3WIBA

Crystal structure of y109w mutant haloalkane dehalogenase data from agrobacterium tumefaciens c58
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
289
structure length
289
Chain Sequence
PHSAFGDGAKAYDVPAFGLQIHTVEHGSGAPIVFLHGNPTSSYLWRHIFRRLHGHGRLLAVDLIGYGQSSKPDIEYTLENQQRYVDAWFDALDLRNVTLVLQDWGAAFGLNWASRNPDRVRAVAFFEPVLRNIDSVDLSPEFVTRRAKLRQPGEGEIFVQQENRFLTELFPWFFLTPLAPEDLRQYQTPFPTPHSRKAILAGPRNLPVDGEPASTVAFLEQAVNWLNTSDTPKLLLTFKPGFLLTDAILKWSQVTIRNLEIEAAGAGIHFVQEEQPETIARLLDAWLTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the novel haloalkane dehalogenase DatA from Agrobacterium tumefaciens C58 reveals a special halide-stabilizing pair and enantioselectivity mechanism.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
total genus 105
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wibA00
1ODTC 5ALNA 3QPDA 4QDTA 3FYUC 5ESRA 3FAKA 3LIIA 2P8SA 2VJCA 2WIGA 5ALZA 1VJ5A 1ZI6A 5CRIA 1EX9A 1IZ7A 3DCNA 5DWDA 3BE8A 3HXKA 3GFFA 3KOOA 3LIPA 2PM8A 3WZLA 2J3QA 3UUFA 4FHZA 4H7KA 1VXRA 3DQZA 1XRLA 5J3JA 5FRDA 1C7JA 2PX6A 3IUQA 2XUIA 3GELA 2NW6A 1QO9A 4IH4A 3V9AA 5KWIA 3IURA 1YS1X 3G0BA 2PKYX 3AZPA 2G4LA 4IHAA 2HA5A 3E4DA 4Z49A 3W9UA 3ICWA 1JI3A 3K2IA 1DINA 1HPLA 2LIPA 3LCRA 4CG3A 1U8EA 2PSFA 4WY8A 2FJ0A 1XRMA 3KXPA 1XZHA 5A71A 5LZ8A 2DHDA 4PW0A 3WIOA 2OGTA 2GBFA 2XT0A 1BEZA 1N1MA 4DMCA 2WSLA 2VJDA 5EFZA 2AJBA 2HL6A 1GPKA 3GUUA 3L1IA 3S2ZA 4OYYA 1W76A 2XMQA 1LPAB 3WK4A 2ES4A 4J7AA 4BYMA 4Q82A 5I9IA 5A7FA 4C87A 5JARA 2G63A 4FNMA 1H2YA 3FOBA 4Y9SA 1DWOA 4YPVA 2YYSA 3WWPA 4ZWNA 4U2BA 2RONA 5BOVA 1MNQA 5HF8A 1VOTA 2WG2A 3C6YA 3O9VA 1OXMA 2WUGA 3FYTA 1E5TA 1FFCA 4X97A 1QIFA 1F0NA 1K6EA 4G5XA 4Q1VA 4FKBA 4E15A 3FBWA 3STVA 4UHCA 1EVEA 4WY5A 5HKBA 3R3YA 5AI4A 2Z3ZA 3KD2A 3R3WA 2XLBA 1TAHA 2WJ4A 4F21A 5EHZA 1YS2X 1CIJA 2ZYRA 1TIBA 3CCBA 4OB7A 1AX9A 3NUZA 2DCMA 3WJ1A 2WLSA 2OQIA 4MQMA 5ALEA 1CVLA 2ZJ6A 2BGNA 4BVLA 5EI5A 4F60A 4BTVA 2EDCA 2EEPA 3H19A 4A5SA 3B12A 5IVHA 4OUKX 2I3ZA 3DKRA 1MO2A 3BJMA 4DNFA 4GWLA 1DT3A 2WFLA 3O95A 3VISA 2RGUA 2AJDA 4X6YA 4EHBA 4LKOA 5EGNA 3HABA 1J1IA 3WL6A 1Q0ZA 4E14A 1JU4A 4NMWA 2PUHA 3G9TA 2I03A 3H04A 3IBTA 3D59A 3C6BA 2Q0XA 2BFNA 3R3ZA 2PUJA 5SYNA 3DEAA 3A2MA 1XZKA 1G5FA 1TCCA 2HHAA 3K6KA 2R8BA 4L3WA 3F98A 3K9BA 1WB5A 1Z68A 4KE9A 4OSEA 4G4JA 5ALIA 3R3XA 3TEJA 3G0DA 5YASA 1KU6A 4C6HA 5D3ZA 5A2GA 1H2XA 4CCWA 1BS9A 1EVQA 1JJIA 4BDTA 5C8VA 3H18A 1L7AA 5ALQA 5FP0A 1S8OA 2C4HA 5AIBA 1DWPA 2ZVDA 1O6FA 4PNZA 1E89A 1W75A 1JMYA 3GZJA 2QTBA 3H1AA 3DS8A 5CXXA 1ZD3A 4J0KA 2JGLA 2OXEA 4A23A 3VKFA 5BWCA 3PUHA 3ESCA 4CCYB 5T4BA 2B61A 1XKTA 1NU6A 5DYWA 4P92A 3DKKA 3WIBA 5D7BA 2OGSA 2ZYIA 1VKHA 4GXNA 2HFJA 1ZIXA 3CN9A 2X76A 4EY5A 1Y7IA 5IVIA 4LXGA 4K6HA 4BE4A 4DNQA 4Q34A 3Q8WA 4HVTA 2WJ3A 4B80A 5AHXA 3D2BA 4UHDA 5JATA 4AO6A 1XRPA 4GECA 4S0XA 5F4ZA 4X95A 4EY7A 3ICVA 2XUHA 3H2KA 1GQSA 5K3BA 3FYUA 3O4GA 4PQEA 2X5XA 4BAGA 3CCCA 1A8QA 5AK4A 4PV7A 5CMLA 1MPXA 1ODSA 2QUBA 4I3FA 4JEIA 1KU0A 4MEBA 4M0FA 2BUBA 3IUJA 2AJ8A 3ZV7A 2GYUA 2BKLA 1IUOA 4G4IA 2PU5A 3H2JA 4K6KA 4OB6A 1MX9A 2VA9A 3FLBA 1CR6A 3CN7A 3O4HA 5HCUA 2CB9A 2O2IA 3I2JA 3QBJA 3C70A 1G42A 3HZOA 2V96A 3TGLA 1Y37A 4QZVA 2WHPA 4IH9A 4AMYA 2B4KA 2QKYA 3A2LA 3V1MA 3G9ZA 1A8SA 2XMRA 3H17A 4BC0A 1KEZA 3L1HA 4BP9A 1CUSA 3TJMA 3HACA 2BAGA 4DNOA 1R50A 2PSJA 4PO3X 3IDAA 4YASA 3C5VA 2QM0A 3VVLA 5A6VA 3L1JA 2HA4A 2VAXA 4B0OA 1XRQA 2HU7A 4ZV7A 4B84A 4IH1A 2XQGA 2XE4A 4J03A 2DQYA 4LXHA 5K3CA 3HEAA 4BB0A 2OGZA 2IX9A 3F9CA 3IB3A 1GZ7A 4W1RA 2VTVA 1FFDA 5SYMA 5FPQA 3DOHA 3WKBA 3D3NA 4N8EA 1XQXA 2Y1KA 2HFKA 5ALRA 2CJPA 5ALTA 1EHYA 5HF5A 3DL4A 1GPLA 3LLCA 1WCYA 5I8PA 4YX9A 2OCKA 1G66A 1XROA 3E0XA 3LS2A 4U2FA 4BCDA 3R41A 1THGA 4UHEA 2HA7A 3D0KA 4WFKA 2Z8XA 5JD6A 2PBLA 2JGJA 4WFJA 1WB4A 3H1BA 4FTWA 5ALSA 3I2KA 2Z5GA 1AGYA 1ZGCA 4Y7DA 2EDAA 2DHEA 4IQ4A 2ZYHA 5AKLA 3R3VA 1IZ8A 5EIHA 3QPCA 3IUMA 4RNCA 5HFNA 1JKMA 4EBBA 1M33A 2H7YA 3ZLTA 1G4HA 4AZ0A 1ZI9A 2BUAA 4QWMA 1GGVA 5JADA 3STUA 1J07A 1CFJA 2RAUA 2C58A 5AM1A 5BV7A 2WTNA 2XUAA 3S8YA 1EXWA 5K3EA 4OYLA 3M82A 2X8BA 1YSCA 1QLWA 5AI9A 4DLNA 3EF3A 3ESAA 3EQ7A 3SC2A 3BF7A 2WUDA 1UKAA 5AKKA 1XZBA 3WYNA 5JIBA 3H2GA 5K3FA 3OOSA 1B41A 4H7JA 4DSZA 4H7EA 3ILSA 1CEXA 5AH0A 4N5IX 4KE7A 1UT6A 1SC9A 2GZSA 3FCXA 4INZA 3EQ8A 1R1DA 5AOCA 4KACA 2CEKA 3BF8A 2FJPA 4B7ZA 5AJHA 2QZPA 1A7UA 4UFOA 3N2ZB 1SCIA 4OCZA 1CUBA 5JD5A 4X92A 3FLAA 2B9VA 1ETHA 1DQYA 5CURA 1K5PA 4QLAA 5DLPA 5JAOA 1FFAA 2DSNA 5ALHA 3ZWQA 3STTA 2VEOA 1ZGBA 3HJUA 3IUNA 3RM3A 2VF2A 1ZOIA 4MWTA 4GLBA 4E46A 2XDWA 2XLCA 4BAUA 5CT5A 3FSGA 2JGIA 1QFMA 3WA7A 2YH2A 4B81A 1QIEA 1A8UA 2Z8ZA 3QMVA 3WWCA 4BATA 3BXPA 3IVMA 5AI0A 5HKAA 3VJLA 2JEYA 7YASA 4QLOA 2J4CA 5CBKA 5AI8A 2WG0A 3QMWA 4B83A 1XLWA 1XZJA 1P0MA 2XMCA 3I2FA 4BP8A 4EY8A 3AJAA 5AKZA 5AM0A 5LP1A 4BAZA 2VT7A 2XMGA 4K6GA 5C81A 1HLGA 1K4YA 3AUKA 2CUTA 3V48A 4X71A 4Y2PA 2VJBA 3WK5A 2JBWA 3ED1A 3HSSA 4BCCA 2HA6A 4C01A 2Y6VA 4U2EA 1LPMA 5HQ3B 1EI9A 1CUAA 4L72A 3NOXA 2VAVA 4AZ3A 2K2QB 4C4YA 1LZKA 1EB8A 1MJ5A 5HK9A 3MUOA 1BU8A 3CXUA 4EY6A 4ZREA 2OQVA 1QIKA 2WU4A 1QONA 4UBIA 2GBGA 1THTA 