3SJCA

Crystal structure of s.cerevisiae get3 in the semi-open state in complex with get1 cytosolic domain
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
349
structure length
276
Chain Sequence
TVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAECKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPase GET3
publication title Structural basis for tail-anchored membrane protein biogenesis by the Get3-receptor complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transport protein
total genus 80
structure length 276
sequence length 349
chains with identical sequence B, E, F
ec nomenclature ec 3.6.-.-:
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3sjcA00
1N5LA 2CK3A 1PJRA 1PLJA 3EA5A 3OAAD 1S2MA 3VR2A 4MKHA 4C7OB 1DAGA 4FMCF 4HZUA 2R6CA 1H8EA 2H17A 4GSYA 4Q21A 2FGKA 2ASEA 1Z3IX 2G77B 2EVWX 1LTQA 1ZC4A 1E2IA 4YXWA 2OLKA 2FPKA 2HT1A 4TLBA 4LYAA 4ZI3A 4LOAA 1QHNA 2IYVA 1MABB 1HY3A 1E2HA 1XMJA 1NIJA 1IN7A 2QSZA 1TF5A 1V43A 3RC8A 3NIBA 3C16C 1OYYA 3NKVA 1E98A 4XD7A 4AKIA 2WPDD 4LWZA 2IF0A 3BFVA 4HUQA 4KSCA 1GRRA 4B2IA 2AFHE 4DIDA 3ADDA 3MRSA 2YC2C 3T61A 1E0JA 3ZZ0A 5F9FA 1US8B 1NVVQ 3A4LA 4F93B 2LWIA 4E07A 2EQBA 2QNRA 3REGA 3THWB 1AS0A 4S35A 2ZRBA 2VF8A 3UK6A 2F1RA 3O8BA 2HXYA 3AGQA 3UIEA 3VKHA 1E2MA 4NYJR 1R0YA 2EWVA 4DEXA 4BE7B 1KI6A 1C1YA 4MUAA 3W5IA 3TAHA 2DFKB 3X1XA 4IEEA 1GILA 2AKAB 3V4FA 1OXUA 1HUQA 3ZVMA 3CLVA 4GFDA 2WVJA 5FUXA 1OKKD 4L9SA 4C0SA 5L3QA 1L7VC 1W44A 5AJXA 4AWXA 1GNQA 4JZKA 1CIPA 1A4RA 1JAHA 1E2PA 3LO5A 4POAA 1T91A 2P5SA 3KDSE 3SZRA 3WP0A 3C15C 4Q1EA 2VRWA 2ZANA 4DUGD 4Q4HA 5EZ6B 3B9PA 2QAGA 4GMXA 4RZXA 1RJ9B 3R20A 2IUTA 5TDHA 5L8VA 1GUAA 1AGPA 2O8BA 2ZRLA 2PJZA 1L4UA 3EW9A 3AF2A 4R2IA 1XBTA 1R5NA 1G3RA 2H92A 4DHEA 1Z6TA 5GJBA 1SZPA 2KJQA 1TQ4A 2O0HA 1UAAA 3LDAA 4RZUA 2NO6A 1W4AA 1MRSA 3TH5A 3WYGA 1D6JA 1GFIA 5BXQC 5H1YA 3ECCA 4HAVA 3HU3A 2GTPA 2HUPA 2QMHA 3B1WA 4TMKA 3U2QA 4PC3A 2BHRA 2V54A 2QG6A 4Q1DA 1E0AA 3L8YA 3FHTA 4WIAA 1M6NA 3BOSA 1RVDA 3NBXX 4FW9A 1VIAA 3TVDA 2WMNB 3DMNA 2QQ0A 1Q1BA 4IDPA 1AS2A 4KBGA 4MRVA 2XTZA 4F91B 2FN4A 3AKDA 1FP7A 4YMTA 1JPJA 4E09A 1G6OA 2JJ1A 4XTRA 1Q1ZA 1GKIA 1NSFA 5EZ5A 3BAFA 3LQQA 3GJ8A 3DM5A 4C2TA 1Z06A 3K0CA 2C99A 1KDOA 1ZD8A 4FMBB 2W6JD 1Z2AA 1KI9A 3H2YA 1Z0AA 3Q3JB 3F3YA 1TQDA 1ZRHA 1ONBA 1WXQA 3ASYA 3GMTA 3K0FB 4M9SA 1JR3A 1TADA 1SHKA 1SQ5A 3AP1A 3ADCA 1BH2A 1UKVY 2OG2A 4W5JA 1GRQA 5HTKA 2OFXA 5CB6A 1KI7A 4B75A 3VFDA 1BMFA 1TMKA 3M1IA 4QHTA 1N6OA 5TV2A 1AZTA 2IXEA 5L3SA 2G83A 3K09C 4YONB 3IILA 5GJVC 1TU4A 2WKQA 1E3MA 2WWHA 1OH6A 1D5CA 3I92A 1SVOA 4UNNA 2HLDA 1DADA 2V6JA 4B44A 4P4SA 4YLGA 3I62A 1W36D 1JJ7A 4MA4A 4DCSA 4JLPA 4M9QA 4HSEA 3THYB 2W2VA 4TTPA 1K5GA 4JLJA 1MV5A 1LV7A 1UEJA 3D3QA 3IEUA 2MSEB 3LWNA 4KLNA 2ZE6A 1AIPA 3PQCA 4I1UA 2FSGA 2DFTA 1X8KA 3LXXA 5F2EA 2RH5A 2O8EA 3O47A 1E4YA 2J0VA 1XTRA 2GVZC 4Q19A 2HJGA 4B71A 2BV3A 1XCGB 2C95A 1KJYA 4OQNA 1VCIA 2VP6A 3NG1A 4KV9A 4B48A 4CEHB 4YMUA 1S9DA 1R7RA 4UXHA 3SE0A 2PCLA 4DLVA 3PEYA 2CDNA 5HE8A 4Z1MA 2OO7A 2CXXA 4YDSA 4D4MA 2OAQ1 3ICEA 2IYLD 1T8TA 5AJYA 4FN5A 1N6PA 4EDHA 2C9CA 1FMLA 2J0SA 3SHFA 3OIWA 2NGRA 4B2PA 1L8QA 2NTYC 4TMVA 5DLQC 3MAAC 4ESVA 2CL7X 4A15A 1XMSA 1FZQA 2IA5A 4WOPA 2B21A 2R2AA 5HKKD 3X1YA 2CNWA 4DRZA 2FPMA 3NBZC 4FWIB 4JKYA 3BXZA 4G5SA 3VQTA 1OB5A 2QTVB 2VP2A 3AUYA 3ETLA 3GFTA 2KSQA 1E0KA 1XD2B 2QN6A 3KJHA 3P4YA 2J0QA 2J87A 3T1OA 2XOKA 5EP1A 4B3GA 2D62A 1S1CA 1LF5A 4I1SA 5FTJA 3ZGXA 4BGDA 2EW1A 4BFTA 2OHFA 3EPKA 3DOEA 4YMSA 1CULC 3UWOA 3FPAA 4UNPA 3BB4A 1ZM3A 4OHXA 3WYFA 3D6TB 4LUCA 4QBFA 3AGPA 2GAAA 2WWXA 3R7WA 2GHIA 2X2EA 2RB4A 4AC9A 1SVSA 3WRYC 2CLDX 3BD9A 721PA 3FTQA 1KMHA 4RKEA 4CEIA 1IXRC 2JGNA 2RCNA 4TL6A 1F48A 3VHXA 2R8RA 4OKSA 5D3MB 3TQFA 4ASUD 1VG0B 1G20E 3R9IA 2F9MA 3MWLA 1PUJA 1NMYA 1OE0A 3GEHA 4GOKA 1O87A 1YE8A 2P5TB 421PA 3QKSA 5JJLA 1MO6A 4BLRA 3T35A 5CJ2A 3TK1A 3G0HA 1N5JA 3VNVA 3EXAA 2VHUA 2JLWA 5FPKA 2PCJA 5DH9A 2N1BA 2WKPA 4GI7A 4HAUA 2R6GA 3BFXA 1LY1A 5EE3A 3AVWA 1P9RA 3VU9A 3U3OA 5DI3B 2G0TA 3FMIA 3QF4B 4MGKR 3PUVA 3PIRA 1KI4A 4IKEA 4A1FA 1M7HA 2ZSDA 4KSBA 4HB0A 1R6BX 2XB4A 1Z6AA 2VHJA 5IK2A 3EWAA 2PMDA 4DB4A 4Q7LA 1MOZA 3AKEA 1CJKC 3EA0A 2MMGA 4DLUA 4TL9A 4LK2A 3KJIA 3QEOA 4Q4JA 3VNUA 2ZTSA 2BM1A 1FMJA 1TQ2A 4JSYA 4JYBA 5FR1A 1XU4A 1Z0KA 4GT1A 1II0A 3LRPA 1F2TA 4DB2A 5K8UA 1Q1EA 4UNRA 1SXJD 1VYVA 2QPTA 4H1UA 1SHZA 1Z6YA 2VP5A 4HI0E 5DN6D 4M22A 4D4JA 2ZRMA 3U61B 3GLGB 2WSSD 4B3FX 2QP4A 2CL0X 3RS0A 3QVVA 5AK0A 2JA1A 1II8A 1SVLA 5TMPA 3ND8A 5FTMA 1ZNYA 4AG5A 2BMEA 2IBMA 5GADl 4WAUA 3KTAB 1E1QD 5KNCA 4LJAA 3GLIA 5FOTA 2G1KA 3PVSA 3WRXC 1Z2CA 1I2MA 2OEPA 1P73A 1G17A 1E94E 2X8AA 2F3RA 2ZSBA 3I8XA 1G18A 1LFDB 1T5IA 2YWHA 3OIYA 1Q12A 4PHFA 4D2IA 5JI2E 1KJZA 4A6PA 3R9WA 3PUZA 4YMVA 3QXHA 3OFNA 2D06A 1R0ZA 4A0GA 4S2EA 4QJ3A 3K53A 1SGWA 2AR7A 2FSFA 2C5LA 3IO3A 5FR2A 1MO3A 4II7A 4Q9KA 3UMSA 3ONWA 1A2BA 4CEJA 1KOFA 1RZ3A 2W6ID 5J4HA 4PQYA 1U8YA 1U9IA 4B2LA 2ZR0A 4FMDF 4O2LA 3WBKA 4TLCA 1E9AA 1CF4A 3LQRA 4B3BA 3K70C 4JLNA 2GWHA 1RYFA 1E2GA 1NG1A 2V8OA 1ZVQA 5GJWC 1UM8A 4EAQA 4M1SA 4Q9IA 