3SJCA

Crystal structure of s.cerevisiae get3 in the semi-open state in complex with get1 cytosolic domain
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
349
structure length
276
Chain Sequence
TVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAECKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords ATPase GET3
publication title Structural basis for tail-anchored membrane protein biogenesis by the Get3-receptor complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 80
structure length 276
sequence length 349
chains with identical sequence B, E, F
ec nomenclature ec 3.6.-.-:
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3sjcA00
2JLQA 2OO7A 2O8DB 3T34A 4I1OA 1I4LD 2CLCX 3LDAA 4DSTA 3ZVLA 2G3YA 2QE7A 5EXPA 2PL3A 3BC1A 4DT1A 2ODBA 4DLYA 5C2JB 2GILA 1E2NA 1S0UA 1WCV1 2JATA 4OQFA 3Q72A 4Y0AA 4XTRA 1GP2A 4L9SA 2KBFA 3MWYW 4RD6A 1IXSB 2JLXA 1KI8A 1KI3A 1J8MF 1T5IA 3FPAA 3K0AA 2ZRGA 3KUCA 3AVPA 4BECA 4LJAA 3OESA 3QKRB 3AVXA 2DFTA 3QG5A 1T0JB 5BN4A 4NCJA 1ZMXA 5FTMA 4ZCLA 4A2PA 1WXQA 4KBFA 1FQJA 4JS0A 4YMVA 2OZEA 5DYIA 2ZVQX 3CR7A 2HCJB 2QA5A 3B9PA 4A0HA 1G6OA 4M9XA 4NPHA 4V0ME 1T3LA 3A8TA 2A7QA 1E9SA 1RKBA 3RRMA 2QT1A 2O8BA 4ZCMA 2TMKA 2R6GA 3L0IB 1OH5A 5TARA 3PEYA 3W8NA 1Q1QA 4DUGD 2I3BA 4ZDKA 4LYJA 2K5UA 4C0HA 1YZUA 1G7TA 2GWHA 2ORWA 1MT0A 1KYIA 1T8UA 2WTUA 1HY3A 3MD0A 3NEJA 2GEUA 3VR3A 1DELA 3KQNA 1G9XA 3TNFA 4JT2A 4LHWA 3D31A 1J7KA 5JJLA 2BCGY 5SZJA 3P4YA 5B57C 5JI2E 2R6AA 3LX8A 4JBXA 1NLYA 2BHRA 2GXSA 2DWQA 4IXNA 4MGYR 1QHXA 3Q3JB 3QXSA 4PR0A 1KKLA 4TMXA 1U98A 2XGJA 1CR2A 2X19A 3AF0A 3DHWC 1M7HA 2O8FA 2IWHA 3TSWA 2BBOA 2UZIR 2OBNA 1UDWA 1KO1A 1G18A 4PQRA 5GVRA 3UATA 4MH0R 1EFCA 3EPLA 2P6NA 1US8A 2WOOA 3LXRA 3GLIB 2IS4A 4UNNA 1W2HA 5FI0B 2N46A 3TQFA 3OE7A 4POAA 5CK5A 2ERYA 3UPUA 2RB4A 5G41A 5E7JA 2GXQA 3D8BA 2Z83A 4HI0E 1HURA 2R2AA 2J0UB 1F2UB 2OFXA 5EE1A 1CJUC 1KI9A 4LV8B 4V02A 2JJ2A 4TYQA 4XD7D 2D2FA 1E2PA 4BFXA 2D74A 3GP8A 4D2IA 4UKDA 2BM1A 5JWOA 3WP0A 4Q02A 1NLFA 2RH5A 3LQQA 4JVLA 4L16A 1PLLA 3GFOA 1RJ9A 4HSEA 1OHHA 3NEYA 2OAP1 4Z1MD 1KY2A 2V55B 4XWKA 5CJPA 2G0TA 5FOVA 5HCIA 5DO9A 4TYWA 2OILA 2CK3A 2QAGA 1OE0A 3AGPA 3KQLA 2XSZA 4DB4A 1FQKA 4ZKDA 4GP7A 4A0RA 1TF7A 1JR3D 2WWIA 4DT1B 3ADCA 2YJTD 3OAAA 5J4LA 1T6NA 1XMSA 1M7GA 1N0UA 1Z6GA 2B8TA 2WKQA 2CCGA 4KFSA 5DIFA 1KSGA 2R6CA 1OXUA 1ONBA 2NGRA 3W6PA 1KSFX 5C4GB 1CEEA 1C9KA 1GILA 4K46A 4KI0A 1T91A 1L4UA 4L8GA 3HU3A 1Z28A 5JS8A 4AG6A 2ZJBA 3BOSA 1YR9A 2AFIE 3C7KA 1JXMA 5P21A 1OH7A 2ZRNA 3AF2A 1UEJA 1TF5A 1KI1A 4ABYA 3EPHA 3FB4A 4B48A 3QG1A 2F43A 4TQUS 4NL4H 4OQMA 4NU0A 1J2JA 3DL0A 1KJYA 3MRSA 3V4RA 4R9UC 5KSPA 3N2EA 3CO5A 3S1AA 4K8OA 4Q03A 1QHYA 2H8KA 2ZYVX 2AK2A 2QTFA 4M1TA 4TL6A 3L8YA 4UNQA 3RAPR 3B1VA 3BK7A 1GKUB 1LY1A 3BB1A 1XXHA 3TUZC 4OHXA 3WRXC 1UPTA 4Q9KA 4ARZA 5KHOC 4OHYA 1KK3A 3CF2A 1P2UA 3THYA 2I1QA 1S2MA 3LLUA 1HT2E 2GDJA 4FIDA 4JLKA 4L15A 2DCUA 2EVWX 3ICEA 2AXNA 3PG5A 2CBZA 1U94A 2PMDA 1QBKC 1Z6TA 3K8YA 2VHJA 1KZ7B 5C46F 2JAQA 1RVDA 3FGNA 1CLUA 3AP1A 3B2EA 4DLXA 2ORVA 2XNSA 3BORA 1I4DD 1KI7A 4MGZR 2O8FB 1EX7A 4BLTA 3T1TA 3CRW1 1FFHA 2GEVA 2KE5A 2W6ID 3CX6A 3OZXA 4Z8XA 4DCUA 2VPPA 4Q1FA 1W36D 1NBME 1P5ZB 3IIKA 3VMFA 3SEAA 1X8JA 2OEPA 2Q21A 4KAXA 3EC2A 4OJKA 2FFQA 3SYLA 4AURA 1COWA 1KI4A 4AKIA 1MO4A 2CHGA 3TIFA 3VX4A 1S3GA 2IYVA 1DAHA 3KXLA 4QNRA 1SHKA 3M0EA 1N6NA 4FD2A 4GBMA 2G9NA 2PEYA 4CEIA 3IUYA 3NBYC 1BO6A 3BXZA 2IYRA 4M1MA 1G8PA 5JI3E 1P61B 1T3HA 4QBFA 3T5DA 4UNSA 4LJ8A 5EUMA 3RS2A 2C78A 2B21A 3W6OA 4JSYA 4BZPA 2BJWA 5BWMA 4Q9HA 2ZU6A 3GFPA 2JLYA 5DYGA 1TQ6A 4PHTA 4Q9IA 1W46A 3N70A 1CKEA 3UMRA 2KI5A 1PVOA 2RCNA 3RANA 1LS1A 4C0SA 1JQLB 4DDVA 2ZS9A 4LWZA 4LYFA 2WAYA 2V7QD 4C2TA 4EPTA 4NONA 2OCAA 3PVSA 4MDEA 1Q22A 4JLJA 4KFUA 1AJEA 3B7GA 1XNJA 4M21A 1AA9A 1G5PA 2IXFA 3HJNA 1PLKA 1UBEA 4GSYA 4N0DA 4S2EA 4KV9A 3TVTA 2HT1A 4HAZA 2FPMA 1OXSC 3CRVA 1AGRA 5KUTA 1E79A 1KO8A 2VP9A 1KI6A 4LHZA 4MUBA 4O0MA 1KMHA 4AWXA 4RD3A 1S96A 2YOFA 4LJ4A 3LBIA 4O2LA 4C9BA 2ZAMA 4JL6A 4JLVA 2C9CA 4D0NA 4Q01A 2XJ4A 2CCJA 1OYWA 3NHBA 3ZH9B 3QIAA 2HYIC 1QF9A 4Q1CA 5FOXA 4TSFD 5FR2A 2RGEA 3H2YA 1QG4A 1ZM3A 4OI1A 4LSGA 3U60B 2F43B 3FMIA 1RPZA 1M1YE 2EYUA 2X1VA 3CWQA 4MYHA 1X1SA 4TZ6A 1Z22A 2IYSA 5C4MA 3S1AB 4R98A 1Z06A 2J41A 2H7VA 2PX0A 4ILEA 4ZI3A 1TQ4A 4URZR 3Q5DA 4K81B 1KK1A 1XXHB 1E4YA 2VHTA 2A2ZA 4TTRA 2QEQA 1QHSA 2YWGA 1E2FA 4EFNA 1IHUA 4HDCA 5TMPA 1WB9A 3C5CA 3SS8A 5CDFA 3KJIA 4RJLA 2ZSFA 1EFRD 2ZXUA 2YC4C 1FNNA 2BIFA 2VH5R 5HCNA 4IRUB 1PV4A 2JIZD 3LAWA 4OK5A 4PANA 5AUOB 4CGZA 1G3MA 1B0UA 2C04A 2ZE6A 4O25A 2ATVA 2GZDA 3LW8A 1UKZA 1XCPA 1A2BA 1A4RA 3E5HA 4ERNA 1Z0AA 5BYJA 1LB1B 2CL7X 2WV9A 3TAUA 2ANBA 1KSJA 2P0EA 4BFZA 2VP2A 2WMNB 2RGGA 3OFND 1JNYA 1K8RA 2IYYA 4B3DA 5BN3A 5JSZA 3CH4B 1E2JA 1CF4A 2IL1A 3KB1A 2UKDA 1DG3A 2PJRA 4GMDA 1HE1C 2P65A 4IDHA 1U81A 4LHYA 2CNWD 2HXYA 4NMMA 2OLKA 4A8JC 4CEIB 2ZI4A 2G1KA 3AVQA 3ZS9A 4B43A 5JJIA 1IN8A 4QKQA 2N1BA 1SHZA 3MAAC 5HPYB 1L2TA 1XTRA 2BM0A 3B13B 3UMSA 2QENA 2V1UA 1GSIA 1AZSC 2P67A 1N3BA 2REOA 3BIFA 3FYHA 4OHZA 2VTKA 3H84A 4IJMA 1W47A 