5K3BA

Crystal structure of the fluoroacetate dehalogenase rpa1163 - asp110asn/chloroacetate - cocrystallized
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
298
structure length
295
Chain Sequence
DLADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRVAPKLAERFKVIVADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLGHVHFALAGHNRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRAYALKIYHWSFLAQPAPLPENLLGGDPDFYVKAKLASWTRAGDLSAFDPRAVEHYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPVPMLALWGASGIAQTPLDVWRKWASDVQGAPIESGHFLPEEAPDQTAEALVRFFSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Fluoroacetate dehalogenase
publication title The role of dimer asymmetry and protomer dynamics in enzyme catalysis.
pubmed doi rcsb
source organism Rhodopseudomonas palustris (strain atcc baa-98 / cga009)
total genus 115
structure length 295
sequence length 298
chains with identical sequence B
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5k3bA00
4PSUA 2ZJFA 4BRSA 1ODTC 2PSJA 3BL8A 2FJPA 4X97A 2AJBA 3E3AA 1ODCA 2GBCA 2XUKA 1MAAA 4FLFA 3G9UA 4KYVA 1Y7IA 1BN7A 1QIIA 1K8QA 3C5WP 3WA6A 4HXEB 2VT7A 5AKKA 4EUSA 1ZD4A 5K3AA 3AFIA 1IUPA 3X3HA 5C8VA 4H35A 3GZJA 3IUMA 4U2FA 1DU4A 3H2KA 2Z3ZA 4FFVA 2XMSA 3HYSA 4UHBA 5CTAA 2ES4A 4B7ZA 4J7AA 4CI9A 3ICWA 1YA8A 4ITVA 1YR2A 2XQIA 3WKCA 4BTLA 4RE6A 1R1DA 3C8DA 1XZKA 3FVRA 1MNAA 1BN6A 1WB5A 2HA3A 4X3CA 2WUFA 3ZWQA 2VJCA 2B61A 3W2TA 3PUIA 1WPXA 1H22A 1CUUA 5JAOA 4B81A 4S0XA 2OXEA 4GI1A 3O9MA 5FP0A 1BEEA 4DMCA 1CQZA 2CKMA 2UZ0A 1DQZA 1XLWA 4X6XA 3QM1A 1EDBA 5AICA 3DOHA 1MJ5A 3FYTA 2PVSA 1ACJA 2WIJA 1SFRA 4Q3LA 4QZVA 1R9NA 4EZIA 1R88A 3EIOA 1THGA 1W6RA 3IB3A 5AKIA 4QEKA 3BXPA 5JADA 1LBTA 1QLWA 4LYEA 5ALNA 3FLEA 3TEJA 5IVHA 4Y2TA 5DNVA 3K2IA 1CUGA 1XZMA 1XLUA 1E8MA 2VJBA 3L1JA 2O2GA 2J3QA 2WFMA 4W1PA 1EK2A 5DTJA 5K3FA 2CMFA 3BE8A 5ALDA 4LIPD 1DWPA 3LIPA 5LIPA 4BC0A 1MX5A 3G7NA 4PQEA 3TRDA 1UFOA 2BUCA 3PUHA 4BYMA 4XJVA 3F67A 4GEGA 4BCCA 5AI5A 3JWEA 4UHHA 1QIEA 3SC2A 5CXUA 3P2MA 2I78A 2HFKA 5JZ9A 4WY5A 1H2YA 4NMWA 1U65A 1HBJA 2OCIA 1XRRA 4I3FA 5ESRA 1XQWA 5DJ5A 1K6EA 1R4ZA 3MVEA 2HA5A 5AKHA 3C87A 5ALXA 2K2QB 1IZ7A 4H7FA 4IH9A 2WKWA 4F0JA 1N1MA 4QDTA 5AOCA 4X93A 5EHZA 2QXUA 4Y2JA 2BGNA 4ARBA 1X2BA 5LZ7A 3VVLA 3H1AA 3DKKA 3JW8A 2B4KA 2QXTA 2ONCA 5JYCA 2WM2A 5AIAA 5HF6A 3A6ZA 3UMJA 2PSDA 2X76A 4X90A 4DMHA 4GWLA 1BE0A 4MYDA 4UBIA 1PV1A 4INZA 4H7KA 2PU7A 2QOEA 5JD6A 3O0DA 5T4BA 2B20A 5FLKA 4PO3X 3D7RA 1CUWA 3C8HA 1ZI8A 4KE6A 2H7XA 5A7FA 2Y2UA 4BAUA 1VOTA 5ALRA 4CG3A 1EH5A 2QMQA 1QO7A 1DX6A 3HJUA 1CUFA 3B12A 3G0CA 3QPAA 5AIBA 1ZIYA 3WK4A 2Y6VA 1GT6A 5AM4A 2IX9A 4U2CA 3N2ZB 1CUEA 1EINA 3F9CA 4IQ4A 4H0CA 3AZQA 4X95A 2XB6A 2Z3WA 1UK6A 4OSEA 1EXWA 3STXA 5CH8A 5FRDA 2Z5GA 4WDRA 5C81A 3Q0TA 3PICA 3VISA 1T4MA 3I2HA 2WQZA 1H23A 1CUYA 3H18A 2R8BA 1ZICA 3D4LA 4OYLA 4UBMA 3HLKA 5ALSA 5I9IA 3IUNA 2OGTA 1JJIA 2J3DA 5FOQA 3IIIA 4U2BA 1QIJA 1XQXA 1XZFA 4EA6A 1VXOA 1GXSA 4MJ3A 1LNSA 3WZLA 1MU0A 3V1KA 3T4UA 3ZV7A 5ISMA 4NS4A 4G1FA 2XUHA 2FX5A 2WHPB 3C6BA 5IKXA 2QJRA 4MEAA 4UPDA 1B6GA 4Y2QA 4JEIA 3M81A 3BWXA 4N5HX 4X94A 5LZ5A 5A62A 2G5TA 4WJLA 3EBLA 5BWBA 4U2DA 2HFJA 1Q0RA 1XFDA 1GPLA 3WK8A 4UBJA 4PV7A 1LGYA 1CUDA 2Y2VA 3STTA 5HKAA 1LPSA 1EX9A 1YAHA 3R3ZA 1CUXA 4OB7A 4GHWA 3O9VA 5ALYA 1SC9A 4YPVA 2OG1A 3V9AA 2ZYSA 1F0PA 5HFAA 1R50A 1CPYA 2XMGA 4FOLA 3WI7A 1RP1A 4F21A 4OYYA 5ALKA 4W9RA 3DCNA 4FLMA 5ALUA 4B9EA 5FDFA 4B9AA 2QJWA 3HACA 4JH0A 3TJMA 2BCEA 1J2EA 2HRQA 4N8DA 1E66A 4W63A 4FNMA 2XMRA 2XUFA 2ZSHA 4DYHA 1XZJA 4G8CA 5I7UA 5AI4A 4K6GA 4BTVA 3GA7A 1NU6A 3FYUA 2WU4A 2RAUA 3F8SA 1VE6A 2P8SA 4C4YA 3L1HA 1ACLA 4RGYA 5JAHA 3VDXA 2XMCA 4N8SA 4UHDA 4E46A 4A5SA 4G4IA 1CFJA 3M83A 3FYUC 2OQIA 1N5MA 2JGJA 1JMKC 4A16A 5T4EA 2EEPA 3WIBA 3W9UA 2PPLA 1VXRA 1JU4A 1N8SA 1P0PA 5HF9A 4X7BA 4Q34A 2DQYA 4FDMA 3G9ZA 2VAVA 3I1IA 3F98A 4HAIA 4UHFA 5DWDA 1WB6A 1FFDA 1FSSA 1MN6A 5DYTA 1EB9A 5I8PA 1BRTA 1GPKA 5CURA 5CW2A 2XUOA 5FPPA 2DSNA 1TCCA 3PFCA 3IUQA 5FPQA 3AJAA 1ZI6A 3C6YA 3H04A 3KSRA 1UOPA 2XUGA 3AIOA 2HRRA 4J0JA 1XZCA 4JNCA 1LBSA 2I3DA 5FXMA 3M82A 2H9YA 1LPBB 3OC0A 1C7JA 4BVLA 4X6YA 2PM8A 3FBWA 2RONA 3B3QA 1LPMA 3PF8A 3V1LA 4H7IA 2Q0XA 3HABA 3QH4A 4YASA 2WJ4A 5HF8A 3ESDA 4KE8A 1DTEA 4BP9A 4GW3A 3QITA 4WFKA 1VA5A 2C5GA 1CUCA 3KD2A 4OCZA 5FUMA 5AOBA 3WK7A 5E4JA 2RIPA 5ALQA 3DD5A 5HFNA 2ZVDA 3FNBA 3C70A 3OG9A 3DL4A 1ZOIA 5HZGA 4Y2VA 2HADA 5AI0A 1N5RA 4CCYB 3LP5A 2XI4A 3QPDA 4ROTA 2XUIA 4WY8A 5AHXA 3GUUA 2CB9A 4BE9A 1MX9A 5EI5A 2OAEA 2YH2A 1MT3A 3R41A 2J4CA 3KDAA 4MEBA 4GDMA 2XMZA 3FSGD 1OXMA 3S2ZA 3WWEA 5KWIA 3W9BA 1UZAA 5AM5A 2ZYIA 1P0IA 3I6ZA 1WB4A 1AMNA 2DR0A 2HIHA 4AMYA 5T4HA 1P0MA 1DWQA 4UBNA 3WWPA 3IULA 4AZ0A 3CN9A 4AN1A 4QNNA 2I03A 2PBLA 5ALTA 4TVKA 2O7VA 3WKDA 4EHBA 1W76A 3OPMA 1HPLA 4L3WA 4BVJA 4P9NA 1YS1X 2O2IA 1XRQA 2CEKA 3DYIA 1MTZA 2ORYA 4GBGA 4ZXFA 1JJBA 1QJ4A 1XROA 2EDCA 1R3DA 4WFIA 1CR6A 1X2EA 4FFWA 1ZGCA 1XZDA 2H7YA 2EDAA 5ALJA 4EY5A 1HL7A 4E15A 4CFSA 1A8UA 2C4HA 2G4LA 3I28A 1JJFA 4J0KA 4N8EA 2NW6A 4X92A 1XKLA 3R3VA 2IITA 4DNQA 3D3NA 4OB6A 3FVTA 2I3ZA 2RHTA 2X5XA 5T4FA 