5K3BA

Crystal structure of the fluoroacetate dehalogenase rpa1163 - asp110asn/chloroacetate - cocrystallized
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
298
structure length
295
Chain Sequence
DLADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRVAPKLAERFKVIVADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLGHVHFALAGHNRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRAYALKIYHWSFLAQPAPLPENLLGGDPDFYVKAKLASWTRAGDLSAFDPRAVEHYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPVPMLALWGASGIAQTPLDVWRKWASDVQGAPIESGHFLPEEAPDQTAEALVRFFSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of dimer asymmetry and protomer dynamics in enzyme catalysis.
pubmed doi rcsb
source organism Rhodopseudomonas palustris (strain atcc baa-98 / cga009)
molecule tags Hydrolase
molecule keywords Fluoroacetate dehalogenase
total genus 115
structure length 295
sequence length 298
chains with identical sequence B
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5k3bA00
3D2CA 2D5LA 2EDAA 2OCIA 4UPDA 5IKXA 3G0GA 3WK5A 1EDDA 5EGNA 5FP0A 1FFEA 2Z5GA 1QO9A 4EZIA 4DYHA 1AGYA 3H17A 3IUJA 5LP1A 1HDEA 5HF5A 3QITA 4DM7A 1K4YA 2ZYHA 3AFIA 3O4JA 2BUBA 2QJWA 1GPNA 2ZSIA 3L1HA 2QRUA 4F5ZA 4OUKX 1ZD2P 5LZ8A 1A8QA 2ORYA 3A70A 2OGTA 1ZIYA 2XUQA 1Q0ZA 3EIOA 4K6GA 1ORVA 1XRLA 4BVJA 3G02A 4EUSA 3C6ZA 4PQEA 5CT5A 3WLAA 3I2FA 2QUAA 2OPHA 3QVMA 2CJPA 2QS9A 1ZD5A 5DNUA 1F8UA 2PUJA 1AMNA 1CLEA 3GELA 4E15A 2JIDA 5CURA 4MEAA 4C01A 3E3AA 4UFPA 2GYVA 3OTQA 3EQ8A 5KWJA 1I6WA 2PSEA 3SK0A 2BGNA 4J7AA 3CN9A 4IHAA 1EDBA 3WWOA 3WWEA 5AKGA 4KACA 3G8YA 1G66A 3AIMA 3WA7A 1OXMA 1K5PA 5ALSA 4G9EA 1CUJA 1XZEA 3KDAA 4U2BA 4HXGA 2DHEA 1H2ZA 2WHPB 1CUBA 2JGEA 1CRLA 2UZ0A 2DCMA 1PFQA 5BWCA 3QPDA 1RWQA 1HBJA 3GBSA 3RLIA 1YCDA 2B9VA 4BATA 5AICA 5E2IA 1WB6A 2PUHA 1DX4A 4JYPA 4C89A 4Y2XA 1QIKA 1DT5A 1XRPA 2PKYX 2O2HA 3M81A 4UFNA 3E4DA 5K3AA 3WL8A 3H18A 3D0KA 4UHCA 1U2EA 3DCNA 4M0MA 3OC0A 1WHTA 3IUMA 5FXMA 1YS1X 4KAAA 4OPMA 5AM5A 2VJCA 2PSDA 4IO0A 1X2BA 1LBSA 4B85A 5LYYA 1QIGA 3EBLA 2XUGA 2DQYA 3ESDA 4KE7A 3IURA 2HFJA 3GUUA 5DNVA 2ACEA 3AILA 4EB0A 2QR5A 2JEZA 5HFAA 4INZA 5AKHA 5K3CA 4DSAA 5AOAA 4FFVA 4FBLA 5AI9A 4UUQA 2XQFA 1XZKA 2HU7A 4BDSA 5EIEA 1E8DA 2GBFA 1XRMA 5DYYA 1CUUA 3STUA 1F6WA 1TCCA 2DHDA 3LP5A 1X2EA 4G4IA 1G4HA 3W06A 2WUDA 2B61A 4AQDA 3HC7A 1YB6A 4QWMA 3R3XA 4HXFB 3H0CA 1NU6A 1CUHA 1P0IA 4S0XA 4DMFA 3UMJA 4QE3A 3DOHA 1GKLA 1TAHA 1RP1A 4G4JA 5ALQA 4QLOA 5A62A 1GGVA 1F0NA 2O7VA 3C5WP 4KE6A 4YK7A 1Y7HA 1JJFA 3BWXA 5A2GA 2HA0A 3QBJA 2O2IA 3IUQA 3I6MA 5EI5A 1TKRA 4W63A 3RKSA 3ILSA 3V1LA 2BCEA 5A71A 2ES4A 4FTWA 1WM1A 2J3QA 4PNZA 3GFFA 4CIAA 1BE0A 1UKCA 5AP9A 4Y2TA 1XRRA 1FFCA 1GZ7A 3G9XA 1KU6A 1XLWA 4RE6A 1UOQA 2HA3A 3DYIA 4C88A 3JWEA 1BRTA 1B41A 4EY6A 1CUSA 2CEKA 5DNWA 2J4FA 2WKWA 5HQ3A 2AJDA 2XMGA 3T4UA 5ALIA 2AXEA 4JNCA 1EX9A 2WTMA 4UBKA 5LKAA 2CKMA 3LIPA 1EINA 3ZLTA 4PV7A 4GLBA 3NGMA 3KSRA 1PV1A 3F96A 1J1IA 1VKHA 2PVSA 2ZJ6A 1YA8A 3FSGA 3ZV7A 2BKLA 4Y2VA 1ODCA 5ALJA 1H2XA 2XI4A 3CN7A 5AKKA 5HK9A 3ZPXA 4FKBA 1XZJA 3SC2A 4W1PA 5AO9A 1H2YA 4OCZA 1S8OA 2GYWA 3VDXA 1WB4A 1YASA 4K6KA 4N5IX 3TEJA 3RM3A 1JJBA 3KWJA 2WUGA 4XWGA 5LZ4A 3D2AA 1ZICA 4UHEA 1AC5A 1ODTC 5E4YA 3G9ZA 5AJHA 4B82A 5ALKA 4UBMA 1G42A 3QM1A 1QTRA 3IBTA 2BUCA 3U1TA 2I03A 2XMBA 2QOEA 4CCWA 4J3JA 3EQ9A 4AO6A 2V9ZA 3BJRA 3M82A 1CEXA 1ZJ5A 4OU5A 3BXPA 4B7ZA 1JT2A 5JADA 2XUKA 1QIJA 3GA7A 2WILA 1ZOIA 3O0DA 4Y2QA 4MEBA 2PX6A 2WHQA 2RGUA 2XMRA 2V97A 4KEAA 5D3ZA 4MJ3A 2O2GA 3A2NA 1CUZA 2AJLI 1EK1A 2XT0A 1VE6A 2CUTA 1CQWA 1K8QA 3ED1A 1PJAA 5CXUA 1ORWA 1YAJA 4BTVA 3QMMA 4FWBA 4QNNA 3WKBA 4JH0A 1MX9A 4X6UA 5AIAA 1L7RA 5CTAA 3DLTA 3H1AA 3ANTA 3ZWQA 3H19A 2ZYSA 3UUFA 4ZRDA 4ZV9A 3C6XA 5CBKA 3DDUA 2VA9A 1R9NA 3G9TA 4QDTA 5AM4A 4X95A 4HRYA 5JYCA 4WFJA 4YASA 4J0HA 2QMQA 4Q82A 1QIMA 4Y2JA 3BE8A 1R50A 2VQ6A 2W6CX 4BDTA 4BRSA 1VOTA 4EHBA 4Y2YA 4AZ0A 2OAEA 5JALA 1XZCA 3GROA 2BGRA 1ETHA 4Z49A 3PDCA 5FLKA 3HXKA 1ZI9A 3R3VA 3WKCA 1CUYA 4DMKA 3IDAA 4ITVA 2OQIA 3KWFA 5ALYA 3H2HA 2ZSHA 1SOMA 3WJ1A 3WWDA 5JD5A 1IMJA 3DQZA 4Q3KA 5IVHA 2W22A 1UOPA 4NMWA 1R88A 2D0DA 1B6GA 5ALMA 5T4FA 3M83A 2B4KA 2WU4A 1ZI6A 5K3FB 4OB7A 2HIHA 3PFBA 3LLCA 4YX9A 4X85A 3A2LA 2RIPA 2VT7A 3C6YA 4ZWNA 2HM7A 4PSUA 5K3BA 3WK7A 1LPMA 1MO2A 4DMHA 4GEGA 2OCKA 3MVEA 1CUGA 3D59A 1M33A 2Y1KA 4KAFA 1MNQA 2HRRA 1XRNA 1LNSA 2YYSA 3EF3A 4LKOA 4PO3X 4JEIA 2P8SA 5JD4A 3I2JA 1QO7A 4FLMA 5A7HA 1SC9A 3PUIA 2ACKA 3DL7A 2XQJA 3WYDA 5ALGA 4E46A 1XQVA 3OG9A 2XMCA 4FDMA 2JBWA 1GQRA 3PI6A 2QT9A 1A88A 1LPAB 2BFNA 2DR0A 1ISPA 1BU8A 3PUHA 3QMWA 3V48A 3CCBA 1LPBB 3WI7A 3HACA 2WFZA 3FOBA 3ZI7A 4X93A 3V1NA 5HK8A 1UOOA 1YR2A 3AIOA 1J2EA 2BJHA 3D3NA 3T52A 3G0IA 3WMRA 1G5FA 1XQXA 2RHTA 4K5QA 4X3CA 3O9VA 1CUAA 5C8ZA 2HRQA 1EA5A 5JAOA 1IUNA 3IULA 3F9CA 3WZLA 4XJVA 3R41A 3HI4A 2YH2A 4H7IA 3ESAA 1XKLA 3KD2A 3WA6A 3BF7A 3DNMA 3RARA 5ALZA 4UHDA 3R3ZA 3IUNA 1KU0A 4BVLA 3E1GA 5AM0A 3G0CA 1QIEA 4GWLA 4J0CA 5ALNA 2X8BA 5HKBA 1UFOA 5D6OA 4A23A 1TCAA 1E89A 1ZD3A 2WFLB 4UHHA 1BN7A 3W9BA 1MPXA 1HL7A 5AI5A 2XMZA 3EQ7A 3DL4A 2G63A 3FVTA 3VXKA 4B80A 3C5VA 5J3JA 