3BB3A 1FUUA 4NDZA 3TJZA 4A2WA 2FDCA 3NC1C 2HV8A 1IN5A 1D6JA 1KNXA 2A9KA 2IUTA 4PFSA 2L0XA 4BASA 1CXZA 4R71A 4I1UA 3R9XA 2KSQA 1BMFD 3KKQA 4F91B 5DHAA 4U7DA 3CR8A 1YZGA 2R6DA 3K53A 5A4JA 3PUWA 3DKPA 4IEIA 3FVQA 4TT3D 1N5LA 3ADDA 3EC1A 3NKVA 2ZREA 1XTJA 3MWLA 1MO5A 1KK0A 5M04A 1GITA 4H1VA 1UBCA 1K6MA 1E99A 621PA 4NE2A 3DOEA 1KI6B 1W0JD 1R2QA 2PJZA 4JVNA 2WKPA 1GKIA 4OYHA 4EJSA 1TADA 2ZS7A 1WF3A 4KJZA 3WYFA 2VO1A 3R8FA 3FKSD 1WDTA 4CEHB 5GJWC 3X1DA 2NZ8A 3BFXA 3H0KA 3OF5A 3P4XA 4URXR 1CP2A 1VYVA 3KTAA 1NG1A 1C4OA 1DTSA 2A5GA 2ZRDA 5CM8B 3CRMA 1OFUX 3U7EB 4GNKA 4QM7A 2AD1A 1R10A 4G5SA 2J0SA 3SNHA 3VKWA 2P2LA 4V0OA 5KDOA 4URWR 4C4PA 1G8FA 1PJRA 2XTZA 4KSBA 4QL3A 5UKDA 3LLMA 4LYHA 5J5CA 4Q7LA 2W0MA 4GDFA 1KKMA 1NN0A 2EFCB 3OEEA 4B74A 2CXXA 3KZ1E 3W3ZB 4FMCF 1HV8A 1A7JA 3AP2A 3GJXC 1SVIA 4RD4A 2CVHA 5EXTA 5K8IA 1SVOA 5ELXA 3I62A 1N0VC 4TYYA 2Q3MA 5ANRB 1HT1E 2VP5A 2JLVA 2R9VA 3LVRE 3FE2A 2F1RA 1P9NA 1UKVY 3VAAA 1ZIOA 3GJ0A 1OH8A 2IEYA 1VMAA 4UJ5A 2O8CB 4ZI2A 1GL9B 5SZIA 3MWKA 1Z47A 1KO7A 4W5WA 1ZIPA 3ZZUA 4Q1AA 2LWIA 3TW4A 5JSZB 3SQXA 4D4MA 4LBYA 3OEHA 3O8RA 3BGWA 2ZE8A 4MKGA 4QHTA 3UANA 2FU5C 4US1R 5JRZA 1SGWA 2VHQA 1TTTA 2PCLA 2Z6VA 3GLHA 4Q7KA 2J0QA 1GRRA 1Z0KA 4DSUA 5FPSA 2GAOA 2NIPA 2VEDA 2ZJOA 3ADKA 4QGGA 4Q4AA 1TUEA 4RD0A 2KB0A 4ZDIA 3MG9A 1DS6A 1N5IA 1HH4A 1P60A 4EKDA 4M1KA 2B7BA 4P33A 2N42A 1S9HA 1VIAA 4BQSA 2NPFA 3B82A 3SFVA 1W4RA 4I1SA 4I81A 3L43A 4MKIA 2XXAB 1M2OB 3RHFA 8OHMA 1Q1ZA 1YR7A 3AF3A 3P20A 2HT6A 3QXXA 4JJZA 4EQ6B 2IUSA 4P4TA 4QOSA 2O8DA 3P26A 3T12A 1TEXA 3J81k 4JLDA 2OE2A 3VR2A 4BFYA 4RZ3A 4C0QC 1N6PA 3AQ4A 1SXJC 4PC1A 1XD2A 1Q3TA 5J4HA 4TL8A 1Y63A 4HLUA 1OXVA 1G8YA 1K5DA 2HDNB 5FPKA 4IVPA 2BDTA 2ZUDA 2G1JA 5EP2A 3RRYA 4LBZA 3WY9A 4DLWA 4EJSB 3QXCA 1N2CE 1YZKA 4BFTA 1WE2A 3NH9A 1NJGA 2AKAB 3IIMA 3KB2A 2G88A 2E87A 3TK1A 3R9IA 1IY1A 4PHHA 2QQ0A 2IXEA 4B3BA 3MSXA 5TY0A 1HQCA 1OIVA 4W9MC 3KTAB 4B6EA 1ZNZA 1ZUHA 5K8TA 1G7SA 3FMFA 3IPXA 1C1YA 5CITA 1VTKA 1R7RA 5KDDA 1Q21A 4DC9A 1IXZA 5B58C 2XB4A 4A8JB 1WBDA 2IF0A 5HZHA 2YV5A 1XJ0A 3GFTA 3VR4A 4NKRA 1WQ1R 4QG7A 5F98A 4HATA 1AS3A 1MOZA 1XTSA 3F3YA 1CRPA 1NVUQ 1ZC4A 4DCSA 2IHYA 2WM9B 1YU9A 4KYUA 2XJ9A 3PUZA 1FNMA 2BBWA 2QORA 4MUAA 2IF2A 3LO5A 4UNRA 3T35A 2XNDD 3C5HA 1UEIA 2WZQA 4H1UA 1NG9A 3TR0A 1Z2AA 4W7SA 1JQJC 3FHTA 4AKEA 1G41A 2EFDB 4P4SB 3EPKA 3QVVA 2B6HA 5FI1B 4DHEA 2VLIA 4B2PA 4P31A 3VQTA 1YZLA 3U5ZB 3IPYA 3SE0A 1LTQA 1XEXB 1VKJA 4ZCIA 4MYUA 1H8HD 3PV0A 1E9FA 1GWNA 2DY1A 1JALA 1EXMA 3JZAA 4RZ2A 1BH2A 3OIWA 4DZZA 1T4GA 3IO5A 2OLJA 4KFTA 2XEXA 3THWB 5KSZA 1Z0IA 3QPWA 1D8TA 2ZEJA 2F9LA 3KJGA 1EFUA 4QGFA 4XWAA 5FPTA 2IEZA 4QXAA 1YZNA 1DAKA 1GIAA 2VL7A 2J7PD 2EFEB 3RS0A 1EX6A 3WMFA 2GK7A 2WSSD 4FW9A 4EPVA 4PO9A 5FOTA 3I8SA 2RAPA 1SXJE 3H1TA 3U6KA 2JASA 1RIFA 2WBLC 4JYCA 1ETUA 2X77A 1U0LA 2J0UA 5JS7A 2F55A 3NDBB 4Q4AB 3KKNA 1EFHA 3ZQ6A 4DEYA 1KTVA 4Q7JB 3K9LA 4FWIB 1FP7A 5TDHA 2QU8A 5LBIA 4ACBA 2D62A 3KQUA 4DRZA 1U2RA 4PO8A 4M1WA 3T61A 3ZIAD 1N6LA 1NSFA 4HLQB 5KNBA 5FUVA 2AL7A 3QKSB 5FUXA 5KDLA 1AM4D 3FOZA 2PLFA 3Q7QA 1PUJA 2QE7D 4RZUA 2ZYUX 1UADA 1NVXQ 3AUYA 4IW3B 1PLJA 2OCBA 2AXPA 1F3OA 2ZR9A 3IQXA 2FMXA 1Z0FA 5L3RA 2OAQ1 3RC3A 1U8AA 4NYJR 4TLCA 1E2MA 4IDOA 5SZKB 3NVAA 1JBKA 2QGZA 4HAXA 1X8LA 1E2KA 1D9XA 4LI0A 1XD2B 1P2VA 4LV6A 1ESMA 2QGNA 4V0MA 3FTQA 1LS6A 4M9QA 3TQCA 2GJ9A 6Q21A 3H86A 5A0FA 3HYRA 4GOKA 2C96A 2IYLD 1FMLA 3E1SA 4HLCA 4LPSA 1KI2A 2F7SA 1L4YA 1GRNA 4RKFA 5GVSA 3UG7A 2ZJAA 1OKKA 4PAQA 2ZI5A 2D2EA 2HXSA 1ZVQA 1VG0B 5FOWA 5FTJA 3NC0C 1R0YA 4KYIB 4JT4A 1XFAA 3A1SA 1S9DA 1W44A 2FFHA 5JHGB 1CR0A 2VQSA 2ZIAA 3AF1A 3RS5A 1QG2A 5FUYA 2IBMA 4MDFA 3X1YA 4NYJQ 2WJYA 4XSHA 1YHNA 4A36A 4YDHB 4KO8A 4CT4B 5E4FA 2QTHA 4ESHA 1MABA 2V4ZA 1F5NA 1N25A 4GPTA 3AGQA 3H4MA 4PZZA 1WMSA 1JPJA 2O5VA 3WNCA 2XTNA 1BOFA 3SJAA 4WZAE 3CZQA 2VA8A 5LD2C 1XD9A 4JLOA 5J4KA 1AS2A 4B73A 5J4YA 4RY2A 3K0CC 4QNMA 3SYKA 3IEVA 4P32A 3ASZA 2CLSA 2J59A 4Z8YA 3RWMB 3GD7A 1D2EA 1F6BA 4CIDA 4HYYA 3NBFA 2P5TB 1G19A 4OK6A 2NO7A 3QKTA 2PT7A 4NTZA 2WJIA 4DJTA 2ZVPX 2AN9A 1VG1A 3T1VA 2C2HA 2EWWA 4AD8A 1NY5A 3OE7D 4M22A 2IYZA 1DE0A 1SXJB 1XZPA 2R8RA 1Q1EA 2ZI6A 5IDVA 4ASUA 3SI7A 2ZYTX 1E9BA 2HJGA 5TXGA 2ZR7A 5JFGA 1TU4A 2IYXA 4MKFA 4QC2A 3THOA 2JJ2D 2Z43A 5D3MA 2VF8A 1XMVA 4RVCA 1L8QA 3QBTA 2QT0A 1G20E 2A5YB 2Q9BA 3CH5A 1Q1BA 4HZUB 3EPJA 1B23P 4O2RA 4LUCA 2ZTSA 3V00A 1KO5A 4TLEA 1KMQA 1OHHD 3LBNA 1MRSA 1A1VA 2RGDA 3ZVMA 3HU1A 5DGXA 2XITA 2CE2X 3C41J 4A15A 3K0FB 4DLVA 1E2EA 2FWRA 3WXMA 4FMDF 5LB2A 1CTQA 1RFLA 2CK3D 4A6PA 2XSZD 4NH0A 3DDCA 2Q9AA 1CR4A 3CX8A 1Z07A 3HR8A 1MKYA 2GEDA 3OAAD 4OK3A 4QRHA 5E95A 1AQUA 2AWOA 5B30A 2H5EA 4YDSA 821PA 3AH8A 3KL4A 3LH5A 2WHXA 2REBA 3FMOB 1AIPA 2EU8A 1SVWA 4V0KA 1VG9B 3DZ8A 2ODWA 2WWXA 4OL0A 4RCYA 4G5GA 3CONA 2LKDA 3EZ6A 4KLNA 4TMWA 2OBMA 4JLPA 4B2IA 3CIOA 2ZJZA 1TL7C 2GJ8A 1ZD9A 2ZRLA 2CLDX 2FX3A 5KNCA 4XVQA 1OXTA 3BAFA 2DPXA 4TWZA 3W5JA 1FX0B 2FPKA 3EX7C 3EIHA 3DEFA 4ZPXA 1G3RA 3N2IA 4PXAA 3PJRA 2WVJA 1UM8A 3GJ6A 1Z3IX 1CBUA 1E2GA 4P3YA 1NNEA 2XX3A 1IBRA 1GDDA 2NTYC 3GEHA 1YKSA 2OFWA 