4Q82A 1VLQA 2V9ZA 3F97A 5CXXA 1CEXA 2JGIA 3IDAA 1W1IA 3C5VA 3B5EA 2J4FA 1EVQA 3HXKA 1L7QA 4ZWNA 5AM2A 1WM1A 5CRIA 4HRXA 4BZWA 5KREA 5ALWA 3R3UA 1XRMA 4UFPA 4DTCA 4QLAA 1Z68A 1QIKA 3I2GA 4KRYA 4QE3A 5EGNA 5JANA 5AKJA 1LPOA 3TGLA 5AKLA 4Q05A 1EA5A 3BF7A 2JBWA 1GKKA 5CT8A 2WUEA 5LLSA 5CT4A 1JKMA 3WL5A 4KJXA 4FBMA 3G9XA 4MWTA 3LLCA 5AM0A 1U4NA 4XVCA 3VJKA 4UFNA 3D59A 3AZOA 2VJDA 4K2AA 1P0QA 4G9EA 3QYJA 3IVMA 4B82A 1DT5A 5HF5A 2PX6A 3G0DA 1EB8A 1QIMA 3WK6A 4TGLA 4DNPA 4Y2SA 4OU5A 3DL7A 5EIAA 1CUJA 5F4ZA 5HK9A 2WTNA 1BROA 1Q84A 2GBGA 4EY7A 4AMZA 2WIDA 1MPXA 1E8DA 1H2WA 4DMFA 5E4TA 1VJ5A 1EVEA 3I2JA 4KEAA 2VQ6A 5E4YA 1UKCA 3HZOA 3WQHA 3O4IA 2WIGA 5ALHA 1LZLA 2JGKA 3HSSA 4OD0A 4GLBA 4P08A 4CIBA 2JF0A 2XUAA 1GKLA 1I6WA 3MUNA 4ZI5A 1AURA 2HU7A 4QWWA 4AO8A 4E14A 3ZPXA 2H7CA 4W1QA 4OU4A 4DNOA 5AKYA 4KRXA 1CQWA 1EDDA 4BDSA 5AK5A 4X71A 1IMJA 5EHQA 4X91A 2DCMA 2BGRA 4C89A 3KWJA 4BP8A 3R3WA 4HRYA 3QMMA 3H2HA 2HDWA 1H2XA 2GYVA 5C8ZA 3GBSA 3D5EA 2OCLA 1XQYA 2QTBA 4Y2XA 5ALIA 2VT6A 4J0IA 5CMLA 5CT6A 3ANTA 1E8NA 4GXNA 1C4XA 5AKZA 3BIXA 4UFOA 1B41A 3QVMA 4K5QA 3G02A 4RPCA 1L7AA 4Y2RA 3WZMA 5AJHA 3FLBA 5ALPA 1X70A 4AQDA 2OQVA 5DLPA 4XX1A 5HK8A 2HU5A 1KEZA 3C45A 4U2GA 2OPHA 4Y2PA 1FFBA 3FCXA 4EBBA 2WIFA 4B85A 2ACEA 2C7BA 4JYPA 2WHRA 2QVBA 1DINA 4CCWA 2WU3A 5BOVA 5K3FB 3WJ1A 2PSHA 5A2GA 3ESCA 4KE7A 2DHCA 2BUAA 3O4JA 3YASA 4ZV7A 2WUDA 5IH7A 1XLVA 3LCRA 3IUJA 2VTVA 2PL5A 3MUOA 3BJRA 3EQ7A 2WHQA 1RWQA 3UUFA 4MXDA 3WIOA 4L9AA 4BC1A 5D7BA 1F8UA 4CG2A 2JGMA 3A70A 3WL7A 3ESBA 5LKRA 1PFQA 2XMQA 3A2LA 2G63A 2YASA 4AB1A 4B84A 3O95A 3JYHA 2AXEA 4DLNA 4J0CA 5LP1A 4EB0A 1R9MA 5JD4A 1LPNA 3G9TA 3BF8A 5EIHA 5BV7A 4KAAA 4QDOA 1A8SA 4AO7A 1LPPA 4QDXA 4M0EA 3AILA 4FLEA 3STVA 5C7YA 4AO6A 1XRNA 4X6UA 4DM7A 2Z8ZA 5EFZA 1XRLA 4AN0A 4UBKA 4H77A 3BJMA 3DQZA 1MNQA 1CUAA 2QUBA 4FWBA 5EHNA 3ZLTA 4LXIA 5A71A 1ZJ4A 3D2CA 2XQJA 1FFAA 1MX1A 4KAJA 2RGUA 4E11A 1A8QA 2QM0A 2XDWA 1QIDA 5YASA 2HL6A 1EI9A 5JASA 4XWGA 2XQKA 4OUKX 1TKRA 1BEZA 4QWMA 4UBOA 2JEYA 5AH0A 1T2NA 2VAXA 3LIIA 2CZQA 1AZWA 2HA7A 3OTQA 3I2IA 4I19A 2WG1A 3DJYA 2JGLA 1AKNA 3T52A 1OILA 2XMDA 2ZJ7A 4C4XA 5D3ZA 2BAGA 5A6VA 4QDZA 4Z49A 4J3JA 3A2NA 3I2FA 1UKBA 1CUHA 2XQFA 2WFZA 3GFFA 2VSQA 4ARAA 3H2GA 1O6GA 2OGZA 1UKAA 3E1GA 2ZYHA 5FV4A 3VJLA 2OAGA 2WJ3A 3SK0A 1XZHA 4CIAA 4H18A 1E5TA 4C6HA 1AC5A 3CCCA 1CV2A 1AUOA 2VATA 1DT3A 3R3XA 3DS8A 2LIPA 3HEAA 5D3KA 1YB7A 5AKXA 1YASA 2XUPA 1J1IA 2WG0A 1FJ2A 1TK3A 5CH5A 5LZ4A 1PJAA 3Q8WA 5KBYA 3LS2A 2W22A 4ZREA 4Y2UA 3PE6A 5ALFA 1KU6A 2Z8XA 4FHZA 2GYWA 1K4YA 4JYMA 2RI6A 2GBIA 5CBKA 1DX4A 3STUA 5AI6A 1EK1A 2XUQA 4NVRA 1XZEA 4C4ZA 2QS9A 2C5FA 1BCRA 5CH3A 4DNFA 3GROA 2WJ6A 1NX9A 4IHAA 4YK7A 3WYNA 2XLCA 3OOSA 3RK4A 1O6FA 2GZSA 1E89A 4A23A 4WDQA 5AK6A 3PI6A 1ZD3A 1UOQA 4WFJA 3WJ2A 1CUSA 4H7EA 3OURA 2ROQA 1QONA 1JU3A 1QIFA 1XZBA 1UT6A 2OLEA 5JATA 4LXGA 4W1SA 4RE5A 1ORWA 3KOOA 4UHEA 3WL6A 4P92A 1YAJA 4B83A 1GQSA 4G9GA 2WLSA 5LYYA 3KWFA 3VXKA 1THTA 1JT2A 3SX4A 3PDCA 4H7DA 4C87A 3KXPA 1VZ2A 3FAKA 1DWOA 1RYYA 4MQLA 2HM7A 1ZI9A 2PUHA 3EQ9A 5AOAA 4KR0A 4LKOA 4B6GA 2BKLA 2PSEA 3E0XA 2YXPX 3FLAA 5K3BA 1C7IA 4QDUA 3VVMA 4MWSA 5K5EA 3H17A 4EY6A 5LZ2A 1WOMA 1J06A 5SYMA 1QTRA 1WHTA 1HKHA 1XZGA 2O2HA 5H3HA 3D0KA 5A7HA 1JI3A 3VJMA 3G0IA 2PUJA 1SCIA 3R40A 1CIJA 4J0GA 3WLAA 4QA9A 3FYUB 2XT0A 1W4LA 4BATA 3C6ZA 1CLEA 1WCYA 3BDIA 2ECFA 5DNWA 3R0VA 5JAPA 1U2EA 4AZ3A 1G5FA 1XZIA 2DHEA 4FNGA 1CUVA 4OB8A 4BBZA 1HDEA 4BRZA 3HRHA 1XZAA 3W06A 4X85A 1J07A 1BU8A 2V97A 3D2BA 1TAHA 3STYA 3G0GA 4Y9SA 1XZLA 3NGMA 5FKJA 1HQDA 2ACKA 1QIHA 1GQRA 4PNZA 3DNMA 1UXOA 3CCBA 1H2ZA 3EQ8A 3WKEA 3WL8A 5BWCA 1OCEA 2GZRA 4X00A 3G8YA 5CT9A 5HKBA 2XUDA 1CUBA 1JFRA 3K6KA 1G42A 1UK9A 2D5LA 3E4DA 1SCKA 2DHDA 2AJ8A 2WG2A 4Q3OA 3WWCA 4HZGA 2PSFA 2WHPA 1CRLA 4IH1A 4G5XA 5ALEA 3ESAA 4DGQA 1A88A 2PU5A 4BDTA 3PFBA 2WFLB 4EY8A 3H2JA 3A2MA 3CN7A 3WK5A 4BVKA 1VZ3A 2XE4A 5AM1A 3C43A 3V48A 3RM3A 2OCKA 1LPAB 2RHWA 2HHAA 3DLTA 3O4HA 4PW0A 1F6WA 1Y7HA 3NOXA 7YASA 5ALVA 3H19A 2HA4A 4OPMA 5HQ3B 3FCYA 1QFMA 5ALGA 5D6OA 1TQHA 4UHCA 3QZUA 3UUEA 3WWOA 2XUJA 1YSCA 3N0TA 3QPCA 4WCVA 4IH4A 1BS9A 4FKBA 3HC7A 4C88A 2AJDA 3DYVA 4KAFA 5AK3A 1G66A 1ZGBA 2AJLI 2CUTA 3W05A 1ZD2P 1AGYA 2YYSA 4Y7DA 4Q1VA 3RKSA 3IA2A 4HVTA 4J0HA 5HCUA 3L1IA 5JZBA 1KU0A 3WK9A 3OM8A 1XQVA 1D07A 2XQGA 4HS9A 2OGSA 2HU8A 2QRUA 1MO2A 4MYSA 3H1BA 4D9JA 1UK8A 2C0QA 3I6MA 4MQMA 3S8YA 2D0DA 1FFEA 3WYDA 3DDUA 1DQYA 5ALLA 1MAHA 5DNUA 5LZ9A 1QFSA 2QUAA 3K9BA 3D2AA 5AI8A 1YA4A 4B0OA 1USWA 1GGVA 1SOMA 1VKHA 3DEAA 3RARA 4AX4A 2Y6UA 5AO9A 1U8EA 1A7UA 2JEZA 1QGED 2GBFA 5LZ8A 5AM3A 4BZZA 4EY4A 1AQLA 3AUKA 5K3EA 1IZ8A 1TIBA 4PSDA 3ICVA 5AKEA 3AINA 5CT5A 3MGAA 2WUGA 4UUQA 5JD5A 1TRHA 1K5PA 1VA4A 1IUOA 4RNCA 4G4GA 5IVDA 4G8BA 4G8DA 4B80A 4BCDA 1K63A 2QZPA 4BB0A 1GZ7A 4F5ZA 4I4CA 4IO0A 3AIKA 1FFCA 4H7JA 6YASA 4CG1A 3FWHA 3ANSA 1QE3A 1IUNA 3WA7A 3V1NA 3H0CA 2Y1KA 3FSGA 3GELA 3C6XA 1S8OA 3BDVA 2V96A 4W1RA 3QBJA 4HXGA 2ZYRA 1Q83A 1HLGA 4BE4A 2XMBA 4K6HA 1ZJ5A 1YCDA 3R3YA 4HXFB 5AI9A 5JZSA 2ZJ6A 3F96A 3FOBA 4XIIA 1XRPA 4L0CA 4NZZA 2WSLA 2QT9A 2O7RA 3V1MA 3EF3A 4K6KA 