3WIBA

Crystal structure of y109w mutant haloalkane dehalogenase data from agrobacterium tumefaciens c58
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
289
structure length
289
Chain Sequence
PHSAFGDGAKAYDVPAFGLQIHTVEHGSGAPIVFLHGNPTSSYLWRHIFRRLHGHGRLLAVDLIGYGQSSKPDIEYTLENQQRYVDAWFDALDLRNVTLVLQDWGAAFGLNWASRNPDRVRAVAFFEPVLRNIDSVDLSPEFVTRRAKLRQPGEGEIFVQQENRFLTELFPWFFLTPLAPEDLRQYQTPFPTPHSRKAILAGPRNLPVDGEPASTVAFLEQAVNWLNTSDTPKLLLTFKPGFLLTDAILKWSQVTIRNLEIEAAGAGIHFVQEEQPETIARLLDAWLTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Crystal structure of the novel haloalkane dehalogenase DatA from Agrobacterium tumefaciens C58 reveals a special halide-stabilizing pair and enantioselectivity mechanism.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Hydrolase
total genus 105
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wibA00
1DINA 5LIPA 4S0XA 1EI9A 4LXGA 4C6HA 1QFMA 1E89A 3WK6A 4F5ZA 3WWDA 4MQMA 5AK4A 5AKZA 4BCBA 1LPAB 5F4ZA 5JD4A 4ZV9A 5KBYA 4HXFB 4X97A 3CCCA 2G4LA 4AXBA 2VTVA 4K6HA 4V2IA 4Z49A 3WYDA 2ZJ6A 4X92A 3B3QA 3R3ZA 1GT6A 3HI4A 1MX9A 1DX6A 5JARA 3B5EA 2GYUA 5CXUA 3S8YA 3FYTA 1LBSA 1IZ7A 2V98A 2XUAA 5AOBA 3F67A 3FVRA 2XQIA 4B9AA 1UKBA 2GBIA 1EVEA 3DJYA 1B41A 2Z5GA 5DLPA 2H7XA 5ALNA 3MGAA 5C7YA 3C70A 2RHWA 5ISMA 2JGKA 3DYIA 1QIDA 2JF0A 3PFCA 3N0TA 5ALFA 2BGRA 4F21A 5AM4A 2XMCA 3R3WA 4TPKA 3TRDA 2PSFA 4KRXA 3H17A 2ECFA 1A8SA 4NVRA 4BC1A 3AJAA 1UOPA 1GKLA 5CT5A 4EY6A 4F60A 3T52A 1FSSA 2QUAA 2JBWA 4OB6A 4B0OA 1JFRA 5FRDA 3AIOA 5CRIA 4BRSA 3I2JA 1QIJA 2WTMA 1VZ2A 3A2MA 3A2LA 1GGVA 1F8UA 1ETHA 1SC9A 5ALHA 3STWA 1DQZA 1K5PA 1QIHA 2QT9A 4WCVA 3GUUA 1YCDA 4HRXA 1X2EA 3ZLUA 5AI8A 3DD5A 2XMGA 2PUHA 1CUJA 2OAEA 4J03A 4DMKA 2EDCA 2CUTA 4KEAA 4C01A 2PU5A 4X94A 4EY8A 1BRTA 4LHEA 2RHTA 1QOZA 2B4KA 1J1IA 4BP8A 5E4YA 3KOOA 1C7IA 4KACA 5CT4A 2VQ6A 3X3HA 3O0DA 5LKRA 2CBGA 3G9UA 1CUFA 5ALZA 2GZSA 4KAJA 3ILSA 4Y2RA 2DQZA 2WJ6A 5CH5A 3FLBA 4G5XA 3UUFA 1CQZA 1WHSA 1TQHA 4A16A 2WSLA 5IKXA 2QUBA 4Q34A 5FOQA 5KREA 1WOMA 4HVTA 5DYTA 3AFIA 5AKHA 1YB6A 3IDAA 5DTIA 3I6ZA 2WHRA 4N8EA 1HL7A 5AI5A 4MEAA 4A23A 1QIMA 2WU4A 4AZ3A 2HA6A 1Q0ZA 1VJ5A 4H7IA 5CH8A 3AZQA 3LS2A 4E46A 3G02A 2GBFA 2BFNA 4DSZA 2QS9A 3DEAA 1PFQA 4BP9A 2WG2A 4UPDA 5LZ9A 2AJLI 4X00A 3LP5A 5BOVA 2VAVA 1W76A 1XRPA 4UHEA 2OCIA 1W4LA 4CG1A 1EINA 1QONA 2R8BA 4ZXFA 5CT8A 5E2IA 2RIPA 3NWOA 3G0IA 3H2HA 3HLKA 5LZ8A 2G5PA 4XWGA 1CUSA 3GBSA 3G0GA 3W9UA 1CUBA 5DNVA 4QLOA 3BE8A 3CCBA 5HZGA 1X70A 3HJUA 5SYMA 4XJVA 1XFDA 2EDAA 1XKLA 3O4JA 3C6XA 5KWIA 2RI6A 2C7BA 1FFCA 3FNBA 3FYUC 2V97A 4Y2VA 3O9MA 4RNCA 3SK0A 2XMQA 3IUMA 2C0QA 1ZGBA 1KU6A 1ZD5A 4FLEA 5JD6A 4ARAA 1AKNA 2DFPA 5AI4A 1Y7IA 1CQWA 2HRQA 4X6UA 3DS8A 5EIEA 1LPNA 1YA4A 2O7RA 1EH5A 5ALTA 2JIDA 4JNCA 3GFFA 1XRLA 2FUKA 5AP9A 1Y7HA 5LZ5A 3HZOA 4DNPA 3ESDA 3VKFA 4K6GA 5T4EA 4KE7A 5A2GA 5ALOA 5EIHA 3WK4A 2XLBA 2R11A 4Y2YA 5AI6A 1U2EA 5EHZA 3GZJA 4B81A 2BGNA 3WKDA 3STXA 2BUCA 2WHQA 3C8HA 3R3UA 4Y2JA 3WKBA 4ETWA 4KE8A 4LIPD 1LZLA 3O4IA 5JZSA 2OGSA 3EQ8A 3R3VA 2XMDA 4Q3KA 1JJFA 3H0CA 3W04A 4ROTA 4K5QA 2VF2A 4BZWA 1XRNA 4UBNA 4WY5A 2H7CA 5CH3A 3RM3A 5ALIA 4MWTA 3PFBA 4BC0A 3W9BA 1BE0A 1EA5A 4WJLA 3VJMA 3VISA 4G4JA 1R9NA 1YSCA 3AZOA 4YASA 3W06A 4INZA 2HU5A 1IUOA 4Y2XA 5LZ4A 2WFZA 1Y37A 1MX1A 3UMJA 5JALA 1TCBA 4UFOA 5EIAA 4HZGA 3FBWA 3FSGA 3O4HA 2WM2A 5CW2A 2HA4A 3F98A 1CPYA 1UWCA 3WA6A 2HHAA 3M83A 3HSSA 2J3DA 4O08A 4ZWNA 2CB9A 4QDZA 2Z8XA 2Y1KA 1HQDA 1I6WA 3R40A 1AC5A 5HF8A 3WI7A 4DIUA 5AKXA 2BUBA 1TCAA 4DMCA 2QZPA 3RLIA 3AUKA 4H7HA 1QIFA 4W1PA 1ODTC 2PSDA 2WLSA 1L7QA 4JYMA 3WLAA 5T4HA 2HL6A 2HADA 4WY8A 2ORYA 1OILA 1XZAA 3WZLA 1P0QA 2V9ZA 1S8OA 3L1IA 4ZRDA 5JAOA 1DT3A 1EK2A 1MX5A 2WIKA 4AN0A 4QE3A 1CVLA 5C8VA 3KXPA 1G5FA 1J07A 3WL7A 4PV7A 2Z8ZA 2B9VA 3C8DA 5AK3A 1HDEA 4QWMA 3EBLA 3MUOA 5K3EA 1TCCA 4C89A 4MXDA 2Y6VA 3EQ9A 5A7GA 2AJCA 1CUEA 4QA9A 2PKYX 1SOMA 3N2ZB 3M81A 4M0FA 5AIBA 3D2AA 4EY4A 5AOCA 4J3JA 4EY5A 4OD0A 4H18A 4X95A 2G5TA 4OPMA 5D7BA 4WFIA 2ZSIA 2WHPA 4B7ZA 2OXEA 3ED1A 5I7UA 3MVEA 4U2GA 3V1LA 3L1JA 1ORVA 4AB1A 4EZIA 4DSAA 3FCXA 1XZMA 4KAAA 2BKLA 4PSCA 2PL5A 2EEPA 1G42A 4J0GA 3RARA 3TEJA 1RWQA 4BE9A 1ZD3A 3ANSA 5AICA 1QIKA 3F97A 2XUDA 2XLCA 2Z3WA 4GHWA 1SCKA 3D3NA 1ZIYA 3I2HA 2WIDA 1JMYA 3SWWA 1EXWA 3E4DA 4HS9A 1XRQA 2WHPB 2QVBA 2PX6A 3G0BA 1R1DA 1XQXA 5CURA 2I3DA 5AOAA 3E1GA 2WJ4A 4EUSA 3BDIA 3OM8A 4QDXA 5IH7A 4J0CA 1UZAA 3H19A 5EGNA 3YASA 2QXUA 3AILA 1EHYA 3DKKA 3IULA 5JAHA 1MO2A 2DQYA 3IUJA 1AZWA 4WFKA 4EHBA 4UBMA 1WPRA 1CUXA 1VE6A 2YASA 3KWJA 1XZGA 4Y2TA 1WCYA 5ALDA 3G9TA 4FBLA 4RE6A 2XUIA 4W1SA 4GLBA 4L3WA 4UUQA 5K5EA 3HABA 1X2BA 2HFKA 4L72A 1QIGA 5ALJA 4E11A 3BF8A 3WKAA 1BROA 3RKSA 5JATA 5JD5A 1XRMA 4HTAA 1A8UA 1CRLA 1DT5A 3LCRA 3R3YA 4C4XA 1U65A 3P2MA 2YH2A 1KU0A 4CI9A 2O2HA 2Y6UA 1EDEA 3QZUA 2JGEA 1QGED 2OQVA 1QE3A 2XUJA 1XZFA 4HAIA 1W1IA 1VXRA 3QMMA 2XUHA 2GBCA 3I6MA 1J06A 3AZPA 2HRRA 3IIIA 2XQJA 1YASA 2JEZA 3I1IA 1EK1A 1IVYA 1K4YA 3VDXA 5KWJA 4JH0A 2RONA 2BAGA 4WDQA 4BCDA 1CR6A 2X5XA 3C87A 2VATA 4E15A 1CUVA 3HEAA 2DR0A 1LPMA 3CN7A 3H04A 4FMPA 1ACLA 3W2TA 