4F4JA 1D2MA 1EG7A 3V4FA 1Q12A 3PFIA 3W5IA 2REXB 5HKKA 4PC7A 1W36C 5DLQC 2JLWA 4OQLA 3ZDQA 4B44A 2Z5FA 3SHWA 4E09A 3FFBA 1MABB 2B92A 4OI4A 4D0LB 3KFVA 3DMNA 4E03A 2FSIA 4TMTA 1JR3E 4IDNA 4A6XA 4BFUA 1S8FA 4F4CA 2FH5B 4C0JA 2QBYA 2GXUA 4PPFA 1VECA 4PO1A 3LXXA 4D26A 1XEFA 4OKSA 1S4QA 1NBMA 4PSKA 3TUIC 4C30A 2CL0X 4N0EA 4E22A 5EE3A 3A1UA 3MCAA 3AUXA 1VHLA 4XVRA 3T15A 3QQ5A 1N6OA 4DB2A 5KTYA 5JMTA 1COWD 2Q9CA 2FSGA 3LVQE 1II9A 2RGNC 3TSZA 5BN5A 3A1WA 5HE9A 2ZRCA 4BFVA 4DLUA 4WZBE 3UG6A 2CHQA 3EIEA 4HB0A 4ACAA 3K9GA 1E1RA 1WBBA 2VIIA 4JLAA 3F0TA 5AJVB 1OB5A 1FP6A 2IC5A 1JPNA 5JZVA 2PZGA 5BW8A 4DDUA 4U5XA 4CYMA 3MGCA 5D3MB 4AK9A 1P7CA 4WIAA 3THXB 3KKOA 4EFLA 3PCRB 4DLSA 4I99A 2WAXA 4KCGA 2BBSA 4QGAA 3KUDA 3A4NA 2FF7A 4C0LA 2HF9A 3VNUA 3BE4A 5CB6A 3NBXX 4Q66C 4B3CA 4NYIR 3D6TB 1D9ZA 1FPMA 4DCNA 1G3QA 221PA 1E32A 4M0LA 5DISB 3Q7PA 1ZNYA 4L9WA 3VU9B 4WA7A 2WJVA 2V6IA 4B3GA 1E2QA 4F92B 5D3QA 2BJVA 2VP0A 4TQAA 3W9YA 1P2SA 2YWFA 3NIBA 5FL7A 4D80A 2NO1A 2V54A 4B33A 2NPIA 1E79D 2QROA 5LD2B 2GF9A 4XVUA 2HF8A 4EPYA 4C0BA 3FHOA 1J70A 2HJVA 2WOJA 3DMDA 5KPDA 4TMKA 2BKEA 2GKSA 4PAOA 3KQKA 2W2TA 3MJHA 2ZSBA 5EUQB 5AUNB 2AR7A 2PMKA 4KHZA 1G17A 1TUIA 2J3EA 4G5RA 4WVFA 3PENA 2RGAA 4ZKEA 4JL5A 2GVDC 5KO2A 2CJWA 2VHCA 3B1ZA 3L0PA 4NYIQ 2WIBA 5E7MA 4CEHA 1K5GA 4DLRA 1H8EA 1VHTA 1XTIA 3GCGA 3DM5A 1AKEA 3R20A 3O8DA 4NCKA 1BYUA 3P1JA 2QSYA 5HR5A 4RCZA 2O52A 2BMFA 1KO4A 4RFSB 1TQ2A 1G4AE 4QHYA 4BFWA 5J47A 2WWYA 1LFDB 2BCJQ 4JBYA 5IK2A 2JDIA 2XZOA 1UDXA 1VCOA 2C77A 1FL9A 3QNUA 3R7WB 3TAHA 5FUWA 3BD9A 1Q57A 2J1LA 2BV3A 4Q00A 2WICA 1ZCAA 1E6CA 4AIIA 1F2TA 1GOTA 1N6IA 2H18A 4M9ZA 3LWNA 5DH9A 2AHOA 1J90A 2GAAA 2QPAA 2QBYB 1W7AA 4TTQA 2EYQA 4TN1A 4LJYA 4ITRC 4GFDA 1XF9A 3EZ2A 3W34A 1LW7A 1ZUNB 3G5UA 2QY9A 1ZM2A 4OI2A 4IOJA 1X1RA 5F3WB 1R8QA 5EXSA 1CR1A 5EE0A 3CX7A 1U90A 2YOHA 2O8CA 5JEEA 4MA4A 4BRUA 1EFTA 2O0HA 5HZKA 3A4LA 3IHLA 2IS6A 1CULC 1IY2A 2IT1A 3BWDD 3QPVA 1P3JA 2ZANA 1XB2A 1KAGA 4IOLA 2GRJA 4H9GA 1ZD1A 4FXPA 1ZNXA 1IY0A 4LGMA 2JA1A 4D82A 1EFRA 3G82C 5KOYA 3SBDA 1UKYA 5FTLA 3AVYA 3RWOA 1Y3AA 4F38A 3VX3A 4NBSA 3E70C 4D4LA 4PHGA 1QHIA 2ZRKA 1P62B 1NIPA 1E1QA 3M6AA 4WAUA 5L8VA 2GJSA 3HPQA 2XXAA 1AK2A 4QBIA 2EWVA 1G1MA 3EIQA 2D7DA 1CIPA 5KYKA 4GOJA 1I2MA 4OHVA 4M4SA 4X8LA 4XTCS 4PQYA 2ODEA 2IX3A 4KODA 4LJ5A 4EQ6A 5JEDA 1L7VC 1S3SA 4XJXA 4NZYA 1NY6A 1TX4B 3GEIA 3LD9A 3WMEA 3BH0A 4MRNA 3I73A 1XPRA 4PZLA 3WP1B 3B9QA 3GEEA 1W2GA 3CF0A 4U02A 3GJ7A 1Z6YA 2BKUA 2VP4A 3IBGA 3WNDA 1OF1A 1UF9A 2QQEA 5LPNA 1MV5A 5GJBA 2ZYWX 3CM0A 1WA5A 4OJQA 1YE8A 2C98A 5DE3A 5CYPA 1XEWY 2X2FA 4B32A 1P75A 2CJWB 4B75A 2JLZA 3AVVA 1LVGA 4YMUA 3CWZA 3W3AA 3X1ZA 3ZZ0A 1IOZA 2QMUA 1GNRA 2I4IA 1SVSA 3DKVA 3WBJA 2MSDB 2WKRA 1R5NA 1ZM7A 5KSYA 4IFBA 3SN6A 4HB4A 3K70D 1I2DA 1V43A 1GVNB 4FI3C 2XOKA 2GCOB 3B1YA 1D2NA 3OEED 4OBEA 1Q20A 4A8JA 1NL3A 1DPFA 1OYYA 1G7CA 1LNZA 1N6KA 4W5HA 5DNYB 4Q9JA 3ECCA 3FKQA 1EESA 3E2IA 1J99A 4PQFA 3U3OA 3LY5A 2BBTA 2ZM5A 2SHKA 1F2TB 2H1LA 4MYCA 4GOXA 3FDIA 2ZRHA 5CLLA 2P6UA 2BEJA 4YXWA 3AB3A 1DVRA 3C15C 5CM9C 4DIEA 3NXSA 3U3KA 5IF9A 4P4SA 3VR6A 5IT5A 4WZ6A 5H8WA 1YR8A 4B3XA 4R2HA 3TH5A 4BLSA 3VFDA 1GNQA 1Z0JA 1XEXA 2FFBA 4OQNA 1IQPA 3BJIC 5C18A 2MSEB 4UXJA 2WJHA 1A82A 2YHSA 4WXRA 3SU8A 4CRWB 3RS4A 3OEHD 2LCFA 3THWA 1E96A 2OUKA 1II0A 1W49A 4C0AC 3IQWA 4EAQA 2OESA 2ZRIA 2FZ4A 1NP6A 2YWEA 3CB4A 4D25A 2FE4A 3OHMA 4E07A 1G3IA 5F9FA 3TRFA 4PPGA 2O0JA 4JVMA 3CNLA 5DI3A 5H70A 2NOAA 3RS3A 1W0KA 3L0OA 3A1TA 1GL6A 3I72A 1RZ3A 2VSXA 1N5JA 1N0WA 5KU1A 3GQBA 3TE6A 4BLQA 1XPUA 1Q3HA 2ZRBA 3QKSA 3EXAA 4JLNA 4EPWA 3ZLJA 1E94E 3RABA 4PSAA 2GJKA 3SJCA 4LJ7A 1SKYE 4TL9A 4ZO4A 1VDZA 5DHFA 4D0GA 1W4BA 2AD5A 4GI7A 4QJ5A 1MR3F 2DFLA 4OI0A 1SULA 1DAEA 1VCNA 5JECA 4HUQB 2JJ1A 1IJFA 1ZC3A 1QVRA 2VRWA 4JIMA 3SQWA 3TMKA 1ZYUA 1Z0DA 4LBVA 4DVGA 4D6PA 1R0ZA 4P4UA 4DDWA 1TQDA 2FA9A 2FPLA 2IXGA 2MSCB 5GADl 1Z8FA 2QMHA 2VSFA 4FCVA 4HB3A 1KJZA 2A5DA 1ZW6A 1Z83A 2EW1A 4NCIA 2H17A 4Q47A 3SR0A 5AUPB 1AS0A 2MMCA 1HE8B 3BFKA 3LRPA 3AKEA 1JJ7A 1NVWQ 4M9SA 3U3MA 1E69A 3PQCA 1GFIA 2A78A 1ZNWA 3WYAA 2HLDA 1R6BX 3RDPA 1NF3A 2FSFA 4HLDA 4JBWA 4BUJA 3C4JA 3DO6A 4MRPA 3ZJYA 3B60A 1AZTA 1NVVR 4UNPA 1JB1A 2GETA 1U9IC 1OSNA 3DZDA 1VYUA 3CF6R 3U7GA 3BH7A 1IN6A 1QVAA 4LPKA 4M8NE 1G64A 3B8HA 1JEDA 4LJ6A 5HTKA 4CT5A 1Z2CA 4HDOB 3V9PA 4DCVA 4ZIRB 3HDTA 3B1XA 5DSZA 3I32A 1MRNA 1YQTA 2F3TA 5EQTA 4Q21A 2W6JA 3DOFA 3CPHA 1DARA 4HAWA 1OT3A 3TW8B 2NG1A 4IXMA 4EFMA 5K8LA 1XJQA 1GG2A 3JVVA 1H65A 2ZETA 4E5UA 4TLAA 2QM7A 3ND9A 4F7WA 4MRVA 3QI2A 1ZRHA 2PLRA 1OV4A 2JLUA 1N6RA 3KX2A 4TMZA 2ZRFA 3PEVA 4HAUA 4YONB 4DLZA 5FOSA 1U0JA 5DN6A 2ZJ5A 2OV2A 2ZUCA 4BRWA 2BVNA 1NVVQ 1E0SA 4LCBA 1KNQA 3RNLA 1SXJA 1DAGA 4CW7A 4URYR 3EARA 5CIWA 2ATXA 5FPYA 3PUXA 4A9AA 4MKHA 1ZJ6A 5EZ5A 1ZBDA 4B35A 2DB3A 4DCTA 2H57A 4QFMA 2YZ2A 3AV0B 1UAAA 2X2EA 2ZRAA 3PR1A 2FJUA 3QJYA 5DI3B 1G21E 2IS1A 2IHBA 1KAOA 4JJKA 2ZU0C 3QEOA 4TYPA 4JMPA 1HUQA 4HZUA 3K0EA 3T1QA 4D81A 3U44A 1SKYB 2HEIA 3R8CA 2Q6TA 4D4JA 1OB2A 3KJEA 2GZAA 3AKCA 4KITB 1Z6AA 2ZI9A 3TLXA 4TYNA 4S35A 4Q4HB 4B71A 