4JUIA 1JMYA 3WWDA 4Q3KA 4B0PA 1UK7A 4C01A 4CCYA 1L7RA 1LLFA 2WILA 1F0NA 5C8XA 1AX9A 3NUZA 3HI4A 3O4GA 1LZKA 2XLBA 1VE7A 1ODSA 3WMRA 5J3JA 4FTWA 4KACA 5ALOA 1Y37A 4V2IA 4ZRDA 5LKAA 2V98A 2E3JA 4GECA 1ZD5A 3WKBA 3BIWA 1ISPA 5AKGA 3WKAA 3CXUA 2X8BA 2CBGA 4Y2YA 4J0DA 1IVYA 5JALA 5JAUA 4FBLA 1GPNA 3VKFA 3U0VA 4DSZA 4LXHA 2QKYA 4F60A 2R11A 4U2EA 1M33A 3U1TA 2HA6A 4J03A 4ETWA 1TCBA 3ZLUA 2C58A 3DKRA 3W04A 3I2KA 4O08A 2CJPA 2FUKA 4QLOA 4DMKA 5SYNA 5K3CA 3ED1A 4G4JA 3QMWA 4M0FA 1XKTA 3I6YA 2PKYX 2WIKA 2VJAA 5AP9A 3H2IA 3IURA 4HTAA 5IVKA 5AK4A 1YS2X 5K3DA 1ORVA 3QMVA 4BAZA 3G0BA 2OCGA 3IBTA 4BCBA 3DOIA 2BFNA 1W75A 1G4HA 2JGEA 1WHSA 1EDEA 5E2IA 3STWA 3ZLVA 1SCQA 4BAGA 4TPKA 1QIGA 1UOOA 2QR5A 5KWJA 4PSCA 4ZGBA 3NWOA 5DTIA 3AIMA 4H7HA 4UBLA 5IVIA 4P93A 2BJHA 2DQZA 4PF1A 2HA0A 1ETHA 1NU8A 5A7GA 5DYWA 1CVLA 5DYYA 2JIDA 2VA9A 3AZPA 5JIBA 3SWWA 2JGFA 5ALMA 2WFLA 2IIVA 2G5PA 2GYUA 3ZI7A 4LHEA 2B9VA 2ZSIA 2VEOA 3ILSA 1TCAA 4AXBA 2BUBA 3RLIA 4DSAA 1QO9A 2H1IA 1Q0ZA 1QZ3A 2WTMA 2C0PA 5HQ3A 1QTIA 3M3DA 1QOZA 2AJCA 4FMPA 5ALZA 4LYDA 1BCSA 1CUIA 4L72A 2VF2A 1ZIXA 1YB6A 3I1YA 1WPRA 4YX9A 1EHYA 1UWCA 2FJ0A 3PF9A 5EIEA 2W6CX 4KE9A 5EHXA 2HA2A 4ZV9A 2DFPA 1CUZA 4M0MA 1E3QA 4N5IX 5JARA 4DIUA 1W52X
chains in the Genus database with same CATH superfamily
1JTVA 2P5YA 4BRSA 1UEIA 4IZIA 4KGVA 3BL8A 4EPVA 4TMXA 3H4TA 2CWDA 1SD5A 4BMDA 3A6PC 1SKQA 1U31A 3DTVB 1U2GA 5JI2E 2CJYA 2CBXA 2QNBA 5ERXA 2OOSA 1ODCA 1YZ3A 1BKYA 3EXG2 4UEOA 3ZDFA 4AXXA 4BFZA 3AETB 1IPFA 1ZK2A 2EL7A 2VNAA 3G49A 5HDQA 4C0BA 1FB5A 2GBCA 2IKSA 1KJIA 1NYTA 3BB1A 3IP7A 2CDBA 4KYVA 4AKTA 4OHKA 1ARZA 3B7PA 3HTXA 1GG8A 5AVRA 1BN7A 4RFSB 3B52X 3Q11A 1QIIA 1YRWA 2Y71A 4PICA 1XPRA 3UMRA 5FBLB 4HXEB 2PNJA 3GEHA 2QUKA 1ZNXA 3N70A 1ZK0A 4PNHA 1WXEA 1DLJA 3MJRA 2JLYA 5KPDA 3AFIA 1BYUA 1PGNA 4CGYA 1U2GC 3H1TA 3KTOA 2BFCA 1MW9X 2WJHA 4Q3NA 1KO8A 5DP2A 3HKEB 2X0EA 4H35A 1HSOA 5EQDA 2OYRA 4QUIA 3IUMA 3G68A 3USCS 4EUEA 1UAGA 1HEYA 2GKGA 2QM3A 4GPZA 3MA0A 3HYSA 4L16A 5B53A 1E5DA 4CBVA 3FOWA 4EMBA 1LX6A 1US8A 4N03A 5CA0F 4CI9A 4FDTA 2I4RA 2PBFA 4N6GA 3NBQA 4QFMA 1YA8A 4PIMA 1YIDA 1YR2A 3QV2A 2XQIA 1FTYA 3M4JA 3SI7A 1RBZA 3WKCA 1KAQA 3TZCA 4BTLA 2YFQA 4L6IA 1KJWA 4M88A 3DBHA 4NV3A 1EJ2A 2OA0A 2G82A 3ROQA 4CHGA 3FIJA 1DB3A 4OMUA 2XNHA 2YN4A 1R1DA 4U00A 4BLVA 3FVRA 4TZKA 5A5VA 5IUKC 1J0AA 3IP6A 1J2JA 3HJBA 4MGKR 4TM7A 2HA3A 2ODBA 2PGAA 3U60B 4X3CA 3S29A 2GN0A 1TCUA 3QTBA 3O90A 3TWOA 3ZJUA 3M6IA 4P80A 1P44A 3SFVA 2ZR7A 3PXAA 1ZJWA 4B81A 5FI3A 4TLLB 4GRDA 5CLIA 5FP0A 5L8VA 3RVKA 1T5HX 1BEEA 5FIUA 1A5SB 4M60A 5KOJB 4L6CA 1K97A 3M2PA 5KAMA 1I94B 1ZVVA 1QYRA 3BRWA 1H1LB 2UVPB 4IFBA 1X19A 3DPSA 4L4UA 4QUJA 4BYGA 1Z47A 2BFFB 3D3QA 3DWIA 4GRIA 4KC0A 4X6XA 4F46A 3UWSA 5IXYA 5JMTA 1YMQA 3FHJA 3IO3A 4LX0A 4LRQA 4Q7KA 3PJRA 1NPYA 1EDBA 1SG9A 3HMKA 3L9XA 5K0ZA 2XYGA 3DOHA 4GVPA 4N9QA 3EJ6A 1MJ5A 5F2EA 9ABPA 1XKXA 2QE7D 2RK3A 5E9WA 1I5EA 2OZLB 4Q3LA 2A0KA 5F52A 1FSPA 3RC7A 4MIOA 1R9NA 3T1TA 1H3NA 2HIGA 3TQTA 4HVCA 1Q21A 2XHEA 5TGTA 3OMXA 4F6RB 1BFUA 3CNBA 4L5YA 4QTUB 5AKIA 1KAEA 1YR9A 4QEKA 3ZBTA 1QLWA 3OSUA 4TLAA 4A8JC 5ALNA 1MT0A 4ZCIA 2GWHA 5KB3A 3VU9B 3L0YA 3TX6A 5DNVA 3RAGA 4U9UA 4JJEA 4DFDA 4NOMA 1XZMA 4TUYF 1ZM7A 1K08A 4P34A 1R27A 5F9MA 5IDVA 3IMKA 4RGVA 2UZ1A 3S0JA 4A3SA 4C4AA 1Z56C 2IEAA 2EHJA 1J49A 1EFLA 4JQZA 2VJBA 5FBVB 1PL8A 3OEHA 1QKKA 1SU4A 2W2LD 4F3YA 2BFBA 1AQIA 2WTAA 5AVXA 2O2GA 1PL7A 2J3QA 2O2DA 5KSZA 2YV5A 1DTWB 4MKXA 2QPOA 2OC4A 2CMFA 3HCBA 2IIPA 1VFNA 4N7JA 3AQIA 4P2GA 3VR5D 3ROZA 2AKEA 4AP9A 3EY4A 4BS9A 3KZCA 2J3MA 1VSUA 4L27A 4EGQA 3L06A 2CY0A 1L4GA 3BL5A 1QM5A 1E3TA 2YFYA 3L7DA 1MX5A 3G7NA 3HU3A 4WKBA 4YJDA 1C3OB 3OPYA 2PX5A 2HSGA 3PUWA 2EX1A 3PUHA 2BFOA 5HWSA 1IONA 4DT1A 3X2SA 3P2YA 4TQAA 4GEGA 1G2PA 3GJ0A 4BCCA 5DXFA 3FE2A 3JWEA 3MRVA 4OFZA 5IJ0A 3SM3A 3AI1A 1O6CA 1IXSB 1Z0DA 4IEEA 4UHHA 5EKTA 4RDXA 1ZOOA 3WHKA 4FILA 3LDFA 3O8QA 2HFKA 4OMDA 4XIFA 2IT1A 2OESA 4R0NA 1VI5A 4PBTA 5BN4B 3GW8A 3CJTA 3DUFA 1U65A 1SVMA 2ZTUA 3IOYA 3IEXA 5FOXA 3ME5A 3BZWA 3UA3A 3LBAA 4DVJA 5G4KB 5CHEA 2ZUVA 4TWBA 4DM7A 2Z2IA 2I87A 3JAKB 3QOXA 4GEKA 5M29A 1Q11A 3F6SA 1ABBA 2WBLC 1XRRA 4FMBB 4BO0A 2VAWA 3NDIA 4FFPA 2E82A 5ESRA 3VVBA 3PCTA 1WMSA 3K0AA 5DJ5A 4B2LA 2YNMA 4AKHA 1V3TA 221PA 1HM5A 5B1DA 3SNKA 2AMJA 3C87A 3MHPA 4X1YA 3WLLA 3EIFA 4URVR 4YRKA 3F6RA 1RC8A 1MC8A 4F0JA 1N1MA 1XF1A 1D2CA 2NPIA 4RF4A 3RC9A 4ESHA 4UDNA 3E5NA 2OG2A 3UZUA 5AUNB 4NC9A 1N2CB 4R68A 2AFHE 2Q3BA 4RVUA 2MYNA 3ZW9A 1NQWA 3WS7A 5K0FA 4A1FA 3NDRA 4N5NA 1ZRSA 8ABPA 2IS4A 4QVKA 3DKKA 4FZVA 1BHSA 1GY8A 2YNMC 4ZOBA 1TXGA 1IOZA 1MXFA 3ZK8A 1FYDA 1L7BA 3EZLA 2D2VA 4O2BA 3DWFA 5AIAA 4RPKA 5JSKA 3ZW7A 4NMMA 5JNWA 5HNKA 3I5MA 2IPXA 3F1LA 3M6WA 2PKQP 3P20A 4J1TA 3UMJA 4DLZA 2CV2A 1I7NA 3KZOA 1M1YE 2GPAA 4GM4A 1Z33A 1J2TA 2BGKA 2V7GA 5HG0A 3FI9A 5FUQA 3MTIA 4DMHA 4GWLA 1BE0A 1OFUX 1QHYA 3SJUA 2V7EA 2GPJA 2X5NA 4CFZA 2XZLA 4ZCTA 4OX9B 2X58A 2Q3CA 4LVNA 1JHMA 1LBIA 2PU7A 3RTEA 3NYQA 2WD9A 5ELXA 3C41J 3RPEA 2NSHA 4C7XA 3LLMA 3MRXA 1E3WB 1WHTB 5T4BA 2G7ZA 3AX6A 2Q45A 4NE2A 2PMKA 5CLQA 2BDTA 5FLKA 4YUXA 4L3VA 3KG2A 3C8HA 