2F3TA 1YVDA 3TKLA 1HQYE 2O8FB 5E4FA 2Q6TA 1Z47A 2HJVA 3K0AB 1RW4A 3LW7A 3ZZTA 5B30A 3SC3A 4D25A 4V0LA 4JKIA 1EFUA 1JECA 1W5TA 4GPTA 2B8TA 2VO1A 1GAJA 2J46A 5BWMA 1YZKA 1T5LA 1JB1A 5F3WB 1E2NA 2O8DA 3UMFA 1W4BA 4W9MC 3LX5A 2E87A 4NKRA 3X1DA 2QEQA 2F43A 1RFLA 2BCGY 4M4SA 4DC9A 1G3QA 1KKMA 2JIZD 3RS3A 6Q21A 4LGMA 1AKEA 1T8UA 2A5DA 2XNDA 2ZI7A 1ZIOA 5FPTA 1T4GA 1OIWA 1Q44A 3BK7A 3SYLA 4QG7A 2RGEA 1ZUNB 3IHWA 3M0EA 4ILEA 621PA 4Y0AA 3B1YA 5CM8B 3CKLA 3GP8A 5JLJA 4TQ9A 4C30A 5EE5B 2BBTA 1IY1A 3V00A 3U7HB 3ZQ6A 3AF3A 2OFOA 4L9WA 2QMEA 4DLTA 3Q9LA 2R62A 4LJ8A 4RCYA 1W0JA 2J7PD 4MITA 2JJ2A 3IHLA 2QA5A 1HYQA 3GLHB 3O8RA 2OBMA 2GCOA 2FWRA 1XEXA 1ZP6A 2ZAMA 3THXA 2GJSA 1G8FA 2D74A 4D81A 1FX0A 1XXHB 2IYWA 3ADKA 3F0TA 3NEJA 2P6RA 3PV0A 3GLFB 2ERXA 2ZJBA 5HZKA 4MQBA 4KFRA 3IGFA 1Z0JA 2RGAA 3KQUA 1AQUA 1Q3TA 2XSZA 4BZQA 3ZYCA 1CS4C 2B7CA 2GF0A 2RAPA 2RGGA 2KBEA 2ZQ5A 4GZLA 4AI6A 2N46A 2A5FA 4ESHA 4C0BA 2AN9A 2DY1A 2GZHA 1X1RA 2WJVA 5JEEA 2NPIA 3Q7PA 3THOA 2BBWA 3QKTA 2AX4A 3Q85A 3X1WA 4CW7A 1FW6A 4FXPA 5DYIA 4Q1CA 1R8SA 4BASA 1P6XA 4HATA 3WHKA 3OEHA 5SZJA 4NCIA 3FB4A 4H9GA 4QNRA 4TSFD 3K9HA 2VEDA 1OH5A 1YR7A 1OPXA 3IO5A 1CLUA 2PEYA 4HEJA 2MMCA 4PAQA 4ZIRA 4F92B 2WHXA 1NIPA 3KKMA 4K81B 2EU8A 2WAXA 3T1QA 3C8UA 1WMSA 4US1R 2OCYC 1N6IA 4AYTA 4IVQA 4JYCA 4W5HA 1MT0A 4KVAA 2W83A 4FCWA 1R10A 2R6FA 3SBDA 4V03A 4XH9B 5B2ZA 2G9NA 2GKSA 3AQ4A 1ZCAA 3PUWA 3SJAA 5KSPA 2ERYA 2SHKA 3SFVA 3I8SA 5FPSA 2VYFA 3GLIE 2FDCA 1HV8A 1GM5A 3GJ6A 1U8AA 1FTSA 3PEUA 2VIIA 5G40A 2PJRA 1WE2A 3LLUA 2NPFA 4NHOA 4BEBA 4XIGS 1KSHA 4WVFA 3PITA 1RPZA 5F9HA 2B92A 4JVSB 4DSUA 3U3MA 2X2FA 2DBYA 4B3CA 5J4LA 3KX2A 3T5GA 4B6FA 1LVGA 1ZU5A 2ZRGA 1RRGA 1XRJA 1IN5A 3WHLA 4ACBA 3A36A 1D2EA 2YOHA 1IN6A 2Z5FA 4JLVA 4EJSB 3U6BA 1KZ7B 4KYIB 2IC5A 3C5CA 3P20A 2IYQA 3SN6A 2J1LA 4DDVA 4RD1A 2AKYA 4LJ7A 2R9VA 4NE2A 4BZPA 2C77A 1GL6A 3RRYA 1YZUA 1FNMA 4HDQB 2F6RA 2YV5A 4LV8B 3S1AB 4BQSA 2KB0A 2WBLC 2YC4C 3RDPA 1HH4A 4QJ4A 1WDTA 2AXNA 3W3AA 2XGJA 3CPEA 4CGZA 3EIHA 4U00A 3ADBA 1GWNA 2AWOA 4IOLA 3MGCA 2IK8A 4B32A 1F3OA 3W3ZB 4C7OA 5AUPB 1K8RA 1QRAA 3KQNA 1KY3A 3CPHA 2IS6A 2ZRIA 3IBGA 4IVPA 1ZJ6A 2I3BA 2NG1A 1F2UB 1W0KA 4NYJQ 4D0NA 2IYSA 1X1SA 5HCNA 2P2LA 1ZCBA 4JL8A 1COWA 1FUKA 4HAYA 3G82C 5BW8A 1CRPA 2DYKA 2GK6A 1NI3A 2FFAA 1EGAA 1E79A 1MABA 1I2DA 2R44A 2RGBA 1VYUA 2QL6A 4M1MA 4JT4A 1I4DD 3EWSA 3R8CA 2ANCA 2V1XA 2AFIE 3LD9A 3LLMA 1DS6A 3HU1A 3NEYA 4RD6A 1QHIA 4EFLA 2DWQA 1BKDR 1OLOA 5CM9C 4PSAA 4LYJA 4MYCA 4C0JA 2RGDA 1AK2A 1XCPA 2GBLC 4LJ5A 5FL3A 3QBTA 1XTSA 5K8IA 3AVQA 5UKDA 1OXTA 3CBQA 3WNBA 1US8A 1FNNA 2CE2X 4B73A 1R5OA 5LD2C 1W4CA 2VH5R 3THWA 1W36C 4JL6A 4PHTA 5FBVB 1NG9A 2NZJA 2XTMA 1DO2A 4M9XA 1B0UA 1G21E 2H18A 2J7KA 3AF1A 3U44B 1EX7A 2H5EA 1ELOA 2BJVA 4N1AA 5TXGA 5EJEA 1CR4A 1GIAA 1S3SA 3K70B 3EAQA 2Q9CA 2ZI3A 4Z8YA 4TQAA 3SFZA 2H1LA 1U0JA 4US0R 2C8VA 1JNYA 5BQ5A 2F1JA 1H65A 2IXGA 1XJ0A 2D2FA 4R2HA 1KKLA 4AD8A 1GSIA 1H8HD 2QE7D 5EE0A 4D6PA 1KJWA 4M1OA 2EYUA 1P9NA 3MCAA 3GFPA 3NH9A 4XSGA 4EPTA 3TMKA 4G0NA 4B33A 5JFGA 2UKDA 1T6NA 4IVRA 2GETA 3L8ZA 2GEDA 4NZYA 2QU8A 2ZS8A 3P1JA 4ZDWA 4WBSA 4Q4AB 4DDWA 5FBQB 1QHHB 4BLOA 3T5DA 5EE1A 1EFRD 2Y8EA 4N0DA 3RANA 2RGNC 5HZHA 4G3XA 1GNPA 3LBHA 2G3YA 3P27A 2WOOA 2G1JA 3QI2A 2CK3D 1M34E 3K1JA 2Q9AA 2QAJA 1UF9A 4RD3A 3SHWA 1XZPA 3AF4A 3L0OA 4WZ6A 4DLWA 1A1VA 1H8ED 1FQKA 1GITA 2VPPA 5JWRA 2QT0A 4FIDA 1QDEA 1KI1A 1JJVA 2DPXA 1ZNXA 4YXWD 5ELXA 4GBMA 1W1WA 4PQRA 5EXSA 3NBYC 3NHBA 1N0VC 3O8DA 3SQXA 3AV0B 1E9FA 4Q7JB 5CYPA 4HYYA 2VLIA 3EPJA 3KFVA 4NP6A 4QJ5A 3CX8A 4ZDIA 2FU5C 4PPQA 5CJPA 3VHLB 1E69A 4WW0A 3SI7A 1Q57A 2ZJ8A 4L16A 4DSOA 1AQYA 4XD7D 4QM7A 3AKYA 4FINA 4EPYA 3I32A 5E7MA 3AVUA 4QHSA 4P32A 1RKBA 3A8TA 1SKYE 1Z0FA 5JSZB 4QHYA 2PZEA 1YZQA 3IIMA 3IDQA 3K0FA 1D9XA 3QIAA 3H0KA 1W5SA 4BFSA 2C2HA 1D8TA 4EPVA 2QBYB 5TY0A 3PENA 5D3QA 3L2OB 4MRSA 3VTKA 4QFMA 4F4CA 2ZE8A 1TF2A 5HE9A 3CPJB 1RC8A 3IIJA 1J2JA 1L4YA 3CW2A 4OHZA 4JLAA 4ZI2A 1ANKA 4O3MA 4Q66C 3KQKA 1BYUA 2DFLA 3T12A 4RZ2A 1Z6XA 4JLOA 2OFWA 4PSVA 5SZIA 2WIBA 1XCMA 2XITA 3TUIC 2VP4A 3T1VA 3ZIAA 2V4ZA 4I4LA 1OV4A 5JMTA 4ITRC 4L15A 4LDJA 4JLDA 1K5DA 4TZ0A 4A2QA 2EFCB 3TSOA 1ZM7A 2BBOA 2FEOA 3QG5A 2ZITA 3THYA 1CJTC 2IF2A 4IXMA 3KFXA 4B74A 4DWJA 4JIMA 2HV8A 3E5HA 5DIFA 5JHGB 1VHLA 1G5RA 1XJQA 2GJ8A 2CCKA 2NIPA 3G5UA 1VCMA 5EE9A 1I4TD 3W5JA 2O8CB 2I4IA 3GD7A 3B82A 1G7SA 3U4QA 2BIFA 4V0OA 1UJ2A 1XPUA 4IDNA 4CEHA 4OJQA 3GJ4A 1D2NA 4K8OA 4LRWA 1DAMA 3LY5A 3MWKA 3TSZA 4JVNA 5CDFE 1A2KC 1XJCA 2ODEA 4KAXA 4LV6A 5DGXA 3KKOA 1JPNA 5KU1A 3WNCA 1BO6A 1NY6A 3LW8A 5BN4A 2E9SA 3QENA 5JI3E 4HDOB 3W34A 1KSFX 1TX4B 4TTRA 1F60A 2ZSAA 1Z28A 3QG1A 3EZ9A 1A82A 5FBWB 3AVPA 4M2LA 4ZPXA 3SEAA 3QF7A 2JJ1D 3CM0A 3LH5A 2LCFA 2FFHA 3HDTA 4HB3A 1M8PA 4G01B 1II9A 4ZCMA 5EP4A 2OV2A 4Q4HB 4DSNA 1J70A 2KI5A 5H70A 5E95A 4G5RA 2VSXA 1NVVR 4TYNA 2CJWB 1NKTA 2MSDB 3QSYA 2JLQA 4JLBA 2GA8A 4JS0A 1XD2A 1DTSA 1C4OA 1E9DA 1SKQA 2ORIA 4FCTA 1VKJA 4DT1B 5HPYB 1JR3D 4EIWA 1OB2A 4LHYA 1F6BA 2FGJA 2ZAOA 5A5GA 2O0JA 2Z4SA 1A5TA 3AP3A 2ZRNA 4IXNA 2VSOA 1YZTA 4BLPA 4M1TA 1BMFD 