3K0FA 3OIUA 4OQXA 4CZ2A 5L3QA 2C03A 4NP6A 1LV7A 5EE9A 4CDGA 3RRZA 4C2UA 5JHHB 1G8GA 1T9HA 1UKEA 3D7MA 3K0SA 2J5XA 4M2LA 4RKEA 1TU3A 2E9SA 4Q5IA 2PBRA 2JGNA 2PZEA 4F4IA 5JCPA 5B2ZA 3GLIE 1XPOA 3X1WA 2C9YA 1DAIA 3FHCB 3I4LA 2F1JA 1EWQA 1VYTA 4KU4A 5AJWA 2BMDA 3W8RA 2B7CA 4LC0A 1U0HC 3CZPA 3GLFE 2QMEA 2WPDA 4G01B 4HB2A 1M7BA 1HYQA 1OKKD 4Q7MB 2ONJA 3WMGA 2CL6X 5EP3A 4PC6A 2ZE7A 5IRCD 4CEJB 3RSLA 4B76A 3VR5A 1U8ZA 2IYUA 5CIQA 4BLOA 2OBLA 1QHHA 2RGCA 1ODFA 2A30A 1FX0A 3N5CA 4NYMR 2J46A 4X8MA 1QZXA 2IYTA 4A0FA 3R9WA 1A5TA 3ICQB 2DHRA 4PZYA 1W4AA 4BLPA 4LYAA 2QM8A 1RRFA 4GZLA 1RC8A 2PH1A 2F1HA 1OH6A 2V3CC 1AN0A 4MITA 1Z63A 1YZTA 4HAVA 4A92A 1E3MA 4DKXA 2GXAA 1KIMA 2Q3HA 1G5RA 1RW4A 3AVWA 3ZQJA 1R8SA 2D7CA 1T0HB 3GPLA 2HUPA 2RHDA 3U7HB 4BLRA 2EFGA 2OT3B 3RC8A 4G3XA 1DO2A 3EZ7A 3ZZTA 3LX5A 3FMPB 4YQFA 1E0KA 2ZE5A 3CPJB 4M1OA 1XD8A 1YJ5A 4LHVA 1CJMA 2ZSDA 2OXRA 3A36A 4NYMQ 4Q1EA 4UJ3A 4ASUD 2JLSA 5BYKA 4PAMA 3U7FB 1BKDR 3ZD6A 4DWJA 1YVDA 2QAGC 4DUGA 2BEKA 1SQ5A 4GZMA 4F93B 2YKGA 4PPNA 1FW6A 2GNOA 3QE0A 4HDQB 3ADBA 1PZNA 1NLZA 4BPBA 4GMXA 5FOUA 1NN1A 1OIXA 4G0NA 3FFAA 4FMCB 3B6EA 3HP1A 4ESVA 1II8B 3B1WA 1NMZA 1G8HA 4MRSA 4KBGA 4B47A 3THXA 4CVNA 2GF0A 1XMJA 3CLVA 4QJ3A 3IHWA 4FMBB 1G6HA 3U44B 2AKYA 1NIJA 4LX0A 1IONA 2O8EB 2HCBA 3WHLA 4EUNA 1VPLA 4Q9LA 3K09C 4PC3A 2D3WA 2DWPA 2A3RA 4D4KA 5L3QB 3K1JA 4LK2A 2Q0HA 4WXPA 3VU9A 1YRAA 3A1VA 5AJYA 1JECA 3CPEA 5H68A 5EXXA 1ZU4A 5E7IA 1A2KC 4GRAA 4MRRA 3WHKA 3C14C 3GLFB 2ZPTX 1ZAKA 1P4SA 1R5OA 1TF2A 2NQ2C 4TMVA 4B3FX 2IYWA 2GJAA 3B5JA 3PIRA 3QXJA 2QTVB 3K0CA 3AVUA 1GL7A 2OCYC 1JR6A 3I61A 2OFOA 4XD7A 4MGKR 2BMJA 4IKEA 3REGA 1MO3A 4JYBA 1G4UR 2QAJA 4IEEA 1ANKA 4Q4JB 1ZINA 4HZIA 2ZRMA 3T06B 3U4QB 2ZRJA 4DXAA 3CBQA 1XX6A 1QHHB 4WBSA 5LB4A 4KXFB 2R44A 3BBPA 4GT1A 1U8YA 1Z29A 4Z1MA 3CRQA 2D4HA 4R2IA 5HKKD 5FBWB 3QF4A 2CE7A 3KKMA 2FEOA 2WWWA 2FOLA 4RFSA 4Q4LA 1GNPA 5SZHB 1JR3A 3W6NA 3K0AB 1NSTA 3SHFA 1CJTC 2C99A 1R0WA 1P73A 2V9PA 4WW0A 3B78A 4G5QA 2QP3A 3RVBA 2OM2A 2XAUA 1W48A 3R7WA 4AYTA 2FFAA 2IW3A 3EA5A 3RRNA 4ZV4A 2VF7A 2YNMA 3DVLA 3Q8XB 1BIFA 2ZQ5A 2ERXA 2BOVA 1NBMD 3K09A 4LY6A 4YMWA 5AR1A 4BZXA 3IBYA 2O8BB 3TR5A 2QG6A 1OPXA 4YMTA 2J7KA 4JKIA 1Z5ZA 4M1SA 4A0GA 3WNBA 4V0LA 2XZPA 4FCTA 1DBSA 4FINA 2FG5A 2GTPA 3SYNA 4RD2A 1LF5A 2YVUA 1E9EA 1E1RD 3BH6A 3K9HA 4V03A 3HR7A 2VHUA 3M4YA 2FV8A 5K8UA 1CJKC 3U3RA 3A4MA 1W1WA 2FGKA 1SZPA 2QI9C 5FBQB 3CNNA 1KY3A 4URVR 3JZMA 2E1RA 3GJ5A 2OG2A 2A5FA 4TLDA 4DSNA 4LHXA 4XOIA 2IS2A 1P2TA 1XXHE 3U3JA 4YC7A 3NWJA 4B6FA 5AWFC 3QOFA 1NN3A 4IOKA 2NZJA 1GAJA 1RRGA 3L0SA 4AYWA 1FTSA 1WRBA 4URUR 5L3VA 2CHVA 3I1FA 5GJVC 1X86B 3A37A 3UKDA 1UBGA 3O47A 2P3SA 1W5TA 2JLRA 1EK0A 3FWYA 1DADA 4LOAA 4Y0VA 4ON9A 5EP4A 4Q18A 2IA5A 2ZJ8A 4X8HA 4Q48A 4BEJA 4BEBA 1RYFA 4HEJA 4PPQA 1US8B 1R0XA 3QF7A 4JSTA 2W6IA 3C8UA 2FSHA 2PCJA 4NHOA 2QP4A 4XWOA 2BMEA 2PEZA 5FL7D 3KXIA 3HWSA 3RLFA 2Z4SA 1BS1A 3F8TA 2G83A 2C9OA 2DFNA 2FZLA 3AEZA 1RE0A 5CJ2A 2JJ8A 2AFHE 3B85A 4RFVA 4EPXA 3GJ8A 3UIEA 4UXHA 1QRAA 2EFHB 3I5XA 2OSBA 1JEEA 3NBZC 4PX9A 4AKHA 1RJ9B 4GL2A 3AKYA 3MWJA 1ESNA 4BFSA 1SVKA 2CDNA 1H8ED 1UFQA 5FBVB 3RSOA 4ZDJA 3C16C 2NMVA 3UK6A 3KJHA 2QAGB 2GBLC 2RGNA 4B2LA 2Y8EA 3QEJA 1FZQA 4XIGS 1RRPA 1MH1A 1AGPA 4R7ZA 5IK2D 3Q85A 4KLZA 2JDID 3EWAA 3K9NA 5F2EA 1X3SA 2V7QA 3QF4B 3SOPA 1TPZA 1TNDA 3L2OB 1JAIA 3DM9B 2Z4RA 4M1YA 2BC9A 2LKCA 3CW2A 1W5SA 1OFHA 3NHAA 2GCOA 3TGPA 1E0AA 2MMGA 3VHXA 1VCIA 3QXHA 2G77B 2H16A 3BFVA 3KFXA 3W90A 1CS4C 3HPRA 3SJBA 4TQ9A 3I8XA 4L5BA 4Q19A 1KZGB 4MYTA 2YWHA 2WMOB 2GZHA 3BS4A 4PHFA 4EDHA 3U2QA 4G1UC 2C8VA 2QP9X 4C3ZA 1YR6A 3LA6A 2RHMA 1FUKA 2QRNA 2ASEA 1GZSA 3EAQA 721PA 1NJFA 1KHTA 3LFUA 4TSFA 4LC1A 5CB8A 1KK2A 2ZAOA 4DSOA 5A5GA 5CK4A 5IHPA 2VSOA 1SKQA 2B8WA 3PEWA 1E9DA 1NI3A 2V8OA 3EASA 2DFKB 4LJ9A 4ARZB 1J8YF 1ZD8A 1R4AA 3THYB 1S1CA 1XBTA 3TVDA 2GCPA 2ZS8A 2VYFA 4X8OA 2QNRA 2A5JA 3Q5EA 1WP9A 2J9RA 1JAHA 1XTQA 4DBLC 1T3SA 4LDJA 1KGDA 4AKGA 1Q44A 1NKSA 3EA0A 3CUEF 3IILA 4BGDA 2GBLA 5J40A 5CDFE 1FMJA 4EJSC 2ZSEA 2ZR0A 2JIZA 1E1QD 3TSOA 3T1OA 2DBYA 1CU1A 4II7A 4NCNA 5FTKA 4A82A 2IWRA 5FBRB 4AC9A 1PUIA 1QDEA 3AF4A 2WSMA 4B34A 2BWJA 3KDSE 4Z51A 2J87A 3SFZA 1GUAA 4N1AA 4UXIA 4OHWA 1T8TA 3AVOA 1ZCBA 4AY2A 1W36B 2ODNA 1Z08A 4YLGA 2XB2A 2QMOA 2GHIA 2PX3A 3AM1A 3U61B 2WJJA 3OFNA 4DDTA 1TAGA 1NN5A 4HUQA 2WIAA 1ZP6A 2AWNA 4US2R 4TZ0A 3KQHA 2QSZA 1VCMA 3AVTA 1O3YA 3ZS8A 1VIYA 3K70C 1HTWA 5KSOA 2WWGA 4MGIR 2CNWA 1XTKA 2W2VA 5AK0A 1E2IA 4BZQA 5BXQC 2CCKA 3D3QA 2CVFA 1HQYE 4JZKA 4L4UA 4QBGB 3AP3A 5HE8A 5KPJA 1E2LA 4FMDB 2VP6A 1M6NA 4IHQA 1OXXK 3BRWD 1G16A 4CF7A 2X8AA 2ZUBA 1QHNA 1M8PA 2ORIA 3UXMA 1DOAA 4DEXA 3EZ9A 3IIJA 3IO3A 1MO6A 1E98A 2OHFA 2PT5A 5AUQA 2XOKD 1RRCA 2ZI7A 2XZLA 1BMFA 1E4VA 5G3ZA 2ZROA 5CYOA 5FBLB 2ANCA 4KVAA 5G3YA 3GJ4A 3SZRA 3CRRA 1HA3A 1UBFA 2WWHA 3UMFA 3PXGA 4TT3A 3CKLA 2IK8A 4W5JA 3RS7A 1XRJA 4LBWA 1DO0A 4QBHA 1KMHB 2UZ3A 2RMKA 4IOMA 3ZD7A 2NO6A 3WRYC 4YXWD 4RD1A 1FTNA 1E0JA 4ZIRA 1N5KA 3VKGA 1IXRC 3ND8A 4BE7B 1W0JA 1E2HA 2QN6A 1X8KA 1DEKA 4TL7A 3GMTA 1FOEB 2WWFA 3HU2A 1T5LA 2JEOA 