4RGYA 3TGLA 3I1YA 3WK7A 2DHDA 2HU8A 2YYSA 4H7KA 1LGYA 1AUOA 1C4XA 3H2JA 5D3ZA 1E66A 2OGZA 1FJ2A 4X7BA 4GECA 2XB6A 4DM7A 2PU7A 2ZJ7A 1UK8A 1UK6A 1SCQA 2WJ3A 1MT3A 3K9BA 2WILA 2VJAA 1GQSA 3ZWQA 1FFAA 3CN9A 5FP0A 4UHBA 5AKIA 4BTLA 2WIJA 1PJAA 2OCGA 1CLEA 2G63A 3DKRA 3C6ZA 2HA7A 2ACKA 2OCKA 1D07A 4B82A 2XUQA 3C6YA 4OB8A 1TIBA 4Q05A 4H7JA 2OG1A 5HCUA 1OXMA 3W05A 4MYSA 2VT7A 3EF3A 1H23A 3CXUA 3FLAA 1GPLA 2ZYRA 3QMVA 5I8PA 3HYSA 3PICA 3BJRA 1BU8A 3FYUA 5D3KA 4FFWA 4AX4A 3VVMA 4OCZA 5HKBA 2ZYIA 3WK5A 3DL7A 2XE4A 4B6GA 4QLAA 2D0DA 1IZ8A 4Y2PA 3JWEA 4MWSA 3I2GA 3ZI7A 2QJRA 4G9EA 2VEOA 3M3DA 2OPHA 1R88A 1XQYA 1HPLA 3F9CA 3IURA 2XUPA 4HRYA 5SYNA 3RK4A 2W6CX 1UT6A 1GPKA 5ALWA 5ALXA 4FFVA 1MTZA 4CCYA 3FYUB 2QR5A 4G9GA 2AJBA 3WK8A 2HA3A 4Q82A 5JANA 3PI6A 1QO7A 4DGQA 5DYYA 1UK9A 3WWEA 5LZ2A 4PO3X 5DWDA 1JJIA 3MUNA 5IVIA 5A62A 2PSHA 4G8DA 2HDWA 3QPDA 5DJ5A 2JEYA 4Q3LA 1NU8A 3PF8A 4ZV7A 3OC0A 4FTWA 4PQEA 2HA5A 1XRRA 2FJPA 5DNWA 4XVCA 2GYWA 4BDSA 2CEKA 4CCYB 2XQGA 2XUGA 1XZHA 2DCMA 3IUNA 5HK9A 4QDUA 4FOLA 4OSEA 3UUEA 2WUFA 3ICVA 4CFSA 2H9YA 1TRHA 1BCRA 1UXOA 1TKRA 1WM1A 3R0VA 3V1NA 5C8XA 1AMNA 2PSEA 3QMWA 1BS9A 4OU5A 3O95A 3WL8A 1VE7A 2FX5A 1H2WA 3IVMA 4DNOA 4FHZA 1GQRA 3T4UA 4Y2SA 1IUNA 4LKOA 1YR2A 3QPCA 4AQDA 3LIPA 1VLQA 3QVMA 1L7RA 5AK5A 2QXTA 1PV1A 4C4ZA 1XZDA 4W1QA 3SC2A 3PDCA 3ZPXA 4J0JA 1DWPA 1MAAA 3OOSA 2PUJA 3A6ZA 3QM1A 3U1TA 3I2IA 5AI9A 5AKLA 4JUIA 1E8MA 1WB4A 4CIAA 1UOQA 5K3BA 5HKAA 3C5WP 3B12A 1AGYA 1R3DA 1U4NA 5HF9A 2ONCA 1LNSA 4K6KA 1XZIA 5E4JA 1UFOA 4KJXA 4BVKA 3V9AA 4N8SA 5H3HA 2NW6A 4GW3A 3BJMA 2J4FA 3WKCA 2AJDA 2VJCA 5FXMA 5FDFA 1E3QA 1ZI8A 1FFEA 1G4HA 1WB5A 3BXPA 3IUQA 4YK7A 3F8SA 4J0IA 5EHQA 1O6FA 4XX1A 3H2GA 4BBZA 6YASA 1WB6A 3ICWA 4DYHA 5HFAA 3NUZA 1BEZA 2WIFA 5ESRA 4UHCA 4FLMA 5CXXA 5ALRA 1N8SA 1QFSA 1CUGA 4OYYA 1E5TA 1SFRA 4IH9A 2B20A 3BIWA 4A5SA 2WUEA 4P08A 1R4ZA 3G9XA 1IMJA 4C88A 2OCLA 4IQ4A 1T2NA 3WMRA 5JYCA 1XLUA 3ESCA 4X6YA 3BWXA 1DQYA 5T4FA 1R9MA 1ZI6A 4WDRA 4GDMA 1NX9A 5LZ7A 4ZI5A 3DOIA 4AO8A 2X8BA 5A7FA 1A88A 3KSRA 2VT6A 2WQZA 4U2FA 1P0MA 4GEGA 2ZYHA 2X76A 2JGJA 1EX9A 1EB9A 1QTRA 5LKAA 1O6GA 1CUUA 2D5LA 2FJ0A 3WZMA 5I9IA 4CIBA 3FLEA 5FPPA 1CUAA 2IX9A 4PNZA 3OURA 4G4IA 3C45A 4I4CA 4D9JA 4M0MA 1T4MA 3WWOA 5BWCA 1VXOA 3D7RA 3U0VA 1YA8A 1XROA 3H2IA 2BUAA 2ROQA 2OLEA 2PPLA 4H7DA 2GYVA 4BDTA 2DHCA 5HFNA 3VJLA 1GPNA 3STUA 4JEIA 1ACJA 5CMLA 5JAPA 2HU7A 1A7UA 4Q1VA 4Y2UA 3WYNA 1W75A 3D0KA 5JZ9A 1AX9A 1L7AA 2VJBA 4MQLA 2WFLB 4BCCA 3VXKA 4UBOA 4BAGA 1XZCA 4B83A 1THGA 5JASA 1THTA 5FPQA 3G7NA 4IHAA 1XQWA 1XQVA 3PF9A 4J0HA 5EHNA 4UBIA 4G1FA 3NGMA 1BEEA 3LIIA 7YASA 4YX9A 4J0DA 2DSNA 4LYDA 4GWLA 2VAXA 3STTA 2V96A 4H7EA 4WFJA 3G0DA 2XMBA 3G8YA 3K6KA 4BTVA 1N5RA 1U8EA 3FVTA 2BJHA 1DU4A 2ACEA 2QMQA 5K3AA 1YAHA 3HXKA 4CG3A 1XZBA 5DYWA 2AXEA 2PM8A 1B6GA 4L0CA 1BN7A 4L9AA 3QYJA 5AHXA 3OTQA 3WJ1A 5JADA 4UHFA 1ZJ5A 5AM2A 1GXSA 1YS2X 5AIAA 2XUFA 4PW0A 3O4GA 5FV4A 1E8DA 5CTAA 5FLKA 4PSUA 2HA0A 2VSQA 1EDDA 5IVKA 2XT0A 5ALUA 5ALSA 4X91A 4KAFA 2CZQA 1LPBB 4MYDA 2CJPA 1QLWA 5D6OA 3KD2A 3D5EA 2C0PA 2XQFA 2Y2UA 5BWBA 5FUMA 3WWPA 2XMSA 5J3JA 1M33A 5AK6A 5A7HA 3GROA 3G0CA 3ZLVA 3BF7A 4UHDA 2YXPX 2OAGA 2HA2A 3LLCA 1E8NA 5ALLA 4BB0A 5ALEA 4KYVA 1QIEA 2QOEA 5ALYA 4W63A 1ORWA 3BIXA 1LLFA 2ZJFA 3FCYA 1LPPA 1VA5A 5AM1A 3WJ2A 4GXNA 4LXIA 2H7YA 1UK7A 2JGMA 4DMFA 1HBJA 4X71A 5AO9A 2HFJA 1G66A 5HK8A 2XQKA 4EBBA 3PUHA 2HIHA 4KRYA 5HQ3A 4DLNA 4Y9SA 2C4HA 2W22A 4N5HX 3V1MA 4G4GA 4BZZA 1BN6A 5DTJA 1CIJA 4AO7A 4RPCA 4G8CA 4AN1A 2IIVA 5IVDA 1ODSA 3D2CA 1YAJA 4BVJA 3IB3A 4DTCA 4LXHA 1CEXA 2WUGA 2Q0XA 3WK9A 4ZREA 3EQ7A 4C87A 1JT2A 4AMZA 4ARBA 1CV2A 4UFPA 2I3ZA 4QNNA 1JKMA 2K2QB 4N8DA 5HF6A 3WKEA 3V1KA 1CUYA 1ZD2P 4BATA 5HQ3B 1Q83A 4EY7A 4TVKA 2ES4A 3ANTA 1VZ3A 4AMYA 3PE6A 3M82A 3E0XA 3IBTA 2Z3ZA 3FOBA 4BRZA 2J4CA 4MEBA 3DYVA 1ISPA 2QJWA 1LPOA 1MNAA 1QTIA 5CT9A 2E3JA 5LYYA 4UHHA 3IA2A 3ESAA 3DOHA 5ALQA 4U2CA 1ZICA 1CFJA 4Y2QA 1R50A 3OPMA 4KR0A 2WIGA 4NS4A 5A71A 1CUWA 3AINA 5AKYA 1QO9A 5AI0A 1CUHA 3FSGD 3QPAA 1CUDA 4C4YA 1EDBA 1JU4A 4X90A 2J3QA 2WTNA 1H2ZA 2WFMA 2IITA 4FWBA 2WG0A 3A70A 2XUOA 4YPVA 4H7FA 1RYYA 3AIMA 2QM0A 3OG9A 3WA7A 1XLVA 3L1HA 1HLGA 4H77A 3SX4A 4H0CA 1XLWA 1P0PA 5BV7A 5AKJA 1K63A 1CUIA 4G8BA 1UKCA 4W1RA 4P93A 1YB7A 2ZSHA 1WPXA 1H2XA 2LIPA 2PVSA 3VVLA 2QTBA 4BVLA 3QBJA 5AH0A 4F0JA 4CCWA 4FKBA 3DNMA 2WU3A 1NU6A 1WHTA 1RP1A 4IH4A 4M0EA 2WKWA 1ZJ4A 5K3DA 1ODCA 1BCSA 4TGLA 2XDWA 3I6YA 1XKTA 4DNQA 2RGUA 3ZV7A 1OCEA 3H2KA 5YASA 3BDVA 2GZRA 2XUKA 5ALPA 3I2KA 2VJDA 5E4TA 4GBGA 2I03A 3DLTA 4RE5A 1ZIXA 1H2YA 1MU0A 1YS1X 4X93A 1J2EA 4OYLA 1FFBA 3O9VA 4B9EA 4DMHA 4MJ3A 1LZKA 1EVQA 4OU4A 3H1BA 1DTEA 2AJ8A 3WL6A 3QITA 4B84A 1MN6A 3JW8A 2BCEA 5JZBA 1UKAA 2XI4A 1JI3A 2OGTA 4B80A 4BYMA 4DNFA 4X3CA 1LBTA 2CKMA 4I3FA 3G9ZA 5AKKA 5FKJA 4QZVA 2QRUA 3H18A 4FLFA 4FNMA 4HXGA 2OQIA 2ZVDA 3C43A 4PF1A 5EFZA 4XIIA 2PBLA 5CT6A 4PSDA 3WWCA 5CBKA 1F0PA 5DNUA 1A8QA 5AKGA 1MNQA 4X85A 1VKHA 2JGIA 1F0NA 2H1IA 5A6VA 3FAKA 3BL8A 3VJKA 3C5VA 4H35A 2XMZA 3C6BA 2C5GA 1TAHA 4JYPA 3TJMA 3HACA 3DCNA 2P8SA 3D2BA 4UBJA 2B61A 4UFNA 