3SJCA

Crystal structure of s.cerevisiae get3 in the semi-open state in complex with get1 cytosolic domain
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
349
structure length
276
Chain Sequence
TVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAECKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for tail-anchored membrane protein biogenesis by the Get3-receptor complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transport protein
molecule keywords ATPase GET3
total genus 80
structure length 276
sequence length 349
chains with identical sequence B, E, F
ec nomenclature ec 3.6.-.-:
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3sjcA00
1CU1A 1H8HA 3VHXA 2REOA 2Z83A 3TR5A 4BLPA 2J3EA 4M1OA 4P32A 5SZJA 3GJ4A 1G21E 2NO0A 2C03A 4QHYA 1RYHA 1W2GA 3W8NA 3WP0A 1GRRA 4RKFA 3UMSA 4DCVA 1IN8A 3QKUA 1CKEA 4MRSA 4QM7A 1NKTA 3L2OB 5EXXA 4P3YA 1E3MA 2ZRDA 3ECCA 2R65A 1F6BA 3Q9LA 2IK8A 2ODBA 3BS4A 1L8QA 4TMWA 4BLQA 1DO0A 3Q85A 3LDAA 5FPKA 1CP2A 1OW3B 3SJZA 4ITRC 4JT2A 4PTLA 1DAIA 1NSFA 1Z08A 4XWAA 2IUSA 4D4LA 1OXXK 1SVMA 4MYHA 1MKYA 3FE2A 3CPHA 1VG1A 1FL9A 5CJPA 2W6ID 2Z0MA 3TK1A 3LXRA 4DWJA 4D4JA 4DUGA 2WPDA 3A58B 1J2JA 4GSYA 4GP7A 2JLQA 4OQNA 4XVUA 4PAQA 3BFVA 1Q3HA 2P67A 1U81A 3IQWA 3GMTA 3QKSB 4YC7A 4GZMA 3PEYA 1FNMA 2PEYA 4ZO4A 2EFEB 4DXAA 2CDNA 2ZYVX 4Q9HA 3TAUA 1KDOA 3AF4A 1RKBA 3CX6A 2O0HA 4Y0VA 2HF8A 3VR1A 4CIDA 2WAYA 3C15C 1M1YE 2WWFA 4DVGA 1OH7A 1T5IA 3GEEA 1DARA 2PBRA 4BFSA 4H1UA 1KI9A 2EFGA 4HZIA 3LX8A 2FEOA 3WYAA 2OAP1 2XZLA 4JMPA 3D31A 3VX3A 3B8HA 4LYJA 1TX4B 2GA8A 1S1MA 1LNZA 3MRSA 2GBLA 1NLYA 1Z47A 1P4SA 2IW3A 4A0RA 3ICEA 2WSSA 1WB9A 1JQLB 3O8BA 4YXWA 3LX5A 2J87A 1ZAKA 3EIEA 5FBQB 2ZETA 5CDFE 2XTMA 1XJQA 2ZU6A 3P4XA 5GJWC 3GLIE 1NY6A 4M1TA 4PZYA 2BBWA 4HLCA 2ZQ5A 4DEYA 1GILA 2EU8A 3OE7D 3B1VA 3RDPA 5JSZB 5HR5A 1EFRD 1LVGA 2VEDA 3BORA 1IY2A 3BRWD 4KU4A 1P75A 3FVQA 4NPHA 2IXEA 4NYIQ 3WYFA 2IS1A 1MO6A 2GXUA 4CZ2A 1GNRA 4ZPXA 5LB4A 1CEEA 5J47A 1HE8B 2WOOA 2D3WA 2DFTA 1KJYA 3KTAB 1XWIA 1E69A 2RHDA 3EX7C 2QBYA 3UANA 3FMOB 4F4JA 2ZSEA 4O25A 2YWEA 1Z0AA 3UG6A 2AK3A 3ZZ0A 1E2EA 2AFIE 1KSFX 3FOZA 3SQWA 2FJUA 3FDIA 2HJVA 2IYTA 3DKVA 4OK6A 4Q18A 3RSLA 1ANKA 2GESA 4KFSA 4PAOA 2XNDA 1L4UA 1P61B 5AK0A 1N5LA 2EFHB 1KO1A 1Z6AA 1R7RA 4Q9LA 2DWOA 2BVNA 4XSHA 1RRGA 2FG5A 5B30A 3PJRA 4OK5A 3VU9A 3IIKA 2QN6A 5FTLA 1VCMA 1XPRA 1E9RA 1FP7A 3DOEA 1OJLA 1QHXA 4WZ6A 4V0OA 2JLXA 4JSYA 4BE7B 2WIAA 4HAUA 1UF9A 4KYIB 1D8TA 5FOTA 2ZRLA 1NIPA 3M6AA 4X8OA 4YXWD 3B1WA 5JJKA 2A3RA 3D6TB 1DBSA 4TLEA 4MRPA 3AKYA 4MGYR 4EFLA 2OG2A 4P4SA 2LKDA 2ZVPX 3BJIC 1AS3A 4M8NE 4QNRA 1A5TA 2GTPA 1QDEA 4IDOA 4Z8YA 2J0UB 2GXAA 4AKEA 2A5DA 4OBEA 3AVXA 4UNQA 4EJSA 2RGNC 3R9WA 1SVKA 4RD6A 1Z63A 3EXAA 3IIJA 1VCNA 1XD2B 2OFOA 1JBKA 4DIEA 2G6BA 1SXJD 2D74A 4TQUS 5CK4A 2FN4A 4OI0A 1EXMA 2QMUA 2ZE5A 621PA 1RVDA 2O5VA 4G3XA 5EE5B 5FOXA 2OESA 5L3QA 4TZ6A 2F1RA 1NVVQ 2OLKA 2XTZA 3VR4A 3GLHB 1S3GA 4L16A 5M04A 2ZSAA 4P33A 1WBDA 2BM0A 1XX6A 3SFZA 4Q4LA 5K8LA 1HT1E 2ZUDA 3B5JA 3QPVA 1Z0KA 4Z1MA 1HURA 3EIHA 3KB1A 2ERXA 4DHEA 4NP6A 1AZTA 1K6MA 5BN3A 2XNSA 1W1WA 1NN0A 2WAXA 5FOWA 1JXOA 4LGMA 2QSZA 4HATA 2QA5A 4KFUA 1WDTA 3KKQA 3U4QB 4D26A 3OIYA 3NBZC 1P9NA 1EFUA 1U98A 2J1LA 4PHGA 2WMNB 4GNKA 5FI0B 2RAPA 3AVQA 4KSCA 3T1QA 3PITA 3RNLA 4MDEA 2YWGA 2IF0A 3KUCA 3L0IB 5AUQA 1WMSA 2YC2C 1Z2CA 1DS6A 3AVPA 2FGKA 3K0FB 4EPTA 2IYSA 2YOHA 4JBXA 3D8BA 4RZ2A 1YZQA 5B57C 3MSXA 3ZYCA 4UNNA 4NTZA 4QBFA 2PLRA 1F2TB 1H65A 1IBRA 4KSBA 3ZH9B 2YKGA 3PUWA 2JEOA 2FFHA 5CYOA 4BPBA 3AVTA 4FWTA 4OL0A 4Z51A 3PG5A 2ERYA 1NMXA 3H4MA 4M2LA 3RC3A 3K0CC 1CIPA 2ZJ5A 1AQUA 1RYFA 3A1TA 3DOFA 4D6PA 5AUOB 1FMJA 1X1SA 2ZE7A 2JIZD 4XTRA 2J41A 3QF7A 3T1OA 2CL7X 2R62A 4ZDJA 1WXQA 4NKRA 2ZRIA 3B6EA 1TEXA 4V0NA 2B7BA 2JJ1A 4LWZA 2FGJA 1P9WA 3KQNA 3QE0A 4ZDIA 2DCUA 4NCIA 3WMEA 1IOZA 3IQXA 1KO5A 2W6JD 1LB1B 4ACAA 4JVMA 2Q3MA 3KUDA 2J7PD 2RGNA 2HCBA 5HZHA 1G4UR 2CJWB 1CBUA 1KI6A 2OXCA 2O8CB 1CRQA 2WM9B 3M0EA 5HKKA 3GLHE 2QPOA 3GLGB 4E07A 1CJMA 1G8YA 3WNCA 4BGDA 4TMVA 4G01B 4Q21A 1GKIA 4MH0R 1OXUA 2VSOA 4NDZA 3TW4A 2NPIA 4TTQA 4U00A 1GDDA 2R2AA 1OH5A 4CW7A 3L0SA 2WJGA 3NEJA 4PO8A 4A2QA 2FFAA 4D81A 1CR4A 1WP9A 2P6UA 3TVDA 4XD7A 3AGQA 1XU4A 2WV9A 3K0AA 4KJZA 3TNFA 4DUGD 4DDTA 5CDFA 1WE2A 3BFKA 3HR7A 4BFVA 4LZZA 2JLVA 2BKEA 3AP1A 4JVSB 1NKSA 4DLUA 1UM8A 3KZ1E 1DAKA 4LUCA 2OFXA 2OXRA 2WPDD 3DZDA 3LVRE 4RD0A 2H5EA 2VP9A 1U99A 3MCAA 2QAGA 4J0QA 3PV0A 1YHNA 2B21A 2ZRPA 2YWHA 2ZJAA 3DDCA 3OHMA 1NI3A 4JLJA 1OYYA 1WF3A 2YWFA 4DLSA 2OBNA 2VRWA 4TQ9A 2W2XA 1Y3AA 3QF4A 3TRFA 3BE4A 1QG4A 3NC1C 4C4PA 2VSXA 3KFXA 1P2TA 4US2R 3TW8B 1YZNA 4UKDA 2H16A 4EPYA 4QXAA 1AN0A 4BFTA 5DI9A 3RRMA 3L0PA 3W3AA 3CONA 4O2LA 5GJVC 1XMVA 3K0CA 1T0JB 3FMIA 3QEJA 4G5GA 1GUAA 2ZI4A 2WHXA 5CLLA 5CM9C 1A4RA 3VHLB 1G7CA 3TSOA 2HDNB 3WNDA 1M74A 3HU2A 3N5CA 4JLVA 3CM0A 1E4VA 5F98A 3VKHA 2HLDD 5JCPA 2QORA 3NWJA 1PLKA 3REFA 3QF4B 4DDVA 1SXJE 5CITA 3QIAA 4MGZR 4KBFA 1B0UA 5GJCA 3QSYA 3GJ3A 5CK5A 5KSOA 4WA7A 3NDPA 2XOKA 1GZSA 3SBEA 2FZLA 2B92A 2R6GA 3NH9A 3VR3A 3GLGE 3GJ8A 2RGGA 