1W46A 4NBSA 3WBJA 1E4VA 1KAOA 5JEDA 5IRCD 4OHYA 1PZNA 1Z0DA 4BFYA 3LAWA 2PZGA 1XMVA 2BEKA 3FKSA 2WJIA 3HYTA 1GP2A 2JEOA 3FOZA 2ZR7A 1KK3A 3VAAA 4DKXA 1KK2A 2HLDD 1OXXK 2GXAA 3K9LA 3QVUA 2X19A 3MG9A 4QOSA 5D3MA 4P0TA 4M9ZA 3LXRA 1DG3A 3Q8XB 2ZETA 5FOWA 2PZFA 1N5KA 2DCUA 3WP1B 1GRNA 2V7QA 2EWWA 3PCRB 4PR0A 2CCGA 4F4JA 1KAGA 2FSHA 1P72A 1TF7A 1WF3A 3NC1C 4NYMQ 4V0ME 3AEZA 1KK0A 1XTKA 5DYGA 3QKRB 4Q48A 3D31A 3SJCA 521PA 3CZQA 5LD2B 4OL0A 4NONA 1W36B 3HPRA 4EPRA 4PC7A 4A36A 3AB3A 5FUWA 1AA9A 4OI0A 4U5XA 2NQ2C 1VG8A 3KZ1E 3OESA 5DI3A 821PA 3QF4A 1ZM2A 1MKYA 221PA 3B8HA 2V3CC 1E9BA 4A82A 2ZEJA 4Z1MD 4Q01A 2FPLA 2FA9A 3I5XA 4OQMA 4RD2A 4KODA 3E2IA 3HP1A 3PUYA 1RYHA 2BDTA 2QTFA 1KIMA 1KO7A 1GTVA 3PXGA 3PG5A 1W48A 2QRNA 2ZJYA 3F8TA 3LVQE 2GDJA 1NJFA 2NO7A 2ZE7A 2BM0A 1UDWA 3W8NA 3P4XA 3N2EA 4HLCA 3HR8A 5LB4A 3L0IB 4R98A 2WV9A 2ZR9A 1W7AA 4TWZA 1W4RA 1Q0UA 2CNWD 2FSIA 4PO8A 5AJZA 1M7BA 4A8JC 1IY0A 4ZCLA 4CRWB 3FGNA 1E2LA 4P3YA 1DO0A 5G53C 3VMFA 4Q4LA 3GLGA 4DLYA 3NDPA 2XOKD 1G291 1G3UA 2YWFA 3SS8A 2DHRA 1VHTA 1D2MA 4QC2A 2Z43A 4D4LA 4PC2A 3CONA 4E22A 2ZRHA 2V6IA 2REXB 5CB8A 1SVWA 3KTAA 1TUEA 1E96A 3Q5DA 3ZVLA 2RGXA 5DI9A 2XXAA 1GG2A 2Z6VA 3TUJC 5JJKA 4F7WA 3SNHA 1KSJA 3WMFA 4PC1A 4QBGB 2AD5A 3ZS8A 1ODFA 2ONJA 5HCIA 3WY9A 5KUTA 3FMPB 2ANBA 2GXUA 2Z83A 4MKFA 4DBLC 4YQFA 2ZI6A 2MSCB 3A1UA 4TTQA 2A7QA 3VR3A 2IEYA 4ZKEA 1M74A 2P67A 3HPQA 1ZD1A 4QKQA 2GVDC 3DDCA 4EJSC 1XDBA 2WAYA 1TNDA 3L82B 2V9PA 3B85A 1EWRA 2OESA 5LB2A 5FI1B 1E1RA 4TMZA 1Z29A 1CU1A 2OSBA 1P9WA 2VP0A 1NBMA 4NDZA 3RHFA 3AH8A 1KGDA 2QTHA 1NF3A 4WXPA 4PZZA 4LBZA 2Q9BA 1E2DA 2NZ8A 2ZSEA 5FOUA 2WM9B 1GNRA 3OE7A 2QZ4A 3CZPA 4CT5A 2CLSA 2XAUA 1X3SA 1E6CA 1CEEA 3DKVA 1CR0A 3HYRA 4R9UC 2P0EA 5DHFA 3QXJA 1GKYA 2Q3HA 1S3GA 4RCZA 2O8FA 3K09A 1M1YE 5IK2D 4JJZA 1E2EA 3K0AA 1TL7C 2ZS9A 4HLDA 2WJYA 4GNKA 4LHWA 4NTZA 4Z54A 5KNBA 1QVRA 4P4TA 2XZOA 2CL6X 4URUR 1YKSA 3BH6A 4RD0A 2D7CA 4LZZA 4UQOA 1G5TA 4LPKA 5KTYA 3PJRA 5C4GB 1G3MA 1QHXA 3TGPA 1XTQA 5KYKA 1NLFA 1U0LA 4DIEA 2ODWA 4M0LA 2HF8A 4LBYA 4MDEA 1Y63A 3PEWA 5BN3A 4D26A 3VX4A 4KO8A 3GJ0A 2CEAA 5KO2A 4LJ4A 3RS7A 2O0KA 2ZUDA 1W2GA 1YR8A 5C1BA 1EFCA 5IDVA 3SDZA 2ORWA 2GK7A 3Q5EA 3U7GA 1I4LD 2VTKA 2PT7A 1KDPA 4XTCS 3RS2A 5H8WA 4TT3A 2XX3A 5J4VA 4TYYA 2WWGA 4FWTA 3CX7A 3K0EA 2IWHA 1SXJB 2NO9A 5KSYA 3CB4A 2EFEB 1D9ZA 1X8LA 4MGYR 4EPWA 1L2TA 4D82A 3GLHA 3HWSA 5CITA 5A0FA 4TL7A 2QI9C 3K9GA 4QBIA 4C0HA 1JALA 3TLXA 1XXHA 3UWKA 4JT2A 4NYIR 4LPSA 2IEZA 2W0MA 1FFHA 3CRVA 4PPGA 3QXCA 3AVOA 1OIXA 5FOXA 4MRPA 4GZMA 1S0UA 3OFND 4GOJA 1G8HA 4RSGA 4N0EA 3A1WA 3LNCA 3KJGA 1XPOA 4IEIA 4RFSB 4NMMA 2JDIA 4QM6A 2A2ZA 2JLUA 1IQPA 1HURA 1F2TB 1QVAA 2RHMA 3TR0A 3CWQA 4UJ5A 5M04A 2D7DA 2WWFA 2AHOA 4P31A 2A78A 3AM1A 3TUZC 2IS1A 4BFUA 5JCPA 5AWFC 4AK9A 1MH1A 5H68A 4G5GA 4HDCA 3AF0A 4JJKA 4OHWA 1OFHA 2YOFA 4C3ZA 2FJUA 2GEUA 3B7GA 2BOVA 4EPXA 2O5VA 3ZS9A 4AURA 1DBSA 2ZJOA 3KXIA 5KSOA 2ZYWX 2ZYTX 4UJ3A 1T3SA 2EYQA 3I72A 3GLGE 2NO1A 5CIWA 3RSOA 2BKUA 4TYWA 1PV4A 3FKQA 4TMXA 3CR7A 1SVMA 4HLUC 4LI0A 1ZYUA 3DMDA 3N5CA 3CX6A 5BN5A 2FFQA 3QPVA 2FZ4A 2DR3A 4E5UA 2OXRA 3QBVA 2WOJA 1GDDA 3ZVRA 4OK5A 2F9LA 4NL4H 3UATA 2B8WA 4Q1BA 2XNDD 3J81k 3GEIA 4B47A 1T0JB 2OUKA 4DSTA 2IT1A 1IBRA 1Y3AA 1ZNWA 1UPTA 2H7VA 1G16A 2WKRA 1DVRA 5SZHB 3RNLA 4A0RA 4B3XA 2KWIA 4OYHA 2ZJ2A 3EZ2A 3O8CA 2Q0HA 2YWEA 1W0JD 3NDBB 2JJ2D 2IUUA 3MLEA 1S8FA 1NBME 3GEEA 4AKHA 1P60A 2YYZA 4W5WA 5KDOA 4M1WA 4BFZA 5J4YA 2EFHB 1Q3HA 2P65A 4NPHA 1YU9A 4KCGA 4OK6A 2QGZA 4C2UA 2ZRPA 4M1YA 4MH0R 4Y0VA 1OHHA 2ZS7A 2G6BA 2IUSA 5E7JA 3U60B 1DARA 4E03A 2RHDA 1DAIA 1R2QA 2GZAA 4FMCB 1OSNA 2XSZD 2F43B 1IN4A 3BGWA 4A8JB 1GKUB 5FL7A 2JLZA 4TYQA 5KHOC 1S4QA 2Z4RA 1G4AE 1ZUHA 2HYDA 2BEJA 2R6DA 3QJYA 4LY6A 4MGIR 1TAGA 2GCPA 1NY5A 3DKPA 4C0QC 5KOYA 1WBDA 4OHVA 3NWJA 1BIFA 3P26A 4MYTA 1W2HA 1VMAA 4NCHA 2FF7A 1J8YF 4BZXA 2OLJA 4CIDA 4PFSA 4D0GA 2YVUA 3CF0A 3KXKA 3OEHD 3SU8A 4KYUA 2I1VB 3I1FA 3AP2A 1JQLB 4B6EA 2BMDA 1Z08A 3OEEA 4BFWA 3C5HA 5BYKA 3TNFA 1IY2A 3JVUA 1Q1QA 1VDZA 1HA3A 4URXR 2J45A 5LDDC 1AN0A 3MWJA 4N3NA 5FUVA 3LV8A 1XEXB 1AZSC 2IYTA 4Q1FA 4TLAA 3UMRA 4C4PA 1G1MA 1OT3A 3GJXC 5GVSA 1FX0B 3I73A 3L0SA 4OQXA 4Q03A 2WWYA 3EARA 4I99A 3L43A 5AR1A 3WYAA 1P3JA 1KSGA 3SJZA 1G3IA 1NLZA 1KNXA 2VQSA 1PVOA 1CJUC 3VKGA 2VHCA 1G7RA 4GL2A 5B58C 1G64A 2FH5B 3QPWA 4R71A 1HQCA 2QAGC 3GLHE 5JRJA 2X77A 2VA8A 3W6PA 3U44A 3AVVA 3IQXA 2AK2A 3FYHA 1EK0A 3CR8A 1AGRA 1XXHE 1ZW6A 3FMOB 2OZEA 4QXAA 4FI3C 4ARZB 4JBYA 1OFTA 5KDLA 3EIEA 3GLFE 5JCZA 4QGGA 3C7KA 2FE4A 4LC0A 3B6EA 4NCJA 4A4DA 3R8FA 3FFBA 4PHHA 3K8YA 3UKDA 4KVGA 3DM9B 2ZYUX 5JBQA 2ZJAA 2XNSA 1KO1A 1X86B 1N6NA 2OT3B 3LFUA 1XF9A 2IHBA 3TQCA 1OJLA 4CF7A 2KBFA 1U2RA 4JMPA 1KO4A 4DCVA 3EX7C 3SQWA 4ZIRB 3T15A 2IWRA 4JLMA 1XEWY 2YINC 2OE2A 3F5FA 1YRBA 2R65A 1R0XA 4OBEA 1XTJA 4TL8A 3U5ZB 4URWR 5CLLA 3ZH9B 1QHHA 1CBUA 3TIFA 2PLFA 2REOA 4B34A 1NP6A 4KLZA 5K8TA 1Q22A 3CNLA 2VSFA 4XSHA 5LPNA 3ZZUA 1N6LA 5CDFA 3SOPA 1VCOA 1ZBDA 2IHYA 1XZQA 2YOGA 3U3KA 1JR6A 3K0CC 4URYR 2AXPA 4PSKA 2DWPA 1IJEA 4A2WA 4DLRA 4PANA 2V1UA 1W0KD 