1QONA 5HKAA 2WU3A 2PU5A 3VVLA 1XKTA 5CH5A 1E8NA 1MX5A 4I19A 5JD6A 2EEPA 4X97A 2CB9A 4AXBA 3MUNA 2J3DA 1RYYA 3QPCA 1LZLA 5AOCA 3QZUA 1UXOA 2QKYA 3I1IA 4F60A 4AO7A 3STVA 4XVCA 5AOBA 1BS9A 5H3HA 1BCRA 5ALDA 4FNMA 4WDQA 1W1IA 1EDEA 4OB6A 1Q83A 4H7HA 5F4ZA 3DOIA 4X6XA 1QIFA 2FX5A 1BEEA 5JAHA 2XMQA 1H23A 1WPRA 1AURA 1QIDA 4QDUA 1ACLA 1MAAA 3WK4A 1QIIA 1A8SA 1W6RA 2WFLA 1GT6A 4DTCA 4A16A 2DHCA 1Z68A 5DYTA 1CUCA 5JASA 4I3FA 5CT9A 1EHYA 3D2BA 3WKEA 1C7IA 1KEZA 5CT4A 3STTA 4BC1A 1NX9A 1EH5A 5SYMA 3C6BA 1UK6A 2RI6A 5JANA 4MXDA 1EI9A 3VJLA 4DSZA 4NVRA 1SCKA 4Q3OA 4EY7A 1XZFA 4B83A 2GZSA 4KYVA 5KREA 3IA2A 5C8XA 4KE9A 5JZ9A 3MUOA 1DQZA 4U2CA 3BL8A 1YB7A 2GZRA 5T4BA 1THTA 4AN0A 3NOXA 4PSDA 4F0JA 3FNBA 4AMZA 1YA4A 2GBIA 3C8HA 5AK4A 2HHAA 1JKMA 2IITA 3S2ZA 1AZWA 2Y6UA 2C5GA 2Z3WA 4ROTA 2EDCA 4WFIA 3VISA 3FYUC 2RAUA 2JGKA 3I2KA 4ETWA 1LPOA 3AJAA 2JGIA 5AI6A 4OYYA 5BOVA 4CFSA 2XUJA 2GYUA 4B0PA 1CFJA 4DNPA 1MX1A 3WIOA 1DTEA 4H18A 4BYMA 1C4XA 5ALWA 2OCLA 4G8CA 3G0BA 2G5PA 1QZ3A 1CUWA 4W1QA 4X92A 3O4HA 1XZAA 1XLVA 1UZAA 3O4IA 2V98A 2C0PA 4GI1A 2XUFA 1CUIA 1TCBA 4HXEB 3OPMA 4RNCA 2R8BA 2OCGA 2B20A 1CUFA 5AI4A 3G9UA 1ACJA 5ALFA 3STXA 1U65A 1N5RA 2FUKA 4X94A 3TRDA 1CIJA 5CT6A 1CPYA 4EY8A 1CUXA 2G4LA 5DTIA 1QTIA 4L9AA 1R1DA 3R40A 2WG2A 5A7GA 2Q0XA 2QM0A 3BIXA 1CUVA 3JYHA 4WFKA 1XZDA 1DWOA 4X6YA 7YASA 4AZ3A 4B6GA 2WUFA 2VTVA 2PSHA 2VAXA 1AQLA 3WYNA 2XE4A 2Y6VA 4UBIA 1IUPA 2C7BA 4GBGA 3X3HA 1LPPA 3AZOA 1FJ2A 3IIIA 4L0CA 4EY4A 4UFOA 3WKAA 4LIPD 3KXPA 4J03A 4BVKA 4BZZA 2AJ8A 1UK9A 4H0CA 5AM2A 3I6YA 4QDZA 1WCYA 1SCIA 4RGYA 3JW8A 3W04A 3BDVA 5K5EA 1AKNA 2YASA 5AK3A 1OILA 4O08A 4Y2UA 1MJ5A 3E0XA 5FUMA 2WLSA 5AKXA 1T2NA 2ROQA 4OU4A 3DD5A 1H2WA 4GECA 3FCXA 4FFWA 2VATA 1LPSA 1U4NA 1CUDA 1EB9A 3TJMA 4K6HA 1BN6A 3OM8A 2WHPA 3WWPA 1EVEA 5HF8A 6YASA 5IVIA 3F67A 3I6ZA 1GQSA 4UHBA 4J0IA 5IVDA 4F21A 4J0GA 5LZ2A 3UUEA 1D07A 2HU5A 3PF8A 4HZGA 3U0VA 3FLEA 3W05A 3SWWA 2XUOA 1UWCA 4U2EA 1R9MA 4X00A 2WIGA 5ALTA 4DNQA 3WL6A 5CRIA 3C43A 5JZBA 1JMKC 4QZVA 5HCUA 2OG1A 3WWCA 4W9RA 4AMYA 3FSGD 4HS9A 5AKJA 5ALHA 1Y7IA 5C81A 2FJPA 1CUEA 1JFRA 1TRHA 5HQ3B 2HU8A 3C45A 1BCSA 1T4MA 3ESBA 2XLCA 5AKEA 1DWQA 4C6HA 3FLBA 1XFDA 3BJMA 4TGLA 1USWA 3O4GA 2WIKA 2QXTA 4KE8A 2OQVA 1XRQA 2PL5A 4J0DA 5EIHA 3WQHA 4DNOA 1UK7A 1TIBA 2H9YA 1ZI8A 5FDFA 4EBBA 5LZ7A 4WJLA 5ALEA 5EHXA 1ODSA 4WDRA 5ALOA 2HA7A 4OSEA 5A7FA 3VJKA 3S8YA 2NW6A 2ONCA 4CIBA 2I78A 2I3ZA 4Y2SA 5K3DA 4FNGA 3MGAA 2PSFA 4LXGA 1GXSA 5ESRA 4UBNA 3N2ZB 3BIWA 2WJ6A 2Z3ZA 5D3KA 4BAZA 3QH4A 2HA2A 2C5FA 4C4YA 1DQYA 5DTJA 3AUKA 5ALVA 5FKJA 3HJUA 2XB6A 3VKFA 3C70A 4BP9A 1LBTA 4BRZA 1UKAA 4H35A 1L7QA 1J07A 1IZ7A 4BTLA 5EHQA 5C7YA 3WL7A 2O7RA 1K6EA 2CBGA 5AM1A 4WY5A 5T4EA 5AM3A 4HRXA 1ZGBA 4Q05A 3I2HA 5I7UA 2VEOA 1SCQA 4M0EA 4J0KA 3WIBA 2WJ3A 2FJ0A 3V1KA 1LGYA 2OGZA 5JAPA 3B5EA 2Y2UA 4RPCA 1JMYA 4KRXA 2JGFA 1H22A 5JIBA 3H2GA 1GPLA 2HFKA 4B9EA 4FLEA 1FSSA 2ZJFA 4LXIA 4MYDA 5YASA 3SX4A 3IVMA 4RE5A 3G7NA 3PICA 3Q0TA 3Q8WA 3DKRA 4WCVA 2XLBA 5ALUA 3LS2A 5I8PA 5T4HA 1LZKA 2YXPX 4H7EA 3FVRA 4MWTA 4IH1A 2OGSA 5EHNA 4BC0A 1P0QA 4KRYA 2JGLA 3V9AA 4W1RA 2DFPA 2WQZA 2VT6A 1IUOA 1O6FA 5CMLA 4GHWA 1QOZA 3C8DA 1HQDA 2XQKA 1R4ZA 2PPLA 5AI0A 4L3WA 5ISMA 1HKHA 1CV2A 3LCRA 1JU4A 1W52X 4V2IA 4BE4A 5AK5A 3R3YA 1UKBA 5LIPA 2WFMA 3C87A 1TQHA 5A6VA 1QIHA 4FHZA 1CVLA 1IVYA 3AINA 1ZIXA 4N8EA 4XX1A 1GPKA 1QJ4A 2AJBA 3H04A 2JGJA 4G4GA 3WJ2A 1MU0A 4P93A 1LLFA 2OAGA 4ZV7A 4MYSA 1X70A 4G1FA 3WK6A 1VJ5A 4CG3A 3HSSA 2PU7A 3G0DA 5SYNA 3FYTA 2J4CA 4HVTA 4G8BA 1VA5A 1XZHA 3AZPA 1AX9A 1DU4A 4CG2A 4KR0A 4LYDA 4E11A 1F0PA 1ZJ4A 4QEKA 1SFRA 2AJCA 2QJRA 5BWBA 5AKLA 3R3UA 1MNAA 4U2FA 4OYLA 1C7JA 1IZ8A 4HAIA 1CR6A 2VJAA 3HYSA 4BCBA 4FLFA 4C4ZA 1QGED 1QFSA 3R0VA 4X7BA 3I2IA 1XQYA 2WUEA 1E3QA 4QDXA 1E8MA 1XZIA 4Y7DA 4E14A 1TK3A 4Y2PA 4G5XA 1UT6A 3FWHA 1WOMA 1MTZA 4BCCA 5CH8A 2HA5A 3WK8A 5JATA 2GBCA 4P92A 3O95A 3H2IA 4DNFA 4JUIA 1QLWA 2WTNA 3ANSA 3V1MA 5AH0A 5AHXA 1XZGA 3LIIA 5AI8A 5LZ9A 4ZREA 1N8SA 1BROA 1WPXA 1XZLA 1EXWA 1YAHA 3FYUA 5LKRA 5C8VA 2LIPA 1W4LA 4KJXA 4BB0A 5AKIA 2ZYIA 4EA6A 1AUOA 3K6KA 1THGA 4P08A 1U8EA 4CI9A 4X91A 5DJ5A 3VVMA 4K2AA 5CXXA 2XUPA 3H2KA 5HFNA 5ALLA 4L72A 4B9AA 4AX4A 5JZSA 2WJ4A 1VXOA 1WB5A 3STWA 1GKKA 2CMFA 4PW0A 5HZGA 3FBWA 5JAUA 3ICVA 4Q1VA 3DYVA 2BUAA 5E4JA 3QMVA 3WKDA 4DIUA 3HEAA 1EVQA 2JF0A 5D7BA 2C4HA 3ZLVA 2IX9A 4ZXFA 2VJBA 2Z8ZA 2Z8XA 3DS8A 3L1JA 4P9NA 5KWIA 3PF9A 4Y9SA 2XDWA 4H7JA 3F98A 2H7CA 2XUIA 4I4CA 2C58A 2IIVA 4H77A 3BF8A 4QA9A 2XQIA 4HTAA 4N8SA 5CH3A 2Y2VA 3YASA 4A5SA 4BZWA 2QZPA 3FYUB 4IH9A 1QE3A 2RONA 3R3WA 2WIFA 3A2MA 3DJYA 5ALPA 2X76A 1W75A 5LLSA 2VSQA 4LXHA 1QFMA 3F8SA 3L1IA 4CCYA 4UBOA 4X71A 3FCYA 4B84A 4D9JA 4C4XA 4Q34A 3D7RA 5FPQA 2VAVA 1JU3A 1VZ3A 2QXUA 2PSJA 3K9BA 4DMCA 2H1IA 1VLQA 1O6GA 3WL5A 1BEZA 3STYA 4BBZA 4BAGA 1Q84A 2X5XA 4CG1A 1MT3A 4X90A 2WG0A 1EK2A 2K2QB 3BDIA 4IH4A 1W76A 4J0JA 2HL6A 1WHSA 4UBLA 3VJMA 3HLKA 3GZJA 4ZGBA 5FV4A 1VE7A 2G5TA 5FPPA 1HLGA 2WM2A 5AKZA 4AO8A 2V96A 3PFCA 1K63A 2ZVDA 4GW3A 4QDOA 2ZJ7A 4N8DA 2OXEA 3N0TA 5IVKA 2XQGA 4TPKA 5K3EA 4U2GA 2OLEA 2XUHA 4KAJA 5AK6A 