5K3BA

Crystal structure of the fluoroacetate dehalogenase rpa1163 - asp110asn/chloroacetate - cocrystallized
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
298
structure length
295
Chain Sequence
b'DLADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRVAPKLAERFKVIVADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLGHVHFALAGHNRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRAYALKIYHWSFLAQPAPLPENLLGGDPDFYVKAKLASWTRAGDLSAFDPRAVEHYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPVPMLALWGASGIAQTPLDVWRKWASDVQGAPIESGHFLPEEAPDQTAEALVRFFSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fluoroacetate dehalogenase
molecule tags Hydrolase
source organism Rhodopseudomonas palustris (strain atcc baa-98 / cga009)
publication title The role of dimer asymmetry and protomer dynamics in enzyme catalysis.
pubmed doi rcsb
total genus 115
structure length 295
sequence length 298
chains with identical sequence B
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5k3bA00
4KRXA 3UUFA 1IZ8A 2VJDA 3R41A 1GKKA 5AK4A 4WDRA 1GQSA 5CXXA 5ALHA 1XRNA 4UPDA 4P92A 5EHNA 2JGEA 3C87A 1IMJA 3C43A 1XLUA 4KRYA 3W04A 1CFJA 4IH9A 1XRQA 2WFMA 3TRDA 1TCAA 3WKDA 4WFIA 3WA6A 3A2LA 3RLIA 3H18A 1CUCA 1ZD5A 5LZ7A 2V98A 5AOAA 2GBCA 4B0PA 3FYUA 2DR0A 4K6HA 4FFWA 1DQYA 1O6FA 5T4BA 3U0VA 4BTVA 2IITA 1XZHA 5JYCA 1CUUA 1C4XA 3HEAA 3WK6A 5IVIA 4UBMA 4RE5A 2VAXA 1IZ7A 3OC0A 5K3FA 2HHAA 2PBLA 4BZZA 4JYPA 4OD0A 3PICA 4N5IX 2WFLA 1XZBA 1UOPA 5DYYA 2XUIA 5AI9A 1AQLA 3H1BA 3G0DA 3WZLA 3ZPXA 4HVTA 2HA5A 1ZI6A 5AI6A 2CZQA 4XVCA 1T2NA 2PSEA 3R3UA 4EB0A 2H7YA 5YASA 2DCMA 1JFRA 2G4LA 3VVLA 1GXSA 1DT5A 3H04A 1JU4A 3PUIA 1EXWA 5AM1A 1E66A 3GUUA 1CUYA 2O2GA 1LNSA 2WIDA 4G8BA 4U2DA 5FP0A 2OCIA 4K2AA 3HABA 2BUCA 1MNAA 3FLEA 2VQ6A 1FFDA 3KWFA 5JARA 3FYUB 3VJMA 5HCUA 1BE0A 3IBTA 3LCRA 1QIHA 4E11A 3ICWA 4KJXA 4H7IA 3F96A 2HA4A 1G42A 4E14A 1LLFA 4DNFA 3TGLA 4B9EA 3AUKA 1CUHA 3KSRA 5JIBA 1CUWA 2BCEA 3D3NA 3ICVA 3KD2A 4BRSA 1QGED 2VA9A 4L72A 3E1GA 3H2HA 4RNCA 1QO7A 3WQHA 3IUJA 1UXOA 1TCCA 5BWBA 5K3BA 1KEZA 2G63A 4DMFA 4RPCA 1AUOA 4CIBA 4BB0A 2WUGA 2WFLB 3WL8A 1JJBA 3C8HA 4AB1A 2RHWA 3A2NA 4CCYA 4GXNA 2HL6A 5AH0A 3BIXA 1O6GA 3QITA 3WKAA 3C6YA 3Q0TA 5AJHA 1XZEA 1HKHA 2O7VA 2QXTA 5ALPA 1AZWA 4GW3A 4KE6A 4G1FA 3WWCA 4CG1A 1ZJ5A 4QDZA 2YYSA 1DT3A 3PDCA 2HA7A 5AM3A 2WU3A 3QPDA 5E4JA 1K5PA 2ZJ6A 2QM0A 6YASA 2CEKA 4C89A 4OYLA 3DQZA 3JYHA 2WLSA 1A8UA 4YASA 4K6GA 2H7CA 1CIJA 3AIMA 3F9CA 5K3AA 1N1MA 5ALXA 3N2ZB 2VT6A 2EDCA 2B61A 5AKXA 4PSUA 4G4JA 2BGRA 3IULA 5K5EA 4FBMA 4INZA 2QMQA 4A5SA 1DWQA 2XMZA 2PVSA 4E46A 3H2IA 4AX4A 1U65A 4AO6A 2QTBA 2ZYIA 3V1NA 5EIEA 3HI4A 4QDOA 3EQ8A 3AJAA 4WJLA 4CI9A 4M0FA 2HFKA 5ESRA 5SYNA 1EB8A 2VAVA 5AI4A 3HC7A 1QIKA 1VE6A 5A7FA 2BGNA 1ZI8A 2WFZA 3WIBA 1EK1A 1R9MA 3WL7A 4XIIA 3O9MA 4KACA 3M83A 2B9VA 1EA5A 2PSFA 2OAEA 3FOBA 1H2YA 1CV2A 1MNQA 2WJ6A 1IUPA 2XQFA 3I6MA 1QFSA 3DS8A 3S8YA 4UBNA 1VE7A 1QFMA 4ROTA 4U2FA 5AKZA 2ZSIA 4UHHA 2OGZA 4J0CA 2WUDA 2YXPX 4J0KA 1AURA 5BOVA 2WHRA 4WY5A 3OG9A 2Z3WA 2RIPA 4X85A 4KE9A 2I78A 5JD5A 3R40A 4ZWNA 2XMQA 2DHDA 3QM1A 5IKXA 1OILA 5AIAA 4J0IA 2XE4A 3O4IA 4FMPA 1I6WA 2JGIA 3H19A 4BRZA 4XJVA 4B7ZA 2C7BA 4X95A 1ORWA 3F97A 3QBJA 2VJAA 4QWMA 4LXHA 4H7JA 1XRMA 4BVKA 1BN7A 5HKAA 2WJ3A 2OPHA 3W05A 4BVLA 3FYTA 1EVEA 3BDIA 1R4ZA 5EFZA 1UWCA 2QVBA 2XDWA 2R11A 2WM2A 3D5EA 1E8DA 3G8YA 1W1IA 4QZVA 3Q8WA 5SYMA 3WZMA 3HSSA 3SC2A 2J4CA 2Z8XA 4AO7A 4H0CA 4Q3LA 1T4MA 4F0JA 3EQ9A 5T4EA 3I2JA 1QIIA 2XUPA 3QMMA 1GT6A 4DM7A 1A8QA 4FFVA 4G4IA 1XKTA 3EBLA 4I19A 1GZ7A 2QJWA 1BRTA 3FVRA 3FBWA 5HF6A 5CH5A 3STWA 5AICA 3W9BA 2C58A 4GEGA 4LXGA 5CH3A 3GBSA 5AK3A 2JEYA 2JEZA 2WKWA 4FLEA 1ODCA 1IVYA 1LPOA 2QXUA 1JJFA 5CT8A 4PSDA 1L7RA 1ZIXA 1VKHA 3GFFA 3I1IA 2XQJA 5AM4A 4B81A 2ROQA 4I4CA 5AOBA 4JH0A 5IH7A 2JGJA 5DNUA 2BUBA 4MJ3A 2D0DA 3OPMA 4ZRDA 4HXFB 1UKBA 4LYEA 3W06A 4BYMA 3E4DA 1KU0A 4WDQA 1VXRA 1QJ4A 5K3FB 3GROA 4WFKA 1TKRA 1YCDA 1MO2A 1BCRA 3MUOA 1YS2X 5CTAA 3PF9A 1ZIYA 2QKYA 2XQKA 2WIJA 1Y7HA 1R3DA 4Y2YA 3EQ7A 3HRHA 2WIKA 1QIDA 5JAHA 3W2TA 3OM8A 1ZOIA 1CUDA 4LKOA 4S0XA 4ZI5A 5AM5A 4DNPA 4GBGA 1D07A 5A2GA 4B85A 4XWGA 3CXUA 5K3EA 5DYTA 1WB5A 3V1MA 4Q05A 5FPPA 2C5FA 2WJ4A 5AKJA 2WHPB 4EY8A 4DLNA 5DNWA 2VATA 4Q3KA 5EIAA 1HQDA 1ISPA 2WIGA 3G0GA 2XMGA 4HRXA 3A2MA 1W76A 2OG1A 2W22A 3M82A 4NZZA 3DLTA 3D0KA 1QTRA 3STYA 1XZDA 1QIJA 2OCGA 4GDMA 4KAFA 2JGLA 4KR0A 1WPRA 1CUGA 2ONCA 1LZLA 4BCDA 1QIGA 1TCBA 1GQRA 3FYUC 5EHZA 4Y2QA 3STVA 3OOSA 1YA4A 1C7JA 1MAAA 2HRQA 3VJLA 4DIUA 3R3XA 1LGYA 4H18A 3WK8A 5AKYA 4NMWA 3C6BA 4RE6A 4NS4A 1E8MA 4UHBA 4WY8A 5A7GA 4A23A 3D2BA 2FJPA 5A62A 5ALLA 4EA6A 4Q3OA 2WQZA 1MX5A 1CUEA 3ESDA 1J2EA 2ES4A 4DGQA 1CR6A 2XMCA 4HRYA 3BF7A 2GBGA 4AZ0A 2VEOA 5FLKA 3DDUA 4QLAA 5I7UA 4X6UA 4X94A 4B0OA 5AI8A 2HU7A 5F4ZA 4C87A 5E2IA 4UFPA 1FFEA 3NOXA 1CUVA 4DSAA 2Y1KA 1Z68A 4H7DA 2AJDA 2LIPA 3B5EA 1TRHA 4QWWA 4MWTA 4NVRA 5HZGA 1YAJA 2PPLA 1U4NA 1USWA 4F21A 2HRRA 1TAHA 1CQZA 5ALVA 2PUHA 1THGA 1DINA 1W52X 5ALKA 3IDAA 5C8ZA 3WK7A 5EGNA 5ALZA 3VKFA 4F60A 4D9JA 3CCCA 5HQ3B 3WMRA 4J7AA 3G0CA 2HADA 4CG2A 