5E2IA 1U4NA 2HM7A 2Y2VA 3JW8A 1BE0A 4G8CA 5JAPA 3C6XA 3QITA 5ALKA 1XFDA 1Y7HA 1T4MA 4KJXA 1R9MA 4PSUA 5AM5A 4ZI5A 2R11A 3I2IA 5LYYA 3TRDA 5LKAA 1IMJA 4BVKA 3IA2A 5AO9A 3WK9A 1WB6A 2XQKA 3FWHA 3WL7A 1P0PA 4WDQA 1BRTA 5ALMA 4EZIA 1XRRA 2WUEA 1CUXA 2QVBA 1QTRA 2G5TA 3VXKA 1CQZA 2ACKA 4WJLA 5AKIA 3BDIA 4CG1A 4X91A 3HC7A 4RGYA 4AX4A 1LPOA 2YASA 5AKJA 1VZ2A 4DNPA 5CXUA 4MEAA 3W06A 1YAHA 4Q3LA 5DNWA 4UHBA 5EHQA 1SCQA 1OCEA 5ALWA 1WOMA 1I6WA 3OURA 2HA2A 2WIDA 1WPXA 2GYWA 1QIDA 4GI1A 1UFOA 3KWFA 4Y2JA 3F97A 1ORVA 4KRYA 3G8YA 1XZMA 5IKXA 1VE7A 2AXEA 4J0HA 1CUHA 4HZGA 4RPCA 2XMZA 5T4FA 2QRUA 4FMPA 1X70A 5JANA 3UMJA 2UZ0A 1QO7A 2HIHA 1XZFA 2QR5A 4DTCA 2ZJFA 2PPLA 4FFVA 4MYSA 2OLEA 5AKGA 1DQZA 5ALPA 2E3JA 3D2AA 4HRXA 3P2MA 1GPNA 4Y2UA 1CUFA 3MUNA 1VA4A 5K3AA 2XUFA 1XQYA 2WIJA 4ARAA 1XZCA 3C45A 3H0CA 2JGEA 1GT6A 5KBYA 3A70A 1C7IA 2PL5A 4AB1A 4O08A 5E4TA 5CT8A 5AK6A 3DL7A 3G9UA 2VSQA 3QM1A 1DX6A 2WHRA 1YASA 5JZSA 3I1IA 1AKNA 5IVKA 2J4FA 4QNNA 5CH5A 2QJWA 3UUEA 1ACJA 3ESBA 4FBLA 4XJVA 3M81A 1EB9A 1F8UA 4JYPA 3ZLUA 1GQRA 5A7HA 3ZLVA 4IO0A 3A6ZA 2O2GA 2PSDA 4HS9A 4CIBA 4UFNA 5H3HA 5AM3A 3BIWA 3WI7A 4Y2SA 2XI4A 4PF1A 3AILA 3W04A 2D5LA 4C89A 1T2NA 1U65A 5HF6A 2OPHA 1DWQA 5AOBA 4C88A 3FVTA 3AFIA 3I6ZA 3ANTA 4MXDA 4H35A 4W9RA 3VJKA 1ZJ4A 3WZMA 1UK9A 4BRSA 1X2BA 5LKRA 2V97A 3T52A 5C8XA 5ALXA 2O7RA 4NZZA 1ZD4A 4H18A 3WMRA 4UBMA 3IIIA 1TCAA 5AI5A 3DOIA 5E4JA 1CPYA 1QIGA 3O4JA 3G0IA 1UOQA 1AMNA 3FYUB 1LPSA 3V1LA 1HQDA 2JGKA 1SFRA 5ALUA 5ALJA 2C5FA 3DDUA 3FNBA 4WFIA 2XUGA 3V1NA 2Z3WA 4X6XA 2PVSA 3WA6A 3R3UA 5K3DA 4P9NA 1E8DA 4D9JA 4BBZA 1BCRA 2C5GA 3WJ2A 1UOOA 1XZAA 1USWA 4TVKA 4KAJA 5CT6A 4QDZA 2WHPB 1XQVA 1ZD2P 4AMZA 1QFSA 2OG1A 1EDDA 4EB0A 5FUMA 5LZ7A 4J0JA 1ODCA 1U2EA 2I78A 4ZRDA 3AIOA 1CUEA 3WLAA 4EY4A 3DYIA 4N8SA 1MT3A 4Q3OA 3PFCA 4ZV9A 4K2AA 1YCDA 3G0GA 2WIFA 1EDBA 4M0EA 1CUWA 1BCSA 4MWSA 1RP1A 5JZBA 1BROA 2C7BA 2FX5A 4BVJA 4TPKA 3HLKA 2OAGA 4NVRA 1EH5A 1TRHA 2XUKA 4FLEA 4B0PA 1NU8A 3I2GA 1VXOA 2ZSHA 3DLTA 2PSEA 1NX9A 1DT5A 5AP9A 3GA7A 3C87A 3RLIA 3PFBA 1LNSA 1B6GA 2I3DA 2QXTA 3FSGD 2BGRA 3AZOA 1LPNA 2QUAA 4Y2RA 5FXMA 1QGED 4CIAA 4HAIA 2PU7A 2RHTA 1VLQA 3A2NA 3OPMA 2OCGA 4OD0A 1AUOA 4X94A 1J2EA 4X90A 2XQJA 3KDAA 1UK7A 1H2WA 2JF0A 1FSSA 1CUYA 2XQIA 1YA8A 5DYYA 3QYJA 3KWJA 2ECFA 3W9BA 1VZ3A 3C5WP 4FNGA 2XMBA 5LZ4A 4ZGBA 1GXSA 3O0DA 2J3DA 1XKLA 5DTIA 3D7RA 4LYDA 4X3CA 2W6CX 4MQLA 3U1TA 5ALVA 3OM8A 3G9XA 4WDRA 1MU0A 4X93A 5ISMA 5FKJA 4N5HX 4KRXA 2GBCA 3C43A 2QJRA 1MX5A 5E4YA 3BL8A 2ZJ7A 5AK5A 1XZDA 3WWOA 1AZWA 2HDWA 2WILA 5ALDA 5KWJA 3DNMA 2VJAA 4KE6A 3AZQA 3DJYA 5C8ZA 1EK1A 1MNAA 2RIPA 3V1KA 1DTEA 5T4EA 1O6GA 3JYHA 4ARBA 4UHHA 3G7NA 5DNVA 4AO7A 3F8SA 2QOEA 1D07A 2ZSIA 1UK8A 1HKHA 3T4UA 4KAFA 3SX4A 2PSHA 4QWWA 4G9GA 2OCLA 1YB7A 2HA3A 1QE3A 4LXIA 4KE8A 2ROQA 3QVMA 2ACEA 3WWDA 3LP5A 1CUZA 2HU8A 4AN1A 4X6UA 4JUIA 5HZGA 3OTQA 1SCKA 4JYMA 1E8NA 3PF9A 4KAAA 4BC1A 4B82A 5JALA 2BUCA 5IH7A 1F6WA 4G8DA 1BN6A 5IVDA 4BRZA 1HBJA 1R4ZA 2Y6UA 4G4GA 3C8HA 4FOLA 5ALLA 3FVRA 4LHEA 3WK7A 3STYA 5JD4A 3W05A 1W52X 4C4ZA 3F96A 1ZD5A 4P93A 3STXA 1A88A 2GYVA 5AKXA 4FLFA 4F0JA 2V98A 3WL5A 2JEZA 4Y2TA 4FDMA 1CQWA 1CUDA 2FUKA 5AK3A 5FPPA 2D0DA 5A62A 4H77A 4H7IA 4F5ZA 3M83A 3B3QA 4ITVA 4UBJA 4KR0A 4JNCA 3H2HA 1ZJ5A 4BTLA 1QTIA 4AN0A 5AM2A 2QXUA 3GROA 1JT2A 3KSRA 1FFBA 1EK2A 3H2IA 1P0IA 4BZZA 1RWQA 2O2HA 3I28A 4LIPD 4CCYA 4I4CA 2WU3A 3NWOA 1CUIA 4A16A 4JH0A 4UPDA 1CUVA 1VE6A 1PFQA 5FDFA 5FV4A 4XX1A 2ONCA 4X85A 1UKBA 1R88A 4QE3A 3BDVA 4AO8A 1Q0RA 2HRRA 2CZQA 1P0QA 2CKMA 1CUCA 1R9NA 4H7HA 3DYVA 3X3HA 4ZXFA 3WKCA 4E11A 3ANSA 6YASA 1Q83A 3G0CA 5AI6A 5AIAA 2VT6A 1XLUA 2WG1A 4OPMA 5HK8A 2W22A 4HXGA 5JYCA 2C0PA 2WIKA 5LZ5A 2OAEA 4DYHA 4GEGA 3WL8A 4XVCA 2XUJA 4RE6A 4ETWA 3OC0A 1QZ3A 4UBNA 1GKLA 5LZ9A 4TGLA 2RI6A 4XIIA 5C7YA 1JJFA 1UOPA 3G02A 4Y2YA 4CG2A 4M0MA 3GBSA 4DIUA 4V2IA 3BWXA 1PV1A 3ZI7A 1XQWA 1TK3A 3MVEA 1XZEA 1ZI8A 2AJLI 5JAUA 3AIKA 3O4IA 2DFPA 3RK4A 1E3QA 4DM7A 4YK7A 5D6OA 3SWWA 5KREA 4GW3A 4UBKA 3WQHA 3PF8A 4QA9A 3QMMA 2XQFA 5AKHA 1LGYA 1JJBA 2WFLB 1CV2A 4H7DA 1W4LA 1AURA 3PUIA 2IITA 4L0CA 1AQLA 4Y2VA 2XMSA 4N8DA 4B6GA 4DSAA 4FLMA 2WJ6A 5LZ2A 3VJMA 1LBTA 4RE5A 2XUOA 1QIIA 4ROTA 4UFPA 1OILA 3HI4A 3HYSA 5FOQA 4B9AA 1FFEA 1E8MA 1GKKA 1MTZA 1WPRA 1K8QA 3NGMA 2XUDA 2WFZA 1BEEA 1QJ4A 4W1PA 1CUJA 2DQZA 1EINA 3AINA 3D2CA 1H2ZA 1CUUA 4FWBA 4Q3KA 4EA6A 1LBSA 1RYYA 4AQDA 3VVMA 2CBGA 2WM2A 1X2EA 4UHFA 3WKAA 1DX4A 2H1IA 3WK8A 5T4HA 2WHQA 2QS9A 3ESDA 5LIPA 1WHTA 3STWA 3PE6A 4HRYA 2QT9A 2VQ6A 1CUGA 4FBMA 3WK6A 5JZ9A 1UK6A 5DJ5A 1H23A 1SOMA 4MJ3A 1N5MA 2QMQA 1QIJA 1PJAA 2DR0A 1XZLA 3BIXA 3I6YA 3D5EA 3W2TA 3M3DA 4U2GA 1XZIA 4MYDA 4UBOA 4QDXA 4Y2QA 4PSDA 4GHWA 5AICA 5DTJA 1AC5A 5AM4A 3N0TA 2HU5A 1C4XA 3E1GA 4B85A 1QIMA 2H7XA 4WCVA 4HXEB 3QH4A 4KEAA 3IULA 4B9EA 5AKEA 4W63A 4BE9A 3OG9A 5HF9A 3U0VA 3WKEA 5JASA 3FLEA 4U2DA 3F67A 4GDMA 4L9AA 1LPPA 4X00A 3I1YA 4X7BA 5CW2A 2H9YA 2WKWA 3O9MA 3JWEA 2CMFA 3WKDA 1L7RA 1CLEA 1JU3A 4CI9A 5ALYA 4H7FA 3QZUA 5I7UA 1L7QA 2Y2UA 5ALOA 5D3KA 4QDUA 1MN6A 4HTAA 5CTAA 1HL7A 1N8SA 5DNUA 1W1IA 1IVYA 