV2A 4YMUA 4MUBA 1TTTA 3NTUA 1WDTA 5GJBA 1UADA 4BFZA 4A8JB 3QEJA 1EGAA 1X3SA 2VTKA 1K5GA 2AL7A 4JLPA 2F3RA 1IOZA 2AWOA 3AH8A 421PA 3NHBA 1QHHB 2LCFA 3SHFA 2FFAA 3MFYA 1KMHB 1ZBDA 2D74A 3JVVA 3D31A 1Q22A 4KAXA 3THOA 6Q21A 4RFSB 2EFEB 3WYGA 4OBEA 4E5UA 5KDOA 4JJZA 4C7OB 2YZ2A 2MMCA 2N1BA 3KKQA 2OCBA 2ZRNA 2E87A 2WKPA 4NYJR 3U7HB 4GMXA 4FCWA 5TY0A 3NBZC 2O0KA 3BIFA 1SKQA 1SZPA 1R10A 1YR7A 1YZGA 2Q9BA 1E2KA 3MJHA 4R98A 5KO2A 2P6NA 2VHCA 3CIOA 4MKFA 3EZFA 2BWJA 4MA4A 3TIFA 4F7WA 1OJLA 3E1SA 2GZHA 5FR2A 2ZSAA 3QKRA 5EE1A 1T3HA 3F0TA 4OYHA 2HLDD 4X8OA 3SFZA 1P9WA 1KKLA 2J0UA 2PEYA 3Q5EA 4NMMA 4TLBA 5FPSA 4DHEA 4B73A 3PUWA 3DHWC 4MH0R 3K53A 3KQKA 4XWKA 121PA 2P3SA 2QRZA 4JBWA 3EPLA 3KXLA 1M74A 2OFXA 3T34A 1MO5A 2PZFA 2B8TA 1E2FA 2FSIA 3THXA 5EXSA 3TUZC 3LVRE 1TF7A 3K8YA 4PC7A 3EWAA 1U0HC 1U8AA 4D4MA 1N5KA 2VEDA 4Y0VA 2PEZA 2VP9A 1P9RA 1UDXA 3NG1A 1IXZA 2X2EA 2SHKA 4L9WA 4TSFA 3WRXC 1DO2A 1JPJA 4CYMA 4DXAA 2B6HA 3OAAA 4L9SA 4WXRA 2ZREA 5K8TA 1W2HA 4KFTA 3OE7A 3VNUA 1N3BA 5C18A 2ZJYA 1OPXA 1LF0A 3OIUA 4JL6A 1S9DA 1KMQA 1EWQA 2O8CB 2XGJA 1RJ9A 3BAFA 3QVUA 3FMOB 1YRAA 4GPTA 1EFUA 2JDID 2GEDA 1HEIA 3A1UA 3L2OB 2G6BA 3QIAA 2DFTA 4OI2A 1JI0A 3SBDA 4HB4A 3T1VA 2NO1A 2O8BB 1E1QD 1G7RA 1R8SA 1DEKA 3HPQA 1PUJA 3AF4A 2BC9A 2YVUA 2Z5FA 2JJ8A 4ZIRB 2ZR7A 2OAQ1 1E1RA 1OKKA 4TT3A 2HT6A 2OCYC 1Q3HA 3PFIA 1U90A 1N6KA 1TMKA 2PMDA 2YWHA 1S3GA 2J7KA 2QAJA 5C4MA 1BH2A 2QPAA 4B2PA 4L15A 2O5VA 2AFHE 2ZUCA 3RNLA 1GNRA 1MO3A 4B43A 4XVQA 1TEVA 2HJGA 4B75A 2IYZA 2WWGA 4HUQA 1E4VA 1G8GA 2XNDA 2R44A 4AC9A 2WWYA 2ZVQX 1G5TA 2FMXA 1FPMA 1YJ5A 3NH6A 2F1JA 4Q4LA 3Q9LA 4G5SA 2ONJA 4Q48A 2V9PA 5AUPB 3MGCA 3DM9B 1YZLA 2ZJZA 3SS8A 3FYHA 4FCVA 1CULC 1ANKA 3V4FA 1T5IA 4O2LA 3DM5A 1H8HD 4DZZA 4TQUS 3K70B 1N25A 1NJFA 1OLOA 3PEWA 4BEJA 4CEHB 2JLXA 3V00A 1R8QA 4CEJA 2JLVA 1BYUA 5FOVA 5SZJA 3N70A 2IYUA 3LRPA 5IRCD 1FMLA 4YDHB 3VU9A 2BDTA 5G40A 2FV8A 3B9QA 4LBWA 5EP1A 2ZSBA 4D82A 5KHOC 2DFNA 2GF0A 3PQCA 4PSVA 2K5UA 1JAHA 3VAAA 1Z08A 1X1SA 2J9RA 2QP9X 2J0SA 3QOFA 2IC5A 3GLFA 1QHGA 1F6BA 5JEDA 1ZIOA 2IL1A 4BFYA 1IN4A 2XOKA 2FDCA 3IUYA 2NQ2C 4HLDA 1UKZA 3TH5A 4CEIB 1N6NA 1G64A 1E96A 2YV5A 4Q9KA 3LW8A 4D4LA 3BC1A 3BBPA 1NSFA 4ZPXA 3THWA 1NSTA 2CVFA 2IS1A 1WF3A 2CL0X 2L0XA 3WNDA 3ZJYA 1KNXA 3PITA 1UFQA 2RGAA 1Z0AA 1JEDA 3E70C 4DUGA 4F93B 1Q1QA 4IXMA 5TDHA 2VHJA 3I3SR 3JZMA 3ZH9B 4ZCLA 1GP2A 2A7QA 4LJ6A 1DOAA 2FFQA 5DNYB 4LPSA 1E69A 3KUDA 1PLKA 5KNDA 2REXB 1BO6A 2GVZC 2HF8A 1KNQA 4NL4H 1DPFA 1ZD8A 4JLMA 1SQ5A 3CRMA 2Z0MA 1DAKA 4IOKA 3Q72A 4ZI3A 2E1RA 2BHRA 2QM7A 4LBYA 3HU3A 4RCYA 4Q4HB 4Q4AB 1RRGA 5LB4A 3U7EB 1Y3AA 2HLDA 2ORIA 4RKEA 3CM0A 2Z43A 1P61B 1IN5A 1YR9A 2J0UB 3NH9A 5GADl 2OSBA 4C0JA 4AURA 2J7PA 2H8KA 3RYTC 3U44A 1G20E 1YKSA 3EWSA 3Q85A 1G3RA 1KSJA 3LY5A 2QG6A 1XMIA 4P0TA 3NBXX 4DEXA 4NYMR 3VX3A 1H65A 1YR8A 1NN1A 5AJXA 4YMTA 1B0UA 1S0UA 1NN3A 2GKSA 1E99A 2EW1A 4PPQA 1G5PA 3U3RA 1AKYA 3AUYA 3LBNA 4TN1A 4DLSA 5A4JA 1KO1A 2H7VA 1XD9A 2J41A 2XOKD 2R6AA 2WHXA 2A5GA 1FTNA 3MWYW 4F4IA 5CLLA 1LS1A 3CW2A 3DOFA 3TUIC 4A8JA 4MRSA 1YZKA 3VFDA 1EFHA 1QHYA 2HEIA 1CJKC 2IHYA 2PCJA 3EZ7A 5E7MA 4P33A 2IWHA 1N0WA 4OHWA 4M53A 1S9HA 2ZROA 1KO7A 2ZSDA 2ZI6A 2JLQA 4Q01A 5JMTA 3QG5A 4UNNA 4ERNA 4RD6A 1G3UA 3R7WA 1X8JA 5KSOA 1Z63A 2CHVA 2DFLA 4IDOA 3RRMA 1KI8A 2ZYTX 3C4JA 4JLKA 4TMTA 4YXWD 2A5FA 3D3QA 3T06B 2OT3B 4LYFA 5CLQA 2FGKA 3QBTA 4OHXA 1Z6YA 4GT1A 1QF9A 3B1WA 3G82C 1CBUA 2ZRCA 3SDZA 5JBQA 3R9WA 4M22A 2I3BA 2V3CC 1N6RA 4JBXA 2REBA 3W6OA 4Q21A 2O0JA 4ASUA 4O2RA 5B2ZA 2ZI4A 3IO5A 4OQNA 1II8A 2OEPA 1FP6A 3OIYA 4C30A 4AYWA 1GVNB 3HR8A 3I5XA 3C5HA 3DO6A 4TYWA 3C7KA 4ACAA 2CCGA 2W2XA 2ZJ5A 1XJQA 1GIAA 1ZCBA 3IBGA 4B3FX 2WAXA 4JIMA 1EX6A 4FCTA 3UMSA 2C96A 4LJ7A 1KI9A 3GJXC 4WIAA 4C0AC 3C8UA 3RWOA 4X8HA 2C78A 4HLUA 4POAA 4ZDWA 1Z6TA 1D9XA 2WZQA 2RGBA 4I81A 4WXPA 3EPHA 3DOEA 2ZJBA 3AVUA 3KB2A 3LV8A 1U0LA 1W2GA 