1CUFA 1XFDA 3ED1A 4QDXA 4H77A 1OCEA 2WHPA 2Z3ZA 3STUA 3RARA 3WWEA 3DNMA 3YASA 4UHEA 5D6OA 3DL7A 3FCYA 1U2EA 1XQVA 4L0CA 3SX4A 4Y2VA 3LLCA 1NU8A 1JMKC 4FNGA 3H17A 3O4HA 3ESAA 4RGYA 3WK4A 5CXUA 3F98A 2IX9A 5D3ZA 2X5XA 1EVQA 3B3QA 4ZV9A 4IH1A 1XZKA 4BAUA 1VZ2A 4FLFA 5DWDA 3OURA 3NGMA 3H0CA 1RYYA 4ZV7A 2XT0A 4OU4A 1S8OA 4C01A 5ALFA 4BAZA 3K6KA 4YK7A 5AKKA 2BAGA 5IVKA 3OTQA 1ACJA 3IUNA 4FDMA 1FFCA 1ZD4A 4MQLA 4QE3A 4W1PA 1OXMA 4EUSA 4ITVA 4BE4A 5AO9A 4FNMA 3WIOA 1LPPA 3ESBA 4OPMA 1ETHA 1XROA 2VTVA 2ACEA 1EINA 5CT6A 3DYVA 2P8SA 1A88A 1F6WA 4BCBA 4C4XA 4J0HA 4QDTA 1MJ5A 2XUHA 4AN0A 4EY6A 3VXKA 5C8VA 1WPXA 3CN7A 1QONA 5E4YA 5FOQA 5ALQA 3AZOA 3PFBA 4AMYA 4UUQA 4PQEA 5CT4A 5LZ8A 2PSDA 4JEIA 1HBJA 5A6VA 4B84A 4B6GA 5AIBA 4U2BA 5AOCA 5CBKA 4ETWA 1EDDA 2D5LA 2BFNA 1TQHA 1XRPA 1XQWA 2OAGA 3RM3A 4X6YA 1MU0A 3BL8A 5JADA 3WKBA 5DTJA 4BDSA 3C5WP 2RAUA 3V1LA 3DKRA 3I28A 1UOOA 2JBWA 3M81A 2I3ZA 5CURA 2HU5A 1FFAA 4WFJA 1TK3A 3ILSA 1XQXA 4FTWA 5LZ4A 2H9YA 4AO8A 5H3HA 1FJ2A 1LPAB 1N5RA 1JT2A 1G4HA 2QUAA 1J06A 2OGSA 3BJMA 5JZBA 5EHXA 3HZOA 2JIDA 3ANSA 1XZCA 1XZAA 5JD6A 3WWPA 4Y2RA 4IHAA 1E5TA 3IURA 3X3HA 3ANTA 5ALEA 2XUKA 3JWEA 1CUBA 1FFBA 1XRRA 1ZJ4A 4QNNA 4H7HA 4PSCA 4KYVA 1P0MA 1HL7A 4OYYA 1VOTA 3WKCA 4Y9SA 1X70A 2GBIA 4BC0A 1N5MA 3C8DA 4H35A 5EHQA 2Y6UA 4WCVA 1WCYA 3V1KA 2O2HA 1EB9A 3BE8A 3IVMA 5LLSA 2HM7A 2V97A 1AMNA 2GZRA 2BKLA 4KAAA 3QPCA 3FLBA 5KREA 2G5TA 3D2CA 5CRIA 1K6EA 1R50A 3WYDA 2XI4A 1MN6A 3G02A 1AC5A 2W6CX 2WU4A 5JALA 3NWOA 1LPNA 3D59A 2PKYX 5AKLA 5ALUA 5LIPA 1CUJA 1F0NA 1W75A 2DHCA 5FDFA 1EI9A 5BWCA 3IUQA 1BEZA 3LIIA 1MX1A 3PF8A 2V96A 4CCYB 2JF0A 4QA9A 1QO9A 4KE8A 4M0EA 2HFJA 4GWLA 5AK6A 2IIVA 4J0GA 2HA3A 2BJHA 4Q1VA 2PM8A 2AXEA 4X00A 4X92A 3ZLUA 3I1YA 3ZV7A 2HA0A 1QIMA 1CRLA 1NU6A 1R88A 1CUXA 1P0PA 1ZICA 4X6XA 3IUMA 1WB4A 4IQ4A 1X2EA 5AI0A 5LP1A 2ZJFA 4LHEA 2RGUA 5HKBA 2PSJA 3WI7A 1ODSA 3FCXA 4I3FA 3O0DA 5HQ3A 3K2IA 1CVLA 1H2ZA 1MAHA 1KU6A 1LBSA 1GKLA 4AZ3A 3DL4A 5JZ9A 5CH8A 2PUJA 1YA8A 1ACLA 1EDBA 1NX9A 3N0TA 2J3DA 5DNVA 1EH5A 5JATA 4KEAA 1UK6A 4Z49A 3WK9A 3I6YA 3SWWA 4MYSA 4C4ZA 3WA7A 1VXOA 3S2ZA 3O4JA 2CMFA 2UZ0A 3D7RA 2X76A 1BEEA 1AX9A 2B20A 3K9BA 2ZYSA 4P9NA 4X3CA 2WTMA 2C0QA 4MWSA 2FUKA 3T4UA 2DQYA 4JNCA 4Y2PA 1JMYA 4J0JA 2V9ZA 1DWOA 2G5PA 1LZKA 4EZIA 3R0VA 4Y2XA 2ZSHA 3CCBA 3STTA 2OGTA 3BIWA 1CQWA 1MT3A 1XZIA 3MVEA 5I9IA 5LKAA 4FBLA 3DYIA 1SC9A 2Y2VA 4ZXFA 3KWJA 2ZVDA 4YPVA 1CUIA 3AILA 4BBZA 4TGLA 2ZJ7A 3ZLVA 3ESCA 4BE9A 3P2MA 1MPXA 1YR2A 3C70A 3G0IA 5ALWA 2XQGA 4OB8A 4K5QA 1G5FA 3IA2A 1EHYA 1E89A 3QMVA 4MXDA 5KWIA 4BTLA 4N5HX 1JJIA 2VJCA 2DFPA 5JD4A 3TJMA 4BZWA 3HXKA 3KOOA 3FWHA 3DJYA 1F8UA 1H2WA 5FXMA 4HXGA 3WYNA 5FPQA 2WUEA 4AQDA 4UBJA 4W1QA 1IUOA 2XUGA 4UFNA 5EIHA 1G66A 4DNOA 2WUFA 4UHDA 4B80A 3SK0A 1UK8A 3T52A 2NW6A 2QOEA 3STXA 5HK8A 1B6GA 1GPKA 2WG2A 3HACA 5JASA 2ZYHA 5ALSA 5CW2A 4ARBA 2PX6A 4Q34A 4JUIA 1DTEA 5AKEA 4DMKA 3FAKA 3AIKA 3U1TA 2XUJA 5ALJA 5FRDA 1VLQA 4Q82A 5DJ5A 4HS9A 3UMJA 1UK9A 5AKIA 4W1RA 4MYDA 1VJ5A 4DYHA 3BXPA 5A7HA 2PU7A 5AM2A 3WL5A 5DTIA 2XMRA 3WWDA 5IVHA 4EHBA 3G9UA 2XQIA 1A8SA 2CUTA 1UKCA 3I2KA 4XX1A 1DU4A 4BC1A 1PV1A 2R8BA 2EDAA 3C45A 2HA6A 1DX4A 1H22A 1J07A 1YASA 3R3WA 3HJUA 5EI5A 4KE7A 3AINA 3R3YA 1Q0ZA 1P0IA 2EEPA 2QR5A 5A71A 2VJBA 4MEAA 4N8DA 1SFRA 4BP9A 7YASA 3B12A 2PU5A 1EDEA 4LYDA 5ALYA 4PF1A 2VT7A 3I2IA 1QIEA 5CT9A 4DMHA 3A6ZA 2JGFA 3VVMA 3E0XA 2FJ0A 4W63A 4LXIA 4Y7DA 5AK5A 4U2GA 2J3QA 5CMLA 3WWOA 4H7EA 5E4TA 3WJ1A 2XUOA 4GHWA 2OCKA 5LZ5A 5T4HA 2AJCA 3C5VA 4Y2SA 4M0MA 2Y6VA 3F8SA 2ACKA 5LZ9A 2WSLA 4G8CA 4PNZA 2PL5A 5FV4A 1QOZA 3PE6A 4B82A 5BV7A 1DX6A 5ISMA 2XUQA 1PFQA 4A16A 3QVMA 5D7BA 1XRLA 2DHEA 2QS9A 1PJAA 4QEKA 3RKSA 2GYWA 2HA2A 4OUKX 1J1IA 4UFOA 1BS9A 4AN1A 1YAHA 1GGVA 1BCSA 4FHZA 1LPMA 3L1IA 4EY4A 3BWXA 1ZI9A 4CG3A 3V48A 5AKGA 3EF3A 4Y2JA 1GPLA 4UBKA 4BP8A 4UBIA 4B9AA 4BVJA 1TIBA 2C4HA 2XUFA 3AIOA 3I2FA 3PFCA 2HU8A 3WK5A 2GBFA 2CB9A 2E3JA 1MX9A 3O9VA 4UBLA 4BDTA 5AM0A 1XKLA 3E3AA 5C81A 4GECA 4J03A 3TEJA 1MTZA 1YB6A 3FVTA 1W6RA 2XB6A 3GA7A 2X8BA 1XZFA 5HK9A 1VZ3A 1EK2A 3AZQA 5AP9A 5HFNA 2ORYA 1AGYA 2B4KA 3D2AA 2GZSA 4X71A 2QT9A 1QIFA 1JI3A 1BROA 1JKMA 3R3ZA 1XLVA 4DSZA 2OXEA 3GELA 3HYSA 1SCIA 2Z8ZA 1ODTC 3WL6A 4O08A 5DYWA 1SCKA 5FKJA 4TVKA 2FX5A 2OQIA 1M33A 2QZPA 1UK7A 4E15A 2XLBA 1N8SA 3G7NA 3M3DA 3VISA 5C8XA 3V9AA 1IUNA 3AFIA 1Q84A 1HDEA 1XQYA 1AKNA 5JAOA 5C7YA 2XUAA 4U2CA 1U8EA 1C7IA 5CT5A 1UFOA 3F67A 4G4GA 1UT6A 5LZ2A 3I2HA 2WILA 3DEAA 5ALNA 4YX9A 3KXPA 1RP1A 2AJ8A 1CUSA 2XUDA 3A70A 4F5ZA 2AJBA 4FLMA 1ZD3A 4OCZA 2QUBA 2YASA 3FNBA 4P93A 3FLAA 3RK4A 1ZGBA 2BUAA 1QTIA 4MQMA 1HLGA 3G0BA 3UUEA 4C4YA 3WJ2A 5HF5A 2WG1A 3PUHA 2O7RA 4UBOA 1K8QA 3C6ZA 3L1HA 3WLAA 3G9XA 1RWQA 2HDWA 1BN6A 3WKEA 1Y37A 4BAGA 5KWJA 5HFAA 4G9EA 2YH2A 2RONA 1FSSA 1QLWA 2OQVA 3LS2A 1ZD2P 3H2KA 4PO3X 5ALIA 3MUNA 2XMDA 4H7FA 4DTCA 5I8PA 3IIIA 1UZAA 2CBGA 5D3KA 1JU3A 2XMBA 4KAJA 1XLWA 2DSNA 5ALOA 4B83A 4U2EA 4MEBA 1BU8A 2WG0A 1XZLA 3EIOA 2WHQA 4HAIA 2Z5GA 1EX9A 3GZJA 4OB7A 1CUAA 4Y2UA 1CEXA 3DD5A 2PSHA 3DKKA 3QZUA 4IH4A 5K3CA 2JGMA 5ALRA 1H2XA 1B41A 1LPSA 4G9GA 1DQZA 5AHXA 