1XZLA 5ALVA 5K3FA 1DWOA 4U2EA 5K3CA 1AQLA 1ZD4A 1LPSA 1DWQA 3DDUA 1FFDA 2I78A 4ITVA 1W6RA 2RAUA 1KEZA 3Q0TA 2O7VA 1Q0RA 2VA9A 4QWWA 1H22A 2CMFA 1SCIA 3I28A 4K2AA 4I19A 1MAHA 2HM7A 2O2GA 1USWA 1VA4A 1QJ4A 4UBKA 1EB8A 2WUDA 4NZZA 1QIIA 1VOTA 4IO0A 3WIBA 4ZGBA 4N5IX 2QKYA 5IVHA 5LP1A 3I2FA 1ZGCA 1K8QA 4U2BA 4B85A 3S2ZA 1DX4A 5LLSA 3KWFA 5K3FB 4QDOA 2UZ0A 3GA7A 4HXEB 3A2NA 5ALMA 1IUPA 3F96A 1MJ5A 2GBGA 4OB7A 3Q8WA 2WFLA 5HF5A 3D59A 4LYEA 2WG1A 1JMKC 4B0PA 1ZI9A 2ZYSA 3R3XA 5T4BA 4X6XA 1JJBA 5C8ZA 3ZLTA 3JYHA 4EB0A 3ESBA 1TK3A 2DHEA 3QH4A 1UOOA 4FBMA 4AZ0A 5JAUA 4UBLA 3D4LA 1N1MA 4NMWA 1CUZA 5C81A 1ZOIA 1Z68A 3E3AA 4CG2A 1C7JA 4FDMA 3K2IA 3NOXA 2C5FA 5JIBA 5AKEA 2XMRA 3DL4A 3DQZA 5AM0A 2Y2VA 5AJHA 3STYA 1GZ7A 2C58A 3WQHA 4OUKX 5ALGA 1Q84A 4QDTA 2O2IA 4BAZA 1XZEA 4J0KA 2JGLA 4P92A 1CUCA 5EI5A 4QEKA 1JU3A 3V48A 2JGFA 1AURA 1GKKA 1K6EA 1HKHA 4AO6A 5AM3A 1N5MA 3HRHA 1MPXA 4KE9A 5AM5A 4J7AA 1F6WA 3H1AA 3PUIA 4W9RA 1XZKA 5ALKA 4FNGA 4IH1A 1P0IA 4GI1A 3HC7A 1XZJA 2PSJA 4KE6A 4Q3OA 4U2DA 3WL5A 3WIOA 4EA6A 1W52X 4E14A 3STVA 3FWHA 1QZ3A 5EHXA 3EIOA 4P9NA 4BAUA 3R41A 4BE4A 3KDAA 3GELA 4Y7DA 3AIKA
chains in the Genus database with same CATH superfamily
1DINA 4OGKA 4W8OA 3IODA 4PYIA 1BXGA 4XTCS 1EI9A 1Z0AA 4LXGA 4C6HA 5JS7A 5D7NA 1ZR2A 1E89A 1KQGA 2XOKA 4I6JA 3BK1A 4MQMA 3ADKA 1SC4A 4D46A 3Q9LA 3QOFA 1NBHA 2XB4A 1LPAB 1K4KA 2FFRA 2ID9A 3M4NA 3TQCA 5JJCA 5F4ZA 4Q02A 2O6LA 1SKYE 2YUTA 5EJIA 2QQFA 4FE4A 1WV1A 2OG2A 3W90A 5LQDA 2XSZD 4X97A 3K09A 3MTIA 3ZE2B 5GTDA 4BNFA 4NBRA 4FOTA 3QP9A 4CVNA 1E1KA 1PNVA 721PA 3H5VA 1GRNA 3NHJA 4LHXA 2BMFA 3BXZA 1FC0A 5GZ6A 1OZ0A 4FEEA 4PCVA 4QC2A 2EF0A 2F3SA 1E94E 1H1LB 1W4CA 2VYFA 4NR0A 3S1SA 3ZJUA 3T3PB 5B55A 2I4LA 3KWMA 3ZNPA 4DDTA 4C7OB 5BN1A 3AKDA 3MCTA 4KSBA 1T3GA 3GJ3A 1V0JA 1DC5A 1OLXB 1JR3E 1U80A 3FPFA 1DX6A 3F2VA 4FWTA 2VDWB 3MJVA 3KVVA 5CXUA 3COSA 4HH1A 1JBEA 3L1UA 1XAJA 4EKGA 3S8YA 1JYFA 1D6MA 5DP1A 5G0TA 3FYTA 4Q9JA 4TYNA 3K92A 3QVVA 4J2TA 2P9TA 4O2AB 4ECAA 2D7JA 5ITVA 3F67A 1AUQA 1U9YA 1U8UA 2QG6A 3ZW9A 4B9AA 2UUBB 1Z4KA 4MRAA 1V11B 4NENB 4G8JA 3TLEA 2VK4A 3FTNA 3V6LA 4JGBA 1ATZA 2IY8A 3M34A 1FLAA 1E64A 1PWXA 4OIFA 3DJYA 1B41A 3VZDA 1XELA 2O5EA 3KWLA 5DLPA 3W3AA 3CRRA 3AI7A 5JSUA 2XYRA 3TIIA 2WSYB 3C70A 1UBRS 4ZOLA 1VBKA 2JGKA 2QD2A 3DYIA 4XI9A 4CWAA 1NUAA 3MAJA 3I5UA 1NL3A 3G6KA 4BFUA 3WO0A 3HVHA 3N2YA 3AF5A 4JR2A 2DUNA 2H18A 4KXYA 3ZCVA 2QW8A 3PFCA 3AUUA 2EFEB 4C78A 1F0KA 2E4YA 3PRKE 2H85A 5ALFA 1U8CB 4DLYA 1H5NA 5KWEA 1VKJA 3U7FB 2R8RA 1ZU5A 2P9BA 2A5JA 3KJQA 3R3WA 4H3SA 3V00A 4FW8A 3KZCA 6Q21A 5LQJA 3AUTA 4X0EA 4B6QA 4KRXA 3H17A 1Y6QA 4NVRA 4UU7A 1VHJA 1LBIA 1YRLA 2YQ5A 1UPTA 4ZQEA 5MN6A 5FFMA 1F3OA 4W4TA 1I6KA 4Z1OA 5LM3A 5C1IA 3AJAA 4KMOA 5DHPA 3Q10A 3VAZA 2VCEA 4EWLA 2IZ5A 1JB9A 3CLTC 3EVDA 1WXGA 1K3UB 5CT5A 1NV8A 3AKEA 1BWPA 5EJ2A 1ZK2A 1I14A 3IV7A 1W5BA 2QUAA 3AY0A 1VQ1A 5CB4B 4NE9A 4FGZA 4Z9YA 1KSFX 1CNFA 1NJFA 1NVDA 2RHJA 4V2UA 4UMVA 2JBWA 2KBEA 2Q3HA 4I1IA 2K6GA 4WA7A 4D7AA 1Z4JA 4OB6A 3TF5A 3DCYA 2O19A 3CRZA 2O3JA 3MOIA 3S55A 1EFRA 4C0LA 2GFHA 3DLIA 3UJPA 3KOZA 3N86A 4GRDA 4IF6A 4OH1A 4W8HA 3I2JA 3PPYA 2O5VA 5KYUB 3AOGA 2IY9A 1K89A 2QNRA 4OX9B 2AR0A 5EMKA 3UCXA 3A2MA 1MGPA 1PL7A 1QPGA 5B7NA 1TYCA 2DETA 2R9VA 4TKLA 4LYHA 2WU1A 3DE5X 3MILA 2IHBA 5A2QA 1K97A 1MOSA 2P9FA 1QIHA 4CDMA 4WCVA 2NO6A 5F33A 1CXZA 2G67A 1LEHA 3CUEF 4DQXA 2CLCX 4U7HA 4JLNA 3ZLUA 2Z1NA 4JJZA 3V4PB 1C3JA 3RUPA 1GPMA 1LCIA 3GH1A 3OZVA 2O8NA 3PA6A 4K0KB 3MGGA 2ACWA 3M1LA 3C39A 3FTQA 3FN4A 4JJAA 3HUDA 3ICQB 1CUJA 1ZXBA 2OAEA 4WAUA 4H0FA 3DZBA 4BNUA 3D6FA 3P4XA 4C08A 2GN9A 2IVZA 1CYEA 1TECE 1AVTA 2ENWA 3DE4X 4F6RB 4WXMA 1RMQA 1TA9A 3WDSA 1MV5A 3N8DA 4ETMA 2Y0BA 2Y3IA 2IY7A 4KEAA 4HEQA 4YAIA 3MMXA 4LJ4A 1BX1A 3PXCX 3SYKA 2FGKA 5KTNA 1U0GA 3RIEA 3MNFA 5JWOA 4YT8A 5D00A 4FYXA 4X94A 3HCWA 4ZVVA 1WDWB 5FR1A 5JEDA 4UEQA 1SAYA 1JHPA 2RHTA 3HCOA 3NV9A 4B3RB 1XXLA 2B34A 1SURA 1QPBA 2O5CA 4CGZA 2HWWA 3INNA 3KOOA 2B94A 3E35A 5IUNC 4WCFA 3EX7C 4Q6BA 3W5VA 2PUWA 2VQ6A 3IESA 3EGWA 3X3HA 3O0DA 1CWUA 2BZ1A 4JB0A 5DDIP 1EGHA 1A4RA 1Z5PA 3IE2A 4J0QA 1VIYA 4F12A 1YA6A 1P2VA 5G53C 3G9UA 3R7SA 1Z13A 4BMDA 1ZRNA 3OPNA 2JLSA 5BUSA 5ALZA 3NO4A 2AF3C 1B93A 1GL9B 2ZDGA 3A05A 2GZSA 3ICOA 3DXZA 3ILSA 4MQFB 4REMA 3ACDA 3BRWA 2WV7A 2WJ6A 2YHIA 5CH5A 3P2JA 4UMFA 3TBKA 4YRSA 4CEHB 4FHFA 3UUFA 4DCSA 2PRSA 2H4XA 1CQZA 1X7XA 1FP6A 3B1XA 2YR0A 4I9UA 3G8AA 5BNWA 4KO3S 3KETA 1SUEA 1T6XA 2ZRJA 4KV9A 5ESXA 1XDZA 3X2FA 3L8GA 3DEFA 2GERA 2HLDD 1WOMA 2YZ2A 2H1OA 3E9YA 1A3CA 1SD2A 3TL6A 1CQIB 1MO3A 1W59A 3Q3JB 5C0OE 2FG6C 3GP5A 4CDRA 3AFIA 5HVNA 1NONA 4YQZA 1BMTA 4FGUA 1JQ3A 4KIJA 1YB6A 3D6AA 1YZFA 3IDAA 3F3KA 2JKVA 1RKBA 4UULA 1NQVA 4N8EA 2CT8A 1HL7A 5LIRA 1DJNA 4I4LA 3QNMA 1NBEA 2IW3A 4P6VF 2VWQA 3L05A 4L78A 1T6ZA 1H3FA 1PBTA 1QIMA 2BFWA 4WLVA 1R8QA 1A9SA 4FGJA 2I67A 1WCV1 5DV9A 2AMVA 4C14A 2RH4A 3L7CA 4BFCA 2FX2A 4K7JA 5ESWA 3UKDA 3RVSA 1M1NB 4Z9XA 2X0NA 2GBFA 3C24A 2WNSA 3HSKA 4ABYA 3TSAA 2B83A 2PH5A 3LWZA 5LB2A 5EYPB 5LU9A 4CKXA 4CEJA 2ZTVA 1O5TA 3FZQA 4DZTA 3ZHBA 1N6LA 1UEXC 2FPSA 4LXTA 2IRWA 5HILA 