1P62B 5EE9A 5J4LA 1V5WA 4YC7A 2HDNB 5CM8B 3WNBA 5AJZA 3LBIA 4KHZA 4BFSA 2VH5R 3N5CA 3QPUA 1GKIA 1WXQA 3QF4B 2IEYA 3WXMA 1X8LA 4Q7MB 5EJEA 2O8EA 2F7SA 2P6RA 4Q1DA 5LD2B 3KKNA 2O8BA 2HCJB 1J90A 1E2EA 4OL0A 4JT2A 4AY2A 1W5SA 3TSWA 1Z3IX 2FJUA 1KDOA 3KJEA 2ZRKA 2ZS8A 5EP2A 2FX3A 4G01B 1QG2A 4KBFA 3D8BA 2PX3A 2IYYA 5L3RA 3MG9A 2H5EA 3WP0A 2JEOA 2NO6A 2Z4RA 1XWIA 3QNUA 1Q44A 1XJCA 4LK2A 1CJVC 4QGAA 4V0OA 3X1YA 2I1VB 3LNCA 1D9ZA 1F5NA 3I8XA 3OEED 2W2TA 4ASUD 1W36B 4NONA 1ZYUA 1RC8A 1IY1A 3L43A 3R9IA 2VSFA 1RRFA 1U2RA 3KXIA 1VG8A 4DT1B 3I5YA 4TZ6A 2NZJA 1COWA 2WKRA 2PZEA 1GAJA 5F2EA 3EZ2A 3F5FA 4Q1FA 4G3XA 3H4MA 4LZZA 1JEEA 4WOPA 5J4YA 1W0KA 4LI0A 4ACBA 3L0PA 3I61A 1GOTA 4PC3A 1NY5A 2G1KA 1UPTA 2ZS9A 3C14C 3TLXA 3ZVLA 1JBKA 1RYFA 3AVTA 2CMKA 4LJYA 1S8FA 2IUSA 2N42A 4CEHA 4TLAA 4YMSA 3SJCA 2ZRFA 1G3MA 2IUTA 1E79D 2OM2A 4P4SB 2GRJA 3SC3A 4CEJB 3CF2A 3TVDA 5C2JB 1KGDA 1E1RD 2J45A 2CLDX 3S1AA 4Q19A 5FL3A 3V9PA 3P26A 1W49A 3PR1A 3GQBA 3RS7A 2QPOA 4DSNA 3HDTA 1OFUX 1UEIA 5FPKA 2ZE8A 5FR1A 1SKYB 3NIBA 4K46A 3WBKA 1ZJ6A 1R2QA 1SVIA 1ESMA 2I1QA 2FEOA 4CT4B 3IHLA 1VG9B 3GLFB 1R0XA 1KO5A 1HUQA 2GDJA 221PA 3M6AA 1JB1A 5DISB 4TTPA 1KJWA 3NVAA 2ZYVX 2PL3A 2LKCA 1D2MA 3O8DA 2E9SA 2BVNA 3I4LA 3EIQA 2ZUDA 1XBTA 3FKSA 4XOIA 4WZ6A 4ON9A 1W48A 4HDCA 2ZR9A 4PTLA 5BN3A 5L3QB 1UBFA 3CWZA 4LHYA 5E95A 3LQQA 4DRZA 1FX0B 4DDTA 3M1IA 4C3ZA 2H1LA 3H84A 1HQCA 1GITA 4FMDF 4FW9A 3SJZA 3FWYA 3Q8XB 1CR0A 4A92A 5FI1B 3MAAC 3ZD7A 4XH9B 1KK1A 4LYJA 5M04A 2CEAA 3FGNA 2OESA 3UWOA 1T6NA 1RFLA 1F48A 3EARA 2QAGC 2A9KA 1VHLA 2EVWX 4DDVA 5L3SA 3GEIA 4DCSA 1P6XA 4X8LA 1E2GA 1LF5A 1Z2AA 3K0CA 4Q4JB 2QT0A 1KYIA 1WCV1 2D2FA 1PLJA 2V1UA 2IA5A 3UANA 2ZJAA 1RE0A 2CL7X 3K1JA 4BECA 3PEYA 3EG5A 2W00A 4FMDB 4EDHA 1EFRD 5B64A 2JLWA 3CRQA 5IDVA 1W4BA 3SE0A 2EFHB 2CLSA 2O8FA 4EPTA 4PQRA 2TMKA 3CPEA 4AKEA 3L82B 2EFDB 3B9PA 4PPGA 2FFHA 2FSFA 5FL7A 2FE4A 3ECCA 2P0EA 3PV0A 1G18A 1E2JA 1CJUC 1GL6A 1P2TA 4KLNA 4LYHA 5G3YA 4DLZA 3IEVA 2QUZA 4ZO4A 2GCPA 2R9VA 2JDIA 4II7A 3KTAA 5JJIA 2F43A 2V7QD 2GTPA 4LJ4A 5CJ2A 4TL9A 5GJCA 2OAP1 3F8TA 2XSZA 3TQCA 4KLZA 3VKWA 1NLYA 5A0FA 1W46A 2V7QA 2YWEA 4OJQA 2GETA 1DG1G 1JQJC 1Z5ZA 3BJIC 1DAGA 4MGIR 4PZZA 2F3TA 5GJWC 1LB1B 4NHOA 1QHSA 4I1UA 1G7TA 1D6JA 2GWHA 2VRWA 3RS3A 3U7FB 2PLRA 3IDQA 4MGKR 4HAYA 3MMPA 1DE0A 2QAGA 1AQYA 3OAAD 2CL6X 2X19A 4D4JA 2BV3A 5KOYA 3AF0A 1G9XA 2IUUA 1MABA 3ZIAA 1XPOA 3K0CC 1LS6A 1IN8A 3L8YA 3RS0A 4ZI2A 3FTQA 1OFHA 3IILA 2ZM5A 2D62A 2IYQA 3RRYA 3ZIAD 2DWPA 2G0TA 3VMFA 3X1ZA 4CW7A 4TQAA 3BFKA 3OIWA 1XRJA 4IXNA 2RGCA 3NC1C 4HI0E 5FTMA 3SR0A 1YZQA 4RZ2A 4PQYA 4HLQB 1IXRC 1H8HA 2D7CA 2GAAA 4US0R 4YMVA 5JI2E 3QPWA 2KE5A 4IKEA 3HWSA 3R7WB 4Q47A 3B5JA 2VP6A 1AKEA 1DVRA 1FFHA 2AK2A 2GJ8A 3T5DA 1M1YE 4A2QA 4DWJA 4XTRA 1P4SA 1TF2A 1AQUA 3KJGA 4K81B 3EZ6A 2ZR0A 2FN4A 2QN6A 2REOA 2WTUA 2IYRA 2WWIA 4XTCS 1KK2A 3PUXA 3RABA 3FMPB 2O8DA 2WJGA 4B34A 5KPDA 3AP1A 2VSXA 2R8RA 2BJVA 2V54A 4IFBA 4I1SA 4A6XA 1VMAA 1W36D 2IYWA 5KPJA 1NBMA 4ABYA 1A2KC 3WRYC 3EIHA 4BASA 4M2LA 1OYYA 2QMEA 1XEFA 3A58B 3K0SA 4ZV4A 2JASA 3K0AB 1U9IA 3AVXA 4ITRC 4KJZA 1SXJE 1GKYA 4NCHA 3BS4A 3K0FA 2FZLA 1TUEA 3DZ8A 4B33A 3Q5DA 1YVDA 4P32A 5TMPA 1IHUA 2NPIA 3DZDA 3QF7A 5AR1A 4QHTA 2JGNA 2UVQA 1I2MA 4IDNA 3TR5A 2WIBA 2YC2C 2W2VA 3KJIA 1VG0B 2PCLA 2WJYA 4MRNA 4JLAA 4OK5A 4MQBA 4RVCA 4C4PA 1X1RA 2CJWA 2WKQA 1M8PA 2PMKA 2G83A 3THYB 1NVUQ 3BE4A 3REGA 3B1YA 1XD8A 3QBVA 1W1WA 2JATA 2VP4A 2IWRA 2IXGA 3CRRA 1FP7A 4DJTA 2D06A 1RIFA 2GVDC 1P60A 2QY9A 4UXHA 1IJFA 2FPLA 3WMGA 3A36A 3VTKA 2DFKB 4KVGA 1CIPA 2H18A 2QBYA 2GF9A 2BIFA 3BH6A 3ZYCA 1XFAA 3A4MA 4MRVA 4RCZA 5CDFA 1UBCA 3BGWA 5BW8A 1W7AA 1B23P 2EYQA 2GZAA 2QE7A 2C95A 1F2UB 1COWD 4HAUA 4BWYA 4IW3B 5L3QA 4UJ3A 1QHHA 3EC1A 1KI2A 4NZYA 5LD2C 4MYCA 1KHTA 1T3LA 2RHMA 3OF5A 3GJ4A 4MYUA 3FMIA 4PQFA 1G291 1L4UA 2ZI5A 2ZANA 3LAWA 1VCOA 2ZUBA 3GJ5A 3GEEA 2ERYA 2XNSA 