5E7JA 5KO2A 3T1TA 3KJHA 1FOEB 2H57A 3U6BA 1Z6XA 1ZD8A 2JLRA 3RHFA 1L7VC 4UXIA 1G1MA 1NVXQ 1ZMXA 3P32A 2YHSA 1ZCBA 3WNBA 4DJTA 1P60A 6Q21A 1Z6YA 1NVUQ 4EIWA 3GQBA 3G0HA 4TL8A 2PH1A 4QGHA 5FH9A 1KI8A 1OFTA 3P27A 2QGNA 4H9GA 1WRBA 4AC9A 1GVNB 4XSGA 2KB0A 4KAXA 4K46A 3FB4A 4IOLA 2Z4SA 1XCPA 2QEQA 1IXZA 1ESNA 1BYUA 2V54A 2QROA 3I32A 1ZC4A 1T8UA 1LFDB 2VA8A 2WMOB 1S2MA 2R6CA 3I73A 1KI6B 2O8CA 1XMSA 2KI5A 1ZU4A 3I61A 1VG8A 3RLFA 3TUJC 1PUIA 1IN5A 4ZI2A 4HEJA 1E1QA 3AB3A 2RGXA 3O8DA 3KJGA 2OCBA 1KK0A 5AR1A 3HYTA 4HI0E 2D7DA 1T6NA 2J7PA 4RVCA 5AUPB 4AKHA 1VCOA 5IRCD 1Z0DA 2VTKA 4L4UA 1Z8FA 1VIYA 3AVWA 1E9CA 1ZYUA 5CB6A 1E4YA 1SQ5A 1XZPA 4QFMA 5H1YA 1IM2A 4RD1A 2XXAB 1MOZA 1QVRA 1X1RA 2ZAOA 1NBME 2JLWA 4Q4AA 3TUZC 2C96A 2MMCA 3C14C 2O0JA 2VHJA 3N2IA 2G88A 3EARA 4BRUA 4IDHA 1C9KA 4WZBE 3K9HA 2QTFA 1G4AE 2CXXA 4I1SA 2NQ2C 221PA 1R8QA 4OHWA 4JLOA 4M1YA 4MRRA 4Z8XA 5JHGB 1QG2A 4NZYA 2ZS7A 3PFIA 3EW9A 4RZUA 1NF3A 4FCWA 4N1AA 3RRNA 4DSTA 2G3YA 4US0R 3RANA 2AFHE 2BJVA 1JJVA 1ZM4A 3PUZA 5KYKA 2QG6A 1Q44A 4LV5B 4DT1B 5JS7A 2QP9X 4LBZA 4RD4A 1HQYE 1O87A 4QHSA 2QE7A 2VLIA 2W83A 5DN6A 5L8VA 3DHWC 3SC3A 4JBYA 5AWFC 4HLQB 4PZZA 2ODEA 5G40A 4EKDA 2OCYC 1F2UB 3IKJA 1OXTA 5HCNA 2EVWX 2OZEA 4C0AC 1CXZA 4YMTA 821PA 4DC9A 3SEAA 4KYUA 1NL3A 3ZVRA 1RJ9A 3T12A 2ZJ8A 1Z0JA 5G3YA 4JZKA 4D0LB 4II7A 2QUZA 3JVUA 3T34A 2GDJA 4DLYA 4YMWA 2CVHA 2PX3A 3DM9B 3FHCB 1X3SA 2AD5A 1Z22A 2FZ4A 3HPRA 5IK2D 1Q1BA 1Z6TA 3ZDQA 2ZRGA 2ZROA 5HE8A 3K70C 4KLZA 3EA0A 3GLHA 4WZAE 3EIQA 4MYUA 1G5RA 4V02A 2NMVA 3DMNA 1UPTA 1YKSA 4PSAA 1M34E 1GAJA 2PZFA 4D0NA 5AJYA 3EASA 4DCUA 3LAWA 2H1LA 1IN4A 2BMJA 4L5BA 2RGCA 4Q1FA 1U94A 1ZD1A 3TSZA 1JALA 3UMFA 4BLOA 4K81B 1OHHD 1KY3A 2XSZA 3IPYA 4FN5A 3EPJA 1GL9B 3MMPA 4F7WA 4BASA 1FMLA 3MLEA 4TL7A 4UXHA 2BHRA 1JJ7A 2Q9CA 5FUVA 2F1IA 3SQXA 4HAZA 4CEIA 4OI2A 1VTKA 4R2IA 5H8WA 1BOFA 3UWOA 1BYIA 3GD7A 4P4TA 3B1YA 5EE0A 4EPWA 3HU3A 2BBTA 3V4RA 1GKYA 3QXCA 2ORVA 1ESMA 1XTIA 4RKEA 4V0ME 1EGAA 4X8LA 4CT4B 3UPUA 1Z29A 3IBGA 4Q4JB 4TYQA 4I99A 2OBLA 3Q7QA 3BD9A 2C95A 2F9MA 4A0HA 1W49A 3LW8A 1G7TA 2GCPA 2VP2A 5G3ZA 2E9SA 2WWHA 4Q1BA 2IUUA 3QKTA 4UQOA 4B43A 1TQ2A 3IHWA 1Q1QA 2ZE6A 3THXA 1DTSA 2C5LA 4IOKA 4QG7A 1U9IC 1PJRA 2UZIR 4UNPA 2IYUA 2FPMA 4XWKA 4C9BA 1SHKA 4WBSA 2X19A 3TQCA 2OILA 2OCPA 2YOFA 4LPSA 2FMXA 1BO6A 3T1VA 3AP3A 2G1KA 721PA 4G0NA 1G9XA 3WMGA 3VKGA 1BMFD 1P2UA 1E0SA 1T3HA 1CJVC 1A2BA 2BBOA 4JYCA 4AK9A 4OJKA 4KBGA 1D9ZA 1OKKA 4JT4A 1YZUA 1R8SA 2ODNA 3RVBA 3TVTA 4HB2A 4KHZA 1GRQA 1XRJA 1SXJA 3THXB 3I4LA 2F7SA 5GVSA 2G9NA 3VKWA 1J8MF 2ODWA 3CWZA 4JLMA 3X1XA 2QT0A 1E1RA 5LBIA 4QKQA 4IOMA 4MQBA 1N6OA 1Q3TA 1NJGA 5BYJA 2FOLA 4OQFA 4I4LA 5BN4A 4QJ4A 1G3IA 1YE8A 1KDTA 3K09A 4AG6A 2VSFA 5CIQA 1W36C 4A8JA 5KSYA 1W36B 3CLVA 121PA 3BXZA 3ZD6A 3PVSA 4JVLA 4OHYA 4IXMA 1OB5A 2RGBA 5JCZA 1DG1G 2DHRA 1R6BX 3OFND 5KNBA 1E2PA 3UWKA 2BMEA 2QRZA 2OHFA 4QGAA 5AJZA 1C4OA 4I1OA 3CWQA 4B34A 1YZLA 3SJBA 3WHKA 3SOPA 4GRAA 3U3KA 5JRJA 4IVRA 1G8GA 1E1RD 1GIAA 2R44A 4LHZA 4LHYA 4DSOA 2VP6A 3R9XA 1CRPA 1G5TA 1OPXA 2ZE8A 4B35A 5FOUA 4OKSA 4W5WA 5IF9A 1B23P 4QJ3A 2AXNA 1Q1ZA 3IBYA 2HT6A 3OESA 1AJEA 4JL5A 5K8IA 2O8FB 1N3BA 1G18A 1T8TA 2HEIA 3I8SA 3K1JA 4G5OA 2GXSA 1OE0A 4PZLA 1FQKA 4ILEA 3U6KA 4TZ0A 1NRJB 1IN6A 4B76A 2W2VA 1P73A 3U2QA 3H2YA 3RWMB 1DE0A 2V1XA 3O47A 2NZ8A 2IYVA 5JSZA 4PANA 4BUJA 1LY1A 2WZQA 3A37A 4QBIA 1F48A 2EQBA 2GNOA 3ADBA 2BV3A 4GT1A 4EFMA 2JLUA 1G3QA 3MWKA 2FSFA 2P2LA 1G6OA 2KJQA 4Q1AA 3SNHA 3C5CA 4BLTA 4R9UC 3AQ4A 4DKXA 3NBFA 1FZQA 4MRNA 3U3JA 4A0GA 4P0TA 3ICQB 2GEVA 5EZ6B 2W2TA 3CF6R 2ZI5A 2JATA 4A4DA 2IYZA 3TIFA 4QNMA 3W6PA 4A0FA 1D2MA 3ZGXA 4M9ZA 2QMHA 2KBFA 3EC1A 1HTWA 4CYMA 1GL7A 4LY6A 4ZV4A 2DWPA 3C41J 1E9DA 2GK7A 4FMCB 4C7OA 5E4FA 1DO2A 1T5LA 1E2QA 3LA6A 2OBMA 4Z54A 2YOGA 2ZJBA 3JZAA 3LRPA 3NVAA 1G19A 5TB5A 3SYKA 4PO9A 1NN3A 2A2ZA 4B2PA 1W0KA 3A4MA 2JDID 1KSGA 3MUFA 1AZSC 2F3TA 1YR6A 3PUYA 3ZQJA 4IEEA 1U8ZA 2VHQA 1SVOA 3GCGA 4PO1A 3LBNA 2P5SA 5HZKA 2P5TB 3HR8A 3ZIAD 2AWOA 1P3JA 2BOVA 1PVOA 3W5IA 1JR3E 2WJJA 4ERNA 4DEXA 4C2TA 4AYWA 1COWD 1Q57A 2QENA 3ZJYA 1UKEA 4XVQA 1CR0A 2DBYA 1XMIA 3PEVA 4PC3A 4I1UA 4RD3A 5IHPA 1YU9A 5CYPA 1ZM3A 5EXTA 1AKYA 4JLDA 2QU8A 3TGPA 1XDBA 2FA9A 4WXPA 2WSSD 1E2FA 3NBYC 3HP1A 1RRCA 4NHOA 5FL7A 5CLQA 1N5KA 3K9GA 1D2EA 4FINA 3DPUA 1NJFA 3ASZA 1OIWA 3W8RA 2MSCB 4QRHA 5J4VA 3AUXA 4MUAA 3LQQA 2CHVA 3KKMA 5EUMA 2P65A 5KUTA 3THWA 1R0ZA 3GLFE 4UJ3A 3QKRB 3I72A 2AKAB 1MV5A 1E2MA 1W0JA 3SYLA 3FHTA 5DH9A 4Q19A 5FTNA 1ETUA 1HEIA 2PCLA 2ZRAA 4LJ6A 2CBZA 4B32A 5C4GB 4GOJA 3ND9A 5GJBA 2BWJA 3MWYW 3OZXA 4C0HA 2XGJA 1C1YA 1CTQA 3U61B 3CH5A 1LS6A 2AX4A 4B2LA 2BKUA 5DISB 3VAAA 4HB4A 4L9SA 1R5NA 4PPQA 1P62B 2GAAA 3FWYA 1G17A 3GLGA 5JFGA 3V00A 3MJRA 1DVRA 1QBKC 3THWB 3IGFA 4EDHA 1XPOA 4BFUA 4FMDB 3CB4A 1XTSA 2NO1A 3IEUA 4IKEA 4JJZA 4QJ5A 3QKSA 5EP1A 2D7CA 4E22A 3Q5EA 2IHYA 2WIBA 1KK2A 4NCJA 1QZXA 3A6PC 2DPXA 1S9HA 2ZAMA 2ORWA 1E79A 4W7SA 1DPFA 1BKDR 3VQTA 4DCNA 4HDOB 1TAGA 3C8UA 3I3SR 3MG9A 4IDPA 2AD1A 1XEXA 4NCNA 1ZP6A 1XTKA 4ON9A 4N3NA 4OHXA 2ZM5A 2ZS8A 2ZXUA 