1S1MA 4Q1DA 2P6RA 3LV8A 5FPHA 3VHLB 3FKSA 1F60A 5CLQA 3WYGA 3KXKA 3EW9A 2W2XA 3GLGA 3QSYA 3VTKA 4XSGA 3T5GA 4QGHA 4AG5A 1XMIA 5JCZA 4GP6A 1DG1G 3F5FA 5JWHA 4O3MA 1V5WA 2YINC 5AJZA 2IYQA 5FFMA 4A1FA 5JLJA 3VNVA 4EIWA 2YC2C 4M53A 3EG5A 1SVMA 2F6RA 4US0R 1P9WA 1UJ2A 2HYDA 3QVUA 2W58A 4I1VA 1EWRA 3QUSA 5FTNA 5BQ5A 3X2SA 1G291 3O8CA 3QBVA 1R5BA 1I4TD 3GLGE 5JRJA 5DI9A 3PEUA 121PA 1W0KD 4NCHA 1ZU5A 3VR1A 1KDPA 3MUFA 2GA8A 4DLTA 4FWTA 3ZVNA 4HLUC 1SVLA 3LQRA 5F9HA 3ETLA 2NO9A 2RGBA 3EWSA 1DAFA 5L3SA 1YRBA 2Z0MA 1OW3B 1EGAA 4HAYA 2OXCA 3I5YA 4AYXA 3MMPA 3RYTC 1CRQA 2DWOA 4Q4HA 4LRWA 2UVQA 1Q0UA 5C1BA 3L82B 3SBEA 1GKYA 2JJ1D 3GJ3A 1O87A 1P72A 5H1YA 1OJLA 3CNOA 4C7OA 4QJ4A 5G40A 3X1XA 3PUVA 2W0SA 2C95A 4JL8A 4KSCA 5EZ6B 1W4CA 2G0NA 1JJVA 1IJEA 5TB5A 3AKDA 3QKUA 5TV2A 1IN4A 4ZDWA 1KSHA 1XDBA 3LNCA 4KFRA 2KJQA 4JVSB 3MLEA 1P9RA 2AX4A 3GLHE 3IEUA 3M1IA 5JWRA 2R62A 1KDRA 4KVGA 4U00A 2QPOA 4Z54A 1BYIA 2GVZC 2Q3FA 4IDQA 1ZM9A 4JLMA 2IUUA 4CEJA 1JI0A 1NKTA 2HLDD 5E3HA 2JCSA 1JXOA 1XU4A 4FCWA 1GM5A 3ZVRA 3TUJC 4BWYA 1YZQA 1G7RA 3QY0A 1XEWX 4JKYA 1AQYA 1E9CA 1XZQA 2F1IA 4IDPA 1G5TA 2ZI3A 2C5LA 3TKLA 1RYHA 2D06A 3PUYA 3QENA 2ZRPA 1TMKA 3PITA 4WOPA 2WJGA 1F48A 1OFTA 1E2DA 1U99A 2DYKA 3G0HA 3DPUA 4YMSA 1D5CA 2J0VA 3REFA 2FEMA 2W6JD 4PSVA 4TLBA 2QZ4A 1OLOA 4RSGA 2YYZA 3MFYA 3ZYCA 3QKRA 3BB4A 5KNDA 1X6VA 5GJCA 2W00A 2ZJ2A 2GK6A 4JLBA 3ASYA 5EP1A 3MJRA 1NRJB 4UQOA 4AI6A 1ZM4A 2ZJYA 3EZFA 2P5SA 1GTVA 1QHGA 1M34E 5DN6D 1GRQA 4LZZA 2CEAA 2OCPA 3OIYA 3P27A 3OIVA 2RKOA 2FN4A 3L8ZA 3GLGB 1SXJD 1ELOA 2G6BA 2KWIA 2XTMA 3A6PC 3NDPA 5AJXA 3K70B 4DIDA 5FH9A 2QPTA 2EQBA 3UWKA 4I4LA 1IM2A 3LBHA 5LDDC 3NTUA 5EE5B 5FR1A 5TVKA 2QUZA 1II8A 1AKYA 4PC2A 3ONWA 1XCGB 1KDTA 4HUTA 1M74A 4PTLA 2ECKA 2R6FA 2QL6A 1IN7A 3WBKA 2XNDA 3IGFA 4FN5A 5L3SB 4QHSA 3SC3A 2PZFA 1P6XA 4EPRA 4P0TA 4TTPA 5JJKA 4MQBA 3TBKA 2GESA 2RGXA 3SDZA 1DAMA 5JBQA 1XJCA 2AK3A 2I1VB 3IKJA 1E9AA 4C0KA 4V0NA 2O8EA 421PA 2VBCA 4XH9B 1Z6XA 1NMYA 1XWIA 3NG1A 3SJZA 1H8HA 2FGJA 3GLIA 1U9IA 2W83A 3A58B 1XP8A 1OFIA 3NH6A 2ZITA 4IFEA 5FL3A 3QPUA 4C7OB 4IVRA 3P32A 1KOFA 4J0QA 1ZUIA 1IAQA 1KDOA 2KBEA 2NO0A 1E9RA 3GLHB 4Q1BA 3ZGXA 3GLFA 3IDQA 1N6HA 2YOGA 521PA 1G3UA 3HYTA 4A4DA 2J7PA 1F2UA 2ZSAA 3I3SR 2V6JA 2WPDD 2GCNA 3BERA 2CMKA 1HEIA 2WSSA 2F9MA 1OIWA 2R65A 3VKHA 2F3RA 2J45A 4A2QA 3O8BA 2DR3A 3Q9LA 1NMXA 4RZXA 1LF0A 2ONKA 3I92A 1KJWA 2H92A 2O0KA 4LV5B 5G53C 3UWOA 4N3NA 1TEVA 4QM6A 4IVQA 1CJVC 4G5OA 2V1XA 5B64A 3KKPA 3U6BA 3LW7A 3ZIAA 5J4VA 1VG8A 1XCMA 4Q4JA 2FNAA 3U4QA 2QRZA 3JVUA 5EJEA
chains in the Genus database with same CATH superfamily
2OO7A 2R5NA 3T34A 1SCUA 4HTAA 4W8OA 3NT5A 5EXPA 1G42A 1Y82A 1YOBA 2FZ5A 2PL3A 2XLBA 3LUPA 2ODBA 4Y6RA 3SBXA 3DC7A 3TZ6A 4UPEA 5BSGA 2GILA 3KVNA 1S0UA 5C2JB 1KYYA 4Y0AA 4BO9A 2D1RA 2YR0A 4WGFA 2KBFA 4FOTA 4MR7B 4RD6A 1NXSA 3JALB 5ARDA 5SYAA 4GXRA 3HCNA 3OLCX 1KI3A 4P2BA 5BT9A 4C88A 1FCJA 4HP8A 2WU4A 2ZRGA 1IZ7A 1XZAA 2J6IA 2WA2A 4LC9A 4YAFA 4BECA 1MC8A 5IG2A 1L3BA 4QYMA 3OESA 2ZWAA 1YE3A 1C2TA 3QG5A 4HAIA 5FTMA 1ZIYA 2Q5QA 1SZDA 1A5ZA 4KBFA 2WTNA 2WWRA 1SUSA 2B5OA 2IIBA 3B9PA 2XADA 5H7XA 4ZK6A 4V0ME 4DUZB 1MVOA 1T3LA 3WLQA 1GCAA 5CNJA 1S3IA 3ACBA 4KMOA 1C41A 2A7QA 4EVQA 2QT1A 4Q93A 2B5VA 4ZCMA 1R1DA 2IYNA 2QU7A 3HB7A 4BWFB 1TM7E 2WMDA 3JWPA 4J76A 5TARA 2YIMA 4ZC8A 1Q1QA 2B4QA 3RUFA 3SSOA 1U3VA 4B80A 4C4YA 4DUGD 1E0AA 5MGNA 4LYJA 2K5UA 4W5TA 4MV4A 1GGNA 1XVLA 4MLPA 3ZD9A 4KREA 4Y3UA 3RLIA 2V7WA 5J59A 1HY3A 4GBJA 3LJKA 1Z16A 3WGQA 1X2EA 3O03A 3NEJA 3C8MA 4HHEA 3W79A 5K2OA 3DFUA 3KQNA 3D6VA 1ZKMA 3NLLA 4OUKX 3TNFA 4DDKA 2AN3A 1X92A 5K0FA 3V2HA 5B57C 2PQ0A 5C31A 2EKBA 2PUEA 3K4PA 2FQWA 3ZY2A 3LC1O 1NLYA 2BHRA 4MGYR 1QHXA 1ZH2A 5AHWA 4HNAB 4M83A 2IXDA 2WD8A 4MV0A 1JIIA 5CFNA 2ZCUA 4TLLB 1U98A 1UM9B 1TO6A 1U7XA 5J5AA 3FSGD 2X19A 3VAZA 3DHWC 4MCHA 4DWOA 1VPVA 5CFRA 1CUSA 1DTWA 5F76A 4J0HA 2ODQA 1G18A 4AW9A 4ZEXA 3ZDFA 3OA2A 1H9BA 4EB6B 3OZCA 3EDOA 1VB3A 4R54A 3Q3EA 2Z5LA 3A27A 3AI2A 2GEFA 3SQOA 1FYDA 3F2IA 3ZV4A 1C0EA 4R1MA 3GLIB 4I55B 4DG8A 4MW4A 4UNNA 5EPOA 3UK7A 4OH1A 1RJEA 3G68A 5CK5A 2ENWA 1O57A 2AV6A 4KUEA 1R9JA 2O1WA 1E20A 4W4TA 5E7JA 2F17A 2W37A 3D8BA 3OFJA 1I10A 4EMTA 1HURA 4QGSA 1A9PA 1F2UB 1K7XB 3JQAD 4OLAA 3NX4A 2OFXA 1CJUC 2FPXA 1KI9A 5IASA 2A9RA 4V02A 5EKTA 3UJDA 1N9KA 4YUAA 1VJRA 5EGSA 1E2PA 1QS0A 3D3JA 5I7UA 5JBIA 4OGKA 4D2IA 1Z12A 3WP0A 3QV1A 2RH5A 3LQQA 1ZIDA 1ZZEA 1XZLA 3GFOA 5HIMA 1VXRA 3KHTA 4HZGA 4H7DA 3RTDA 1J0DA 1U2PA 5IAEA 4DY6A 3SZMA 1G98A 3GD5A 4JLSA 4RTNA 3U62A 2V55B 1S01A 1ADYA 2G0TA 5HCIA 3IIEA 2UZ4A 4RVDA 1NASA 5E9JA 3DBLB 1ZGHA 5B1HA 5IEJA 2OILA 2CK3A 2FEKA 2W6PA 1OE0A 3FVTA 1U7DA 2OV4A 3LP8A 4ZKDA 4BJ1A 5EIOA 2BGLA 1JR3D 2Q7XA 2WWIA 3DKIA 2AEJA 2QYSA 3VH3A 2YW2A 2NADA 2OUIA 2QRVB 2WYUA 3OAAA 2WUVA 4X1IA 1DUSA 3BMOA 1WX1A 3ZHVA 5JROA 3MJ4A 4YAWA 5DIFA 4GQAA 1N0UA 1IAVA 4DQXA 1GPDG 4JQZA 4O4IF 1HZZA 3LXMA 2HTFA 1H3NA 3EDYA 4PTYA 4XE5A 3VRHA 4NENB 3MWDB 5KJCA 3COYA 1T91A 4OXKA 3GROA 3WMXA 5JS8A 4CR8A 2FWMX 4JXJA 2AFIE 4JFRA 4J94A 4JBGA 1I0IA 1HBJA 3PFNA 3I1YA 1XUOA 3AF2A 