1HPLA 3NUZA 1YS2X 4PSCA 2CZQA 5ALRA 1VXRA 1XQWA 3AIKA 4NZZA 1EB8A 2WG1A 5KBYA 1JI3A 3HZOA 3K2IA 5ALXA 5I9IA 5LZ5A 4YPVA 4FOLA 2R11A 3HRHA 5CW2A 3D5EA 4PF1A 2DSNA 1NU8A 4G8DA 2GBGA 4G9GA 2H7YA 4C87A 5JARA 3M3DA 3FLAA 5HF6A 5DYWA 2QUBA 2VJDA 3H2JA 5FRDA 4B81A 4IQ4A 2RHWA 3B12A 2C0QA 4GDMA 3HABA 3QYJA 3ICWA 4DGQA 5AKYA 5FOQA 4MQMA 2H7XA 3DKKA 1XLUA 5AIBA 1JJIA 3DEAA 5EIAA 4WY8A 2XMSA 3I28A 4GXNA 4MQLA 4QLAA 1VZ2A 4N5HX 3W9UA 2BAGA 3P2MA 4B0OA 3KOOA 3B3QA 4M0FA 1R3DA 1E66A 5K3FA 1P0MA 2WIDA 2XUAA 3WK9A 3AZQA 3TGLA 4XIIA 1FFBA 2I3DA 1UK8A 1N5MA 5DLPA 3CXUA 1LPNA 5CT8A 1FFDA 1OCEA 1N1MA 4DLNA 3I1YA 4TVKA 2ECFA 3F97A 3W2TA 2QTBA 2XUDA 5IH7A 1P0PA 1J06A 1VA4A 4MWSA 4W1SA 3O9MA 4Y2RA 2PBLA 5HF9A 1E5TA 5E4TA 2E3JA 1CQZA 4JYMA 2JEYA 4OD0A 3OOSA 1DT3A 2WSLA 3NWOA 4AN1A 4U2DA 4UHFA 2HDWA 4OB8A 2WHRA 1A8UA 4BE9A 1A7UA 5BV7A 4EY5A 4QWWA 4CCYB 2WIJA 3PE6A 4ARBA 3H1BA 2HA6A 1ZD4A 1DX6A 3A6ZA 3D4LA 1FFAA 1MN6A 1MAHA 3WZMA 4UBJA 2PM8A 4LYEA 3QPAA 1L7AA 1XROA 5EFZA 2HADA 4H7KA 2DQZA 4BP8A 4H7FA 3RK4A 1YSCA 4ZI5A 2QVBA 4NS4A 1XZBA 3FAKA 3CCCA 3IB3A 4AB1A 3ZLUA 4ARAA 1Y37A 1Q0RA 4Q3LA 1ZGCA 3OURA 4BCDA 2HA4A 1XZMA 5EHZA 4FBMA 4LHEA 5DWDA 3ESCA 4FMPA 2ZYRA 2XMDA 4H7DA 2JGMA 3I2GA 1DWPA 1DINA 4BAUA 2VF2A
chains in the Genus database with same CATH superfamily
5EC8A 3G49A 1AZLA 1R0ZA 4WPGA 2Q1YA 4U02A 1X7YA 2AMFA 2EDAA 3SJUA 4OO3A 3TUIC 1II0A 1T5BA 3PKJA 4DR1B 1DSSG 3AXTA 5DOZA 5CG1A 3B7GA 3L7JA 4QVIA 4YJKA 2FMIA 3MAGA 4FNOA 4MCAA 5EGNA 1D6NA 3HKDB 4QXQA 3RVMA 1SU6A 3DAYA 2ATXA 1QO9A 3G82C 4LWPA 5HJ2A 5L3ZA 1ZM9A 1L5LA 3I4CA 3IT2A 4COOA 5TGZA 3H17A 3D0OA 1Q7CA 2R1TA 4NBNA 4PU0A 5EIBC 3FPBA 4IEFB 3RT1A 2JIQA 2XZTA 3KAJA 3OHMA 1N0VC 1DMSA 1KY2A 1YO6A 5HF5A 1R27A 3G5UA 2GHIA 3EVZA 2R00C 3PNKA 3QITA 4DM7A 1CRPA 1MMFB 5CJ2A 4ZOEA 3I58A 3M6XA 2EIHA 5E6UA 3R9XB 4AXXA 2CN1A 2L2QA 3VRHA 5F2OA 8AT1A 4M9XA 1FU4A 3D3WA 2A9VA 3P4UA 4FIDA 4OREX 1DC4A 1FNSA 2CMKA 1JR3A 3NBFA 4QBGB 4D42A 5BQFA 5JDIA 3SHVA 1HFJA 1QTQA 1OY1A 3EMDA 1WAMA 1IMOA 1TL7C 4H3KB 3AG5A 1YGPA 3MD9A 2QAIA 3UHFA 2FR0A 4UTNA 4Y0NA 4ISCA 4IO1A 1VE5A 3P52A 2FQ1A 2RCYA 4I9HA 4CYMA 4BS9A 2BE9A 5U9CA 4OUKX 5E8RA 4PAOA 1E1CA 4EFLA 2OSVA 3ZE7A 1SM4A 2C5EA 3L9XA 1IN1A 3I83A 3KYBA 1S2MA 3NI2A 3OEWA 4QQ8A 5IM4F 2A7QA 1PS8A 3RVLA 1A4RA 2ORYA 3SDBA 3ZBQA 1J0CA 1YR6A 3T99A 4KO4S 3A70A 3LA8A 3H0KA 1FZTA 1DVRA 2PMDA 1Q0ZA 4IP0A 1XKQA 2MT9A 2G9RA 4YMUA 1WP9A 1N1GA 5DNCA 3HXTA 4RQUA 1NRIA 1PL7A 1XRLA 1UUFA 5BORA 4LFBB 3KFVA 3L1KA 3L8MA 4BVJA 3LXRA 1DOAA 1GSIA 4HDQB 1LJUA 4B43A 1J5EB 3UXEA 4BX9A 3BORA 3KWLA 4IHJA 2ZP1A 4N5LA 3HCCA 4V0NA 4YUXA 1K06A 5FI1B 4E88A 5DIZA 4N7JA 5F5LA 3WLAA 1YDEA 1IUKA 3LY5A 3PUVA 3VH2A 2QUAA 4QT0A 1L2TA 2A4MA 1CQJA 1XQ9A 4TL6A 3SBXA 3FB1A 1X14A 4NZYA 3ZTWA 3TTVA 3DTYA 2QS9A 4NCAA 2M1ZA 3U44A 1OBVA 4TWRA 1KARA 1U8YA 1NM5A 2Q7DA 2PUJA 2VO1A 3UAYA 3NT4A 2HCRA 4PYIA 5MFPA 3UG6A 1GPH1 1L4NA 4E15A 4LRQA 1RZRD 1T2VA 2CBXA 2PT7A 2P35A 3RVJA 1ZNYA 2QL7A 3IP6A 5DH9A 3DLBA 3KZXA 2X4GA 4UFPA 3PTLA 3D5TA 3BIJA 1N1DA 3OFSA 2C4UA 2RKOA 4LDRA 3OTQA 4Q18A 4Z2YA 5ER6A 2BKVA 3EQ8A 3P32A 1WE2A 3EC7A 4UUAA 1AGNA 4I4NA 1N7GA 2B7LA 5JDCC 4YRQA 4MKZA 2IC5A 3HCFA 5JSHA 3N8DA 5DGDA 2Q4EA 1FUUA 2HY7A 2VJMA 3HWX1 4O8ZA 4LJ5A 3KE9A 4J7AA 2MR6A 4R8KA 2ATCA 1XVIA 3JAWA 3K0SA 4DIEA 4DR3B 1CR2A 4GXQA 5F9MA 4BFWA 3CZRA 3GUYA 1RPNA 4JB3A 3HJGA 4YJGA 3RU9A 4CR8A 3UBTA 3WA7A 4BPBA 2PRZA 4RF3A 1A9YA 4XTCS 4WXPA 3GWZA 3IFSA 5DISB 1EFPB 3QQPA 5JCOC 4G9EA 4IUCS 4GM1A 4MUHA 2VNJA 3VPSA 3PLNA 2IYEA 3ESYA 1XZEA 4L4RA 1HE5A 1SVUA 2FU5C 3K8QA 1MQ8B 4BNJA 1SVWA 2AFIE 4NV3A 2VZEA 2VUSA 5ITZB 3I6IA 3H5VA 2WHPB 4B2PA 4DIFA 2ZRPA 4DILA 4EMTA 3VNQA 1ND6A 1QMPA 1N2EA 1YC2A 5HM8A 4TWIA 1XX6A 2DCMA 2R4TA 1GPBA 3KUXA 2CXRA 3M1YA 4ONEA 1G17A 3ZE1B 3AV3A 5TT0A 5GM2A 1JFLA 5ICGA 3WGOA 3QPDA 5AHKA 3EF0A 5AVJA 4A0SA 2KMLA 4BATA 3T3DA 1MRZA 1W34A 1E1RD 2RHRA 3OLZA 2FDCA 1YZFA 3W5AA 3CVJA 4HY3A 4UDOA 1EGQA 1TZKA 2X8AA 3AETB 3E2IA 2A0UA 3ZWKA 1HDOA 2MMGA 2W11A 2XODA 3FWYA 3UGQA 5BV2P 1JU9A 4DEXA 3PXBA 3Q6NA 4LQCA 5I7RA 3ORHA 3TX6A 1NW6A 2GCOA 2JFYA 2PKYX 1KQNA 4EUNA 2PE5A 1CY6A 2O48X 5K3AA 3KOWA 3WL8A 1Z4JA 3AUSA 5TQ2A 1KIMA 1SXQA 3N87A 1B42A 1Y42X 1QORA 2FMXA 1GD1O 1U2EA 4PYKA 3OZ7A 4UHCA 13PKA 4M0MA 4PO8A 1WHTA 1JDUA 1B6TA 1RM0A 3RG8A 3HNRA 4CM4B 4KMRA 1GGEA 3HCBA 1FZQA 2PL9A 4TQUS 1ZLXA 1ZJJA 3N59A 3WDSA 1KI9A 2Z5VA 4R0NA 4UZEA 1DDIA 4X1OA 2HCTA 3TZQA 1NIJA 1NXPA 2HJRA 2JAUA 2Z2JA 2PRSA 2XUZA 4QKQA 4IO0A 1X2BA 2CXHA 5TQ0B 1RP7A 2PXAA 4P3YA 2HTFA 5IYZA 5HG0A 5HMLA 5IEJA 2CF6A 1QIGA 2AKAB 2PX8A 3I64A 2IEDA 2ATIA 4LYGA 1WUJS 4XEUA 1J7KA 2YNMC 3NTQA 1H1DA 4M0PA 4P36A 5LP6C 4QARA 4B3MB 2I7DA 3BMOA 1MJHA 4DA8A 4YUVA 4EFNA 3ZU4A 2JLCA 3NOQA 4FEEA 2D4AA 5CFLA 4G1MB 2PIAA 3MERA 5JAIA 4EG8A 4EYGA 3DEYX 2A1IA 5I7EA 2AFHA 3ZE9A 4UOEA 1K0UA 1G6HA 1YZHA 1T5LA 1IC6A 3TR5A 1PLKA 2CCJA 1DAIA 3K4QA 3ZCSA 1I10A 2FQWA 1J9ZA 2CNBA 3LA6A 4Y18A 3OX4A 4GU5A 1XZKA 2ZJYA 1SBIA 2V65A 3TAXA 3EVAA 4UEJA 1J97A 4Y1FA 5TB5A 5ADHA 2OQ2A 4MI1A 5GV7A 1UAYA 2P11A 4FD2A 4Q4CA 2BFCB 3IMEA 1F6WA 1TCCA 3LP5A 2XGJA 1D5WA 2BC9A 3NYQA 1GTMA 4G4IA 