4S1NA 1N32B 1KRHA 3BTSA 1CE8A 2H7XA 4Z0TA 5SZIA 3SMQA 4MYUA 1FS4A 3I76A 5AYVA 3OJOA 4J1TC 5MHTA 1DFIA 4AWXA 5DNYB 4EKNB 2IKQA 3WSWA 2GF2A 5ALRA 3QKRB 1PJZA 2XTAA 2WYHA 4QQKA 3RSZA 3LTNC 3RD5A 5K6AA 1ZL0A 2PLAA 4LCJA 4ZYVA 1AKYA 1MABA 5B55A 1MB9A 3KFLA 5JY1A 1VMEA 1GTVA 3EHEA 3UHJA 2HR1A 3U3DA 2IQ5A 3RUCA 4F6LA 2JGRA 5DX0A 1DVRA 3O8OB 5I4CA 1VL2A 1UF9A 5DSXA 3AGPA 2H1OA 2FKNA 1U5BA 3G5LA 1GT6A 2QV7A 5IYZA 1PTJC 4MQEA 2O2SA 3W5AA 4RF2A 4ONEA 1I51A 3NHMA 2G72A 3AR5A 4GMHA 4HB4A 4TXMA 1YJ8A 1E32A 2QI9C 4WK2B 3TLGB 4BLTA 1CQIA 3GRAA 3K2BA 3LHFA 2CL5A 2IPMA 1OH8A 2GM5A 5K6AC 1CNEA 5BOSA 3L07A 3HJTA 4YAIA 1P2BA 1HETA 3STXA 1JS1X 1EIWA 1PWYE 4LJSA 4XGKA 5FRDA 2F3PA 3A31A 2IXFA 2JFGA 4ZCPA 3RKRA 2Q9CA 3HO1A 2QP4A 2AFRA 5GJVC 4JLNA 1TJPB 3I2HA 5IP5A 4K40A 3EFEA 3WGJA 3FUTA 2PRIA 1H23A 1CUYA 1NM5A 2FNAA 3R8CA 1F5SA 1JIJA 4B2IA 4C4RA 3T5BA 2DFVA 1RWKA 3D9QX 3DG9A 4TKVB 4QARA 3M34A 4NAVA 1SBTA 2DTDA 4YJFA 3COJA 4DHWA 1P4SA 2B5OA 4MR7B 4YP1A 2AHRA 3V4VB 4ZI7F 3KNZA 1FMTA 1Z37A 2CXTA 5G0VA 1Q95A 1M2WA 4CDGA 4UBMA 5I9IA 2CCKA 2YWBA 1ESMA 1GA1A 1KK0A 2Z3VA 3D8TA 3DMDA 4TKZA 1VSVA 2I6UA 3L7KA 5SY6A 3ZTTA 3EG5A 4IG9A 3PQEA 3VZCA 4R51A 3FDFA 3UM9A 4MPRA 4DR2B 1OU4A 1U90A 3DONA 1T5IA 3E03A 1WMFA 4MI6A 1NM5C 3LOUA 4E88A 1EBUA 4FQ5A 2J67A 3KSZO 5AJXA 4YT8A 3D4NA 3ANXA 3NHUA 1QIJA 4HN2A 5JSQA 1XVTA 1XZFA 1N5JA 3A6FA 3K8YA 1XK6A 1PGPA 3DL0A 4FCTA 3NHAA 3RFCA 3GZNA 3T34A 1P1RA 4EYSA 4IDOA 1GNQA 4MB0A 3QFSA 1IXKA 3KR2A 1QF9A 3CH5A 4JL8A 2CXXA 3W5UA 3A9UA 1NUPA 1RABA 4UJ5A 3GLHB 3ND7A 1CK4A 1UEJA 3ZV7A 2QPTA 3SBEA 3OO1A 2ZJBA 4IIJB 4GICA 1XN1A 2GH1A 3AT1A 4C0KA 5CVCA 4G1FA 5DULA 1G3UA 2IEZA 3L05A 1ZN9A 5JHHB 4BJ5A 2QDKA 2W6OA 4G1UC 1NOIA 3EFOB 3GRUA 3L4KA 2WHPB 4TSKA 3U6BA 2O7NA 4HDNB 1NR5A 1L4KA 4MEAA 4UNNA 2V74B 1G16A 4LY9A 2B2NA 3ZUGA 4I1IA 1AK1A 2AL7A 3DR5A 4DV7B 5AXDA 1HGXA 1PD0A 5D7NA 5HIIA 5TQ0B 3BWBA 3W5CA 5BMOA 3CW9A 4R1MA 2FW9A 1FBNA 1P2VA 1RKVA 1VL5A 4JEIA 3USES 1P61B 3V1YA 4ZIRA 3QBDA 5JROA 4N5HX 1QG2A 3SHWA 1RPJA 4B3JA 2XE7A 1N6RA 5CA1A 2KJQA 5ES4B 2R1UA 2YWRA 3CUEF 4WNAA 5BQOA 4MNTA 2FZ4A 3C3EA 3LKBA 3BXEA 3RV4A 4QRIA 2ZT6A 2AWOA 3OTHA 3LWBA 4U2DA 1SZPA 3CEPB 4EMSA 3TOXA 4L6AA 4Y3UA 1G9SA 2ODQA 1II8B 3BQNB 4GWGA 4MLPA 4AF6A 5FL3A 1IN4A 4HRVA 4IDAA 1KJYA 4PM4A 4QUKA 2Z9BA 2Z8YM 4R54A 5H70A 5AW9A 3ZEAA 3TXYA 5D86A 1CD5A 3LJKA 4GPBA 2IWRA 1EM8B 1D1TA 3U5ZB 2QP9X 3B6JA 4IVRA 2VDLB 2Y2VA 1ENPA 3RIYA 3PJEA 3LLUA 3VA7A 1VLZA 1DBPA 1QGUB 2R47A 3RRYA 3FH0A 2WJPA 3E9EA 2V7TA 2QVZX 3IQWA 3PJFA 4FOPA 3UAXA 3T15A 1EX9A 2BWJA 3VV2A 4ZKDA 2XGSA 5ADUS 5JE8A 1A0OA 2HY7A 2MYTA 1O0SA 1QDEA 2H2DA 2CC2A 1CUXA 4R31A 2BFEA 3WRXA 5C51B 3BE6A 4MGEA 4NYMR 4TXHA 1PL0A 2FN3A 2X5OA 2W2NA 3WG9A 1SC9A 1JXQA 1KEUA 3KPWA 3CCFA 3EQ2A 3T4PA 1JDTA 3TR6A 3VSDA 4HNUA 1ZEMA 1ZIOA 3RYHA 3WO1A 4C29A 4ETIA 1Z45A 2XA1A 1M0SA 2B99A 5A3JA 3OCYA 3TE6A 2Y92A 2XMGA 3PLAE 1VB5A 2R68A 4DLSA 3BSYA 1G9TA 1WDTA 4QIHA 5JISA 5CLHA 1AV7A 2B8TA 4URFA 4WKCA 3UUGA 3HNOA 4RV5A 3IP9A 4LPSA 4O4IA 1V16B 3P0IA 3FRIA 3NBUA 3WLEA 4ESVA 2A84A 3F1KA 4LZWA 1DG9A 5ALKA 3WRXC 3DE6X 5CLJA 2W2MA 5THXA 1F0YA 1PVDA 3AFMA 1FBTA 1GZUA 4NBSA 2EWVA 2EV9A 3N2GA 3QJGA 2QJWA 3HACA 3NU1A 4QDKA 2NO6A 4JKYA 5KJ1A 4ZQEA 4N8DA 1JSZA 5CVUA 2CLOB 3FJYA 1W59A 4YRJA 5A05A 1QSGA 1CRPA 3KJZA 2PEYA 3LXRA 1MFZA 5L3SB 1WTAA 3RTCA 2J3LA 1D09A 4B3CA 4E1VA 4G0WA 2XBMA 4PYKA 4URWR 1XDUA 4XGNA 1Y8RB 5I7UA 4YAWA 1I4LD 4WK4B 3LOQA 4IGKA 4K6GA 1JWBB 1U0LA 4U6NA 4US0R 4BTVA 4N0EA 4Q3AA 4CNBA 4EQ6A 1DGQA 3S27A 4D4KA 2PY6A 4C14A 2BZ1A 3MGBA 1U1FA 2VUIB 4WV3A 5LP6A 2E2WA 1XMPA 2P7HA 1S2GA 2EJBA 4YDSA 1VE6A 1WUKS 4FS8A 1RYMA 4WK6A 3ZVLA 1LV8A 3WGYA 2J3KA 4C4YA 4N01A 3L1HA 1ACLA 3FMFA 4NICA 4WN9B 2FZ5A 4Z0HO 5CB0A 4M8IA 1U9IA 2ZCUA 4I4TA 4HHEA 4YAGA 3DAPA 4N8SA 1IY8A 2QRLA 3COVA 4XX0B 5ADWA 3SX2A 3UAGA 2CXUA 5H3CA 4A5SA 4M8KA 1UBGA 1WMAA 1DRUA 2DBYA 2R7KA 3G8DA 3P9PA 4G4IA 5WRFA 3VYWA 1A2KC 3V8VA 4CKWA 3M83A 4YMWA 1EGVB 2R4TA 4JBNA 4IM7A 4KQ6A 16PKA 2PFKA 3TFWA 5LP6C 4W5OA 1G1AA 2GN6A 3OZAA 4WOBA 3C7TA 5AJTA 4U63A 4A16A 2O48X 4EEZA 4OKNA 5KTOA 5CNKA 4L85A 4UM8B 1Q0SA 3K9NA 1Y3FE 3D1JA 3W9UA 5ED0A 5HHTA 4ZAXA 5GVRA 3O4RA 5SV2A 3I0NA 3AVOA 1TEHA 3UHOA 3GU3A 3IV9A 3N76A 1HYQA 1YR6A 2OR3A 4GKVA 1ZUNB 4DWVA 4U7WA 3OF5A 1JDSA 2X6RA 1FDIA 1M2EA 3G9ZA 4TOIA 2ZVJA 5KOJA 5F2KA 4MW1A 2VAVA 3E1SA 1SR8A 3C8UA 4POAA 4HAIA 2CLHB 3OD1A 2RE8A 5A0VA 3IELA 1U8YA 3BM5A 1FRVA 4MW4A 1PQUA 5BR8B 1WB6A 1FFDA 3DZBA 4WECA 2IYRA 2JB9A 4BV9A 2FLVA 1UFVA 1FSSA 2ZBFA 5FLXA 3EPRA 1XHEA 2AMLA 1RQPA 2B37A 5B6PA 5HGJA 3QW4B 4IOKA 1BH6A 2E4YA 2Q5HA 2Q6OA 4YEDA 3RT9A 1BRTA 2A92A 3NX4A 4YLYA 2NN3C 2ID4A 1L5RA 3RU9A 4BNVA 4KPUB 3GUZA 4NARA 1Y1RA 3QEBZ 3FSRA 3U0BA 1NN1A 5CVEA 2AYZA 1DXYA 4ZALA 3FOEC 3B1WA 5HKKD 4RHXA 2M6RA 4BX0A 2HIMA 1NKTA 1VJ0A 1WVGA 3TSWA 1U0NA 2OWDA 4NPAA 5DE3A 5FPQA 1IG3A 4PXYA 3SKXA 2ZPUA 2ZVQX 1XDWA 4YAJA 3GA5A 4GX1A 2GEJA 2GAJA 4E1BA 3WSTA 5LQDA 1JAYA 1KEVA 1DDGA 2YY6A 3H1FA 2B0JA 3IPRA 3QE2A 4X64B 2IBMA 4WCDA 1AT1A 1TO6A 5EP4A 3FHTA 3MMSA 1Y9EA 3ZVNA 1NXTA 3DP9A 1XSEA 2H4FA 2HTFA 2VQSA 3AIOA 4V1CA 2O5VA 1Q2XA 1XZCA 