2O2IA 3PI6A 1L7AA 3O4GA 4Y2TA 2VF2A 2WIFA 4C88A 3VDXA 5FUMA 3L1JA 2RHTA 2OLEA 1W4LA 5IVDA 4AXBA 2QRUA 5ALDA 1WM1A 1K4YA 4QLOA 2C5GA 4C6HA 2Y2UA 4N8SA 4PV7A 4TPKA 5JANA 1UKAA 3HLKA 3BDVA 3G9ZA 3O95A 4L3WA 5AI5A 3ZWQA 4HTAA 5LKRA 4P08A 1R1DA 4JYMA 4CCWA 1X2BA 4G5XA 1QE3A 1LPBB 2CJPA 2DQZA 1P0QA 4CIAA 4BATA 4OU5A 4BCCA 4EY7A 3JW8A 1ORVA 3AZPA 5DLPA 2AJLI 5T4FA 2WTNA 3DOIA 2GYUA 3R3VA 4L9AA 4GLBA 2K2QB 1CUZA 1THTA 1H23A 3MGAA 3I2GA 4PW0A 4QDUA 3NUZA 4H7KA 1ZGCA 4HXEB 2XMSA 5ALMA 3ZLTA 2QJRA 4K6KA 3G9TA 2CKMA 4DMCA 1QZ3A 4J0DA 5J3JA 4AMZA 4IO0A 4J3JA 1CPYA 3QH4A 4W9RA 1E3QA 2VSQA 2C0PA 5LYYA 2I3DA 1GPNA 4X97A 1VA4A 2I03A 3DCNA 4DNQA 4X93A 4HZGA 4V2IA 3VJKA 4ARAA 1CLEA 3QPAA 3H2JA 4UHFA 4G8DA 5HF9A 3BF8A 2J4FA 3I6ZA 2ECFA 5ALGA 4FOLA 4ZREA 1SCQA 2OCLA 4LIPD 3H1AA 4UHCA 2HIHA 3ZI7A 1Q83A 2XLCA 1R9NA 4X7BA 3W9UA 5K3DA 3LP5A 1WHSA 4FWBA 1WB6A 1DWPA 3CN9A 1HPLA 3FSGA 2Q0XA 1L7QA 1F0PA 1Y7IA 1E8NA 1XZJA 1XZGA 1YS1X 4GI1A 3C6XA 3H2GA 4EBBA 1VA5A 5KBYA 4W1SA 5JZSA 3LIPA 4EY5A 3IB3A 2GYVA 4X90A 2RI6A 1XZMA 4FKBA 5JAPA 1A7UA 4ZGBA 1SOMA 4N8EA 1UOQA 5HF8A 2H7XA 2H1IA 1WOMA 5AKHA 2JGKA 2ZYRA 3D4LA 4OSEA 3KDAA 3FSGD 1K63A 1WHTA 5ALTA 1LBTA 1Q0RA 5JAUA 4X91A 3BJRA 3QMWA 3DOHA 4OB6A 1YSCA 4CFSA 1YB7A 3QYJA
chains in the Genus database with same CATH superfamily
2A35A 3PYMA 3ZBPA 4NOKA 4KRFA 2HW8A 1TKCA 1G3IA 3VHRA 1KEEB 1SBZA 4Q9NA 1GKKA 4E5SA 4WDRA 3EIHA 4NULA 5EIXA 1QO0A 3KFVA 5CXXA 4M1YA 3LF2A 3ECSA 3NZEA 4AX8A 3O7MA 1I1HA 1FRZA 1ULAA 3L8YA 4FK8A 4IFBA 3LO8A 4IV5A 4NNOA 4PZUA 5EJMA 5EHNA 2JGEA 3K1AB 2GDJA 2VLBA 4FZ5A 4J1SA 3FN4A 3C43A 2Z1DA 2QMZA 3FCOA 2PRZA 1CFJA 2VLIA 4IH9A 2QN3A 1YIAA 5I7OA 4RKFA 2FXIA 3WKDA 1N7JA 1WQ4A 2MIIA 1B2LA 4WFIA 4O4IB 3MMPA 3W5UA 3WA6A 1FLDA 1N0HA 1AGNA 3HO8A 1WY7A 3BG5A 4AQ7A 1CUCA 4MV1A 1KK2A 3MFQA 9LDBA 1ZD5A 4CVNA 2W6ID 4P5EA 4D44A 4DM3A 2I9KA 2YW2A 2OYSA 3Q6IA 5BR4A 4P4SB 1F2TB 1JIVA 3HCFA 4YRQA 4UTZA 5HJEA 4L1KA 3U1BA 4DLBA 4O1HA 1KDYA 2F2TA 1SVIA 2KLHA 3CRMA 4FFWA 1E2HA 1DQYA 4OH1A 4PC2A 2ZBRA 5AJXA 3ZWXA 5T4BA 4BKQA 1PU2A 3JRXA 4BQSA 2AQHA 4CCSA 5F7XA 3M5DA 1V7ZA 2A59A 2B6NA 4MI3A 3LP6A 2PXAA 3VPHA 4CMHA 1NQXA 5A4DA 4XA8A 3AKYA 3GRVA 1FU4A 4RE5A 2JAPA 3GP8A 2V5VA 1R10A 1IZ7A 1XMXA 2XRMA 1MR3F 2BE9A 3QGMA 3RGGA 4DUGA 2PZBA 1TDJA 2BJWA 1A5SB 4RPHA 2BP7B 4ARZB 1N5JA 3QOYA 5HW0A 2CXOA 4IIXA 5H5JA 1PZGA 4F2HA 3E1SA 1HZZC 3PICA 3W6ZA 4RKQA 2WFLA 2Q6VA 4KQIA 4RLFA 4ZI7B 2XOKD 3OP1A 4EG4A 1HT2E 2XUIA 4PAGA 1SKBA 2R86A 3CURA 5LC1A 1SAYA 3VPAA 3I09A 4QBFA 4HVTA 2CJWB 5F98A 4RXMA 3AUYA 5KAPA 2PRSA 1Q6ZA 3MTAA 1YDFA 2A88A 3AERA 5JDCC 3WBKA 1QGAA 2BTQA 4X24A 4XDZA 1BH6A 1HT3A 1X7HA 3P0HA 2FH5B 4XTCS 2PSEA 2VYCA 1RKQA 4R1NA 4TKUB 3RTGA 1GAXA 3COJA 3F2IA 1CLUA 5YASA 1NNI1 1JFRA 1QVRA 2EP7A 1KSJA 3HDVA 1NUAA 4LX8A 1U6IA 2AFHB 2NPIA 3EASA 2I4NA 3TQFA 3ZNNA 1RMTA 1SCNE 1AUVA 3CGGA 1ZM4A 1GXSA 1KMHB 3DM9B 3H0KA 4BQFA 4IRMA 2RCNA 5CNJA 3TTXA 2YINC 4RTSA 1IWPB 4J1TA 4O4LA 1JU4A 2A3RA 3PUIA 4XD7A 2YR0A 3C74A 1EUZA 1E66A 1RCUA 4J07A 1KPIA 1PR0A 2BFFA 1IM8A 2DSTA 2C98A 2FCAA 2OESA 2QV7A 3BMOB 3GUUA 3I5AA 3LY7A 1CUYA 1SCBA 4PYQA 1F4PA 2QWXA 3CH5A 3WY9A 3GJZA 4AI6A 3F46A 5FP0A 2OCIA 4K2AA 5K2MA 4B7AA 4KFUA 2Q3CA 3NHAA 5IBCA 1G8KA 2W2NA 3BRQA 4UD2A 2NO7A 1TZJA 2OBBA 2YYAA 5IASA 2BMEA 5AUQA 3AB3A 5ECGC 4XCQA 1YOVB 3IUPA 4MLZA 2X9QA 3LBAA 4CEIA 4ICIA 3A06A 4UOEA 5F51A 2XCTB 3NJRA 2P79A 4JVMA 1UXHA 1ZM2A 2HF2A 4TKLA 4B3BA 1L0BA 4DKXA 4GKKB 1JPNA 2X4GA 1WS6A 2ZE7A 3AM3A 3IBTA 2VRWA 3DZJA 3LCRA 3NTOA 4JGGA 4LHYA 5F1KA 2EERA 5DGHA 2FPOA 4P8RA 4RJKA 4KBGA 3UHFA 3CMMA 3O4VA 3KSDO 1FFSA 4H7IA 3F96A 3KELA 3ORFA 3DNPA 1O7JA 1E96A 3D6VA 5IM4F 1SVWA 3ZVKA 2PLNA 3DPUA 2ATXA 1CUHA 3ZDRA 3G5MA 1D04A 3KSRA 4BMVA 4JLWA 1GNQA 1NSFA 1CUWA 3QVKA 3N2GA 3N1UA 3HHEA 3HE3A 2XYVA 3DLIA 2H5JA 2ZTMA 5B7PA 1J4AA 2GZ3A 4P53A 3VO9A 1QGED 3OCZA 1J0XO 1ZKDA 4C21A 3WLSA 2JEOA 1FOEB 2J3EA 2QI9C 4CKWB 4R54A 1GLGA 1GKUB 2V3VA 3E1GA 3OFKA 2QJOA 1XVTA 3EZ6A 4NQZA 4RNCA 1QO7A 2QRGA 1VPTA 1TEXA 1EWQA 3OMLA 1CEYA 1P6QA 3F6CA 3HADA 1UXOA 3CZQA 4DCNA 3LQFA 4FUQA 1NYTA 4FC6A 3C2QA 3KVRA 2RK6A 1TCCA 4O4HF 4RY8A 4Y6PA 1E6WA 5BWBA 5C4MA 4DBZA 3CG0A 3UMSA 4LF7B 5GP1A 4MV5A 2ZITA 1XQ9A 1OE0A 4O4HB 2UKDA 3UM9A 1N9KA 2IPOA 3JSAA 3G49A 2QP3A 4DMFA 2ZXUA 4WOKA 5AHWA 5FB3A 2RHRA 4RPCA 1RQPA 3F90A 1Y9AA 3H75A 3QFSA 4ARZA 4AROA 1TO1E 2QTMA 1X39A 3IRUA 3IHTA 2GJSA 3P0RA 4BUJA 5AUOB 1LWOA 2A4KA 3NAQA 4JLJA 2F3UA 1CS0B 3NP9A 1DPGA 1EGMB 1M1ZA 4OO3A 4UE2A 3WGGA 5KKCA 1TUIA 4B2YA 4J29A 4MS1A 2WOJA 3U7QA 1TUBA 4Q12A 3HDTA 5SY9A 4B6SA 3I3OA 3UMRA 1E3TA 4FFSA 4OGLA 1JEDA 1KP3A 3DKPA 2IU3A 3QFCA 3BE5A 1IBCA 3PZBA 4EYOA 2HL6A 1K7FB 5AH0A 5HFJA 2GN2A 1DADA 5AVZA 5IDXA 2L82A 3BIXA 5D84A 5CPBA 3QITA 1J56A 4H1UA 3WKAA 2E89A 5AJHA 2OHOA 3RUEA 1I4TD 4M1TA 3VNVA 3W3ZB 3LDHA 5G1NA 4HFRA 2QMUA 2O7VA 1J9GA 2PWZA 2BR4A 1U7TA 4XM1A 3O83A 4ND6A 3EQ6A 5ALPA 4KK4A 3UK2A 4CFYA 4DVGA 5IYZA 1Q19A 3PNVA 1GU7A 4CG1A 4LJSA 4EEZA 5JMPA 5FOUA 1AQUA 1CYEA 3I5MA 4QDZA 3A2KA 4KXUA 3C8UA 3EK2A 5GZ1A 3VC1A 1OB5A 1QP0A 5I4KA 1NRXA 2BMVA 1T4CA 4MEJA 4QOHA 2ZUBA 4N12A 2PPVA 2Q6TA 4NBWA 