4X00A 1MABA 4OKSA 4WCFC 1IPFA 1TEHA 4HEHA 4ZVSA 3OZXA 4LC0A 4U7GA 1PJQA 1SA0B 2GJSA 4G26A 1VLZA 3ZHOA 3ZEIA 2XD4A 1L4HA 3KPUA 3GLIB 3BREA 4G5HA 5FPHA 1W36C 2F6RA 4GGMX 4XEUA 4O59O 2XPCA 4MB6A 3LQ4A 5A9TA 4DC1A 4EOGA 2FETA 4YRQA 5C51B 4J07A 1TF7A 5CFRA 2R8BA 2ZAMA 4FGSA 1G6OA 4LTDA 3AT1A 4UUAA 3O8OA 2GEDA 4ZXFA 4DSUA 3VNVA 2AR7A 1XTPA 5CIWA 4L07A 5CJPA 5E2IA 5FEUA 3E1SA 3SQMA 1PS8A 1SBQA 2XITA 3ER9A 2ZBGA 3PJGA 1ZCBA 3G0IA 4ISBA 3H2HA 4L15A 4ZQBA 3RSZA 1I33A 1X80A 2JHPA 3QVJA 1Z74A 1O87A 3I09A 3V4SA 3G0GA 4Z8YA 1UZMA 1X1SA 2M9MA 4DXHA 1GSOA 4B76A 4UE2A 2BHNA 4O2BA 1M67A 1KY2A 3K0FB 4I3GA 1E1QD 4IIYA 1MQSA 1RM3A 3B1JA 3CCBA 1OIXA 2D5CA 4HGOA 3RVKA 4CLHA 4UKDA 1Z3CA 1V8OA 2HBRA 4N47A 3OQOA 3NWJA 4EG8A 1E61A 3PUJA 5EWLB 3DTVD 2PYDA 2YW2A 2B21A 3PCTA 3FROA 2QMHA 1XTBA 2FQ1A 3O4JA 3PS9A 4B17A 2APJA 5KWIA 3ET5A 1I2ZA 5FLYA 1UCFA 3FNBA 4MUYA 5TMBA 1YBAA 2PWPA 1NTOA 1E1DA 1WKVA 1ZNWA 3ZX4A 3P4YA 4MHTA 3FYUC 4TV9B 1W0JA 4P4TA 3ROZA 4ND5A 2ADOA 2ZIAA 3BD6A 1M1XB 2XGMA 3AP1A 3AEKB 3TXAA 3T61A 3A9CA 4LSZA 1WP4A 2B2CA 2JPDA 3KXIA 1POXA 2ZRNA 3IQGX 4RVOA 4IIEA 5JD6A 1JW9B 3B82A 3KOMA 4CT4B 3SZMA 4BQIA 2EBHX 1NKVA 4EGAA 1NZJA 2Y1XA 3PGMA 1J8MF 1ZKMA 2J3EA 2FDRA 2Q2NA 2QLFA 3DR3A 3KP1A 5H81A 1PWZA 2RDMA 3MRXA 1Z6GA 2AOXA 4D4JA 3DAOA 3HHEA 3SYLA 1Y7IA 2CNWA 3G2HA 4CEIA 3SHVA 2HRQA 1QOQB 1Q0PA 1DAOA 3DS8A 1JQDA 1DXQA 3JTEA 5J4HA 1EH5A 7REQA 2HU2A 2FFQA 3SHQA 1BX0A 4C03A 1FDOA 1XRLA 3GFFA 2ACVA 2QTWB 5LZ5A 1U9IA 1T9KA 3RFFA 5HQJA 1V7ZA 1ENZA 3VKFA 3TOCA 4GP9A 4HPWA 2HOQA 3N7UA 3SJZA 1QR6A 3V1TC 1KQFA 1DFIA 2H4HA 3NT5A 3MAAC 5DHUA 1FQWA 3DKVA 4MA5A 4R1QA 4RETA 3NPMA 3VR3A 1J6UA 1JE1A 4MH0R 4KDFA 1H0RA 4XIYA 4J1TC 5EIHA 2O0JA 2GS9A 5CM9C 5BN4A 3JAMA 1OSNA 3OE4A 2ONJA 3OIFA 5L40A 1SCUB 4YJ3B 1M8KA 2OYCA 4GDFA 1RKQA 4J0EA 3GZJA 4AY4A 4TLLB 3AUFA 2BGNA 4LJYA 1JHDA 1ECPA 4NBWA 3H5WA 1XB2A 4IDDA 1GUYA 2F8MA 4JJ8A 3RGGA 2LP4Y 3W34A 2HPZA 3VZQA 3RRBA 3C8HA 1G6HA 3EZ9A 4Y2JA 3SS7X 3UWKA 3PQEA 3EN0A 4AS2A 1QE0A 3QLJA 2GXAA 1MJNA 4CKZA 1I24A 3O4IA 1TM2A 4J76A 3UWPA 2OGSA 5JPDA 3EQ8A 3UJ3X 3H11B 1T8TA 4JFAA 3G2IA 4CTMA 3IAM6 1JXMA 3I01M 3T7JA 4KPYA 2XMDA 1JJFA 4G0YA 1JQKA 3EXFA 4HDKA 1FCJA 2F17A 2Z83A 4TYPA 2VF2A 3TQFA 4Q12A 4WADA 4EITA 5FBKA 2JJ1A 4ALMA 1J8QA 4EG0A 1E62A 1XJ0A 1EP3B 2VS1A 1SVUA 3BG5A 1YDGA 1PW7A 4CM4B 2IS1A 2BEWA 5HBGA 1UMCA 3NW9A 1P4JA 1YI8A 4B3SB 4LSWA 1ODLA 3F8WA 2LV8A 5E3HA 4I36A 1Z7YA 4WJLA 3H83A 5B1EA 3KKPA 1SZJG 2O7SA 1CE8A 3Q7RA 3DE7X 1EQ2A 2R6ZA 1ZCZA 1POWA 3SDBA 1YSCA 2PN1A 1J0DA 1MEJA 3CTMA 4RBNA 3UMVA 3A0UA 5IU6A 1AUXA 3H5TA 2HU5A 4IO1A 2COEA 4INZA 1IUOA 3F6CA 4A4DA 3FOWA 4BKOA 1YU9A 1G4UR 3N0VA 1OXXK 4MVJM 2PSSA 4DQLA 1L5WA 1QX3A 2F7SA 3V7YA 3J7AC 2R68A 1MX1A 3CZ9A 5FOTA 1DV2A 1ZGGA 4MGKR 3QQPA 1XOIA 1U8ZA 2X0RA 3L8CA 3LPLA 1LSJA 1TCBA 2WKRA 4WK2B 1JPNA 1YULA 3EE6A 3QPUA 4UFOA 5KAPA 3BQMB 3U9LA 2YMPA 4JQOA 4HZGA 3S1AB 2DERA 3GZNB 1L7OA 3NHYA 1PEYA 2WM2A 3QBDA 2I2DA 2X77A 1YCFA 4OQXA 3QPWA 1CJTC 2OZVA 4YRJA 2QRNA 1N7IA 2WF7A 1H2EA 1JHZA 1JA0A 2AK3A 5FFNA 3WAJA 1F4VA 2A7QA 3Q3CA 4HX9A 1JSLA 4Q21A 1Q20A 2C9MA 3N9IA 3R44A 1PDOA 2QMYA 3D4NA 3M83A 1L5HA 3RC1A 1DV1A 4ABTA 2HXGA 1Q15A 5E6RB 1I30A 1VMAA 1M10A 2XOKD 1RRPA 4LQ4A 1E4YA 1X7ZB 1NVAA 1XYYA 2HWXA 2Q3JA 1EE1A 2QDXA 4NYMQ 6CHYA 3H9UA 1UPAA 1V8ZA 2AEFA 3ZLBA 4CQMB 5KDDA 3G88A 4NPAA 1KP2A 1WD5A 2G1PA 3A9SA 3JD2A 1DTWB 5HJEA 2QTHA 3D43A 3JCZA 1C30A 4FK8A 1UJBA 4LRXA 1OI7A 2I6TA 4U5QA 4YRFA 1TCAA 4C30A 3QX8A 2R2AA 1YQXA 3HPRA 4RGVA 5H02A 1U3DA 3OPYI 4RQAA 3UC9A 1U28A 4P81A 5BV1A 2VUUA 5CEEA 1K2WA 3E7PA 3ILVA 2VJNA 4LYYA 3TTYA 4TV8A 3P96A 1WW8A 4N7RA 1ODTC 4D6PA 1SCBA 2FW6A 2D2IA 2PX0A 2WLSA 3EDOA 1SU6A 1FDIA 1J0EA 2WKPA 4QOGA 5CX4A 4L95C 5I47A 1P9NA 2BGJA 3SP1A 4PHTA 2QSYA 4PQFA 3OE5A 2GXUA 2XYHA 3UQYS 4GX0A 3C41J 1RW4A 2OHVA 3PPIA 1WABA 2B8TA 1JMVA 1GN8A 2ZKIA 1DHRA 3K2QA 5HM8A 2NSDA 2EW8A 1JZQA 3K9HA 3WZLA 4DVGA 4Z7QB 2PGNA 3LW8A 3OFVA 4BBPA 1EX6A 4L3OA 2HY7A 1EK2A 1MX5A 4MV8A 3D2LA 4PXAA 3O4FA 5C8VA 1CVLA 1E2PA 1E1MA 1P5ZB 3KXPA 3NVAA 4QD3A 2D4AA 2D00A 5C5IA 3WL7A 1GLVA 3IAM1 2GAJA 4PX9A 1VJCA 4M0UA 4WZAB 2Z8ZA 4CFYA 1TM7E 4XARA 3W3AD 3KUDA 4U9IS 1BH2A 2DUUA 3PUYA 1XWFA 1Z6YA 4M60A 1EFHA 1A8IA 3R8FA 2WZCA 5FO1A 2HQOA 1UBLS 1CR0A 4BZPA 2VF8A 1CR1A 1GPDG 4IJMA 4GZ6A 4CM8A 3A7DA 1UAAA 4M22A 1AKEA 1V16B 1ZO8A 1TO1E 5AK3A 1SUAA 2OQRA 3EBLA 3NUGA 4IFBA 1RC8A 2HSZA 4K46A 4WHMA 1TIKA 2J6CA 3PVCA 5LBTA 5I4BA 4GGPA 3IPYA 5K0GA 5KJFA 2D6FA 4RQUA 1HYQA 4EGQA 1TCCA 2Q1TA 4OK6A 1TLLA 1O7JA 1NVVQ 4RK4A 2Y6VA 4W7SA 3S27A 3SKXA 3QX3A 3E7DA 3JX9A 1ZUWA 3P52A 4LDAA 1DKRA 3N2GB 1R0RE 1F7UA 3WHIA 1F5SA 1L5SA 2JASA 4S0ZA 8OHMA 4A82A 5LD2B 1QORA 3KL2A 3R23A 3TSYA 1GTMA 2PKYX 4ZEOA 4LTNA 4QASA 1U28C 3M81A 1FSFA 2IOFA 2OECA 3LRXA 1J9ZA 2KLBA 4LG1A 2YWRA 4MB2A 4EY4A 1G64A 1B0ZA 3WISA 5JXJA 1PYOA 5AOCA 4FYMA 2X0FA 5K8LA 1W29A 3PTAA 1LXCA 2OHHA 3I05A 4OPMA 3ZOZA 4RF4A 3DW3X 4EK9A 1TJ3A 3IAEA 4EDHA 4AQYB 4F56A 3FHTA 1F2UA 1TEXA 1QG4A 3FTPA 4ID9A 2NU8A 1Z73A 3NTOA 2ZSIA 1BE6A 2BP7B 4BQRA 3LNCA 3RFXA 1NXOA 2F67A 4KPUA 2X4GA 3P32A 2QYTA 5E7QA 1YRQA 