4LYEA 1HDEA 3BJRA 1EDEA 2JGFA 2HA0A 5AOAA 2GZRA 2O7VA 4Q05A 1VA5A 1ACLA 2AJCA 5A7GA 2DHCA 3D4LA 4G9EA 4I19A 4NS4A 5EHXA 5EIEA 4PSCA 4P08A 3I6MA 4GBGA 4KYVA 2C0QA 1UKCA 3DD5A 3YASA 4HXFB 3E3AA 5ALGA 2XMDA 3RKSA 1WHSA 1WM1A 4AXBA 3ZPXA 4J0CA 4W1SA 1N5RA 5CT9A 5EHNA 4J0IA 2JGMA 2GBIA 5AKYA 1TQHA 3RARA 4H0CA 2WUFA 1F0PA 3I2HA 1UXOA 2ORYA 3PI6A 1H22A 4OB8A 1IUNA 2XB6A 2HRQA 1K63A 2BJHA 5DYTA 3C8DA 5CT4A 2G5PA 3AIMA 1ZICA 1Q84A 1XLVA 2WTMA 1MX1A 2XUQA 3PDCA 4UUQA 5BWBA 3WWEA 5JAHA 5CH3A 1JMKC 1TKRA 4BCBA 4QEKA 1CRLA 3QPAA 2IIVA 3R0VA 3EBLA 5HFAA 2WFMA 3C6ZA 3VDXA 1UZAA 1ZIYA 1YA4A 4DMFA 4DMKA 5HQ3A 3WYDA 4BZWA 2HADA 4CFSA 1YAJA 4XWGA 1LLFA 4DMHA 1ISPA 1EA5A 2JIDA 1LZLA 4K5QA 1JFRA 1BN7A 5ALFA 2BCEA 1DU4A 2YXPX 5FLKA 3EQ9A 3FCYA 1YR2A 1IUPA 1FJ2A 3B5EA 1MAHA 4G8BA 3R40A 4FFWA 2VATA 4BDSA 1TCBA 5K3FB 2ZYSA 4Y2XA 2RHWA 1W6RA 4U2CA 4J0GA 4DGQA 5K5EA 3MGAA 4QDOA 3PICA 4OU5A 1R3DA 5EIAA 4C4XA 3Q0TA 3EIOA 4G1FA 1QIHA 4EUSA 4J0DA 2V9ZA 3HRHA 1E66A 1UWCA 2H7CA 5CH8A 1QOZA 1XRNA 1ORWA 5LLSA 2XUPA 2WQZA 1LPBB 1YB6A 3SK0A 1XZGA 4J3JA 2OCIA 4W1QA 2B20A 4OU4A 4UBLA 1MAAA 1J06A
chains in the Genus database with same CATH superfamily
5HE8A 1E20A 3OKFA 2PKEA 1MJGA 1ZS9A 5EHIA 3TR5A 1ZUNA 3CEPB 1N2GA 2C03A 1CERA 2HD4A 1XCMA 4I4NA 3K1AB 3KZXA 2IVZA 4M1WA 4Z3OA 2PMKA 1NMZA 1BVRA 2H00A 3IALA 5DOZA 4NMHA 4G3XA 1D9XA 5AWFC 2VJCA 3AKEA 4C03A 5KHOC 3TAXA 4CKZA 1GCUA 4RHTA 1NQXA 5CRIA 2TSYB 5EUQB 4RL6A 4LFAB 2MSWA 2I7XA 3DAPA 3ZHZA 1UC9A 3DCNA 3LPCA 3X1MA 3RRBA 4C22A 3HMQA 5MFZA 3G23A 4NY1A 2OOSA 3UVEA 4G0WA 1U6JA 1U6KA 3KQYA 4U8HA 3HXKA 3T5GA 3LIPA 3H3XA 1IXSB 1Q20A 2WIAA 3NDRA 1AKWA 1CY8A 4JGBA 3UUFA 4ZCIA 1JLKA 2Y1XA 4MUNA 3U4AA 4IRUB 5FJIA 3FM9A 4YO8A 1K89A 2O2DA 1ZG3A 5BQXA 1XRLA 1SK9A 2ZZMA 1U3TA 3UK7A 4XWYA 1CRPA 5CB4F 1NNLA 2PGOA 5L3RA 2PX6A 5KYUA 2X0IA 2B0JA 3OE5A 4YMWA 3KELA 1UBRS 5IN4A 2O8CA 1EX1A 4AM8A 1QO9A 2D59A 3NV9A 4IH4A 4I6JA 4ND2A 4ZVKA 5BSTA 2GZAA 3CH7A 3VHRA 3IE2A 3MSXA 3ZWNA 3MHPA 1XPOA 2FR1A 1QPZA 4WNIA 2MJLA 1K8YB 4MGIR 1OC2A 4OXRA 1PZFA 1CZRA 4I46A 4H6WA 1WBDA 1Z7EA 4ZT6A 2GJ8A 4CM4B 5BSHA 3KXIA 1CFZA 1T9GS 4MVXA 2D1QA 1U9ZA 2XSZD 4KSCA 5DHQA 5E7MA 5FOTA 1JHDA 3X1DA 2EHJA 2R1TA 3FR7A 1K0FA 2QV7A 1SAYA 2J41A 1N78A 1Q0SA 3OIYA 3HJGA 1BKSB 4U5XA 3DCYA 1DLIA 3G1WA 1FP7A 3HWSA 2EGGA 3TS1A 3CKKA 4BUJA 3W5DA 3IYLW 1BA3A 1P77A 2WR8A 3L8YA 1J22A 1CZLA 2VPYA 4L4XA 3UUWA 2NSDA 2VAMA 1JB9A 3EWNA 4UDNA 3QKIA 2BDEA 5AW2A 1JR2A 4U8GA 4ZHQA 4J9UE 1GUZA 1KJJA 1NVTA 5CJ2A 1IQ0A 2OWEA 5E6SA 1T9KA 1XZHA 4WD3A 4Q47A 1PD0A 5CD9A 1Y9DA 3M6AA 4L51A 3TQQA 4BP3A 4P5DA 3SQXA 3HR7A 2OGTA 1X94A 2LDXA 2OC4A 4ZA2A 3MD0A 4ADSG 3D1VA 3H84A 2WSLA 1GL3A 2VJDA 3PQCA 1O4VA 5EFZA 2YICA 1QH1B 4A6EA 1KPGA 3VHXA 2HL6A 3WNCA 3WB0A 1XDBA 1GD1O 1PO7A 4COOA 4BO5A 3GUUA 2X1LA 1C7EA 5HDBB 4PZPA 2OCXA 1WW2A 1S2LA 1EKXA 1MAVA 3L1IA 3PNYA 4CMGA 2EFJA 1R5OA 4PG4A 1I5RA 5BYAA 1SBTA 4MUJA 3VTZA 4OYYA 1BNCA 3U16A 1JZQA 2Z1DA 2NQ8A 4H1TA 4ATNA 4BNXA 3IP5A 4J1QA 1TZBA 1VPTA 3P7MA 3ROTA 3WP0A 1ECLA 3I9KA 3RVRA 3L8ZA 3PKZA 4K28A 1BX1A 1Q21A 1SD2A 1MA0A 1TQDA 4R8SA 1FNDA 2NPOA 4IGEA 5A7FA 5I9IA 3JQRA 4DV7B 2J07A 5CXQA 3LF1A 2P2LA 4K9QA 4BX2A 4TMXA 5CXSA 4YPVA 4O3FA 1LTKA 2Q5LA 2W0MA 1NN1A 3QW2A 4HLNA 2CE7A 1ENOA 1X7YA 2P40A 4OH7A 4IJUA 1RRCA 4Q4LA 1U0SY 1CE8A 2WM8A 4FYPA 3V42A 2HEIA 1A04A 1ONNA 2WF5A 3VO8A 4TUYA 4UE3S 3SJBA 4ZGGA 4KKVA 1M8KA 4JC4A 2DOKA 2MYTA 2WUGA 4C3UA 1TFUA 5K3SA 2LE0A 2ZSUA 1IB0A 1E5TA 2ZJ4A 1FFCA 4X97A 2HU2A 2V6FA 1E59A 4D6PA 4QJ3A 1CQJB 1E9FA 1H9BA 3SLRA 4DPLA 5FBVB 1QIFA 4U9HS 1IM2A 1NMYA 1Z5UA 2LKCA 2PZ8A 5ULLA 4ZU1X 4BNKA 1Z26A 1VI5A 4FKBA 2KWIA 2OV4A 1T5IA 1DBWA 5JEDA 4QOGA 2HCFA 3DV0A 3D8NA 2PJRA 1XTZA 4F97A 1MVLA 3MWLA 4KJZA 1QUFA 2JHPA 5D3MB 2D0OB 1HZJA 2FPKA 2PNFA 4WHMA 5IH3A 4EJ2A 2J9RA 3N0VA 4RD2A 4UHCA 3RYIA 1EVEA 3T7TA 3IDSA 5HKBA 1JVNA 4ZVMA 4WNYA 2OD2A 5FFNA 3KD2A 3I6QA 1A0OA 2F1HA 3R3WA 4M21A 2H1RA 3RS2A 2AFRA 2FG6C 4C1BA 4EF5A 4YXFA 2XLBA 1XIVA 5CM8B 4DLYA 1AN9A 2ZB4A 4ER5A 1VCOA 4L22A 3ZDXB 2H1HA 2JLQA 1XTBA 1C9MA 2ZSKA 1RWPA 1SQSA 1L8AA 1TAQA 4FOSA 2XNCA 1S8NA 3NUZA 3GD5A 2XEXA 3B3AA 4RGBA 5DF1A 3SR0A 3KZKA 4M87A 2XVZA 4ASUA 3DP7A 5EXTA 4PWZA 5B3JA 3U13A 3W8RA 2C3YA 1VPEA 1TZ2A 1AQUA 3JQQA 2XZPA 4WXYB 4AYXA 1J1ZA 4RK4A 2ZJ6A 1ODIA 2BGNA 4DWOA 2AOVA 4JLDA 5LUBA 4YCLA 1DHRA 4BVLA 3E5HA 2B3TA 2L19A 3TD9A 3VPCA 4NARA 3E22A 4F60A 3DTVA 3EWAA 1TL7C 3H19A 4A5SA 4D9GA 5KMGB 1QQTA 1Z5VA 4EM6A 1DTWB 3LY7A 4UKDA 4EZBA 2O3UA 3ZH2A 5JAZA 5SY4A 3RIXA 1NURA 2ZR7A 4N0DA 2FLKA 3GI1A 4Y9UA 3EBPA 1T0IA 3RH0A 3QBTA 3SC4A 3ZZUA 4DNFA 5BVGB 2JLCA 4GWLA 5J63A 1CDOA 2JFXA 4ZYWA 1II8B 1ZVKA 2WFLA 4U4AA 3VISA 2D2VA 3KPUA 4E5UA 1U1EA 5IC5A 4EJSC 5ER6A 5IUNC 4DQ0A 4X6YA 1U8FO 3INYA 1OAOC 4G0OA 2J30A 4M36A 1F12A 3EB9A 4X8HA 1T1JA 3EVEA 3OEYA 3ZY4A 2A9PA 3NPMA 4H6PA 3ZOZA 2GSWA 1BH2A 3FJOA 3K9WA 1WZUA 2G6TA 3DONA 1LB1B 5IS2A 1ZOOA 4YA6A 4BO0A 2V3VA 1PL0A 3IBTA 5FUYA 2JCSA 3UY4A 1EAYA 2PZLA 3A26A 4FFMA 3QWBA 2UYHA 4C0QC 5H82A 3THYB 3QVGA 5G3YA 2OBBA 2AWOA 2V7VA 1AZSC 1Z7WA 3Q5EA 2BFNA 3MYRA 5BN4A 1GSIA 2XCOA 1RXUA 