1KO5A 5AJVB 1COWD 1F5NA 4C9BA 3DZDA 3WNDA 4YDHB 1MO5A 4EKDA 1E79D 2GJ9A 2H57A 4Q9HA 5DO9A 2JASA 2VL7A 3OAAA 2IYZA 1B23P 3KQLA 3CH4B 4IOMA 4LHVA 3U3JA 4URVR 4LX0A 1KI3A 1NMZA 2LKDA 1E9EA 4TMTA 2FOLA 4EQ6B 1NN0A 2HXSA 2B7BA 3RSLA 2ECKA 4LYHA 4GOXA 4MKIA 4TQUS 4TZ6A 5JSZA 1LS6A 4Q00A 4OJKA 1KK1A 2K5UA 4BFXA 1ZD9A 1IAQA 1IXSB 3NTUA 4FD2A 3GQBA 4HUTA 5KSZA 4PQFA 1RJ9A 3RVBA 4IJMA 2CE7A 2QBYA 1CKEA 4UNQA 4GRAA 3MUFA 2WPDA 1CR1A 5HR5A 2QENA 4KHZA 2CBZA 2J5XA 3FWYA 1LB1B 3M4YA 2WWWA 3SBEA 1ZM9A 3CH5A 1E9SA 1U94A 4BLTA 1FPMA 2WZQA 1G8YA 4Q18A 2ZI4A 4DDUA 4Q5IA 1G4UR 4EFNA 5B64A 1KI2A 2KE5A 1XPRA 2GF9A 1SULA 1UBCA 3BWDD 2XEXA 4CZ2A 4V0MA 4LBWA 4RJLA 1CJVC 1P2VA 2QM7A 1OKKA 3NC0C 1AS3A 2VHTA 1ZC3A 3QUSA 3IEVA 1EFTA 5L3RA 1E9CA 121PA 1WBBA 2O8CA 2ZI5A 4J0QA 4QGFA 1U81A 1ZNZA 3VR4A 1NKSA 2GILA 3C14C 3U7EB 1XEFA 1W47A 4MYHA 4C0KA 4DUGA 3MWYW 3T34A 1XB2A 3QY0A 1UKYA 2GEVA 2ODNA 5CLQA 1JEDA 4CVNA 1Z0IA 3E70C 2QP3A 3I61A 1UKZA 3T06B 1Z5ZA 2NMVA 5FPYA 3UG6A 4A9AA 1RRFA 1G19A 2G0NA 4A6XA 4OQLA 1KZGB 2GESA 2J0UB 4DLZA 1T0HB 1XD9A 3P32A 4PAMA 3GJ3A 2OXCA 1N6RA 2QMOA 2G88A 3ZQJA 3BFKA 1KI8A 2Q3MA 3AKCA 1JEEA 1DAHA 1T9HA 3H84A 4RVCA 1U99A 3CRW1 2JLSA 3UPUA 1GOTA 2GJAA 3X1ZA 5FBLB 4HZUB 4AKEA 1FP6A 4JBWA 4C0AC 1DEKA 3DEFA 4QGHA 3GJ7A 2D2EA 4LHXA 4XWOA 3B13B 3DPUA 5E7IA 2QRZA 1KNQA 2CJWA 2ZREA 3D7MA 4CT4B 5EP3A 1PLLA 2W58A 4DT1A 2WJHA 3EZ7A 1LW7A 4OK3A 5ANRB 4RFVA 1N6HA 3KL4A 2WJJA 3DL0A 1OIVA 1DAEA 4F4IA 1IHUA 2QT1A 3C41J 5P21A 4HUQB 5EXTA 2V55B 3BBPA 3EG5A 3OF5A 4B76A 3I4LA 3H1TA 1CR2A 1VG9B 2W6JA 3NHAA 4U02A 1T3HA 2XTNA 4DCNA 4I1VA 1Z8FA 1BS1A 2A9KA 4KFSA 3EZ6A 4Q7KA 2PEZA 3JZMA 3ZIAD 2JAQA 5J4KA 3EASA 2C96A 1RIFA 1SXJC 4OQFA 1KI6B 2OAP1 3TBKA 5FPHA 3NBFA 3VR5A 4B3DA 4PZYA 1DAKA 4TLEA 5L3QB 2WIAA 2CHGA 2C78A 5FFMA 2J41A 4HLQB 2GBLA 3U3RA 1YJ5A 3VR6A 2L0XA 1MR3F 3FMFA 5G3YA 5FOSA 2W2TA 2N42A 3QKRA 5EXPA 4AYWA 2W00A 3PR1A 3QKUA 3CRQA 4KFTA 4LYFA 3SJBA 1PUIA 3PUXA 3KKQA 2BVNA 2QAGB 2DB3A 2C04A 3X2SA 3RRMA 4ZDKA 3B9QA 2O8BB 3N70A 4Z8XA 3A4MA 4IDOA 4P33A 3E1SA 3U7FB 1CXZA 5IT5A 4LJ6A 2ATVA 5J5CA 3DOFA 1OXSC 3KUDA 4LCBA 2HYIC 3LA6A 5DSZA 3GCGA 2PLRA 2CHVA 4NH0A 3A58B 1A7JA 2UZIR 1U90A 5JRZA 4L8GA 1OW3B 3N2IA 2ZRFA 1R4AA 2CVFA 3U6KA 4M53A 3V4RA 3FE2A 4ERNA 1NVXQ 1WP9A 3CRMA 2QPAA 1P61B 4IDHA 4PAOA 3W9YA 2RKOA 5KNDA 4ZV4A 1JXOA 2FEMA 3I5YA 2IL1A 1VTKA 1TEVA 4DCUA 4KJZA 1ZINA 4HB4A 3DVLA 4PZLA 4BEJA 5IHPA 3EPHA 5CIQA 2RGNA 4D4KA 4ZDJA 2VHQA 3MJRA 4KU4A 4NCNA 3U4QB 3D8BA 3HU2A 5FTKA 4GDFA 1XD8A 4LJYA 5JHHB 1G7TA 3I3SR 5HKKA 1YR6A 2AWNA 3KKNA 5TARA 3OIUA 1VECA 4HB2A 5L3VA 4OI4A 3FKSD 3ZD6A 5JJIA 2VBCA 4IFEA 1U9IC 3RLFA 3QE0A 1E0SA 4PPFA 1K6MA 3VX3A 2H16A 3QQ5A 3REFA 2GJKA 1S9HA 2IYRA 1CJMA 5CK4A 2JLVA 4AKGA 3B78A 4LBVA 4PXAA 1YZGA 1NN3A 2EFGA 3QOFA 4RKFA 5C46F 1XP8A 3MSXA 4X8MA 2XB2A 1EWQA 2IXFA 4KXFB 2OILA 2F55A 1P2TA 3BIFA 5L3SB 1LNZA 1N5IA 4FMDB 2V7QD 2CHQA 3RAPR 3OIVA 1XTIA 3TW8B 4F38A 4O2RA 4ZKDA 3B2EA 2FV8A 4M1KA 1UBEA 1NMXA 2PX3A 3BC1A 1C9KA 3B60A 4XWKA 1X8JA 3EC2A 1WQ1R 4P4SB 3VR1A 5C4MA 2JJ8A 1VPLA 2C9OA 2BJWA 2HF9A 2YZ2A 4ZO4A 3MJHA 1SVKA 4ASUA 4BFVA 3FHCB 5J40A 1E32A 2ATXA 2PH1A 3HJNA 3W6OA 2A5JA 1OYWA 1E2QA 2FX3A 1EG7A 2YHSA 4BUJA 5TB5A 2YNMA 1IJFA 1LS1A 3EPLA 4LV5B 2WSMA 1SVIA 3ZDQA 1W49A 1FOEB 4GMDA 2FG5A 3TR5A 3DZ8A 1G9XA 1AM4D 1G41A 3ASZA 2UVQA 5FH9A 2JLYA 2O8EB 2PBRA 1EFHA 2OBNA 2ONKA 5FI0B 5J47A 4KI0A 3RS5A 3FHOA 4HZIA 2FNAA 4RD4A 1P75A 3GFOA 3RWMB 1S96A 1NL3A 1UBFA 1BOFA 4WA7A 3H4MA 4LHZA 2QMUA 2JLXA 4GP7A 5KDDA 1VYTA 4NYIQ 1AJEA 1DAFA 4O0MA 2VP9A 2A5YB 4I1OA 3WMGA 4UKDA 1FQJA 1ZU4A 2PX0A 2J3EA 5KPJA 4CYMA 2ZIAA 1ZMXA 1ESMA 3W8RA 3QNUA 3BORA 2ZSFA 3W90A 2ZVPX 1P62B 1Z6GA 2ZUCA 3K9NA 3OZXA 3EZFA 4AY2A 4DVGA 4QNMA 1QHYA 1OH8A 4A0HA 4PTLA 4DJTA 5JWOA 4PHGA 2TMKA 4JVLA 3CIOA 1YQTA 3AVYA 4IW3B 5JWHA 1SXJA 1VIYA 1HT1E 4L5BA 1QG2A 5DN6A 1XX6A 4IHQA 2WSSA 3A1SA 4X8OA 3ZD7A 3IQWA 4RZ3A 4DCTA 2ZU6A 3GPLA 3WXMA 3A6PC 5F98A 1UFQA 4P4UA 1N3BA 1IN8A 2BBSA 2Q3FA 1QBKC 2HT6A 4XOIA 3A1TA 4BECA 1HE8B 5A4JA 1KTVA 4JL5A 1GL7A 1YZNA 5C2JB 1JR3E 1E1QA 2IS4A 2AL7A 1QHSA 2GRJA 3R7WB 4MRNA 4BPBA 1E1RD 1E2KA 2AD1A 3T1TA 4MDFA 1M2OB 4RFSA 3IKJA 4NYMR 4TYPA 3GJ5A 3ZLJA 1WRBA 2BWJA 5BYJA 1NBMD 1IXZA 1KMHB 1P5ZB 2QGNA 2IYUA 1RRCA 2BKEA 4CEIB 2W2XA 3OHMA 1NSTA 4AG6A 3OE7D 3IBYA 2CCJA 2QSYA 2ZROA 3IPYA 1VG1A 3CNOA 1RRPA 1J90A 1MO4A 3FDIA 2NO0A 3NVAA 3PFIA 4HAZA 4YMWA 4XWAA 3QKSB 1WA5A 1P2SA 1FL9A 2XZPA 3CWZA 2I1QA 3V9PA 4EUNA 1Z22A 3TW4A 5IF9A 5EUMA 2W6IA 1YZLA 5AJWA 2UZ3A 3W6NA 2XXAB 2A3RA 3VU9B 3LX8A 3QEJA 1KO8A 3KJEA 2WWIA 4A2PA 3B5JA 3ND9A 2ZU0C 5G3ZA 3RC3A 1YHNA 4WXRA 4HAXA 4A92A 1Z83A 3BS4A 1KY2A 1G8GA 4URZR 2JLRA 2J59A 3NXSA 3A1VA 2FZLA 2GZDA 1JBKA 2FMXA 4ON9A 2HEIA 4G5OA 2C98A 1NN5A 2ZRCA 3CUEF 4D80A 3KUCA 5LBIA 5JS7A 1FTNA 4EFMA 3ZVNA 3GLFA 4K46A 4Q4JB 3BJIC 2OM2A 4LSGA 1ZUIA 4OI1A 3LBNA 4BRUA 4TT3D 5CK5A 3TSWA 2CVHA 3BE4A 4ACAA 5EXXA 3L0PA 4IFBA 1ZIPA 3AUXA 3MMPA 2FFBA 3KB2A 2JIZA 2P3SA 4D0LB 3SYKA 4X8LA 3RRZA 2YWGA 2ZM5A 2BMFA 5DISB 1LF0A 2YKGA 4KBFA 1II8B 2C03A 4FCVA 3BH7A 1OFUX 