1Q3TA 3ROKA 2BEWB 2W43A 2OXIA 2WU3A 1T9CA 3HH8A 3QPDA 2GF9A 2ZP1A 3UAYA 2Z5LA 5CD1A 1O6CA 1AU9A 1UM8A 3GEEA 1ZRSA 2QSZA 3T1OA 2OR3A 2HJHA 3N59A 1FTWA 4DADA 2F1RA 2FTKE 2F4NA 2Y1FA 4CHGA 5JQGA 1IDOA 1FJHA 3M89A 2I71A 3VVBA 2WLSA 2GAIA 4H9GA 4DRXB 1NYQA 3EWSA 2B5WA 4MW1A 4YRJA 3KSZO 3F4LA 3PNMA 3QVVA 1XEXB 4O59O 1Q1ZA 3SYNA 1OGIA 1KAQA 2EKZA 2MINB 4LJ7A 1Q50A 3IQHX 2EP8A 1J24A 4DC1A 2LD4A 3EPPA 2QU8A 1T1SA 2FWAA 3U3ZA 3TPFA 1U2PA 2ERCA 4HH4A 3T3NA 4JJKA 3G0HA 4EHJA 1GA6A 3ICEA 2CVPA 4OQEA 4YDRA 1JI0A 3RRFA 1PBTA 2H8KA 5FT9A 1FTYA 1OXUA 1GR0A 2B61A 3VU8A 4NBSA 4BNYA 4HN4B 4DCSA 1E2BA 4JXJA 5DXJA 2HPHA 1EBBA 4G4JA 4PAQA 3E9RA 4GC5A 4FGSA 1NSYA 1IQ0A 4RHUA 4ZQGA 3WO1A 3CF4A 1J8FA 1P7VA 3AHFA 3LBHA 3MCVA 5DN9A 4A2WA 4D42A 2V6BA 2VEDA 3C7AA 4IJ6A 3EMVA 5L51A 4DJFC 5HJ7A 4TTJA 2OC4A 4E1VA 4A5SA 4YV2A 2ZW9A 5TMBA 4OQYA 4DMUB 4L08A 2GVNA 4YO7A 4MIEA 4RK6A 4KXFB 3LUAA 3ZV6A 4LZPA 2R97A 1UMCA 4N3AA 2FPMA 3AEQB 1XEAA 1L7XA 4B74A 2QN2A 4M87A 2O0HA 3MJFA 4M4SA 4HUQB 1Z38A 1IHPA 5GONA 1RI1A 2GEVA 3U5ZB 1HT1E 3A1TA 4CEHA 4LKRA 2ZYIA 4J7XA 3U6KA 3ESQA 2ZU0C 3S7TA 2ZWAA 5DKFA 5KTPA 2RAFA 3Q9LA 3WGNA 5AVRA 3W5DA 4FC7A 2XNKA 3D2LA 2YHIB 1C3EA 3V4SA 5CVDA 1A5BB 3ZDXB 4M0FA 3PJRA 1PS0A 2HFKA 1YBAA 2W8BA 3DBHA 2I7CA 1EB8A 5GTDA 2R2AA 3IEPA 4PS1A 1WP4A 3Q2OA 5A7FA 1L4MA 2JPDA 2PBZA 2WFZA 1E3LA 3WIBA 4F91B 2AJTA 2Z6VA 4R1OA 1CP2A 3U80A 5FH9A 3NHBA 2GN4A 3CZMA 4DZTA 4B8ZA 3EVDA 2B9VA 4KXWA 4HWSA 3MLAA 3GLQA 1H2YA 1CV2A 1G5QA 1MNQA 1SQ0A 2D7JA 1CY7A 3L7IA 4KFSA 3IVCA 4RVNA 3SVZA 1IHXA 4V1CA 4W5NA 1NVMB 2QW1A 4Q7KA 2IOFK 3NO4A 1O94A 3E5NA 4CPDA 1XPUA 2WF7A 3EJ6A 2QM8A 1FDVA 3ROTA 2C5SA 3UAZA 3MQ2A 1NNUA 4WBSA 1FXSA 3L0SA 1BXRA 2B0JA 1ICIA 2QLJA 1VCNA 2X4IA 2XGSA 1J0CA 1S3FA 2Q4DA 3GU3A 3PP8A 4L07A 2FQYA 4ND7A 4OHYA 2LKDA 1U0OC 3E3LA 3O3MB 4LGYA 1E0DA 2OGZA 2ZRLA 2C2ZA 4IOJA 4UUBA 5LXTB 2DBRA 3HFGA 2KPOA 4QJBA 1WXIA 1M73E 1KI6A 3WNCA 5IAGA 4DRYA 4UCWA 4HQKA 4ZHQF 5EWJB 2GNOA 4EKYA 1FSGA 2A84A 4EKDA 2Z3WA 5KO2A 2RIPA 1C5KA 4KE9A 2FEPA 2Y0DA 4EL0A 1U2GA 1Q21A 1U6JA 4ZWNA 3ROEA 1VSVA 1HFWA 3EUAA 4Y7CA 1U7OA 3OU7A 1GA4A 4HDRB 4KP7A 1KFEB 1RWVA 3RU3A 2P4SA 2C2HA 3QM1A 4BVGA 1FJGB 1JKIA 3PV0A 4QASA 1YS7A 1VIVA 2PX2A 1UAYA 2R00A 1U7UA 2C2XA 2HCBA 2IHVA 2PSSA 3PRKE 4DGSA 4EFMA 4QQRA 5JWHA 3QKUA 3WBBA 3LC1O 5IANA 1GT91 3KSBC 1FYWA 3K5IA 4YJHB 2R62A 3VYVA 4DMMA 2UVPA 1A72A 3I9JA 3ADCA 1VHLA 5I7RA 3EZFA 2AN3A 1OT3A 1MUUA 2HK6A 3ADKA 5CB6A 1KTIA 1YBMA 2A78A 1HG1A 3UXYA 4BRZA 4B7ZA 5EP1A 5EE1A 4E2FA 4K6CA 1UBGA 5JCPA 1ORWA 3FIJA 5KNBA 2H9AA 1ZGAA 4ZKDA 1WVGA 3QBJA 5FA6A 2YOFA 1ZK2A 5BW8A 2VZLA 4GICA 4QWMA 1E1QD 2WHYA 1IOVA 2C77A 3BWEA 3C3CA 4LXHA 3ID6C 3I04A 4KLZA 3VGPA 3U56A 4NJMB 1XMSA 1Y6RA 2C4VA 2NAPA 4HZIA 4IOMA 1Z33A 3V7WA 2WJ3A 4R2KA 2AS0A 3LHSA 3TKLA 2OPHA 4DCGA 5KTOA 1QYDA 1YK1A 2F1JA 1HT0A 1TU0A 4J1NA 2OBXA 1AKEA 3K0EA 1JHXA 4YJFB 5JS2A 1PJCA 3DCIA 1EFCA 3OE5A 4H15A 2YJ6A 4W99A 5EFZA 1FL9A 1KP2A 4TKVA 1MB2A 1AIPA 4DV6B 3OZDA 2QE7A 1GTSA 4J2OA 5KU1A 2VQFB 3TZ6A 1OWMA 3DR5A 1GILA 2C1ZA 1VLZA 1JEEA 1CY1A 1VB3A 2F17A 1NJ6A 1UT8A 5KNCH 1VIYA 2HCRA 4L5AA 4P58A 4QFDA 5J5AA 4YV1A 4E2ZA 1E6KA 3A1CA 2WF8A 3SC2A 4BQNA 4ND8B 5EQDA 2Z8XA 2Y66A 1RZUA 3HVJA 4HMOA 5CVEA 5C8YA 1C30B 4MGKR 2C61A 3VR4H 13PKA 3DKVA 3K15A 4HNAA 5JDCA 1IQPA 1NMQA 2A9VA 2JAOA 2AOTB 3GNQA 4AY5A 4PFSA 2HRZA 1KVTA 3NHJA 2YIMA 3IMCA 2P0AA 2VHWA 2EW2A 3B6ZA 4MKHA 5A9TA 4NZ9A 2OHXA 3ND9A 3E48A 2XUPA 2Y4NA 1UIMA 4DM7A 1ID8A 5JTTA 3L1UA 4O0MA 2Q2OA 1FYDA 2XITA 4QECA 4HDRA 4TYQA 1NWHA 3IYLW 2Q6LA 4X8HA 4ZCTA 2VKQA 4XUEA 3FVRA 2YZGA 4CMEA 2WWWA 3QOFA 1EVIA 5H59A 5HM6A 3OQHA 4IO1A 2FDRA 3DTVB 2J09A 3FETA 3R0XA 3WIUA 1MAVA 1ZN8A 3E53A 3VR3D 3VZSA 4BLRA 1DMSA 2WJHA 3GJ5A 3EMKA 3TW6A 3CHYA 1YKGA 3B20A 5KTSA 2NSJA 4QPDA 5CIQA 4M60A 1F3OA 3AMVA 3I9FA 3A6DA 1K8XB 4E3ZA 1YGYA 3MELA 1EWYA 2L19A 2HJGA 2X3YA 3OM0A 3W5HA 4PBSA 2ZZMA 4ID3A 3U3RA 3REQB 3CEJA 1L7RA 4YECA 1CRQA 1MVOA 3SJUA 3D9QX 5ADHA 5EJAA 3L40A 3KETA 1C29B 3QV1A 4JC8A 4B81A 2JI7A 3H9CA 2XKKA 4M8LA 2YWFA 3M2PA 4KXYA 4HJXA 1SUEA 5AQ1A 1YVUA 1U0FA 1V8BA 3HA7A 3OX1A 2HCTA 3NI2A 2HJ9A 3HB7A 4GR4A 2JGJA 2H2WA 3GJSA 3EA0A 5DNUA 7MHTA 4XZ3A 1YS4A 4JU9A 1RR6A 2J3MA 2QVZX 3EGDA 4IDDA 2GK3A 1P2TA 5BXQC 3F78A 4HXFB 4EJSB 1XO1A 3L0PA 1EZ1A 3BQNB 4LYEA 1CZKA 4IIJA 4DCOA 5IN5A 1KMQA 1JQDA 1VXRA 2VYFA 4H60A 3BL6A 5J4VA 5IK2A 3CF0A 4GE3A 3FPLA 2GMWA 4ZODA 5LXTF 1JXQA 3QEAZ 4LQDA 4GRIA 3H11A 1P2BA 2I67A 2GHRA 4DPKA 4LE0A 3EMDA 1QHSA 3E9QA 2W2KA 1BCRA 1FEZA 3Q8LA 1OYVA 1YS2X 1M83A 3IR5A 3L6UA 4NV1A 3PF9A 2I4LA 3KL2A 4CXMA 4IJMA 5C80A 1L5FA 2K6GA 1I5OA 4PIPA 4RPGA 3U9SA 4URHA 3BMNA 4RS3A 2PLRA 1NMEA 1XTQA 1Y3FE 3HRHA 1U0HC 1IN8A 5C5IA 3AVOA 4MV3A 1JR3E 1Y9JA 3K0HA 4MR9B 4RM3A 3ZQ6A 4C6SA 4C6RA 8ABPA 4CIYA 1G1AA 3KYDA 1U2ZA 1Z4LA 3G59A 3SEFA 3O8DA 3WGHA 3ZWMA 3S27A 2H06A 4KIGA 4JD5A 4N48A 3UHAA 1DIHA 3ZV5A 4DNPA 1ADCA 1D07A 2BGWA 5GJCA 3K6JA 4DARA 1IXRC 2O1SA 4R6XA 3KJXA 3FMIA 5E3JA 5BPHA 1F5SA 1IIRA 2MSLA 4RD2A 4L5IA 1SKMA 1M2VA 4XX0B 1G8SA 1XRJA 2MYNA 3A8TA 4KVGA 2JK1A 2REXB 3CW9A 1KYVA 4O4HA 1GQFA 5FPPA 4RVUA 1LF0A 3V4FA 1NBMD 