4CMEC 3OIDA 4ZZIA 4K9KA 4JB8A 1V9CA 1QUFA 2GA8A 4RL6A 4YT5A 3IC5A 5FXMA 3HLTA 5BYAA 2L82A 2FPKA 1QHHB 1KDRA 4UEJA 4FX5A 1UCFA 2XKKA 5BXYA 3OPQA 1IHXA 2VF7A 3OLQA 1MH1A 2GD6A 2R85A 2ZIGA 3CX7A 4IY1A 5E9AA 3I73A 1L5QA 1P60A 3SFTA 3ZCRA 3TFQA 1SK8A 4E5DA 3AMVA 3GLRA 4ND1A 4UOEA 5LQAA 3U1VA 2ZUEA 3CH4B 1YB1A 2FQWA 1ZW6A 2JRCA 2ZANA 3NALA 1W85B 3PF8A 2GAIA 4RSGA 3MB8A 1A2BA 4L22A 5CVJA 3RASA 2GUWA 2FKAA 3TTTA 5A3RA 4H7IA 2JGDB 4BY9E 3OZDA 3R6TA 3A37A 1Y5IA 4QJ5A 4K3UA 3L0BA 3SHQA 3X1XA 3NJRA 2AG6A 1HE5A 1QFJA 3CLVA 3FPFA 1XP5A 4TTIA 2EQAA 4YRIA 2V4MA 3RLFA 4KE8A 4QXOA 2A35A 1DTEA 2GF9A 2WTEA 3L0OA 2IZZA 4PRLA 4UU7A 3RUFA 2CHUA 3DM5A 2PCJA 4JNKA 3AOEA 1O8BA 4LYAA 4BP9A 2W42A 1RCFA 2L17A 3LPAA 3GLVA 1C2YA 1M8PA 1OFIA 3QITA 1B8NA 1VA5A 3H9GA 4UC0A 2I33A 1KTVA 4JIGA 4YC7A 1EXNA 4HV4A 1ML3A 1R4AA 1H2EA 2P35A 4MLDA 2QRQA 4QFCA 3P9SA 1WZ2A 3NH6A 2NU8A 1Y3CE 1A9QA 4S0ZA 3ZHQA 3WK7A 3ADOA 1MBZA 1GEEA 2K5UA 1NZJA 2NV2B 3SS9X 2AUNA 1C3XA 3BTOA 3MFQA 4BKUA 1J1UA 1COWA 1AQNA 3AOEC 3C70A 5FOUA 3W3ZB 5F77A 1DC3A 1N2CA 1TGYA 3IKJA 3OG9A 3Q7PA 4L4YA 5JNRA 4NI5A 3IT2A 3I5YA 4B3RB 2IOFK 3QJ5A 3I9MA 4Y2VA 5EXEA 1K7XB 5IM4A 2PUBA 1BX3A 1CG6A 2WT8A 4JA2A 4D0RA 1ND6A 4N7MA 2PVPA 2A86A 3SYNA 1D2NA 2N46A 3DVSX 2XUIA 3I9V6 1ZJYA 3B8HA 4MMXB 4NEQA 3VO2A 2PGXA 5AHXA 1AKQA 5KTRA 3CU5A 4NULA 3FYSA 1XXLA 3GUUA 4MVJP 2J6HA 4PG6A 1DIRA 4ODIA 4Y67A 1V7PC 3DM9B 3TZ6A 5L4SA 1TEZA 1KEEA 4JC4A 2EG9A 2VLIA 2Z1DA 3PK0A 1WOYA 4FT4A 2XOXA 4N5DA 4RY0A 1S2IA 2YRWA 2EFDB 3L84A 2ZIWB 1Z88A 3TSAA 2VUHB 4Y2GA 1KH1A 2XMZA 2BL4A 3UATA 1RHMA 3KAPA 3ORFA 2OXFA 4OREX 4YMVA 5KSYA 1W96A 1JSCA 1DIAA 3FSGD 3HU5A 2X6QA 2QTMA 3NM6B 3M5WA 3OQ1A 1NFRA 4ASUA 5AESA 1EUYA 1IY9A 1QK5A 3QE0A 5KQGA 4BQQA 5BN3A 1CEQA 4WZBB 1G3MA 5BQ5A 5JH7B 1YZTA 3INGA 3R9XB 3IT3A 5K1ZA 3W9BA 1JG6A 1NXWA 1J42A 4M9QA 2ISQA 2K6GA 4OGLA 3AJDA 4CTMA 1XD2B 3T3PB 1CW2B 3BG5A 2VNSA 3CO5A 3D6AA 3QKRA 1F1BA 1AMNA 2FPPA 4JR2A 3T7JA 2X77A 3HDQA 3W5SA 2ENUA 1Z7GA 3T5PA 3AOGA 2FE1A 2B83A 4GP7A 4UBNA 4WLNA 2F55A 4BMNA 5J58A 2G9RA 5JT1A 1B0UA 2QTNA 5JW6A 4AWAA 4NV1A 4AN1A 1Q1EA 2PBLA 4QNNA 2C5SA 4TVKA 5IKEA 5JPIA 3FWYA 3HKBA 1A76A 1U8TA 4AAYA 4EHBA 3G79A 4LHVA 3V5NA 4QAJA 1KJZA 5CDFA 3V6LA 1OLOA 4BVJA 1W5AA 3WMXA 3JZDA 2O2IA 1PLLA 1XRQA 4DQLA 4V2UA 4G1EB 2VK8A 3TLXA 1CP3A 3HDTA 3ESRA 4NCXA 3C3WA 4DM3A 4HFJA 1Q0LA 5EFOA 2FSSA 4W5JA 5FL7A 4UMVA 3IE2A 1BSVA 4B48A 5I9SA 4W5RA 1NSFA 1DE0A 1R8JA 1QJ4A 1F2TA 4V0QA 3UK0A 1QG6A 3W78A 1ESEA 1XO1A 4XUDA 2BEWA 1W1UA 1NNI1 3R6GA 1P0FA 1WXGA 2VJMA 3LFTA 3AG5A 1KJ9A 4L0QA 5GM2A 1KVRA 5LD2B 2EFEB 5H4HA 3RDPA 1I6KA 5ALJA 1NULA 4RM2A 3KQVA 3LPCA 3PGMA 2ECOA 2AN4A 1B2LA 3T38A 4ZU1X 2PLFA 2VDPB 2WM3A 4D45A 1KZ9A 3W8NA 3RRNA 1Y3HA 2WSIA 1A8UA 2C4HA 1SIBE 4DDVA 1JJFA 3BH0A 4O4HA 1DC7A 2V58A 3IPAA 4N8EA 2O8FB 1CY1A 2PH5A 4YNBA 5SYAA 4OLAA 1M6EX 1TM2A 1JHYA 1YRHA 4FD3A 5DGTA 1CULC 2BR5A 1JHQA 3FZQA 3PXDA 3WQRA 4AUKA 5KSOA 1R00A 2DFTA 5SZJA 1C50A 4HC4A 2KS6A 4DNQA 1GT91 3K1ZA 5KKAA 1JLLA 2IU4A 1QB7A 4JU9A 4Y8VA 1R15A 4JEUA 5T4FA 2A9PA 4EFKA 5J59A 1VLQA 4BUZA 1Z0JA 1IB0A 1V8ZA 3PS9A 4MUEA 4XEHA 3OQVA 4Z9BA 4HAXA 5KSWB 2AN1A 1FZTA 5TSDA 2QRPA 1T8PA 2WKPA 1CEXA 3F2IA 1WD7A 3GLHA 4CEHA 4GBJA 2HYIC 1C4WA 2H06A 3R3JA 4M9UA 8LDHA 3ENKA 1GRVA 1RJEA 1BX1A 3NGLA 1XQ6A 2V7PA 5GIOE 3RADC 2FY8A 4AG5A 1BOFA 1V2HE 4ZO7A 3EFOA 2COUA 2JJQA 4REQA 2GXAA 4KN9S 2QU7A 3T9CA 8MHTA 3B5IA 2GRAA 3T9EA 5K8VA 2W8BB 1EFPB 4C6TA 2WAAA 2HW8A 1FUYB 3H11A 4QJIA 2GM9A 3V55A 5MGBA 1S7CA 4IQGA 2AOTA 1Y9AA 5TIIA 3HGQA 2C2YA 3GOQA 3FSJX 2YWXA 5I4KA 2V4ZA 5BSKA 3NZEA 3ID6C 3VJRA 5HFJA 2C99A 3PRKE 1TVKB 1NRXA 2QY9A 4Y7CA 3TPZA 3ESYA 4DXAA 1JA9A 4EHFA 3UAYA 3WB0A 1FSFA 4I66A 5BN1A 1G8FA 3WGHA 3KPVA 1CC1S 4JJ8A 5IRCD 4QC2A 2C4NA 2W6ID 3H3FA 1UKZA 2Z5FA 3KFVA 3VBEA 4ARZA 2B35A 5AKJA 4F84A 1LPOA 5DOVA 3TGLA 1R66A 4DJTA 1G3RA 1CJKC 2X23A 3GN1A 2CVHA 3MMZA 4PLVA 1RI5A 5KVSA 3L0ZA 4G36A 5CT8A 2PLWA 4GOXA 2WUEA 3ND8A 5CT4A 1BNCA 2PJUA 4ZXPA 4CLXA 5C7LO 2F8MA 4BKQA 4ZTUB 5IJ9A 3K70B 3WL5A 3WP0A 2YRXA 1XD8A 5DI9A 4AMBA 4BKRA 4M3NA 3JQPA 3PDIA 5KQPA 3QHPA 1KQFA 3M89A 1GGHA 3TR0A 3CLUC 3UENA 3WQQA 3AVUA 3OE4A 3L49A 4LV6A 1C7EA 2R1TA 4ZQGA 1YMUA 4XE5A 3AF1A 5D00A 5KINB 4LY0A 4Q3KA 4HX9A 1YL5A 3ND9A 1C14A 3TDNA 1V7QA 2VQEB 4UFNA 1N0VC 2JFNA 5E3HA 1QKJA 3ZE6A 4IQ8A 1KDOA 2ZE6A 1QMGA 3HXTA 3ZKWA 3WWZA 3E82A 3V33A 2BHRA 1U8FO 2C61A 1DT5A 4NCHA 2PX6A 5HF5A 3OSZA 1ZGJA 2VNKA 2CW5A 4LQ4A 4LQLA 3GJZA 1NXXA 2YIMA 3Q5EA 4I1OA 4TGLA 3IYLW 1ZOLA 3GGOA 1ORTA 4OJKA 3PGJA 4Z9XA 4DNPA 2J0EA 5C4MA 4ER7A 5CVVA 3DL7A 5KKNB 5HK9A 4FUTA 2JLCA 2PG3A 1G8GA 3S44A 2A58A 2D8MA 4CCSA 1Q84A 2ZWMA 1AJEA 2BC9A 3LWDA 5E1DA 3AHGA 1NJ1A 2SHKA 3C4JA 4WOJA 2QVGA 2ZRFA 2ZS7A 1O3YA 2AMYA 3AXSA 1T9BA 4DMFA 2LDBA 1KP3A 1Z07A 1B4DA 1ZA2A 5JXGA 2E6KA 3CG0A 4DG8A 3SDBA 1S4MA 5L3SA 4Q5IA 5BN5B 5IBRA 1AU9A 4P22A 4EG4A 1V7CA 4YJ2A 1O9GA 2P9TA 4ZJUA 1EVYA 2WIGA 5K0LA 1C1YA 4OD0A 5BT9A 4JAVC 3KHTA 3HEBA 2BF4A 2ZRDA 3IAS6 4FGWA 4JB2A 3HLYA 3GJ7A 1GU7A 4MQFB 4CIBA 2JCBA 3HL4A 3O8LA 3OPXA 3ENNA 2FR8A 4ZI5A 3Q2IA 1AURA 5E3IA 4QWWA 3QX3A 4BBAA 3K70D 1IBMB 