5KDLA 1E2NA 2GILA 5FOSA 2ZSDA 3LVQE 4LRWA 5JRZA 4HAXA 2J46A 4GMXA 5EXSA 2O8DB 1RZ3A 4PFSA 2J5XA 1ZU5A 4BQSA 4HAVA 1OYWA 5DNYB 5CM8B 5G53C 2VHCA 1CR1A 5FUYA 2QZ4A 5L3VA 1NVWQ 5SZIA 3I1FA 2GVZC 1QHIA 2WJVA 2IYQA 1T91A 1KSJA 2ZRHA 1XEXB 5FUXA 4PSKA 2A30A 4PHFA 5EZ5A 2A78A 2IL1A 3WHLA 3EG5A 4LYHA 1GFIA 3A1UA 2W58A 2ASEA 2ZS9A 3CRQA 3DL0A 5HE9A 4YMUA 4ZCLA 1SXJC 4PQFA 3KKNA 2CMKA 3MAAC 5UKDA 2RGEA 3BOSA 4PPFA 5J4LA 4RFSA 4LJ9A 4YLGA 5SZHB 1LTQA 4XVRA 3IDQA 1U0HC 2I1VB 2A5YB 4L15A 1Z6GA 2R6AA 5EUQB 3REGA 5F9HA 4PR0A 4WIAA 3VX4A 1H8ED 3BERA 1W46A 1NLZA 3RS0A 1SKQA 4UJ5A 3EPHA 4IJMA 3GJ6A 2CEAA 1OIXA 4HDQB 2C2HA 5FR1A 5DGXA 1E2KA 1SULA 1X6VA 4NYJR 1OLOA 1Z06A 2HXSA 2NTYC 3Q3JB 5JEEA 4GPTA 4KITB 2HLDA 1X8LA 4M22A 2B8WA 3W34A 1OH6A 3FKSA 3EAQA 1TL7C 4TYPA 5DN6D 3LXXA 3U44A 3A4LA 2QPTA 1IN7A 1E2LA 1S96A 1YQTA 5KNCA 4LK2A 2A5FA 2KBEA 4YQFA 4JLBA 4MRVA 2VO1A 4P31A 1U8YA 2XAUA 5DLQC 4YONB 2V7QD 1UKVY 3B9QA 1XTQA 1QHHB 2REXB 4F38A 3U60B 2RGDA 2C98A 4NCKA 4V03A 1FFHA 2ZUCA 4LC1A 3TKLA 1UEIA 2MSDB 2MMGA 3D3QA 4ASUA 4C3ZA 1E2HA 3U44B 1IJFA 2IXFA 4IVQA 4GBMA 2C9CA 4G5RA 1I4TD 1SXJB 2VQSA 3SYNA 3OIVA 1JECA 1GWNA 1N0WA 5E7MA 1UDXA 3VR6A 3WXMA 1SKYB 2PZEA 3R7WA 1LW7A 1QHSA 4OJQA 3RS2A 1KSHA 2J0UA 1KI4A 4JS0A 3ZS9A 1EESA 2GCOB 1HYQA 1DAGA 3CF2A 4RSGA 3X1DA 2DY1A 2Q3FA 1DEKA 1FUUA 2QI9C 1UEJA 1G291 2ZRJA 3J81k 1KHTA 1UKYA 2WBLC 4TMXA 1E9AA 4Q9KA 1W4AA 3MD0A 2VBCA 2RH5A 5ANRB 3JVVA 1RRPA 3CBQA 1GP2A 2QNRA 1IJEA 1A1VA 2DR3A 2YC4C 5L3QB 3EPKA 2RGAA 3K9NA 4LBWA 4QBGB 3V4FA 1R2QA 1KNQA 1KIMA 3SJCA 3B13B 4V0LA 4PAMA 1S1CA 1VYUA 1AGPA 3G5UA 4TYWA 4LYAA 1EFHA 2OLJA 1R10A 1TQ4A 2QQ0A 4EAQA 1KI7A 1ZNWA 3HJNA 3SU8A 3CR8A 2AKYA 3AVYA 2FU5C 4AD8A 1VIAA 1G8PA 2WICA 3B85A 4BWYA 1OH8A 3LQRA 4V0MA 4I1VA 1MO3A 2ZRFA 5TV2A 3AV0B 1KJWA 1W2HA 1CJKC 1TMKA 1GNPA 4B75A 2O8DA 2VHUA 1OHHA 2XSZD 3BH0A 3QPUA 4FCTA 4EFNA 3THYB 2HYIC 1W5SA 5BXQC 5KNDA 4Q1EA 3Q8XB 1MABA 1CF4A 2P3SA 1HUQA 1KI3A 3LLUA 2Q9AA 2ZIAA 3KFVA 5P21A 2FFQA 3PQCA 1MR3F 2WJIA 3KTAA 3U5ZB 2IX3A 1ZBDA 2X2FA 3IEVA 5KDDA 4Z1MD 3OE7A 3QUSA 2GZAA 4DB2A 2OEPA 2UZ3A 3FFAA 2FEMA 2I3BA 2WWXA 1ZRHA 2JA1A 3EZ2A 3L82B 4URWR 5FBWB 5JECA 2Z6VA 3NDBB 4PX9A 3RRZA 4AIIA 3QVVA 4JLNA 4PSVA 4CRWB 3ZVMA 1KI2A 3K0EA 3IILA 1M7GA 4D80A 1IY0A 3KKPA 3GLIB 3GJ0A 4D0GA 2C04A 3OIWA 1TUIA 2J7KA 1JAHA 1TADA 4CVNA 4EJSB 2XZOA 2IBMA 1E96A 1R5BA 2QY9A 4LDJA 4ESHA 2IWRA 4C0BA 1W0KD 1DAFA 1DAMA 3MWJA 1MRSA 2CNWD 3X2SA 1A7JA 4TSFA 2X8AA 4ARZA 2O0KA 3I92A 2CK3A 4Q7JB 4QL3A 4IEIA 3DMDA 4DZZA 3SN6A 5DE3A 4FD2A 1I4DD 1VKJA 3DKPA 2ZANA 1G16A 2P6RA 4B74A 2NO7A 4JL8A 4DDUA 5HKKD 3GLIA 1OB2A 1YR9A 4DLWA 1ZVQA 2Q6TA 5JI3E 3AUYA 3QY0A 1GKUB 5KPJA 4Q03A 4Q7KA 3QG1A 1IONA 3SHFA 1F5NA 1JAIA 3HWSA 1K5DA 2EFDB 4QGGA 3TUIC 2W6IA 2D2FA 1GSIA 1VYVA 4HLUA 4HDCA 2EWVA 2KWIA 3GEIA 1MH1A 2GZHA 4B44A 1OV4A 2GF9A 2H18A 3PENA 2VHTA 4IFEA 4TWZA 3VR5A 4CDGA 2G1JA 2J59A 5FTMA 2C9OA 4LBVA 3FYHA 2WJHA 3IO3A 4NONA 2V4ZA 4TYNA 3TJZA 4CEIB 2ZSBA 4PPNA 3SJAA 2N1BA 1X8KA 1Q1EA 4JLKA 5HPYB 4AKIA 2D06A 3TE6A 4KCGA 5JBQA 2A9KA 2ZUBA 1BH2A 3K9LA 3OIUA 3E5HA 4NYMQ 5LPNA 3SI7A 1G20E 2CCGA 2VIIA 4NH0A 5F9FA 5EP2A 2X2EA 4GZLA 1K8RA 2VF8A 2ATXA 1D5CA 3NTUA 2ZI9A 4D4MA 4MKHA 1PLLA 3T5GA 2ZR0A 4A6PA 4ZI3A 2GHIA 1NVVR 3UG7A 2CE2X 4XJXA 4KLNA 1TUEA 3NXSA 1P7CA 1IAQA 4LHVA 3Q5DA 2GWHA 3X1ZA 3AKCA 5JEDA 1Z0FA 2JASA 2H8KA 4HB0A 2OSBA 3P26A 4YMVA 2ZJOA 3K0SA 1M8PA 3FPAA 1JR6A 3EZ9A 1OFIA 1RFLA 1VHLA 4Q47A 1VG9B 2KE5A 3FMFA 3RC8A 4DCSA 3UXMA 2GK6A 2FSGA 3CF0A 2Q21A 5E95A 5DI3B 2PCJA 5FFMA 4OQMA 1YZTA 3KDSE 4LHXA 4QOSA 1G7SA 5CJ2A 3RS7A 3CZQA 3K53A 4EPVA 1KK1A 4FWIB 2BCGY 2NO9A 5JJLA 1XXHB 1KKLA 3EZFA 3QI2A 3OEEA 1FNNA 2OM2A 3W5JA 2ZR9A 4A15A 4M1KA 4R98A 3W9YA 1U0LA 4ACBA 4DCTA 3AM1A 3CRVA 3LNCA 4KVGA 4A8JB 1GNQA 2EYQA 4URYR 2V6JA 3AKEA 4X8HA 2V1UA 3HU1A 4JL6A 1W36D 4LCBA 4WXRA 1II0A 2GJ8A 1U2RA 2FSHA 3ZQ6A 1SZPA 2QE7D 1FTSA 3U7EB 4YDSA 3TAHA 3B60A 4ESVA 2BMFA 2G83A 1BMFA 1Z83A 2RHMA 4TLDA 3KQLA 4HLDA 3ZS8A 1N25A 3DVLA 3AKDA 2BEJA 3FKQA 3K0AB 1XZQA 2VP5A 5BQ5A 2PT7A 3TQFA 1M6NA 5JLJA 2ZSFA 1Q22A 2QM8A 4POAA 3OFNA 2J0QA 2WKQA 5LD2C 2CE7A 3BGWA 4PQRA 2R6DA 2QL6A 2Z4RA 3ONWA 2Q9BA 4PXAA 3CO5A 1NP6A 3BH7A 1TEVA 2LWIA 1KO7A 1ZC3A 2A7QA 1M7BA 1G64A 4BFZA 3LO5A 3RWOA 3M1IA 3E2IA 4B71A 4PC6A 3GJ5A 4GDFA 5IK2A 4AG5A 1R0WA 2Q0HA 4M9XA 4C0KA 5BWMA 1UKZA 2PZGA 5TDHA 1E1QD 4Q5IA 3VU9B 2FV8A 2BC9A 2JLZA 2QAGC 4M9SA 1TQ6A 1E9BA 2QAGB 3U7GA 4OK3A 3KQHA 2ZYTX 4QM6A 3NHAA 1P2SA 5AJWA 2UVQA 4PHTA 2W0MA 3U3OA 4IOJA 1W48A 1ELOA 3K70D 3KKOA 2OFWA 4JLPA 4GFDA 3CH4B 2ZREA 4R2HA 3F8TA 4UNRA 5KOYA 4U5XA 5JHHB 2HYDA 1KGDA 3L43A 5JI2E 4CEHB 3B1ZA 2VYFA 4LYFA 2JAQA 1DAHA 1FQJA 5EE3A 4B6FA 2ZU0C 5SZKB 1XXHE 2G77B 1X86B 5KDOA 4JYBA 4LI0A 2L0XA 4DLRA 2TMKA 5JJIA 4M1MA 1ZIOA 3I5XA 1XJ0A 3OEHA 3QXHA 3BAFA 1QHHA 2IF2A 3ZZTA 4JLAA 3BH6A 2FE4A 5LD2B 1NSTA 3GPLA 5B64A 3A8TA 1E0KA 4X8MA 2FPLA 2ZRBA 2UKDA 5TVKA 5FPYA 1ODFA 2HV8A 3U7HB 1E0AA 5J4KA 2ZPTX 3BB3A 1ZJ6A 4C0JA 5TY0A 4YDHB 2OCAA 2D4HA 4V0KA 3T61A 4LJAA 4B3DA 1COWA 2G0TA 4BECA 1NG1A 3L8YA 5HCIA 4FW9A 