1O5OA 4KVZA 4CG0A 4EY8A 3WGIA 3QSGA 1E69A 2RG1A 1TGYA 4H0NA 1JYFA 1LSUA 4BLVA 2AMYA 3OBIA 2H0AA 3OU6A 4RSMA 4BLQA 4CTOA 3JQRA 3GLKA 2VATA 2ACWA 1ZH8A 3V4PB 3Q8XB 3LUBA 4Q3KA 1XPOA 3IO5A 1JIIA 1NFRA 1ACMA 5KHLB 3DMPA 3O47A 2A57A 1YU6A 2DU8A 1OPXA 4AS1A 2GLXA 2DEUA 1DQSA 4G85A 1QE0A 2D62A 1WQ1R 4PZDA 2XMGA 4EHKA 2Z2YA 3D7SA 3E4CA 4AMGA 2VJQA 5T3UA 1M2OB 5JISA 2ODBA 2EHJA 4MYHA 3HXTA 3D0KA 2GARA 3M5WA 4KCGA 5JS8A 3PLRA 2G1KA 2X0IA 4RGQA 2VXBA 3VTKA 3F8TA 3HYRA 4KAFA 2HB6A 1ZCBA 4J75A 3EZXA 3LD9A 2IYXA 5KQMA 4AJ4A 1UAGA 2E49A 3LYUA 3O2NA 5BW4A 4TL9A 1Y8AA 2VOJA 1O4WA 1T0JB 4UMFA 1L9XA 1ZM3A 1PGQA 1WX1A 2PZJA 1DXOA 3DXFA 4US0R 2OWDA 4WBXC 3T7JA 4C0XA 5K05A 3BFPA 3HP4A 4WLUA 2IP1A 2VI5A 4M8NE 3WB0A 4JUBA 1JLMA 4BFCA 4Q9LA 3VDMA 2CD7A 3FUUA 1E3SA 3U3JA 2NYRA 4FYYA 3EDMA 5EHZA 4Y2QA 4OMFG 4XUDA 1LJLA 3D5TA 1JXMA 4R4JA 3KALA 3STVA 3E2PA 5EXEA 2J30A 2QR2A 4MUGA 1S5PA 2UU9B 4JP8A 4LF9B 1YA4A 1IAQA 3KR0A 1C7JA 2OV4A 2V8OA 4GI3A 5KTRA 2QUHA 3AM1A 4HV4A 2KBFA 3TGWA 1KC3A 4TV9B 3BD9A 3BVPA 4DIUA 5HA5A 3OT5A 1RLJA 1D09A 1YNSA 2H63A 2ZIVB 2PKCA 3D02A 4NMWA 4PE5B 5AKYA 3RSSA 4W5OA 2O2JA 3NVDA 1YRLA 4RE6A 4NS4A 4HGRA 2BN4A 1MVLA 1WUHS 3GYBA 3DBIA 3HG7A 5JI2E 2B21A 4QUDA 1P7WA 5FEMA 5LUAA 1GVNB 1JVBA 3RU9A 4WY8A 4RWZA 2D3WA 2D2VA 1D4FA 2E4WA 2PTHA 3DVLA 3IT2A 4J1QA 4TWBA 1YZKA 4QXOA 2V7UA 3RJ9A 2J0VA 5ALLA 3NNSA 3A26A 1XQ1A 4IVNA 4ZVVA 4CDRA 3T9AA 3OLYA 3KJFA 2BKXA 3ND8A 2ZSBA 5DT2A 4LF8B 5ITZB 3HKDB 4BNJA 4OFBA 4HZUA 2Q5OA 4NE9A 4R83A 1CUEA 1GPUA 1Z9BA 5FBZA 5CDHA 4RMJA 5C18A 4H4CA 4G67A 3PEFA 2WBLC 3CVYA 1JDZA 5SZJA 1X1SA 3PDUA 1TZCA 5BMVB 2R84A 2VRCA 1QHXA 3CXRA 4OLFA 4ZO6A 3ZYZA 4AZ0A 1T2CA 3SZUA 2MU1A 1EFRD 3OA2A 2IZOA 2NVOA 4D97A 4JI8B 3QQ5A 1P4HA 4FEAA 2VJYA 4M6WB 1OASA 2Z4SA 2GF0A 4ILEA 1IJBA 5IT4A 5ERGB 3GIWA 3AI1A 1Y3DE 2HCFA 4FS8A 2L0XA 2QD2A 1XBTA 3UXHA 5F4ZA 2XNSA 1OXSC 3FKQA 5E2IA 5G0WA 3FTDA 4JXZA 4ASUD 2O54A 1TT5B 3R9WA 1R9GA 4CM4B 1CEEA 1RQRA 3C1TA 1P5JA 1XAGA 1KP9A 3M4NA 4J4HA 3WMFA 1K7SN 4EUFA 4XIGS 2BEJA 3B5EA 1GRQA 4FIZA 3JTEA 4IUCS 1MO6A 2IF2A 1PJ4A 5FL7A 4EPVA 3MJSA 3OQJA 4A82A 4FX5A 3B6EA 1N78A 4RELA 2PUWA 3RUIA 2Y9MB 2L42A 2PPLA 1FP2A 4QU8A 2VHCA 1USWA 1INLA 2F1KA 2JIPA 1PT8A 2O8BA 5COQA 1TQ8A 4K9LA 1E2DA 1NM5C 1TAHA 4TT3A 5BV2P 7REQA 1FJXA 1N0VC 1W88A 4X1OA 4JBWA 1CQZA 2DY1A 4M9XA 5U4XA 3LWZA 4AURA 4D3DA 4EAQA 1NUPA 3JQCA 2NQTA 2R8PA 3E8MA 2C7OA 5HJ5A 3VDNB 1ESNA 2PYIA 3GVXA 3WK7A 2ST1A 3Q3VA 4MKGA 1TFRA 1FXWA 2HTFA 3L7JA 5KQRA 2PV0A 3OP4A 4IIHA 1MDFA 2ZRBA 3X44A 5JVDA 4XDYA 4ZYUA 4EABA 4D0GA 2YXLA 3I9V6 4HN2A 2I6GA 3RPEA 3WMRA 3ZJYA 3G0CA 2QAJA 2BI4A 3QA9A 2QAGA 3RTBA 3SQNA 1DC5A 3AYZB 4M7PA 2G8LA 4N3BA 4FBGA 3EXG1 2ZK7A 1RZVA 1J5PA 1YNOA 3PWSA 3E5MA 3C4VA 3R0ZA 4H1WA 4YS6A 4EHNA 4YMIA 1Y5MA 3YASA 4J0QA 1R74A 2TMGA 4ENQA 2ZBDA 2YN4A 1Z7EA 4A1OA 2JJ2A 3K32A 1B00A 4UAGA 3SLKA 2C7QA 1WE2A 4NCBA 4X44A 1L4EA 2L18A 1J22A 2OZPA 2IZ0A 2P2YA 4KUGA 2IW1A 3ZWOA 4PPGA 3NDJA 2C2KA 2LE0A 3RJTA 5F5NA 4LHSA 4TV9F 3U0BA 1IY2A 4P4SA 3N0WA 5CXSA 4FNGA 1JMKC 2WLTA 1DZIA 4D9KA 1R6BX 4IQGA 2HLNA 5JUWA 5BORA 3ESAA 1LC0A 2VK1A 4RGYA 4RKWA 2JCGA 4XLLA 3F98A 5BYJA 5CXUA 5JS7A 2CVFA 4FNOA 1QWSA 2GCIA 2XT6A 3RJZA 1QP4A 3GUCA 4HCJA 5HSGA 3GDGA 3B3QA 3D7MA 4YRCA 1GNVA 1ISMA 1Z0DA 2YHAA 4HZUB 3RWBA 3T7IA 4ZV9A 1I2AA 4CR6A 2R9VA 4IH1A 1VDMA 2W98A 1T0IA 3QVSA 1VZ2A 2JLRA 2BGKA 4I5FA 5HQ3A 4ZVKA 3WLRA 3UJHA 4TQGA 5HUJA 1P31A 4FLFA 2O2YA 5DWDA 4ARIA 2FR8C 1JR3D 2FE1A 2WJIA 1V71A 3C16C 3OURA 3T5CA 1WJGA 1J1UA 4C14A 4NK4A 2XT0A 1NVXQ 3IDFA 4C01A 4ZOBA 5BQXA 1CR1A 1GV1A 3HV0A 1VLLA 3K6KA 4YK7A 1VHWA 3E9EA 3DEZA 5T6BA 3RSLA 3ELWA 3FDIA 5BSUA 4YAKA 1H6CA 2XB2A 3GB9A 2QPOA 4MOWA 4M1KA 1GZDA 3SG0A 3B3GA 1WZIA 5J9FA 1BS1A 2OE2A 2DTEA 1CT9A 2YRXA 1XZNA 4PLZA 1UZNA 5EL0A 3KHKA 1ECGA 3DMTA 2HDHA 4ZDWA 2CLEB 1M7BA 2O3TA 5KYYB 1QU2A 3LX6A 5D00A 2G4CA 4P3XA 1EZZA 1DRWA 4QE3A 3NKFA 1XIVA 4P0TA 1B3RA 4DCPA 4YJ2A 4A6XA 1DXQA 2FMXA 4BWVA 4IDQA 4R0NA 3E7FA 1DELA 2QL7A 3TLGA 4FIDA 5AXCA 1V7CA 4GE0A 3PCRB 1QZXA 4KNWA 4RD0A 2VJMA 1HFEL 1PUJA 4KGXA 1FDUA 2ACEA 5CB8A 1YCGA 2FEMA 1J09A 5CT6A 3ZHVA 2XY4A 2Q9CA 1NKVA 1U5BB 1P6UA 3R5KA 2D1SA 1F7VA 2PMCA 2P8SA 3SPXA 1GN9A 3P0FA 3MG9A 1XCGB 4C4XA 5EMJA 4J0HA 2XUZA 4QDTA 3OJFA 2ZSJA 2ZCJA 2W6NA 5AJZA 1BD3A 3WFIA 4XM0A 3WO0A 4NZOA 1E59A 2XUHA 4RIIA 3RANA 1YQEA 1YL6A 2AR0A 4N5MA 1TUGA 2AN9A 2XHZA 3NTVA 1QCCA 1PSWA 4UKDA 4KODA 3W1EA 1YJ5A 5M7EA 1GRRA 1QHGA 3AY3A 3I05A 4ZOLA 2WJVA 1QONA 4GSLA 5GZ3A 1MC1A 3MCAA 5E6SB 1KQNA 1KEPA 2VF5X 5ALQA 2Z9CA 1SG0A 1WHSB 1LVUA 2EOAA 1Z0AA 2RJNA 4OMDA 4E7PA 1U0SY 4AMYA 1DFIA 2P9YA 1D0IA 3DAFA 4RANA 1WCWA 5D87A 4PQEA 2JAQA 2XVXA 4MVWA 3W77A 10MHA 2QUIA 5DULA 1DEHA 1PE0A 1QQ6A 1BEUB 1FFXA 1CERA 5F78A 3OTOB 1AUPA 2VNHA 4M37A 4POOA 2ANCA 1R5NA 3MJVA 4RYDA 4U2BA 4FYWA 4UVEA 1JIJA 4EKGA 3J80A 4LDAA 5AOCA 2OY0A 1G5TA 4LXUA 1P44A 1EX6A 2XZDA 3Q7TA 3EUFA 2IUEA 4BNZA 1EDDA 3OJEA 4ALJA 1I36A 2JIZA 4I4TF 4U0JA 2I7DA 3OSZA 4BIIA 1C7EA 5CXQA 2DF8A 3VU1A 1I3LA 2WD7A 5JCOA 1YRWA 2BE7A 2ECQA 3JQPA 3L04A 1PVDA 4ZVRA 3RM3A 1Z0IA 3ZVRA 1U1DA 4BKMA 4X6YA 3VUEA 2CV2A 2XYPA 2P11A 