2J9GA 4PQRA 1T1GA 1BW9A 4F3RA 4NFYA 2C61A 1DB3A 4YAGA 5CXQA 1NP6A 2MSDB 2B61A 2J0EA 2OO7A 2RGCA 3GG2A 3NEPX 1NURA 1PHPA 3EW9A 1DKLA 1XDUA 1YB6A 5IUJC 4TVOA 3FM9A 3SF8B 2ZLBA 3I34X 3R3XA 4MV6A 4P98A 4QNMA 2Y76A 1O2DA 3ZGYA 3OU6A 2R8RA 2W6QA 1TQ8A 5FI5A 3DLHA 1PFGA 4RPKA 5BP7A 1XC7A 2L18A 3AKZA 1IU9A 4DLZA 3PJGA 2AOXA 1ZO8A 3K70D 2Q1TA 3JR7A 4XDZA 4HN2A 3KSUA 5CG2A 5HIIA 4MLDA 3DOHA 1BQ4A 3L40A 1SOUA 1UPFA 3UMSA 4C3UA 1V5FA 3D43A 1PJ2A 1V3TA 4LJ8A 5J5AA 2PNJA 5KQGA 1TAHA 1RP1A 1FVOA 4I9UA 5ALQA 4QLOA 3IPYA 5B7GA 5C8DA 3TWOA 2W6OA 1GGVA 4U39A 5DN6A 5B1SA 4DLSA 1E2GA 3ASUA 3E9EA 3FYCA 2XIJA 4LI3X 4UDNA 4IEIA 1N5IA 5SY4A 2G8LA 3SIWA 1JJFA 2WMDA 3GHHA 3IAM6 4YMLA 4QFCA 3UHPA 3BWMA 1C81A 2HA0A 4I1UA 1RZUA 4JI5B 5A2GA 1NUHA 3TW6A 1RRFA 4JWTA 3IB6A 1GG5A 5EJGA 3IUQA 3GOHA 2QSYA 4OI1A 4ZC1A 1LBHA 4RFSA 3K9FC 4DTIA 3RYHA 3E3MA 2RHGB 3AHJA 5HUJA 3RKSA 4CKEB 4NI5A 1JDZA 2BZ1A 2IGTA 1QQAA 4B31A 1UPXA 3ZI0A 1CEQA 3DT6A 4JQSA 4FWIB 3UXHA 2QY9A 5A71A 5EXEA 1CERA 4LNUB 4MRSA 1DXYA 3GQVA 4HTFB 5BT9A 3SFVA 2QRVA 4FBGA 3UV3A 4BVAA 1QV7A 3PE4A 4F56A 3RIYA 2OFWA 3CX3A 4YMHA 3UMRA 2PMEA 3BQMB 3GCZA 4URYR 3GEIA 4OQLA 1OLOA 5BNZA 2GHTA 3TCXB 2Y8EA 2Z2KA 2DAPA 2HBYA 2QX6A 3QA9A 4TZ6A 3M6UA 5DSZA 1UKCA 2WHEA 3FWZA 4EUEA 4R9VA 1HTBA 3EJ6A 3R6GA 4NV0A 1X8LA 1GUDA 1M2OB 2NT3A 4E94A 1U2TA 2IZZA 3TNJA 4I55F 3KEOA 2DFTA 4HGQA 1GGMA 1E0JA 3TDMA 1G5HA 1KU6A 1V1MA 2FKNA 2ZOSA 4QFDA 4X9XA 4EUHA 1XLWA 2ZULA 3AUYA 4IJ6A 1M2VA 2ZKLA 4MVWA 1Q0QA 4QO7A 4WVLA 3W8EA 3AFGA 3O8RA 3PQFA 4LHXA 5DN6D 1LDBA 1AXRA 1E1YA 2WJWA 4D6YA 1D3AA 4C88A 2D74A 4U5XA 4FSXA 2CE2X 1B41A 1CUSA 4PS0A 3QNWA 4WI1A 4AP5A 5KYXB 2O5EA 4TTPA 1MAWA 5HQ3A 3CISA 3OX3A 4C6RA 1T2FA 2VH1A 4E22A 1OHHA 2XCRB 3L82B 4YP7A 2AJDA 3MWYW 2Q29A 5ALIA 4X7RA 2ILTA 2GO1A 3EMVA 5HKLA 1UM9A 4EJ2A 5GONB 4NBRA 2QN1A 3CY6A 4ZU1X 2P91A 3T8YA 2Z83A 2J6BA 2QD4A 4UBKA 1SQ5A 3RAPR 3SX2A 2L42A 2CKMA 1MKYA 5KAPA 3ZLTA 3OMXA 2C9YA 1LDNA 5C7LO 3OFKA 4X41A 5BQOA 5CLHA 4MTLA 4QYIA 4QGBA 2WIBA 5ECYA 3BFVA 3NGMA 4LHZA 1A50B 3U37A 3QY9A 2V74B 2FX3A 5TPZA 3K1AA 1T4GA 5D84A 3IXLA 4H1UA 2E18A 2BFAA 1PJ8A 3GU3A 1XZNA 3E8SA 3DEZA 5TIIA 1D0SA 4QGFA 1B76A 3VDQA 2I55A 3TZCA 2CJYA 2ST1A 1Q0HA 3AF3A 2EARA 3ZEIA 1PJQA 3QK7A 4PBRA 1BVHA 2FVYA 4WXHA 5LYJF 4TLMB 1PR6A 4F5EA 1IL0A 5DI3A 4ZYWA 3IOCA 3DHNA 1E5LA 2GN8A 1F6BA 1W2WB 1ZW6A 4TX1A 5JRZA 3PFGA 1MH1A 1OU0A 1XZJA 2ZRAA 2GB4A 2GF2A 3SC2A 2WEKA 4CKBA 5CVTA 5FPKA 4W1PA 1MVOA 5AO9A 4G0ZA 3U4HA 4OH1A 1BVYF 1OX4B 3LRPA 4NYJQ 3LW8A 3R7SA 4JP5A 4MDEA 1Y6JA 1N36B 4KQHA 4OCZA 3LAWA 3I92A 3UTCA 1W8IA 1BGXT 3QG1A 4R2WA 2O6HA 4BEWA 1BNCA 3A1EA 3FVWA 2E0IA 4EW6A 1QH8A 3CT4A 1UIMA 4JWKA 1A5SB 1LQUA 3GGDA 2YWRA 3RM3A 4EKYA 4BMDA 1IG3A 1W1UA 2J0SA 1J8DA 3JQ9A 1XNRB 4GZMA 5J59A 3DDZX 1ADBA 3NWEA 3ZE8A 3D1VA 1EUDB 2JVJA 4OI2A 3F6BX 5LNK1 3I5AA 3C3XA 3OCZA 4YDHB 1NYRA 2HAEA 3ZGVA 4RF2A 4QTYA 3RIXA 5DOVA 1FDVA 4ZMRA 1JDSA 1REQA 5FBLB 1T4BA 1VDMA 3V34A 1K97A 5LQSA 1USUA 4YCCA 4KNWA 4K9MA 4YRZA 1QTRA 2O3RA 3EPHA 1A1VA 5AHWA 4D9IA 3KALA 1IOZA 4QYWA 1KSGA 1QZXA 4F9FA 4BIIA 2AG0A 2QOEA 3N39C 4EJSA 4DARA 3HUFA 4OSPA 2H5IA 3H1PA 2V9ZA 3BJRA 3M82A 4ICIA 3IJRA 4KPUB 1DDOA 4N49A 2GAAA 1CEXA 1ZKDA 2X0KA 3MG9A 5FL7A 4LF5B 3RVPA 1V2HE 4W4TA 3GPLA 5JADA 2ZUTA 1U94A 2J5BA 3SHWA 2VNIA 2B30A 1JHMA 3GA7A 3CLTC 2O05A 3GR6A 3ME5A 1T4CA 5T67A 5CIYA 1PV4A 4TMXA 5I01A 1ID8A 1SIWA 4LWZA 1NFFA 1ZOIA 1XFAA 2F48A 4LJYA 1CNFA 3UICA 3W77A 1Q20A 3FIUA 1GCUA 2VQ3A 4ZANA 2QTAA 2IS2A 4CTMA 1ZDMA 3K6SB 1FRFS 2OCPA 3IJPA 5M2QA 1YIDA 2PX6A 2RSLA 4PGGA 3ZJYA 2RGUA 2PDAA 2ZE8A 3PPXA 1UOEA 4R8LA 5KMGB 5D3ZA 4HWPA 3EPPA 3BN3A 2Q3EA 2GAJA 4JZKA 1DKOA 2G1KA 3DMGA 1EK1A 1VE6A 3PR1A 5NLLA 3THOA 1WMBA 5I4IA 3CTPA 2WAOA 3ZZUA 1PJAA 2K4MA 5CXUA 2A0WA 1WZNA 1AN0A 3HB7A 1T9KA 2BE7A 4Y30A 4WINA 4LMPA 5DRTA 5EPUA 3UB2A 1HR0B 4XPIA 1VFPA 4Q4AA 1SURA 1HQKA 2ADMA 3H9EO 4LWOA 1MX9A 1IBLB 1XV5A 3A6KA 3G2QA 3OJWA 2J0VA 5CTAA 1DZ3A 1JEQA 3JAWB 4P7BA 3H1AA 3T1NA 4F8JA 3EMBA 4IIHA 3ZWQA 3Q5DA 4ZAVA 4A8TA 4AJJA 1XTVA 2NGRA 3H19A 2ZYSA 4UU0A 1SHTX 2EHDA 4UMDA 2L69A 4ZV9A 1X1TA 2KBFA 4KI7A 3I8XA 3GH1A 3QFFA 2E1PA 1Y9EA 2V9PA 2JLZA 1G1AA 3NR2A 1IWBB 1NRXA 4JGIA 4M6WB 4XQEA 2R66A 4MW6A 3MLAA 3P9QA 3CKLA 4QD3A 2AOTB 3KKOA 2IYRA 1VJ0A 3FTQA 3K9QO 2VHCA 5C4GB 2IUSA 3WNBA 4DCPA 5KNDH 3ITKA 1AS0A 4R2MA 4YASA 2K6GA 4MO9A 4MUIA 1E3SA 4NNOA 4QTXA 4R6XA 4J0HA 1E4OA 1KZ1A 2KW5A 4QOHA 2ZQYA 1RXSA 3N9IA 1SVKA 4YAFA 2HHLA 2LE0A 2JFQA 1H1LA 1SVSA 1UDAA 4Y2YA 3Q8KA 2Q46A 4AZ0A 1E59A 1COWD 2PO7A 2OAEA 4XLTA 4XYMA 3FWPA 3B1XA 1XZCA 3DKIA 3SG0A 4DG9A 5B7NA 6Q21A 4EB6B 3N3AC 4QEZA 2BGRA 2B3DA 5AVSA 1KC1A 1L3CA 3LCVB 1JLSA 3HJHA 1CULC 3PDCA 1DRKA 1XPJA 5DE3A 3RWBA 4RMIA 4Q9IA 2IKSA 1DFGA 1P9LA 2H2HA 3TZEA 3UFBA 2JJ2D 3V2GA 1ZEJA 2OTCA 2X42A 1D2RA 2P9BA 1EFCA 2HCFA 2O5CA 3LYLA 3L6DA 5BWBA 3RS8A 2WJVA 1MEJA 2A6PA 5EWMB 4DRXB 1GA4A 4NU5A 4ZT6A 1OGIA 2HDHA 1MZPA 1N9KA 4UE2A 5FWNA 2XTAA 3KWFA 5EWJB 3MYYA 1E9DA 1F5SA 1F4VA 1NBIA 2D1QA 3RUEA 1J09A 3WLMA 2RGEA 4B17A 1HGXA 1RJGA 1MD9A 4ZZ2A 4OHFA 1Y4ZA 3UWOA 4MW1A 4RCZA 5AHOA 4RIIA 4DANA 1W1WA 3LOUA 2IYVA 2W22A 