5G41A 3K0FA 2K5UA 2E1RA 4ARZB 1JEEA 4KO8A 3M4YA 3MFYA 1AA9A 1E6CA 3BWDD 4URXR 5DO9A 4C0LA 1E32A 1FP6A 2PX0A 4GOXA 2REBA 4M21A 1KAOA 1CR2A 2WKRA 1IHUA 1QF9A 3ZIAA 2F55A 4BEBA 1J70A 3C7KA 3PUXA 5EE1A 4F93B 2VP0A 5EQTA 2QAJA 1NIJA 4KVAA 3RS4A 1SVWA 2XEXA 3VMFA 2E87A 2SHKA 5KHOC 1P9RA 3IUYA 1KDRA 1Q0UA 5JWOA 3GFTA 2WWWA 1S8FA 2P6NA 3U3MA 2PJRA 4ZKDA 2B7CA 2C99A 2DWQA 3PR1A 1HV8A 4I81A 1E9FA 4A82A 1W0JD 3CNOA 1JR3D 3LV8A 3WBJA 1NBMD 1ZM9A 1E0JA 2ZRMA 4HB3A 3THYA 1RPZA 2QTVB 3WBKA 1EG7A 1S9DA 4TQAA 3GFPA 5BN5A 1BS1A 4DBLC 2DFNA 3H0KA 2GKSA 2CHQA 3SFVA 2BMDA 2BEKA 2OO7A 3WP1B 3CRW1 2Q3HA 2ZRNA 3OAAA 1SVSA 1ZNYA 1I4LD 4A36A 4RD2A 3AVUA 4BZQA 2IC5A 3EA5A 4NE2A 3VNVA 1II9A 1OFUX 4M1WA 2GXQA 3H1TA 2XTNA 2XX3A 2D62A 4TMKA 1XTRA 3CPEA 4WAUA 3QVUA 1P2VA 2QGZA 3BB1A 3TBKA 4GMDA 2QM7A 1XNJA 4ASUD 2ZRKA 1GITA 1OT3A 3QXJA 1NY5A 2C77A 2V3CC 4GL2A 1GM5A 3L8ZA 3FGNA 3KQUA 2O8BB 4MGKR 4RCYA 4KFRA 3B2EA 2FH5B 1KJZA 4IW3B 1FX0B 1TF5A 3TMKA 1ZM2A 3SE0A 2WJYA 1IY1A 4HAYA 4MUBA 2NGRA 5H70A 4PQYA 1U9IA 4E03A 3KJEA 2V9PA 1AM4D 4S2EA 3U7FB 2F43A 5AUNB 1CLUA 5DI3A 1G7RA 1YRAA 4MDFA 3RRYA 4WVFA 5CB8A 4BLRA 1E2IA 1VYTA 2F1JA 2OAQ1 3VTKA 2AHOA 4EQ6B 1EWRA 3QQ5A 3O8CA 5EP3A 4FI3C 3BIFA 3PIRA 2CCKA 4M4SA 1PUJA 2HF9A 2VL7A 4Q9IA 2NPFA 3R9IA 1XTJA 4Q66C 2GVDC 1JB1A 2YJTD 4RFSB 1SVIA 5HTKA 2O8FA 4URVR 1MT0A 2VH5R 3GFOA 4O2RA 4JKYA 4XTCS 5BYKA 2GZDA 4IDNA 2F43B 4B3FX 1ZM7A 1N6IA 2HCJB 2XJ9A 4A2PA 4ABYA 4CEJA 2XZPA 4QBHA 3CX7A 2H92A 3ZVLA 1NNEA 4N0DA 3R8FA 4WW0A 4D2IA 2I1QA 1VG0B 5FBVB 2F1HA 1QHGA 3NEYA 5C46F 4MYCA 2WOJA 3OEHD 4Q7LA 5LB2A 1VECA 2CLSA 3B1XA 4R71A 1UFQA 1A2KC 4M0LA 4GOKA 1N0UA 4HAWA 4AWXA 1QVAA 2QQEA 2VP4A 3G82C 5GADl 1U8AA 1XMJA 1E2DA 1HQCA 1ZCAA 1PZNA 4DB4A 4BLSA 2PL3A 2W0SA 2FFBA 2RB4A 4O0MA 1XD8A 1EWQA 4BFXA 1LF5A 4Y0AA 4FMBB 2IYLD 2B6HA 4TMZA 5F3WB 1ZNXA 4B3CA 2IEZA 4NU0A 4XH9B 3UIEA 4NBSA 4OYHA 2WSMA 1NG9A 1HA3A 2JGNA 4DLTA 1N6NA 5L3SA 521PA 3R7WB 1J8YF 1OSNA 1FPMA 2I4IA 1CS4C 4LV6A 1TU3A 1N6PA 4TYYA 2ZJYA 1N5JA 2CJWA 2IT1A 2ZI7A 3F5FA 4PC1A 3ZLJA 2IYRA 1XFAA 3EC2A 4IHQA 4XWOA 3B78A 1QRAA 2OE2A 1P5ZB 3N2EA 4M9QA 1HH4A 5D3MA 1N0VC 1R5OA 4A9AA 2GJ9A 3NIBA 3I5YA 4A1FA 1XJCA 2C9YA 1IXSB 5AJXA 1YR7A 5EXPA 3QPWA 4CEHA 4UXJA 3LW7A 2NO6A 4LJ7A 5EP4A 3AF2A 1S0UA 4Q4JA 2ZTSA 4G1UC 1HY3A 2H7VA 3HDTA 2OV2A 2CHGA 1XEWX 2GAOA 2FPKA 4HUQA 4BZPA 2ECKA 4F92B 1E79D 1QHNA 2XJ4A 1NMYA 4URUR 1J99A 1KNXA 3L0OA 4IDQA 4W5JA 5TMPA 5L3SB 1EFCA 2GCNA 4IVPA 1XEWY 2GRJA 3WY9A 4IXNA 1KO8A 2GCOA 5KU1A 2V7QA 5A0FA 2RKOA 1G8FA 3IPXA 4C2UA 1E9EA 1UADA 2GJKA 4FCVA 1ZINA 3QKRA 1FTNA 2VF7A 4NYJQ 2BDTA 4TMTA 1NN5A 3QBVA 5D3MB 3PXGA 5JZVA 4AKGA 5FL3A 4AYTA 4RZXA 3VR2A 2J0SA 4M1SA 1NMZA 2IEYA 3CR7A 3KXLA 1MRNA 4KV9A 3CW2A 3PCRB 1R0YA 1LF0A 2IA5A 1V5WA 1JPNA 2EFCB 5B2ZA 4O3MA 3UK6A 3WRXC 5KSPA 1RRFA 3CNLA 1N5IA 3F3YA 2ZITA 4JJKA 2JIZA 3I62A 3BC1A 1DAEA 4GI7A 2JJ2A 3NHBA 1MABB 4KI0A 4MKIA 3LLMA 4U02A 5CIWA 4LSGA 3I8XA 1WA5A 4JSTA 3LY5A 3H84A 4DIDA 1DG3A 2YV5A 4K8OA 2ONKA 1OIVA 3ZD7A 1KYIA 4Q4HB 2H17A 4EJSC 4EQ6A 2GEDA 2FNAA 3A1WA 2GEUA 1UBFA 4MGIR 1KOFA 4Q7MB 5IDVA 2GF0A 4MKGA 2A5GA 2PEZA 2NOAA 1U90A 2NZJA 4EUNA 3K09C 4JBWA 3ZZUA 1I2MA 4TL9A 4OHZA 3RS5A 3TR0A 1VPLA 3CRMA 1X8JA 1GL6A 1TF7A 4ZDKA 4JVNA 1N6RA 4LJYA 3TH5A 1KY2A 4LC0A 5E7IA 1F2UA 1Q21A 2R9VA 2J45A 4CEJB 3GJXC 1R4AA 3QJYA 5F2EA 5K8TA 4B2IA 2AL7A 1ZW6A 3SBDA 4CF7A 4AYXA 1KI1A 2N42A 4OI4A 3GEHA 1GTVA 4LJ8A 1RE0A 5C18A 3VFDA 1SHZA 2QP4A 4D82A 5FPHA 3LBIA 1W44A 2BBSA 4BRWA 1Z0IA 5DYGA 2RCNA 4TL6A 1KO4A 3U3RA 3UKDA 3VNUA 1G41A 1G6HA 2R6FA 1YJ5A 2O52A 3CKLA 1CJTC 2JLSA 4A2WA 4P4SB 3QEOA 5FTKA 4BFWA 3LD9A 1SKYE 2JCSA 4HUTA 4YMSA 1TPZA 1BIFA 3X1WA 1P72A 1LS1A 4B33A 5LDDC 1Q20A 5TARA 3NH6A 421PA 5J40A 5FI1B 1RJ9B 3LWNA 4DDWA 1MO5A 5ELXA 4ZDWA 1JPJA 3TLXA 4S35A 1T4GA 1KAGA 1ZD9A 3WMFA 3E1SA 4KXFB 3W3ZB 4C30A 2JJ2D 4XD7D 2ZYUX 4B3XA 1ZUHA 1J7KA 1RC8A 3P4YA 4OHVA 1CJUC 4HYYA 3QENA 1NBMA 2VPPA 4HLUC 1XD2A 5FBLB 5J4HA 5D3QA 2ONJA 4H1VA 1XP8A 2AR7A 3B7GA 4TSFD 1WQ1R 2F9LA 3RSOA 4LHWA 4DSUA 4C7OB 1T9HA 4P4UA 2ORIA 3MGCA 4RZ3A 2G0NA 3RABA 1D2NA 2XITA 3H86A 3DZ8A 4TTRA 1LV7A 2Z5FA 1TQDA 3S1AA 3A36A 1W7AA 2AN9A 5GVRA 3KQKA 1HE1C 4Q48A 1JEDA 2GJAA 2V8OA 1XF9A 1E9SA 1Y63A 3UMRA 1JI0A 4URZR 2B8TA 1G8HA 2O8EA 4LOAA 1F3OA 2CLCX 1EFRA 2D2EA 3W6NA 4B3BA 2BJWA 3BK7A 2AXPA 1IQPA 5JMTA 3KXKA 1E98A 4TLBA 5DSZA 4ZIRB 1YR8A 3CX8A 3RYTC 1T3SA 2YYZA 4NYMR 1II8B 2JJ1D 1UBEA 2ZEJA 5AJVB 1EFTA 1F2TA 1ZUIA 2F3RA 5DHFA 1H8HD 2W00A 2YVUA 4B6EA 1KZGB 4AY2A 4TLCA 1VMAA 1DOAA 3X1YA 1W4BA 2ZRCA 1M2OB 1AGRA 1E2GA 2PMDA 1HT2E 2R8RA 4LJ4A 1XXHA 2IWHA 3CNNA 1F60A 1A82A 1PV4A 4Q4HA 1DELA 2EYUA 4LV8B 1AS0A 4HZUA 3IHLA 2V55B 3EWAA 1FUKA 3KXIA 5FTJA 2LCFA 3FHOA 4RJLA 3WYGA 4NYIR 4BFYA 3KB2A 3QXXA 4BEJA 1PLJA 5KTYA 1D6JA 3OF5A 2WTUA 2O8BA 1W4CA 3UATA 2FX3A 5JWRA 4EPXA 1Z3IX 2IYXA 4LPKA 4BZXA 1K5GA 4OQXA 1GOTA 2ZVQX 4HUQB 3QOFA 1RIFA 3P1JA 1NN1A 5C1BA 1FX0A 1N2CE 2QRNA 3EWSA 1L4YA 5EJEA 2ANCA 1Z5ZA 3MWLA 4XIGS 1KZ7B 2CVFA 3FMPB 3QBTA 4PPGA 4W5HA 2F6RA 3EZ7A 1KK3A 1EX7A 1W47A 3NG1A 3D7MA 4LX0A 