2C92A 3DBLB 5H02A 1E1YA 3RFUA 5KPJA 3ZZMA 3GLFA 1GD1O 1NVBA 1T9KA 3UNXA 3AH8A 3SC2B 3C5WP 4UNNA 5JAZA 2G0TA 5IW8A 3WYGA 1I2ZA 2WABA 3DP9A 4ZKEA 4RMNA 1Q95A 1SEVA 1XHFA 4FT2A 1JB9A 3ZYCA 3TKAA 1UOOA 4PX5A 3I4LA 1PUIA 4PLWA 5C35A 1CB0A 3K5HA 3EXIA 1W25A 4Y0NA 3T9EA 5DBIA 1M2FA 1VJ0A 4LRQA 6AT1A 1FDIA 2JIZD 3JD1A 1VGVA 1V96A 3ABOB 4HNGA 3UA4A 2H1SA 4G2TA 4HVCA 1QB8A 2HO5A 1I13A 2N1BA 2VH1A 2WVJA 4RK7A 5NLLA 1M2EA 2CXHA 2ZB7A 3TB4A 5CNMA 1KDOA 2YFQA 1OROA 2F3QA 3F73A 3K0AB 1WMAA 5DEIA 4OXYA 1HDOA 3F1KA 4D9NA 2D5CA 4AYTA 3LH5A 2YQZA 1EUYA 4AO8A 5C51B 3ZEIA 4EHLA 1FJ2A 1LPAB 1DRVA 1TM2A 1IZZA 2FSIA 4D56A 2K87A 1L5OA 1W19A 2X1MA 4PNHA 1AO0A 3KKQA 1RJGA 2XRFA 4LISA 5FBQB 2JLCA 3L93A 2QUAA 2WICA 3G13A 4B1FA 5DBGA 3LTEA 5DBFA 5JZBA 2GAAA 2JARA 1DCFA 1KSFX 3X2SA 4Q3CA 3QF4A 3H5NA 2I65A 1OB2A 1RLIA 1R6DA 1Z6ZA 5IC4A 4QICA 3IEKA 2JIDA 3O26A 2IH2A 2ZE8A 1P8JA 2YWXA 5GONF 4YDQA 4RSGA 2YJ3A 3CG4A 3PQEA 2M1ZA 4IHAA 3HNOA 3IURA 5L9AA 1JTEA 1ZK3A 2WDPA 3U7HB 4CEHB 3NAZA 5JH7A 4MICA 2X0FA 4FM9A 3KBBA 5K03A 2VTBB 2BEVA 3T7RA 1UKVY 3M34A 5GJWC 1ZDMA 1PV2A 2H4WA 4FYJA 1LH0A 1CUBA 2IYTA 4JAVC 3RABA 5BSWA 3N7UA 3DE6X 2QAIA 3EZ2A 3CEHA 5FTKA 2J8ZA 4RA9A 1QBGA 5E7IA 1HL7A 1QCZA 1P8AA 2QMYA 4XSHA 3WKCA 4YRGA 3MPUA 4DSNA 2AQKA 3ILXA 2O20A 4NHOA 4UM7A 2VC2B 1Z5GA 3IEXA 4P34A 2AHRA 4GIBA 4FR2A 1BVRA 4NZNA 2QSJA 2P62A 2DZDA 2FQ1A 1XK6A 4D9FA 4V1CB 3QVUA 2ZIWB 5ANRB 3C15C 3MERA 2HMTA 4DLSA 1OT5A 5IAEA 2Y6UA 2PJRA 3SSAA 1C4OA 1KDPA 1EFLA 1NBEA 2CHEA 1R6XA 3CIFA 3F9RA 3I1JA 3OQPA 3Q12A 2REQB 4N3CA 5BQ5A 3IVMA 4ND5A 4OX9B 4II3A 1II8A 1XAJA 4RVHA 4TQ9A 1WHTB 3LFUA 2H6EA 1Y6QA 1TQ4A 3KWMA 2V97A 4WKCA 4N6NA 1AMNA 2BKLA 2C1XA 1JJAA 2BHRA 4ZCQA 1RC0A 3ACCA 4XW2A 2WT4A 4Q1DA 4DQLA 4D9BA 1VLMA 5H80A 4L5BA 1B2RA 1TMKA 3HDQA 4UDYX 4DV3B 1QH8B 1EA7A 2WSYB 1E2QA 4LBZA 3UB4A 3ANMA 4N0QA 2R6R1 1WCIA 3D2CA 4P54A 4EGJA 2PNJA 2RGRA 5CRIA 3DW3X 1FNDA 4NU6A 4D4JA 4G0NA 4S2EA 2OSBA 2WZQA 4I8IA 1U5BA 2XI4A 4HX2A 3WYDA 3NGLA 1B8NA 4IXWA 4X20A 1KEEA 4P80A 3G02A 3ZI0A 4XQ0A 1PGNA 1Z5UA 2DWQA 2G82A 3HFJA 4QUBA 3FNQA 3PEVA 3FHLA 4B45A 4DUZB 5E6RB 2DTDA 2PCJA 4C2UA 4E2WA 4KKXB 3VSAA 2VYVA 3NWPA 1A7KA 2HBRA 4MV0A 3RD5A 5A0TA 2ZSAA 4LK2A 2RHJA 1ODKA 1G7CA 3NTLA 1Y4SA 1N6OA 2QUZA 3GFGA 3AUJB 4JLKA 1TEZA 5JCJD 5D51S 1PHRA 4KVAA 1SXHA 3CLRD 4ZHQB 3TLCA 3AU9A 4HDOB 1W75A 3ER9A 1A3CA 1N2XA 3Q0IA 1V5GA 2P91A 3LLMA 3OHPA 2IRWA 2XAAA 5C5DA 4G56A 1EI9A 2PGXA 4DXDA 1Z07A 3HWRA 3AEXA 5CLIA 2IBMA 2PGAA 4MI9A 1JDBB 2V6IA 2QRVB 1GTMA 2R8EA 1OYWA 3EN0A 3BOSA 2VTBA 2O48X 3LYAA 3N2IA 4YRRA 3PGJA 4P5PA 3QF4B 4FYXA 1PL8A 4L5CA 3AHHA 4C0KA 3KEQA 3OCCA 2C3UA 1QO9A 2NYUA 3JQFC 5FPYA 1TM4E 5I7EA 4Y1EA 4MWZA 5AK6A 4DWJA 4H2DA 4LHWA 5CYPA 3AI7A 5FIUA 3A11A 2ZTLA 1CRWG 1MOSA 2XF2A 4G23A 4MK4A 3DHNA 3EA5A 2BJHA 8ATCA 5K51A 4CLXA 4IDCA 5BVGA 2PM8A 4OUDB 3ZU4A 3ZLUA 4DDKA 3ZV7A 1HYGA 1PWYE 4CT4B 1QIMA 3EG5A 2G72A 3S99A 4IP0A 2PZLA 3T7AA 1NU6A 3UYKA 3QW4B 1W0CA 2QMOA 2NTVA 5L4NA 1HETA 1QJCA 1U0TA 2UYHA 5FFMA 1P9WA 4B8YA 1JW9B 1HTWA 2BLLA 4RD6A 4OJKA 3UMCA 3K6SB 2J9FB 2NM0A 3HB5X 2EFJA 1SQFA 2PR2A 3DP7A 3SCZA 4YGXB 2OYCA 1BKYA 1WB4A 4A0FA 1QH8A 3KXKA 3RRXA 3Q7PA 1R00A 5AI0A 4TSRA 4V0RA 2IV2X 5LP1A 1YBFA 3ZDZB 3WGMA 1HXHA 2OV2A 4QBTA 2WINI 1DBPA 2OCAA 2UZ1A 4LZZA 4QIHA 2R6GA 1FBNA 3LKZA 3H7IA 3D31A 1QVVA 5HKBA 2C03A 3CONA 4Z3KA 5HQJA 3BD6A 3T99A 1ODSA 2P8JA 4TYPA 3QXXA 1V26A 3PB3A 1E79D 4JKYA 3VKGA 3BQ9A 4KR9A 2IXAA 3SZLA 5IJWA 3UICA 1NA5A 2GZHA 3OD5A 1CRZA 5BNFA 3OEYA 1TMGE 1KHHA 1T2UA 2H1FA 2OGUA 2ETVA 2VHYA 4LBVA 4G0ZA 1Y8ZA 3KQTA 4ABYA 3ZNQA 2P5SA 2OD9A 3TOZA 1ACLA 1QKJA 2JHPA 4B4VA 3N0TA 2ZJ4A 4P4TA 1TOAA 3DV0A 2J3DA 3K1AA 4ZP1A 1JZQA 2YCLA 5FOVA 3BXZA 1SBQA 3ETJA 4IQ8A 4D9MA 4DILA 5DNVA 5G4KB 4CW7A 4YJHA 1EH5A 4ME6A 4EPYA 3R3JA 1ANKA 1UBMS 4KEAA 3RAJA 3WRWA 5M34A 4GLJA 3GGOA 1GAJA 5MN4A 1WD7A 2XTAA 3MCZA 4YAEA 4A6PA 4UTRA 1YONA 3DMGA 3O8CA 1MABA 3KZKA 5ARBA 1T1EA 3DD1A 5DH9A 2ZU6A 2GPAA 3LLVA 3LY9A 2Q5JA 1T24A 3KJGA 3RSOA 1ABBA 3NVAA 3RUHA 4R0MA 3HDGA 2YXDA 4TXJA 4UM8B 1V4VA 1YDEA 1ISSA 5EXXA 1IL0A 3Q7IA 3UQYS 1UMBA 1XCMA 4L73A 4MVJF 1BA3A 1NW7A 3MXOA 4MUFA 3VHXA 3TFWA 3FD8A 1LI5A 2AK2A 1E4OA 1SEPA 2UZ0A 3D7RA 3OJOA 1JKJA 3ZQJA 5CFOA 3VX4A 1IEVA 5E6UA 2B20A 1QGYA 3GAFA 4QREA 3M5PA 4D79A 3A1EA 4JLDA 4BX8A 3MRXA 4PYRA 2Q28A 3BGOS 4DG9A 3I72A 2JJ1A 2Z5FA 3KEGA 4P9NA 2WTMA 2WMYA 1CDDA 1DUIA 2C0QA 2WV9A 1TVEA 2B5VA 2FUKA 2COEA 3HKEA 3H05A 4LOAA 4Q01A 2OO3A 1JWAB 3BIOA 1SCUB 2M6SA 1SUIA 4JNCA 1U3GA 4K6MA 1R0SA 2P6RA 3UCFA 1ZMBA 1KBQA 2O2DA 3GHHA 3KB6A 4W6QA 3T7CA 2Z95A 3DEIA 4F4HA 1KO4A 3DVAA 6NULA 1HORA 3HPQA 4MWCA 3O92A 2FWIA 1T8TA 4X3OA 1W4RA 2P3OA 4TVBA 5BT8A 3AF2A 2AF4C 2G9UA 1RLOA 1V11A 2GSDA 4LZOA 5IKEA 5AW9A 4N5NA 2INGX 3MVEA 3IGFA 2PR7A 4GQIA 3G2LA 3KUDA 3SZOA 3ZGOA 4D8VA 4TSFA 1MF7A 2BH9A 3DT8A 3RBAA 3AEYA 3QUAA 3RQIA 2WWIA 3ASYA 2QPLA 3AP2A 1IATA 1S7CA 2PFGA 3WHPA 3B6JA 4ENTA 2Y2VA 4D81A 4WT7A 2B4YA 4IINA 3KWJA 4Y0AA 4YPVA 2PD4A 3HR8A 3OPNA 3AILA 1M2WA 2Z3VA 1W48A 1QWOA 4RL4A 1QANA 2GN1A 3DDNA 1JDBC 4WL0A 4XOUA 3W5CA 3ICCA 2PKXA 1O9HA 4G5YA 4KLRA 2PUVA 4NCKA 4YNBA 