2VF7A 1EX6A 5EQTA 2QY9A 4CDGA 1P2UA 4IRUB 1JQJC 2REBA 2IX3A 3CF2A 5EUQB 1U0HC 5E3HA 2WJGA 3GLIB 3CF6R 1ZM4A 2QM8A 1EESA 1G8PA 2JDID 2J7PA 4A8JA 1NVWQ 3EIQA 2OCAA 4B43A 2ZRDA 2ORVA 5AUQA 2R6AA 2DWOA 1YRAA 4Q1AA 4YC7A 4DLXA 2WICA 1IONA 4ZCIA 5FTNA 4NCKA 4QRHA 2Z0MA 3ZJYA 2GCNA 4WZBE 2ZXUA 2ZRJA 2XJ9A 4TMWA 3B1XA 3KXLA 4G5QA 4CEJB 3ICQB 3Q7QA 3NH6A 3QXSA 4UNSA 1N0WA 2ZE5A 1XEWX 1FUUA 4AIIA 4JSTA 2F1IA 4W7SA 1UEIA 4I81A 2IYXA 2B6HA 1AKYA 4UXJA 4MYUA 4DDTA 4DEYA 3RABA 5C18A 1KHTA 1G6HA 3A4NA 1E2FA 3TAUA 5KPDA 2DFNA 4Z51A 3R9XA 3KKPA 4TLDA 1GVNB 1GZSA 1OXVA 4PO1A 4QL3A 4RY2A 5FUYA 4EJSA 1CRQA 4TSFA 1ETUA 1SXJE 4XVQA 1J7KA 4BLQA 1UKEA 1P4SA 3SR0A 1YR9A 1V5WA 1NRJB 2H8KA 3JZAA 1XNJA 8OHMA 1E9RA 2ZPTX 3QXXA 4PX9A 1E99A 2O8DB 3KQHA 2HDNB 3S1AA 1KYIA 2GXQA 3RS4A 4A0FA 2PT5A 2ZJZA 4ARZA 3AVTA 5JECA 1R5BA 3IPXA 2CLCX 2P6UA 3HR7A 4KFUA 5DNYB 5FOVA 4IOJA 1ESNA 2D3WA 1TQ6A 2BMJA 4IDQA 4O25A 2Q21A 2IS2A 2A30A 1UDXA 4GP6A 3DHWC 1GL9B 2CMKA 2XJ4A 1F2UA 2OBLA 5DE3A 3RWOA 5SZKB 3DO6A 4JVMA 2F1HA 2QROA 5CYOA 3IUYA 5G41A 1WB9A 1OHHD 2ZRAA 3FFAA 1CTQA 1N25A 4QBHA 5B57C 4KITB 2C9YA 4L4UA 5DHAA 4AYXA 5FTLA 1Z63A 3VKWA 1KDTA 2WMOB 3RRNA 4PO9A 1J99A 5FL7D 3UG7A 3TRFA 2GAOA 4Q7MB 2GCOB 3THXB 2XZLA 1Q20A 1QZXA 2ODBA 4QGAA 2JATA 1CP2A 4JBXA 4Q47A 4US2R 1JXMA 1NN1A 4BWYA 2PMKA 1P7CA 3LVRE 4G1UC 1N0UA 2F7SA 4M21A 1HE1C 4LJ9A 4UXIA 3BB3A 1JAIA 3MFYA 4HAWA 1E2JA 5K8LA 2EFDB 5GVRA 3FVQA 2BCJQ 2QORA 2RMKA 3UXMA 2OCPA 1IM2A 2ZYVX 1WCV1 3C4JA 3BH0A 1U8ZA 1QF9A 3OEED 1Q21A 1DE0A 1HEIA 1N6KA 2P6NA 3Q72A 2ZI9A 4Q9JA 1XMIA 4PC6A 1Z07A 4R7ZA 3JVVA 4JLKA 5FBRB 3UANA 1T3LA 4ABYA 1DELA 1G5PA 3CNNA 4XJXA 1NJGA 2JCSA 2BC9A 4NU0A 2GXSA 4DZZA 4EQ6A 2O52A 2PL3A 1QHGA 3IIKA 1N2CE 1NLYA 1VCNA 3BERA 4MGZR 3A37A 2W0SA 1JI0A 4H1VA 3TJZA 5TVKA 4M8NE 1BYIA 1XWIA 2QP9X 1RE0A 2NOAA 5JS8A 5AUOB 4IOKA 1J8MF 3M6AA 3CRRA 3MD0A 5GJCA 1UADA 1O3YA 3B1VA 1EXMA 4Q4AA 1U98A 4DLSA 3K70D 4LC1A 1TPZA 1IOZA 2A5GA 5JZVA 1TU3A 4MRRA 1MRNA 3BRWD 3RYTC 1DPFA 2J9RA 3AVXA 1UBGA 1KMQA 1R8QA 3TE6A 1NNEA 2IW3A 4MUBA 3K0SA 4XVUA 4B35A 4DXAA 1HTWA 1NVUQ 1XFAA 4BLSA 2GNOA 2X1VA 3CO5A 1SKYB 2AK3A 2D4HA 2HCJB 4HLUA 1HT2E 4U7DA 2ZRKA 4X8HA 1DG1G 5EP2A 4BRWA 1TUIA 1OF1A 1G7CA 1OFIA 1QG4A 1KDRA 4OI2A 2OCBA 2LKCA 1ZAKA 2IYYA 3H86A 3SYNA 1H8HA 1S1MA 2YJTD 1R0WA 3BB1A 2E1RA 2QE7A 3QPUA 4WZAE 2ZUBA 4TN1A 1TEXA 2QQEA 4PPNA 3PEVA 1OH7A 1DOAA 1X6VA 2ZJ5A 3EC1A 4XVRA 4MKGA 4Q9LA 5AUNB 1TTTA 3B1ZA 2QPOA 4V0NA 3KB1A 4V02A 4C0LA 2J0UA 3LBIA 4Q02A 1EFRA 2HCBA 2QUZA 1M7GA 2RGCA 4V0KA 2ZVQX 3TVTA 2WTUA 3WMEA 1PLKA
chains in the Genus database with same CATH superfamily
1HKUA 2QJTA 4PPYA 4KHPB 4JP1A 3EA5A 5EHIA 3VR2A 4DV5B 1VKOA 1DAGA 2B3DA 4MB6A 4UBKA 5AW5A 4UFNA 4Q21A 1KDVA 2XNKA 3K73O 1Z3IX 1T34A 2B1QA 2EVWX 3EXFB 3O9ZA 1LTQA 2Q4EA 4NESA 5LOVA 2J9FB 2FKAA 3WWCA 4XVHA 2HT1A 3V7UA 3SVLA 4OYRA 1ZIXA 2IW1A 2IYVA 1MABB 1WP4A 2H54A 1XMJA 3EH2A 4UCQA 1D0VA 2VK1A 3P2MA 5IFKA 1V43A 2G7ZA 2PQMA 4O4HF 4DV7B 3RC8A 4YJGB 2JZNA 3AW9A 2VHZA 5LD2B 5G4KA 3JQAD 5JVDF 1HPLA 1O5IA 1ISPA 4F1WA 1J0AA 2IF0A 4HAIA 5FQNA 1GRRA 4J07A 3ADDA 1MA0A 3KPJA 2HA3A 2YC2C 1PNVA 4TV8F 3FHLA 2IOQA 3AUUA 3ZZ0A 1NVVQ 5LU8A 5F9FA 2C7GA 2G63A 2LWIA 1KQOA 4MV7A 3TSCA 1G8KA 4B6SA 4HRVA 3JQQA 1A5ZA 2QVZX 3O8BA 2VK2A 1E2MA 3DOOA 4NYJR 1EUCB 3B6JA 1Z56C 4OD0A 5D01A 4BDTA 1KI6A 2PZAA 1C1YA 1OWLA 2DFKB 2AKAB 4GNRA 3EFOB 1AX9A 2GAJA 1OKKD 4Z3DA 1NVTA 4C0SA 1L7VC 1W44A 1W75A 5BV2P 1OX4B 1CIPA 2PGLA 1PFYA 3FKJA 1H9BA 1KFBB 3WGIA 2CLEB 5B1SA 1D6SA 5JLAA 2YQ4A 4MEAA 1V3UA 2VRWA 2OHHA 3E7PA 4FE7A 4C88A 1ONNA 3KPYA 4FQ8A 4MMYB 2NM0A 4DUGD 4WV3A 5EZ6B 3B9PA 2ZSKA 2RBEA 2GFQA 3RAJA 1NUQA 2FRXA 5CFOA 3JQFC 1E61A 3GZNA 3P9KA 3Q0TA 3EW9A 3GC6A 3HLYA 4JYZA 3AF2A 1YS9A 2J3HA 3A06A 3O8LA 2C20A 1JV2B 4R2IA 1XBTA 3A04A 3ANMA 3FW1A 1CQJB 2F8MA 2H92A 1N1GA 5JT1A 4C14A 1KY4A 5GJBA 1SZPA 2KJQA 2WM8A 1USWA 2OXTA 2O0HA 1UAAA 2EEZA 2JK1A 4MVJM 1MRSA 2JIRA 1NRXA 1KVRA 3DOUA 2FAXA 1GKKA 2Q5EA 1Q92A 4GOLD 3UJPA 3RT1A 3JWGA 2NTNA 1UDAA 5IN4A 4HCJA 3EULA 4NMLA 3R6DA 2IYPA 2V54A 3N8IA 2QG6A 3QV2A 3OLVA 5JQWA 5ECGC 1M6NA 3CGWA 1FJGB 1OAKA 1I3NA 1YB7A 3ANNA 3NBXX 1R6AA 4YR7A 3PRHA 3EGWA 2A0KA 2WSYB 3DMNA 2OC4A 2AW5A 4WNYA 1AS2A 2MYPA 4KYVA 3VGPA 3ULKA 2FN4A 4JH0A 3NHUA 3IJRA 4O1MA 3PL1A 4E09A 2FMTA 2BGMA 2H29A 4HDNA 1PTKA 3AETA 1Q1ZA 4MW1A 5C7YA 3D1LA 4I9HA 4YCJA 5LQDA 5DM1A 3B1JA 4E31A 3LQQA 1SG6A 3CXUA 2P2NA 1NX6A 3DZFA 2H2AA 4F60A 2F8LA 4I9UA 5LQJA 1W59A 5BSEA 1V96A 1JHMA 1ZD8A 2AOUB 2GHQA 3R5TA 4LXGA 4ND3A 3KIPA 4RSMA 3ICCA 1KI9A 1UJBA 1Q2UA 4RTSA 1ZIYA 3CW8X 4MR9A 4XGRA 4YRTA 3H18A 3KTOA 2JBAB 1ZRHA 4X20A 1ONBA 1WXQA 3GMTA 3K0FB 4JOCA 2A6PA 5I7WA 2NACA 3HNRA 4FE3A 1JR3A 1TADA 5G0UA 3ADCA 4PIPA 5AOBA 1BH2A 1UKVY 2XRFA 4HDMA 1ISSA 5JUWA 2ZBVA 3VFDA 4DR4B 1CPYA 1QYIA 4I0WB 3ZJUA 3M1IA 1XAGA 3AFIA 1HSOA 5TV2A 3GCXA 1AZTA 3IA2A 3UOWA 3LA8A 4MSUA 1Z0UA 2IODA 2RKWA 1QYCA 3AFMA 3DW3X 3G13A 3K05A 4G25A 4YONB 4AMUA 3OUZA 2BRUA 5B7NA 4YAOA 5GJVC 2PQ2A 4QPCA 5JAPA 3CXRA 4JX9A 3MCTA 1OH6A 1D5CA 1HEUA 2RHGB 3I92A 4NZ9A 5BRAA 4B44A 