2OQVA 5ALGA 4POOA 3M82A 1KI1A 2JFOA 1UK7A 3U7JA 3QG1A 1YB6A 5BW6B 1D6NA 3S8MA 1J2JA 1SA0B 5EJFA 4H7FA 4D9JA 1RQNA 2PGDA 2HSZA 1K3TA 4R9UC 4ZN6A 4I4TA 1L5SA 2NNWB 4UHEA 3IAEA 4D8UA 4K8OA 3SC2B 1GSAA 4JH0A 3RNOA 5FNZA 2AK2A 2QTFA 1A8HA 2YX1A 3FY4A 2M6SA 1O8CA 3BK7A 3HN2A 3BB1A 1LY1A 3N2NA 3QPCA 4FBGA 2DPMA 1G66A 3NB0A 4Q9KA 1PKEA 3LLVA 5KHOC 3CF2A 2K87A 4YV7A 4OHYA 3HYSA 4B40A 5A1JA 3AW8A 3D0OA 1CYEA 3C3AA 3L4EA 3AY3A 3AILA 1VHQA 4MIOA 4O4HB 4RVOA 3RTBA 4B5KA 3PKIA 1M9NA 1KIAA 1VLQA 3EVNA 1EBFA 1BCSA 1UBJS 2F3UA 4MROA 1GGHA 1N8TA 3JQRA 2BGMA 5L4SA 3GLTA 2JG3A 1D8AA 2PMDA 1HLDA 2YASA 4NRDA 1Z6TA 4M86A 2M6KA 3ETCA 1KZ7B 1YFLA 4FSDA 2RC6A 4E5YA 4AL4A 2QTNA 2XNSA 2IYFA 1KI7A 2NO4A 3ZWXA 3WGIA 4BNZA 4I7EA 4QVGA 1NYLA 4BP8A 2QUAA 4ZYXA 2JGKA 3OZRA 3R5FA 3CRW1 4U9IS 3ZV5A 2VJPA 3T1TA 3CX6A 4S3MA 2IJGX 2X3UA 3NIFB 2ZTVA 1NBME 3K1TA 4XDGA 4YQZA 1QKKA 3FYTA 2PJUA 4LWOA 5ERXA 3S55A 1VJ0A 3HS3A 2AUTA 4YAGA 2AFHA 1WMFA 4F6RB 2CV2A 1JXQA 1KZ1A 1KI4A 1I1NA 1MO4A 4EO9A 3VX4A 1EQ2A 3V4OA 2BD0A 1TJNA 1FFXA 1XKTA 3KXLA 3R76A 1LNQA 1SHKA 1G9SA 2E1PA 2ISSD 2WKSA 3M0EA 2NAFA 3PE6A 4I1RA 4UW9A 3G2LA 5EWJB 5IYZA 3UHOA 5LP6B 2NSHA 2DY0A 3DE0X 4MB0A 2EX1A 2B30A 4I2NA 5L95A 1ISMA 4FFVA 2IZ7A 2WT4A 4RVNA 2C78A 3AHDA 3A9RA 4INJA 4H6VA 1ZHOA 1DUVG 3W1EA 1UBTS 5DYGA 4EDFA 4Q7EA 1AU9A 4MWGA 3E8MA 2EBUA 3B3FA 4UTNA 3WZMA 3IEMA 1NF9A 1W46A 3N70A 1YF3A 5B3LA 1D5WA 2CNNA 2E3JA 4GLLA 1LS1A 3RANA 1JQLB 4DJJA 4DDVA 1QH8A 1P1BA 4LWZA 5EGNA 1T9GS 3GZJA 3DMHA 1VL6A 4XPIB 2JJYA 3C6ZA 1GG5A 3VPBA 4PEVA 4WX2B 1LSSA 4MDEA 4NE9A 1FZTA 3ECSA 4QXQA 4JNCA 3HA2A 2BR5A 4MQEA 2W2MA 3W9UA 4N5LA 4HYQA 4N0DA 4U8HA 1KYZA 4P93A 2J31A 4G4GA 3RU2A 1N2GA 2HT1A 3RCBA 2PQ2A 1O58A 1C3OA 1Y37A 2QTGA 3CRVA 2FB9A 1KO8A 2PWAA 2GBFA 3KYJB 3GFGA 5CT9A 2AOUB 4DA4A 1X70A 2FXVA 2V9CA 1KMHA 3DVRX 3GGPA 4RD3A 3LBIA 3N8DA 3UAZA 1JZQA 3ODGA 3MS2A 2C9CA 4JLVA 4NQRA 3PXCX 2AVNA 4ZRDA 2CCJA 5GAJA 4WA8A 3WLAA 4Q4CA 5E9WA 4I2VA 3QIAA 1QF9A 2P78A 5BRJA 4MPPA 4MW7A 3HZRA 5FR2A 1QG4A 1ZM3A 4OI1A 1R4NA 4EBBA 3ZZMA 5BNFA 1M1YE 4B3IA 4ARCA 3LWZA 4E08A 3E18A 5C4MA 5H5JA 2WYHA 4R98A 3SHVA 1Z06A 1XHLA 2H7VA 3KSBC 1FRVA 2WE8A 3KOXA 4K81B 3ADOA 3U0BA 2ACVA 3BHMA 1E4YA 1RQLA 2O05A 4YP1A 1SQFA 2A2ZA 3LX6A 4EA6A 1K08A 2J9YB 5ICSA 5A4IS 4TXLA 3INTA 3OQIA 2QR3A 3SS8A 4EHIA 3HO1A 3AMVA 2BJHA 4QDUA 4MV8A 4Y2SA 2ZXUA 4FYYA 3RVKA 1FNNA 1BMTA 2A1UB 2VH5R 2H54A 4NAVA 4P81A 4UDNA 1U0EA 1CFZA 1R4MB 3JYPA 3Q40A 4PANA 3AONB 5C1IA 1G3MA 5AUOB 4P84A 1K88A 5DIZA 1PR2A 2ZWOA 2GZDA 1W6UA 4N5IX 3AXSA 1A2BA 2QTAA 5ESXA 3C85A 4F8JA 3L04A 4NH4A 1Z0AA 5F3RA 5T4BA 3NFRA 3U56A 3GAMA 2CL7X 4ETMA 5JO0A 5CVVA 1B3BA 1KSJA 4BFZA 2QW1A 2WZCA 3L6OO 4U2KA 4DUPA 2QQGA 1KEZA 1YR3A 5C81A 3V4VB 1E2JA 1CF4A 4DDMA 3QLUA 4WSOA 1OAOA 1RYEA 1L8AA 2AR0A 3IE1A 3RIYA 3RBZA 1TYEB 1GNSA 2WE7A 2YJ5A 3GELA 4K03A 1OU0A 2CNWD 4NMMA 3CH6A 3CEPB 1JQBA 4CEIB 3TRKA 2B82A 3DTYA 3KJZA 3ZS9A 4CDMA 1JSXA 3EB9A 3ZHBA 2NT3A 2N1BA 1SHZA 5HPYB 1PWXA 1L2TA 1U0BB 1T24A 1ECGA 2ZDGA 3B13B 1KMMA 1S89A 4Q3DA 3N87A 3M5PA 3E5MA 5FORA 1ZN8A 1AZSC 1N3BA 2REOA 3ETHA 4UULA 2XAAA 3A3PA 3FZGA 2IU4A 1VCHA 1QZTA 3N7TA 3FUUA 2HV8A 4GX2A 2F3SA 2YVKA 2B36A 3PQ5A 4MWTA 3VTAA 1CE8A 1NRIA 4BASA 3WVNA 4DRXA 5KMGA 3ZDAA 3KOZA 2A94A 1ZSVA 2ZJFA 1QGUB 1K5HA 4R8MA 3RWBA 4WNIA 5KNLA 4U7DA 1VLHA 3CSDA 4D9IA 3DJFA 2WUFA 4QXPA 3HSSA 4ZANA 4OQ4A 2Z58A 2DZDA 3L4BC 3PUWA 5L51A 4UEWA 5KOJB 3AEUA 3PPXA 5H59A 2OYRA 1SCQA 1N5LA 1WR8A 3OJOA 2C7OA 3O1HB 3EC1A 1M67A 1XTJA 1NDQA 1WUJS 1KK0A 1QLHA 1PSWA 3DEKA 2X0RA 3EVCA 5M04A 2IP1A 5ECDA 4ZXPA 2X0EA 2WHPA 3S2SA 3FJYA 2XWJI 3QFSA 1WV1A 2ZCJA 3GMSA 1P4AA 4NE2A 1YTLA 1MJNA 1SU4A 2C3MA 4OX9Y 3EVAA 3PLNA 4CIXA 5ISMA 1KI6B 1T3GA 2PJZA 3EOZA 3H5AA 4X1YA 2WKPA 3C3CA 3JD4A 4YJGA 2V59A 4YYEA 4N5HX 2ZS7A 4PFKA 5G0WA 1GNLA 1WF3A 3IV7A 1LBIA 1QSGA 3BXPA 3WYFA 5EJ7A 1P19A 3FKSD 1ENZA 4KGDA 3H0KA 3SLKA 2ZT5A 5LQNA 4RY9A 1XKQA 1VYVA 3KTAA 4I36A 3OZ7A 4EYSA 1C4OA 3P45A 1DTSA 1G2OA 3QYPA 2A5GA 1ODJA 5LU8A 2G8NA 1LEHA 1PT5A 4QPDA 1AURA 3ILVA 3PR2B 2QMZA 4INPA 4G26A 3IELA 4QM7A 1IC6A 3FOFC 1L1RA 3RADC 1KEPA 1QDLB 2P2SA 2R5FA 3DQPA 3DT9A 1UPFA 3KLMX 2O14A 2P2LA 3VXKA 5JAPA 4O29A 2PG3A 4FSXA 4H7HA 4KSBA 2Z2YA 3F7TA 5UKDA 2FK8A 4LYHA 3H1GA 2AF3C 2EFCB 3STHA 2CXXA 1L7MA 3MRTA 3OLXA 3W3ZB 4LTNA 4RD4A 2QUIA 2ZSIA 3AP2A 5D7BA 2CVHA 5K8IA 4ISCA 1E3EA 1U7HA 1ZX1A 4YAIA 1W30A 4CN9A 3G9UA 1Z56C 3Q3IA 4O5AA 4BJ3A 1C1XB 2RGUA 3AZQA 2R1TA 3BX1A 3TL6A 1CUIA 1HT1E 2VP5A 1OBFO 2P4UA 3L05A 5CVEA 5EVCA 1SC4A 1Z2OX 2R9VA 5A4DA 3WG9A 3LVRE 2CWWA 4X3PA 3U26A 2XNCA 1JH9A 3VAAA 3IQFA 4H31A 1HGXA 4H08A 4ZI2A 2XUAA 3VNBA 2OCGA 4M0MA 3G23A 2E18A 3E35A 4HH3C 1FSZA 4ZAFA 1NQAO 1QU2A 1U4OA 2LWIA 1DZIA 1EXVA 3KALA 1RAEA 3I5AA 2FMUA 1HLPA 1L7QA 2BP7B 3GLHA 2YCBA 3AKZA 4WDRA 1Z0KA 1DRVA 1I6KA 3ENZA 4KPUA 4R16A 5JDCA 3GAZA 4Y1RA 4IJ5A 1CIVA 3ADKA 2ZJOA 1RYDA 3T3DA 4ZHQA 3QE4A 1LI5A 1PEKE 5FEUA 3P5SA 3T7IA 2ONZA 2Y0CA 1VIAA 3WGTA 4BQSA 4FHCA 1Y8CA 3B82A 2Q5JA 3H5VA 1LW6E 3H0EA 1NQ5A 3KSDO 3L7IA 3SFVA 3CNBA 3CY6A 3VTZA 4I81A 4MRAA 3DO8A 5A7FA 