3TLGB 4AWAA 3MVEA 4EUEA 4U2GA 3TNDA 1RD4A 4QQ8A 4C22A 4E3ZA 3N59A 3VR4A 4QO7A 1OFGA 3JQBC 4D8YA 4EG4A 5EZSA 2BM8A 4R51A 4AB1A 1Q1ZA 2I4TA 1H69A 4YIKA 4DSAA 3RAGA 1NUPA 4QFCA 5LLTA 4QTUB 3FCXA 5LQAA 1P60A 4TL7A 3UOAB 1LY1A 4ALLA 2FW0A 2NO1A 3RU7A 1MZVA 6ADHA 3VVBA 1A4UA 2QX8A 2P1RA 2JIOA 2V5UA 1RWQA 4BFZA 1S1MA 3KFVA 3UT0A 3UIEA 5LWHA 4R8MA 3ANSA 3LVRE 5TGTA 5ECYA 1HDXA 2AYZA 2Z5LA 1QH8A 1NKTA 4LOJA 3L0PA 3MERA 1A76A 1B0AA 2Q3BA 3DONA 4JNKA 1URPA 3TWOA 4QUKA 4Q9IA 2XLCA 4HVCA 1FRQA 1T9BA 5DWQA 1YVUA 2VAPA 2L17A 3IEXA 4D9KA 1ZIYA 4RVSA 5JY1A 1T9AA 2WIDA 1JMYA 2EGHA 3A1EA 5BW4A 2FSVA 3FNQA 1KRWA 2PWAA 2ZIEA 4B3DA 4QHSA 3KKKA 1I7SB 3E4DA 4IILA 1BHQ1 2H16A 2PRYA 4DLKA 5HOQA 4Z7JA 5U9CA 3AM1A 5F73A 4HS9A 5AVOA 3OLCX 1J97A 2N9UA 3FCCA 1KHTA 1FP7A 4LWQA 3UB3A 1XDSA 4OV6B 1RYFA 3EW7A 1ZSNA 4OAPA 2FMTA 2BM1A 3EEIA 4L16A 1G5QA 1KA9H 4MTLA 3WO1A 2GJ8A 2R96A 4L0DA 6NULA 1R1DA 1O94C 3CNBA 2C20A 3B6MA 3RS8A 3P0EA 3STTA 4MS3B 1RMYA 1N9KA 1FUYB 1W4AA 4JOSA 3AR7A 2I87A 5AOAA 3ZCUA 1W8DA 5E6UA 4BO0A 4C7MA 1T2EA 5KQPA 1H8HA 3I42A 3BDIA 3BRWD 1DG9A 3VBEA 1X8LA 1ZONA 2FZEA 3GZ4A 4DEVA 5IH7A 1NJ8A 1BTOA 3IKJA 4UDNA 3E9RA 4MK4A 1LVUA 2YICA 2GPNA 4JJ4A 5CB6A 4Z3DA 1TT7A 1G8YA 4HWKA 5KPJA 2V54A 1WQ3A 3PQ2A 1Z2NX 2Q4TA 4K9LA 1ILWA 4U02A 3NBQA 4II7A 3STHA 3U6BA 3BULA 1JT9A 2QXUA 2Q21A 1E63A 2P5YA 1F2TB 3AILA 3W6OA 4EECA 4TVSA 3DKKA 2ZRPA 1XU7A 3IULA 1BHJA 2FLVA 1TLFA 1J00A 3NB0A 4YQYA 3UT6A 1MO2A 2GRUA 3A31A 1AZWA 5GAJA 3CG0A 3ZQJA 4EHBA 4UBMA 2I6SA 4M8LA 5CJJA 3RW9A 4R1SA 2F55A 1JSCA 2INGX 2J5BA 3GRYA 3KSMA 3VDMA 2YASA 1G3MA 4MQEB 5DEOA 3VNQA 5EN4A 1QK4A 1ZISA 5IF3A 1OH6A 1K6MA 1X7HA 4Y2TA 5IANA 1DRUA 1GQOA 1W30A 3UCEA 2CJYA 1EWYA 4KX5A 5BV0A 5IBQA 3KBBA 2WA1A 2YOFA 4MA4A 4RE6A 1YF3A 2WD7A 4PG8A 4GLBA 1NJSA 2IPMA 7MDHA 5FBLB 1L3CA 3ENKA 2FSVC 5K5EA 5DM4A 2GQ0A 5KX5F 2ZJYA 4JP1A 4L5IA 4MWCA 2HFKA 4L72A 2Y9PB 2K2WA 5JEEA 5ALJA 2DM6A 3BF8A 3VH1A 4XYEA 1TVKB 2BFBA 2V6JA 1IBLB 3GPCA 5HE9A 1BROA 3DO8A 3KE8A 3G7SA 4HTAA 1S3FA 4BLSA 4CV0A 1DT5A 1XTKA 1E5VA 4XJXA 3R3YA 4C4XA 1U65A 2ZT7A 3P2MA 5IKEA 1J99A 2IYNA 3O4VA 2JH9A 5JISA 2IXDA 3T1HB 3RHTA 2NU6B 4LDRA 4OFZA 2G4CA 3FHOA 3HRIA 4GLOA 3T3GA 2FZLA 4QGBA 3DZ8A 3TDKA 5LDHA 2JGEA 1B2RA 1QGED 1S2MA 3AR6A 2OQVA 3ZZTA 2JA2A 3OD1A 4JGIA 3CSSA 2V3WA 1AGNA 1LTQA 3Q7TA 3DJFA 2XD9A 3PTZA 3L4KA 1ZGHA 1CZOA 1O3YA 1UPCA 5KSZA 4M1TA 5LXTB 1FLVA 3A37A 5H16A 4XWOA 1HM5A 4Y6LA 3QMMA 4EELA 4HVLA 2W2OA 4N9WA 1RM4A 2OEPA 1J06A 3PHJA 4HHEA 2X0DA 1OFUA 2VHCA 1BVHA 1N9ZA 2D8MA 4B3MB 3AZPA 2XQJA 2G0TA 5JSYA 2PUGA 4NCXA 1UBNA 1EK1A 2PRIA 4E1VA 3FPCA 3LA6A 2B5OA 2IOQA 4HJXA 1EGQA 3CR7A 2JH3A 4B6JA 2EJUA 1UP6A 4O1MA 2WYIA 4ZVOA 4P2BA 3K9CA 4Q3DA 5CLQA 1W0JD 1A9TA 1JHUA 4PS1A 2CMHA 3H84A 1MKYA 3KVOA 2J48A 4BFWA 2FZ4A 4BCDA 1W1WA 2I2AA 2NM0A 3D7LA 3M5CA 4UVEA 3A1UA 1JDTA 3EZ2A 5CCXA 1WV0A 2WI8A 3NORA 4MA0A 5IARA 1CSEE 4OQ4A 4RIFA 3WGYA 3HEAA 2AMFA 4ED9A 1LPMA 3K0KA 4DR5B 1I80A 1VHTA 1O95D 2X3FA 1PT5A 3H04A 4WKPA 1LJLA 4WOBA 3RVNA 4DJFC 4PPQA 4RGYA 1PR1A 1HQCA 1ZUHA 2CHEA 3NEJA 5I4CA 4WOKA 3WK7A 3N7AA 4LNHA 3NM4A 3WGVA 3UHOA 2CNWD 3PSHA 3VSAA 5B36A 4DXAA 3O2SB 1Z7BA 1ZMBA 2JFHA 1QO0A 2OHXA 4YAFA 4IZOA 4LF7B 4KBFA 3NAGA 4QUGA 2JJQA 4ZO9A 4PZ0A 1AUOA 4NYJQ 4P5EA 3H2JA 4J1QA 1AM4D 4EEZA 1ADBA 1E66A 1UKYA 2NVOA 1P2FA 1JVBA 2P6MA 2R97A 3HBAA 2X9LA 3SYNA 3TIXB 2GPAA 4HATA 5I7EA 3U39A 4IRUB 1F20A 3OOWA 1M8FA 1PJ8A 3BORA 3BYZA 1DKPA 4DM7A 2NGRA 1U90A 3DT9A 4GZ5A 4FZ3A 1WDKA 1FW8A 1R2QA 1YR8A 1PK7A 5L9AA 4CM3A 1KNQA 5A9SA 4NWIA 2WNHA 3D81A 2WJ3A 4MDYA 2P1ZA 1YQWA 5IASA 1NY5A 3K9BA 4E5NA 2WILA 2VJAA 3QXXA 1NG9A 1GQSA 2FJUA 3ZWQA 3LQRA 1JEQA 3CN9A 3ZN2A 2YNMA 2NZVG 2IF2A 3IOYA 4ZYYA 2R7MA 3HCAA 5DU2A 2OHOA 4RMGA 3OHSX 4HGRA 5LP6C 2V7UA 1G20E 1EXVA 4OOFA 2J32A 1C9KA 2HQSA 2WIJA 4BTLA 1Y8CA 2H1SA 2DF8A 3DF7A 1NHGA 2ZWPA 3DEJA 3LUKA 3EDCA 1GU0A 3LC1O 3NKVA 4Q7LA 3RFCA 2VP9A 2HMAA 5JG7A 4C0WA 1ZOLA 2PMFA 2FXIA 1ST2A 4TOIA 1M2VA 2G63A 3VJRA 4BNGA 1YZLA 4NAUA 3OZSA 5TQ2A 2K4MA 2C96A 1PUXA 3GDGA 2ZM6B 3LX5A 4PN7A 3IAUA 2DY1A 1UPXA 1HSOA 3QEOA 5EKUA 5KCMA 4AU1A 2BDUA 2EHDA 4UXHA 1UJMA 4ZZ3A 4XM0A 1D07A 2JJ1D 2OV4A 3C48A 1FDTA 4O4HB 4OB8A 1Y8QA 4K6FA 1MJFA 4TLDA 1FK8A 5GONA 3K5WA 5A4IS 4UQLA 2GZ2A 4PAWA 3DMPA 2Q6KA 1QDUA 5HCUA 2VWHA 1VG9B 1OXMA 5IJ0A 3WGUA 3CONA 1XQ6A 3TL2A 1E0SA 2IV2X 1QRDA 4H4CA 3W05A 1Z36A 3SF0A 1RC1A 2WNIA 2VT7A 3K6JA 4DSNA 2B1RA 4ZCTA 1FJGB 3CXUA 1YKFA 3QLVA 4ACBA 1X39A 4FB5A 3MJSA 1WXHA 2ZYRA 3KYCB 2WAXA 3QMVA 4X63A 4R69A 4Z4FA 5I8PA 3E9ZA 3PICA 3KT8A 2OXFA 4LJ8A 1I94B 1TK9A 2J5KA 2ZSAA 4FFWA 1TA0A 3AIIA 4N54A 4A6PA 2UV8A 4AX4A 3RDPA 2JAHA 1FS4A 5DHRA 4OL9A 3PXDA 2AZTA 3O26A 3K70C 2QX4A 2E5LB 4X8LA 3VOSA 4YUZA 1L5MA 3WK5A 5BRAA 3OUUA 1IHOA 1F06A 4U39A 3FVWA 5AJZA 4Y6SA 4ZC8A 1FTSA 1LDBA 1H2FA 3L8YA 3ND8A 4AC9A 2POCA 1COWD 4MW2A 1ISFA 1EP2B 2RB4A 2YVAA 4M76B 1IB6A 4LXQA 1EFTA 1VE1A 2GCIA 1UBFA 2NU7A 2VK2A 2D0DA 4B3BA 2YNMC 3I45A 4EO4A 1MOPA 4P4UA 3IX7A 2QMEA 4GQBA 3K2EA 3U56A 1BG6A 4FR0A 1YRHA 2J3MA 4KMRA 4X7RA 4QBHA 4KWIA 3JWEA 5EC8A 1MA0A 4MWSA 2Q1XA 4KQIA 2A1TR 1HEIA 4W7HA 