1R0XA 4MYTA 2N46A 3FTQA 5BW8A 3AVOA 4L8GA 4A8JC 3LBHA 4L9WA 4RFVA 4E5UA 4MITA 1AS2A 5B58C 4B73A 3LH5A 1UJ2A 1VCIA 1IXRC 5FUWA 1JR3A 4DSNA 5IT5A 1WBBA 3KX2A 2IS4A 2YZ2A 4TT3A 3ZVNA 1Z28A 2CK3D 3IO5A 4U7DA 5H68A 5E3HA 4F4CA 5FPSA 2DB3A 1KKMA 4RY2A 1TNDA 2QTHA 3AF1A 3QXSA 3DM5A 4EPRA 4W9MC 2QT1A 1XD9A 1G3MA 2QMOA 3RS3A 1EX6A 4UNSA 1ZUNB 5KPDA 2ATVA 4KFTA 1N6LA 4US1R 2HXYA 3SR0A 3JZMA 1YZKA 2IUTA 4DLZA 4Q00A 2WWIA 2PLFA 3A1VA 4C0SA 2QSYA 1W4RA 1YZGA 4Q1CA 3GLFA 3HYRA 2PJZA 4PC7A 4C0QC 5C4MA 1L2TA 3CZPA 4D25A 4OI1A 5FPTA 3RAPR 2GBLC 3NKVA 3BFXA 2WWYA 1KMQA 1J90A 1SGWA 3SZRA 2IYYA 3LFUA 4LBYA 1YRBA 2RMKA 2IS2A 4TT3D 2QPAA 1DADA 3AP2A 3QNUA 3S1AB 1WCV1 3T15A 1N6KA 4TLAA 1Q12A 2HUPA 3ND8A 2ZR7A 3W6OA 4Q9JA 5C2JB 2FSIA 3B82A 3QG5A 3KL4A 5A5GA 5JS8A 4Q02A 5DHAA 1S3SA 1E94E 1P6XA 1OF1A 2AK2A 2P0EA 4B47A 1KTVA 2CLDX 3EZ6A 1XCGB 4M53A 2GETA 4FXPA 3C4JA 1H8EA 2JDIA 4AI6A 4RCZA 5FOVA 2XNDD 4F91B 1II8A 3K8YA 3BBPA 4DRZA 3GLFB 3AH8A 3F0TA 4CT5A 2NG1A 1D9XA 2WVJA 3PUVA 4JIMA 2BM1A 1FW6A 2XB2A 3GP8A 4TN1A 2ZI3A 1Z2AA 2EWWA 2ZYWX 4IFBA 5DYIA 3CRRA 4N0EA 3OEED 1UBCA 2EW1A 2XB4A 1KDPA 2AWNA 4G5SA 2FDCA 1W5TA 2ZJZA 1XCMA 1UAAA 2CNWA 2FF7A 3P20A 3IIMA 4GP6A 2FWRA 2QMEA 5EE9A 1G3UA 3ADCA 4A92A 1S4QA 3ASYA 2JJ8A 4NMMA 3U4QA 1OXSC 3AEZA 5TXGA 3FKSD 3KJIA 2WWGA 4HZUB 4NCHA 3PEWA 2JLYA 3C5HA 4B3GA 2IS6A 1TTTA 1ZNZA 5FR2A 5J4YA 3CIOA 1UBGA 2MSEB 2NIPA 2J9RA 1GRNA 1E99A 3GJ7A 4QC2A 3TSWA 3K70B 1XPUA 3B9PA 3E70C 4G5QA 4CGZA 4R7ZA 4WOPA 3DEFA 1UDWA 1CULC 1XB2A 3DO6A 3BB4A 2IXGA 4DLXA 4AURA 5A4JA 3EPLA 1U0JA 1XEFA 4E09A 1NLFA 1AQYA 3AF0A 3THOA 1OFHA 1TF2A 2GJSA 3ADKA 2IYWA 2LKCA 2Y8EA 2BCJQ 1M7HA 1Z07A 3ADDA 3R20A 2O8EB 1T3LA 3T35A 5L3RA 2HT1A 3AF3A 1AKEA 4JKIA 2X1VA 2X77A 4HSEA 1SVLA 3Q72A 4ZCIA 1QHYA 1ZIPA 1I2DA 2CCJA 2HJGA 2ZJ2A 4OQLA 2DYKA 1AK2A 3Q7PA 4ZIRA 2DFKB 4XOIA 4FIDA 4F4IA 1VHTA 2KSQA 1OKKD 5DIFA 3O8RA 3MJHA 4Q4AB 2WKPA 1TU4A 1US8A 2PT5A 4FMCF 4ZKEA 1GG2A 1ONBA 4KODA 2YINC 1E2JA 1KMHA 2C8VA 2PMKA 4ZCMA 2XXAA 4Q1DA 3SDZA 1OXVA 4DLVA 2CL0X 2A5JA 4Q01A 4QHTA 2J0VA 3C16C 4PHHA 1VDZA 3W90A 2IHBA 2OT3B 2OUKA 3PEUA 5J5CA 2Z43A 5KSZA 2CL6X 2DFLA 4QGFA 3HPQA 4DT1A 1MO4A 2YNMA 3AVVA 3A4NA 4PC2A 2QP3A 3OAAD 1JXMA 2ZI6A 1AIPA 1US8B 3T06B 1JQJC 1O3YA 3WRYC 3N70A 3CUEF 4TTPA 2V6IA 1KMHB 5FL7D 1RW4A 4LJ5A 2C78A 3ETLA 1YVDA 3V9PA 3NC0C 3FFBA 2ANBA 2QBYB 3AGPA 3SHWA 2XOKD 4NL4H 5K8UA 3SS8A 8OHMA 1G3RA 1N6HA 3R8CA 1G5PA 4D4KA 4IRUB 3A1SA 1EK0A 3NBXX 4MKFA 4FMDF 1JNYA 1XBTA 2BIFA 4A6XA 2W6JA 5FBRB 5JWHA 3T5DA 4MA4A 4B48A 1T0HB 1V43A 3CPJB
chains in the Genus database with same CATH superfamily
2POQX 5HF5A 3TJRA 4OU4A 4PINA 1XZHA 3WMRA 4FHDA 3MMNA 4CODB 4IEFB 3F71A 1G21E 2XEDA 3S7TA 4X84A 4AS2A 4D3YA 2J30A 2YUTA 3FOFC 1PG5A 4J16C 4RKFA 1WVMA 5C8YA 3CKKA 5IMBA 4QM7A 1NKTA 3GOHA 3PEFA 4GPD1 3WG9A 1IY8A 4UQPA 3SSNA 4AJ4A 4EMUA 2IKQA 3WA7A 4FGWA 2RKBA 5AKKA 2MHCA 4Q7QA 1C7RA 1L8QA 2P77A 3BS4A 4TMWA 1UUFA 2IX9A 1MAHA 3AHGA 3RUEA 5K8CA 4PX3A 5BWBA 1CP2A 1OW3B 3I5AA 3G0DA 3PGVA 4ITRC 1JE1A 1DAIA 1NSFA 1QP8A 1XO1A 2C4TA 2VXOA 5L6MB 5J9FA 4D4LA 1SVMA 5HNKA 2I76A 1MKYA 4PAWA 1PR4A 1YDFA 1IHXA 3I9FA 4DJEC 4EO4A 2W6ID 2Z0MA 1I2BA 3K9CA 3LXRA 5K45A 1R6TA 4G9GA 3VYRB 3GA5A 2JFBA 3NUZA 5ERXA 1MC8A 4GP7A 3PNKA 4OQNA 1L8AA 4PAQA 1Q3HA 3IQWA 3MILA 5DYTA 1OWPA 4GZMA 2QXYA 2EFEB 3O3NB 4V0RA 4Q9HA 3DDHA 3TAUA 1K06A 4TS3A 1WV0A 4RTMA 1YDWA 1RKBA 2N1MA 1OI2A 1OAAA 4WZBA 2OAEA 3FDJA 2HF8A 4JCCA 3VR1A 4CIDA 2HRDA 4S1NA 1QHEA 1VE9A 1QIHA 4DVGA 5IKMA 1M1YE 3F5DA 3KKZA 3T4UA 4U2KA 1E77A 1ONOA 1T5IA 1JWLA 1D4AA 4NSNA 3C6ZA 3ULKA 2H07A 4NZOA 4OHCA 3IH5A 4BO5A 3Q1LA 3TQIA 4II2A 3F4KA 2PWAA 1CQJA 2C8JA 2GKGA 2AG8A 3LPCA 3AJAA 2BTQB 4JMPA 3FCSB 3Q5GA 5DV9A 2D2IA 2LVBA 3QELA 3IP8A 2JAOA 4LYJA 3W1EA 4DBVO 2O50A 2GBLA 1NLYA 1Z47A 1JG2A 2JI7A 3JQFC 4QDOA 3BQMB 2WSSA 1J42A 5K6RA 1JQLB 2O7VA 2PD6A 1HYBA 2PXAA 2XGGA 1GXSA 2WU0A 2ZETA 1JEYB 1QORA 2I6QA 3FSRA 3RJMA 7MDHA 2ZU6A 2XMZA 4FC6A 1NY6A 4P9NA 4UBLA 3GPDG 2BBWA 4IHJA 4DEYA 3HSYA 3N6RA 1XDSA 3OKFA 1GILA 1W0CA 2EU8A 5FF9A 5K0FA 3MWEA 4MQUA 3LKZA 4UEJA 1W85A 4AF8A 3R75A 3A27A 1JNXX 3BORA 2VEDA 3N7UA 3O26A 2H48A 2N75A 4I3GA 1F4VA 3BRWD 4OV6B 4JXJA 2FEXA 3MXTA 2FPWA 2IXEA 2DFVA 3WYFA 2IS1A 3DDUA 4K9OA 1RJDA 2HREA 2GYVA 4WCFB 3G79A 4BGIA 5GONF 5D51S 3KCQA 4ALMA 4KGZA 1XPJA 2D1YA 5J47A 3QK7A 2WG2A 3H6KA 5TQ2B 2UZ1B 1OXKB 1KJYA 2BRUC 1Y82A 3EF0A 5D5QA 1E69A 1FS4A 3RQIA 2RHDA 3EX7C 1OU0A 1A9RA 4ZREA 2QBYA 4F4JA 3VPDA 3MBIA 4O25A 3V1TC 3W5UA 4UU7A 1DXYA 1LXCA 1K5HA 1JW9B 3WJ7A 3SQWA 2YYYA 4I50F 2FJUA 1E18A 1VDMA 2CB9A 3WIUA 2P8JA 1U0TA 4P83A 3M9XA 1P1CA 2D5AA 3VYSB 4L1KA 1ANKA 4YIHA 3EFOB 2HJRA 4PIMA 4OHOA 1L4UA 1P61B 3DUFB 3GPBA 2RIPA 3B5IA 1GGFA 3VPAA 3WL3A 1O57A 4IXDA 3T7CA 4OQDA 2IBTA 4RIGA 1Z6AA 4Q9LA 4LF5B 4PLWA 4ENUA 1QVZA 4G4GA 4EJ0A 4MP6A 2W70A 4BN4A 2HN9A 4PBTA 1C0IA 2FPPB 3VU9A 1FP7A 3TIGA 3GYBA 1PX2A 1QHXA 3C98A 3PPYA 2PJUA 3FSGD 3K2EA 4R0NA 4B6GA 2JLXA 5C1PA 5TS2A 2AW3A 2W22A 1DC8A 1UF9A 2B36A 2YUIA 5HJEA 2WM2A 3EVBA 5TQVA 5FOTA 4G0UA 5AHWA 1UJNA 2WFAA 4K3UA 2YJ3A 