5A0VA 4LMAA 3IP5A 8OHMA 1PDWA 1YASA 2HWXA 3NHMA 1QIMA 4CQMD 3U7QB 5KYGA 1HNWB 4KHPB 3P20A 3FYUB 3QXXA 1T1JA 5C7OO 3DVAA 4PINA 2G9RA 2VDKB 5H9VA 4ZVPA 3WYNA 4NHEA 4M7RA 3GHHA 3JTEA 3N0WA 5JC1A 1EUCA 4NZMA 2YXEA 2XYVA 4LQCA 3A9SA 1SXJC 2FUNB 5DRYA 2WA1A 1W52X 3NOQA 1U2GA 1OX4B 1Q3TA 4KR9A 1GSOA 2PX2A 4HLUA 1O95C 4K40A 1P8AA 1VFPA 2QN3A 3VGPA 1U11A 4LBZA 2DETA 1OX6A 4EJSB 2F67A 4ZO9A 1YZKA 3PD0A 3F6BX 3NH9A 1Q1GA 4O2AB 1C2YA 1NJGA 4IICA 3TK1A 2G88A 3WL6A 5CEJA 4KFCA 3RGGA 1TVKB 4M0DA 2CUZA 2QQ0A 2IXEA 3JW8A 1V16A 5TY0A 4EY7A 4XYLA 4W9MC 3FVVA 3UMMA 3IP9A 1ZNZA 3Q7TA 4B6EA 5B5SA 3OFKA 1ZRSA 1QRRA 2HTEA 4KE9A 1TUGA 3A3NA 4AJPA 1C1YA 3OZIA 1KDVA 5JVDB 1R7RA 4DBLE 1K89A 1Q21A 1X8XA 2QTLA 5KDDA 5KVAA 5DNEA 1UINA 2HSWA 4GOOD 2ZB8A 4MJLA 4URFA 2I6XA 4WK6A 4A8JB 1GQQA 5BRAA 1WBDA 4LGYA 2IF0A 4P7BA 1GYQA 2YV5A 4MAFA 1XJ0A 4L6CA 2R751 5F98A 4QG7A 2YHUA 4F6CA 1AS3A 4CTMA 4U4AA 4CWAA 1UH5A 1CRPA 1JP7A 1YJBA 4DCSA 5LNK6 3HHEA 1NXPA 1GO2A 1V39A 2OBYA 3PUZA 2BBWA 1JE1A 1E6MA 2QORA 1NMSA 1N2XA 4JB8A 2IF2A 2QLFA 4KRXA 3S68A 2BHSA 4WCFB 3C5HA 3P9KA 2V4UA 2WZQA 3D7NA 4H1UA 4RKQA 2DHCA 5CB4A 1JQJC 2QIOA 4BN5A 4CKEA 4P7GA 2EFDB 5AMXA 3FHTA 5FI1B 4KAJA 4B2PA 3EXG2 4JZYA 1HFJA 3VQTA 2CT8A 3IPYA 2BGKA 2P68A 4OKNA 3OQ6A 2IV3A 3ZCXA 4F60A 5MN5A 1LTQA 2HJ9A 1VKJA 4TTIA 3SVTA 2ERCA 3JZAA 1SZJG 3OIWA 3ZWWA 3HABA 1WABA 2B61A 3CR3C 3THWB 2VZ0A 3LSTA 2GOYA 1UJNA 1PTJA 2EERA 2ZEJA 3BN3A 5FPTA 5KVSA 2GLTA 1HFWA 2VCYA 2IEZA 1UOQA 1PWEA 4OA5A 1HO3A 4QXAA 1DAKA 1ZOLA 2EFEB 2NXEA 4RKYA 1EX6A 1WIWA 2BR3A 4MVJA 2GK7A 3WMFA 2WSSD 4C7JA 5LYJB 3EEIA 2V5AA 3C5EA 4RH3A 3KSAC 5JXWA 5FOTA 5HM8A 1CUJA 3JATB 4BNVA 2RAPA 2H4YA 2ZYRA 1V2GA 2FSVA 1Z4JA 1DIBA 2RSLA 3BTSA 2WBLC 2C00A 4G0UA 1EVZA 2J0EA 3SHOA 2PS3A 2FQ1A 2OOKA 2BDUA 4YEDA 1KTVA 1LPAB 1J07A 4Q7JB 1EXDA 3WB9A 1FP7A 2E85A 5C0OE 4ACBA 2CXNA 2DM6A 4V2UA 4Y6LA 4DRZA 4NBWA 4L74A 4PO8A 3FCYA 3EF3A 1N6LA 1NSFA 1GUDA 4HLQB 4XB2A 2PXHA 3GEMA 4RWEA 2AL7A 5IBQA 2P9BA 3WO1A 4FYPA 4GF5A 2PLFA 4HBZA 1ENYA 4BCDA 3QITA 3IV9A 1L5YA 3QNMA 4QDXA 4RZUA 2JKZA 1QIDA 3D4NA 1NVXQ 2ZRQA 3ID6C 4GM0A 4IW3B 3RSQA 4FNOA 2AXPA 3SEZA 1RACA 2YV4A 4AU1A 3KAQA 5IVKA 1PCXA 2O3QA 5KYWB 5CLFA 1U8AA 4PLGA 4KGVA 2G5TA 1QCCA 3PQEA 1PU2A 3GFVA 1J5XA 4I5EA 1A9YA 2GZRA 4DCCA 7REQA 2IXTA 1KRHA 3F6SA 4HAXA 4MJ7A 1E2KA 1D9XA 2I71A 1XD2B 4LI0A 4MPJA 4O4LF 1MZPA 3P9NA 1ACLA 3U40A 1ESMA 1Q15A 1KVUA 3ZR4B 4IL5A 5TPWA 2QTZA 2JGJA 2GD6A 3GOQA 4YWJA 2C96A 1SWWA 4J1TA 5JAMA 1UUFA 4F4UA 5FWAA 2F7SA 4JYAB 1GRNA 2J30A 5GONB 3RU9A 2JKVA 4QEDA 1OKKA 2R4QA 1I01A 5BR8B 2D2EA 3JX9A 2F1OA 1DCTA 1C3EA 2GTHA 3LGXA 1ZS9A 2XE6A 1F14A 1ZMTA 2I4RA 2CMFA 4OFBA 1JJAA 5BSHA 4RDHA 3WLLA 3IHKA 2FW9A 3ROEA 1S9DA 1I2ZA 2C4KA 4I4TF 3PQ4A 4PGMA 3C3YA 3H5LA 1CR0A 2YXPX 1Z7YA 2ZYAA 2MINB 4CLXA 3ZWBA 4MDFA 2R4TA 5HK8A 3RT9A 1RXEA 1IQUA 2WJYA 4XSHA 1ZLYA 1J4AA 1YHNA 4YFVA 5P8WA 2H1FA 4KO8A 1UJMA 4II2A 4ESHA 2V4ZA 2O07A 7ADHA 4ZOCA 4P1ZA 1RU3A 3H4MA 1C1HA 1JPJA 1H2EA 3WNCA 1BOFA 2NYUA 3O9VA 4MA5A 3FDFA 4CKCA 5CXSA 3NM5A 3IMFA 1FSFA 1Y9JA 1DBIA 3H9JA 4C4XA 1KMNA 1XRSB 3CW9A 3K0CC 1M2VA 2D3TA 3AJEA 4QNMA 4P32A 4Y6QA 4CBVA 1KQGA 3FCEA 3IEVA 1GLNA 2VDWB 3LT4A 1K6JA 1PVDA 2FN9A 3DDOA 1IWBB 4IV8A 3MJDA 5LA6A 3I76A 1A04A 1D2EA 1L4MA 4EM6A 2F3QA 4HYYA 4FGJA 3DE1X 1PT6A 1TM4E 1T1SA 2P5TB 3DV2A 3ENKA 3K9CA 3QMWA 1GU7A 1USKA 2NO7A 4Y2UA 2PT7A 3T4XA 1KAQA 2WJIA 1WUIS 3MINB 4JK3A 5DCWA 4E4YA 5F7XA 1VG1A 3MPUA 2I9PA 2AIRA 1XLTC 2C2HA 3EGWA 4OOFA 3V97A 2FUG1 1TIKA 3ISTA 1XZPA 1T5DX 2R8RA 3AZPA 5IDVA 4YDRA 2OBXA 4IDBA 10MHA 3I04A 1U2DC 2B0CA 4M8LA 4UEQA 4IVNA 3SI7A 1QGED 5EEGA 5TXGA 3QBDA 3MUEA 4BRSA 2IYXA 2OD9A 4BNHA 1SCNE 3RV3A 3RFUA 3UYKA 4TUYA 3DCJA 1L7BA 2GM5A 4XQ0A 4UBIA 1XMVA 1I32A 4YIHA 4RVCA 3AUTA 4OLFA 1BU8A 3H04A 4P2GA 1L8QA 1YZYA 4G23A 4EATA 4B7AA 5D1NA 3EPJA 3OZTA 4LUCA 1FXSA 1PJ3A 3MTQA 1A1VA 3MERA 3T4EA 1IEXA 1Y33E 2ES4A 3PFKA 4X3CA 2CE2X 5DGXA 3SJ7A 3GARA 5BV8A 5EQJB 1E77A 3K0FB 4DLVA 2FWRA 2JLCA 3WXMA 5LB2A 1CTQA 1RFLA 2AMVA 1AT1A 1HE4A 3DDCA 1P0MA 1BZYA 1NPTO 5JNSA 2A3NA 4WUVA 5IF3A 4BFCA 2Q3LA 3DTNA 2DT5A 3BKWA 3PSHA 4IV5A 1LK0A 4QRHA 5EXDA 4CFSA 4TKMA 3AY0A 4AJ1A 1V1MB 1L6RA 5HRCA 5IH7A 3KL4A 2HMTA 2WLTA 4JHXA 4MS3A 3ZWVA 1ADBA 2Q6OA 5IJ9A 3U5TA 3KAKA 3IKMB 1YKFA 1ENOA 4GPBA 2NM0A 1VG9B 3DZ8A 2HMVA 2WWXA 1PJ8A 4OL0A 5GGXA 4BO4A 1GPMA 4GKJB 2GK4A 1F12A 1TJYA 3EZ6A 4IG4A 5ALNA 1UMCA 2BL4A 2OBMA 1MQSA 2GK3A 5AYVA 3KOWA 1UFRA 4DGQA 4ZEVA 3QVLA 1SUDA 5CAEB 1ZD9A 1RHQA 2VDNB 2A0FA 1JBQA 4M7OA 2ZRLA 5E4JA 3IURA 2Q41A 3B70A 1AHHA 2I8LA 1ORVA 2GPAA 3ELWA 4TWZA 4HQ0A 1APBA 2PL9A 4X20B 1X7ZB 1VKOA 3KELA 2JFWA 4G9GA 4IDEA 3NIDB 3EIHA 4J0JA 3PJRA 3N2IA 1P18A 4MGEA 5AOVA 3NVMB 1CQZA 3RI3A 2BEUA 2R8YA 2C31A 4HWGA 1NNEA 4DZRA 4XR4A 1DQNA 4ZZ0A 3QVXA 5TX7A 4GYWA 2OFWA 1VI6A 2ECFA 3HCWA 4G65A 2PY6A 4F4JA 3IX7A 3FX2A 1O0CA 1EG7A 1WVMA 3V4FA 4N0PA 3A6KA 4OQLA 5IM4A 1WLSA 2F1KA 3C3PA 5DJ5A 1BMDA 1E8NA 2B92A 4OI4A 4BNLA 1YB5A 1W94A 1PJTA 2W6NA 3HWRA 4HADA 4KH0A 1NTRA 3KFVA 4UD6A 1BEZA 4YRDA 3U17A 2LDBA 4PNEA 2ZDHA 3GRRA 2AUMA 4DSAA 