4NMWA 1V71A 3LP8A 3PHLA 2WSSA 3RJMA 4F06A 1XKXA 4YIHA 3OFJA 1K7SN 3TL3A 2R00A 4S1VA 3RVDA 2YXLA 1AH2A 1T6XA 3CUEF 2REBA 2WU4A 1G8AA 1HURA 3MCZA 1QYVA 2I5PO 3NVMB 2HIHA 4OB7A 2C84A 1GITA 2MINA 4Z53A 4YX9A 2GM9A 1C9JA 4IYRA 3REGA 1G20B 3SJBA 4CKBB 3E9ZA 3ENWA 1GL3A 1CY7A 4DMRA 1IE3A 4RMNA 3P9CA 4HH1A 3LKVA 2Y1OA 1ZXXA 2R8OA 1NG9A 1FS6A 4NMXB 4H6WA 4LVCA 1UJCA 1GU0A 5CYPA 5ADVA 5A9SB 1DG9A 1HTWA 1E60A 3CHYA 4Q3AA 1SXJA 1R66A 1Z74A 2B1JA 4NKRA 4RY0A 2YBEA 4M1YA 2OHXA 4YR9A 3FTEA 3K5HA 9LDBA 1U3VA 2NQ8A 2AI1A 4EZEA 4RVGA 4X44A 4ZCSA 4OQMA 4UD6A 3HA2A 3MVEA 3PRJA 4FR0A 1CUGA 4ER6A 1M33A 5CBPB 3RE1A 1WW3A 2VQSA 4Z7NB 1TIPA 3LWZA 1LWOA 1F3LA 5CU7A 2XKAA 4MK4A 2CSXA 4XFDA 1TZCA 2UYOA 1EJ2A 3Q6MA 1SG0A 1GLGA 5A4IS 4W6ZA 2J85A 1KA9H 4JEIA 1Q11A 3R0JA 4G5HA 1OXVA 3FBTA 1GZ5A 3IT3A 2HB6A 3FG9A 4I3HA 3I2JA 3NCHA 2XBLA 4U6SA 3WIDA 3JPWA 4UXJA 4RK7A 4BNVA 3TJZA 4NXNB 1QU2A 2EBWA 3CB4A 2WY2D 4Z0TA 2FSPA 1YK1A 2DR3A 4QUIA 4Z8YA 2XQJA 4LXYA 1H42A 5A5VA 2WTXA 2ZR8A 2NQ2C 3PVCA 3X1JA 1L7XA 1Z39A 1DG1G 1HLFA 2Q6VA 4KPUA 4RSMA 3IPXA 2D00A 2NTVA 1LSUA 2KLBA 1XQVA 1M34A 4FDMA 3A31A 2OCDA 4IDFA 3BS4A 4KWIA 4FKZA 3DT8A 2C5BA 1WMAA 3F5SA 3MELA 4CTJA 1MGPA 3P9XA 1W4ZA 1FRQA 1TPZA 1OZHA 1RZVA 3OICA 4MV8A 1LPAB 4RY2A 5FA6A 1RAFA 2PH5A 4K3VA 1BU8A 3PUHA 3NHJA 3LKDA 1Y8RB 5ESDA 1FEZA 1M2OA 4I1YA 4QU8A 1BE8A 1LPBB 2V6BA 3EFEA 3FPAA 4II2A 3SF8A 1EG7A 4Q1AA 3WI7A 1RHKA 3AL0C 1QQ6A 4FHGA 3FOBA 1UZUA 2WZQA 4LF4B 3RADC 4L6IA 1GAEO 1OYYA 2JANA 2G82A 4YPOA 3UJAA 5HIKA 4YT2A 1UOOA 5IU6A 3W5IA 3DZIA 5JZOA 4R69A 2W9XA 5JNRA 4J91A 1V5GA 1J2EA 1YQQA 1QQTA 1UF9A 4M9UA 4ZXPA 2QP3A 5HA5A 2M6LA 4AIIA 4D6XA 5AVYA 5LFAA 1U1FA 3G0IA 3GOQA 3WMRA 3GPBA 3LYUA 2OZPA 2PXCA 1XQXA 2IXBA 1SKAA 3RFFA 5IC6A 3O9VA 3DBHB 1CUAA 4L5JA 5EZ5A 4NYIR 4YRBA 5KNCH 1QU3A 4IDEA 3CZAA 2CUNA 4LDPA 1D09A 4W5RA 3LBAA 3IP1A 3OCCA 5H16A 2WOOA 2YFHA 1MZVA 2C83A 4GI3A 3D8SA 3KOUA 1XNGA 4IV5A 4QTTB 1YS7A 2RGRA 3HYTA 1WEKA 1NPYA 2RGGA 1K7EB 2HWKA 3LGSA 3R41A 2AK3A 2OBXA 4ESOA 1JWLA 4ARUA 2ZYUX 4H7IA 4H0NA 3ESAA 3TI7A 4PQFA 5BW8A 1MT0A 1LCIA 2I2DA 1CFZA 2FF5A 2XWBF 3T5DA 3C15C 2JFHA 2WE8A 3DNMA 3RF7A 2WYOA 2NZXA 5ALZA 4AKTA 4UHDA 1YXMA 3R3ZA 3IUNA 3EYAA 3HKEB 1TZBA 4BVLA 1R8JA 5FUQA 5F78A 1QAQA 4NICA 1KYYA 5DI3B 2FLKA 2XVZA 3GVCA 3S68A 1EFUA 1QIEA 2ZJ3A 3M70A 1OVMA 3Q41A 2UVDA 5SYAA 4FEGA 5EIXA 2WNSA 2E9SA 5KTNA 1IN5A 3C0KA 3HDVA 2IHUA 4KFTA 2FPKA 1JHAA 3IBGA 1EGVB 1FE8A 3MM4A 4J2TA 3B1FA 4E21A 2Q4DA 3GNSA 5HKBA 1UFOA 1OB5A 1ECPA 2PX3A 3BK2A 1R5NA 4C05A 8ABPA 4IRMA 1O57A 2FZEA 4MGYR 5JMTA 2JC3A 4C5BA 2HHJA 2WFLB 1XEXA 1U0NA 1BN7A 2R5WA 2XTNA 5B3LA 3AI2A 4M1OA 5CM9C 2A1UB 1QYXA 2GN4A 5L7YA 2JGDA 5THQA 1IJEA 2XMZA 4XW2A 1NP7A 3SGLA 5JJ5A 5DNYB 4LGMA 4GP6A 3G1WA 2G07A 4DIKA 4YCAA 1RW4A 3DL4A 1PAUA 3G8DA 3MQ2A 2G63A 1GN8A 3FVTA 4P3OA 1JQ3A 1I24A 4TRJA 1TUIA 3S2FA 2ANCA 3AEQA 3DDCA 1RKBA 2P75A 3HL4A 2X6TA 1A2OA 1ZGHA 4PYNA 4DUYB 1T36B 1LDYA 4IOLA 1FIUA 1BDMA 2C97A 2WU3A 2FPGB 1GUYA 2V3VA 2XCUA 1UDWA 3L6BA 5AJYA 1QKJA 4FGWA 5EMNA 3TCNA 3TIVA 5ABPA 5KB3A 4F2HA 1E8NA 2ZJOA 1MX5A 2FWAA 4UVIA 1HI9A 1VSQA 2EEPA 2J48A 3HR8A 3RKRA 4BQSA 4YRKA 2I4RA 2BLNA 2SBTA 3KJQA 5DHTA 2OORA 4DA9A 4RKEA 2C4MA 4PBTA 1IIBA 1X1BA 1R4AA 5U4XA 1IHDA 2QN8A 2YZKA 1K89A 5AOCA 1H4TA 4M1KA 2RBKA 3WLFA 1ECLA 2D1TA 4K03A 3D7SA 3UMGA 5HTKA 1RPAA 1OFTA 5KDOA 1IY8A 1S1CA 1TYDE 5DYGA 4UAGA 4IOJA 2Q7XA 4DCSA 4Q12A 3W5VA 1EZZA 4Y2HA 3ZXXA 2V8BA 1CIPA 4NAVA 3VYRB 1IBKB 5A3QA 4U3JB 3KC2A 5G3ZA 3N5CA 1BS9A 4OQNA 4QRHA 4XVRA 1GZUA 1PDVA 2V4ZA 4Q3BA 3UANA 5ALDA 3QVUA 3PJFA 2F64A 5CK4A 5EXTA 3CFYA 1P77A 2IPOA 2WW8A 3Q9LA 4FNMA 4WDQA 1M9NA 3JYQA 4WZAE 2E4XA 1G7RA 2RG1A 2XB2A 4UVGA 2XAAA 2ZS9A 2AG6A 1Q83A 3Q3GE 4H7HA 1OUMA 2I6TA 4ETNA 1NNI1 3B7WA 2QAGC 3Q7TA 4RLSA 4RVNA 5ECWA 5AUNB 5F3RA 2XXAB 3X1WA 2ZJ0A 4X6XA 4FI3C 3QBVA 4EX6A 1QIFA 1Z9BA 2P9FA 1MGOA 1G7SA 4QTUB 1DE0A 1BOFA 2RHMA 2ZSUA 4URWR 5AW7A 3HYLA 4XQGA 3PDUA 3B2QA 2BFPA 1U8AA 2YVKA 1H8HA 1GNQA 1QIIA 1RBYA 1P9NA 1A8SA 2EHJA 2YJNA 2WFLA 5I6DA 1K5HA 2F67A 3IAS6 5CGQB 2WVJA 4QHSA 3FCEA 4A16A 3M5PA 4I1VA 4PSVA 5CDTA 2WMNB 2EZUA 2OVBA 3FTDA 4L5BA 1GNTA 1MO5A 1RZ3A 1PZFA 2JHCA 2W00A 4I3FA 5IJ0A 1YZVA 5JASA 5K8VA 5LXTB 1EHYA 5GPBA 5CB0A 2INGX 3L84A 1U6KA 2OBFA 3D2BA 2ZB2A 3LX5A 4EPVA 1Q7EA 1G3UA 1SWVA 4LZLA 1XMVA 3PUKA 3QTLA 5IN4A 4PC3A 1R6BX 5SYMA 4BLQA 4JJIA 4XA8A 5F73A 1JDBC 4YJFA 2B83A 3QVOA 5JANA 1HMPA 4UOQA 5GGXA 2DFKB 1SVIA 4MXDA 3TS1A 2H00A 2AWNA 2C2GA 1EI9A 2QSUA 1Z7BA 4L6AA 5BR7A 3K5IA 4OL0A 1XCGB 5KYXA 1BS2A 3ABQB 2GHRA 1N5JA 4ND6A 1RI2A 1SCKA 2NU8A 3G5LA 1K75A 1IY9A 2PT5A 2E1RA 4A1OA 4D4KA 2YCBA 2C5LA 4Z4CA 1XXHB 3D8BA 1H2EA 3QVKA 4O2BF 4V0ME 4YCJA 2W5UA 4CMKA 2YIDA 5IXJA 4HDCA 4NYJR 4C6SA 2AS0A 3DV9A 1KDZA 2OL4A 2P41A 3AU9A 1E7QA 1XK6A 3ICCA 3NWPA 5KREA 4NJOA 4A91A 5JLJA 2DLNA 4K9NA 3IA2A 1W36D 2VTBB 2JK1A 4G85A 4FIZA 3K6JA 3OCUA 3EG9B 5C8XA 4NCHA 3R9XA 3N2YA 1YB7A 1OTHA 5T4BA 4RY9A 4YY3B 5BMVB 2Z6VA 3AHFA 1ORTA 4M87A 1WOYA 2BDEA 3NOXA 4OJTA 4QUAA 4AN0A 4DCMA 1NVWQ 1FP6A 4X62B 1X87A 1JEAA 4H6PA 3VR4H 2BMWA 5HBRA 1NN0A 1M7BA 4WASA 5BT8A 1R16A 2OILA 