2VF4X 4B7UA 3QKRB 3DEJA 3FROA 4PVDA 4QUGA 1S0UA 3ENQA 5EA2A 3Q3IA 3TOSA 1YR2A 3ZVMA 5I9LA 3FNGA 3CVXA 4FCCA 3LVBA 4QULA 5LU9A 3V97A 4LXTA 3BEOA 2O2SA 1EQUA 5AJWA 2EQBA 3AONB 5D5QA 3IPCA 2XQGA 3H6HA 1FP1D 3FR7A 4A26A 3IA2A 4J16C 5ENZA 1E9EA 1E89A 2R6DA 4UCFA 2VDRB 4O3MA 4OP2A 4LNUA 3LK7A 1TM5E 5F76A 3VSCA 2ZUEA 3INNA 2PTGA 4RHTA 3NR2A 3QLEA 5E7MA 5JQWA 1X9IA 1YV9A 4HQOA 3DGEC 5KWIA 2Z2IA 1OYOA 3KU4A 3HA5A 3KOYA 4V39A 3WYBA 1FNMA 4BTLA 1H85A 4TRNA 2DFPA 1X7XA 1ZHFA 2XCQA 1YDWA 3REGA 3DFMA 1QLJA 3TJMA 3ZE1B 3HXKA 1UUFA 1AXRA 1D7OA 2FE4A 4MRVA 2BVNA 1G7RA 4JB8A 1IB6A 4DM4A 3DJYA 3E7PA 4GI7A 2IVZA 5A06A 1H2WA 2O7NA 3WGZA 5EERA 4I2NA 2IDJA 2XSZA 4MI6A 2HHJA 1L4FA 1NQ5A 3A7DA 1EP9A 2E87A 4NDZA 2NV0A 4M9ZA 5C1OA 3AVXA 2RK3A 2XYHA 3EEBA 3QY9A 2J33A 4U63A 4PLGA 3KXIA 3ECAA 2QV0A 4OJTA 4ZDIA 1H3EA 1L5MA 5DO9A 4GMKA 4ZTZB 5BPFA 3I0MA 1VJGA 3EODA 3GMDA 3T0GA 3GLTA 4AY6A 2LXNA 2VP3A 3KAQA 3E3OA 1FYFA 3SYRA 5TEVA 4DWVA 4Z1MD 4HKTA 5J2UB 1G66A 1EIZA 3E22B 4YQEA 2ZYTX 2ZRGA 2Z30A 1I2BA 3LUHA 3O8NA 4YY3B 2WUFA 5JCJA 4B80A 1ENZA 2F64A 4RDCA 3SK0A 1UK8A 3QVXA 3T52A 2QOEA 4G2NA 4C3ZA 3KP1A 4N49A 4IMPA 1GPKA 3HACA 4TTAA 3BORA 3JPWA 3TE7A 5JASA 5JWRA 5AHKA 2W0SA 2OFPA 3DXZA 5ALSA 3L0OA 4QWWA 2D1QA 2YNMA 2CHGA 3HV2A 1P7YA 5FJIA 5G3YA 3SJCA 3UPDA 5LQUA 3FPEA 1NBAA 1W8DA 4Q66C 4XQEA 1U1CA 1MO4A 3KQLA 4JUIA 3RT7A 3HXQA 3VKUA 4JY7A 3UAOA 4UUNA 1DTEA 3L84A 3SJAA 3X1KA 3FAKA 5C1DA 3IBYA 1O5IA 2HTEA 4AJEA 3LG2A 5IT9A 3GCWA 4FFPA 4ATNA 5JECA 3GFBA 3SS9X 5GVRA 1Z22A 4FGLA 3ZUPA 2OV3A 2QXYA 4Q82A 3H9JA 2G8NA 2C5EA 4EJ6A 5KYGA 5AKIA 1MJHA 3SHTA 4PWZA 3WLJA 1Z2NX 4JU8A 2CK3D 2DKNA 2P2GA 4UMEA 4CUKA 4U5QA 1XTVA 2ZR8A 1RYEA 3HL0A 3ZU3A 3GAAA 3WL5A 5AM2A 3NIFB 1QV6A 4DYVA 2JFGA 3AVTA 5DXAA 4ZPJA 4DAOA 1ST3A 5KYWB 1QHIA 7ADHA 4R7TA 2XRYA 5KB3A 1UKCA 3D64A 4FJ1A 4XX1A 2QMHA 3S0JA 1OY1A 3TMAA 4J3NA 4AU1A 1Z28A 2G4VA 1DDGA 1A95A 1E2JA 1SQSA 2HQRA 1UIRA 4IMRA 4I08A 2NUAB 3UV6A 3OIDA 1RFLA 1DX4A 2V7WA 3F7OA 1N4AA 3OZAA 5KHAA 5FAXA 1YRQA 1H22A 1YASA 1XG5A 1XVAA 3HJUA 3KAKA 1FVHA 1YJQA 5F2KA 2NPFA 1L7DA 3WRYC 3ZTYA 3AINA 1ZUHA 4IGFA 3SOPA 1BE6A 2C2WA 1O0CA 4YJFA 1G55A 5JFGA 2ZRHA 3H4IA 2A2ZA 1T1GA 1G8MA 4MEAA 4N8DA 2YX1A 1SFRA 1KXJA 4IDBA 4OQQA 5K8TA 2FFBA 4G0YA 4HGNA 3CRRA 4KMMA 1EDEA 4XXHA 3CEMA 2XEDA 4FB5A 3TCKA 4ZQEA 2ZI7A 1PWHA 4K28A 3UT0A 2V1UA 5TPWA 2KSQA 1NI3A 2HMVA 3I2IA 2I6XA 3GFRA 3KPJA 2PRKA 4BL5A 3A6ZA 2R6FA 2JGFA 3MCUA 1TADA 2GWRA 3RCBA 3VVMA 4CTNA 1NG9A 4MZXA 4YXFA 3IXQA 3L0BA 2FJ0A 4HGPA 3HZZA 3WMXA 3A14A 4QSMA 2XWQA 4KV7A 4OHKA 5AK5A 4RLQA 5TEWA 4LVUA 1T2AA 4HFNA 4KQFA 1T1IA 1FSPA 1P7ZA 5CFLA 2YWRA 3RKRA 2W9XA 3IT3A 3GRAA 4IS3A 5BOSB 5J2TA 2D1YA 2AG0A 2P3SA 2XUOA 4GHWA 1FMLA 4TQUS 3NHFA 1U4OA 4IJVA 4NL4H 4B33A 4G6ZA 3WIDA 1T6NA 5L95A 4NV0A 3KTAB 1TA0A 3GLGA 2QAGB 3EVBA 1LBEA 1LWNA 3UQZA 4TS1A 5J4HA 5J1SB 3WGOA 5LZ9A 2PL5A 5H9VA 3CKYA 4JJ8A 1RRVA 2Y1XA 1NKSA 1K8ZB 4K9NA 2C5BA 1TUEA 2NU6A 4KYUA 2EJTA 2Y67A 2Z5VA 4ESOA 3DEFA 4RA9B 3A32A 4A6DA 1QOZA 1P1RA 1MHTA 2RJ3A 2ZB3A 1HDIA 1Z16A 5JE8A 3FSJX 1K5DA 5EZYB 5DNYB 1E3MA 4TMXA 2C2BA 3M4YA 1KY5A 3ZY5A 4Z9BA 4YC7A 1KVRA 3DE7X 1H5QA 2A0YA 2RDMA 1RKXA 3OI7A 5H4GA 3MYRA 1ECCA 1Q1QA 4BFVA 2BDEA 2HPZA 4BX9A 5I48A 4NCNA 2CFCA 4KXMA 1R4NA 3VBCA 5JT1A 1KNQA 1PJ8A 4QEKA 3QE3A 5JCOC 5DSXA 3IOYA 1W34A 4EITA 3AEKA 1KERA 1N5OX 5A5EA 3EXAA 4CTJA 3NORA 2DUJA 5I6DA 1QRTA 5I9TA 4KITB 2ZS8A 1POWA 5JFOA 1MB4A 1DI0A 1YAHA 3NHZA 2NVWA 1GGVA 5EUBA 1NLUA 2V9CA 1LPMA 1ZP6A 6LDHA 5JPIA 1NY6A 3L1IA 2KWIA 1SURA 3WNVA 3IUSA 1XDSA 4E51A 3OLXA 2ID8A 1N2OA 1P39A 1ILWA 1I3OA 3V48A 1NXOA 1UFRA 1GEEA 1QMGA 3N2YA 3CF2A 1JFFA 1GPLA 1NT4A 4UBKA 2OP1A 5UKDA 4B9AA 4M83A 4I55A 1WSAA 4Q7LA 1EU1A 4WJKB 3RC2A 4X66B 1H05A 2RGEA 1KO1A 2XUFA 2Z2KA 4RZ3A 1TYBE 4QQ8A 4ZCIA 5T41A 2HWUA 1PEKE 3LA6A 2NUBA 2PY6A 5DTRA 1Y6ZA 1Z7GA 4HDNB 4V0KA 4P7GA 2CB9A 2IZ5A 2BJVA 5CFNA 1T9ZA 2AD1A 5TPWB 4UBLA 4JK3A 5AM0A 3UPTA 1JH8A 1XMPA 3C7KA 3E3AA 3MN1A 4GECA 2CCJA 1RI4A 2J5KA 2NYVA 4W4TA 1JEJA 1L7MA 4JB0A 1U31A 1MTZA 2R1TB 4OQ4A 3J7TA 3FVTA 4XYBA 1W6RA 4RD3A 1BKSB 4RJ2A 1TJ4A 1ZAKA 4F6LA 3GA7A 4PPNA 3BK7A 4GYKA 1XZFA 2AEJA 3PPXA 4R1SA 4ZTBA 3RHTA 4YWJA 3QPBA 2F55A 4N9WA 3AL3A 4H3VA 3Q7EA 1OXXK 1ZVJA 2HHHB 4D57A 4UZFA 3BC1A 3E61A 2Q5IA 3B2NA 7ABPA 3D2AA 3IAM6 5LMUB 4NBUA 2R8OA 3IJRA 2QT9A 5JJKA 1GGFA 1QIFA 1V3VA 1Y3AA 3VAAA 1EIWA 1RRCA 4UVDA 1ZEJA 4ZOAA 2WWHA 1JZTA 4IHJF 4WLOA 1XLVA 1WV1A 2QTWB 1G5IA 2OXEA 3GELA 4URWR 5MN5A 1WDLA 1ZCJA 2Z8ZA 4JC0A 3WL6A 2WUWE 3ENWA 3IAS1 2EL7A 3Q6NA 2XNHA 4B09A 3JCZA 1A8IA 5FKJA 2FX5A 3ECCA 3PPIA 3TIFA 2G1JA 4BNWA 2DP4E 3SM9A 1RHRA 3FE2A 3OTWA 1N8NA 4N3NA 4W5WA 2DPHA 3LLUA 2PFSA 1KIMA 3G7NA 4II7A 3ZCSA 4KQMA 2YWEA 2ZKLA 1R6UA 1EG2A 2IZ1A 2ISQA 2K4MA 2CL0X 5E2AA 4RF2A 3DBRB 4ZYVA 2B0CA 3G2QA 4GYWA 1NGSA 4DPLA 3AUAA 4KC0A 1BW9A 1N2HA 3PEWA 3SQXA 4FMDB 3R5SA 3WDLA 1GNRA 1DXHA 4I4TA 1NTRA 4INJA 2OXFA 3R6DA 1D1PA 1KRHA 4PG6A 3QX9A 4FMDF 3TQRA 4W8HA 2JGRA 1Y1SA 3V1TC 1Q57A 3ZQKA 2C42A 4KXNA 4YHBA 2G5CA 1N92A 2PANA 4BIMA 1BQ4A 2B83A 2VPIA 5CT5A 5CVCA 4G4GA 1T29A 4MWDA 3UBMA 3M8KA 1WAMA 2CXPA 7AT1A 5MGBA 