5GQSA 1R88A 2X0KA 4JT2A 1VTKA 5D5PA 3WYGA 1D4OA 5KX5B 3ER8A 4GSKA 4R3NA 5ULLA 4CIVA 4MRNA 3MD0A 4ZT5A 5IAJA 4B8WA 2CV0A 1NRWA 1SGWA 4JBXA 5C7OO 4UC0A 1GTG1 1UT6A 1GPKA 1MB9A 1UDCA 3GRKA 5I9MA 1XMPA 3JRWA 5K0BA 5CFPA 4ZPXA 3S1LA 3L46A 1IJKA 1KMHA 3CHYA 2AUMA 3ETEA 3G1UA 4RO0A 5IK2A 3UEOA 5BXYA 2JFZA 4R1TA 5T3YA 3IEMA 1QRSA 1W4ZA 5SZHB 3GLGB 4HN2A 2HHJA 1FP1D 4WJZA 1QCZA 4Q82A 3B9PA 1UT5A 4FMDF 5DYYA 3GRVA 4N41A 2VKQA 5CAEA 1X7YB 3M6IA 4D3DA 2G72A 4HGZA 2XDQA 4DQVA 3T5TA 3EVCA 4TRRA 2NTEA 3PRHA 3I1JA 3EC2A 1H0SA 4OQFA 2Q4DA 3MUNA 5JFTA 1M76A 3PRJA 3UFBA 1FTQA 1WKBA 5IVIA 4RFVA 1KVRA 2PSHA 3L6DA 4YH1A 1ZOOA 2DSTA 3L8EA 3QUCA 5J59A 4BNJA 5DJ5A 1IZ0A 4FYJA 4YACA 2OENG 4M86A 1V1JA 4HEA1 3PJDA 4XDYA 1G16A 1DXYA 3D8HA 3I4LA 1SXIA 1EBBA 1OYYA 5AHWA 1X0VA 2I3BA 3A6JA 3EIHA 3CO5A 3HY6A 3D31A 3IPAA 3MHPA 4BWFB 5HJ2A 2ZBFA 5JZMA 1ZDMA 4V0ME 1Y5LA 4EM6A 2F1IA 2VJMB 3U40A 3J81A 2O8EB 4FP9A 4WOPA 3WMWA 2IYZA 3COPA 5E9QA 2WAOA 1T15A 2UZIR 1QAQA 4LJ5A 3ZWVA 1TUBB 2YFQA 4URWR 1PFYA 3EA5A 4CF6A 4QUDA 4KNVA 3GEMA 4FNOA 1LWNA 1SNYA 2OAP1 2FOLA 5C9ZA 2WB4A 2NNWB 2OVBA 2R1VA 4CLRA 2X8JA 1YUMA 4HB3A 4D4HA 4XOIA 5AVWA 3IBGA 3LCVB 4RIGA 3WQRA 4OSEA 1ODJA 4PLZA 3EMKA 3J7TA 4CIDA 1NDHA 3IXMA 3U17A 3VPFA 4ESHA 4KLZA 1ABBA 2H9YA 2C7RA 3PJRA 3N8IA 1K98A 3T41A 2QV7A 3RVJA 1J8DA 1TKRA 5HFJA 4AWBA 5CNIA 3PD7A 3FOAA 4QECA 5FL7A 4EYQA 2GEJA 4RTPA 1K9VF 1YHZA 1YQDA 4MS4B 2C4MA 2X5OA 1PVDA 3R9XA 2XAAA 2HYDA 3PT5A 4QVIA 1FNMA 4GM0A 2IUUA 2O23A 3IVMA 2JVJA 1VIMA 1JQ5A 4FD3A 3T4UA 3WFZA 4NFHA 4Y2SA 5ADUS 4R2MA 4BMCA 1NQ5A 2ZCJA 1R7RA 5ITZB 3RS7A 1EJBA 5KQMA 3ZJVA 2JAPA 3EFOB 2BFOA 4L8LA 1CZUA 1NI4B 2FR8A 3GCWA 3ZWWA 3D4IA 4M4SA 3VR4D 4DJTA 5J4KA 1QZZA 1QOPB 2KS6A 2ZI3A 1OLSA 4YREA 3ZPXA 3BWYA 3L07A 3QKTA 3IMFA 4JUDX 5LMCA 2BI4A 2E87A 4JXZA 1M2FA 2QYHA 1Q6YA 4KH0A 1E20A 4YI5A 2A4KA 1N2SA 3HDQA 3MB8A 4Q66C 1UMDA 2FUNB 2RHGB 5FUQA 3HO1A 3RSQA 1EFUA 1EWTA 4UTZA 3IAS1 3SZLA 1QZUA 1JU9A 4DCGA 1XEXB 3CM0A 2EFGA 1CB0A 4KK3A 2J67A 1XBTA 1Z8NA 4DLXA 4QJ4A 1O8CA 3A14A 4OHKA 1NP7A 2X13A 1VPLA 3C5WP 1PWHA 2F3UA 3B12A 2GAIA 3SI7A 1AGYA 2RKWA 3A4NA 4RDXA 2C00A 2VSYA 5HF9A 1WU7A 3CZCA 4A9AA 2CDAA 1XNHA 1TC2A 1N5DA 3C1OA 1LNSA 4K6KA 1TZMA 3DZCA 1V5GA 5E4JA 2OCDA 5LWQA 4MRVA 1CY1A 1BW9A 1JPVA 1QGUA 1Y3IA 4U6SA 4GW3A 4FDVA 1G8SA 3UW1A 3KQNA 1YT5A 4XSGA 2CSXA 2QZ9A 3C1UA 4ADSG 3KLNA 2DPGA 3NBKA 2XVYA 5SZKB 1R0CA 1ZS9A 2RK3A 4CR7A 5FXMA 1RLIA 2FSFA 2F1KA 4KYIB 1E5DA 1ZI8A 2G9NA 4BY9E 1SELA 3U4CA 4YIHA 1FFEA 1QH0A 2VT3A 4RU1A 2HT1A 4EVQA 4YRZA 5L4NA 1Y82A 1DKOA 5DBEX 1QRUA 2GUWA 4PC7A 5LL6P 1O6FA 1W94A 1H8HD 1LRLA 2I7DA 4XPIA 2CLOB 1GNTA 3H2GA 5FHQA 3SJ7A 5KU1A 2NOAA 3CTPA 3I9V6 3RO7A 1GNRA 2QIOA 1OZGA 5HFAA 4DYHA 1G63A 5KYWA 5JI2E 4CM9A 3L77A 1J2TA 5LYJF 1VMKA 3WLQA 4DDWA 1NXWA 2V7TA 2QUHA 3GEEA 5IPFA 5JV5A 4PO8A 3NV7A 1C5KA 5CHEA 4FLMA 5K3OA 3S68A 4C6TB 2FLKA 1JJVA 1H4SA 3OOYA 3EDMA 2MSCB 2A67A 1I7DA 4E2ZA 2IUSA 1CC1S 3UANA 1KSGA 4ERXA 1OFHA 1IBMB 4ZHQA 5TT0A 3Q9UA 4FT2A 3ND6A 4ZJZA 1SVLA 2BEUA 4A5SA 2Q2VA 2FUCA 4KDEA 3R7DA 2HO5A 2TMYA 4GL4A 5ER6A 1WY7A 4FJ1A 3U4QB 1KO1A 4O6VA 3G1TA 5AW1A 3SDZA 5CP8A 2HSEA 1IULA 1NA5A 2QE7A 3N58A 2NYAA 1T25A 4XIJA 5D84A 2BBWA 4C88A 2ODQA 1ULHA 3DMYA 3ZQ4A 1ZMRA 4W5QA 3I34X 4IQ4A 1N2JA 2DLDA 2YCLA 1LLUA 1R6BX 3QFSA 3GFGA 1SKYB 2ODPA 2E6UX 4E70A 3NDPA 4ZDWA 1WO8A 4XZ3A 3I4FA 4RLFA 4JI5B 2FRVA 1FFHA 2Z6AA 4XLZA 1B3RA 4J9UE 4QSMA 1HSZA 3BWXA 2DX7A 1X74A 1Z5VA 4BQOA 2WTXA 1J2RA 1DQYA 1C2TA 4G23A 4S3MA 3KAPA 5T4FA 3U7EB 3ZS8A 4O4IF 3UT5A 4YCSA 2Z57A 3GFPA 1F4LA 2FLWA 4AF6A 4ZTZB 3QKWA 3CJQA 4GDMA 1UZNA 5JNTA 3JQAA 3LP8A 3Q7SA 4MYCA 4RZHA 1VL0A 1NX9A 1F17A 2D2VA 4MMYB 5LZ7A 1H5UA 1NBOA 1NPTO 3AVPA 2QT0A 3S5JA 5CA1B 2OLKA 2JFNA 4QBTA 1ISJA 4RF2A 1OU4A 1GITA 1OQAA 3WBBA 1RJGA 1ZAKA 1MAUA 3KLMX 4U2FA 1P0MA 1A4XA 4GEGA 4M36A 1E2JA 3IH5A 4LECA 4YI3A 5EMLA 5JDCA 1IBKB 4QM7A 3W8DA 4BFLA 3PL5A 2XBMA 1EX9A 5EJEA 3Q0IA 2GOYA 4IHKA 4G37A 5D3QA 1ZN2A 2NZJA 1EB9A 2FPIB 4JEMA 1CS4C 1QTRA 1ZIDA 4F5YA 1IWPB 4OQLA 3RHFA 1OR8A 2IYYA 4ZYTA 1F9AA 3TOXA 2YJGA 2X22A 3UUGA 3HWRA 5T5QA 3BDAA 2IV3A 3HP1A 1EFPB 2QSZA 4MWEA 3BE6A 5GJWC 1G8JA 3A06A 5FPPA 4YV2A 2H5IA 3P97A 4G2NA 1NWHA 2DKFA 3VHXB 1V5FA 1A71A 5FBQB 1VCOA 2ST1A 3MPOA 3X43A 1GR1A 2O57A 2HZ7A 4WOCA 4I4CA 3WGKA 3QRWA 5CB8A 1QZXA 5IEBA 3WWOA 3DTVB 3O3OB 3B51X 1L5RA 3QEMA 1UDAA 2B36A 3G2NA 4JVNA 4WZ6A 4P2GA 3D7RA 4HDAA 1ZWKA 3QWFA 1YA8A 1XROA 3T8YA 5K8TA 1ULUA 4TXHA 4CQLB 1VLMA 3SF8B 3CNHA 3WIDA 2AMYA 1MT0A 3W4IA 3EAQA 1XF1A 1F4PA 4M7OA 5I4IA 2VDQB 4OX9Y 1DQPA 1ULBA 3SBXA 1FFXA 1LVHA 3BWCA 4R7ZA 1XMXA 5I9TA 1GPNA 4LJ6A 4JEIA 4H1HA 4Y0NA 1XQ1A 5CMLA 4YP7A 5HIIA 4W5TA 2HU7A 1FBNA 3VNUA 1A7UA 2DFKB 5AHOA 3S44A 2ZSJA 4JLSA 2O48X 5KKCA 3EXAA 4I1YA 3LT2A 4DW8A 1W75A 3D0KA 5EKDA 6REQB 1NMXA 1UBEA 4M0CA 1KAHA 3P9XA 1DG1G 2OGWA 2QRHA 4FYWA 3USCS 1CZKA 2ECOA 3M7IA 1TJNA 3VXKA 5TQVA 2RIRA 3KJNA 4BMPB 3OMLA 4Q0MA 1RXWA 1Q22A 5G3YA 3T4XA 1XZCA 4BAGA 1RWXA 4Y1GA 4KN5A 7GPBA 2VDRB 2GI4A 3HLTA 2P3LA 5IYZB 1K68A 4HGPA 1KQ3A 2JIMA 4I4TF 3ZCPA 1F6DA 2ZJ0A 4X24A 2HIMA 4LXUA 3K70D 3AHEA 