2QEQA 4QUIA 5AJWA 2PWPA 1YJBA 2B4TO 3BGWA 1P29A 3Q8LA 3IPRA 1C7FA 3P0RA 2HHAA 4UD6A 2WYWA 1S8FA 1XLTC 1BSVA 4HZUB 4MHSA 3TQTA 2RG1A 1CQIA 4NV1A 3LYAA 1EDZA 2DPGA 3T15A 3W3AD 1ZVQA 4OHYA 3ELBA 3OLCX 4MOWA 1GZ6A 1YKSA 1WB5A 3ROZA 1D6MA 1G8KA 1W5FA 1W44A 2YIVX 3OUUA 4FNOA 4KE9A 4MJLA 1K9SA 1NTRA 2CYAA 3L3BA 2OV6A 5ALIA 2ZYUX 5IC6A 3HCRA 3WGQA 5AVRA 3TEJA 3WGZA 4B4VA 1IVNA 4N5NA 1PYDA 2IC5A 5JTTA 4Z4FA 1HRDA 1UBNA 1V3TA 1GYPA 3M70A 3IE1A 4TS9A 4OXKA 4BV3A 2ECOA 2V54A 2JK0A 1GCIA 2NAPA 2P9JA 5L95A 1PJ2A 3W1EA 1JJIA 3NTOA 4BDTA 4Q4CA 1RP7A 2KS6A 4DA8A 4B3DA 4F91B 2QPLA 3HGQA 2NU8B 1K5DA 3CONA 4UEQA 3DAHA 2NVUA 3LPAA 2WWTA 3KYIB 3D43A 3PYXA 4HWRA 2FW7A 1XMPA 2C2BA 2DC1A 3D7KA 4IIYA 1R4NA 3E35A 3NRCA 4RWEA 2F3UA 3LUKA 4PHCA 1YFKA 4Y6QA 2O3JA 4DIOA 2ZVDA 5MGNA 4W5WA 2DY0A 4D4MA 4LJ4A 2ZUVA 1JMYA 2D54A 4TKMA 5EJ6A 2CDCA 1C9EA 2FAXA 3BD9A 1WUTA 3R7WA 3Q9SA 4PYMA 5T8KA 3IQIX 1M2GA 1GSHA 1TA0A 1X7XA 1ZRHA 1LDYA 3DS8A 3KKNA 1NYTA 3NC1C 4OFXA 5CG1A 1XCOA 4YAEA 1JWLA 4MKXA 4PGAA 4Q93A 1ZHHA 4IMJB 2VSNA 1XDUA 2G80A 4S2UA 3VH1A 1QB7A 3VKFA 1OU0A 1FEZA 3KJNA 5IDWA 1DUIA 3MB8A 1COWD 1Q0QA 4JLMA 2OBLA 3AKZA 1TVKB 2P91A 3CLTD 2JEOA 2O6HA 4CCYB 2IPLA 3L07A 1XKTA 4F1JA 3GMTA 3GJ3A 3A36A 1JSRA 5EOVA 3DDZX 3JATA 4KGZA 1NWCA 2YZ7A 2ZBPA 3F6SA 4QGHA 3QOYA 5KYNA 3U9TA 2Q29A 3O8LA 2QK4A 1V26A 2ZGVA 4GZ3A 4OHXA 2Z9DA 3VPFA 2OCDA 3U4GA 1IIBA 5TGTA 3VVCA 2DUJA 3QYAA 2VSXA 4GXNA 2HFJA 1Z6QA 4TS4A 5ECWA 1Y7IA 2Q62A 3IHWA 3W78A 1CY6A 4TLMB 1LW7A 1NV8A 2MSNA 4Q34A 3BORA 5K8UA 1PN3A 4FSHA 5CA0A 3WLRA 5AW6A 3LK7A 4M99A 2QNIA 3KPYA 4FYWA 4O63O 1IN8A 1USGA 1SC3A 2D1YA 3HVIA 3OY7A 2QI9F 3TW0A 1FVHA 3V5NA 3ZS8A 4HVTA 3EQ6A 4OFZA 5AHXA 5DASA 4YRPA 4NQRA 2J33A 1EX6A 3NPAA 4JIMA 4UHDA 1Q7CA 1XRPA 1YKGA 3Q9LA 4Q1BA 5DHTA 4IR7A 4ZK2A 3Q7EA 2ZRLA 1OHHD 1CZNA 1FVFA 3EZYA 2J31A 4PSKA 4C0KA 1B8OA 1TM5E 5ICMA 1T9HA 3ICVA 4I5EA 4JU9A 5C1BA 4U9IS 2XUHA 1U7HA 4GGPA 5LQCA 2GAJA 3PL1A 1KF0A 1GZUA 3FYUA 4B09A 1Z2AA 4WADA 4P2BA 1P1IA 1GRQA 1NC3A 1YTLA 1G2IA 1JYFA 2BFBA 2ATXA 3F1LA 3O4GA 4QECA 3AEUA 4Z0TA 4TWAA 1U1IA 4CMBA 3IAS1 2TMKA 1F6BA 3CLVA 4NBKA 3UF0A 3UMGA 4PG8A 4YN3A 2OHFA 1W36C 3EUAA 2DR2A 1Q12A 3T5DA 2ZAOA 3WHKA 5KQGA 4JEIA 1JN0A 4MEBA 2ZYTX 2BUBA 1A50B 3F6YA 3CY6A 3MJCA 4QBKA 5EWJB 3L5OA 1LD3A 4L8FA 3ZV7A 1X0VA 4AY3A 2ZIVB 3HUTA 1F2UB 3WBJA 2GN8A 3BMXA 2Z4RA 4FCWA 4RZ2A 4U3JB 3W5VA 4C08A 1Y8RA 2PRIA 1J4AA 4DUGD 3CUEF 4CN9A 3D6FA 3FLMA 3RJ5A 1F17A 3M9XA 5DYIA 3ZGYA 3S70A 3WYCA 3S28A 1A1SA 1PNQA 2GTIA 4PZZA 2YYZA 2ODBA 5BQFA 4U6QA 4K9LA 1HETA 1P2TA 1BC5A 4TKVB 1XHLA 2AFVA 2WSSD 1U0EA 2EHDA 3UJ6A 3DEHA 4IJ6A 2VBFA 1EUDB 3DVRX 3K9NA 4FFBB 1Y9JA 4HVAA 3CN7A 4J75A 3V8NA 3K92A 4NPHA 5A03A 2ZJYA 1W36B 4WK4B 2CB9A 3D54D 1XD2A 3AP1A 1M8FA 4DBLE 3IAUA 2LVBA 2UVPB 4LUCA 2WM9B 4EW6A 2C96A 1S9DA 3AVOA 2OKGA 1PFWA 4R8LA 2Q0SA 3TM5A 1EUQA 1M2WA 4WVLA 3VKVA 1RLMA 1YRWA 4J43A 1FLNA 1N3LA 3KQNA 1LDEA 1K8RA 2FV8A 2PS0A 4R81A 4AMYA 4GDFA 1JXOA 3BQMB 3EULA 4L5IA 5J2TA 1QBKC 2PS9A 4J8PA 4WZBE 3A2LA 3NYQA 4FOOA 4YO7A 1FP6A 2J3LA 2ERCA 2PCLA 3MIIA 4L8WB 3TZBA 5JECA 1KEKA 3EGIA 3A4YA 3EUFA 3RD5A 1RI1A 2XNHA 3HO8A 4BC0A 2HJVA 1GGEA 3LDHA 4U7JA 5FA5A 3HACA 1EFDN 1PIWA 1TJYA 3D8UA 3OFND 4R9SA 4RCYA 2BF7A 2B4AA 2FWMX 4UZEA 2XXAA 2RGGA 1RYEA 3PITA 3C5VA 1Q57A 2QE6A 1U28A 3GF4A 3EGCA 3RK0A 4UOZA 1SXQA 2UZ3A 2XNJA 1DC7A 1SC4A 1WLSA 3BOSA 3HYNA 4JASB 2ZJZA 4GPAA 1CTQA 3R9XA 2C61A 2MSDB 3SZOA 2F59A 4B0OA 1QVZA 3CVOA 4DQUA 2INGX 5KVAA 4BJ6A 3ZE8A 4MRRA 5ESDA 4X7PA 5DI3B 4AWAA 2XE4A 1RM0A 1UT5A 3W9YA 3OU7A 2DQYA 1FFXA 1JMVA 1U5BA 1RKQA 4MKHA 1T2UA 2TECE 1M2HA 1XCBA 2ETVA 2FEXA 2WT8A 3O8OA 3A4VA 2YN0A 4R71A 2V6MA 4XDHA 3OICA 4OIFA 3TEMA 1GTSA 2AZXA 1C2YA 3LX5A 4S2EA 3ZVMA 2ZB8A 3B48A 1E3WB 4HC4A 2ZJ5A 4ZPJA 1OX5A 2NM0A 2ZKIA 2XADA 5SYMA 1XTPA 2ZUTA 5JO9A 3EA5A 4P0TA 2QDKA 3D3NA 2WJYA 3AEKA 4TQAA 1SB8A 2EAUA 2HXGA 4RK0A 5ICSA 1XQXA 4H27A 3DTNA 5B1SA 1WKVA 1I24A 4JP2A 4RDIA 2CJPA 2MIIA 2ZBGA 1EHYA 4L8LA 5E9JA 5HF5A 5AVQA 3DL4A 1KSFX 1U5BB 4EGJA 5MFPA 3HM9A 4ZDWA 4H3SA 4URHA 4PNEA 1YJXA 1K3UB 5BT8A 4PCUA 3GT7A 4K9KA 5I8PA 2G0AA 3R5FA 4YUAA 5A5GA 1M76A 2OCKA 3NXKA 2ACVA 1C3VA 3QHQA 1M83A 4U2FA 4B87A 4CCSA 4RYDA 4JC5A 1F8GA 1HNXB 4H9GA 1J8YF 1JIKA 1PZXA 2E0IA 4OF4A 4DA6A 1Z22A 4UM7A 2R8PA 3AHFA 1JAIA 2A33A 2B36A 4OSPA 4Z9YA 1YONA 3BB3A 3D0KA 5K6RA 4WFKA 3N2YA 3BD8A 3Q10A 2JCYA 1A2BA 1FTGA 1S3SA 2Z8XA 1YZTA 4UU0A 2C9ZA 1RC0A 5L7TA 4CEJA 2CJYA 1A96A 5ALSA 1WTAA 1N2EA 3GX1A 3I2KA 4KWTA 5KWVA 5KYGA 4E2ZA 3A6FA 3LRTA 1SQ6A 4N03A 4A1FA 1KERA 1S96A 4AJIA 2EDAA 4WACA 2DHEA 1HSOA 3MC1A 5CB4A 1KI1A 2MSEB 3NYIA 1KEEB 3DKPA 4YXWD 3HJBA 5KPDA 4RNCA 2A88A 4GVLA 4LDNA 3I5AA 4C0HA 4LOIA 1HWYA 5SZIA 3SJZA 3UCFA 3D6TB 5FNVF 3VBEA 3WSTA 1ZI9A 2BUAA 5DPMA 4O4JF 5C1OA 2RGAA 3F5QA 2QL7A 4Z5XA 3SYNA 2DPHA 3N8HA 3DZJA 1Z38A 4KO1S 1JG4A 1RABA 1JHOA 2RH4A 3GJXC 2V7XA 3H9JA 4GP9A 1ULSA 4P4TA 3SHVA 4E0BA 3DC7A 1CFJA 4JC8A 2RAUA 1BTOA 3ROKA 1DFGA 1DV2A 2CNDA 4FE3A 3DE0X 4OX9B 5CYFA 3CSDA 3R24A 2GPTA 3QKRA 3PXCX 4OYLA 2CLOB 3B5IA 4RZSA 4Z99A 3SXUB 4F4HA 2BKUA 4EW2A 1QLWA 2JGRA 