4TTRA 5CM9C 1JR3E 1L8QA 2JLYA 3OEEA 2ZRGA 2GZDA 4BQSA 4V0KA 5EXXA 1JAIA 1SGWA 1R6BX 4JZKA 3ZVNA 4RZXA 1GSIA 4RD4A 1EFCA 3U3JA 2OCPA 3QXHA 4HATA 1MRNA 4C0QC 3IQXA 4DSOA 2RAPA 2V55B 3QXXA 1IN6A 3U4QB 4JVNA 3IEUA 4UJ5A 3LW7A 4JL8A 5DE3A 2VSOA 2MSEB 3IIJA 4TMZA 1XU4A 4KCGA 1Z0JA 4BFTA 2A78A 2VBCA 2WOJA 1WBBA 4IOLA 3LBHA 3I32A 2P2LA 3ADCA 5TV2A 1T0HB 3CONA 1FNMA 1W4CA 2EFGA 3C41J 3CB4A 5C1BA 1M7BA 4S35A 5KNCA 1RYHA 2XJ9A 3H1TA 1FUUA 3NXSA 4BLPA 4IDQA 1G7CA 3AEZA 4HZIA 1MV5A 1AA9A 4DLTA 3I8SA 4TYYA 1OFTA 5AUQA 4ZDJA 2EU8A 5EP3A 4DVGA 2PT7A 2MSCB 3GLGE 5TVKA 3SFVA 2CXXA 2F43B 2W83A 1VIAA 5CYOA 4PO9A 2ZJOA 3VHLB 3K9HA 1UKYA 4DIEA 1C1YA 1G6OA 1E4YA 2NPFA 3D7MA 1WBDA 4HAZA 4LJ5A 2ODWA 5K8UA 1IY0A 2R6DA 3ZD6A 1TL7C 1ZUNB 2EWWA 4C0BA 3U3OA 3PENA 3C15C 1DAIA 4AI6A 5BYJA 3PJRA 2QAGB 2FOLA 3AKEA 2ASEA 2XITA 3C16C 1ZMXA 2QM8A 4QOSA 5EXTA 3AVVA 2C2HA 2CE2X 3H86A 3HPRA 5CIQA 1QDEA 4LGMA 1N0VC 4GFDA 3KQHA 2PZGA 3CR7A 5JHGB 1KMHA 4KU4A 1FX0A 2Z4SA 1W47A 4R2HA 1T3SA 2HYDA 3MWKA 2GCOA 2QORA 4EIWA 1R0WA 3LXRA 2A3RA 3LWNA 4W9MC 2NO9A 4CRWB 2ZEJA 3AF3A 3WMEA 4D26A 2CCJA 2Q21A 3ZLJA 3R8CA 4XSHA 4Q9HA 2GJKA 3TGPA 2H16A 2YC4C 4Q18A 4V0MA 3NBFA 5KNBA 1N0UA 4QKQA 1WMSA 3MWJA 4DBLC 3WMFA 1LFDB 4M21A 2DR3A 3VR5A 3AV0B 1W4RA 4JLNA 3LXXA 4US1R 1Z28A 2B7BA 1NLFA 1SKYE 4MRPA 2CK3D 1BOFA 2QTHA 3UXMA 3I72A 3FB4A 4MRRA 4M9QA 2VF7A 1YHNA 4B48A 1ZNYA 1ZIPA 1KY2A 4N0DA 4QJ5A 5JWRA 4UXIA 1OKKD 4IEEA 1K6MA 2FFBA 4Q7JB 1DELA 5B58C 5G53C 3T1OA 3A1SA 2YNMA 1G8PA 5FFMA 1VECA 1HQYE 5FI0B 3I1FA 4DLUA 2YJTD 4DSTA 1MR3F 1TQDA 4DCVA 4Z54A 4YQFA 4BGDA 1ONBA 1Z2CA 3GLIE 3CF6R 1KI3A 1JALA 2QP3A 3RVBA 1RW4A 4OJKA 1NIPA 2QGNA 4QJ4A 4E09A 1EWRA 2UZIR 3CNLA 4ZDKA 4M1WA 3ZDQA 4LUCA 1JR3A 4NPHA 4TMKA 3RRNA 5A5GA 2IYLD 1CR4A 2AWNA 3A37A 4P4UA 3ZVMA 2BEJA 3OE7D 1G5RA 4JSTA 3CPJB 1E9AA 1ZC4A 2Q9AA 2ZRDA 1E2IA 2A5DA 5F9HA 3K09C 4B47A 1J7KA 1OH7A 1RJ9B 4FXPA 2FZ4A 4IRUB 4Q03A 3IQWA 3TQFA 3IBYA 1CR2A 2IF2A 1EX7A 3IHWA 2HXSA 3UMRA 2WICA 2Q3HA 2XJ4A 4PC2A 2HV8A 3WY9A 4UXJA 3CUEF 4M0LA 4PHGA 4CEIA 2B7CA 1XXHA 1E9CA 3CX7A 3RSLA 4HZUB 2ZXUA 1R0ZA 2MMGA 5F3WB 4JKIA 3SHWA 1U81A 3W3ZB 1IJEA 1KSHA 4LDJA 3QUSA 3BWDD 1XMSA 4LRWA 2F55A 3TAUA 3AVOA 3CRW1 1XMVA 3BORA 1O87A 3REFA 3AP2A 3QY0A 5DIFA 4B3BA 4QXAA 1GRRA 3ZVRA 1E2HA 5D3MB 4EPVA 1XEWX 2VHQA 1QBKC 2OG2A 5IT5A 2ZIAA 3LFUA 5FOUA 3ZS8A 4LHWA 3BD9A 4O3MA 5P21A 3IIKA 4AYXA 3GD7A 1BIFA 2XX3A 4DEYA 2NOAA 4V0NA 1QVAA 2FF7A 1R7RA 1X6VA 3B1VA 4LJ9A 5UKDA 5HCIA 3KX2A 4R9UC 3EPKA 2UKDA 2DHRA 2J5XA 3C5CA 3QKSB 2IYXA 2ZAMA 1OB5A 1TU3A 1AZTA 2IS2A 4AWXA 3NC0C 3EPJA 1AS2A 3BXZA 2R62A 5JWHA 1DAEA 1P3JA 3X2SA 1AGPA 4E22A 2XB2A 2NO7A 4EQ6B 1HT2E 4NYIR 4QL3A 2WWWA 2FA9A 2B21A 1WP9A 1Z8FA 2JLRA 1AK2A 3J81k 1KI6A 3ZQJA 1VCIA 2ZYWX 2C8VA 4LHXA 4JVLA 1FW6A 2CE7A 1E9RA 1XTKA 1XXHE 3NBYC 3R9XA 2CDNA 3TVTA 4EFLA 4NU0A 3E2IA 3WYFA 1EK0A 2PX0A 4XD7D 1FQJA 2OBNA 1XX6A 3T12A 1KAGA 1GNQA 1KJZA 2RGEA 3VU9B 3ADBA 2OCAA 1SULA 2GK6A 3WP1B 4TYPA 3TBKA 1W4AA 4BLQA 3U6BA 5FTLA 3HU1A 5K8IA 1I4TD 2H57A 3NHAA 2QPTA 3QKUA 3U60B 2WPDD 3JVUA 5D3QA 3FKQA 2ODBA 1KTVA 2ZRBA 1F3OA 2O52A 3W8RA 2QI9C 2XZOA 4GP6A 5BWMA 4IEIA 4M1TA 1NF3A 5HPYB 4C2TA 2R6CA 1RKBA 3SOPA 2QBYB 5DYIA 4TLCA 3LVQE 4D6PA 5CB6A 1AZSC 1JR3D 5JHHB 2OE2A 1OB2A 3BB4A 3SEAA 1HE1C 2WV9A 4Q02A 2FPKA 5H1YA 3THWB 4NYJQ 4BFXA 721PA 1WQ1R 3DMDA 5LPNA 4JS0A 5FUYA 1W5TA 4PO8A 4B6FA 3BB1A 3SJBA 1GILA 4FN5A 2GCOB 3EASA 5FL7D 3UATA 1CTQA 4LC1A 1CU1A 5EZ5A 3K9NA 3PEVA 3EZ9A 1GTVA 4QGFA 4A0FA 1G8HA 4Q1CA 1VTKA 4FWIB 1QG4A 1Z06A 3BFXA 2JIZD 3T1TA 2VF8A 4OHZA 2OXCA 1XZQA 4NTZA 1U0JA 1ZINA 3HR7A 4EFMA 4Q1AA 4V0ME 1ZUIA 1T5LA 2F6RA 2C99A 5E3HA 4TQ9A 3UKDA 4HEJA 4O0MA 4P31A 5B30A 4LHVA 3VR4A 1HV8A 4PHTA 4U5XA 5F98A 2IBMA 4Q4HA 1XTIA 2KBFA 2QU8A 1L7VC 4JMPA 4Q4AA 1U9IC 5EP4A 1XCMA 3QXSA 4TYNA 4C0LA 4BLSA 1SXJB 4NKRA 3HU2A 3W6PA 2ZPTX 2QL6A 1XMJA 1S1CA 3KL4A 