5AVSA 4YXWD 3Q2KA 4G36A 4FYYA 2DPMA 2KX7A 1EVIA 2A3RA 1V35A 2X76A 5ESRA 5CURA 5LJLA 1I7DA 4P4SA 3AIIA 4CLXA 5C0OE 1SZJG 3I2KA 3HUDA 1ICEA 3D7RA 3G1TA 3GYGA 3PXXA 4P54A 4WN9B 2FW7A 5EXDA 2WVAA 1QDEA 1U04A 2XCLA 4IDOA 3WGYA 4BTEA 4P4LA 2QVXX 2GD0A 2YHBA 3HXTA 4AXBA 2GXAA 3KKEA 2A5DA 2BYTA 4L2IA 3R9WA 1UINA 2WEKA 5JV5A 5CAEB 1ORVA 3AFHA 1A76A 3R7SA 3ILHA 4PIPA 4DIEA 1E4EA 5AK3A 5EMHA 3U4HA 4B9EA 5HWSA 4OI0A 5JAZA 1RVDA 4G3XA 1FNCA 2MYTA 3PZRA 5EE5B 2VDLB 4LF9B 2OESA 1DAOA 2HDHA 2XTZA 1NVVQ 2OLKA 1S2IA 4M0EA 5M04A 1S3GA 1P44A 4RMJA 3QPAA 1D4OA 1UMCA 3L02A 1ZJWA 4ZZ3A 3SFZA 4AIRA 4Q4LA 1PU2A 4A23A 4Z4IA 1TOAA 4FILA 3B5JA 5D7NA 3WV5A 1WS6A 1L6RA 3LYHA 2FFJA 1T29A 2H4YA 1KJ9A 2VDWA 3WXBA 4BXOA 4GE3A 2AV6A 3PT5A 2YQ4A 4RZIA 4F97A 1N7JA 1AZTA 1EFLA 2RARA 3ZN2A 1K6MA 3NONA 6REQB 5IJ0B 3RARA 1WD5A 2IZOA 4QGBA 5FOWA 4FHEA 1U7UA 2A0YA 4H3VA 3UJBA 2DUUA 3E1KA 3HUEA 1OFGA 1SUCA 1WDTA 3HCPA 4WLFA 1Y8RB 1QONA 5EJ2A 4E94A 3WGQA 1N9GA 1ODJA 1RC0A 4NMXB 4RMIA 4PHGA 4R51A 3T1QA 3MJ4A 3MS2A 1NV9A 4KSCA 4PHCA 2W2OA 3PITA 1QXSA 4MDEA 3KUCA 1JLMA 3M89A 2O9JA 1TW2A 4HXEB 5AUQA 3RVQA 3SP1A 2YC2C 1CZKA 1PT9A 1USWA 1JHDA 2FGKA 2R6JA 2VJKA 3TNYA 4C6TA 2YOHA 1W19A 1YMQA 2MOKA 4JBXA 3WRWA 5JNSA 1QYCA 2Y05A 4JOBA 1PTKA 3MSXA 4OX9B 1YRWA 1JTFA 2YIMA 4NTZA 2PLRA 1F2TB 1HLFA 2ZXFA 2FFHA 3OKPA 2CVPA 2C5EA 2W8ZA 4MUGA 3IKLA 3S40A 5BVGB 5LYJF 4YCNA 3I2IA 5CBPA 3I2HA 3OLYA 5EL0A 4BKQA 2FEWB 3PSAA 1CIPA 4IGIA 4J1TA 1RYFA 3DTVB 3Q98A 1V8DA 4QXPA 4W99A 1FMJA 1PO7A 1Y8RA 2B5OA 4TS9A 2ZW9A 4MVJF 4P6VF 1U3DA 4JI2B 1HLDA 3KSUA 1T1RA 2R62A 3WS7A 5BPHA 2JG3A 1FUIA 4R3UC 4B0PA 1YQEA 2ZRIA 2ZB8A 5CGQB 4UVGA 2I1LA 2DECA 4MW7A 5AKLA 1TQ8A 2QTGA 3ZJ4A 1V8PA 5BQXA 3GLUA 2NUTA 3RIXA 4BNLA 3L0BA 3LM8A 2HD4A 3QE0A 1FMTA 3R7NA 2DCUA 3DTNA 4J0CA 3PFGA 1H2FA 2J9YB 4H59A 3V7FA 1FFEA 3WMEA 5K0LA 1NT2A 1KO5A 2PPVA 2W6JD 1LB1B 3SBXA 3KD3A 1AY0A 1EE9A 2Q6IA 4HPXB 4JVMA 2OP1A 4M1QA 2BGWA 5JBNA 3PLNA 2RGNA 4GHWA 2XV1A 5B3AA 1GQFA 4CUZA 2PSEA 3SVTA 3ICOA 4JI0B 1KI6A 2ICAA 4KK4A 4AJOA 2Q7XA 2QL5A 3EGOA 5HKKA 1MIOA 4MVJP 5GGYA 1YV9A 3S8YA 1RJWA 3GLGB 4ISCA 1VBMA 2FSSA 1TC2A 3N2LA 4TMVA 1OI7A 5JIBA 1QGAA 1GKIA 1PFVA 3BXGA 1OXUA 2VPQA 4MH0R 4G0VA 4DNFA 1Y4AE 1K9SA 1Z18A 1RWPA 2NPIA 1Y8QB 1GCGA 4CW7A 3IV9A 1GUYA 3NEJA 4I2NA 5M29A 1YTUA 2IHZA 1XHLA 1DJOA 4QYXA 1J23A 2J0EA 4AZWA 5ICCA 4MXDA 1CR4A 5AM5A 1KEKA 3U1BA 5IT9A 1XU4A 3DWGA 3SCZA 1AX9A 1OX4A 2C7OA 1ECGA 5TVGA 4AG3A 2H1OA 4R1MA 4D4GA 3EXG1 4DIKA 3ESRA 3AP1A 4JVSB 4X7PA 1FW8A 4BNKA 2W6ZA 1NKSA 4DLUA 2QD4A 4BWGA 1H05A 2NXWA 2OFXA 4MAAA 4EF4A 2LCQA 2VCHA 3C45A 4BMOB 1TJ5A 1A3CA 1WY7A 4LFAB 3MCAA 2QAGA 1ABBA 2B21A 4HLNA 3DZKA 3EXFA 4CEHB 3SHTA 5TR9A 1OYYA 4F3NA 4PE5B 2WMDA 2VRWA 1DRWA 2W2NA 3G59A 3S5JA 3BMQB 4TQ9A 2W2XA 3HRIA 3QF4A 1PV2A 3P9RA 4IF6A 1MC1A 2OHVA 4MQ6A 5C3UA 3ZK9A 2ZCJA 4WHMA 3E35A 1E63A 3MJDA 2VSXA 3KFXA 3WJAA 4M98A 1R1DA 1P2TA 1GZDA 2YZGA 1XZNA 4QTUB 4F06A 2IYFA 3HKBA 4NBVA 1YZNA 5HOQA 4UKDA 5KVSA 2I3ZA 2XMGA 3EH2A 4NMLA 1F51E 2RK4A 3W5DA 3RROA 4ZOEA 2WTMA 1DX6A 3RRMA 4AVYA 3LLVA 3RF6A 4D4HA 1I24A 3DONA 1TQHA 5I5EA 1CY8A 5MN6A 1XMVA 1GQ2A 4RELA 3K0CA 1XQ6A 1T0JB 4M0CA 1VJ1A 3QX8A 1PL8A 2FE1A 2O1XA 2ZI4A 3QUQA 1MJ5A 4G5GA 4TX1A 4FOSA 1CUXA 2HJWA 5LKRA 1JDBC 3TSOA 3OF2A 4MUIA 1YJBA 3HU2A 2BZGA 3WLMA 3QVJA 1D2CA 3M6MD 2PGJA 1ZD4A 2HO5A 3CN9A 1E4VA 5M2QA 5F98A 1EK1A 1SBHA 1QS0A 1FDIA 3MA0A 3NWJA 3KQVA 4MV7A 2GZ2A 4EARA 2B4AA 1HQKA 3QF4B 2XYPA 4L5AA 4KK3A 3DOUA 1HFJA 3QIAA 4MGZR 4FHFA 3G8BA 2ATIA 5GJCA 4EF6A 5KC8A 7REQB 5GINE 1MOQA 5DGIA 1SKMA 4X71A 3ORFA 4N82A 2B92A 2GAIA 3OTHA 3EGIA 1U5BB 3NWPA 3GJ8A 4D8WA 1KMNA 4HYQA 2I8LA 1EBFA 3AONB 4FR0A 1FOEB 1FRNA 3PS9A 1NM5A 4OXQA 3OCCA 4WNCA 5LQSA 1RKVA 4O4LF 4B45A 4HH4A 1ZD8A 2JLRA 2X14A 1I9GA 1VPTA 3HM2A 1ZMXA 5TE9A 3EOZA 4DR5B 1P60A 4BNHA 4KAFA 2J6BA 2PN1A 2PH1A 5A5DA 4C4AA 3TZLA 4A5SA 1FMFA 3OLQA 2GZRA 5CM2Z 4AX4A 4QNNA 1KS2A 1JZTA 2HO4A 3MC1A 3RVLA 1YMVA 4RVGA 4E14A 1UOEA 3QQPA 4DIUA 4KAXA 1B1CA 4RUKA 2Q3CA 3FB4A 1NXSA 3L8GA 3DBVO 4K46A 2HJSA 1NFQA 2J3MA 2VDJA 4QELA 2GHTA 1Y4ZA 4R1TA 3IIIA 4DWVA 5K6AA 2AR0A 3ABRB 3N0RA 2O2IA 1MB0A 2XAAA 3FSGA 4OO3A 3UV6A 1OI4A 1V1RB 2R6CA 1QU2A 3HL0A 3FFXA 2O8CA 1OAOC 2KI5A 3O2SB 4Q4DA 4TWRA 3D7SA 3UA4A 1VG8A 5P8WA 3VSEA 5JY6A 5JRDS 1IN5A 3AB3A 4WERA 2RGXA 1UC8A 1WO8A 3KJGA 5DYWA 1KK0A 3SKYA 1A9OA 3WGKA 4EVSA 3DP7A 1J0CA 1WCIB 2UUOA 2ZUWA 1T6NA 5B37A 5AUPB 2D7DA 2VPTA 2G9UA 3VNAA 4P7GA 2CJPA 1E92A 1O96B 4K1LA 1VIYA 1E9CA 5LSAA 1A7KA 1DTEA 4YNBA 1SQ5A 2PJDA 3X1JA 1X13A 1NLMA 1SCNE 4LVOA 1L8LA 3UYKA 1IM2A 3WLEA 4CTJA 1MOZA 4TSRA 4F84A 3B9RA 1RYNA 2XXAB 1NBME 5FWYB 3EHEA 4HWRA 1ULZA 2MMCA 2B4YA 3C14C 2XLCA 2VHJA 4MEBA 5EESA 3EARA 4BAUA 2XMPA 5AVWA 3ENZA 4WZBE 4PM4A 4J6FA 1NJ8A 1SBTA 221PA 3OPYB 5B4VA 5L7YA 1AC5A 5KCMA 4QYIA 1QG2A 2XYVA 2ZS7A 3PFIA 3PPWA 4CMKA 1XJWA 1G20B 4N1AA 1X70A 2HA6A 4ETNA 4F11A 1QV6A 2CZCA 2G3YA 4Y6GB 5TRTA 3T5PA 5K0JA 1N2XA 3K9QO 4E5KA 3ESAA 5KYKA 2JB9A 1Q44A 1RC1A 3UQYS 2FSVC 3QVGB 3KRTA 2G5TA 1P3DA 4LBZA 4LQDA 4TWBA 2H2IA 4WY2A 1ZN8A 5COBA 1JTEA 