2P79A 3ISJA 4KGZA 4MDYA 4PTZA 3R7BA 1UIRA 3RW9A 1YIOA 2PZ8A 3IR5A 3ZCXA 3ZDEA 1U2QA 1YA4A 1YZUA 3EYWA 2HHAA 2IL1A 3HKDA 4YRMA 3DPSA 3ZBTA 2IITA 3HJNA 4YTEA 4EEXA 1J2TA 3OZWA 5BOSA 3S2ZA 1KJIA 2UDPA 1M5TA 4NK5A 3L49A 2D2EA 1TVMA 3BG5A 4ROTA 5CR9A 5A1TA 3RVSA 3GT3A 4H4DA 2H3HA 4ZOBA 3PNLA 3VISA 3FYUC 2YWFA 2C59A 4F92B 2EKZA 3FX2A 3S6JA 2JGKA 5JXGA 2CK3A 1N2BA 2ZR7A 3BCHA 3SE0A 4R1NA 5HS4A 3HUEA 1LH0A 1M2JA 3BZUA 5AI6A 4OMDA 3PJRA 4LTDA 1PWEA 2TS1A 3W5JA 5DW3A 2HW8A 2J30A 3N2GA 2X1LA 5BOVA 1ODIA 3WYEA 4CM5A 4CFSA 4N65A 1E5XA 5ILGA 1LTQA 1KE1A 2IHKA 1A4UA 4XD7A 4M8LA 5H68A 1OBCA 2XUJA 2HYDA 2XAUA 4B0PA 5KKCA 1R0BA 3W4KA 4EKNB 2ZT8A 5EKSA 4WA7A 3OQBA 4MDFA 2G06A 1BMDA 3WIOA 1RYDA 4TV8A 2HNBA 1E5VA 1C8VB 4Q9LA 1D9XA 2ZVQX 2G7MC 3VC7A 1E2QA 3COWA 1J70A 4UU7A 1O94A 3B9BA 3BHMA 4OHVA 5KYKA 3B2NA 2WICA 3ZI4A 1N8TA 1WP4A 5ALWA 3CW8X 4A9AA 2CLOB 2FWIA 1CQIA 2D7CA 3BWDD 3N07A 3QFTA 1QYRA 2F8LA 3MS2A 1H0KA 2ZQZA 1XVTA 3M4ZA 2IPLA 4PZEA 3UYLA 3VR2D 4OKSA 2O4CA 3DO6A 5AJZA 3GJ6A 1I7NA 2PRKA 4DPKA 2CVQA 3C3DA 4UHKA 1CUWA 1GLNA 1UH5A 4Y6QA 2JCSA 4JHLA 3O4HA 4UW9A 1QRRA 1XZAA 4JBLA 4EDHA 5JQGA 2QRKA 2K87A 3Q0IA 4IQGA 1UZAA 2NUPA 9GPBA 2WAXA 3BTOA 4H7PA 4GI1A 2VR1A 2PGLA 1MB9A 4N5MA 2IK8A 3QFHA 4GL4A 4N48A 1H1TA 1OI2A 3D31A 4KCGA 4H3HB 3RIHA 5JWRA 3PXGA 2OHHA 3OPMA 4R71A 2A5DA 1XK7A 1PEDA 3KZKA 2BMEA 1TQ6A 1P44A 4AQ7A 3ZDBA 2EYQA 3UC5A 3K6RA 5KVCA 3EC1A 3WVNA 1CUFA 1XF9A 3OZDA 3JCZA 3WICA 3NTVA 3I5UA 2VHZA 3HWWA 3IQIX 3UF0A 5LPNA 2RKWA 3NGXA 7ABPA 3CTMA 1CKEA 2Z6AA 1RRCA 1HEYA 4LJSA 2OT3B 3UK6A 1EM8B 3RUCA 3NHSA 1U65A 3EY4A 2NU7B 2IEYA 1TM2A 4JFRA 2FUKA 2QTFA 1N5LA 2R751 1BCSB 5EMJA 4ZEXA 3TIGA 1U3UA 1KY4A 3NP7A 3TRDA 4IR7A 2GJ8A 3JD0A 3L7LA 4OKIA 3UJ8A 4E12A 1KI1A 2CHFA 4IG4A 1YL5A 1CUXA 2BEVB 4Q4AB 1PCXA 5C5IA 4NK4A 4C7OA 3R40A 2VHUA 2YC4C 1QV6A 4LNUA 1D2GA 1ZP6A 1ZMXA 3O7WA 5KTTA 2PR2A 2BOVA 3BRCA 4JC0A 1O08A 2Z2ZA 4C03A 2YJZA 2JIBA 4MJXA 1KBZA 3ELYA 3EXHB 4R6WA 5I9LA 3QU9A 5LCXA 2NPFA 1V16B 4HNTA 2ZI4A 4LSMA 3PENA 1CZNA 4C1BA 1NVFA 2ZROA 1W87A 4X1IA 4XYLA 3HN2A 5CBPA 3LBIA 5KPJA 5HQJA 2IXGA 3UWDA 2XSZA 5I4CA 1XNJA 2HHCA 3LDUA 3LSYA 2MYNA 3BCSA 4LQ4A 5B2ZA 4P4NA 3T7CA 3ZG6A 4AZ3A 3OOEA 4B6GA 3GVPA 3T7RA 3A4MA 4RFLA 1G8JA 2EL9A 4LDQA 3NKFA 2ORWA 1OLUA 2XE4A 2FMFA 1EP1B 2C7BA 1LLQA 3W3AH 5FULA 3IIIA 4RM2A 3I5MA 3B78A 4UFOA 1NW3A 1D5CA 1JR4A 3JQAA 4GO1A 4LIPD 1FDSA 4EY4A 1KXZA 3T9EA 4I8XA 1NBHA 1YACA 1Y81A 3RASA 2AJ8A 3AUAA 1RWXA 1SHZA 1MQAA 4QBFA 3SM3A 3JVIA 4V0MA 5AM2A 3LO8A 1UC8A 1Z16A 5CB4F 1GAJA 2RHOA 4BMCA 4RGYA 3CA8A 5G02A 1VC2A 5IFKA 1E3IA 1WZUA 5K5EA 1I7DA 2YASA 1ODFA 1TKCA 2YHIA 4CG0A 3PX3A 1UXGA 2ZJ4A 3LXUX 1HWYA 4B7AA 1KWGA 4JBNA 1P73A 1WDMA 2VYVA 1MJ5A 1Q7RA 1UBGA 2IUTA 2GXUA 4Z1MD 5C46F 2COEA 4EGQA 2WLSA 3EXIB 2ROQA 3K9GA 5L3RA 2I1QA 1VPEA 1C9YA 4RVSA 1KZGB 3D7KA 3FCXA 1W0CA 2RDMA 4FFWA 2GNOA 3DP7A 4GPTA 2EZTA 3S2YA 3VR4D 1QCYA 4LF6B 1LPSA 2RJOA 4EHLA 4UOZA 3E05A 1EB9A 5BSGA 1UJMA 1YE5A 2LZ0A 3NHFA 5D86A 3PUZA 3VOSA 4QNRA 3DONA 4X20B 3BL6A 2PL3A 2WHPA 3IEKA 4U7TB 1GTZA 1O1YA 1EVEA 2H0QA 3B9RA 4G1UC 2NAPA 4D96A 2A14A 3F67A 3I6ZA 1JDNA 4UHBA 1EWQA 1WQ3A 2V5VA 1PQWA 3B3FA 3EWIA 2XB8A 2GZHA 2JCGA 3A1VA 4J0GA 3DF9A 1D07A 1ISGA 1VPDA 2HU5A 2VKTA 3PF8A 2WJZB 4F46A 5EKXA 1ESCA 1T0UA 1XTQA 3DOJA 4JOCA 3GLHA 4EG5A 1VYVA 3ZW9A 3QUBA 5B58T 5J1SB 1FSGA 3JX9A 4BNYA 3E1KA 4LDZA 4X00A 2PGXA 3X1MA 1H6DA 3ZXUB 1XA0A 5GM1A 1P7CA 4DNQA 3DQPA 4GX5A 4GC9A 5CDSA 3DSRA 1NE7A 4BMNA 2ACVA 2XXBA 4BECA 4JLDA 4OYHA 5CRIA 3C43A 3WXBA 1IZZA 4PPNA 3C4JA 3IUEA 4CT4B 3A0RB 1DKUA 2Q3CA 5HCUA 4ER7A 3LVFO 2CBZA 5KOYA 3T1YB 1A0OA 3HU3A 1VCHA 3SNHA 4F9TA 4LF9B 2OG1A 3S7ZA 2AFRA 4W9RA 1GPAA 4AMYA 4ILEA 2JFZA 4WTOA 4C20A 2E4VA 1E3EA 1B3RA 1Z83A 1FDWA 3HU1A 4WL0A 2OYCA 3U3KA 4UNSA 2YFYA 4C4RA 1HOTA 1YCHA 3FGOA 1P60A 3BD8A 3H3FA 5C81A 4B6FA 1M10A 4RSHA 4MHTA 3GQBA 2FWBA 4R1MA 4B5KA 2BM1A 2A0XA 3H6GA 2DG2A 1GA6A 3ZQJA 2OENG 3O92A 5HQ3B 5FV7A 2HNKA 2HU8A 2GK4A 1TA9A 2ZIXB 3GFBA 3LLVA 4Z7JA 3I3SR 1T4MA 2VHXA 3ESBA 3A4YA 1FDUA 3AHCA 3BWBA 4JA0A 5U1PA 4JLWA 5K2MA 3SZOA 3U4IA 1DWQA 7MHTA 2OXIA 3HBNA 3Q3CA 3IYLW 4EENA 2G0TA 3RCBA 3ZD9A 3DOOA 1LJLA 2CDRA 3FROA 1USWA 2X9LA 1SIUA 1Y8QA 2F3UA 3TYXA 2QXTA 2VYNA 3KZVA 1Y9JA 4CL8A 5EIHA 2GJAA 2XGGA 1ML4A 2PKRA 4RZSA 2I2WA 3CSUA 3BTVA 4MYRA 3QHAA 3CWZA 3SBOA 4LE1A 4DWJA 3U19A 2JAWA 3ETCA 4IIBA 1XMQB 2PUAA 2O8CB 2NNLD 4E5NA 4E32A 8ADHA 3AUFA 3P0HA 1ZI8A 3QI2A 3C1AA 3S1AB 3TEMA 2H1HA 4PZAA 1X7XB 3DLPX 3P0RA 1G2IA 3GRAA 3LV8A 1G3QA 3N86A 1H3NA 4Z4QA 3RNLA 5EHXA 1Y5RA 3NT2A 1N77A 3R20A 4KO2S 4BX2A 1U6JA 4ER5A 5AXDA 1ODSA 4QTZA 1QH9A 4J3NA 1UC5B 1FLAA 4LA4A 1QO0D 4HMPA 3MUEA 1PT6A 1ORIA 2B4YA 3AJRA 2HA7A 3RJ5A 3QXSA 1U0JA 1Y6ZA 1EXVA 3VJRA 3MOIA 2IBMA 2NT4A 4H9GA 4RHFA 4JYBA 1UODA 3WWYA 3AH8A 3AVUA 3NFRA 3NAMA 1R2QA 3CRRA 2B35A 1WXFA 4QBKA 2I78A 4QM7A 1CF4A 5EE0A 5BSEA 5KVAA 5JNWA 1HOXA 4B3SB 1JAXA 2O8EA 2CHQA 3SLKA 1ZGAA 1VLHA 2GJKA 4B6SA 3DFFA 2WUVA 4LXGA 3NV9A 1JIKA 4IF6A 4WV3A 4RENA 5NULA 5EXPA 5JJCA 3WGLA 3ZH9B 5IM4A 2ZATA 4UBNA 3N2ZB 1Q1BA 4K88A 3B60A 3NHUA 3D4NA 1FFHA 4N39A 4AYTA 4ER3A 3EJWA 