3P27A 1NDUA 2DMRA 4FYKA 5K4GA 2WILA 3MMNA 2VDKB 4GQAA 3MK31 4YP5A 3NW9A 1S3SA 4MA0A 1CJVC 1GSAA 2VNSA 1E2IA 3OFSA 1G1MA 3BQMB 5F3DA 1NBME 2ADFA 3UVEA 3L41A 1ESEA 2A9FA 1GM5A 3A70A 3MWKA 2Y05A 4KIFA 3VA7A 3GFSA 4EB6A 2WTBA 4HB0A 3SN6A 2P2ZA 4GOMD 4ZANA 3FRIA 2I29A 2O6HA 2IH5A 1RXIA 2EARA 2RH4A 5FNVF 5I5EA 3RYHA 4Q4DA 2YASA 3EDOA 2AOXA 4L76A 1D3AA 1PGJA 1KF0A 2B37A 3QK7A 3C3BA 4DV4B 4DDTA 1T2EA 3ESZA 1UWKA 1C9KA 1PEYA 2CNWD 1HNZB 4CRWB 2ZIGA 1KARA 3GDOA 5BQOA 4RTMA 3TDMA 4MQMA 1II9A 3CW2A 4L0QA 3THWA 5AW0A 3ZW9A 3G0BA 1QS0A 4IJKA 2VUHB 4ENUA 5FUVA 1SA0B 1GNLA 1T9GR 4F12A 4I1OA 3VH1A 2ZPUA 4JDPA 4GDFA 2ZDQA 3GZ4A 4U7WA 3IOCA 5HF5A 2HO4A 1RYMA 2ZRCA 3PRHA 2WI8A 2GTIA 4QXMA 1M0EA 3KOXA 1XMQB 1X8KA 2QUJA 4QEDA 5CDUA 5LYJA 4G0VA 5A3SA 3L1HA 3LQ2A 1BRMA 1BU5A 3L92A 2NUTA 3VR2A 3JZFA 3SOZA 1E1KA 4CM9D 1JT9A 2B6HA 2HDWA 3A6LA 4KTVE 1BN6A 1C0EA 1XI2A 3NWJA 3NBMA 4P84A 3WKEA 4E5UA 3FZYA 4RA6B 5KQGA 3WGTA 5FOXA 3ZCTA 3E2MA 1G9SA 3KKNA 1D2CA 2QX8A 1Z4IA 1TYZA 5DGXA 3KQHA 4M9RA 2HN9A 4IGAA 4DLAA 4PNPA 3TBFA 1RACA 1O95C 2ZWIA 4K9QA 3ZJ4A 4F46A 4XJTA 1TU3A 1V1MA 2RONA 1FSSA 2AE1A 1QLWA 3LP8A 1R8QA 3NRJA 3OEEA 1KJNA 1NG1A 4ONEA 5CM9C 1HK7A 1SB8A 3LS2A 3ZZUA 1QU3A 3G8CA 4EG6A 3A6GA 2FUG1 2ICAA 2VHEA 4YT2A 5FULA 5AK0A 1VC2A 5ALIA 5BQPA 1CZUA 2J6HA 3E8XA 2Z4RA 5ED4A 1FPQA 3V32A 4H7FA 1J21A 5I8PA 3W5SA 4WCFB 1FS4A 5GPBA 1X8XA 2NXCA 2XNJA 3QJ5A 1SXPA 2V3WA 3AEUB 3RK0A 4FYIA 2XTNA 5FBVB 3AKDA 3GP3A 3WGYA 2ZE5A 1D5WA 1FTQA 2CJFA 4KAJA 5DLQC 1XLWA 2DSNA 4B83A 4RZXA 3GJQA 4MGIR 4NOLA 1FY2A 1YVRA 1BU8A 1ULSA 1C8BA 2LGJA 1WLYA 1Z6PA 4F5EA 5AMXA 4ZOLF 5BNTA 1V11B 3K7EA 3T0FA 4TTVA 3AKZA 1V37A 1R27A 1JJVA 1EX9A 3GZJA 4UOQA 3RVDA 3TEFA 4AF7A 4K88A 4DZRA 2JBAA 2IYWA 2RCYA 1A7JA 1TECE 2PSHA 2W2QA 3QZUA 4IH4A 3V8MA 2WC1A 2QNIA 3TE6A 4EO9A 4BJHB 1H2XA 3H8WA 3IBGA 1LPSA 1VBFA 4FFNA 1LK5A 2EBFX 3PQCA 1O9GA 1OMOA 4S2UA 4TVOA 4X1KB 3VC3A 4V1CI 2QL6A 4FDVA 4Y2TA 1WUKS 5IM5A 3P45A 2VF2A 4HEA1 1M1YB 4RWEA 1FNNA 2CXQA 1LTQA 3PQ5A 3R6WA 5BT9A 3V4ZA 2N46A 3CRZA 4JQSA 2JJYA 5GWXA 3M3PA 2GILA 4D74A 4MWBA 4O4JF 4JI1B 4GBMA 3J81A 2P2NA 1HDZA 1W4LA 1FTNA 3QYPA 1GPMA 3I9KA 1V1JA 1E61A 3M1YA 3ZVLA 2IY7A 2RBEA 3M1AA 3RYCA 4AXBA 1Y1TA 1I51A 1HLPA 2QRUA 2HF8A 1J97A 2C54A 5CA0F 4ESVA 1FDOA 1OZAA 4FD2A 1WM1A 5A6SA 4QLOA 1P1BA 4TYNA 1T5IA 3HJGA 3G2JA 3RJMA 2F1IA 4R41A 4YCDA 4C6HA 1JPUA 1U7HA 4N8SA 4BYGA 4TPKA 5JXGA 3T34A 4S05A 5EVCA 2NP7A 1ORDA 2VJNA 1P1KA 1UKAA 2OD2A 3BDVA 3HLKA 2GCEA 3O95A 4FYHA 4GZ5A 4PU0A 2I3BA 4ALNA 5AI5A 3WX0A 2X0KA 1KFBB 1RE0A 5LKRA 4GWGA 1QGUB 5F73A 3KKPA 1FE8A 4PZ0A 2ODQA 2DPXA 3D3WB 3T3MB 4AT1A 1SZPA 2W8BB 2CD9A 1R0BA 3DBHB 4IXNA 2Q3JA 4B75A 3PX7A 5F7JA 2OXTA 4EUNA 4G25A 2FEWB 4TROA 4DS3A 4IZOA 4JJFA 1O08A 4G41A 3WLFA 5JMTA 1LPBB 1P0QA 3O1JC 4WHMA 5T57A 2POCA 3EGXA 4QPNA 3DFUA 1KPHA 4MQEB 4JT4A 1ISRA 1U8XX 2XOKA 3ROPA 4Q1AA 1UXKA 4EY7A 1Z2OX 2ZVPX 1T9GS 3AZPA 3CTMA 2C3OA 4XUGB 1NZDA 2WTNA 2GYUA 2XEXA 2X77A 2R85A 3R3VA 4GLBA 1ID1A 2F62A 4PGHA 2ZKIA 5KNCD 3D0RA 1Q7CA 3T7TA 3SICE 4KQCA 1AJEA 1FU8A 4LRUA 5EZSA 3MGAA 2OMKA 1QCDA 3AFNA 4IEIA 4XB2A 4QLBA 4GVPA 1V9CA 4WOBA 1A9QA 2VDPB 2YY7A 3I2GA 3JARA 4HWTA 4PW0A 4LFCB 4PG4A 3SIRA 4BJ1A 1CXZA 1GQQA 4QDUA 1CE8B 5HOQA 1QG2A 1MORA 3GOQA 1DZ3A 1ZMRA 4H7KA 4ZAFA 5H1YA 4HXEB 2EF0A 4ZZIA 1G41A 4I46A 3WG9A 5J40A 5HVNA 2D7DA 1YCFA 1CR2A 2QX9A 3TMYA 3LC2O 1RPNA 1T26A 5TPZD 4C3OB 1IEXA 2BISA 3DC7A 4X1KA 4J0DA 4MP3A 3EWIA 5J3JA 1EX7A 2YN2A 3LE8A 1IM5A 2EBUA 4AMZA 4AFNA 2E5WA 2DOKA 1Z6YA 2FZ4A 1K75A 2IVFA 3I73A 3TNFA 3ZE6A 3VU3A 3TVDA 3GPLA 4O0LA 1QV7A 3HCAA 1E3QA 1SMKA 2C0PA 2JRLA 2H2IA 1UQTA 2XBLA 4JX8A 1MQSA 4HFMA 5H81A 3E9CA 1R8JA 2FY8A 1C9NA 1JYEA 3FA2A 4IF4A 3KE9A 2QZSA 1F4LA 2C3PA 4Y3UA 3AOGA 4Q1FA 3VJKA 4G1VA 3OIWA 2HLHA 2AEMA 1JIUA 2HCJB 1CLEA 2H4JA 3E05A 2R7LA 4WLNA 2YYYA 5CDSA 4JJ6A 3SDSA 1RJ9B 3LY5A 5DGTA 2XBUA 2PL1A 2Y1WA 1PFWA 3Q15C 4NECA 1H5UA 3EBOA 1WMFA 4E5NA 4CMIB 4NFSA 4EPTA 3ICPA 1WBBA 3BF8A 1GTRA 3R76A 3EZNA 1ENOA 1SCAA 2YIJA 2G83A 2XE7A 3I6ZA 4IUDS 5BO5A 2YKGA 2XQVA 2PKQP 4JJEA 2V6GA 4KQ6A 3R6LA 4IBOA 3H1AA 1YZNA 4UHCA 2QN6A 2YWCA 1Q83A 1TI7A 4OKSA 4NP6A 4YLGA 3SS8A 1CY6A 1N8KA 1OI2A 2JZNA 4LSGA 4QHTA 4IPTA 4X7BA 4EKNB 3FZEA 4PO1A 4YBZA 1WHSA 4Q16A 4D3SA 4IJQA 5JNSA 2CLLB 2R5NA 3KZMA 1RXCA 4RORA 1Z26A 4EG7A 1U6KA 4G5HA 5D85A 2FETA 1TL7C 3GQBA 2B3TA 3USCS 1F2TA 4QUIA 4YP9A 1L7QA 3B7PA 3H3JA 1PLLA 3DE1X 1X1DA 1X7WA 2OHIA 3Q9UA 3E9MA 4LY9A 1XZJA 4CM8B 2VRBA 3VNSA 1BOFA 3P2KA 4DBLE 3OT1B 3OLWA 4RSHA 3C6XA 1FUYB 3QE4A 4KQGA 4BFWA 4Y6LA 2OXRA 1KR5A 4W1SA 3V4RA 3EISA 5JZSA 2PL3A 1U7XA 1B73A 3NBKA 1H0HA 1YE3A 2REBA 3IB3A 1NVWQ 3NBUA 4UE3S 3VNAA 5C5CA 2Y93A 3L7OA 1W2GA 1X7XB 1HNWB 5K8IA 4Q19A 4X90A 2AYZA 2RI6A 1XZMA 2L2QA 2CMDA 1EGVB 1L4UA 2CLIB 2FW7A 3IC5A 1SQ5A 3G2PA 3NIDB 2I76A 4FKBA 3ZDFA 4ZGBA 2H0RA 3ZWCA 1RABA 3AR3A 4C04A 3OEHA 1YZ3A 3B5JA 4IQFA 1QVZA 3JRNA 2GXAA 1WDTA 5COBA 5AKHA 3NTXA 1AKYA 3G7UA 3ORHA 1A04A 1QUEA 4LF4B 4WX2B 4OSEA 1OU4A 4B3CA 4Z4CA 2IA5A 2REQA 3HVRA 4BY9E 2C9MA 4ZT6A 1D4OA 1KK3A 4XYLA 2C9CA 2A67A 1OGYA 1TC2A 3TRIA 1QGOA 1VE3A 2AW3A 5BURA 1T9DA