4YWHA 2H08A 1H2AS 3AESB 2HWXA 2I71A 3DT8A 2Q7XA 2A2ZA 4CG0A 3BHNA 3OOHA 1R0SA 1GGNA 4W8GA 2P7HA 1F5SA 1M34B 2QX9A 1GHTA 1MB0A 2EFCB 3SS9X 4DXDA 3H4MA 1DCMA 2EKDA 3BF7A 3PNBA 2XCUA 3PJFA 3BXEA 2GN6A 1I10A 3WIDA 4G0ZA 1JG6A 2C2KA 2WUDA 5AKKA 2P2YA 2RB4A 4DV0B 1DTSA 4BFUA 4FFDA 1TEVA 2X2EA 1BH6A 2DTDA 2PRSA 3LD9A 3LU1A 1KVRA 2IPXA 1DBQA 4ZDIA 5FX2A 2PQ6A 2AYZA 1I9GA 4H7JA 3WGTA 3GG9A 3PGMA 3QSGA 1EP2B 3MWDA 2E6UX 4FE7A 4AF7A 3SLKA 4MCJA 4M7RA 1RXSA 1KK0A 3CLSD 1X7WA 3NFYA 4ZQIA 4ILEA 2IFTA 3CF2A 1CEXA 3D9QX 5A4AA 1FSZA 3EZ9A 3IP1A 1SKUA 2PKRA 3EQ8A 5AOCA 4KACA 3IAM6 4CIYA 3M1LA 3JZFA 3O8NA 4DUYB 2GOYA 3GFOA 3V7WA 4J76A 3T5BA 1XRSB 1MQAA 3PQ3A 1QG2A 4UFOA 2H0AA 3A10A 1SCIA 2Q7OE 2X1HA 3OZBA 5DGDA 3TDMA 2VSOA 1KFBB 1RNLA 4TRJA 4D8UA 2DFLA 4ZICA 2GJKA 4O5OA 3OMXA 5CFMA 1ZONA 1ETHA 3N5KA 3FWNA 3PFWO 1CJUC 4TUYF 5CURA 2OZVA 2OYRA 3EIFA 1E6UA 1SVMA 4PPYA 1K5PA 4QLAA 1JDUA 1CY4A 1FFSA 3SVLA 1U81A 1CR0A 4HLUA 4UNQA 2BZGA 1FFAA 5ALHA 4DB2A 3ZBPA 4HOYA 1QMPA 4OHKA 4DLXA 1KTVA 2JZNA 2VVTA 3DZFA 2HBZA 3Q2KA 2NT4A 3ZWQA 4DN6A 4UNRA 5A9RA 3KTFA 5LQAA 1W35A 3VNRA 4CM5A 1ZGBA 1MO6A 3OIVA 3OVMA 1GNSA 5DXFA 4FFSA 3C0KA 5B58C 3D8HA 2DUWA 2OENG 2QM8A 4O4JA 4PO9A 4V0NA 4MW1A 3S7ZA 4DUZB 1JXQA 2AXQA 3OM0A 4LMAA 4BN5A 2WUVA 3RRFA 3G5AA 4RA6A 4CN8A 4EPYA 2X77A 1JF8A 1J70A 2NO9A 4LCBA 1VLJA 3LLSA 4UEWA 1KI3A 3ZW8A 3D6HA 3LQQA 1FTWA 2JGIA 1G98A 3GLIB 4GBJA 4OLJA 4XW2A 4E5MA 2IHBA 4M9SA 5M7EA 3U44B 1VKOA 3CNOA 4UE2A 4MUGA 1UDBA 1FS6A 3V3KA 4D46A 1KMHA 2P3OA 4PHTA 4Q0MA 2R79A 3M4YA 5A4FS 4UUMA 1C3JA 1XR3A 4PRKA 3WGVA 1ZXXA 1U4OA 4JL6A 3F5DA 1ZOPA 4KQ6A 3KK0A 3K0KA 1WU8A 3W6ZA 1XA0A 3H6KA 5C18A 3N8IA 2JEYA 4E5DA 5LFAA 2P4QA 3AR5A 3LHKA 2J4CA 2X8AA 2QU7A 3UCXA 4GE0A 1EGHA 2FSSA 4TTAA 3FHTA 3BE4A 5TB5A 3DHVA 1DADA 4OK6A 3TL3A 3X44A 3Q98A 3HR4A 3DUFA 3HBFA 4JQYA 5C5DA 3HBNA 4XJXA 1UKYA 4N0EA 2IP1A 4IDGA 4KH1A 4HUTA 2I2FA 3FGOA 5EE0A 3V33A 1O54A 3JV7A 5AKZA 3SFZA 4XYLA 4MWCA 3EIXA 2FQQA 3R9WA 4BAZA 1VL5A 3L4BA 5HKOA 2BKVA 4DSOA 3K1ZA 3L0OA 4K6GA 1OBCA 1T2EA 3LWZA 2OA0A 1K4YA 3UJ7A 2ZQ5A 3BILA 2AK2A 3NV7A 3PPYA 1HFWA 1EGVB 1FUIA 1MB3A 1CJTC 1ODJA 1USUA 1RCTE 1AXEA 2CZGA 2VK4A 4KXUA 4RU1A 2VJMA 5GMOA 4UVHA 3RJTA 5BP7A 3TLAA 3DLIA 5K6AC 4TMZA 2QRHA 2Y1WA 4TVBA 2PZKA 1XXHA 2WZBA 4W5QA 3ZJVA 4HQFA 1XNQB 3M6WA 1RCFA 3D6NB 4BX9A 3K6SB 2W6JA 5FI5A 3SOPA 5TEWA 4DA4A 1JEYB 5DX8A 4ZCTA 1YRHA 4ZFNA 2CWDA 3GYBA 4IYRA 1CRZA 4FYJA 4BNDB 2ZWIA 4DV3B 1Z88A 4CKYA 2UXDB 5DYNA 3K8YA 5I7RA 3D02A 4XKJA 4QOJA 3KOUA 3TFWA 3VX4A 4LV8B 4DPKA 1VI6A 1CQPA 4DCTA 2QYHA 4ARVA 1Z6GA 2YMPA 1L5YA 2X9LA 3EIUA 1J49A 5H02A 1LZKA 3RODA 3QEKA 5A2QA 4ZYXA 1C9YA 1UJCA 4QUDA 4I2VA 3ZWVA 3TL2A 4D9NA 1G6KA 1EFKA 5HK9A 1QORA 4FYXA 1OX6A 4QQNA 2F8MA 1A2QA 3HCBA 3WLLA 1M5UA 4PO8A 1QONA 3V8QA 4PLGA 2H1OA 1R0ZA 2GBGA 2R7LA 4RH0A 1TJ3A 2QNBA 3B1YA 4OK3A 4YRRA 5AJUA 2GZ2A 2X2OA 2Y2VA 3JW8A 4S05A 1GQ2A 1XYGA 1J25A 2GFIA 3C6XA 3BE6A 3KKMA 1OLUA 2I9KA 4RTLA 1V7QA 4GAEA 5ADHA 5G4KA 1FIUA 3C3YA 5ALKA 2G71A 1KYQA 3SJUA 3ND9A 2EEZA 2WTBA 4FMBB 3C5EA 3NO4A 3ECCA 4HT3B 1IXYA 1EFRD 2LIVA 1IQUA 4RF2A 3ZDBA 2GPWA 2A4KA 2JKVA 2PH7A 4NENA 2FMFA 4HXYA 4QU8A 2A67A 3FNIA 2VRNA 2B6HA 5F77A 4CKWA 3DTVD 1OD6A 2AN4A 3M6UA 4BVKA 3ND8A 4JYZA 5A9SB 2V7WA 5JJBA 1YOBA 4JN6B 3GMSA 4MR9A 3TLEA 3IQDB 1WB6A 1UH5A 1P91A 3EXIB 3IBGA 4WN3A 5AXDA 2QN6A 2C9BA 3EFHA 1JDBB 1P0PA 2WIBA 3D7MA 3HS3A 3I01A 4IJMA 4EZIA 2Z1NA 1P7CA 3NW9A 4IILA 1Y0BA 4TV8A 3L7AA 3BGIA 4EO9A 1CQZA 1ML3A 1PUJA 1UAAA 2XXAB 2ZI7A 1PQPA 3B2NA 3HV2A 2BIFA 2CZCA 2YOHA 4WJLA 2OWDA 2WKPA 1V16B 3BDIA 3MT9A 5G1OA 2HMTA 4CG1A 4RTRA 1C80A 4POAA 3ZHOA 4CTNA 3QVTA 1WY5A 2V7QA 3SZRA 4CXMA 1U3CA 4PU0A 4Y30A 3V4LA 2YASA 3L4SO 2Q6VA 3OX1A 4X1KA 4GZ5A 4RK5A 3PA8A 2QGZA 4JZYA 1ENYA 1YS4A 4D0GA 1QHFA 3JSAA 4BNMA 1U2RA 3ZNPA 5CXUA 1D2HA 1X13A 1N0IA 2Z9BA 1T9DA 2X19A 4RKQA 2RGYA 3VV2A 4K9PA 4ARIA 4Q3LA 4X84A 4ZJUA 2B92A 1NGSA 2VAWA 3ZQ6A 4PRZA 1SCQA 2OY0A 1S5PA 2C9MA 4L5CA 4AWBA 5KTMA 2XYVA 2COEA 3FH0A 3QYFA 3ROQA 5FWXB 1NULA 4MB2A 1YQUA 4LYFA 2P5TB 1GZSA 2NTJA 4EA7A 1WPXA 4PLTA 4ARZA 3UMVA 3I45A 4ALIA 2GYWA 2LW7A 4NCIA 4YCMA 3DDHA 5CCEA 4UPVA 2D6FA 4URXR 1WMFA 3R76A 1HDYA 1RFGE 1UFOA 4QVGA 3ZV6A 3GNLA 3KWFA 5B1DA 1G8FA 2MOKA 3FOWA 1KQOA 4P34A 2YHIA 2BFMA 2FPIA 4KRYA 3U5TA 2PZMA 2XECA 3FZYA 2C4VA 4J0HA 3TQHA 5B7GA 1L7PA 1WQ3A 1MH1A 2D13A 4JVOA 4HH4A 5FV7A 4D3XA 4D4IA 4HZGA 3C3CA 3ZWWA 3ROPA 2EU8A 1NW3A 3RV3A 5CYPA 1E2DA 2VL7A 4IWYA 5AD1A 1XA3A 3HWX1 3DT9A 4KXYA 4REQB 3THRA 1YNSA 5DX0A 2QRUA 3V6LA 2J6BA 3MG9A 3FPHA 4KXMA 2ZI5A 4DMLA 4BLOA 1VMEA 3FFXA 3HUUA 1WVGA 3UMJA 3U7HB 3ETLA 2VS1A 1QO7A 2WJPA 3O83A 1OFTA 3PRJA 4KUEA 4L4RA 1I30A 1QX3A 1XZFA 2HIHA 2QR5A 3FNEA 3KTDA 2NU7A 2VUSA 2WAAA 3C3XA 3VH4A 4XE5A 3ZGOA 1YZFA 1AS3A 1RR6A 3GWGA 4GKBA 1GQFA 1OTXA 1QOPB 3WJAA 5DXJA 2J5QA 1DQZA 5T41A 3W9SA 1ODKA 2ZRJA 5GINE 5KOYA 3TLCA 3TQSA 5K1ZA 2X13A 3ES9A 2SHKA 2NTVA 3D2AA 2OFOA 1A9RA 1NP6A 4LBWA 1GPNA 5GV8A 1X14A 3X1ZA 3EGEA 1BFKA 2X0JA 2VNAA 3KZOA 5HOQA 3UXYA 1XQYA 4LQ4A 1P9LA 1XZCA 3C8ZA 3H0CA 2JGEA 3L04A 2CJWA 4CQMB 2GLXA 1ISHA 2JIOA 2V8OA 