4C30A 4MS3B 5D3KA 1K3FA 1CNMA 1E1QD 2AQ8A 3CBGA 3WIEA 5K9ZA 2QM8A 4S12A 1P19A 1NN3A 1QZTA 4Y9DA 3MINB 5FAXA 3ZXIA 4G0WA 3F6CA 1FXWF 5DTJA 2B5WA 1U6IA 1PJ3A 2ZBDA 1R6AA 1W73A 4WQMA 1OI3A 3WMGA 3NDIA 4G5YA 4PZDA 3HJUA 2XB6A 5JH7A 4QPJC 2QE7A 1N75A 4A26A 4TYMA 1LBTA 3W90A 2B8WA 3DFKA 1RC1A 2P1RA 1L7QA 3G2LA 3NNDA 4S24A 3WWZA 4KITB 2JLWA 1JKJA 4W8GA 5HCIA 1JHVA 2P2SA 5D01A 4FR2A 5KOIA 4LY6A 1U1GA 1JSZA 1L4GA 3K70B 6AT1A 4BN5A 4N12A 1IJFA 2VCEA 3WL7A 1R6VA 1XDBA 2FCRA 1CYDA 1I2CA 2QUKA 1TECE 4FZRA 2LGJA 1INLA 4WFQA 3FYSA 3VV2A 2PCJA 2P90A 1Z7GA 1ZGBA 2PJZA 3I2HA 4HRXA 4F3TA 3GBVA 4PICA 2EX1A 1EJ6A 4GWKA 4M0EA 4J0KA 1RABA 3VYTB 3KSMA 1L5RA 5BXYA 3WIBA 1S3SA 3EBPA 2FJ0A 4CIVA 1I1NA 1P7VA 1KTVA 1FYVA 1UMKA 1T3ZA 3T61A 2W7TA 2OGZA 1ZUIA 3AKEA 1P8AA 2Z08A 4TQ9A 1R6XA 2ZIAA 3LXMA 3K2EA 5JAPA 3P94A 3LUHA 2DJ5A 4GGPA 4MQ5A 3HVIA 5F64A 1MOZA 5KYUB 4LJ9A 3LRTA 4WOKA 3ECSA 4U5QA 2JGFA 3H2BA 5JIBA 4YJ2B 3R5FA 5AVTA 3NIFB 3OF5A 4XIYA 1HYHA 4LSWA 4IIUA 4UNRA 1GPLA 3SJAA 2X0DA 2C07A 2ZI5A 1XELA 1N2ZA 1W9MA 3OIFA 4B9EA 4GI5A 5BUZA 3BE4A 4AT1A 3L0ZA 1U8TA 4N54A 4ALLA 4ZOQI 5CFQA 1NVKA 4P58A 4YMWA 3F5DA 3KETA 2EZ4A 1VMEA 2Z2IA 4CEJA 1RACA 3AGPA 2DLDA 4XVUA 4PNPA 3TJRA 4TL8A 4MINA 3GT7A 5DHQA 2BBWA 2PQMA 1HE8B 4L22A 3ZHQA 3DKRA 3H99A 2XLBA 1EGAA 3WO1A 1PZMA 4MVYA 1LZKA 2GK6A 5T4HA 2X4DA 3NB0A 4GC5A 4NTZA 4LX8A 4MGZR 4F38A 3NKLA 5LP6F 2H4YA 2H2AA 1XHLA 3UOWA 4C9BA 3G5AA 3OUTA 1GAQA 4H7EA 3FVRA 3O73A 3PC3A 2X2EA 4INPA 4MWTA 2Q2NA 1RQXA 1E5DA 4X20A 2OGSA 2NXWA 3QJ5A 1CLUA 4TKVA 3IAUA 3CUWA 4BC0A 3DBLB 3TSOA 3USZA 2AXQA 3LQYA 2V7GA 3GUHA 2WD7B 2JGLA 4CHGA 3ESZA 3NHKA 1SB9A 2Z09A 1J24A 1EAMA 5EWJA 5AJTA 2ABWA 1L8AA 4OFBA 5IBRA 2JLRA 4WKCA 2O19A 1TMOA 2ZUFA 4INAA 2COUA 1G8SA 2WVAA 3CNNA 3WP1B 1E18A 4O4LF 5I9BA 1JQKA 1PJSA 1O6FA 4GHWA 5KX5B 1WKVA 3GRVA 3UK2A 2P9ZA 3EFOA 4Z4FA 1L3BA 2OHJA 1BS1A 3WV5A 4KXWA 2X0JA 2X8JA 3LPDA 4RPIA 3PXUA 3FR7A 1X42A 3UJ6A 2NSDA 3PNQA 3Q2OA 4AMUA 2PPLA 4DC0A 4BX8A 4G0QA 1E64A 1HKHA 5D5HA 5AOVA 3D7NA 3HKBB 4MQBA 3LCRA 3TE6A 4D5GA 5C2JB 1JQBA 1W52X 3U80A 2OHGA 2IIQA 1HDCA 2Y0CA 1B2RA 2M6RA 1VHQA 1M73E 2VSYA 4AS3A 3DH0A 3RU2A 3IAEA 1QHHA 2W2KA 1E9CA 2GPTA 4QULA 3T9CA 4DLPA 5CFMA 3NWJA 3GJSA 2ZE5A 3OP4A 4XJXA 1X6VA 4KIFA 1XCOA 5FO1A 4ND4A 4W9NC 4DA7A 1U7TA 3H9BA 4ADSG 1ZMBA 4RD1A 1U7XA 1AQYA 1EFTA 4JKIA 5FJJA 1SK8A 4QGAA 3B6KA 1V45E 3AR2A 4GBMA 3DW3X 4P0QB 1CVLA 3TNYA 3AINA 4RK5A 5KCMA 1IY2A 2OHFA 4ZARA 2R84A 3HA3A 3I42A 2QPTA 4N8EA 4BKMA 3JD1A 3EEQA 3L8CA 1DIAA 2Z0MA 5COQA 3H04A 5A5DA 2D4HA 5A4JA 5A5GA 3L4BA 1W44A 1KP2A 3FFAA 3G2HA 3BIFA 2DPGA 5LQKA 1E2NA 1RMYA 4KRGA 4IIXA 3HYRA 1I6KA 1L8LA 1LLFA 1FQOA 2P65A 2Z1NA 2OAGA 2J9FA 2YHSA 4P93A 4DBZA 5KZMB 1W93A 1G6OA 5CYOA 1SVLA 3F90A 5FTWA 3A37A 4CT5A 4G1FA 1FYFA 1OGYA 1OAAA 1U9ZA 2PU7A 5DPMA 2EIXA 2B4RO 1LJ8A 3G0DA 3STHA 2UVPB 5DVZA 5DM2A 4XE5A 4DV3B 5SYNA 2YKGA 1SU4A 2O2YA 3AVVA 1A7KA 2FHPA 3E7WA 1Y3BE 2AOUB 3UA4A 2OBNA 5CA1B 4ZZ3A 1VA5A 4YRSA 1RU3A 3CUYA 3DP9A 2Q99A 4RVDA 1S02A 2CL0X 3A1NA 1DU4A 4HK4A 5FWDA 4DCVA 4IDQA 1NMYA 5AVRA 3QFRA 3M1AA 4KR0A 3RFXA 1CQXA 2HLDD 4MP8A 1IN6A 1RRGA 2A86A 3BA1A 3ZE2B 3H8WA 4NJMA 7GPBA 3KOXA 3VZSA 4YCBA 3V32A 3JR3A 2CFOA 1SFRA 1XTTA 1JEEA 1QFZA 2P7HA 2QJRA 3P2IA 2G9UA 3DEIA 3RF6A 4XYEA 5FT9A 3R3UA 4Q02A 4Q7MB 4YCSA 4YV7A 2XDQA 2CLSA 2BGLA 4Q7QA 1U8XX 4DV2B 3GLIA 2ASEA 3R7NA 2OXFA 4ZYUA 4PZUA 3WMEA 4ASUA 4PO1A 2PZLA 2B21A 3G9QA 4QASA 1ZG3A 4FLFA 1Z6TA 3QY0A 2GK7A 1SD1A 1E3JA 1ZUHA 4CF5A 1ODLA 3NTUA 2WB4A 1EGHA 4NL4H 4V1CI 5KNDD 2E6KA 3MW8A 3AR7A 3LRXA 1QFSA 2RHLA 2ZBGA 3R0VA 4UNPA 4A03A 1XQYA 2MCFA 4BEJA 1WMEA 5C51B 4HADA 4LXXA 4R1PA 1FP1D 4AM8A 3BDAA 4MUKA 4B75A 4BNZA 5C8YB 3U6KA 1QQBA 3ELBA 3DLCA 2FQYA 2ZB7A 3PIRA 2JJQA 2ZUEA 4U9UA 4U8GA 4F8YA 3V4FA 5AYVA 4I4TB 3S28A 3ADOA 4A27A 3GLUA 4O4IA 2POQX 4UDXX 1NF3A 2O1EA 1GUZA 4O33A 5CB4A 1VYHA 1K68A 5EXDA 4UUBA 1ST2A 1PP4A 5CH8A 5EIFA 4MROA 3M4YA 2EP5A 3HGQA 3M6VA 4Q4DA 1U0RA 2NUPB 4I9GA 3IEPA 4N6GA 2H8KA 3EZ6A 4RANA 1M6WA 4M2LA 2BFOA 4PYOA 4MGEA 5LYJA 5TF4A 4QGHA 5LQAA 1XNHA 5FTJA 2MWMA 2ZVPX 4P84A 4Y6OA 3PGKA 3C1OA 4ZQHA 1OWLA 3EH2A 5AJWA 4ZAWA 3KJXA 3TVDA 1RHJA 2FR8C 3M3HA 4ND2A 2AFVA 1L6IA 1Z08A 4FFRA 4HP8A 2EFGA 5AHXA 5BSUA 3IKLA 1KDPA 3A9CA 3T1VA 2DFNA 1K27A 4U7WA 3SVZA 3ZX5A 1EYZA 4XAQA 4DQDA 1H0SA 5IAEA 3RJZA 1BROA 3C1UA 3RNOA 1DUVG 2IQ5A 3RVBA 6PFKA 3KJZA 1X86B 3R5SA 1ZN2A 2VPZA 2F8TA 1LXCA 5JTTA 2DPLA 2HGSA 3RG2A 2W2PA 3ANYB 4KU4A 5K8UA 1KEKA 5KSZA 1WCXA 1FMJA 3DYBA 4YJGB 2LIPA 1DTWA 5LZ4A 4CCAA 1HETA 1NBWB 1DQPA 3E5RA 2OO5C 2GK3A 1DLIA 5L3SA 3PEYA 4RIHA 4D8YA 3UHOA 3V2IA 1M6EX 2RMKA 2HQSA 2KS6A 2QN2A 2ZYIA 3K8YA 4EA6A 3C7DB 2H2GA 1AUOA 2ZFUA 3K0HA 3MGBA 4CPDA 4CRWB 1THGA 5LR6A 3OJEA 3PDWA 1XVAA 4MKHA 4CHTA 1U8EA 2YY5A 3IIEA 3OLXA 4E2XA 2IHYA 2F90A 3UMBA 4CT0A 2F43B 3L06A 4K2AA 3R6WA 1YS6A 2XUPA 5AVKA 2MSKA 4OI4A 3ED5A 1PGNA 4EO9A 3H2KA 3P9RA 3Q3VA 4AMGA 2OE2A 3Q8MA 4CKZA 2DWUA 4WD3A 5JSQA 3PCXA 3MTIA 3STWA 5JBNA 5F4BA 2O8VA 4IDGA 1I7SB 2Z98A 2AHOA 1ZSYA 3KVNA 2XT9A 4FCTA 4PW0A 3FMOB 4HQOA 4FGJA 3DAFA 5FOUA 4CQMB 1KVRA 3FBWA 1S7CA 5JAUA 3H8JA 5B6JA 