4I1IA 1H6CA 1G8JA 1H2HA 2VJKA 2YFKA 3EGDB 4G1VA 4OB6A 4C0JA 3TMAA 5E1DA 2BFNA 4PYJA 2J3KA 1ADGA 1K2VN 2DH5A 5K45A 8MHTA 3LXXA 2VH1A 2WM3A 4L5YA 4D26A 3C6KA 1JYFA 1XEFA 2WFLB 3NV9A 2BSXA 2QW0X 4OKSA 1XYYA 4QU5A 4WZBA 3UAXA 4LNAA 1QRUA 3ZZNA 4C30A 2DBRA 2NTEA 5ALUA 1RBZA 1IMOA 4R01A 1SHUX 3AU9A 1JLMA 3AUXA 1VHLA 5EE3A 5F5LA 3HI4A 2XUOA 1YJXA 2NZXA 3DBRA 5KTYA 4GKAA 3JYLA 5I8WA 2Q9CA 2ZAGA 4RBNA 3ORSA 4TSRA 3A1WA 4NAHA 5HE9A 2QAIA 4DLUA 1UXIA 3A7DA 4WZBE 3EIEA 3UG6A 1ZNQO 5FNVB 3K9GA 4M0FA 3RSZA 4E1BA 3C7AA 1WWKA 3FW1A 4P4LA 5DULA 3VPAA 3I9FA 1EFPA 1WCYA 4MW6A 3WQQA 4WK0B 1XWFA 4EF5A 1XVAA 2NUPB 3JV7A 1EUYA 5BW8A 2XMPA 1Y9ZA 1Z5WA 1N2HA 4CYMA 5D3MB 4PBSA 4Y2VA 5EZYA 3A1FA 1K8YB 1MAWA 3KKOA 2PH5A 1ZWLA 4MIKA 1UXHA 3IPLA 3EEOA 4PM4A 2NVWA 4CTKA 1ABBA 3KKKA 3I2JA 4AROA 4C0LA 2P11A 3OM9A 3BE4A 1VJ5A 5F1YA 3VV2A 3DLTA 4Q66C 3N2YA 1C8BA 4CL0A 3D6TB 1OVMA 1G3QA 2SKEA 2WILA 1XTPA 1C4KA 3GN2A 3NKFA 4PSDA 3ZU5A 3K16A 2JFXA 3H17A 3N2ZB 3QPAA 2XQFA 1KP2A 1VSQA 3F6CA 4RC9A 2NZYA 5E6SA 2V6IA 1X80B 5A62A 1TT5B 5EI5A 3V8VA 5C5IA 1KTIA 3PLAE 3H65A 5JS1A 1RBQA 1NRWA 3DOIA 5CRIA 2OZKA 4DMCA 2VP0A 3TXAA 4TQAA 5G0UA 2YWFA 3EQZA 2IBSA 4BB9A 1DC5A 2B4TO 2EEZA 2QLMA 4FYJA 2NO1A 2V54A 3BDIA 4B33A 5LD2B 1INLA 4FJ2A 2OCDA 2QD3A 3KCNA 1QV7A 2GPTA 1OUMA 3IDZA 4YGXB 5AOAA 5BYAA 5LJIA 3V4SA 2HJVA 4CF4A 2WOJA 5KPDA 1BXZA 3A9CA 2OHHA 1H42A 2GKSA 1QGOA 3H4IA 4G1MB 4PCLA 5EUQB 5H83A 3PU6A 5AUNB 1IBLB 4BQQA 4RL6A 1QC5B 4A91A 3CKKA 3HCRA 5F73A 1XVUA 4HRYA 1E7MA 2UUCB 1H93A 2D2XA 2GVDC 2ZBFA 3HVIA 2ZBEA 1YK0A 2V7VA 2XVZA 1QAQA 4DLRA 4F5ZA 4AJ2A 1MW8X 4RO0A 3FPBA 3IUQA 3O95A 2RI1A 3ZNOA 1BYUA 4GWLA 2C54A 1GZ7A 4FGLA 1B93A 2FCAA 2BMFA 1USGA 4M36A 2BMWA 5BNZA 4B3TB 4BFWA 1Z0ZA 5IK2A 2BCJQ 3E7DA 4FR0A 2ABWA 4J0IA 4EJ0A 1U0FA 2Z3VA 2J5QA 4JQYA 1GGVA 3TAHA 2A7XA 4QLAA 5TMDA 1CWUA 3QFRA 3BD9A 2O7NA 3TQTA 4Q00A 4KPFC 4AIIA 3AFHA 3B3GA 3RTEA 3T7SA 3ZBPA 3LWNA 3I39X 4OLJA 4EQZA 1HF3A 1J90A 3UT5B 1QFZA 3FSEA 3ZOZA 1OBOA 2ZKLA 2EYQA 3F7MA 5EHZA 3QXGA 5FWYA 1RABA 4ITRC 2C7RA 1NQVA 2XA9A 1LW7A 3HBNA 4CFYA 1B6TA 1YOVB 3UH0A 2XYPA 4HV4A 2FG6C 3N2GA 3BMQA 2DKOA 1ZM2A 3UV6A 1MVLA 5F3WB 2A84A 2C1XA 4BWVA 3SX2A 1CR1A 3O91A 5CX1A 1E4EA 5NULA 3PWZA 3CX7A 3EMKA 1U90A 2O8CA 5JEEA 4K9PA 5FBZA 1OI3A 2IS6A 5H3LA 1IY2A 3DBHB 3D0RA 1C0PA 3II6X 4MTLA 2JGIA 4B9EA 1YA6A 1DBVO 1YJAA 5IXYA 4PZDA 2VK1A 4CLRB 3BD7A 1KAGA 3C70A 3I42A 2GUGA 1E0DA 4FXPA 2V0GA 1MB2A 4LGMA 1VPTA 2AC7A 4PLTA 5C8XA 3OPVA 2PMEA 4EY3A 3HXMA 4ZJZA 1EFRA 1MBZA 4EYKA 1HDEA 1PZGA 2I55A 5BMOA 4ZHQF 5DBHX 3T3OA 1NWHA 4W1PA 5IH3A 1C3XA 3JARA 1O08A 3W1VA 3I53A 4YRQA 2UYHA 3WWOA 4AKTA 1G5QA 2VXOA 5DK6A 3PD1A 1MF7A 2O06A 1QHIA 3IH5A 4ND1A 3HZOA 1M2WA 2YJ6A 3GGJA 3TNJA 2YN0A 5IT0A 1LTHR 1QCYA 1E1QA 3PDWA 4FLMA 5FA5A 5FV7A 2C2YA 4YCSA 5KYYA 3QJGA 4HEQA 1GJRA 3DMFA 4OFXA 4QBIA 4QUHA 1J97A 2CWDA 2D7DA 4BO6A 3NJ4A 5CB0A 1S2IA 4I3GA 1AO3A 2B1RA 3I0MA 5GV8A 2Y6VA 3SQNA 4M4SA 5EOVA 4PQYA 3OE4A 2BGJA 4KQMA 1PYGA 2P9QA 4NU8X 1EX9A 5JEDA 1EHYA 2WQ6A 1L7VC 2QN2A 1RI1A 1S3SA 4P53A 4PYRA 5JD3A 4XJXA 1TX4B 3WMEA 1O54A 4YUWA 1I24A 3LUKA 4BLUA 4AZVA 3WK9A 1X19A 1ZUD1 4PZLA 4LYYA 3B9QA 1ZEMA 5BV1A 4HNTA 4QVKA 1S2DA 3BWEA 4HQRA 1W2GA 4YO7A 1TZJA 2WSIA 1DO8A 3C39A 4UE2A 2GPYA 3GJ7A 1TGVA 1Z6YA 1JWAB 3IBGA 4UMFA 3ZE8A 5AW6A 3VAYA 4WN9B 3QTBA 1AQ6A 2QQEA 3SICE 3T5MA 1XAHA 3R3UA 5G1OA 2IPNA 1SRQA 3BIWA 4JQOA 1YI1A 8ADHA 1GADO 1Z4MA 4F9EA 3P2OA 3G9TA 3EIUA 4OJQA 1E5LA 2XLCA 4M98A 5I6DA 2QF7A 3M4JA 3MJSA 2QN1A 2CJWB 2LTAA 2F8MA 4N12A 2WW8A 3UEOA 2JLZA 5F12A 3AVVA 2E4UA 2W6MA 3CWZA 3W3AA 4IMRA 3HKBB 5L53A 2QMUA 4OCZA 2I4IA 5I5EA 1SVSA 2V74B 2QRGA 4BNJA 2DXIA 3TPFA 3TQHA 5MDHA 2JGEA 1QFXA 2QRJA 4IFBA 1QO9A 3SN6A 4U3JB 1CEQA 3VTFA 1I2DA 4RHUA 4FI3C 4O4IB 2P1DA 4ZGWA 1OLSA 3JS5A 1Q20A 1XP5A 3AYXB 3PDIA 4G8BA 4HN2A 5HTOA 4DA8A 2CDBA 3T7EA 3OZAA 4RADA 1G7CA 1LNZA 3KOOA 3CX3A 3E2IA 3L18A 5DKFA 3FGZA 4FIZA 1J99A 3FLEA 4JI4B 3ZTTA 2SHKA 1Z5UA 1F2TB 1TRHA 3H2BA 5H80A 3TLEA 4GOXA 3CZMA 3EIXA 3UMVA 4YXWA 4AX4A 4D57A 3C15C 4ZCSA 1UBSB 5G4LA 2C3YA 1E61A 3AUUA 1XALA 2HK9A 4DIEA 5I7FA 2O57A 2PA0A 3MC1A 1ZSYA 1XSEA 1GL3A 1CZNA 1Q5PA 1Y8RB 3G8DA 4PGAA 2BRUC 2VWPA 5DOZA 3ZXXA 2GGSA 2RG1A 5H8WA 3ZDCA 3TH5A 4BLSA 3VFDA 3GT4A 3N3AC 4COOA 2VUTA 4WXRA 4MHOA 5EHXA 5BSUA 3OEHD 3LKVA 4XA8A 2XI4A 4FUQA 3EUFA 4P3XA 3HUDA 3FWNA 3K5PA 2ZQYA 3L5OA 1F9EA 1II0A 1IRXA 1W49A 1EK5A 1XT6A 1XTUA 4RH0A 5TF0A 3TIVA 4EAQA 2OESA 4MVJF 2UUBB 2HY7A 2QRHA 4UU0A 3SXJA 1IK4A 3RBAA 3HYCA 5F9FA 1G3IA 1GZDA 2C2KA 4E70A 2AQHA 1SZCA 1WJGA 3FLAA 2HR1A 4U63A 4JI3B 1NFFA 2AMFA 1QORA 3C1TA 3CNLA 2COEA 4JR0A 5ALFA 3NCHA 5KJ1A 1FDVA 5T4EA 1JQ5A 3A1TA 2EKLA 1JEJA 1OQAA 4BWGA 5DPMA 1QYIA 2BFCB 4G4IA 5KU1A 4MUYA 5I3ZA 3VPGA 5H4HA 1PNQA 3K1ZA 2XCIA 3V1UA 3UOGA 5K01A 2N75A 3ND6A 3NTRA 2ZIUB 3E1KA 3K2QA 4H7KA 3VVLA 5AKXA 4EPWA 1E94E 2H4HA 2WKWA 4PSAA 2QD5A 3ELBA 1LKZA 1SWVA 1JSLA 4ROTA 4IRXA 2OWDA 1VDZA 1YDEA 3LQFA 1CQJB 1PDVA 1W4BA 3N8KA 4QJ5A 2WJPA 2DFLA 3L40A 1T2DA 3I1IA 1SULA 1DAEA 1V5EA 1VCNA 3P2EA 4IJ6A 2P8JA 3M89A 3REQA 5FRDA 4XYBA