1XCGB 5HCNA 4U7DA 3EAQA 2ZSEA 2QE7D 4BEBA 4DCUA 2QROA 4Q7KA 2VLIA 2QENA 1J8MF 1C4OA 1RPZA 4BPBA 2A2ZA 4OI4A 5DH9A 4BRWA 4F38A 2AN9A 3PVSA 1VHTA 2Q3FA 4WW0A 2EFCB 3O8BA 3X1XA 5KDLA 1NG1A 2VHUA 5BN5A 3VKGA 1AIPA 5DYGA 4ESHA 2W0SA 2I4IA 2ZRLA 5HTKA 1N5IA 1P2UA 3WYAA 1SVMA 3R20A 1OF1A 4PR0A 3TK1A 5JLJA 4FI3C 4CZ2A 3AB3A 1T8UA 1AM4D 2AD5A 2ANBA 1Q20A 1MT0A 1ZP6A 2ECKA 2JJ1A 2ZI7A 1FQKA 3CBQA 2D7DA 5J4VA 2DBYA 2P6UA 1GWNA 1C9KA 2AFIE 3RS5A 4W5WA 2IYTA 4MYHA 2NIPA 4WVFA 1E2DA 4CF7A 4BFWA 2DWQA 5DN6D 3TJZA 3A6PC 3P27A 1CRQA 1VG1A 3PXGA 5JJLA 4G5RA 1G8YA 3U3MA 5HR5A 1IONA 1XDBA 1N5LA 1XXHB 4B3GA 1TUIA 3SBEA 5JSZB 2W6JA 3Q7QA 2WWFA 4HZUA 4Q66C 1KIMA 1OHHA 1US8B 1YU9A 4LWZA 4OQFA 3VR6A 2MSDB 2ZVPX 3P1JA 4R2IA 1XTQA 5KSZA 2IT1A 4W7SA 2GBLA 1D2NA 3FE2A 2KB0A 1GNPA 4LX0A 4URUR 5KU1A 1NBMD 2G1JA 4HAVA 4A2PA 2LWIA 2RGNC 3AKDA 4IDPA 2H92A 4AK9A 1KO4A 4LHZA 1QRAA 3JZAA 4C0SA 5TB5A 1Q0UA 3SJAA 3RC3A 2AX4A 3UIEA 1Z0DA 4Z8YA 1NMYA 3UG6A 1XJ0A 3QJYA 1KY3A 4AKIA 3D6TB 3OZXA 1OHHD 3LLUA 1EG7A 3AKCA 4PSKA 1AS0A 2PH1A 1XTJA 4JL5A 2OO7A 4BZXA 1KI7A 1OXVA 4D2IA 4DT1A 4EAQA 2ANCA 2VYFA 1II8B 3QEOA 5DN6A 1P9NA 3CH4B 5FOWA 2QEQA 3GFPA 1JQLB 1J2JA 1M2OB 1QHXA 4PSAA 2Q9CA 3AVWA 2GXSA 2ZI9A 3PUVA 5CYPA 621PA 3T15A 1KI6B 1CJTC 2AKYA 5AK0A 3VHXA 2NMVA 1K5DA 1II0A 1OXUA 1E0KA 2BBOA 4ZCIA 3GEHA 4HUTA 4C0KA 1Q1BA 4KSBA 4S2EA 1R5NA 1KI4A 3KKMA 1NN5A 5HE8A 3BK7A 3GPLA 3AUXA 2BMJA 2VQSA 1NMZA 4B3DA 4D81A 4CVNA 4DUGD 4JBYA 3S1AB 3BERA 3NWJA 3AM1A 3WBJA 4F4JA 2F1RA 4KI0A 1IAQA 2PJRA 3FKSD 3W5JA 4GBMA 1CEEA 1CJMA 2XZPA 2VP5A 2KSQA 1N6HA 3V4RA 1GG2A 4PANA 4WBSA 4RSGA 1KZ7B 4TYQA 3FPAA 2ZS7A 3GLIA 1J99A 1E0AA 4OK3A 5FOSA 3CR8A 3PUZA 2XTNA 2QZ4A
chains in the Genus database with same CATH superfamily
4JLOA 3H9GA 4OQLA 4TVSA 1USIA 4F4CA 1H4TA 5L7WA 2DFVA 1A9SA 1KZ6A 1Z18A 1TO2E 2AJBA 1JIUA 4NOJA 4PSUA 1JKJA 1FY2A 1QE0A 4QRDA 5FFFA 3RFUA 4GLFA 4DIDA 5KC8A 1CVIA 1GPUA 2F90A 4QG7A 4DQKA 1Y6GA 1NXSA 3D1JA 5LL6P 2PBRA 3PQ5A 2ZB7A 4AG5A 4F2WA 1K9SA 2P5TB 4LVCA 3MWEA 1UWKA 5DHAA 2PX2A 2AF3C 1O4WA 4ZT3A 5A3VA 1Y8ZA 3CNNA 3DNMA 3KOYA 1Y1TA 3A2NA 1RI1A 3QKWA 2EQ5A 3JYHA 4IIJA 4IS3A 2FRDA 2Z4TA 4ZQFA 1XMOB 1I94B 4KR3A 4F6RA 1OLUA 1XZCA 2EC5A 3CNEA 4HLCA 3WLAA 3WB2A 1M6WA 2PD4A 1A8SA 1EHCA 2IJGX 4J3JA 1I7SB 4CQJA 4DSUA 4MI9A 1Z6GA 1Y81A 1YZUA 2KJQA 3AF2A 4G65A 3N3BC 5EIEA 1WNTA 4L5BA 2K2QB 1MNAA 3GN1A 1RJFA 2GBFA 2R2AA 3PSHA 3H2JA 2Y66A 4GZLA 5TPWA 1T8YA 3LY9A 3MT8A 5DO9A 3T7SA 5IVHA 1QCZA 3NHYA 4DM7A 4R8LA 5THXA 4DIKA 5ABPA 4FR5A 1ZVMA 5IFKA 4B74A 1TX4B 3BWXA 5ALVA 3BZWA 1I7QB 3X2FA 1RMYA 2P67A 3TX6A 3MGBA 3WV5A 3GLRA 5LZ9A 3OZFA 1WCXA 2BKUA 4N3AA 4OQQA 4JSYA 4Z9XA 3KLMX 4TTQA 3SVTA 4TTSA 3CLRC 4D9EA 2HUPA 1ZM4A 4XD2A 4IV8A 3FNHA 4P7FA 1H2XA 1K7FB 1TJ4A 2PNJA 3TW6A 4LSGA 1VKRA 3ZCSA 1K7SN 2A5LA 3ZKWA 1EIZA 3H4TA 4K6HA 1F2DA 2ZAYA 5GVRA 4EKDA 1G19A 1HC7A 1QV6A 1Q77A 2EJVA 2HGZA 2XRZA 2NXCA 3G0CA 3RCBA 2RJ3A 3H5TA 3SIXA 5CMLA 1JDPA 3ROGA 2YIJA 3CX3A 3G3EA 3HJNA 2DY0A 1KQ3A 1Q7RA 5HNKA 1PWHA 2Q3CA 2QGFA 3NONA 1SG6A 2QVXX 3KTAB 5B37A 2QV7A 3DH0A 2EDCA 4JBLA 2QF7A 4HNQA 5B3LA 3ETGA 2WI8A 5EXPA 2O7QA 1RYEA 3OZIA 1R1DA 1RS0A 4MVJP 4FMCF 5AXCA 1XQ1A 5REQB 2BI4A 3UGJA 3R0IA 5KYVA 2GBCA 1Z62A 4P82A 1GM5A 2ILTA 2J3EA 3ZWOA 1S8NA 3NM5A 4PAQA 2A3NA 1O58A 1A5TA 1A9QA 2IYFA 4C87A 2JAOA 1JH8A 3FLEA 3MCTA 3PNKA 3TFWA 4FFBA 4NYMQ 2FU5C 2IPMA 3B1KA 3STUA 1WUIS 1NXTA 4RKFA 5JADA 4MB2A 4QUJA 1AQNA 1UDAA 1PJSA 5ARCA 2GBLC 2QRVA 3TTSA 1S2MA 1G17A 1UBHS 4WGGA 5IJWA 3G02A 2Z5GA 2H8GA 3LOPA 1QKKA 4L2IB 4XIGS 2WWHA 3S27A 1M6VA 2PJUA 3MMXA 3PIDA 2DETA 1RWBA 4L07A 4ZHSA 1HE5A 4Y3UA 3MTDA 1EJ2A 4S12A 4Y6OA 4EECA 4M7PA 4GUAA 4EO7A 2YMMA 4HOYA 4MJLA 3WWYA 5LU8A 4WEQA 3E7XA 4MITA 1SCDA 4JJIA 1BRMA 2B94A 3KNZA 2FWRA 1VJGA 2L19A 1UEJA 3NNSA 5H80A 5AKEA 1NYRA 4IZOA 3DSRA 8LDHA 3AIKA 1PZMA 3KKEA 2G7ZA 3EIOA 3INRA 2J85A 2G63A 2NZ8A 