1U3TA 2E4WA 5HA5A 4CV2A 1BU8A 1NPTO 2J5RA 2VLIA 2W83A 4L51A 1YL6A 3FMGA 4N6NA 3SC3A 4ND7A 3NNNA 5ISMA 2BFAA 3R44A 3D3WA 1CNEA 1DWOA 2ODEA 2YV2A 2XGOA 3A11A 1CUCA 1GARA 3B48A 3OPYA 1DBIA 4V2UA 4N8DA 5G40A 5K3DA 1F2UB 5CDUA 1AD2A 1OXTA 4O8ZA 2DBZA 3DEYX 1CXZA 1LH0A 4QIHA 2O2JA 3RYCB 2H4WA 4LZJA 2JGKA 2I4MA 3G88A 2ZJ8A 1Z0JA 4KEAA 4MCHA 5HBGA 1I1OA 1E8DA 2YV1A 3ZDFA 4AN4A 4DG5A 5IASA 1XKLA 3TGLA 3D2LA 2QUZA 3JVUA 1ZZEA 1SG6A 2GDJA 4C3UA 1MVNA 2Z5GA 4G24A 3ZOZA 1QO0D 1V3TA 3OZBA 1FXWA 5L7TA 4ZVRA 1DQZA 1TLLA 2CVHA 3MLAA 1Q7GA 1N2OA 3DE4X 4GI5A 2B8JA 2HC9A 1VJCA 4X3PA 5TC4A 4EX7A 2GK3A 2OLEA 3HPRA 4ED9A 1N9KA 3K5IA 1QMPA 3DAHA 5KYWA 2JFPA 2IIQA 4R3WA 4KLZA 4RK6A 3ROEA 3SICE 3A1FA 3BIJA 4MYUA 1TKAA 4V02A 2FW8A 4NFSA 4KWTA 4E08A 1K92A 4L08A 4EYSA 4KR7A 1A71A 5CB0A 2ODAA 5C31A 2BL4A 1M34E 1GAJA 2CVOA 4U2GA 3JQGA 4OGGA 4NEQA 4U2FA 3MHTA 4Y2JA 1C7EA 4DCUA 4TN5A 2P40A 3AUJB 1MU0A 1FE8A 4MUHA 1IN4A 3HHPA 4IJQA 1QQ7A 5L4SA 1ZD1A 1KOJA 4HZGA 3HZOA 2FPIB 4K81B 1QB7A 2BTOA 3IPYA 1Z7GA 1DNPA 1GL9B 3LGXA 1MC4A 2QGFA 4E5DA 5CITA 3DOIA 3EPJA 1NRXA 2BHRA 2H1SA 1H5NA 4JODA 4TQGA 3HXQA 4C3OB 4DRXB 3N2YA 5FUVA 1NW7A 4DMFA 4L9RA 1WEHA 1JSXA 1J6UA 3DE3X 3TL2A 4AMUA 3KEQA 4KIWA 2C31A 3UWOA 3TEMA 5EE0A 1Y0BA 3BULA 1UOPA 4JELA 5KYTA 3HU3A 3W4JA 2QLJA 1ECJA 1ESMA 1XTIA 2K7ZA 1V5IA 3BZWA 2EW8A 3P0JA 5IBRA 1U5AA 4B84A 2L18A 2RHBA 4X8LA 4CT4B 4PAGA 3UPUA 3IBGA 4KQKA 3L5OA 3FH0A 1YQDA 5B3LA 1UWKA 3NUGA 1Y9JA 1J0AA 1PJSA 4A0HA 2FMTA 3G0HA 2AJDA 2FEAA 1L7NA 2N0SA 1RWOA 2WWHA 5HSGA 2IUUA 3QKTA 3EZXA 2PUFA 3F8WA 3IHWA 1UBUS 2ZTHA 2W9XA 1YUMA 4F4FA 10MHA 4JI4B 1CWUA 4K9QA 3QX3A 4LJLA 1T4MA 1RBQA 1TK3A 4IOKA 5ER6A 3GRFA 1C5KA 5TGDA 4DAOA 1XN4A 2JLCA 3AI7A 4QG7A 5G1NA 5HFNA 3V7UA 4CF5A 4CEJB 5H16A 5HIMA 1Z74A 4XWKA 1SHKA 1KYVA 2IXDA 5GM1A 5LR6A 3TQCA 4PQGA 4NU6A 1L8OA 4H6WA 2OCPA 4IQFA 4WKBA 2EJUA 3R6LA 1QYVA 2RDMA 2SCUA 1DL5A 4S12A 1INLA 1H9AA 1Z3CA 1BMFD 4L4RA 1P2UA 4JR0A 1E0SA 2IELA 2JCVA 1SC4A 4KQFA 1CJVC 4YRPA 1VGQA 2BBOA 2OV3A 4JYCA 1JZSA 1YS7A 2V58A 1C41A 3GVCA 4OJKA 4AK9A 1X9GA 2OYCA 1R8SA 4KR9A 1XLVA 2GSWA 4HB2A 3O1IC 2IH5A 3NJ4A 1GRQA 1Y5LA 1N5RA 1K97A 4BDTA 1VKRA 1RHUA 5FBKA 1JUDA 5CHYA 4FDMA 3VKWA 5GVSA 3FAKA 1DO8A 1KEEB 4JLMA 2JNWA 3ZDRA 2BGLA 4GX2A 2FW1A 3IP9A 3QPDA 2CN1A 4S1VA 3BQNB 4II3A 4B8YA 2LP4Y 3EPRA 5IWCA 5GZ1A 1NJGA 2JIQA 1TZJA 4N0MA 1JR2A 4M60A 4OQFA 4LXIA 4I4LA 1P81A 1PZHA 5HS4A 4BN5A 4F9EA 1H9CA 2H1RA 4R83A 4X6YA 4EECA 5E1DA 2PO5A 4MHTA 3O0DA 2Y0CA 1Z0ZA 3LL4A 4XPZA 1Q0QA 4LNUB 4XFJA 1UMBA 1N2JA 4MQFB 4MW5A 5F35A 3ZD6A 1GKLA 1RWXA 5JVDA 2J67A 4NBRA 2C42A 3RU7A 5AESA 4J1SA 2DHRA 1VGRA 4Q16A 1TM5E 2WWRA 3UWKA 4BO6A 2YXEA 4QGAA 5AJZA 2VJPA 4TWAA 1E6KA 1R6AA 2Z8ZA 3KT0A 4MQEB 4O63O 3HZZA 5FEMA 1LNQA 1YZLA 3K72B 4EHJA 1BTOA 4GRAA 5KJ6A 4CU2A 1X77A 1CRPA 5HF8A 3ZK7A 5DRYA 4QLBA 2ZE8A 3CVYA 4B35A 1GTSA 5ENZA 4W5WA 4EW1A 3QX7A 4ML3A 3B6IA 3QU5A 5BQPA 3WIDA 2YR0A 3LQ1A 3ZW8A 3OOYA 4WBNF 4ZYUA 3ZLTA 4DBLE 2ZRQA 3FF4A 4MWSA 3IAS6 3HBAA 1N3BA 3DUWA 1T8TA 3L41A 2GXSA 3LG2A 4DE5A 1WHTB 2BI8A 1UZMA 2OR3A 2ILVA 1FF9A 3U6KA 3G9QA 4YY3B 2VNHA 1M6VB 1Y81A 3I64A 1DE0A 2V1XA 2NZ8A 1VE1A 4QUDA 3MW8A 5HS6A 1YB2A 2JH3A 2O3JA 1LY1A 3FUUA 4Q24A 2QUHA 3AF6A 2C1ZA 2YKGA 1Y5MA 1AKNA 2G06A 2I2AA 2ODPA 1O1YA 4PRZA 2GNOA 2A9RA 4Y6QA 5GOTA 4EFMA 3U09A 1G3QA 3ADBA 3MWKA 3QE2A 2JLUA 1VJTA 1TYCA 4QOGA 4ZVTA 4Q1AA 3SNHA 2CYCA 2X0NA 3DV9A 5CCDA 5A9RA 4P0TA 2PWPA 2GEVA 2W2TA 3CF6R 1NP3A 4A4DA 1E7RA 1D2MA 3ZGXA 5FWXB 4M9ZA 4NCXA 2KBFA 3EC1A 3K4QA 1FLDA 1QDLB 2ZT5A 1V43A 2YWXA 4OCZA 2V96A 3LZ6A 2P35A 1ULUA 1YCDA 2HMTA 3UAVA 3O5AA 3UH1A 4FMCB 3VTAA 3M34A 5IKEA 3E3LA 4MVJG 3F49S 3N0TA 3ZXXA 1T5LA 5CT5A 3LA6A 1QFZA 1OROA 2IEBA 2PUVA 2BI4A 3HKEA 2D5BA 4EHHA 5TB5A 3BGIA 4OIMA 1SCBA 1NN3A 3F4LA 2A2ZA 2VNAA 3W9SA 1C8KA 1FYVA 3B6KA 3T4EA 3HBFA 1NQOA 2G82A 2JDID 1KSGA 4PGFA 5A71A 1AZSC 3ZQJA 1H2XA 4IEEA 1P7ZA 1K8YB 1SVOA 4DWOA 2ZWAA 1GL3A 1K8ZB 4D02A 4RY0A 4IO0A 3JWEA 4JOSA 1E2BA 4RQBA 3OPVA 2HSGA 3ESBA 3ZIAD 1PVOA 3DVQX 1C0EA 2PX4A 1UXKA 2FUNB 2VDPB 1G1AA 2JCBA 4DEXA 1BX1A 3ZKWB 3QJGA 3FPBA 1COWD 2V6MA 3SR4A 1MCZA 4XVQA 2R25B 1L4GA 1U5CA 4TV9B 1FJGB 4KN9S 2ATCA 3DTYA 3LHIA 5J5VA 2YN2A 5FHQA 4FOLA 2NNLD 4P93A 1B8PA 3EGXB 3EXIB 2QU8A 1KS9A 1XDBA 4JLDA 4RF4A 3IJPA 4EJMA 1E2FA 1R4ZA 1VXRA 4NHOA 3LUKA 1M2NA 2J3QA 3H1AA 2MSCB 3EYWA 2WJAA 3KD2A 4TMYA 2RBKA 5F9MA 3RUPA 3JVEA 2YZMA 5M3BA 2P4QA 2W48A 3IESA 2DQKA 2OAGA 4W63A 3T9AA 2BSXA 4K05A 4HDAA 1MDBA 2AKAB 3ZWPA 3M1LA 3SX2A 1JLKA 3SYLA 4ZVSA 2BT4A 4F71A 1N2ZA 2GEKA 3FHTA 1HEIA 3L7LA 5LQNA 1RXVA 3ROMA 3F5SA 3PQFA 4KPEC 2QTWB 4CM9A 1GZ3A 3G7SA 3LXUX 2CBZA 1DQSA 1LCIA 1T1JA 1S2OA 3GY0A 3Q15C 1SC6A 4FE4A 4GR9A 3ND9A 3W4IA 5IFLA 2YXLA 2AG1A 1LPAB 2HK9A 1UC4B 4PG4A 3H99A 4TS1A 5ECGC 2C7RA 4A16A 1CTQA 2XGJA 1YB6A 3IMGA 5HG0A 3NX4A 3UGQA 1Z7WA 1LS6A 4B2LA 1FFWA 4COKA 5BSFA 1U3FA 4NLLA 4D98A 2DJ5A 4L9SA 3HXKA 4KI7A 4X7MA 2GAAA 3ROTA 3UGKA 3EAFA 1A2OA 1D1PA 1CEYA 3V00A 1DVRA 1QBKC 1K3FA 2RI1A 4EDHA 4FMDB 5K8VA 3KM0A 5DWVA 4JJZA 5GQSA 5EP1A 1CUEA 3W5CA 4HRVA 1JYEA 2REQB 3VH2A 