1YRQA 1FQKA 3NHRA 3P32A 1YOVA 2WWRA 1QU3A 3DV0B 4EYEA 4W1QA 2VO1A 4OU4A 1D5WA 5TRTA 2WYOA 3RFFA 3H87A 3L93A 1EJ0A 2AD1A 1BDBA 1FUKA 1CQWA 2C5EA 2POQX 2XDYA 4O8ZA 3DO5A 5AK5A 3JVIA 3TLJA 5FCDA 3BQMB 7ABPA 2ODTX 1IMJA 1U3CA 2HWYA 3RFXA 4XSHA 3ZY6A 4EYGA 2W6JA 5EHQA 1JALA 1QC5A 4D96A 3WNVA 5K0BA 4JMPA 3QE9Y 1AS0A 1NVKA 2W6QA 1X77A 4IFIA 4UXHA 3VYTB 4C89A 3NIGB 3D0OA 1A50B 5D5QA 5EAIA 4MW9A 3VR6H 3C3YA 4N7RA 2FR8C 4E6PA 3F3YA 3R3WA 4MVJE 2GPNA 4N82A 4A5OA 3CNOA 5BSFA 2C07A 1P1JA 2FXIA 3BB4A 3OX1A 4IMJB 3UPDA 2N0SA 3WMGA 3BD7A 4Y6RA 5FWDA 1EK5A 4BV2A 4MVJI 3MT9A 5FYQA 1P17A 4GNRA 3SC4A 2HT6A 1V11A 4LYFA 4IPTA 4P7KA 4Q39A 3E05A 4UZFA 5CMLA 2X7JA 5CT6A 4BUJA 5LWQA 5GINE 3IQHX 1C0EA 1XUOA 1E8NA 1NXOA 3PA6A 5FTJA 5AKZA 1YZQA 3H5AA 3P52A 3SQNA 821PA 3OJFA 1IHYA 4P98A 4WBSA 3EDOA 2W6PA 5EVCA 2O7SA 3GCGA 2AB0A 1HNXB 3K1YA 4R1UA 1R4NA 4IZHA 1C1DB 1JE0A 4XQGA 3W2EA 2UZAA 4AZVA 3AF5A 4G0PA 4FKMA 2ZAYA 3OZFA 3WV5A 2V7VA 3EUEA 4JL6A 3G02A 4RPLA 1YU6A 5CFOA 5EJFA 2ORIA 5JWRA 4RPCA 5EHGA 4GR5A 2DH5A 4A6PA 2H1CA 2R5FA 2OB2A 1G291 1N57A 1GNSA 1L7AA 1X1EA 2AE2A 2Q3EA 3D8HA 4UQOA 1E2KA 3LMKA 1UC5B 2VBGA 1P5FA 1GA4A 3FLBA 1DCFA 3KETA 1X70A 1PGOA 5F5XA 3R9WA 5DLPA 3GH3A 2H57A 1IY1A 2W58A 4G4SO 3IQGX 4N0PA 1MEJA 2HU5A 4PGMA 4RMNA 7AT1A 2VN8A 3CKLA 1KEZA 3G5TA 3MWDB 5JVDF 3A1TA 2RGGA 4U2GA 3PJDA 4W8GA 2Z5VA 5DMXA 4Y2PA 1GKIA 4O2AA 2YMLA 3G82C 1OWMA 4C9BA 1OGYA 1S2NA 2WEKA 4Y1EA 1K3UB 1A7KA 1NVFA 1R9JA 2DWOA 4IIFA 2QUZA 4Q4JB 2YFHA 1SC3A 4ZC1A 4ECAA 4F04A 3M8KA 3HBFA 1TU0A 3NLLA 4TLBA 2OMEA 3GXOA 4U0KA 1UQRA 5CJPA 2YXLA 3LX4A 1M34A 2RH5A 3MSCA 5FD8A 5A2GA 4HEHA 1XC7A 3CEJA 1NVBA 2BUAA 3ICEA 2C2KA 1E4OA 4DLYA 4FSDA 5HQJA 4MV0A 2GCIA 3VPXA 1P1FA 3FUUA 5K8IA 4XM0A 3MWLA 2NVUA 2PQMA 2VC2B 4NU6A 2HNAA 1CS0B 3BJRA 1Q7BA 5P8WA 1JUDA 5M7EA 4UOQA 3WLQA 3HCOA 4KO4S 4XSVA 3AJ9A 3TZBA 4D5EA 4Z0PA 5J2UA 2VAPA 2I2XB 2NOAA 3D7KA 4TKLA 1T4GA 1GPH1 4KQXA 4R98A 4TL7A 3EZGA 4QECA 3SFZA 5KO2A 2A59A 2AJTA 3LUCA 2QQEA 2MJLA 3SC2B 3HP1A 2WD7A 3COPA 3I12A 4QYTA 2IWHA 5LKRA 1XK7A 3EWSA 1XVAA 4HG2A 3N8GA 3H9UA 2XMQA 1Y1SA 4WBNB 2Y66A 4KBGA 3KB6A 4C1NA 2G63A 2YASA 4KMRA 4B34A 3V80A 1SG0A 3TMYA 1QCDA 4R0VA 3JYHA 3W7BA 3O93A 3QW2A 4N3GA 1E2PA 4B6RA 2QU8A 2OK7A 4DLNA 5TS3A 1E7MA 3QRWA 1DHTA 5LP1A 4EB0A 3RYFA 4CV3A 4FC6A 1LPNA 3VNRA 2O3JA 5EIHA 2X19A 1WXFA 1C3JA 1GLGA 5GJCA 4HJRA 1T2VA 2ZSDA 4PRKA 3WL4A 1DLIA 2R7MA 3PC4A 2C3YA 3PIIA 5LJIA 4QQRA 1K6IA 3D8BA 3CINA 5IKOA 2C3UA 1JLRA 1VC2A 4IWXA 1BHQ1 3IAFA 1QH1A 1VJ1A 2FPGA 2IYTA 2EP8A 4G5GA 4AO6A 3L5OA 3FGOA 3ZDAA 3CE9A 1ST2A 2H5LA 2O8EA 2AW3A 1YHYA 2VDKB 2NM0A 4GT1A 4FE3A 1OZGA 4RHUA 4RH0A 4OHZA 2VTKA 1XJQA 4EELA 1CWUA 3EIWA 1ZK1A 2GEVA 4FHFA 1CFZA 1T24A 1ZVMA 5DB4A 5HMMA 2JLWA 4RNDB 1H42A 3NBKA 1YFLA 1ZJ4A 4OATA 1GQQA 2UZIR 1WBJB 4ZCLA 2EKZA 4B3FX 521PA 2I2BA 4L4XA 1B16A 2OBBA 3JALA 5U1PA 3NHBA 5DK4A 1T1GA 1SHUX 4WZAA 1W73A 1LK0A 1SBYA 3B85A 2C9CA 4WESB 1MHTA 5LXTA 4PZUA 1A4XA 1FXWF 1X7YB 3QPWA 5FI1B 2A1IA 4HNSA 2VP9A 4LXTA 5BSEA 2HV8A 4KSYA 4WXEA 3O2SB 5JASA 5THQA 1Q0QA 3OP4A 3JQ7A 3KLOA 2XQKA 3BWCA 1EDZA 1TKRA 2D2EA 1ABEA 3OICA 3HDGA 2R6DA 1WXQA 5JCZA 1KI7A 2CSUA 1WUYA 3O5AA 4MKHA 4FYYA 3FWNA 3PPYA 4DIKA 5DM1A 3QK7A 4QOJA 1AZWA 3OCWA 1O5OA 3OTQA 4MDYA 4ZI2A 1U9ZA 5B12A 1TLFA 1WPQA 5CIYA 3DJYA 2Q2WA 3T3HA 3U3OA 1G6KA 5E7JA 1PR5A 2C4UA 3DFMA 2XMDA 3JTEA 1WXXA 3QKSB 3M4ZA 2IF0A 1XCJA 4JXJA 2OD2A 3QOYA 2YMPA 4C4XA 1DRJA 2H1SA 2C8KA 4ZVUA 3URMA 4N5LA 4A6XA 4UCXA 1T8RA 3LP8A 1A77A 2SECE 2YWGA 4BECA 3HA3A 1K4MA 4FN5A 5E38A 1EVZA 2G3YA 1QTNA 3II6X 1M54A 4LV8B 1FVXA 4MDFA 2I2FA 2H1WA 2Z6QA 1T29A 3BMNB 2DHQA 3KOUA 1ZSNA 3PNLA 2EVWX 1IQ0A 2WFZA 3PUVA 4FQ7A 1TPYA 4J3FA 4KN5A 3ELYA 5F3WB 4I5GA 2IYQA 4D9FA 3SGLA 1L9XA 3OHPA 3GJ8A 4Z5XA 4DV3B 2VHEA 1JH9A 4F1KA 1Z7BA 3JD3A 2KPOA 4KJZA 3JQAA 2VQDA 1W47A 3HYLA 3RW9A 1C0KA 2W6IA 2Y0CA 1ONOA 4U5XA 2WJ3A 1U2DA 1ZR4A 5LB4A 4PANA 5JRZA 4KQKA 3E48A 2HLPA 3AVPA 5CU7A 3FPBA 3G2OA 3AM3A 3K9GA 3MFYA 2B8EA 1FNMA 1VKJA 3CCCA 2YHAA 1AUOA 3ZK9A 1HEIA 1SOVA 1DT3A 1K5DA 2XCRB 3CMMA 5KEIA 4EBFA 4KMSA 1Q44A 3IMGA 3U7FB 3QENA 2KX7A 3B3GA 4PS1A 3HEAA 3SVTA 1SXIA 4CMAA 1A9RA 2ABWA 3W7AA 1J1IA 4OLBA 2Z95A 3IAM6 1D3AA 1SZDA 1U2DC 1PE0A 1TK3A 3H5WA 4XDHA 3SC6A 1DQPA 1QQAA 2C31A 3CNQS 3FKJA 1GXSB 3LLSA 5FBZA 4RELA 5JDCA 3F2VA 4ZN6A 3MIZA 1TTHA 4EJSA 4XWWA 2P6PA 3LS2A 2X4IA 5LQRA 4ZT7A 3SKVA 4EABA 2V54A 2NZWA 3CS3A 3EODA 1V3UA 1L5NA 1KU6A 1Z8HA 2XODA 4KDRA 3VTZA 5LDGA 1CIVA 1K4YA 3CRRA 3G6WA 4NJEB 2PGOA 3R5XA 1SN7A 4KQWA 1H4VB 4AFNA 3UFBA 1D4ZA 1HV8A 4LWQA 2WQ6A 2R8EA 4G0YA 4O29A 3KT8A 5KYGA 1H6BA 2OVFA 1DX4A 2W8BA 3L0DA 4PPQA 1EK1A 4FS3A 2XUQA 2JFXA 2VVTA 3W9YA 5FJIA 4MARA 2H4HA 3WGQA 4HUQA 4TROA 2QS9A 2W9XA 4I50F 4J43A 1K7FB 4L78A 4Y9UA 5CH3A 4DNFA 5DBGA 4RQUA 5JDCC 1XNRB 5KNDH 5DISB 3DTYA 5L9AA 1JPNA 1T9KA 2WJ6A 4IJMA 2WOOA 3NONA 4I5FA 4IHAA 4K6FA 4I81A 4NYIQ 1PZGA 3OOSA 3E22A 1SVWA 4L76A 4C78A 2EYQA 1TVKA 1PR6A 2N1MA 5D51S 4YLEA 3RI3A 3GEPA 4JVNA 2GZSA 3VI4B 1GSIA 2QPLA 3FHCB 4E0BA 2AFVA 5ENZA 3EDYA 3OO0A 4M4SA 4A23A 5LN1A 3TIGA 2R8RA 2I2WA 2J7PD 1NBEA 2YDXA 5AK6A 2QM7A 4R3WA 