4P4SA 2FWPA 1N34B 2DJIA 5GV7A 5HEKA 3E4CA 3RKSA 4TTPA 1K5GA 2FEXA 4C6RA 3CMMA 1YBFA 5HS6A 1FDIA 1UEJA 2VUSA 4ECEA 3IEUA 4P86A 1DFIA 1X8XA 1ZJ4A 2VDWB 2VBFA 3C7AA 2FEPA 4KLNA 1AIPA 5DYNA 5EZYA 3PQCA 3IJPA 4I1UA 4O4IF 3WTCA 1XZGA 1X8KA 3I39X 4DQLA 3LXXA 2DERA 1QQBA 2J6CA 5F2EA 2JI8A 3QZUA 1B16A 2WFMA 4MWBA 2ZAIA 3O47A 1ECLA 1XTRA 4OTZA 4B71A 3F6BX 1OAOC 4KDEA 4JNKA 2VTBA 4NFLA 3QIVA 2C2ZA 3MFQA 2VP6A 4CEHB 4YMUA 5JS2A 1S9DA 4UXHA 2VHXA 3I3OA 3LGXA 2C4MA 3S68A 4ZFNA 2HSEA 2ZIGA 4S1OA 2H4XA 2FF5A 4HVTA 2IH2A 3L1UA 3L7JA 1WLSA 5P8WA 4GKBA 4C6SA 3P71T 2WFLA 1GR1A 1XIVA 3MT7A 3TZCA 3VDNB 4FN5A 4QATA 1N6PA 2W22A 4FLFA 2P0AA 1BD3A 2WWYA 2N9UA 2J0SA 2NGRA 1OROA 2HWUA 4BAZA 2B3TA 4PNPA 4TMVA 4AY4A 2ZT6A 2ADOA 3MAAC 3SIWA 2JNWA 1W76A 5A06A 3W9BA 2RK4A 3D6MA 4DA6A 4A15A 4D41A 4GLLA 1QXSA 1LXCA 3WLKX 4C7BA 4DR7B 1P2BA 2H31A 2NUPB 3OZBA 4MYDA 3QUAA 1PL8A 1VLZA 4OKNA 2J4CA 1LC3A 4WOPA 1P5RA 1T2CA 1YDMA 1LA2A 1QTRA 3JRWA 1T8YA 3RBVA 3NIDB 1X7DA 3BAZA 3T3GA 4G5SA 3VQTA 5AM2A 5ENZA 2OGWA 5KTNA 1FSFA 3BHIA 1XD2B 2QN6A 3P4YA 3HJAA 3GLVA 2Q6KA 3ZCXA 3C5EA 4QUIA 5EP1A 5GQSA 3HL4A 4I1SA 2VN8A 3TI9A 4NBLA 4GXRA 2NXEA 3UXEA 3A1NA 2C2BA 2P40A 2Q49A 3DOEA 4YMSA 1XRPA 4CXMA 2ORED 2Z09A 2MWMA 2RK6A 4ZOEA 4LCJA 3O8QB 4EYGA 4RTRA 2VAWA 3EGEA 3NV7A 4NY1A 1PR4A 1BGWA 1DIOB 3P94A 3AR6A 1NVKA 1RWMA 3JD2A 1SKUA 1D03A 5KWJA 1QKKA 2GAAA 3R7WA 2X2EA 2P9YA 5LZ2A 2H3EA 1FRNA 5JANA 3OZVA 3FTPA 1Q0TA 1O5OA 1SCUB 4ZQGA 2R96A 5L40A 721PA 1B8VA 1VI5A 2ISCA 1UPCA 5E6UA 1EHYA 2EKDA 5IJXA 2QSJA 2QN1A 3TFQA 2JVJA 3ZGLA 5CXUA 2JGNA 1SUCA 3KCQA 5DLYA 4WXHA 4NCBA 4UFPA 3T7EA 4MV9A 1IFXA 2F3SA 1PUJA 3L7NA 5KVCA 2VQ3A 3WWOA 1P8JA 1J9ZA 1STOA 1WSWA 5G4LA 3WFIA 1UDBA 2X0RA 3ORHA 3LU1A 5JJLA 3PA8A 2J9GA 1QK3A 3OHSX 2YWDA 4FZ5A 3T35A 3TK1A 1N5JA 3GUUA 2JLWA 1O9GA 2JFXA 2PCJA 1VGVA 2VXYA 4PCVA 2BTOA 3ISTA 2WKPA 2CFOA 2IZ1A 4GI7A 2R6GA 3WXBA 1SK9A 5I7UA 2BFFB 1LY1A 3INTA 3PXXA 5EPOA 1JG3A 3O2NA 5CJJA 1PGPA 3W7AA 1J6UA 4KFCA 4DRXA 2EKQA 4MGKR 1GZHB 4A5OA 3ZHOA 1ULHA 2RDMA 4IKEA 2B20A 2D7JA 4A1FA 5KJ6A 1JXQA 3JYQA 2XCSB 1E7QA 3ETCA 5AVSA 1Z5PA 2ZBDA 4KSBA 1RWQA 1XF1A 3RHTA 1U7OA 5KTPA 1IQRA 1Z6AA 2VHJA 1ZITA 3VDRA 3EWAA 4PG8A 4DB4A 3HXPA 2FW9A 5I9SA 5DTRA 3ZWYA 3EA0A 5E6RA 2OWEA 5IT0A 1AE1A 2PKRA 1FSZA 3EY9A 3QE9Y 5CW2A 1YNOA 2L42A 3G2OA 4NJMB 5D00A 3DMPA 2JJMA 1ACMA 3U09A 4Q93A 2E5WA 4ZI5A 1QG0A 4R41A 3NHKA 1GCUA 2XB6A 2YV4A 1F2TA 1DX6A 3D3WA 4LGCA 1VYVA 2QPTA 4GMGA 5CVCA 5CD1A 1SHZA 4ZOLF 5HF5A 4HI0E 3OETA 1FE8A 2HPAA 2Q9UA 3GLGB 2CL0X 3RS0A 3QVVA 8ATCA 2OO5A 1RHJA 1OTXA 4YRRA 3TEMA 4R7TA 1K2VN 3L8FA 2JFGA 3SM3A 5A4FS 5AM1A 1E3QA 4LI3X 1MFZA 1YKFA 1EE1A 1QH8A 3LNTA 1YR3A 5HZGA 2IQIA 1T4DA 1ZUD1 3JSXA 4N18A 3Q1LA 3U4AA 4CBVA 3RGGA 2Y92A 3W2TA 1XRMA 3JATB 4RSHA 4LJAA 4URHA 5L4NA 1FBNA 1DKRA 1OWOA 2QYSA 4U7TB 1ONPA 2QMYA 5FOTA 4EJFA 1OXBB 2W2NA 5HNKA 4KAAA 4MQLA 2H59A 3BTOA 2OEPA 1CE8B 4R9NA 1YCFA 1E77A 1E94E 4KIWA 2ZSBA 1LDNA 4N01A 3MELA 5B58T 5HKLA 3W9UA 1KVSA 2FSVC 1ZLYA 1Q12A 2R8PA 3MQ2A 5BT8A 5I7RA 2I9KA 4I5DA 4OBBA 4KR0A 5JI2E 2IEDA 3E9DA 2NAPA 1NPTO 2XBLA 2MDTA 2ZWOA 2JCBA 4R1UA 1HK7A 1WVMA 3GDGA 4NV1A 5HRAA 3U81A 2QJRA 3H9BA 1Z5VA 3K53A 4L22A 1VHWA 4QTUB 3HKEB 4UBIA 2ECOA 4KW7A 2QTRA 1B8UA 1EK5A 3AZPA 5FR2A 3AI7A 1A2BA 1Y82A 3K3PA 3PXAA 1QRSA 5D6OA 3ZHBA 1KOFA 1XG5A 3IP6A 1CEQA 3TTYA 5BSMA 3UUGA 2JL1A 4HNUA 4JEUA 5C32A 1J20A 1U9IA 2VJNA 2ZR0A 3ROGA 3F6YA 1FDRA 2QD2A 3MJSA 4J3FA 4KQEA 4QPJC 1AKNA 2GWHA 4QDKA 2SCUB 5DNAA 5AOVA 1HO3A 4B3BA 3MUNA 1W1IA 4U2BA 4MV0A 1NJSA 3KQQA 3HI4A 3C74A 3JQ8A 5IH3A 5GJWC 5LQUA 2G6TA 4EAQA 2FHPA 2OWDA 2VPWA 1YVDA 3WAKA 5EHZA 2X2OA 4BKRA 2O8FB 2G5TA 3OQPA 3HN7A 4J2HA 2FI1A 3VC3A 4QUAA 3FNEA 4R8KA 2O14A 3RARA 3ZGNA 3ZZTA 2AFRA 2BEWA 1AQNA 3OQIA 4EEZA 1ILWA 1W5TA 2G08A 2VUUA 1DBRA 3ILHA 2B8TA 1GAJA 3OH8A 1RAHA 4EY3A 3NHWA 1Q95A 1SCDA 1T5LA 2BF4A 3MIIA 1UPXA 3B9BA 3V32A 5JV5A 3QUTA 4DLAA 5F3WB 2O8DA 5KYNA 3HL0A 3UMFA 1W4BA 2AOTB 2V97A 3LX5A 3ECSA 4M4SA 1PSWA 3KDPA 1NFQA 4NKRA 3FGOA 3ROZA 3U56A 1RFLA 2BCGY 1QIDA 4FT2A 1JU3A 2ID8A 3IC5A 3ICOA 2FPUA 3KEQA 2JH8A 4ND5A 3KXPA 1Y6QA 1BE6A 3L07A 3QUCA 2PWPA 2J3IA 1QIIA 2YS7A 4ZVUA 2XNDA 2ZI7A 1D2CA 3ZHCA 2DKFA 3WG9A 2PX2A 3RVJA 1O77A 1NX9A 1M2HA 1YQQA 4HRXA 3M0EA 3FCEA 1U1IA 4HFNA 1N4AA 1CHNA 4YMGA 4ZCRA 3JQBA 4PM4A 3U49A 4C30A 2B5VA 2ZCVA 5MN4A 3BUSA 4IIXA 3U7HB 2OFOA 7MDHA 4JITA 4DLTA 2J3MA 1ZH2A 3K9QO 4LJ8A 1MHPA 4RCYA 3VNRA 4CV2A 2P3LA 2EBHX 3DV0A 5BR7A 2JJ2A 1JG1A 3IHLA 4QQFA 1ZGAA 2VWQA 2YL2A 3IMGA 2G17A 3W2HA 2FWRA 5DU2A 2ZAMA 4BVEA 1JDZA 4YT5A 3LY7A 1FX0A 3T54A 1A8QA 1XXHB 4Z0TA 2VYND 3H5TA 4TUYF 5HF9A 5BVHB 4P93A 5IEBA 3BXXA 2H4YA 2ERXA 2ZJBA 4B8YA 5T6BA 1HLDA 3X1KA 3H75A 5BWOA 2G5PA 2GM5A 2WV7A 2Y0DA 3UKJA 4CPDA 3LOPA 3H5RA 5IHXA 2XMDA 3ON5A 1JPUA 2XSZA 1XVAA 4BNNA 3IBSA 1PDOA 4H7DA 3L04A 3T7CA 3DOHA 4EF6A 1M66A 5KX5B 2QJFA 4EJ0A 4AI6A 4DQDA 3Q8WA 4JB0A 1XN4A 5BORA 1GPKA 3FHJA 4LSMA 1ZKMA 2JLCA 2VWPA 4C0BA 5A03A 2R7LA 4Z9AA 3TN7A 4DDMA 1GN8A 2NPIA 3AXTA 3Q7PA 2AH5A 2XKJE 3NZEA 1M6YA 2A86A 1T5OA 3WYCA 3X1WA 1IY8A 4FXPA 4X7PA 