4E22A 2IHYA 3QFHA 1H4QA 1I7PA 1KK2A 3CCFA 1L4EA 1QZXA 2DPXA 2BFDB 2VJOA 3QWHA 4NCJA 2ORWA 3DXYA 3QYAA 1UZAA 2GM5A 5EJIA 3O83A 4PLVA 5LBTA 5FWAA 3JQAB 1TAGA 4MIKA 2ZYHA 3SQDA 1R6XA 3HTXA 1UH5A 2XE6A 2AD1A 2X5OA 3NIWA 2YRWA 2E6UX 3GCXA 1K88A 1XJ5A 1ZP6A 4OA5A 1JEJA 1BGVA 1M2JA 1XTKA 4NFYA 4ON9A 3RHSA 4E2XA 1L5FA 5T4HA 4YS6A 3M82A 1K6JA 3KBBA 2GILA 1GU0A 2JAHA 2OB1A 5FOSA 1VFPA 2ZSDA 4XIFA 4FE7A 4ZVMA 4GMXA 3KHKA 3MOGA 2Y4NA 3TIXB 4BP9A 4CFSA 3STXA 4PFSA 4BO0A 2O8DB 4C5BA 1WCWA 2WMYA 3GFGA 4IJWA 5EQJB 1OYWA 1LI7A 5TQ0A 2O05A 5AW9A 3CKYA 2VHCA 5SY6A 5LU8A 1QFMA 1CY7A 4JHXA 3FWNA 5SZIA 5F76A 5IZ4A 2GVZC 2AZXA 2ZDHA 4I8IA 2ZRHA 5LXTA 4PSKA 2A30A 5EZ5A 1GZ7A 2ZDQA 1F6DA 4R1SA 1Z2DA 3R3WA 3N2NA 1EUCA 1RYBA 3CUTA 2HLNA 4CIAA 4D4IA 2RH9B 3KKNA 1DWQA 3BREA 2H1VA 3P97A 2Z6QA 1TRKA 3IERA 3BOSA 3CXUA 2AQHA 4H15A 5J4LA 1HDXA 3UA3A 3HEMA 2YY6A 1YBFA 3KVVA 1U0HC 3BCSA 2OC9A 2BM9A 2A5YB 4JB2A 1CQXA 1QGOA 5EUQB 4LZOA 4DF3A 4PR0A 4G0WA 2ZSKA 1J2EA 1H8ED 1O0CA 4LXUA 1E1MA 1NLZA 1J9EA 3JZIA 3N28A 4UJ5A 5JS8A 4KAAA 1J2RA 5FA5A 1MD9A 3AJDA 1IEQA 3VNRA 1OZ0A 1XRSB 5LP6C 2EP5A 1Z6QA 3O1JC 2D1FA 3IUEA 1IWOA 5BRJA 5LXTB 2R2GA 1TMOA 2X1HA 3JQ7A 1ML4A 3ZLVA 4CIYA 5DLEA 2WB2A 4FYIA 4FNAA 4EA6A 5AICA 4FW8A 1REQB 2JLBA 1PT8A 2NTYC 1Q14A 2PLWA 1OQAA 1X8LA 1EDDA 1R9GA 3CO0S 4EOGA 1M2HA 4E3WA 2CMHA 2VQ3A 1TL7C 4TYPA 1EVJA 1E3TA 3KR9A 3LXXA 3MS7A 5KYXB 1VJ5A 1H94A 4HAOA 1E2LA 4ER7A 1ATIA 2A5FA 3G1UA 3HXPA 2XXBA 4N9WA 5EWLB 5FA6A 4EBFA 3I9LA 1SUDA 1QIDA 4QA9A 1ZEJA 4H7EA 5BRNA 3GN1A 4TWJA 4YONB 1RHQA 1Q5PA 2VSQA 1AXEA 1HM5A 1XTQA 3EIOA 3RYIA 3WGGA 1SUIA 1C1DA 3E3AA 2RGDA 1C0PA 2R0QC 4NCKA 3MUOA 4OHFA 4RHYA 4MR7A 4RSMA 4LC1A 4X90A 1M73E 1R3DA 1VC2A 3GA0A 3HCFA 1C4WA 3O8QA 1IN1A 1E4OA 1UEIA 3LT1A 4YAOA 4QEZA 2F59A 4H4EA 4HWTA 3HHEA 3RFTA 5H4GA 2IXFA 3H4TA 4YALA 2M6SA 2PT6A 4GBMA 3JSAA 4G5RA 3HCEA 1I4TD 3OIVA 4IH1A 1JECA 1N0WA 3G2LA 4WEOA 1CJBA 1LJLA 4XB1A 3RW9A 1D5WA 2HI0A 3JVIA 3VR6A 1YIAA 4OJQA 1GPYA 2IUFA 1AQ6A 1KI4A 3K7EA 4WX2B 2NU9A 1T1IA 5G4KA 4JXXA 3VC7A 2VK4A 2BGNA 4JX9A 3BJZA 2Q3FA 2HIGA 1GDHA 3I04A 2NP7A 2QI9C 1G291 4OFBA 2HEGA 4Q9KA 1YZVA 5A4KA 1BGXT 5DBHX 3MD0A 3CSSA 5LWQA 1ZJYA 2RH5A 3NAMA 3TIVA 5LQKA 3CBQA 3STWA 1VLZA 1GP2A 2ZTLA 4PG7A 4QOEA 3K9NA 4QBGB 3JQBA 4B17A 1Z45A 3GGCA 3SJCA 2G76A 1CDZA 1GTL1 1KAHA 1WDLA 2H85A 1N2IA 2BGTA 3B13B 1VYUA 2C4VA 3FVVA 3P0RA 4G9EA 3G5UA 4IG4A 3AL2A 4TYWA 2PT9A 2A5LA 2FI1A 2Q99A 2QQ0A 4ZTZB 4FZVA 1PGOA 3HJNA 3CR8A 2NU7B 2FU5C 2XUZA 4MJ3A 2WICA 4BWYA 1RPAA 1XLUA 3I6ZA 1LPBB 4I1VA 1NM5C 5BOVA 5TV2A 4EYQA 3AV0B 4DMHA 2VG8A 1R4MB 2GPTA 4JA0A 1NI4A 2B2XA 1OHHA 4AY5A 1V9LA 4QUJA 3NDRA 2HYIC 3TB6A 1E1LA 2WSIA 4L74A 5EZYB 1ID1A 4BV9A 3MF4A 2P3SA 1HUQA 1YI0A 2PFKA 4HRYA 3LLUA 2Q9AA 2ZIAA 3OOSA 5P21A 2OFPA 4A8PA 4EJFA 2Y66A 1WUIS 1JSCA 2XDQB 1EUDB 3HA5A 2WJIA 3FGPA 2VJLA 3U5ZB 3NOQA 1ZBDA 2X2FA 4MW4A 3STVA 4LGYA 2A59A 3O8OB 2UXCB 3I4FA 4ZGGA 2UXDB 3QUSA 2GZAA 4M6WA 2ZTMA 1E5VA 1N78A 2QJFA 3H11A 2ZYGA 4R1LA 2NTJA 2WWXA 4TTVA 5FBWB 4URWR 2BGUA 1T8RA 1D09A 3H1EA 4B6JA 3DP9A 3PXCX 2Z6VA 4PX9A 1EX9A 3EVFA 1KI2A 1L7DA 2FN8A 2A1UA 2CMDA 4J75A 1JBQA 3F5MA 3MMXA 3QLUC 1M7GA 3B7WA 4JROA 3ESDA 5E8JA 4IIBA 3LVBA 2BGGA 3BIXA 4J0KA 5K4AA 2AC2A 1FLAA 3RH0A 1PYDA 1B76A 1L7QA 4WD3A 5EWMB 3TI9A 3ZQUA 3ER6A 3LCJA 4EJSB 2JK1A 2VBGA 1T6YA 3KDAA 1ZI8A 2IBMA 1I30A 3EF1A 2VKQA 3DBHA 3OWXA 2JJYA 1SIWA 4DM4A 1J09A 1A5AB 1MRSA 3X2SA 4ARZA 1A7JA 4TSFA 4G4SO 4RDHA 3HNOA 1LRLA 2CK3A 1QTIA 2O2ZA 1XOIA 4QL3A 4QTYA 3SN6A 4YRFA 5DE3A 1SUWA 3VR2D 5MDHA 1VKJA 2O54A 1A7UA 2UYHA 3OM9A 1ZA1A 5G0VA 5BQOA 5CPBA 3HACA 2OB2A 4TV8F 3SEZA 4B74A 4JL8A 5HKKD 1OB2A 5A0VA 2Z2IA 2IV7A 4DLWA 3JRNA 2F8TA 5KHAA 2RC5A 4Z4GA 1L1EA 3AUYA 3KSZO 4OB6A 4HF7A 5IANA 2AE2A 5KPJA 1JFVA 3DKRA 4YRNA 5CX1B 2EFDB 3DYIA 4IIYA 4QU0A 2XBMA 3VJRA 2C54A 3AU8A 2EDAA 4I4TB 4F3RA 2VPWA 4HGOA 4HNUA 1ZISA 2GZHA 1ZMTA 4X00A 3RVNA 2H18A 5KKCA 3JQBC 3M4ZA 3HFRA 3BQ9A 5ALOA 4U3JA 2G1JA 3K9WA 5C1IA 1VHJA 1OLSB 3CCCA 2X23A 4I66A 2MSNA 2B3DA 1XIVA 1XZMA 1U7ZA 4NONA 3OM8A 4RTSA 5DMHA 2HHHB 4X60A 3TJZA 4CEIB 2ZSBA 1A77A 1KEWA 1WOYA 2GPYA 4Z99A 5A04A 3D8NA 3DXZA 3MWFA 2ERCA 5EJ7A 1JR4A 4AKIA 2AFIA 4KCGA 4Q3LA 2BFNA 2A9KA 2ZCVA 5TGZA 1FNSA 3DWEX 5IF3A 3DMHA 3TZQA 4HGRA 2CNOA 5EEHA 1Z4JA 1X74A 1P91A 2QXUA 1O5TA 4MVYA 4JQSA 5F9FA 3VU1A 4CTNA 4IGKA 3D0OA 3M5CA 4KV7A 2GPSA 3NTUA 1JVBA 1BG6A 2IU6A 4D4MA 1PLLA 3LYAA 3T1NA 3AR9A 4ZI3A 1NVVR 3FF1A 3N6XA 3DMFA 1G6KA 4XJXA 1PE0A 1ONSA 1TUEA 5CX4A 2FMFA 1S7GA 2BFMA 2GWHA 4BPRA 1O94D 4JJ6A 1Z0FA 6YASA 1NZFA 2JASA 2AZTA 2OSBA 2G4VA 3TRJA 2ZJOA 5AKGA 4JP2A 3BWCA 4XPIB 1VHLA 2SCUB 1H9BA 1VG9B 2RHGB 3A3KA 5HBRA 5B4UA 3GVIA 4R8SA 1WXFA 1XA0A 2WQ7A 4I9FA 3UXMA 2GK6A 3IYLW 4YXFA 2Z30A 3H8SA 4IL5A 1CQJB 3A9CA 4OQMA 1YZTA 5FFMA 5KS2A 5EQDA 2VYVD 1FU4A 3M4XA 4LRYA 3RAFC 3R7AA 3EBLA 2BR4A 3F1LA 5TX7A 1G0NA 1JQDA 1UT8A 3CZQA 3I0NA 4LTNA 1GPH1 4J1NA 4LXQA 5BV1A 2FN9A 2VDVE 3ISVA 3EZFA 3OEEA 1NQ5A 2OM2A 1C3JA 5CVDA 2I2BA 4BVFA 3A7DA 1GN8A 3JV7A 4R9VA 3ZXIA 4M83A 4M1KA 4UHFA 4WZAB 1KDVA 4ACBA 3QE4A 4NWIA</