3WLKX 1Y6GA 4NKRA 1SY7A 4UNIA 4DBLE 1B16A 1GTL1 4XSVA 2RE8A 4Z4GA 2P75A 1Y3AA 3HBLA 3I04M 1XT6A 1JVSA 4J0DA 1VPTA 3CW9A 3ETDA 4AKEA 2DSNA 4OVKA 5FTWA 3GPLA 3AJ9A 3FW1A 3B20A 3HJHA 2V96A 4GXQA 5F7JA 4YLYA 3KT3A 4BFYA 5A3VA 1G5TA 5BQXA 3MJFA 4AJ1A 3G8YA 5BURA 1MZPA 4QVGA 4UTVA 1N5RA 3IUSA 4C7KA 4UZEA 4IIUA 4LHVA 4XASA 2JFQA 1G3IA 1GPJA 2BJHA 4RAQA 2R8OA 2R4TA 4OQDA 2QMQA 4WV3A 2IPXA 2HDHA 1YAHA 2FF7A 1XZBA 1TNDA 3UA3A 3R5TA 3AF4A 3H9CA 1GL3A 3OU2A 5DYWA 5JSFA 1KTIA 2XNKA 4P3OA 4EEXA 3SC6A 3IELA 3TB6A 4L0CA 2PWYA 1OX4A 3LRTA 1U2SA 4LDNA 4TTIA 4CMBA 3QG5A 3HR8A 3Q0EA 3DDWA 1H2HA 2AQIA 2IOFK 3WJ1A 1ZNQO 3VPGA 3KTDA 1JFSA 3TQOA 1V45E 1OGJA 2PMKA 5AM2A 1GCGA 5C8YB 5AIAA 1JSZA 2YWCA 3MBKA 4PW0A 3O4GA 1V7CA 5I7VA 3BBLA 4C2TA 1HG1A 4ZK2A 2WZQA 5CTAA 2J5RA 3QVOA 3F3YA 4F9EA 1PKEA 3A1WA 2FSGA 2A9PA 4U3JA 4BN5A 3FTEA 1UXGA 3PC2A 3ZCSA 5IUKC 4JUBA 4KQWA 4E5KA 3RABA 3OSUA 4AJ2A 4M1KA 1ZRHA 1Z45A 1P4HA 1JHQA 1BJRE 2VSQA 3FF4A 3K35A 4TTAA 1HFJA 5DZSA 5HTKA 4C2UA 4NZYA 1EDDA 5AJTA 3TI7A 4OMDA 4WN9B 1IVSA 5IVKA 1Y33E 1QC5B 1TAQA 3BMNB 4Z0TA 3C85A 4D6XA 3K96A 5K8VA 2O50A 2O4CA 3HV0A 3ONVA 3LT5A 3PEFA 5IDXA 1OWNA 5LJIA 2I2FA 4FD2A 4HLCA 3L7KA 3OCVA 2GD2A 2MR6A 2O2EA 3FMGA 3P0FA 4KAFA 4KLRA 4OSOA 4L7QA 4WLOA 1LPBB 3JARA 4PHFA 1MIOB 4R2KA 3INRA 5LQCA 2PX3A 4MYDA 2CJPA 1GPWB 3OEYA 4HY3A 3SHOA 1U0RA 3E8MA 1A1SA 4ZK6A 2J9FA 3LSTA 4L02A 1JH8A 2GRJA 2PAFA 1ZJ6A 2C0PA 2ZJ5A 5IAGA 5BWBA 3H8WA 4BVGA 4G84A 4WUTA 4UTXA 2Q4EA 1EK6A 5J3JA 3NTUA 4ZCLA 4FS3A 4BO8A 1L7VC 3ROGA 4HZUA 4QFMA 3OKFA 4OAOA 3WDKA 1EMDA 4JUAA 3O75A 1VSTA 3L5KA 2W2LD 5KNBD 5DTQA 4MLCA 3D8NA 3C4QA 3HM9A 1Q3KA 3LPCA 1KNXA 4CMCA 4PZDA 4LZOA 5GY7A 1R9GA 5HA5A 2YXPX 4OQPA 2QL9A 1U3TA 4AMBA 1RU3A 2VBFA 3LLCA 1FFSA 1YJ8A 2VDKB 3PIRA 1M2KA 4O4IB 3TQHA 4FDAA 3EGXB 3WGHA 2RCNA 5F3WB 2EEZA 4BB0A 1OXTA 2YYZA 3LAWA 4OUDB 2JIZA 2Q6OA 2W43A 2IHTA 3IUEA 4KYVA 5ALEA 5BNIA 2A78A 5ALYA 3ZH2A 5IK2D 3FG9A 3NONA 2NVBA 5DXFA 3C14C 1MVNA 3H1GA 3G6WA 1GV0A 4L6IA 2QYSA 2YHBA 2WD9A 4F9GA 3DSRA 1O57A 1V96A 3GVHA 3PQFA 5AW7A 1V1MB 1PQ4A 1PW5A 5I8ZA 5D1HA 3NZEA 3U3OA 3UF0A 1H05A 1R00A 4GXNA 4EARA 3E0QA 1H8EA 3G89A 3NYQA 4LXIA 1I6LA 3N8GA 3EA0A 4PO9A 3UJNA 2G9ZA 1KF0A 3IVRA 5DI9A 3VC2A 3PUZA 1YJ5A 5IMBA 2PS9A 4FM9A 3SXUB 4R81A 1RHKA 1T9CA 2P5SA 4HDSB 1G66A 3AQ4A 3HO8A 3PK0A 4L6AA 3ROPA 3UFXA 5CYGA 2FQQA 3RFTA 4B40A 2PUAA 2HIHA 2PO7A 3BFPA 1OLUA 3R0IA 4KRYA 4EDFA 4IVNA 4J16A 4PC1A 3MHTA 4I99A 3M9XA 3D0OA 2W4IA 3I9NA 4PINA 4Y9UA 1FZTA 2CHGA 2C4HA 4RVNA 2VN8A 2YXEA 4L50A 2HV8A 1T5TA 2CGEA 3JYLA 1ONPA 3V1MA 5K0FA 1KI3A 2FPPB 1SHUX 3RS5A 1GZSA 2X1LA 3WJ7A 4KODA 2NZYA 4UM8B 1ZNXA 4GG1A 4AO7A 3K4HA 1Y1SA 4RK7A 2R6GA 2ZYWX 3UKJA 4D8VA 4U6QA 2XT6A 3D8UA 5JO9A 1BWRA 1GD1O 3CEHA 5KINB 5JRJA 3BB1A 4DZZA 3GQVA 1CKEA 1EWVA 3IB3A 1KDTA 4OEHA 4ZOLB 1T1RA 3K4QA 1Z82A 1CDOA 1N33B 4UUBA 4F1KA 2WUGA 4KXNA 3TR5A 2FP4B 2X19A 1T4CB 1M1UA 4PAOA 3GLTA 1QHGA 1KK1A 4EPVA 3DD1A 2TRSB 3EGDB 4KIWA 2A57A 2VPWA 4UEJA 5LNK1 4C87A 3FSEA 1NPYA 3KV3O 2HUPA 4KCGA 5E38A 1N0WA 3BKXA 3FM9A 1BGWA 4Q16A 2DMRA 2IE8A 4RPGA 4ARBA 1CV2A 4L4ZA 4TLCA 1QGAA 4R1MA 1Y5IA 3GEIA 2FRDC 3ELYA 3F7TA 2I3ZA 5FL7D 3AERA 4UFPA 2K2QB 5HF6A 3E9MA 4RHYA 1GU7A 1RRGA 3O1JC 3NH9A 3TOSA 1V47A 1SVSA 3FPHA 2C57A 3RTAA 3FNFA 4YRAA 1T29A 2V7BA 4I4TB 2GTPA 3UTCA 4DAEA 1L2TA 4FFOA 1Q83A 1ZRMA 3GRRA 2YL2A 3CT4A 2NAFA 4TVKA 2A33A 2XF8A 5TQJA 5BSVA 2F8LA 1IG3A 2GHIA 3DTYA 3KCQA 4N01A 4U00A 4BNWA 2XYPA 3IJ5A 3MQ2A 4MUGA 5D01A 2B0JA 3I6IA 4K9RA 4LMRA 5EUCA 1B2LA 2I7CA 4DDHA 2C2KA 3DMGA 2QM8A 2VNKA 4QRIA 1BQ4A 2L82A 3BHNA 3OJFA 4I8DA 4RHUA 5KC8A 1QRTA 2IEYA 3M82A 3V3TA 4B3HA 3IAHA 1AN9A 3H7AA 3FR7A 3Q7IA 2F9FA 3FXAA 4AIIA 3IBTA 3HU1A 2Z3ZA 3FOBA 4J16C 3R74A 1C3XA 4CDNA 4DVJA 4AG3A 1YIOA 1VYVA 2L42A 3AESB 4B6FA 1Y1TA 1P3JA 3TO5A 1GGFA 5BQ3A 1WXXA 2PKCA 4MRMB 5JY6A 4GC9A 3ONWA 5TMPA 4US2R 2P2GA 1RYNA 4YJHB 4XFDA 3L18A 4JN6B 1GG8A 8GPBA 1GTRA 4HWPA 4CLOB 5FX2A 2LKCA 1VG1A 2A9RA 2YV4A 2FX3A 4MWGA 5LYYA 2SKDA 4PVCA 1PS9A 1G55A 2MJLA 4TTVA 2GASA 4UU8A 4D0RA 2F62A 3EIEA 1DAGA 2ZUSA 3B78A 3BMOA 3LSYA 3S2IA 5FIUA 1P9LA 5H8WA 5I3ZA 1QB8A 3SX0A 5F35A 4MHSA 4QPJC 4CUJA 2EG9A 4YY3B 1R8XA 3RS3A 3P2OA 1G7CA 5G1NA 2NO7A 2CMDA 4U2CA 2GN8A 1ZICA 1CFJA 2Y66A 4Y2QA 3OPMA 9GPBA 4KR0A 2J45A 4FPXA 5BT9A 2WIGA 3H8SA 5BSGA 3ODPA 3ES9A 5B58C 3ZXXA 1ZU4A 2X8AA 3E3NA 1M0SA 2GN4A 1NMSA 2JHCA 3AINA 4URHA 1CUHA 3PEWA 3DVAB 1P7CA 2J9GA 3V8EA 4ZYXA 3M5DA 3QK7A 2DQSA 4JV5B 2AC7A 3ZCXA 1J09A 1W49A 2BCGY 2OO5A 1NX6A 3FF1A 4ZGGA 5TEWA 2IITA 3VNRA 5JMOA 1GPBA 3HJAA 4URYR 1RQGA 2WG0A 3DC7A 2CFTA 5BPFA 2XE8A 3A70A 2H59A 3RVOA 4OI0A 5ECDA 3OIYA 2JGDA 1TEZA 1E32A 2H0AA 2PZMA 2R5WA 3GMDA 3MT7A 4KVGA 3OG9A 4N03A 4CM9D 1Q0HA 4CV1A 3HH8A 3GAFA 3WA7A 1R16A 3P9IA 4DRXA 2Y1DA 3TLCA 1US8B 3OO0A 4RSGA 3RSFA 4HWRA 3LRPA 5CX1A 3DZIA 1NYQA 4WASA 1OBHA 2BEVB 2J5QA 2WPDA 2H0QA 1X7XB 1JTFA 3BB4A 4K1XA 2E4UA 5FWAA 1XLWA 4XCVA 4XIFA 1XZQA 1K63A 4GPTA 5KOHA 3KSAC 1Y9AA 3KLOA 1UKCA 1V6AA 4AL4A 1IN1A 3FPBA 2FSHA 2B4AA 4BZXA 3I9OA 2Q5CA 2WU8A 1R4MA 3DOCA 4FNAA 4Z0PA 2FHPA 1MA3A 4NY1A 3EQ6A 3M6XA 