2WSBA 2B99A 2ZKIA 2XCIA 4UBMA 3EXEA 1U0NA 3DEIA 3AYXB 2NU9B 4H9GA 2CWWA 1Z0ZA 3IPAA 1OH5A 1Y4SA 1JUDA 1OZ0A 2B8JA 5DGCA 2F2TA 3N6RA 2PEYA 4ZIRA 1LFAA 1KHHA 1Z2OX 4UOEA 4HNTA 2VDJA 1E4OA 4B3RB 4KPEC 2O48X 3FLEA 3GFQA 3VR6H 1YBHA 3GQVA 1NJ2A 1T15A 2V6GA 4BKUA 5IVKA 4AYTA 2WAOA 4IVQA 4JYCA 5B2FA 4EFDA 2CBGA 2FUG6 4FCWA 1TGYA 4B76A 2OB2A 4V03A 3AB8A 4Y6SA 3SJAA 1YI0A 4QOHA 1J9EA 1PWXA 4V38A 2SHKA 1J1ZA 3SFVA 2DUMA 1U6JA 3RAFC 3WRWA 2VYFA 3GLIE 1IBLB 2FDCA 4JBLA 4XQGA 3GJ6A 1U8AA 3PEUA 5ILGA 4IBOA 1TJ3A 2VT6A 2BISA 3LLUA 1H2HA 4YCSA 2BR5A 5EMKA 4WVFA 2ZULA 1PFVA 2XKAA 3DNPA 5F9HA 3NAGA 2JCGA 4GMHA 3U3MA 1Z5OA 2DBYA 1WZCA 1LV8A 4B3CA 2Q27A 3KX2A 3T5GA 5J4LA 4A6EA 4OEHA 1CUCA 3L7CA 2R86A 2FSVA 3BWMA 1QZ3A 3S8EA 3T3MB 1EDOA 1DC7A 2EP7A 4RK1A 2Y1EA 3P0FA 3GEPA 4WA8A 2YOHA 2Z5FA 1R88A 2HWYA 3LWBA 1EVJA 1GFSA 3L0YA 1KXZA 4BC0A 2I6SA 1F7VA 4LFBB 1AO3A 3GYGA 3C5CA 1RQ7A 4KYIB 1P17A 1MJGM 4EW2A 2UYCA 2J1LA 3DBIA 3S4YA 4Z1OA 1Q0PA 2HV9A 2AKYA 2R9VA 5KAMA 4NE9A 3FZYA 5AESA 4P3KA 2C77A 3RRYA 1C1DB 3EVGA 4LV8B 4PLZA 2ROQA 5HK9A 4BEWA 2A5LA 3GP3A 2WBLC 2CJPA 3AY7A 3M6WA 2YC4C 3VHRA 2XE7A 5JC1A 4DTIA 4OA5A 3W3AA 1DT3A 1W8DA 2PSSA 4HO1X 3L84A 3AUJB 3DJFA 1RKVA 3Q2IA 4XB6B 2AW3A 2HRZA 4W6QA 6ADHA 2IK8A 2W2MA 5AUPB 1QRAA 1KY3A 1P9OA 1U7HA 1H66A 3D7KA 4N5IX 3FRJA 1OLSA 4DLPA 2JD2A 5KJFA 2I3BA 1SN7A 2IHUA 3BXPA 4IY1A 3C8HA 4TS4A 5A2QA 3L7YA 4WMLA 3ZBTA 1X1DA 5IVDA 2Q50A 4KDRA 2P2LA 4JL8A 1FCJA 1U3UA 2LCIA 5MGBA 1CRPA 1RM3A 2Z1NA 4BOYA 1NI3A 3PPYA 5ALIA 1E79A 2R44A 1UFOA 2QL6A 4HF7A 4M1MA 1TXGA 1I4DD 4XZ3A 1D3AA 3R8CA 2Y1FA 2AX3A 4GR9A 3CH6A 3K5HA 5CCDA 4JT9A 4X3PA 1T6ZA 3NEYA 3CSDA 2ZXFA 5ALOA 2DWQA 3F6RA 2GD2A 1U9CA 1V2GA 3OU7A 1JQEA 4PSAA 5F2KA 3RR2A 2RGDA 1GXSA 1XCPA 1ZOIA 2YVAA 3AEKB 3QBTA 5FL3A 5K8IA 1GRVA 3AVQA 3P97A 3WGQA 5UKDA 1OXTA 1E5TA 1TW3A 2I4LA 4RHXA 1NQ5A 1US8A 2P5UA 1RHRA 1TVKB 1Z8DA 2C5BA 2I22A 3II6X 3OJ0A 2VH5R 3B8EA 1JLKA 4QELA 4IZIA 4XPZA 5E0KB 5FULA 2WT9A 10MHA 4KN8A 1OI2A 5A0VA 2C61A 5ICCA 3EC7A 4DSAA 1B0UA 1G21E 3D4PA 1JKIA 1CRWG 3TRKA 2J7KA 5CTAA 3AF1A 3U44B 1ELOA 4GQBA 3E1GA 5TXGA 5EJEA 1EUYA 3AUFA 2EW8A 1GIAA 5KWSA 1NAIA 3KKZA 4KUHA 4V0SA 1D4FA 3R3UA 4Z8YA 5LL6P 3SFZA 4XDYA 1UMBB 4US0R 5CDUA 1VSQA 3IUSA 3DFFA 1TRKA 5FNVF 1WOYA 1NQUA 3O93A 4R2HA 1QTIA 4IX1A 4AD8A 3RRXA 3FTFA 1SCNE 1TT5B 3IUBA 1UIMA 1NW7A 2QE7D 5FUBA 4CTJA 4HQ6A 3QW4B 5TRTA 4N3GA 5T4EA 3A7DA 3GFPA 4JELA 4W7IA 2ZTUA 4BNXA 4RDIA 1ISHA 4E32A 2I62A 3E9MA 2GETA 3I1YA 2IEGA 3R5FA 5DYTA 1GJRA 2GEDA 5EIAA 1BX0A 3P1JA 3RRJA 1CS0A 5L9AA 5MGNA 3V34A 1FU4A 4Q4AB 5JAIA 2NAFA 4DDWA 1C9DB 5FBQB 1QHHB 4M1EA 3T5DA 2EG5A 2H9IA 4CKBA 5GMOA 1SCAA 2N0SA 2Y8EA 4N0DA 4PWYA 3H8JA 3LBHA 4G3XA 1KYXA 3FVWA 3U3DA 2G1JA 1M34E 2PZJA 5ARDA 2Y4OA 3GA0A 5JXHA 4L95C 3VR2D 1XZPA 4XUCA 3L0OA 3E48A 3HO1A 4NDAA 2XYGA 2B4TO 1XCBA 3DV9A 5CB4F 4O2BB 1QIKA 5T4BA 4GHWA 1XKQA 3TQHA 3K6SA 1P1CA 1NLMA 3EQ8A 4WD3A 3JPWA 4LWOA 3NBYC 3KZKA 3USES 3NHBA 3KD2A 3OZIA 1XZIA 2I8LA 4FGZA 3SQXA 3CLUC 4YECA 7AT1A 4PYRA 4HYYA 1BX3A 2VLIA 3PPWA 1A69A 2JK0A 4J9UE 4ZYVA 4P81A 1X15A 3CKKA 5K4GA 3EPJA 1HLGA 3ENNA 1C30B 4PPQA 1HRKA 4LF8B 4ENTA 4M55A 3E18A 3SI7A 5U9CA 4NIMA 4A26A 3O9MA 1G6KA 1R0KA 2Q4OA 3I6MA 5E7MA 1FW8A 5DHSA 3REQB 4W7HA 3ZN2A 1XDGA 3WQHA 1QRTA 2X0NA 1SKYE 1Z0FA 3AR5A 3OY7A 4ZZ3A 4XUGB 5JSZB 4DV1B 3Q3EA 5F1OA 4TLMB 3BJEA 4LMPA 5DN9A 2B4RO 3G2KA 1U80A 1F2DA 1RLIA 1W5SA 1USVA 2XXBA 3I9LA 4EPVA 2CXNA 2R2GA 3KJNA 3K2QA 5TPZA 3B7PA 4F0JA 3A1FA 5LKAA 1Q19A 1KAQA 1H4TA 5D3QA 3L2OB 2VZ8A 4S0ZA 4X00A 3CLKA 1F1JA 4BWVA 3JQAB 4NABA 1TF2A 1JDSA 5HE9A 4CR8A 3OCYA 3OE5A 3F6EX 3IIJA 1GT6A 5CDYA 2JI6A 3VI3B 3P9QA 1UBKS 2FB9A 4QT0A 3DDSA 3F98A 4O3MA 4Q66C 1BYUA 4RU1A 3IVRA 4HK4A 3FIJA 3NGMA 4EA9A 1YJQA 2ZUEA 3UFXB 2OFWA 2V4MA 2HQRA 2XITA 3TD2A 1XVUA 3T1VA 4B4VA 3UT6A 1W4LA 2E4VA 3ZKWB 4ITRC 4L15A 4LDJA 1ZSYA 3ZJ4A 4Y6PA 1U04A 4X1KB 3U40A 4A2QA 4TZ0A 5DWQA 3THYA 1Z2NX 4FFNA 5JNWA 1BOOA 3L7KA 4TM8A 4P54A 4A8HA 4M7PA 2PS9A 4GI2A 5DX0A 4WLNA 1UZMA 3DVQX 3GOQA 4JIMA 3OT1B 3PF8A 4P0QB 4KRGA 4AMGA 2HV8A 1T29A 3E9QA 4EELA 2XUAA 3MWEB 1XJQA 4TTVA 2CCKA 4JEMA 3G5UA 4E2YA 1XHLA 5CFLA 1IOLA 1FDTA 2B98A 1M9NA 4YHHB 1B3BA 2XQKA 2C84A 3GD7A 4XEHA 1BHSA 4HSGA 2BIFA 2BMWA 2OCXA 3IULA 4V0OA 3E8SA 3OCVA 3KZXA 4PG6A 2CXPA 2Q2WA 4M9CA 3TR6A 3L9WA 3SIXA 4AUMA 2DUNA 1YKGA 4OJQA 2B6NA 3DZCA 3WO0A 4N0QA 2HFJA 1GQFA 3B3QA 3NOXA 3PE4A 4JVNA 1E1YA 4QREA 2IH5A 2XTAA 5DGXA 1SKMA 3KKOA 1JG2A 1FSSA 3BQNB 3D3KA 4YMIA 5B7QA 2E9SA 5EMMA 1O03A 1N78A 4LN1A 4QA9A 1OOEA 4EW6A 1TX4B 5B3AA 1F60A 5IM4A 3QG1A 2VF4X 2OB1A 3CNEA 4M2LA 1TMYA 1PQWA 4R3WA 2FY8A 3UHJA 2VS1A 1X77A 1RYDA 2P6PA 2QNIA 3TW8A 4P22A 4G01B 4JX8A 4K88A 2CNKA 4R40A 1NYQA 5JNRA 1MIHA 1CUUA 1Z39A 3AUSA 2OXEA 5A3JA 2KI5A 1GG9A 2Z3WA 5E95A 4CMHA 3HUUA 3L6EA 1VZ2A 1NVVR 1Z0SA 2CJWB 1GPMA 1KEWA 1P6QA 2MSDB 2CUNA 3I04M 1GL3A 1C4OA 1MORA 2PD6A 5LA6A 3I23A 4FCTA 1U0FA 3QH4A 4JOQA 3UB2A 4DT1B 2GJ4A 1JR3D 1HSZA 3OD5A 2WTNA 4BVBA 2W2KA 4ZAXA 1F6BA 2FGJA 2O7QA 2XGMA 3R0ZA 1I94B 1AGNA 1GEGA 2IYEA 2O0JA 3FNFA 4C6HA 1POWA 3P45A 