4ND7A 3HFGA 1P73A 1TCAA 3PKJA 4BXOB 5IH7A 3P0RA 1HY3A 2F62A 1JLKA 4PY2A 5JUWA 3PQFA 1O0CA 1IY9A 2DCMA 5BSGA 1G4AE 4KSCA 1QS0A 2ZETA 1PYGA 2OCLA 4EKYA 3ICQB 5FBHA 2WAAA 2WYVA 3B85A 4JT4A 5ALRA 3ADKA 3EIFA 3W78A 4BCBA 3AL0C 1RWOA 1QWOA 3H65A 1Z83A 4L6IA 1QGZA 4F5ZA 3VJRA 1DCMA 4J4BA 5DYNA 3RIHA 3UMCA 3VKVA 1TQHA 1XMPA 1EFKA 2MSNA 3QPDA 3QU9A 2BSQA 3KJFA 5DX1A 4HH1A 2C0PA 5B7GA 4FIZA 3TSCA 3COVA 3DZIA 2VF4X 1ZHHA 1Q21A 3UXYA 5IK2D 2IHJA 3B8EA 5EHIA 5F2OA 4DDHA 3K35A 1ADYA 4F3NA 5JBIA 2IS4A 1FZQA 3OOWA 4HGRA 5J1TB 4WESB 4ND2A 4CM9A 1CEXA 1G16A 3LOQA 4QQNA 1KJNA 3HL0A 4K9LA 5H9VA 5LQMA 4KFCA 4X45A 1K7EB 5BQOA 1U8YA 3WC4A 5ILOA 5K0NA 1E62A 4OB6A 1CUVA 5HEKA 4B32A 5U9CA 1HLFA 3T3OA 3AJRA 2HI0A 3BF7A 2HA6A 3BJMA 4M98A 2JIPA 4MUAA 4Z3DA 5C52B 1G7SA 1SEVA 3A6FA 3CISA 2G9ZA 1RXUA 1ECCA 2I62A 2M32A 3X44A 4YAUA 2OBBA 4KN6A 1SU4A 4X90A 4YEDA 2CFOA 3GP3A 5FQNA 1C3LA 3I4FA 3RS4A 4DG8A 2A1UB 1ZW6A 3M4ZA 3B6EA 4F72A 5J2UA 3C39A 5EHZA 3RS2A 1WETA 3FWPA 5AKXA 2BFCA 1WMEA 3H5LA 4Q3KA 1WABA 4C3UA 2BBWA 4Y2TA 5I9SA 1IY8A 2VP0A 1UAAA 2CNWD 4G89A 1T0JB 4QQFA 3L7KA 2ATVA 3BQMB 3PIRA 3FPJA 4QBGB 3AYZB 4UARA 4I46A 3K9BA 3OWOA 1EK1A 4JBNA 4NYIQ 1JLMA 1FVFA 1G5HA 4GSKA 2BRUC 4MJ3A 4B1FA 1OB5A 4ARIA 4H1HA 2OQRA 1ZUHA 4EARA 1E0JA 1U7XA 3GNQA 3K32A 1XMQB 3OZDA 2Z6VA 3WIBA 1JG4A 4RV4A 3VC3A 2E4YA 5D86A 2J5RA 4BJ6A 2VKTA 4MUMA 2BSXA 1F2UA 4W5OA 4WOBA 1U7ZA 1X39A 3KSZO 4MCJA 3ROTA 4P5PA 4K9PA 1GRVA 1T6XA 2X8LA 1NOIA 3COWA 2FDRA 3L0IB 5I9NA 5K20A 3KR2A 1H6AA 1M6NA 2XDQB 5AJTA 3VNBA 1TLFA 3PHBE 3GAAA 4OGLA 3T4PA 4O08A 3K1AA 1AKUA 1MX9A 4REQA 4X84A 1MG0A 2WY2D 4D3YA 4FB4A 4RZ3A 5IC6A 5FX2A 1PNOA 1VIYA 1J8FA 4YLGA 2HA4A 4F8JA 4QC2A 1FRVA 5JWOA 3BXXA 2P30A 1K4YA 1GUBA 2TSYB 4LZLA 3BIXA 1Z2NX 3JTMA 4HQ0A 2PV0A 2VA8A 2QA5A 1C4WA 4IIEA 4S04A 2DLCX 3FI0A 3CH5A 1NUTA 3GUZA 1BNCA 4URYR 3HWWA 4MCIA 3SFTA 2H17A 4M83A 4IQ4A 4KO8A 2CJXA 1X7YB 3DMFA 3VZRA 1JDNA 4QXQA 4ALIA 5IUJC 2ZDHA 3DE0X 4XAQA 2AYYA 3IAAA 1V1MB 1AN0A 2C9OA 1F2TB 2AR9A 1GGMA 1PCXA 1BS9A 2RHDA 3MXTA 4Q82A 3IE1A 4WZBE 3ANNA 4QDUA 4HB2A 4A1OA 1U6IA 4UUMA 3ZOKA 4EUFA 4XA8A 5AVSA 3MSXA 4NJMA 3KYBA 4B6RA 3VBEA 3KWFA 4H1VA 2NYUA 3TXYA 5A9SA 1ESEA 2PWZA 2XYRA 3H6KA 3L7YA 3OTGA 2IPNA 5L6MB 2ORVA 3CUWA 2WJVA 1N8NA 3LY7A 1WTCA 4G26A 1KDTA 2AE2A 2OCIA 2PLFA 1GAXA 2GXQA 2V8BA 1JIKA 2OR3A 3ZDEA 1TQ4A 1YJXA 2KI5A 4G5XA 4OHPA 5KSPA 5DHRA 4BNDB 3KC2A 3QW4B 4EJSA 4MUFA 2P6MA 1H66A 2FPIA 2CJWB 3MWLA 4PINA 5HZHA 3HVRA 4URVR 4RTSA 3OFNA 4TMYA 3DFIA 1XZAA 4M8NE 3VPFA 4XGNA 2OILA 3WL8A 3J7TA 3ANYB 1RSZA 4PONA 4H3HB 1SUEA 1PL0A 2HWYA 4QODA 4UVHA 1UDWA 5JARA 4RVHA 1GZUA 1XDDA 3F2IA 4FMCB 2X7HA 5ALOA 5DTQA 3BM5A 3R23A 2OO5C 2YXPX 2W6IA 4PAGA 2WIFA 2NTVA 5GWXA 2O5EA 1TZJA 1YT5A 1DHTA 2CFRA 3DCJA 2NP6A 3E3NA 3Q0EA 5IJXA 2VJOA 1TF5A 2NAFA 1DGQA 1XELA 1FFXA 4FFDA 5TPZA 1NURA 1H0KA 4KMSA 3FTDA 3RH0A 4D3FA 1V5FA 2IXTA 2HTFA 2PSSA 2GN8A 3CZQA 1NQXA 1G1MA 3GGJA 5ERYA 3G0HA 4QARA 1UKEA 3L46A 1EGMB 2PKQO 1T9KA 2VDOB 3V8MA 1N36B 1IN7A 5HKAA 1ZI8A 3NTRA 5D87A 2BFEB 2H85A 3K9GA 4PZ9A 4RD3A 5BWOA 5DDIP 3PP8A 1PFQA 1U98A 3TZCA 2Q4OA 2OO3A 5F23A 2HHCA 4MZDA 3FTCA 4QBIA 4AD8A 3L1HA 4D3DA 1TYCA 2ERXA 1TK2A 1UBOS 2X0IA 3PNMA 2YUTA 3A9RA 4L3VA 3E22B 3VX4A 4B31A 4DARA 5EJ4A 3KT6A 4RVUA 3N3AC 1UWVA 4CLOB 5DGXA 3RM3A 2QR5A 1ZSVA 2JHGA 3KSMA 4Y1GA 3U7QA 4AO7A 2HCBA 1W8IA 4JJ7A 1P2SA 1U2DC 2QL9A 1XPUA 1U3DA 1Z34A 3I01M 4ARUA 4EJSC 5HKKD 1X8KA 1F60A 1U2EA 2BFMA 3W4IA 3O8OA 4GWLA 2R6FA 5E6UA 1DC4A 4BLOA 5DRYA 4HDRA 3ZCRA 3IAUA 4J2HA 4TMFA 3IT3A 2YXBA 3BH7A 2M6RA 4TRJA 4XGKA 4GMHA 1RWNA 3ESRA 2O7SA 4OY3A 1XK6A 1P7VA 3OM8A 4NBSA 4QTTB 4X20A 3TZLA 4BNHA 1M2GA 5DXFA 4UTXA 1ZO8A 3TZBA 5HZMA 1I33A 1USVA 4JI1B 5IXJA 4EYQA 1J20A 1A4RA 1SQGA 1UF9A 1DXQA 2GD2A 2JAHA 3KB1A 5EY5B 2FZWA 4D8WA 2QP4A 4E5MA 3UK1A 1I32A 3R3VA 3K5IA 1BFKA 1R6XA 2GPTA 4GOKA 4YO8A 5IN5A 1AJEA 2FWMX 1KXJA 