2XOXA 1MIHA 1LDEA 4Q1VA 4UCWA 2OLJA 5GTDA 2HF2A 4IIEA 1GAWA 1ZOOA 1US8B 1VG1A 1ORHA 5EZYF 5JPCA 5BYAA 3WKDA 4QYTA 4RH3A 2YWCA 3FUUA 2DFLA 1OH6A 1RRVA 2JF0A 4CKWB 4Q1FA 1F7VA 1YI8A 2VHJA 3RU3A 1U8UA 1Z18A 1PZNA 1PT5A 3FGPA 4MAFA 1VSBA 3DS8A 4P9NA 3TMKA 4MEJA 1GPDG 3RFTA 2QLLA 4Y9SA 2IDMA 1Z0IA 3LLSA 2R6CA 1RM3A 3H1GA 4FGKA 2FK8A 4ACBA 4HMQA 4FEYA 1CIVA 4FGLA 2DHQA 3OOHA 2OZKA 4FOTA 2ERYA 4D0RA 1M8PA 4QUHA 4WUTA 2HPAA 4ZQBA 2P0YA 1J8VA 2BJVA 1GNVA 1IB6A 2P0EA 5EA2A 3SQNA 4AECA 2VBFA 2IW1A 2JFPA 4GI7A 3ZVLA 1NLFA 1TVEA 3EXIA 4GMGA 4K9PA 4NAUA 2D5AA 1G63A 3OQVA 4BZWA 1W6UA 1HDIA 6CHYA 3DCYA 3OF3A 4BVGA 1JH8A 4EA7A 2WNIA 1GDTA 3ZV3A 2V0CA 2VYND 3CX6A 3Q6IA 4OFWA 3UJHA 4I8DA 4KFRA 4E13A 4ZMSA 5JC8A 2BYTA 3I1FA 4ZU3A 4BO3A 2IHVA 3IA7A 3RTAA 3OQNA 1P4AA 2WIFA 2GEDA 3A2MA 1N4DA 1S9DA 1DJPA 2YWEA 3C3EA 4GWGA 2QMZA 1P2FA 3KQOA 3QKTA 3B1WA 2HLDA 5T3YA 2OHOA 4JT8A 1RQLA 1AKMA 1B1AA 4UTRA 5IC4A 5KJ6A 3CVUA 3F8SA 5KS2A 1H93A 3ZDZB 4TZTA 2H16A 1KI8A 3FR8A 4FC7A 2FNAA 5DP1A 1K8YB 2F43A 3CR8A 2EW1A 3C8MA 3P2OA 4B84A 3ML1A 4D9JA 4Q34A 1SD2A 2EF0A 2IHBA 4PRZA 2BFCA 1SEVA 2IFTA 3DDWA 2N1BA 1SCAA 1PJBA 1Z0FA 2VAVA 4TTTS 1UWVA 3RC9A 5JHHB 2C8KA 2QRJA 3RYTC 5IJWA 3GRFA 2FFBA 3OKFA 1PZGA 2OWEA 3FPEA 1KJZA 2QXUA 4V38A 4TZ0A 4Y9TA 3ECAA 1KYTA 1SULA 4N3AA 2ZR0A 4DMCA 3KCQA 2H1IA 3N70A 5EJ5A 3TW8A 4IS3A 2GM4A 4XSHA 2I2AA 1QC5B 3KFXA 2RH8A 1KPGA 1PL8A 4DSNA 1VL8A 4O2AA 5LP6B 3S29A 2Y1WA 1I80A 3I45A 3TZBA 1VE9A 5IMSA 4ZVVA 1KAMA 2LVBA 3T95A 5JFTA 4JITA 4RHYA 1Q84A 4CG1A 4ZALA 1HYQA 1PO7A 1U63A 1TF2A 3WG9A 5IZCC 3IL2A 2YXEA 2K2QB 5F1OA 3SS7X 2QB5A 5B3JA 4Y1RA 4C2BA 1AOXA 4NBKA 1GCIA 2F8SA 4OJNA 2WKPA 1E94E 1W76A 4JL6A 4QFMA 4QL3A 5C3UA 4YAJA 4OVKA 4Q0MA 2KJQA 4BV8A 3HLKA 3GZJA 3GCGA 3VVCA 4DCNA 4EG4A 1QK3A 3QOWA 2X22A 4LK3A 4GLJA 2G67A 3DOCA 4B40A 3KYCB 5FOWA 3NBKA 3GJ7A 4DN6A 4PAMA 1PFWA 3KZCA 3V46A 2VTDA 3ZHVA 4KTTE 5I47A 5FPPA 2EKBA 2YINC 1RC0A 4JUDX 4MULA 1XTBA 2WM2A 3CNOA 4FCWA 4KX3A 5AKZA 4FYPA 5KKAA 1K63A 2HBZA 2A59A 2ZVDA 3I32A 4ZI3A 5I9NA 1JHPA 1KPHA 5FB3A 3TG2A 4J4TA 3KHSA 5KTYA 4G41A 4Q3DA 1UKZA 1BDJA 1Z7WA 2CFIA 4G56A 5JY6A 1BMFA 4C2AA 2NXJA 9ATCA 4DVJA 3D6NB 2GN1A 2XQGA 4DABA 4F9EA 1NXOA 4R2LA 5HKKD 3KQSA 2UXBB 1Y3AA 2Y67A 3BBPA 3PXEA 2VRCA 1T8UA 4FGZA 2XUHA 4PC1A 1NRJB 4DL9A 3JQBA 2NG1A 2C9ZA 3NUZA 4FE7A 4D9GA 2O8FA 1SVMA 2EC5A 4I1IA 1V4BA 5E7MA 5KU1A 3QWFA 1MW8X 3R24A 1YS2X 3KKKA 4PSCA 2CZQA 5HXAA 5I7OA 2W58A 4EITA 4IDPA 2P9EA 3HA5A 1CEYA 3UW1A 2YYZA 3A6PC 1QVWA 1Q91A 3H2ZA 1Q1EA 1XQWA 1EB8A 4ZTZB 2CLKB 2PZJA 1V95A 1WXIA 2QY6A 3DJFA 2BEKA 4R9RA 4WADA 3SPXA 2FPGA 5HE9A 2A5LA 1QS0A 3ZCRA 3FYHA 3L43A 2OMKA 2PUGA 2WG1A 4CKXA 1JI3A 3K5PA 4C22A 3R7DA 2XOKA 4AF6A 1V16A 4B35A 3B1ZA 1ESNA 4TSFD 1QP7A 3NQ41 2X19A 3B1VA 4IHKA 5IX8A 4WZBE 5BWLA 2DVMA 5FQNA 1UJNA 2WJGA 1B00A 3HRHA 3RPEA 2WTUA 4C0AC 4B7XA 4PF1A 3RREA 2DSNA 3EDYA 3MOSA 4BMSA 5JU6A 3VPFA 4M22A 2R4UA 4F6CA 4KGXA 4G0UA 2DSTA 4EKEA 3R7WB 2O2CA 1T8TA 4CIYA 4JDPA 1WU7A 5EE1A 2P6OA 3FLAA 1RCUA 3IOBA 1PNTA 1L5VA 2LR0A 3EFBA 3ZGLA 2CVOA 2PZKA 2Q4OA 4NHOA 5G0VA 1MO6A 4YONB 4CW7A 4D3XA 2MU1A 4LF7B 2CFCA 4KQJA 4ZGGA 1IN4A 2W4IA 3OQPA 5DYWA 3PSAA 1SXPA 5KTSA 5REQA 3H2JA 2XX3A 5FRDA 1EE9A 1Z13A 4IQ4A 4ZU6X 1UBEA 3ROZA 3PHIA 5DBFA 1C0KA 5E7IA 4ALIA 2ZUVA 5KHLB 1I01A 1W47A 2JLBA 4MQ6A 3CH7A 5LDDC 2DWOA 4QOFA 4WOJA 2JNWA 1I0ZA 2JVIA 1UDRA 2XH8A 1I51A 4JKYA 4EGJA 4ZRMA 3ABRB 1ZNQO 3QYJA 3ICWA 1K5GA 4MW5A 4KP7A 4MB0A 2CVFA 4O02B 4P5DA 3DAOA 4MQMA 4JQZA 4O4JA 4B46A 3DKKA 1KI6A 3L8HA 4DV1B 2B4TO 1OZGA 4LOHA 1NMSA 5AIBA 1VL5A 4TYQA 1QSGA 3MZ0A 1AQIA 3VOTA 2QTMA 4WZ6A 4IFBA 4FHFA 1ISRA 2FPMA 2W6JD 2GKGA 4K9RA 1HUQA 2L19A 2AMLA 4GXNA 4IXTA 5CVJA 1GL7A 1ICEA 3R0IA 1BHQ1 4C78A 1WBDA 2NV0A 3GLVA 4N5HX 1PDWA 2JASA 4G0NA 4MJ7A 4C76A 1R5OA 3RD5A 3P2MA 3OOJA 4ZEOA 3QNMA 2P3QA 3P0IA 4H3SA 2AL7A 3SYKA 1E66A 2C4KA 2CNWD 4NBWA 1G6Q1 1MC5A 4IVNA 3RSHA 4F6RA 2VBGA 5ECGC 3CRVA 2I7CA 1FMLA 3AZQA 1G291 1FF9A 3Q8XB 2R8EA 3RVRA 3WK9A 4LZAA 3DCJA 5LQDA 2I3DA 4R98A 3CINA 4QJBA 1N5MA 5FNVB 4WNIA 1OX6A 5DLPA 5HRCA 3PPIA 5GONA 3AF4A 1HL3A 1UJ4A 5IKOA 3SU8A 1DAEA 4Q4LA 1XTPA 3L2OB 1FFDA 2VUIB 3QUSA 3GXBA 4F4UA 4DLNA 2X0RA 4G2TA 3U5TA 5I8WA 5CLIA 5FWYB 2YWDA 4AJEA 4O6VA 1I2MA 3B8HA 3PEUA 4WCDA 3WTCA 3VR2A 2DBZA 3AG6A 3W2TA 1WR8A 3QLJA 1ADYA 1ZSVA 2RBEA 1P0PA 4GKAA 4DLYA 2GBLA 3DOEA 4NBLA 1NVEA 4BLUA 3FKSA 4NU8X 4Q16A 4XARA 5E4TA 1YZKA 3W1EA 1V39A 5IJ0B 2PH1A 2ZB3A 4OHYA 2BLLA 1TF5A 3KL4A 1CCWA 4JYMA 4L8FA 3WAGA 4F5WA 1EK5A 2H63A 4IRXA 4ZVKA 4AURA 4DZZA 3LECA 4FGUA 3IR6A 1XE3A 2CW5A 3FIJA 3EWSA 2OCAA 3L01A 1YOVA 1JT9A 1A2BA 1SKUA 4BMYA 3ORSA 2WSLA 3I09A 5CYFA 2IXTA 2YJ5A 3DLAA 2BZSA 4L9RA 3Q9SA 3REQA 4MW9A 3T34A 4MI9A 1JAHA 2BELA 2NZWA 4TTQA 3LY8A 1G59A 1Q74A 1ISSA 4OSOA 3VQTA 8GPBA 1EBUA 3TECE 3RRBA 3KXLA 4MQ4A 2REXB 3RUIA 1P1RA 3FY4A 1LBQA 1P2SA 2WIJA 3EA0A 3OH8A 4ZCQA 4ARBA 2HA6A 4C4AA 1YJ5A 3U6BA 5TPZD 4GRIA 3H8SA 3UK0A 3D4LA 2IPXA 2BTOA 2GRAA 3VZRA 1K7FB 2I80A 3HKCB 3OEHD 3ONFA 2WSBA 1MAHA 1E7SA 4ND8A 1NATA 3ZUPA 1KP9A 1T8PA 4P80A 1TT5B 2PAFA 3FW1A 5EXSA 5HZHA 1XROA 2QZSA 3V8VA 3AW9A 3FYDA