3ENWA 3N5KA 4KXLA 4QVKA 1WPXA 3RV3A 4OHFA 2QE7D 1XDBA 3ZI4A 3L82B 2PHZA 3LC7O 3R7NA 3PC6A 4E22A 4BN4A 4WW0A 1UADA 5DH9A 5FPKA 3E22A 4MICA 3R0XA 1RIIA 4ZD6A 3BWEA 3E5HA 4B7AA 4QULA 5I8WA 5JCJD 3KKLA 1NAIA 2PMEA 1SUFA 3L8MA 3UMCA 3L6UA 9LDTA 2WHEA 2PX5A 4RTSA 1R0ZA 3A58B 4BVLA 4PBSA 5DHSA 5HMMA 4CM7A 1T2AA 3QPBA 1SULA 3TKAA 5AH0A 5EKTA 1W0KD 2J0UB 1E1CA 3D3EA 4S2UA 4DIOA 4F0JA 1I3CA 2RGEA 4CCWA 2O8DA 2FMKA 4XB6B 1CIVA 2WAMA 3PGJA 4WLFA 4BFVA 5JROA 2PY6A 4JI0B 2ZWVA 5BO5A 4FKBA 5JNVA 3NIWA 3DXFA 1TPZA 3H87A 4PANA 2WU3A 3LZ6A 1OXSC 3Q7EA 4I66A 4BU1A 5G1OA 5I9NA 5DNYB 2YWHA 1ZG3A 3JQAD 1HYGA 2KW5A 4CEJB 4DCCA 4K2HA 2OO5C 1N0HA 1SQ0A 5TY0A 2XH8A 5LB4A 3OQ1A 1ZIPA 1XTZA 1C7EA 3DOJA 3P0IA 1ZJ4A 1IBSA 4COKA 4B6EA 5C5CA 3U4IA 2XZLA 1BCSA 4QYSA 2GJAA 1JLHA 2XZOA 3CB4A 4G89A 3TUIC 1XKTA 4MYUA 3U2QA 4DNQA 4EJ2A 1B8PA 5C4MA 4KQXA 3RJZA 1OCEA 1J23A 2JLWA 3EAGA 2W6JA 1U0LA 1M5TA 1Z75A 1XF9A 2V6MA 2ZROA 3FE2A 4JT8A 4QGGA 1MEOA 2BZ0A 4MR9A 4V24A 2RHHA 3AKZA 1PFGA 4JJFA 4GBGA 3Q1LA 1JEYB 2I03A 2Y1CA 3BMQB 3K31A 4RTQA 1HDRA 2NQ8A 2XB8A 2Q6VA 2O1EA 1QUFA 4NQRA 1U11A 3LQ2A 3GLHE 3NQ41 2ZG6A 1FFBA 4ZQCB 4CMAA 3O9VA 2PKRA 3OTWA 1L4YA 4DMHA 4QJ3A 4D9GA 4MKZA 3Q11A 4KXQA 1H6BA 3V2UA 3R75A 1DBQA 2QZ4A 1KOFA 4RLSA 3RS2A 2PLFA 4WNIA 3KJIA 1A82A 3EJWA 2GCPA 3ROKA 4H7PA 4UAGA 3H6KA 2I4MA 4MV9A 5JAZA 4IMIB 1E98A 3RIXA 3VTAA 4YP9A 3ZH9B 1KGSA 4QATA 1ZR4A 1YK1A 3DTTA 4YALA 2GCOB 1FUIA 1E2IA 5LCXA 1B8NA 2BCEA 2BMDA 3GVPA 3O1LA 1A1VA 4ZQIA 1G2IA 4G1BA 1X15A 4U5XA 1L3IA 1UKAA 4D8TA 4Z53A 2OGTA 1NATA 4IJUA 3KAJA 1FQJA 1L1QA 4TTPA 4L5AA 1JIXA 3ILXA 2C95A 4EYGA 2P0YA 1LJ8A 2DTDA 1WUJS 5EJGA 5B1DA 3ZK9A 4W5OA 3GG2A 5HZKA 1KY4A 3A3NA 1K7SN 2OBFA 3KEMA 1EBFA 4G24A 3SX2A 3WLJA 4DV3B 4L9RA 2VZEA 2C97A 3VSCA 3TRJA 2ADMA 3H18A 5DB4A 3WGGA 3HGQA 4HXGA 2PGIA 3SJAA 1T8RA 4AT1A 1WY5A 2PGJA 4D79A 4XIIA 3V33A 3QVTA 4PSDA 1MORA 4DLSA 1EVLA 1F0PA 3LI2A 4DB2A 1OWMA 4DRZA 1N5KA 3IE0A 2ZRDA 2V8OA 3FDZA 3PWKA 3T06B 4OLAA 2W6ZA 2JGIA 1L1RA 2XCOA 1VI6A 3GFRA 3LCUA 3D54D 3ONDA 4NS1A 1RWBA 3OJOA 4EHLA 1EFAA 1RKUA 5SZIA 1WVMA 1R0YA 5A6VA 5MHTA 1QDEA 3HL0A 3HLYA 4QOJA 3C5VA 3RJ5A 2ZCVA 3PYXA 3P8ZA 1YR3A 4FC6A 3ZY5A 1VE3A 2JC3A 5EG5A 3THXA 4MDHA 4JYPA 1G0OA 5L3SA 3HACA 2P5TB 3W6NA 1LU9A 1RKVA 2BF4A 3IKVA 2X8LA 4MUIA 3FYCA 1JQAA 4ND8A 3T5DA 2CUNA 2Y77A 3B85A 2OUIA 3KEQA 4FKMA 4OOEA 4TL9A 5L53A 5BVHB 2GK6A 3GNSA 4MV1A 5FORA 3JWJA 3RYIB 5I7HA 3IHLA 2XWPA 4UBJA 2HIGA 2B61A 2I33A 5EUMA 5JJLA 5G4KA 1UDWA 1LBQA 3E3OA 4B47A 1XZLA 1W5EA 4LPSA 1FVXA 4MX8A 2ID4A 1T10A 3P2YA 2NVUB 2AOTB 3ZV4A 3G2QA 3GFQA 4U2EA 2PIAA 3AY7A 4D4LA 2G1UA 2FQXA 1ZESA 3BD7A 3CPSA 1HT0A 2D5BA 4I55B 4RXMA 5E6SA 1WE2A 1VHLA 1OX6A 1TKBA 1EGMB 4EW1A 4YONB 3PGXA 2W48A 4FYVA 2ZRFA 4ZYUA 3DHEA 2I78A 2YYYA 3USZA 1C0LA 1C1XA 2IZOA 4WZBA 4GQAA 4RHCA 2P0AA 5B2ZA 2C7PA 2J46A 3CUTA 2ADFA 2O7VA 3BAFA 4FFPA 1VFNA 4NU6A 2VK8A 5F5LA 4B45A 4ER6A 1CQJB 1L7PA 1H22A 4QWWA 3I28A 4HLNA 2ZJBA 3DMHA 3SN6A 5JRDS 3RC9A 3WLMA 1A5SB 1G19A 2O2GA 3TE6A 1P0CA 4RNDB 4XR9A 3QU2A 2NXCA 4MZXA 4RDIA 4RPLA 4FOSA 5EWJA 3I30X 2C8JA 1JS1X 2P40A 4R1NA 5K20A 2Z2ZA 4XFKA 1E4EB 2J8ZA 3IOBA 4E5MA 1ZIOA 1HMYA 4G0QA 621PA 3N07A 2F4VB 3EF1A 1E3JA 4NFYA 5D5HA 2IP2A 2NTNA 4XGQA 1W85A 3WWYA 5CA0F 4WVLA 4M1QA 2ZVJA 1RLOA 2DC1A 1EP9A 2X0IA 1Y9DA 3I2FA 2X42A 4LBYA 5IJXA 3U7QA 3FFWA 1B00A 1BVRA 4J91A 1WXFA 3S2ZA 3HKCA 1HFWA 4LA4A 1Y4UA 2E1PA 3H7IA 2CXUA 2FW1A 4TKVB 3QJGA 5DBHX 3KWFA 4A0GA 3QENA 16PKA 1T3ZA 2M1ZA 4QDOA 4EEKA 1J8VA 4OK3A 5C2JB 1RXCA 3LCCA 2VHYA 2C3PA 1IUPA 3UOGA 4ZHSA 3DOEA 3X1YA 5HJ5A 3THRA 4Q4HB 5LFAA 1KFJB 1OREA 4WQMA 2GKSA 2GBGA 3E9NA 3KLBA 4HDMA 5H3LA 4BO6A 5I7FA 1VL6A 3HY3A 4E2XA 4LRQA 4FC7A 3LQKA 4NV3A 1UIMA 4OH7A 3FDJA 5EXSA 2Q6TA 1RWMA 3I72A 4M9QA 4PZYA 1JR6A 2FWMX 1GFZA 2P69A 4GWGA 5U4QA 1Y8RA 2WFLA 4KMSA 2NNLD 3FZGA 3QUSA 2CLIB 4GMGA 1W19A 4PO1A 3P9PA 5DI3A 2F4NA 3SOPA 2JIZD 1JMKC 4PZLA 4CKEB 3MMNA 3CNEA 3E58A 4J94A 2OOKA 4Z9AA 3A10A 1Z0DA 3ELWA 4Q00A 5HPYB 2UXDB 2ZYAA 2ZQ5A 4AWXA 1I8TA 3MWGA 5A0FA 4XKJA 3MWJA 1VSBA 3P9YA 1N5JA 3ZHCA 5IMSA 5EIWA 1Z6XA 4HDCA 1NHWA 1TM5E 3TN7A 2Y0EA 1ESCA 3ESBA 3JYHA 3DMDA 3NC0C 3AGPA 4RM3A 4AN4A 3RADC 1Y5RA 1CLUA 2AS0A 3MLBA 3LWNA 2VDPB 3TOZA 1ZXXA 4AZ0A 4A03A 2ORVA 4IIFA 5DULA 1RM5A 4UBLA 2G82A 1N1MA 2QRKA 1VE5A 2QG4A 4DG9A 1SIWA 4Q39A 3VOTA 4X62B 1FYEA 1CX9B 3ORYA 4DADA 1RHQA 1N5IA 4GE0A 5HR5A 4MWDA 2DWUA 2IBMA 3BL6A 2Q3FA 1I9GA 1ZOIA 4UQOA 1DADA 1VJGA 1CIPA 2EAUA 3SQLA 4KHPB 2GPWA 1T13A 3TM5A 2P4SA 4AKHA 3ZKWB 2FRXA 3RTEA 3VPDA 1W93A 3NOXA 5AXCA 3MIIA 5KHOC 2V4UA 5JIBA 3X1WA 1JHAA 4X60A 4Z9BA 1U8AA 3DQZA 4RZIA 5CFOA 3AHFA 5TT1A 2OBBA 1S1CA 5AM0A 4JC0A 3GEDA 1YI0A 2ZK7A 4EB8A 5K8CA 1WB9A 5GPBA 4KR7A 5AJHA 1PF7E 3U4GA 1RFLA 2WT8A 3H16A 3D1LA 3LPNA 4LK2A 5C8DA 2H2DA 2IHNA 3KSZO 3EMDA 1XP5A 2W2KA 3VOBA 4YMLA 5GJCA 3FRIA 2QL7A 3C7AA 3O3MB 2DBQA 4HYYA 4QYIB 4R98A 3U49A 3R3JA 4QT4A 2OBYA 3P0JA 3TMAA 1KQOA 3OY2A 2CDRA 3U3RA 2O2IA 3O7MA 1TVEA 1ADYA 2K7ZA 3EYWA 4HH0A 4BAZA 4QELA 1XZEA 1ZEJA 4LGVA 2XEDA 2HPHA 3NEPX 2EP7A 2JGLA 1KAQA 4CV2A 4RZSA 2PX2A 4WN3A 4C2BA 2AVNA