2XEXA 1WCIB 3HA5A 4OQMA 5A0TA 3TF5A 1JLLA 3QYJA 1AK9A 2VWGA 1JNYA 1QRRA 4NZZA 1FNCA 4XASA 2BGGA 2HJRA 2I7TA 1VYTA 2CLCX 3SYNA 4ZMRA 3TKYA 3T5BA 3LPMA 4HNAB 4NSNA 2NT3A 4G1UC 5AWFC 3V8RA 1ISSA 3KZ1E 4E2FA 5IF3A 5KYNA 1MO4A 5HJ2A 1YMQA 1L4HA 3WBFA 1EUDA 2N3ZA 1CP2A 3UPDA 4OMDA 5DVZA 3RNOA 3BTOA 4CCWA 4ES6A 3GV0A 2FEMA 2PQ0A 4R3NA 4JYBA 2WSSD 1HE4A 1LW7A 4G0OA 4KFSA 3OCUA 3KYDB 4EFKA 1UBKS 3QE4A 3SIRA 5J59A 5LQUA 1USWA 2FW9A 4LQCA 1H85A 4Z8XA 5EZYB 2TECE 3W2FA 3HCEA 1M8KA 1IM8A 1JJVA 3BDAA 4L2IA 4UCFA 3VO8A 5GM2A 1MVOA 2ISCA 2XYQA 2CHUA 3BB3A 3LFTA 2XE4A 1QLJA 2XE7A 4OXQA 2CCKA 1P2DA 2ZUFA 4OGFA 3KQLA 4B79A 2IYOA 4NECA 1Z4MA 2J9YB 3DMYA 1TPZA 3I3OA 2QQ0A 4C1NA 5CB0A 1TZCA 1BOOA 1RBMA 2PRSA 4CUZA 2WE8A 4FLEA 1AA6A 3FHOA 1NA5A 1Y89A 3MD0A 1E2MA 3NBQA 4HN4B 3G6WA 4J4HA 3WWEA 4A10A 4A0HA 3SQOA 2KQUA 4EG7A 1QYVA 4MS4B 2GCEA 5A4FS 1N33B 1OJ7A 2Z1MA 4YROA 3SKXA 2EOAA 4XCQA 2X2FA 4IHJF 3ND8A 2H51A 1Z0FA 2F4NA 1PJ4A 2R5FA 3CC8A 3K5HA 3AT1A 1BFUA 3UK6A 2JGRA 3HC7A 4C9BA 5DI3A 4F6CA 4U02A 4OJMX 3UWKA 4QUIA 1YRLA 1I36A 1UMBA 4H7EA 2AG6A 4F84A 5ADVA 5IJZA 4TT3D 1MOZA 3FSGA 1Z6XA 4XDGA 3PX3A 3VKHA 3BE6A 1R9GA 5H59A 4IVPA 3VJKA 1QNLA 2Q50A 5IF9A 1JYSA 3OD5A 3ETLA 3PNOA 4FYIA 4XPIB 2DPMA 3UY4A 4NFLA 3GJTA 3MJ4A 4BRZA 4E7PA 1EP1B 1LCIA 2UXBB 2P27A 3W5IA 4BMZA 1XN1A 1Z2PX 2EV9A 1QDUA 1JA1A 3FLMA 4PC6A 1IEWA 3HVIA 2I34A 3OC6A 4MAAA 4CKWA 1E9DA 1JAYA 2QR2A 1J8DA 3BK1A 3GGGA 3G5UA 2YYSA 3LCCA 4ZJYA 2GZ1A 3PEUA 2HOQA 2X1MA 2H1CA 3CX6A 4ZCPA 4K1XA 4DLYA 1GTMA 2R65A 4PLCA 1KQGA 1ZZGA 3I2KA 4UOQA 4QM6A 1T91A 2ZJ8A 3PRKE 4YUZA 1WY5A 5DRTA 3H87A 3RTGA 3LP6A 4GD3Q 4L28A 4E15A 3K92A 1AF7A 4M4SA 1BYIA 4PO1A 5JFGA 1IOLA 1VMKA 4H6XA 4UEQA 3H6HA 5F1PA 4ILEA 1X80A 2GILA 2HK6A 3ZE8A 3TM4A 3P5SA 4FR0A 3EY4A 2G3YA 3RAPR 2RGNA 3OTQA 1KOJA 3V46A 4GX1A 1Y7IA 3S5UA 4NBVA 3E9DA 4LGVA 4N39A 2X22A 2OC9A 1UMCB 4FQ5A 3TX2A 4H4CA 1GY8A 1HSZA 4HDKB 4JLDA 5D5QA 4AWAA 4NE9A 3VV2A 1NE7A 4FOSA 4KODA 5K09A 1ODTC 4XB1A 3G9ZA 1CZNA 4EKIA 2A94A 4ND3A 1X1BA 1JDSA 3H04A 1JX6A 3A6EA 5FA6A 4FX2A 1U7OA 1XEXB 2CVHA 4MW5A 5KQSA 2ZUVA 2IU6A 1XP8A 1NRIA 1WIWA 1JQAA 3JAMA 1TAUA 3GF4A 3NVKI 3TEFA 1G20A 3KIPA 3L41A 1OH6A 1VYUA 4IYJA 3BXOA 8MHTA 5H16A 5D3MA 1O0BA 4K6FA 3RRFA 1DIRA 3O3CA 4HRYA 5C1DA 1JFRA 4R1LA 3DV2A 2AYZA 3AI2A 4C2UA 1CLUA 3WQHA 3UVEA 4F5DA 5JJKA 4WADA 3K70D 4WK0B 4XFDA 4D0SA 5FEUA 3A1DA 4ZXPA 5HZKA 5F7OA 1FYWA 1UJNA 3ELBA 3V1TC 3B12A 3OIGA 1JE0A 1EFDN 3V6MA 4FDTA 4Z51A 2NGRA 3PWTA 3HUUA 1M2VB 2QN7A 3LIIA 4E51A 4BWGA 1WZ2A 1SQ0A 3MGGA 1WW2A 3PWSA 2WMDA 4ISBA 1B6RA 1C3XA 3GEMA 4MARA 4EL0A 3K1YA 5B4UA 4YONB 3NGXA 3RU9A 4AS1A 4DRYA 3A2MA 1J33A 1OV4A 1QM5A 4LMPA 3BOSA 2FHSA 3B8HA 1QOZA 1GQYA 3NTVA 4FFOA 4FGJA 5K1ZA 1KZGB 3JQFA 3N76A 2FXIA 3E1GA 5GONA 4EHFA 2RCNA 2VAXA 1DUVG 3N7UA 4MWGA 4QLAA 4WCFA 1ZU4A 4C22A 3DVRX 1AVTA 3I92A 1R16A 5AW8A 4O4HB 1F6DA 3NHSA 3B2EA 4HQKA 2CLHB 1A1VA 1GZ6A 3G2PA 1Z47A 1UFKA 1TGYA 3OQOA 1YC5A 5BWLA 3GCXA 1HG1A 1FXSA 3NDIA 2VP3A 4EZBA 4WXYB 3PUYA 1RWPA 4WHMA 1VMDA 3LX5A 4HYTA 3X1DA 4BNDA 3NDRA 5K0CA 4MV7A 2I29A 3M81A 1OIVA 1PEAA 3B82A 4JLWA 2K7FA 1PE0A 1PKEA 2WSMA 3K31A 4DYHA 4M9ZA 4KXLA 1D2EA 1RIIA 4V39A 3U9TA 2BCEA 1ZX1A 1YZNA 4DHWA 2AKAB 3LT5A 5JAZA 1UOOA 1DIGA 1NNEA 2QRNA 2X0EA 5ELLA 1RBYA 4U00A 3D3WA 1JIQA 1GYPA 1OYWA 1ZM7A 2X0KA 4F97A 4DG5A 5DMXA 2JGEA 4CMAA 3NYIA 1GNTA 4Z9YA 4KRFA 5L3VA 4LV6A 1U0BB 1TE2A 3GJ7A 4ZMBA 1QHFA 1XNHA 4MS3A 4P5DA 3A8TA 3RF7A 4C7XA 2HIHA 4TSFD 2AN4A 1UP6A 2Y4NA 4MV5A 2ZE6A 2F1HA 4JSRA 3LZDA 1MZPA 1E0DA 3L77A 3HY6A 1W1UA 1HURA 3DPUA 2B92A 3QYPA 1GN8A 4NY1A 1SHKA 1A9XA 3QPVA 3UWDA 4MSUA 1Z4KA 1Z7GA 2HHLA 2V4ZA 1YB1A 3UF0A 1P5RA 1G3QA 1YQDA 3OZWA 4X6UA 1JMVA 2BMFA 2E5LB 1OC2A 2WHQA 3KQQA 2ZJ6A 1JSZA 3M6XA 5DBIA 3LHSA 5A6VA 1I9GA 3GC6A 4A23A 2HBQA 1GSHA 4YT2A 1T26A 4UZEA 5CA0A 1IXYA 1SVSA 2YHSA 4E70A 1WZUA 3AY7A 1AO3A 4YV1A 4ZVTA 3AB8A 