4WFJA 3WJ2A 4A10A 5E6RB 4H7EA 4AY3A 1SVKA 5EINA 1JB1A 5HPYB 1ZQ9A 2CLIB 1SCNE 2ROQA 1EG2A 2D13A 4J8PA 1Z17A 1QLHA 3BGOS 2PXHA 3IUPA 1JU3A 1QIFA 1RKUA 2OLEA 1ZU4A 2Q49A 3Q7EA 3TNFA 4AKEA 4EFLA 2FR1A 5CFPA 1VL1A 1DKMA 4LXGA 4YREA 4RE5A 2Q3HA 5KTKA 5TQ2B 1Q74A 5TMEA 2IP1A 1YAJA 1HOXA 3IVAA 4TTRA 1Z8FA 4EF4A 5IW8A 1UJ4A 3KJNA 2QZ4A 2D59A 2R6CA 2UYYA 3OFKA 4PG7A 4KR3A 1VFPA 2WLSA 3TR5A 2VOJA 3Q12A 4GYJA 1MVLA 1L7EA 3VH2A 4D9BA 4EY3A 3VXKA 3FGNA 2BP7B 5I9TA 1JT2A 5FPYA 5ADHA 1RI4A 4MV7A 4XR9A 1T43A 1U6JA 1QE5A 2CVPA 3PDCA 2D3TA 3P26A 4AUMA 4LJYA 4C87A 5FV7A 3KXPA 4BNGA 4ARIA 4J9UE 3ANMA 3TGWA 2VJQA 2O8FA 1OROA 3QF7A 1R5BA 4TTTS 1GZ3A 3SMVA 4FCVA 2PUHA 2R8OA 3HBLA 3OMWA 4LK3A 4Q01A 4DKJA 1Y89A 3L4EA 2PT9A 4LKOA 3NYIA 2PSEA 2J5RA 4IX9A 3VQTA 2DKOA 1EMDA 5DW3A 4YFYA 2IELA 1N6LA 4QDUA 2JCYA 2R6GA 3F4LA 4KOEC 5KMGB 2RC5A 3LO8A 4JFAA 4FYHA 3NWJA 2DUWA 3H17A 4Q19A 2QVLA 5K5EA 2DULA 3PTLA 1E2DA 2NU9A 4IGEA 5FA6A 5LZ2A 2ZAGA 1NW7A 3AY3A 1FNDA 2BZGA 1TI7A 1QTRA 4QXPA 2PWYA 4TT3D 3UY4A 1HKHA 4WXPA 1GKUB 5LBIA 3TQFA 1BDHA 5FYDA 1PG5A 4XVHA 3LY7A 3ED5A 4GOMD 2IS1A 1V1MA 4BO4A 2ZUBA 4V03A 2QLMA 3CIOA 1M73E 4RD3A 5CR9A 1D04A 4YRAA 1RR6A 3C5CA 4BHTA 1FW6A 2FFBA 3BD6A 3U4GA 2DC1A 3JQ8A 1Z83A 3G2KA 3JQ9C 2Q4OA 4LOHA 4RVHA 2YZGA 3RRFA 4HWPA 4P36A 4W9MC 4J0GA 3T0IA 2FZWA 5CYFA 3PVZA 4BO9A 4POOA 3WLAA 5CA0B 3VR6D 2WJAA 3GRZA 4DA6A 5AVWA 3EG9B 2C7GA 1BW9B 1L5VA 4YJGA 1QBGA 1HE4A 1ONNA 1W4LA 2DQ4A 1AHHA 3GX1A 3I92A 3IDQA 1R6UA 4W8HA 3ZS8A 1VPDA 1EDOA 2QTAA 4NU8X 3C6ZA 3DV0A 3C5HA 2W6ZA 4CUKA 1ESZA 5I9LA 3N75A 4DIOA 5FULA 3L0PA 3LX6A 4ZDWA 5JWHA 5C7IO 1UFQA 1SKAA 5DNWA 3ZGLA 3L6CA 3TCKA 1P3JA 4ZGWA 4L5CA 4AZ3A 3O74A 2QL6A 1L5KA 1ZJJA 1ADFA 2RH4A 4F4DA 4QQ8A 5AT1A 3ZH2A 2KLHA 2G9NA 5D5HA 2EF0A 3IXQA 4FNGA 1G2OA 1OWLA 5E2BA 2AOVA 2AR9A 2CZGA 2EG5A 3ILXA 4HF7A 3KJXA 1SC4A 2L18A 2CN1A 2ZB2A 2BT4A 5J1SB 2BIFA 3LQ1A 1D5CA 1XL1A 1R64A 4X85A 4ZAZA 4KL8S 2FUCA 2CHVA 4PG4A 3KBBA 4FE4A 1GCOA 2GCOB 2X9NA 3I9KA 1PJ3A 2P2SA 4MWOA 2WVGA 3FHLA 3G0GA 4ZVNA 4QX6A 4KNWA 1QRRA 4L9RA 2CT8A 2UV8A 1V95A 5EEHA 4JK3A 1P9RA 3VNBA 1U3WA 3CVJA 3AR6A 4TKUA 1FFXB 5AK0A 4UD6A 2ACKA 1VSBA 2I1QA 3GQBA 3NWPA 4WEQA 4C7OA 1O9BA 1B43A 1DXOA 3O8NA 2Z6VA 3KQPA 2OCXA 3HV0A 4D9HA 3DNMA 1G7SA 1UXOA 3I5UA 1H2ZA 2JFOA 3U09A 2H31A 3WKEA 3EPJA 1Z5PA 3Q1KA 5K4AA 2YJ3A 2ZSBA 3DMFA 3IOBA 1C9JA 3VYSB 4JP3A 4UULA 2V65A 3G8YA 4KQJA 4TUYB 2DGDA 2JLSA 5AW3A 1AN9A 1USVA 2JJ2D 4D9KA 1E3SA 1OTHA 1KDZA 1CQJA 1UZUA 1N6NA 2OZEA 2WDPA 4CUZA 1IJFA 1CUBA 2W2KB 3G23A 1JJVA 3QKUA 4F9GA 1UK9A 2RKOA 2D5LA 2XKBA 2BGMA 3AVYA 4OGGA 3GNQA 4PVCA 2CL0X 3MWDA 2V03A 1EWQA 3CWQA 4HEQA 1JYEA 5CDUA 2BKAA 3ZHYA 1V6AA 2IDKA 4DOMA 2DHDA 2HSWA 4BGVA 5L53A 3MS2A 2FCAA 5EZYF 2WG2A 5B4UA 2C2WA 4HZGA 1NF3A 2PSFA 1LX7A 1CRLA 1NBIA 4RFLA 1L1RA 2BHLA 4G5XA 2R1ZA 5ER9A 1VTKA 3ESAA 1QAQA 1C9DB 1JIVA 2Q6IA 3S99A 4EPYA 5K01A 1A88A 1YK0A 2PU5A 3KZKA 1V6SA 3PJGA 1YT5A 4DTIA 4BDTA 1TVMA 1ZD1A 3PFBA 4PCAA 3B38A 2CK3D 2WFLB 2JD2A 3ZE0B 2JHFA 3QVGA 2MCFA 3H2JA 1XTBA 4KGDA 3A2MA 3S2SA 1GUZA 1EUQA 2R7NA 3OFNA 2FPWA 2I6XA 3A3OA 3P45A 2V1UA 4U3JB 1NGSA 1UINA 4KKVA 2BDUA 4BVKA 4CWAA 4EB8A 4ZZ3A 2V9CA 2XNSA 1H2FA 3C43A 3CLRD 1RZRA 4ZVTA 2QYSA 4F06A 3WAKA 2ZPTX 4N3BA 5IS2A 1L7VC 4R4JA 3PXCX 2J33A 3G17A 4YUWA 2RHWA 2HHAA 3A36A 5A4JA 3L0IB 4P38A 5IJAA 3R5KA 1TAGA 4CN8A 3T0GA 1Y7HA 1MGPA 4PWZA 3VTFA 1WF3A 3FWZA 5FNVA 3IGFA 3IQXA 4HQ6A 3R8XA 3ZZMA 3A06A 1AMOA 1MFPA 1QFMA 1W44A 2CD7A 3AFHA 2B5VA 3MMXA 1PZFA 1NSTA 2BPOA 2YQZA 2FWNA 3BJIC 1B14A 2FVYA 1NXPA 2I1VB 3SM9A 1Z29A 3GNLA 3FTQA 3K31A 4WXYB 1X42A 2KHZA 2IDZA 2XCIA 3HMQA 1JYSA 1T1IA 1JLKA 4J4BA 1EUCB 1ZC3A 1W49A 3BD9A 4PS0A 1FUUA 2P4UA 1Y33E 4X5OA 5B36A 1R8YA 2ZI4A 3MPUA 4KXVA 4PZZA 4GGMX 2P6RA 3PGLA 1T8UA 4RZQA 1P8JA 2VK4A 4R9UC 4B71A 5MN4A 4AJIA 2O05A 4IH4A 3HCAA 2P6NA 3MJTA 4RULA 1LBQA 2XYRA 2ZB3A 4YJKA 3ZHBA 4DYVA 4QGHA 4V24A 2YTZA 3G2PA 2BOVA 3C8MA 3L8GA 3SSNA 3THWB 4RJTA 4OHYA 2FMTA 3SOZA 3LT4A 3OIFA 2O8NA 1MDBA 1G66A 3L7OA 3QLUC 3BMQA 2BKEA 2AJLI 4GXQA 3ILYA 4L5BA 1FP4B 1N9GB 1O5IA 2NTYC 1U9CA 1W87A 5FPTA 3VSCA 1P80A 1CR0A 2XBUA 1ZCAA 3VNVA 3EMVA 3EUAA 3TXAA 3ZJ5A 3OY2A 1T9GR 3E8MA 1WMEA 4D41A 3ZIDA 1NW8A 1TA4A 5CUQA 3HFJA 4HVTA 4X1OA 3T8YA 3ADCA 2C4KA 1ECLA 1M3SA 3NATA 2JZNA 4K26A 3AF4A 1DEHA 3VR4D 3VPHA 4Z6KA 4EB6B 5F3RA 2N3ZA 3DVAA 1VE1A 2OGWA 1NVVR 1MC5A 2PAFA 5HCUA 2BTEA 1SHTX 3ZZTA 3KK0A 1ZKDA 1W9HA 1FSZA 1I14A 1L5OA 2OZKA 4N7BA 2O20A 1G3QA 1KU0A 2DMRA 2DUJA 3SQXA 1U11A 2OCYC 4D44A 4QGBA 5HJ7A 3D4PA 1E62A 5FWYB 1WXDA 3UJ6A 1FF9A 4LZZA 4EGFA 4MOWA 1EEHA 4X7MA 3FM9A 1G6OA 4YTEA 1KFKB 4QNRA 3QEJA 1OWPA 3QQ5A 5EWJB 2V0GA 4FCWA 2ZIXA 4MCAA 2ZB7A 4CEIB 3Q40A 1GN9A 2HJWA 4GI2A 3ZGZA 4AZWA 4QYXA 1J2UA 3CONA 1NJFA 3KJGA 4IQ0A 2NYAA 1O4WA 3NRBA 2G83A 2Q8PA 3OD5A 1FUIA 1HTBA 3VX4A 4BQIA 3THXB 4YUYA 3G88A 2ZTVA 4RENA 5BW4A 1THMA 1Y80A 2FUG6 5BQ3A 4LZAA 3MGCA 3U7GA 1RM5A 3SIXA 3JQGB 1FFEA 1H2HA 421PA 3RF7A 1UIRA 4CF4A 5JYEA 1YZNA 3VR1A 3AHCA 4AS2A 4ZYWA 1KEPA 2VSOA 1Z6TA 3DYBA 1U80A 3NEAA 5AVVA 2QUAA 3ZGNA 1W88B 4ZVQA 5AI8A 1YA4A 1NLFA 2HKIA 2RH8A 1KAGA 3QIVA 