2ZRNA 3HGQA 1RTKA 4YCCA 3WBJA 3TWOA 4QRDA 1GGFA 1LVHA 4AWBA 4RJJA 1KZ6A 3IELA 2V59A 1PZNA 1S3IA 1Z0DA 3AJRA 3ZDZB 4RVNA 2Q62A 3EB9A 3RSSA 1W0CA 4H7IA 1K7XB 1YB6A 2BEKA 3FKSA 1S5PA 2WJIA 4XFJA 3HYTA 1B8NA 1JFRA 3TPCA 4IG4A 4D4GA 3FOZA 5CDTA 2H7XA 2GM9A 3DAFA 4Q3KA 4G97A 1L7DA 3K2BA 1THMA 2NW6A 2GXAA 1XHFA 1X1AA 3QVUA 3GH3A 4CM8B 4DM4A 2ZRQA 3DS8A 1P7YA 2X19A 3MG9A 3PC7A 4DJFC 1XUOA 3C3XA 3F8SA 4G2TA 4M9ZA 1E1KA 5T41A 3VDQA 4X61A 3AZQA 1BX1A 3QELB 1Q77A 4U8HA 2ZETA 4XSVA 3TG2A 1QCDA 1FVHA 4M0FA 4NJEB 4L78A 4L0DA 4L28A 2ECFA 3VPGA 1JEQB 4K87A 5IUJC 1S2OA 4F4JA 3TE7A 4NZMA 1P72A 3BULA 1WF3A 3F1KA 2XUJA 1OC2A 3DDWA 5DYGA 2OAEA 3QKRB 1TYCA 3D31A 4Q48A 4I6JA 4NCXA 521PA 1FYEA 4GOMD 4NONA 4C5CA 3HPRA 4EPRA 4PZAA 1QU2A 4AP6A 3AB3A 2IIBA 1AA9A 2ACWA 3EF3A 4U5XA 3UHPA 2NQ2C 5DI3A 2PUVA 3A2NA 1YNSA 2XHEA 2IZZA 2VJPA 2TSYB 3B6IA 3LQ1A 221PA 3HRHA 3B8HA 3NVMB 3AL2A 2HU2A 2OBFA 4G81A 4KO3S 4YJ3F 3RV3A 3UUFA 5J1SB 2FPLA 2FA9A 4ARCA 1YHZA 4RD2A 9MHTA 3D6VA 1LRKA 4X41A 5C5CA 3HP1A 3PUYA 4OGFA 1EGQA 1KO7A 4OX9B 1GTVA 4BJHB 1EWTA 1MU0A 2ZJYA 1SUBA 1K6XA 2NU7B 2VJMB 4CM4A 1WW3A 4DIUA 2HNKA 4OAOA 2V7GA 1NJFA 1RWWA 3EVNA 5CA1B 3SQOA 3Q3IA 2P2DA 4JUAA 4X63A 3R0IA 3GPBA 4WCFB 3TKYA 2HHLA 3U13A 2GYVA 2ZR9A 1UBHS 3L1JA 4R98A 4TWZA 1PSDA 2FSIA 3C8ZA 4UU0A 1WUHS 4OMUA 3A9RA 4A8JC 5D1HA 4LVOA 4CRWB 3RFVA 3FGNA 1PE0A 4P3YA 5K3FB 2B4YA 2L18A 4Q4LA 1PG2A 1XHEA 4PZ0A 2YRFA 3UWDA 5EMNA 1JE1A 3LGSA 4B5LA 2II6A 2Q99A 2YWFA 2FKNA 3RUDA 1ENYA 1QCZA 2AZXA 2OV3A 1DQZA 4C4SA 3HM2A 4B09A 4R4JA 4YRCA 4ZAZA 2JHFA 4ARUA 1I5EA 3VPXA 3CUSA 4P7GA 2JD0A 5B1EA 2HA5A 1UOEA 1SVWA 2QL9A 2QD3A 5IBRA 1E96A 3VPBA 3CT6A 3ZVLA 4AT1A 2B9VA 5DI9A 3F1LA 3H9JA 1TEZA 2XXAA 1GG2A 1S3FA 1GPYA 2XECA 3SNHA 4EABA 4FBMA 2KX7A 4MQEB 4IJUA 1KH3A 4P5PA 3T3NA 1ODFA 4LZOA 4H15A 3WY9A 3ZCVA 4C7MA 5KUTA 4IJQA 4AROA 1QYXA 2YHUA 5AJUA 3NIFB 5FPPA 2Z83A 2KW5A 1JSXA 3SXPA 2A7QA 5K7SA 1CZLA 1QR6A 3G8CA 1A4XA 1J09A 3ZTTA 1EJ2A 5E2IA 1Q0HA 2GVDC 1U3VA 4EJSC 1PL6A 1ZICA 2AV6A 2WAYA 2YIVX 2Z98A 3WLNA 1ABBA 3D9QX 3Q3VA 1MX9A 1EWRA 1LI7A 3B85A 4G5XA 5LB2A 5FI1B 2OR3A 2RHTA 3C6ZA 2DTDA 1FXUA 3O38A 3W78A 5LQNA 1EUDA 1C41A 2P1ZA 2VP0A 3IDAA 3RHFA 2GTIA 1KGDA 3AH8A 1NF3A 3QVTA 4WXPA 5AQ1A 4PZZA 3RD5A 3EMDA 4PZ9A 4QGSA 1ZCFA 3OE7A 1WW2A 1X3SA 2MJLA 2WZBA 1BNCA 1CDOA 3N7UA 2P0EA 2LIPA 5J63A 3QXJA 1GKYA 4H7HA 5YASA 5EESA 4B17A 1W6RA 4BYGA 2E0IA 5F64A 4ZT6A 1J49A 3D8HA 2NNWB 3DC7A 4QLOA 3FVVA 1M1YE 3A31A 4B82A 4BMOB 4BIIA 4Z54A 4EAAA 1XDWA 3ANXA 4URUR 4U3JB 2Z3VA 4RD0A 2V58A 2NXCA 4LZZA 5F4BA 4LPKA 3QTTA 4MW4A 1GPLA 2X3FA 3NDIA 4G37A 3TGPA 3RADC 2YXDA 3V8BA 3EOZA 1XTQA 1U0LA 3IYLW 3I64A 4CDRA 2SNIE 3RUEA 1G2PA 1KWGA 1VIDA 1B00A 1M8KA 1YL7A 3GJ0A 2MSKA 2JFWA 4X65B 2VTEA 2YH2A 4REOA 3QX3A 4LJ4A 5EWJA 2RBKA 3DJYA 1OD6A 4TS9A 3V33A 3S99A 1EFCA 3FNGA 4D45A 1HKHA 4OOEA 2J5QA 1Q17A 2HJWA 5BP7A 3SDZA 4CL8A 2GK7A 3TOZA 1I1QB 3H1BA 1ZUNA 5BURA 1KDPA 5H8WA 1Z38A 4ZAFA 5GIOE 2FSUA 3NGLA 1N8KA 1HOXA 3EZGA 2EJBA 3RYFA 3VYUB 2DLNA 1VYHA 3GNQA 1FFCA 1CUGA 1HMPA 3CX7A 4LF5B 4IQ4A 2VT2A 2W4QA 5EVJA 1QNLA 5HQTA 1D9ZA 1O97D 4X66B 5CX4A 1T5SA 1L2TA 4QRIA 5ECWA 2OVFA 3FJ1A 3GLHA 4HGNA 2P0YA 3HP7A 4OLFA 3V2IA 5K0SA 5CITA 5A0FA 2QI9C 4OB8A 3WNVA 4XVCA 1QRUA 4L50A 5JAOA 3OEYA 4MVJF 3LZ6A 4S1NA 2QDXA 1XU9A 2JLAA 1OIXA 4TSKA 3VNQA 2WU0A 4GZMA 4GOJA 1SZJG 3Q8LA 1JKJA 3OFJA 3DMTA 4XLTA 5D2CA 3KT6A 2FQYA 4RFSB 4XJTA 4W5OA 2A2ZA 4QM6A 4AO7A 4FNMA 1HURA 3P2KA 1XDZA 2BR4A 5AK4A 1H23A 3CG4A 4ZXFA 5K03A 1G59A 2A57A 1YUMA 1AXGA 3I01M 3JALB 3G6KA 5D85A 1J7JA 3HZHA 3LKZA 2AHOA 5L7TA 1CDEA 2IBTA 1Q7RA 3MGBA 3AM1A 1X7GA 1SA0B 3ZQUA 5JCXA 2K6GA 4AK9A 1CERA 2YHBA 4HDCA 4NMHA 4I19A 5JCJA 2XYRA 3ONVA 4WN3A 1TD1A 5AKIA 4QASA 4G9GA 2CFRA 5CUQA 3SX0A 2RFLA 4ARAA 5JXGA 5BSKA 3WSVA 3ZS9A 4F3CA 4YRJA 2D6FA 1X70A 4P1ZA 1CP3A 5D5HA 2ZYWX 4JIGA 3TVYA 4UJ3A 1V6AA 3BE8A 2FR8C 4IPTA 1WG8A 2EYQA 3TTSA 4MB0A 4OQYA 1I10A 3I72A 4KR3A 4DKJA 5GM1A 1ZIDA 1DIHA 1HNXB 5CT5A 3T0IA 4OQQA 2ZIVB 3SSAA 2QRLA 4TMXA 2YBDA 5JYDA 1TU0A 3CF4G 4HLUC 3N5CA 3P5BA 4LI0A 3CX6A 2C3PA 2RJOA 5FBKA 2FFQA 1PHPA 3ZHRA 2J9XB 4JGGA 4E5UA 1XU7A 3BG5A 4FDVA 2M2IA 3BDIA 3I4CA 5KZMB 2WOJA 1GDDA 2DVMA 4M88A 1Q14A 4PXYA 5EJAA 4OK5A 1YACA 3ZVRA 4WUVA 2F9LA 2P7IA 2QK4A 3B5IA 2DLDA 3KRTA 4NL4H 2B8WA 2TMYA 5D84A 2XNDD 5JAQA 4QPPA 3GEIA 4IM7A 4XIJA 4UUPA 2HCTA 4HFMA 3AY3A 1XI2A 1P7ZA 1Q0SA 5ICEA 1I32A 3F3SA 5IDXA 5JNTA 1UPTA 4FUQA 1QVWA 1V4NA 4HQRA 1FS4A 2B8EA 1KH1A 1NPDA 2WKRA 3AINA 3C3AA 3CY6A 2JCYA 3G59A 4O4JB 5HIJA 2X4LA 3K9CA 3OIFA 5F7ZA 3RNLA 4HEHA 3O4VA 2YJ4A 4KDFA 3FVRA 3HC7A 5BMVB 3EZ2A 1B2LA 2FMUA 3ZIDA 3DP9A 3AR4A 2Q0HA 2YWEA 3QYPA 1Q0RA 5ALXA 3NDBB 1BHQ1 2JJ2D 3M6VA 3MLEA 3PRJA 3GEBA 3KPUA 1H4SA 4CUJA 1S8FA 1KS2A 5KTSA 3N87A 3PX3A 4GGMX 4R6XA 2YYZA 4Y9TA 5FHQA 1XMQB 5J4YA 1N2OA 1FLVA 3OA0A 4NPHA 1YU9A 2ATCA 1H9CA 4KCGA 5LQSA 4MNTA 1FDUA 5A9RA 5E7JA 4CCWA 1OHHA 1VA5A 1QOQB 1DARA 1P4JA 3IT3A 1LI4A 2BI8A 1M34A 2RHDA 3JD4A 3S2EA 4E03A 3NYWA 1VLVA 2VHVA 2G9QA 2W6NA 1RKXA 3JR3A 4FMCB 8ABPA 3OM0A 2XSZD 1KAEA 4JA2A 4Y6GB 5K4AA 2R25B