1Q15A 5DV9A 2IX3A 3NYQA 1JFVA 1WS6A 1V37A 2ODEA 1KR5A 2FAXA 5FH9A 3NTOA 4MWBA 3DV0B 2VHTA 4FMPA 2HA5A 3IKVA 4ITUA 4XOUA 5M34A 3KQNA 4Z4FA 3H75A 2NG1A 5AKKA 1DAPA 4HS4A 4PS0A 1MQSA 2BR5A 3AVQA 3HBNA 1OWPA 1E60A 4FBGA 4M9XA 4YP1A 4LQLA 1V4NA 1XRLA 4WLNA 2OGWA 3O4JA 4OLFA 1B41A 4ZKEA 2OZEA 5A2QA 1QRTA 1GU0A 2GA8A 1L5OA 2BCJQ 3A25A 3G0IA 4PE5B 3EHDA 4M1ZA 2ON6A 2FR8C 1MJ5A 2HMYB 1QZ3A 4R31A 4JHXA 4E4TA 4FUQA 4G1BA 1C7QA 1K8QA 4BDSA 3ESDA 1HMYA 3DMNA 1EESA 2DHDA 2RKBA 4Q5IA 3MUFA 2HJWA 2FG5A 2YMPA 2ZBGA 1T9ZA 4LTMA 2ZRAA 1Z4PX 3L5OA 5GGXA 1M2KA 3NEYA 4GWGA 2NWQA 4MAMA 1DRKA 1OLSA 5IBCA 3RFXA 4RO0A 1LPSA 3H42B 1Y3BE 1MAAA 3KQMA 4NDZA 3I62A 4I1IA 1DJLA 4C3VA 1XQVA 3OESA 3PUKA 3ZGLA 2Q45A 3G0GA 5JEEA 3R6GA 4TRMA 1ZD1A 2JFGA 5FUBA 3UCFA 4DB2A 2AEFA 3ABZA 5B57C 1UT5A 2VDMB 2VJCA 3ZWWA 2B3TA 1T8RA 3F67A 5ERXA 4EA7A 5KJCA 1NUPA 3OT5A 1U4OA 3ASVA 1ZM9A 2FYTA 1ZK4A 4JKYA 2FKNA 2DCUA 1I2DA 3ZE0B 4GEGA 1SXHA 5FUWA 1OH5A 3GHHA 5JSZA 5KNBH 3A26A 3MM4A 1US8A 3AM5A 5IAAA 2Y0DA 4B6EA 2GNAA 4QXMA 2ZRMA 1YTUA 2PZJA 2Z8YA 4RQAA 4QSMA 4A4DA 4JZYA 4G4IA 5ALGA 3ZY3A 4RU1A 3CY6A 4ZOQI 2QRPA 4P34A 3FWHA 1DG9A 4OLHA 4L3OA 1P8AA 4YRZA 2X5OA 2IZ6A 1Q5PA 2JAQA 2QT1A 4BVFA 4X65B 2PZ8A 1HLDA 2VT2A 4OQXA 1DRUA 1LVGA 1OT5A 1D1SA 2AX3A 3TL3A 3SIPA 3OBBA 1ODSA 3AW9A 5DSXA 2Y0PA 2A9JA 2GK4A 3QNMA 4MPRA 4LI3X 1FUYB 2IK8A 3IPAA 5JCOA 3GDOA 1Q7CA 2C4KA 1O97C 5BRJA 5C7OO 4P38A 1V45E 3ACBA 3GYGA 3UH1A 1XZEA 3OEHD 3F4LA 4XUDA 4KIWA 5MN4A 1AXGA 4RIIA 4B8WA 3RRJA 5ICEA 5ITZA 3KQUA 2BGJA 2W98A 2OBMA 3KQSA 5LYYA 3PQ6A 3FHJA 5FJIA 3FCUB 1Q0LA 3A9CA 3WLSA 5DWVA 1LU9A 2GLTA 1U0OC 3V3TA 3FPCA 2GWRA 2OLJA 1JR6A 4NP6A 4C0XA 1E9BA 1T2VA 2NO0A 1M2OA 2I5PO 1Z2EA 1EYZA 1QVWA 5LQNA 3HZZA 3PG5A 5HDQA 2OBXA 3FM9A 1QFXA 1WXHA 3G8DA 1NRJB 1NW4A 1ISRA 2P7HA 3ICPA 1KR2A 2GT1A 1TMYA 5JZVA 5BYKA 4GKKB 2XD4A 1BU5A 3WLMA 3EEOA 5BVHA 5CFQA 3HJTA 4ONEA 1JJBA 2C2XA 4A2WA 1SRRA 1JXMA 1MORA 3JQRA 3EEQA 1YR1A 2GNOA 4JI0B 3UW1A 3VR1A 1G3IA 2VCEA 3MPOA 3B78A 1B74A 4G5OA 4UVIA 4IUCS 4CHTA 1ZJ4A 5D3KA 3CNOA 4ZT7A 1DLJA 1UQTA 3AGPA 1ISFA 2EKLA 2IHBA 1Q74A 1S4MA 2WUVA 1OBCA 1BG6A 2GJAA 4OI0A 4RADA 4BTVA 1IE3A 3EDQA 3H4IA 3PXEA 3OFKA 5DLDA 2X0NA 1HTWA 1SQFA 5DNDA 1V2GA 4C89A 2EKZA 5KB3A 2BFBB 2IHVA 2WPDA 3E7FA 4E1AA 1E20A 4HX9A 1RT9A 4KFUA 1JI3A 1LWNA 5HE9A 4JUBA 4EA8A 5JD5A 4ZVUA 3C3MA 1W59A 5TQJA 5C8YB 1AGRA 1ACLA 2X86A 4I5EA 1E3MA 5D7BA 2JIOA 2OV2A 2YN2A 3INTA 4YMUA 4RPLA 2F4VB 3M8KA 2HCFA 3B36A 5GM1A 4BFZA 1Q84A 4A8JB 1L8AA 3X1MA 4DFDA 3BQNB 3WGNA 3W4KA 3RE1A 2R8YA 2F3RA 4EVIA 4JY7A 1V48A 3JX9A 3NHBA 4YO7A 3EUAA 3GGOA 4IJ6A 2FFAA 5DFAA 3RJ5A 4DS3A 2AFIA 1NYTA 4ZI7F 1ZBDA 1J25A 2GZMA 2YMLA 1X74A 1LQTA 3D31A 4KAXA 5CVUA 4D3XA 1P5HA 4RFSB 4F60A 1QPGA 2Z8XA 4XIIA 1G63A 4NOMA 3WYGA 3MTBA 4N6NA 4Y7CA 4GBJA 1G8KA 3DXZA 4O8CA 4JJZA 4AZWA 1YAJA 5JIBA 9MHTA 1R4ZA 3MFQA 4IIBA 1OFUA 2E87A 4G67A 3H9UA 4FCWA 3SHQA 2QRGA 2XDAA 1E92A 4FHCA 5AW7A 3BIFA 4J1TA 4ATNA 3EXHB 4ER0A 4E0BA 4S1WA 4U5QA 4KN8A 4C4YA 1EZ1A 2VJQA 3UJ8A 4YUAA 1V3UA 2R1ZA 1AT1A 2VHCA 4C4AA 2VDKB 5KYWA 4BNNA 1A7AA 1WKVA 3ZLUA 5BSKA 1OJLA 2BHTA 4FOTA 4D8VA 3IV7A 5ADUS 2C92A 3MW8A 5GONB 1M0WA 2GPAA 1ZCFA 2ZBRA 3CBGA 4JP5A 4F5EA 2P9GA 2FWJA 3G49A 2HV9A 5G0TA 4YXFA 3HB5X 4CM8A 4B73A 2RHRA 3DHWC 3K1ZA 3KZNA 3PUWA 4MH0R 4QOIA 3FOFC 3K53A 5EKDA 1ZMRA 3ND6A 3LM8A 3KXLA 2WSBA 2FTKE 2XUFA 1M74A 1DOHA 5CXSA 4CCYB 1A8IA 1MO5A 1JG6A 2PZFA 1JILA 3NOOA 3VU3A 4ZPJA 1QG6A 3QKIA 3K8YA 1RKQA 1SD1A 3KL2A 4BE9A 2NM0A 3E0QA 1N5KA 3MTGA 2PWPA 4Y0VA 5E1MA 4CV2A 2A59A 2N9UA 2MSLA 1UDXA 2Z57A 1IXZA 4HLNA 4IZ6A 2BFPA 1DIHA 3EGVA 3WRXC 4L9WA 3CVWA 1DO2A 3RJ9A 5C8DA 5DGIA 1SCNE 2PX5A 4EW2A 4RTNA 3MERA 2B6HA 2P3QA 4B0OA 1STOA 4CI0B 2Z30A 3I9FA 4FOLA 2ZREA 2JK0A 1BJKA 4X1YA 2FWPA 4KFTA 4IJWA 3SBOA 3SZOA 4DR5B 3OE7A 3UMJA 2HBZA 3TDMA 5HVNA 4AQYB 2HBYA 4BL5A 1JHOA 5EJIA 1T0IA 3JVEA 1E4OA 4JGGA 