5CEJA 5CEEA 1USWA 1STOA 1NOJA 4WGFA 2PBRA 2XVAA 3LFUA 4KX5A 4Q1EA 4B44A 5IK2D 3NMUF 1NLYA 1SOMA 3TTXA 3ONDA 1Y42X 5L7YA 4ND6A 5CP8A 3EULA 4I2VA 1E2NA 1PNRA 5AO9A 1JV2B 5KKCA 2ZU6A 2JEZA 2VCYA 4OHMA 2EEZA 4ZCRA 2LCIA 2O2CA 4GIBA 4F5YA 1VQ1A 4NDAA 2P9YA 4GQIA 1L1EA 1ILEA 4RCYA 3RU2A 2GBFA 4MR9A 2VDJA 3IOCA 3CR8A 4M87A 5FLEX 5LZ8A 4BZZA 3TKAA 3VR3A 2HBQA 4EKDA 4JOCA 1DZIA 2FEMA 4EY4A 4KKXB 1YJAA 1AQLA 1TFRA 8GPBA 1E2QA 3LK6A 1C9MA 3LSYA 2O57A 1SULA 4KXXA 2DOKA 4R2JA 4B4VA 2ZWIA 4PSDA 5A3SA 5JCPA 1PG2A 3LL7A 2PKRA 4C05A 4F3KA 3S1LA 4AN4A 2WI8A 1T36B 1Z6YA 3BFKA 3P5BA 3GAFA 4OXIA 5CYGA 1POWA 3RVPA 5JD5A 4BRWA 1K5PA 5HILA 4D8XA 4LISA 1IUOA 4P8RA 3ZD9A 4OP2A 2GEBA 2YDYA 5IVDA 1CT9A 3L6OO 4WNCA 1DJLA 2JW5A 1XTZA 2XYQA 2I6GA 3PEEA 3QEMA 3W3AH 1E9SA 2XKAA 3RC1A 3TEFA 4PFKA 4B80A 3FMVA 4JDPA 1UBLS 4D0NA 1KGSA 1YZUA 3Q3JB 1YE5A 1G21B 2C84A 3ASVA 4FYIA 2QZPA 4G0OA 3IOMA 4HGRA 4BB0A 1HRKA 1WF6A 2DFKB 2HJVA 3M9LA 3G8BA 4WCFA 3S28A 3AI2A 3OZRA 4BLUA 3BS4A 4DLLA 2JLAA 2REQA 3BGSA 1D7OA 1SJ9A 6ADHA 1T4BA 4H7JA 3IPCA 4GH5A 3I4CA 1F8XA 2ZTHA 3IX7A 4CG1A 5K05A 3JYPA 5I5GA 1X0VA 1NBOA 2EZ8A 5JBNA 3JWGA 1WDLA 4NJEA 3CZCA 4BB9A 4X20A 4B33A 2G9QA 4D6PA 2MDTA 2JCXA 3V1NA 3DMTA 3U81A 1ZM9A 1QVRA 2VRBA 2O8DA 1ES9A 3HNPA 3KYDA 2VYCA 3KWLA 5L3VA 1NE7A 2HREA 2FSGA 2WSYB 3ZIUA 5BO5A 5IF3A 3SLGA 4WCFC 3P9IA 3PGKA 3TD9A 1QCCA 4TT3A 3ZKAA 3FFWA 3C6XA 3H05A 4EARA 2BSQA 3IHWA 2DR3A 3AVQA 3NG1A 2PJRA 1PGQA 1XJ5A 3PKJA 3QBJA 2XNJA 4ITUA 4BGIA 2JHGA 2ZYRA 1Q83A 4DV1B 3COZA 4FI3F 5EE3A 2FE4A 1YZLA 1Y8ZA 1QGDA 5ULLA 2A4MA 3JR7A 4GOKA 5CK5A 3H2SA 4DV0B 1QDLB 3DMTC 4Z53A 1Z0SA 5KDDA 1PSDA 5CB8A 4Y1GA 4AJ4A 1VLJA 2CF5A 2B4QA 1M2VA 2R3SA 3RE1A 2O2ZA 1XDDA 4HQOA 1I3MA 3I9FA 3LGAA 5AI9A 1V43A 1F9AA 4RMJA 1WMDA 5IT5A 1SXJA 2SKEA 5A9RA 4MV5A 1Z2DA 3DHNA 4PG8A 1DEKA 1AGXA 2DUUA 3EOZA 3QX8A 4NOJA 3VNQA 3WHLA 3FROA 2ZS9A 4ALKA 2FG5A 2LDXA 3GZ4A 1JEYB 4B09A 4NZZA 3D8UA 3LO5A 3A4MA 4KMMA 1ONSA 1L5HA 1UZMA 4A27A 5C1DA 2EKLA 3RTGA 4LJLA 3SEAA 3ZTYA 4HGYA 4MWZA 2RAVA 4GSYA 4X1IB 3PHHA 1HTWA 1OFTA 5BW6B 4CF7A 2DTEA 1FP7A 3MJDA 3F5MA 4L15A 3PDWA 4LE0A 1ZRHA 4NK4A 1X15A 4GLFA 2V5UA 2Q07A 3WO0A 4QL3A 5B57C 5L7TA 5LC1A 1UK7A 4CL0A 4CCYA 3I34X 3FI0A 4MIEA 1R3UA 3AHIA 2H4YA 2NVWA 1SXJC 5ARBA 2HK9A 2KI5A 3R7SA 5H68A 1FX0B 3EZ2A 3G5MA 5J5VA 1Q12A 1TYAE 2N42A 3BXGA 4F56A 3ABZA 3O4GA 4M86A 2BJVA 1LH0A 2CEAA 2XLBA 1AD2A 1U2PA 4J9VA 4MUMA 5I48A 3JARA 1B42A 4JXZA 1WEHA 3ETJA 4OGKA 1XR3A 3PEFA 4MQ6A 3B1FA 4BFVA 3UJHA 4ENPA 2HBYA 2OYCA 3QUQA 3UMCA 1E20A 1Y37A 3K53A 1HFJA 4LRSB 1LS1A 1U2RA 4P32A 3D5TA 5EYPB 2VJLA 5J43A 5JMOA 3HN7A 4ZRDA 2QSZA 2HMSA 4XI9A 2V98A 2L2QA 4O2BF 3C48A 3ZHCA 3ZCSA 1SCJA 1VPWA 1TTPB 3NUQA 4GECA 4B4WA 1RACA 3R1IA 1ISPA 3WLOA 5AKGA 1YQGA 4MYTA 3QA3E 2X8BA 3AK4A 4RVCA 1A95A 1X9HA 2ZT8A 1K75A 2CBGA 3NBMA 1IYZA 3KLMX 3KR0A 1IVYA 2POCA 3OHSX 2JJ2A 3SHFA 2DT8A 4MWDA 2I4TA 2RGRA 3LBYA 4FBLA 1C7QA 5JZOA 4NG5A 2H5JA 4XGQA 2VP2A 1PVVA 4U9HS 1TW3A 3BERA 3ZS9A 1CB0A 5BVHB 1DBIA 4ACBA 2BI7A 5DBOA 3FVWA 4IXDA 3GLIA 3HZHA 1Y3DE 1TJ3A 2P78A 3N2NA 4U1RA 1NX6A 5GY7A 1KC3A 3OU2A 4DLAA 2QKYA 2R11A 3RSFA 1K7YA 2XRZA 3FB1A 4C5BA 3CLSD 3ICPA 4CODB 4L8YA 4EA8A 4N0QA 2X0KA 4RTNA 1DO2A 2D06A 4D43A 3NDBB 2HA6A 3O0TA 4EI9A 4NY1A 1H4SA 1LS6A 4FN4A 1OX4B 1TM7E 3L8CA 1FFYA 1IAVA 4BVFA 1RVV1 1OKKD 1VL0A 1UBTS 4KIWA 2WB2A 1L5GB 1TCBA 4FEAA 5LWHA 2JLQA 3C24A 1EQUA 3DKRA 4G97A 4L07A 1W94A 3KU1A 5GIPE 4O2LA 2XECA 1PRYA 2IA5A 2FB9A 3LECA 4QLOA 4DPMA 2BEJA 2G07A 3AWDA 2J32A 3HO8A 4I55A 3RGGA 2EX0A 3T9AA 1XGKA 4YCMA 3HHEA 2FFRA 5K3CA 1EYZA 1NF8A 1QNFA 2Z98A 4YCJA 5F64A 3T7IA 3V4LA 1LK5A 2BCJQ 4TRRA 1EJBA 1PR1A 5K8JB 1KYWA 3T94A 1T6XA 3KYIB 4M8NE 4S2UA 3SZ3A 1Y8QB 1PFKA 1I4EB 5FWNA 2VJAA 3QFCA 3VU1A 3IURA 1JDJA 1LF5A 1JQDA 4LWOA 1JQBA 2OQRA 4M9XA 2Q50A 1YR8A 4HTAA 1NP6A 3IQEA 2IH2A 3F5QA 4U02A 4BUCA 1IN6A 1V8DA 4M22A 3DR3A 2XGMA 4KIGA 4YRQA 4NJOA 1GFZA 4F85A 1W93A 2HSJA 2JANA 2X5KO 3W4KA 3RRXA 3HN6A 3LVFO 1V39A 3S1AA 2I22A 4HQKA 3QMVA 1ZM3A 1SBQA 3EGCA 1XG5A 2R2GA 2H65A 4P7GA 5KTPA 2IFTA 4E5KA 1F0KA 2X40A 5K0JA 2JGEA 1WHSA 5HXAA 1NWHA 1EDEA 5E2IA 3IRVA 4GZ6A 3HS3A 3PTZA 3STWA 2A67A 3RANA 1TIPA 3NIWA 4H16A 3PNQA 2AX3A 3T7AA 2FCRA 3VH4A 3ZE8A 4JSYA 3A0RB 4D9MA 4LJRA 4EHAA 1UC4B 1YTLA 2BTQA 3DZHA 4MKZA 2HEIA 3AEKB 4H7HA 4IDBA 1DJQA 3NJ4A 2WAOA 2DQZA 4YLGA 2HA0A 1ETHA 2W2QA 4S1OA 1NU8A 2GK3A 3D3EA 4WTOA 4YCDA 4ADSG 1QBKC 2Z9DA 5DYWA 3AEZA 4N65A 3TOCA 2FPSA 3UVEA 3ROFA 3PITA 2YV1A 1I5OA 3EZ9A 2GO1A 4UE6A 2D8AA 1CVLA 1W8DA 4PSAA 2R8PA 4RD2A 3SJZA 1Z73A 1UDAA 3GT3A 2O0KA 3AZPA 3CSUA 4GPAA 4JKOA 2C97A 2OV3A 3L77A 4XYEA 5DF1A 3OJEA 1RJ9A 1UXKA 1UEXC 3LCVB 4TLMB 2WFLA 4Q4LA 5B7QA 2NP6A 3QXGA 3OJLA 1DHRA 1KZ7B 2G5PA 5EJ2A 3UCFA 4IDQA 5EA2A 3OAAD 4M9ZA 5TARA 4Y9RA 3U3MA 1I2ZA 4WWHA 3T7DA 4DSOA 4AF7A 5DIZA 1SCUA 2FVXA 5HDBB 3OQMA 4KXMA 4RO0A 4AP6A 1OOEA 2DVMA 3ZGXA 1S8NA 1UQTA 3LI2A 2OHGA 1Q0ZA 4YAKA 1J97A 3Q5DA 3I62A 3ND6A 3R24A 4KWCA 2NXCA 4IJ6A 2C7RA 4MYRA 4KR7A 3WJAA 4PR3A 5JEEA 2OBXA 3ZTWA 1LSUA 1BQ4A 2V7WA 3FF1A 4JIMA 3CPEA 3HP7A 2VT2A 2O2JA 2WMDA 1HNNA 1NL3A 2ZI7A 4IG4A 4RACA