2X5JO 2PUFA 1G18A 2X4LA 3WO0A 3CR7A 2QY9A 2M2IA 3RF7A 5C4MA 2NLOA 4QQRA 5HR5A 1DAFA 2GNOA 3QXSA 3A6KA 1AE1A 3HCDA 3L8HA 3ND5A 1OBFO 1TQ8A 1YE8A 4UU8A 4TSFD 3LJKA 4O08A 5E4TA 2RHDA 1TCUA 3GWZA 2GFHA 5T5QA 1NXOA 3WGYA 5D2CA 1U3VA 3JATB 4JROA 3AESA 5JWHA 3S0JA 2F1OA 3B82A 2BHSA 4BFCA 1W49A 1DX6A 2V4MA 2E49A 1MLDA 1FMJA 2WHRA 3N86A 3NYWA 1ZMXA 5JZSA 2DKOA 3CW8X 1E0KA 2NU6A 3I1IA 2A9KA 2WWWA 2WAOA 2II6A 3NHBA 3QMPA 3NQ41 1AKVA 5E7JA 1ORRA 5IC4A 3K6JA 1MV5A 1GGMA 1OW3B 2W2XA 3L0YA 1NDQA 2FWAA 2ZRPA 3UUEA 1PZHA 3ESBA 5J2TB 4FFPA 3MJ4A 1Z8HA 1HO3A 4R8RA 1Y42X 1PZMA 3LPDA 5TY0A 1G8GA 3SIRA 1F8UA 5AVZA 1UWKA 4M7OA 1YC5A 1BKDR 1X3SA 1GQRA 2JLAA 2OHHA 3A31A 1I6LA 1I3LA 3KV1A 3MFYA 3OZEA 1A9OA 4HS9A 2I2WA 4IO0A 5J5CA 1M0WA 1PG0A 4NBTA 4UAGA 3BIWA 3K9HA 3IQGX 4RKFA 2I6SA 3VPXA 3GPLA 4LJ8A 2XRMA 3W04A 2QZ4A 1UBTS 2D4AA 3KL4A 3ILYA 2VJNA 2J3KA 3C2QA 1BQ3A 5EWLB 1VBFA 4MGHA 3VAZA 4XTRA 2IPMA 2Q4EA 3IR7A 4TKUB 3X1WA 4BNZA 1KKLA 1JW9B 4LHVA 3K0BA 3ANTA 4Q9DA 3EXG2 1S2NA 3FBGA 1WF3A 1E0JA 2QD1A 4H35A 4JJAA 4FDLA 2NVBA 4W9RA 5T6BA 3VJKA 3WZMA 5CVJA 2FUG6 2G28A 4O4LB 2IHJA 4Q4AA 1JFVA 4RVGA 5DYGA 1C9NA 5A05A 2Z9CA 3OCZA 3GB9A 2IXFA 2W7TA 3VOTA 1KFEB 1DI0A 4TVSA 1XBTA 5FPTA 2C78A 3BZWA 1DPFA 1P62B 2AQKA 4DANA 2V97A 4WZZA 4EGQA 1R8YA 3FYHA 1W0KD 2A14A 5ALXA 3M1IA 4NZZA 1Z28A 4H18A 3A4IA 4UVDA 2E1RA 3AEKB 2I6XA 3OUZA 5FOWA 3IIIA 1TCAA 2ZB3A 3DR5A 4AKIA 1NOIA 2WJVA 2JASA 1GWNA 2PJZA 3F49S 1CPYA 1GEGA 1R6DA 1X1EA 2YJTD 3DEIA 2R6JA 3GGCA 3NNDA 5C46F 2OB2A 3QUQA 2UYCA 4DMMA 4AY2A 3LBAA 4PLVA 2LKDA 1TEHA 1JSZA 2NAFA 2QQEA 4RBNA 5HTOA 1UUFA 2IODA 3PTAA 3LH5A 1HQDA 2X9QA 5F33A 4A03A 1SFRA 4RPLA 4KQ2A 1KQPA 1ABEA 1Z06A 2ZG6A 1R64A 3KYDA 5ALJA 4DC1A 4ECAA 4RH1A 2A35A 2RK4A 2FMXA 1I4TD 1U9IC 2YV2A 3ORRA 4OOFA 1T0UA 3AL3A 2XYQA 4P7KA 2V9CA 5AVTA 1Z15A 2OHOA 3RYFA 3LYHA 3H5VA 3FNBA 3PC8C 1G5IA 4E5YA 2ZULA 4RAQA 4DLAA 1PR4A 4IDQA 3RYFB 5IT0A 4YP9A 1T6XA 2QP4A 3Q7SA 1EWVA 4G65A 3V1NA 4GPIB 3U7QB 4QM7A 4LRYA 3J80A 2IUEA 1JI0A 3QJYA 3LW7A 4RVCA 5FA6A 1D7OA 1E1KA 3E7FA 1Z8DA 1KH2A 4R05A 3EXFB 4ZYYA 4Z2YA 5AVWA 1YR7A 1SXPA 4TYWA 3D0RA 3LY9A 4D9JA 2H5LA 4BBZA 4RD1A 1YULA 4IRMA 1W4BA 2F9FA 3REQB 2GERA 4FDUA 3E3NA 1VIVA 1VLMA 1WR8A 1RC8A 4FFOA 3I0MA 5BW8A 2QIPA 2VSYA 4IGIA 1A71A 3FHJA 2C5GA 3AHCA 5TPZA 1OZHA 2CXRA 2CGEA 3GLUA 3ADPA 4MYHA 4ZYUA 3GRAA 2C4NA 3GJ4A 3OD1A 1R8QA 4HNAA 4LS3A 1VCMA 1QYIA 1Q95A 1ZD2P 2D0PB 2Q2OA 2XT6A 3F2VA 3OIDA 4HFJA 2NNWB 4EHJA 1OFIA 1VSUA 2C3OA 4K6FA 2B8TA 3FPGA 4G0QA 4D42A 1P5JA 1XTRA 2ZKLA 4TYPA 1KY2A 5KNCA 3AH8A 3HFGA 2WWRA 4LFCB 3V3TA 4PPQA 3JWGA 1I4DD 3PE3A 4EYGA 1G21E 4S35A 4ZRDA 2EJTA 1J99A 2XWQA 3M1AA 2G25A 2QVZX 3FROA 4IIJB 4P80A 4CU2A 3S5JA 3ABIA 4A27A 5ECDA 3KT8A 3H1PA 3L9XA 4IO1A 3WLAA 3W79A 2NVUB 1F8XA 3RTBA 1RJDA 3B5JA 4QTXA 2O52A 1XXHB 2C2XA 3BHIA 5DMHA 3VV3A 4D1YA 4D3FA 5CDYA 4EJMA 2OV1A 4Z7OB 4BMOB 3MTAA 3L6EA 4F96A 1FSGA 1C7RA 1PVDA 1E1DA 1ICIA 1YCDA 2Q45A 3D8SA 3PTLA 2UVPA 2Q8QA 2MYUA 4I9GA 4IQFA 4JQSA 2GMWA 1QJCA 4KLNA 4XDZA 4YC7A 4M0EA 4GOMD 4BNGA 2ZBEA 2BFBB 2B2XA 1VJTA 2NTYC 3F7MA 3FDXA 3KZVA 5KNBH 3BXXA 4KZKA 4B3BA 1K75A 4IWNA 4L5AA 5JZBA 3JVVA 3I73A 4MPRA 4PSAA 1BROA 2C7BA 1G64A 2EIXA 3B6ZA 3GRKA 4HHEA 4PYQA 1CQJA 5K4AA 3VR6D 4TPKA 3CGGA 4E21A 4J9VA 4RV5A 1KMNA 1J00A 4HDRA 3QOXA 4FGWA 4DZTA 3W4JA 1EH5A 4ZZ1A 1CQIB 2DG2A 4KN8A 4QPDA 1QH8A 1JZSA 4FLEA 3L8CA 3O73A 3I4FA 1YZUA 2GEKA 1VXOA 2ZSHA 3V2UA 2PSEA 3BJIC 4BO9A 3A9VA 5K6AA 1BCSB 3O7MA 2GK4A 3C87A 2PNJA 3VNAA 4CQMA 1PQYA 4MI3A 1OH6A 2O7QA 2WJHA 2QJFA 3PFBA 1LNSA 2QXTA 3WRYA 3HNRA 1ULBA 1RHQA 1DAGA 3OAAA 2VDMB 3EEIA 3FSGD 2D8AA 3GLHB 4YWJA 2BGRA 3N3AC 2UYQA 3TPCA 4L9SA 1FRVA 3AZOA 1RPJA 2E5WA 1PDWA 3MMZA 1QRUA 1HYBA 3FUVA 5F2OA 1Y81A 2HQRA 1AGNA 1LPNA 5HMMA 4KR7A 2JGDA 4AY5A 1TU3A 1CDZA 2DUUA 5GJCA 5LU8A 2ZI9A 3NXSA 4AJOA 1PWHA 2E48A 4RPKA 4X1IA 4Y2RA 2LTAA 3LQKA 3MJSA 1PJZA 4LECA 3L92A 5B2ZA 3ZWDA 3JQ9A 4HAIA 2XF2A 2FQ1A 1Z39A 2RHTA 3LVRE 5DHAA 2LDBA 2HT6A 2O0HA 3ML1A 4HWPA 5TXGA 4R2KA 1OKKA 1JFFB 3FNHA 4EFNA 1E2IA 2Q4OA 3PWKA 4NH0A 3OPMA 3UN1A 1SUBA 3PB3A 1QP4A 1D2RA 3R77A 5SY6A 5ENVA 3JPYA 4AI6A 3X2FA 621PA 1GKYA 5J1SB 3EVGA 2FTKE 3HKCA 2XQJA 1GTVA 1SZJG 1UK7A 3GMDA 4X90A 5NLLA 2VWQA 3TOSA 3V9PA 4LRUA 1NBHA 3TW6A 5E6SB 1GTMA 1Z2DA 4KQJA 3VR0A 3QYJA 1DDGA 4JT8A 3WLTA 3WLOA 2QT0A 1FC0A 3B36A 2JHAA 3X0DA 4A6XA 3TTUA 2ECFA 1PJ8A 1NHGA 5EKXA 1VZ3A 2V4ZA 3M4XA 2I76A 3BXZA 3UH0A 4RSGA 1MPTA 1OUMA 2JAUA 4CDNA 3NHSA 4RS4A 4ED9A 3FCEA 4JBLA 4ZI7F 5JLAA 2P1ZA 3D6JA 2JJ1A 2NXWA 2ZS9A 5BR4A 3FOFC 3WDLA 3KLOA 1GXSA 4HNSA 2DULA 3FJYA 3LL7A 1R4NB 3OU2A 1U7WA 1M8GA 4NYJR 4PANA 3O0DA 3IAEA 1FDOA 2ZYGA 1I6KA 3WQQA 4DQXA 1XKLA 4B6QA 4E09A 3AF2A 4MR8A 4GLJA 3RU9A 2PUGA 4IVRA 4R4JA 2RJ3A 4YMIA 4HX5A 5TS3A 4B7UA 4XGRA 1MH9A 4BMYA 5HW0A 3ZKAA 2PGXA 4X3CA 3F7NA 1KGDA 4MQLA 2POCA 2H6EA 3G68A 4EPVA 2ZUBA 3VR6A 5JU6A 1NAIA 3D4NA 1HX7A 5GJWC 2X8JB 1V4VA 4F4FA 3C15C 2JFYA 3OPQA 5HUHA 3I8SA 1MOSA 1JG3A 3DLCA 4WDRA 2EF0A 2PMFA 3DPUA 3VR4D 4F8JA 2K4MA 4X93A 1VCIA 2MHCA 4F2WA 1SXGA 3WIVA 5ISMA 2X0FA 4M0LA 3RT1A 5K0SA 1NA5A 1ZU5A 