2O8CB 2HK9A 4CR8A 3HO8A 2CC2A 3EFOB 4DN6A 1L5VA 1HO3A 4J1TC 3E27A 3FMOB 4M38A 4GPTA 3HA7A 2VTBB 1CG6A 4D9JA 3AY6A 4QLBA 2JDID 4JI8B 1XLTC 4O4JB 1HEIA 3C4QA 3K1TA 1FMFA 1JIIA 1DDOA 4B81A 3KZVA 4H6WA 4LNAA 2QMQA 3EQ8A 5BMVA 4WNAA 2O8BB 1BVRA 1G7RA 3D1VA 3VDXA 4E7OA 2X8WA 3AF4A 4CUKA 5BW4A 3ZDCA 2FVYA 4N8EA 1KH2A 2Z5FA 1PK7A 2JJ8A 3O1HB 5FDFA 1N0IA 4AZTA 1OKKA 4XCVA 3G2OA 4TT3A 2OCYC 3AR6A 4EB6A 5LR6A 1Q3HA 3PFIA 1XVVA 4IHJA 4WACA 4E5PA 5GV8A 1KWKA 2J9FB 5CLFA 1Z37A 4J9VA 2YWHA 1TMKA 1CY2A 2J7KA 2QAJA 2WU1A 4UE6A 2LGJA 4QU5A 5C4MA 3F3SA 3OCJA 3PHHA 3JQAD 4L15A 1X92A 2ZIWB 3RQSA 2FFRA 2XKJE 3EJWA 3IAXA 1YF3A 1NOKA 4EO4A 2HFJA 1TCUA 4XVQA 2Y1GA 2JI4A 4I66A 2P2NA 4DMLA 5JZ9A 1E4VA 4R1SA 2DH5A 3HABA 3IUSA 1I13A 2NZ2A 4JOCA 2JZCA 2P41A 2YTZA 4J2TA 4UTOA 4BGEA 4ER3A 1E6MA 4HRXA 1FPMA 3C6KA 4NJOA 3NH6A 3H2ZA 2O2GA 4KE7A 2Z3VA 2ONJA 5EJ6A 3TCXB 1FIUA 4TXJA 3MGCA 1N2GA 5BWBA 2R6JA 3W77A 1EVJA 1HMPA 3E61A 4DQDA 1KBQA 3B38A 4FCVA 2Q99A 3DM5A 2P1RA 1C14A 1Z75A 1NJFA 1Q2XA 1JIXA 1BTOA 1X9HA 1JE1A 1LX7A 4J6FA 2Y67A 3O1LA 1DKUA 3TB6A 3V00A 3PEWA 2JLXA 2JLVA 2H2GA 2DEUA 5FOVA 3N70A 3LRPA 5IRCD 1KEUA 5EIBC 1C0EA 3G7UA 3VU9A 5CVTA 5G40A 2FV8A 1H2HA 3QMVA 3H1AA 3BWEA 2PL1A 3L1JA 1PX0A 3F9CA 3G7SA 4D82A 5KHOC 3G2HA 1B8PA 3KQOA 1ZUD1 3CJQA 4WKBA 2GF0A 4YAJA 3PQCA 2I3GA 4QYTA 4TWIA 5AMXA 1YONA 5K0ZA 2NVBA 3JU3A 2FW0A 2Z95A 3OIDA 2ASVA 1C1XA 2GHRA 4EJ0A 1NW6A 1BXRA 1JFTA 1O97D 2IL1A 1IN4A 1LGYA 5JR3A 4UAUA 4LOKA 2O5RA 3IUYA 2O3RA 4CEIB 2W4QA 3TH5A 4KQEA 3NM4A 2POCA 2W71A 2I87A 2PVPA 2FW6A 2BISA 3CO0S 2OWEA 1WHTB 4IIYA 4I6JA 4Q9KA 1DBQA 4AIRA 2REQA 3BC1A 1UFRA 1BVYF 3BBPA 4N4AA 3Q1LA 2CVFA 1K6EA 1RAFA 1MJFA 1I4WA 3CT6A 4HNUA 3ERCA 5ALDA 5AVZA 2XWBF 1Z0AA 1D4ZA 2WSYB 3QV2A 1F0YA 1KP9A 3E70C 2VQDA 1Q1QA 2AB0A 1D0SA 2AEEA 1WXXA 3FYUB 1VHWA 2OP1A 3MRXA 5H82A 3ENVA 1NHGA 3QRWA 5K2OA 2I76A 3KU4A 3O4GA 2VSNA 3MMNA 1DQPA 3RW9A 4DV3B 2A7QA 4KZPA 4LJ6A 4DLWA 4R1QA 5K9ZA 1E69A 3KUDA 4HNSA 4WSOA 1SY7A 5TT0A 2G9RA 1A5AB 3WLKX 1BQEA 2C3YA 2GVZC 2HF8A 3II6X 1KNQA 1NM5A 1DPFA 1SBNE 4JLMA 2JF0A 1A72A 2PNFA 4YJDA 4Y9UA 3Q72A 3AHIA 2E1RA 2H2DA 4DWVA 4NWIA 2V3WA 3RRBA 3TMAA 4RCYA 3O92A 4Q4HB 5KX5A 1W76A 5LB4A 1L4FA 3P0EA 1CEQA 1T8SA 3MQFA 3QHAA 3V1LA 5CFOA 4ZRMA 1ZPDA 1C3OA 1XDSA 1AKNA 5TQ0B 2VNKA 2YV1A 3WOHA 1IMOA 4FYKA 1JH9A 3R5JA 2EJTA 2XMRA 4IIGA 4BAGA 4AX4A 2G1AA 3C3XA 2H8KA 1MW9X 4NARA 5IAOA 5DM0A 3HBMA 3USCS 1QR6A 2IOQA 3U44A 2C4TA 3HA3A 1QP0A 2XUDA 2XB6A 1NC3A 3EWSA 3Q85A 1PUXA 1UBSB 1OGJA 3E05A 3P52A 4MPDA 3LY5A 3AZQA 3D0OA 3QX8A 2GAIA 4IDFA 1JN0A 2YRFA 4PZAA 3HDYA 1U1FA 4G0WA 2IOFA 5JDCC 3USES 2PUDA 2YR0A 1NN1A 1E58A 1SC3A 1V8PA 4YMTA 1S0UA 3UMGA 1Q16A 5GP1A 1NN3A 3Q9SA 4L02A 3UAWA 5HX7A 1XP5A 5JJ5A 1OTHA 3HYSA 5JDIC 1DWOA 5AVRA 3LBNA 4DLSA 2XHEA 1KO1A 2O9JA 2QDXA 4LSMA 4ETNA 2CFSA 5LZ4A 3IBTA 2BMWA 1H05A 4HFRA 4J43A 1FP2A 4DXDA 4DGSA 1I3NA 2HF7A 2AJTA 3O1IC 2J32A 4MYDA 4CI9A 3WL3A 4F4IA 1PWZA 4KX3A 2WC1A 4A8JA 1HX7A 1YZKA 1RPAA 4HPWA 2V7BA 1FUIA 1ID8A 1BDIA 1C0LA 3HXQA 1AGYA 5CPFA 1EFHA 1QHYA 4L8WB 3V1NA 4YR9A 5JSUA 2PS1A 1CJKC 2IHYA 2XODA 3EZ7A 4MRMA 1U3TA 3ESZA 4UAVA 4W5TA 1N0WA 1X42A 3QP9A 4W4TA 4OHWA 1RAEA 1S9HA 2ZROA 3RVRA 3U56A 2PSEA 2ZSDA 2QB5A 4AZ0B 2NXNA 3GLTA 4CLEA 1WW3A 2QN1A 3LBAA 3WKBA 5K3FA 3A3OA 1LRJA 1HDOA 2BLLA 1H69A 4IIUA 4B8ZA 4RACA 4RD6A 4N3CA 5ALLA 3IHTA 4XARA 4FYWA 2CHVA 2WFMA 1L4KA 1MH9A 2TMYA 1SXGA 5DM1A 2DFDA 3RRMA 4MP8A 4HNRA 1KI8A 1JUDA 4RKQA 5LBTA 4N41A 4EMTA 3C4JA 1RXSA 1P5FA 4YXWD 4IEFB 5A03A 5DNEA 4LYFA 5JASA 1FP4A 4JDPA 5BR8B 1KYQA 5KYUB 1ZCZA 4GT1A 4ZTUB 3B1WA 2ZRCA 5JBQA 3RASA 3CLSD 3R9WA 3TTVA 5MDHA 2QVYX 2QT9A 2CXHA 2V3CC 2KLBA 4JBXA 2REBA 5CFZA 4NXNB 1D09A 2WAOA 3LC1O 2XNKA 4KN5A 5B2ZA 4UM9B 4IWYA 1II8A 5CDHA 3REQA 4MIYA 5A4MS 1KWGA 2A57A 1GVNB 3HR8A 3C5HA 3DO6A 1MG5A 5CDUA 1Y7HA 1FDOA 3RBVA 4BNTA 3HB7A 3JVIA 1HTBA 5AVXA 2CCGA 2W2XA</