1CZKA 1MX5A 2B7LA 2HDNB 3WRXC 4WW0A 4ENVA 3ABZA 4P7GA 2OAP1 4JP1A 4ZI2A 2HIGA 1NPTO 2G09A 3ZTWA 3QX8A 5ALDA 1B8NA 1MMFB 3GCDA 3N0WA 1X3LA 1A72A 5J9FA 4YAGA 4MIOA 3U4MA 3DO8A 3DNMA 4A0GA 3GDWA 3PI7A 5KTSA 3VZQA 2O8DA 4M0UA 1EK1A 4KMMA 2RBKA 3WQBA 2RIPA 3BB1A 3IMGA 3AQ4A 4BP1A 3WFZA 2H9IA 5T4EA 1O6GA 5CFPA 3LHIA 4FC7A 3TNFA 3IUEA 3UZUA 4YAIA 3CNNA 1FLDA 1PZEA 1Y9ZA 3KKKA 4X60A 1FP1D 1ISRA 4II3A 4MWDA 4QJIA 5DNVA 5AQ1A 4NE9A 1U2DC 2NZ2A 4D0NA 1JT9A 1V8PA 4G5RA 5IEJA 1TUBA 3MTBA 4RPGA 4WCFB 4EB6B 1P7VA 2O0JA 3DFUA 5KUTA 3OLYA 4HYYA 4LTDA 5SICE 1W46A 2HBRA 2YY6A 2YIDA 3ESQA 3NBFA 5EQTA 1WE2A 3URKA 1GPWB 1T6ZA 2VNSA 1E7MA 4D25A 1U2QA 1U7ZA 5AW7A 3O84A 1UCFA 2AMYA 1KYXA 1IHYA 4HB3A 4QWWA 5L7WA 2VPQA 1NI4B 4G9GA 5CFLA 3HJFA 3NBUA 2ZATA 4R9RA 2VH2A 1OTHA 2Z2YA 5LA6A 4CM8B 4C07A 3S44A 4JGIA 4CV2A 3OF3A 2OO5C 2IEZA 3HM2A 5LA6B 3U3MA 5IUKC 3ZHYA 4A6DA 4CF4A 1DZIA 2ROQA 4CMIB 2O8FA 3DTVB 2DBQA 3F3YA 1H85A 1P5RA 3Q8XB 3TX6A 2RGDA 1QHYA 2IA5A 4KFUA 5CVDA 5B7NA 4A91A 3GQBB 3LP5A 1CUZA 1S3IA 3OZFA 4I66A 4RKYA 5FHQA 4ZI7A 3ASYA 2ZCJA 1ESEA 1FPQA 2WV9A 3AWIA 3H97A 4V0ME 3VFDA 3K0SA 4UASA 3A28A 4JUIA 3OQNA 1BJTA 1NUQA 3LXRA 1E8NA 2CUKA 3ZD6A 5HUJA 3TR0A 3LQ2A 5T7BA 3WLQA 3E0QA 3JVEA 4D9HA 1WXIA 4BVHA 3BCHA 1XSEA 4NR0A 1NI5A 5TQJA 2GKGA 3I9V6 2Z43A 4JODA 3TH5A 1MT0A 1Y9AA 1GZHB 1CHNA 1SWWA 2CHEA 2YWBA 3BKXA 3KTAB 4V1CA 2AWNA 3UWPA 4G5YA 2HQSA 1C7ZA 2K6GA 1HBJA 1R4ZA 3H7AA 3HN7A 4AZSA 4EAQA 3OTHA 3U2QA 3EMBA 2CLDX 4AUKA 1LU9A 1UXGA 3ICPA 2Y9PB 4LHEA 5I5GA 1I0ZA 2AB0A 2ERXA 2I9PA 2P2NA 3V6MA 3ZE1B 2K87A 2XNSA 3FOEC 1Q6YA 2YVKA 1JIJA 1NWHA 2P67A 4IVPA 4LSWA 4EARA 2GS9A 1AVTA 4JSYA 5P8WA 4E6PA 5EAIA 2B1IA 1YVUA 1A88A 2GYVA 4V0OA 4EKDA 3T41A 3PS9A 3VR2D 5K4HA 5DRYA 4F3YA 4WH0A 1EUCA 4O1MA 2WBLC 5IX8A 5CAEA 4RTOA 5GZ3A 2YC4C 4Y2TA 1SXJC 4NECA 5BSFA 1Y3IA 5LP6F 2HNAA 1RWXA 3IJRA 2HF9A 4G07A 1W5EA 4MW0A 5A04A 5JYDA 3GEEA 3WIUA 4EX7A 2P8JA 1R5NA 3DZDA 2F8SA 1M72A 4AWXA 5IJ9A 1IEXA 4BO4A 2NSLA 4GR5A 1WO8A 3LO8A 5B64A 2YNMD 3DE7X 2V3CC 4F5ZA 2WYIA 3FHLA 4J6FA 3B3QA 4UBJA 4Y6GB 2O1EA 4UD2A 4KR0A 4FP9A 3EDQA 3L0PA 1NBOA 2HPVA 2NP7A 1L2TA 2ZRHA 1DIOB 3I09A 2QF7A 4YI3A 2O54A 1QTIA 4Z1OA 2SKCA 4AN0A 5A6SA 4IKEA 4DPMA 5G4KB 4F3NA 3P9PA 1DMSA 3EC2A 3RVQA 1Z83A 1YR3A 2YWRA 1XWIA 3PDIB 4MV3A 2BM0A 4K6CA 4BY9E 3KOWA 5LQNA 5H3CA 1P0IA 4IG4A 5C80A 3LP6A 5HXAA 3GCWA 4XPIB 4ZVVA 1JH8A 4LMRA 4RA6B 3OHPA 1ZGJA 3F4LA 2NUAB 3U26A 1EJ6A 2AFIE 1P1RA 4NBUA 4EJFA 3U44A 4EG3A 4BBAA 2WU3A 3BAFA 1K08A 2Z57A 4YV0A 2O3TA 2R2AA 4TWIA 3KDPA 4QGBA 3E1KA 2AJTA 1GPJA 4UPDA 2ET6A 3IAXA 2ZXEA 1LDBA 1ZH4A 3ECSA 1LV8A 5CVEA 5F5NA 5REQA 4N5MA 3HFJA 3B6IA 1L1FA 4TLEA 2JAWA 3KPVA 4KO8A 4MS4B 3JZAA 3IMCA 4MKZA 4OJKA 5COBA 4DCNA 1PJ3A 2A1UA 2J4DA 3DE4X 4WECA 2AZMA 2BP7B 2IYOA 1UKBA 2IU3A 4WINA 1JKIA 4AF8A 5LMNB 4DQVA 3CVXA 4IIVA 1UC5B 3KB6A 4QE3A 4J94A 3HCFA 3IOBA 1BMQA 1N2BA 5G4LA 3X1JA 4F1KA 1GFWA 4K3UA 1JQBA 1LXCA 1GNPA 4G89A 3B13B 4NK4A 4HJXA 3U7QA 1LLUA 1Q0RA 1BDJA 3Q2OA 5TMBA 5BOSA 1BVHA 5TF0A 4YUVA 1ZSYA 1QH1A 2IHVA 5CEJA 1G59A 2MSKA 5HCNA 2WV7A 1XAGA 4N3GA 1VG0B 1TMKA 4AS3A 5K20A 6ABPA 2CZQA 1P0QA 2CKMA 3GRVA 3HHEA 3FPJA 3HSKA 4QPPA 3ZXYA 5EMLA 3IIKA 2WHYA 2JC3A 4P3KA 2CNWA 5ICFA 1DXOA 1RHJA 3IEPA 1DKQA 5AVVA 4OBXA 4IIDA 3DYVA 5AFSA 3X3HA 1EP3B 3GBVA 1M34A 4M55A 1YBHA 4G0VA 4KNYA 3MCUA 1XOIA 2JRCA 1YR8A 3ANSA 4JBXA 1P4RA 5EIOA 1YS7A 3E81A 1JWAB 2IH2A 4HNTA 4HYTA 2Y67A 5AIAA 4BMXA 2VT6A 1SHLA 2VP2A 5AR1A 5HK8A 2WJWA 2W22A 2NZ8A 4EKEA 3RGGA 4FNAA 3UMMA 2BC9A 5DNYB 3W6OA 2C0PA 4P4UA 4BV2A 5BPHA 2H52A 1UJNA 2XUJA 1B0UA 4RE6A 4OL0A 2F55A 1E2LA 1H93A 5BVHB 2ZRNA 1QZ3A 4GPBA 4WE3A 5LZ9A 1P5HA 2ZOSA 3JQFC 1GQQA 3ZUGA 4C5BA 4XIIA 4F7WA 3EAFA 9LDBA 3N6VA 2QX4A 1T5SA 3L9WA 1TECE 4YAJA 3MJFA 3BFVA 4TKUA 3JD3A 3NVAA 4Y2YA 4GMDA 2K7ZA 4L76A 5IBPA 1KRXA 1ZCAA 5HM6A 3GBSA 5FLEX 1GUDA 2F4VB 3MPUA 1H94A 2IWHA 3ZW7A 5DSXA 3SIWA 4AZTA 2QA5A 2ZTUA 1PV1A 4MCIA 2OT3B 2HJGA 1DPGA 5CNIA 4CUJA 1I13A 1YDHA 1TK3A 2C00A 1QGUA 2OFWA 1Z0UA 2QLNA 4IV0A 4PY2A 1VLZA 4PRLA 4D6XA 1OT3A 3MTJA 4XLTA 1G3IA 1SVLA 3S40A 4O4HF 4A10A 2BH2A 5JAUA 1QF6A 3KAKA 5BSEA 4JMPA 1UAYA 2FW0A 4BWVA 4RJIA 4QT0A 3EOAI 2BZ1A 5KREA 1PV4A 4CM3A 2FQWA 1DKOA 1ONSA 1T34A 3FZGA 1KYIA 3BRCA 2XYHA 3IVAA 3O9ZA 4HNAB 4QA9A 2HLPA 3LK6A 2ZTHA 4D9BA 1VSQA 4BFZA 2AQIA 4H31A 1O4WA 3DSRA 3S1AA 3I30X 1VJDA 3GC6A 1Q1NA 1QQ7A 1IXKA 4XUEA 4EL0A 1JJBA 4DLVA 3N6XA 1W0CA 3PNPA 1W4LA 2OBNA 5BUZA 3ZQ4A 2QAJA 2IEBA 2GRJA 3C41J 4J7UA 2QHXA 1L5OA 4D80A 1VRCA 2Y1EA 2RMKA 2NU8A 3LF2A 5FAKA 4Q1EA 3TJZA 4FLMA 2V5AA 3RC8A 2GZDA 2VK1A 2AZ4A 4D6YA 3UUGA 5HRAA 5LP6B 4BYGA 1U63A 2RG7A 3CS3A 3PHGA 4YP0A 4RE5A 1D2MA 4IOLA 3PQFA 5B12A 1QIIA 1Y4ZA 1G8HA 2QE7A 4ROTA 4QYIB 3CRRA 4M88A 4V0MA 1P33A 5E9QA 2GM9A 1U9JA 3L6OO 3SIXA 2DMRA 4J29A 3GIWA 2PGNA 1H0SA 1ISJA 2JL1A 3E7DA 4B9AA 3ROEA 2H51A 1GKKA 3NT4A 4QHTA 1Y4SA 3ELYA 4X65B 3RFFA 3H9GA 4UMEA 1RHUA 4UTZA 3ZJYA 2JHFA 1U7DA 2VTBB 1GAJA 3JQEA 2PCJA 2FK8A 3U4CA 3E23A 4B1FA 1X7WB 4D8YA 3AERA 1XEWX 1WPGA 1K8QA 4JLUA 5D1HA 1NNI1 1JGTA 1UR5A 2XUDA 3BWYA 4OMDA 4JI3B 3IMFA 4DIDA 5JNVA 2IUTA 3O8DA 1A9YA 4AZ3A 4ZJYA 3BZBA 2A3NA 1YIAA 4RA9A 1LDGA 3NHPA 2G8NA 1GZ5A 3H5TA 1RBQA 1VYUA 2EX0A 2ZK7A 3O8OB 1FDSA 1C1DA 4HDMB 4NJEA 1CUJA 2J46A 1EINA 2Z2XA 5DLDA 4X64B 5FWNA 1NHWA 5IDXA 1YRYE 1RAIA 4LWZA 3BT7A 1IM8A 1WEKA 4XCQA 3EPKA 4CLXA 1O95A 3BRSA 2W00A 1L5RA 2FVXA 3TI7A 1DJOA 1DEAA 3IDFA 3F47A 4MQEA 1RYYA 4BQPA 2A5JA 4F86A 2SECE 4QXQA 3NVKI 2WM2A 4PEVA 1FQKA 1J9GA 2P5YA 2YHIB 3TAUA 2NNLD 3WKAA 4D4GA 4PYNA 4Q3AA 4MKFA 1C50A 3WHLA 1P1CA 5T4HA 4BOYA 3SDZA 2W2KA 1DARA 3V4OA 3NDPA 2QS9A 1EJ0A 1L5WA 5AOVA 3B9RA 5I7SA 3LNTA 4HGYA 5CIYA 3MWGA 2ISQA 2NUBA 3CX7A 3ESDA 4DCGA 5KTRA 3TCXB 5LIPA 1K3FA 4AAYA 4RADA 2Y1OA 3ID6C 4ID3A 3T4EA 1JEAA 3ZZTA 2VQ6A 2D1RA 4KO3S 1CUGA 1RVV1 4DYVA 2CXOA 2CSUA 3DLAA 1ZGAA 4F72A 4TRMA 1RXWA 1SVNA 1DTWA 3WK6A 4PG6A 2XQVA 5K99A 1KFKB 1XZNA 3C3AA 4C06A 3QEJA 5MDHA 1I2DA 1RC1A 1TJNA 5DJ5A 1AQJA 1KA9H 4ZCRA 2HIMA 5KOIA 1QIJA 5HG0A 3QYPA 4WNAA 5DLEA 3TOCA 3TTTA 4JMLA 4JVMA 4B3JA 2DR0A 4O4IF 3G2LA 4UTRA 4A6PA 3D5EA 4YJ3F 4TT3A 5L3QB 4RKEA 4ZALA 5CB4B 3HKBA 1HE4A 3M2PA 4KAXA 4LVUA 1QYCA 2HBYA 5DEOA 1UAGA 2ENUA 3O38A 4D4LA 3JRWA 5J2UF 5JJIA 1FB5A 1XZIA 3K8QA 1T9BA 4QDXA 2C3UA 1Z0JA 2H4HA 2QV0A 2OFXA 3Q7IA 3OOJA 4GHWA 4PSDA 3C8UA 5JG7A 3V4ZA 4DR5B 3DQQA 4PZCA 5TT0A 4ZGWA 1RI4A 2FPPB 2DPLA 2W6IA 1PR6A 3R5HA 5I4BA 4O2BA 1VKRA 4CQLA 4NBNA 3GD7A 2UVQA 3HNOA 3N0TA 2JGNA 4W9NC 3OZIA 4Q4HB 3TSAA 3AERB 3W7BA 2FGJA 1EFPA 1JEQB 4JVLA 4ZVQA 5J5AA 2A9OA 1K8XB 1NOJA 2HU5A 2JNWA 4NCHA 4PCVA 3UH1A 3OU6A 3F6BX 3E1GA 1QOQB 1UDCA 3OT1B 4L57A 4GZ6A 4PLHA 3L84A 2BFCA 3LO5A 3KOXA 3A1WA 4TWBA 4WV3A 1PE0A 3R7WB 4EA8A 4WCVA 3UGKA 4D4KA 2UYYA 4EENA 4F7DA 4QELA 3OEHD 3L46A 1JPUA 2WU8A 2H17A 3JALB 5EQDA 3QH4A 1MG5A 1V45E 3IGFA 4KEAA 1YHZA 3W77A 1RQXA 3DKIA 1FS4A 4ER0A 1E9CA 3SC2B 3VU9A 1MV8A 1ZGGA 2R85A 4KVZA 4NCBA 3AY0A 1WUYA 3KOZA 3T5CA 3GEGA 3OG9A 4QAQA 5HF9A 1W36D 3IPLA 4ZAFA 3BFJA 2IL1A 4MV8A 3FLEA 5JASA 1RI3A 1XU9A 4N7JA 1K9VF 3C97A 1VM6A 3B60A 4RABA 4E4TA 5FHRA 5ERXA 4I4IA 4KQ1A 1LPPA 3CJRA 3H9CA 1DP4A 1ZH6A 1D6SA 1IE3A 2DYKA 2OSVA 3ONEA 3PK0A 3QY9A 2J3IA 4TTVA 3UHFA 1U6IA 2WKWA 3UWMA 4BN0A 3LQFA 4O2LA 4RTJA 2XZOA 3JWEA 3AHIA 3HN2A 1RVDA 4E22A 3CC8A 3H9BA 1VMDA 5CLIA 2XGJA 2QY6A 1CLEA 2VYCA 3IMEA 4P2GA 1M6EX 1XALA 2ZJOA 5ALYA 4CUZA 2E37A 5GJVC 5BY2A 1BDIA 4TXLA 3SYRA 1O58A 2YTZA 5CB8A 4YRZA 3AHJA 1N36B 3IUYA 1JQDA 3V32A 3ZQJA 2F17A 1YE5A 1ZLXA 3QZUA 4YP1A 4WZ6A 4N3AA 3ENQA 1TTHA 1L7QA 4QBHA 1XJWA 3GGOA 3MUFA 5D3KA 4ZKDA 4UXJA 5JCPA 1A97A 5CTAA 4PYJA 3L43A 1PK7A 4UNIA 4OGFA 1AM4D 3CVUA 4JELA 1M1YB 1W1IA 2QGNA 4PO1A 1I7DA 2NX2A 3VZPA 3OQPA 2FDXA 2UUAB 3NASA 4W5TA 1V8FA 3O2QB 1B76A 1DCFA 5LQRA 3HU2A 4QQKA 3QXHA 4KLAA 3JWJA 3ZU4A 4RQUA 4TOIA 2FUCA 3LC7O 2JGFA 2LV8A 3KQTA 3OCJA 4XZ3A 4QU5A 5I9SA 3GP5A 5T64A 2D2EA 2C8JA 2LP4Y 5GZ1A 2HA0A 2UZAA 2Y93A 3UBTA 1O3YA 3K09A 5AOAA 1HNZB 3C7KA 4IUDS 4NSNA 1VA5A 3TK1A 1FLVA 3I9NA 3ITKA 3ZXSA 4M8KA 1ZUWA 1JFSA 2BGGA 2AJCA 2MT9A 2ZJBA 4OP2A 4NCKA 5TRTA 9ATCA 2FSVA 2FH5B 4Z4EA 4OBWA 4MW4A 4PTYA 2OZLB 1E5DA 4FR5A 4JJ4A 4DRZA 1K2VN 2WD9A 5F78A 5EIEA 3NG1A 4YRFA 5JQGF 4NC9A 4G0XA 1EZ4A 4N76A 5JVDB 4NHEA 4ZVRA 4I5GA 4YQFA 4BTEA 1XXLA 4YEDA 1SPBS 4Q12A 4WVFA 2GZHA 1YZYA 4UATA 4DGSA 3GA5A 2W2VA 3O2SB 3PR1A 1WCWA 3TLGB 2HAEA 1JSLA 1XMVA 1NQ5A 1JX6A 3RFTA 4YIKA 4ABTA 2IS4A 4P86A 1A77A 1GPYA 4F3CA 3KT6A 3ENWA 4FI3F 3NHKA 3AKYA 2WTEA 1T36B 3DFIA 3ZDQA 4BB9A 4XDYA 1SHZA 5EJ7A 1Z6ZA 5F76A 1JTEA 3TR6A 4HPXB 1UC8A 3ILVA 3K5WA 4PR0A 4GKVA 4AXBA 1Y89A 2B34A 5CM9C 3CLKA 5FEMA 2OV2A 3ZPXA 2YKGA 5IHXA 5CT9A 4B47A 5A3QA 3TECE 1V3VA 4ZXPA 3NATA 3KQWA 4ETIA 2EFDB 4MAMA 4NCAA 2YFHA 2FP4B 3D1LA 5AKYA 1FJGB 3AFGA 1KJWA 5E0KB 1U0FA 2B69A 2QMOA 4XD7A 3V8PA 4RAOA 1UXOA 3F4BA 2O8VA 4OEHA 1Z7YA 4GXRA 2Y66A 3GLFB 4RFVA 3INNA 4DJJA 1FX0A 4GM0A 3CYFA 4AFNA 2RGBA 3MBKA 2P30A 1JEQA 3LVQE 4ZMSA 2XV1A 2ZYDA 5DYTA 1Q2XA 1Z82A 1XAIA 1DAIA 2C88A 2HYDA 1Y1RA 2RHOA 3DWGA 1E1QA 2Q1SA 3EZ7A 3HZZA 3AIMA 2WDZA 2PKCA 5EZYA 3M6MD 1GYRA 5KPJA 3L1KA 3L6UA 4CL0A 1I2AA 4XARA 1YF3A 1ZICA 3BHJA 3QEAZ 4LPKA 2FLVA 1QMGA 2I6QA 4R41A 4QJ4A 1XLVA 1YZVA 5BQPA 4Q3BA 1I4OA 4M2LA 4YJKA 1T8UA 4N0MA 4KVFA 4PYLA 4TMTA 4UTPA 2XUQA 2Q3MA 2Q28A 3GLTA 1ZGHA 4GRAA 2GDZA 2FEWB 2VAPA 3VAYA 1GRRA 2R44A 2X9GA 3DB2A 4N7MA 4RF5A 4F4DA 5MGBA 1XTTA 3O8QA 1GSAA 3M7IA 1WX1A 3N7AA 3ILHA 3HVHA 3P2KA 5CH3A 3W5SA 3V7YA 4BGEA 1DKUA 1VE5A 1NXXA 4DLZA 1P75A 2H92A 2P6MA 3D0QA 4MCHA 4QEKA 3G3EA 1TO1E 5HEKA 1I3CA 4P4SB 2IIVA 4Q9KA 3VO9A 1X8JA 1OXUA 1NF8A 1W8DA 1BA2A 1D6JA 1ZIYA 1B14A 1YA4A 2XF8A 5HPYB 4FMCB 4LG1A 5L3SB 5CIWA 1ILWA 3E9MA 3SPXA 5LNK1 3C1OA 4MS4A 4P53A 2NOAA 1R5BA 1PZGA 1A5BB 3ENZA 4QHSA 4QGAA 3KX2A 1UWVA 1FRNA 3P2EA 4AP5A 1PJBA 2A6PA 3HWWA 1THMA 5FBKA 2Z6VA 4DIEA 1YAJA 3DEZA 3N2GB 2YINC 2ADFA 4CTJA 1L7VC 1LLFA 4FCTA 3VR1A 2CXUA 2C4UA 1D03A 1EA5A 2JIDA 1LZLA 2GUWA 1V96A 3P32A 4WA8A 4ZQCB 3BXOA 2EIHA 4K5QA 3SSOA 4YHBA 1PCXA 3IVRA 1OAKA 1WMAA 2CHVA 1RQLA 4RVUA 5E6RA 4KBYA 4F9EA 2G7MC 1T2CA 3B7PA 5ALFA 5C7OO 4A36A 5EEGA 3RSQA 1NQWA 3OM1A 1WXQA 3WYAA 1BO6A 4F6RB 1MC5A 3EQ9A 2R96A 2VYND 1JIUA 3H4VA 4MJ7A