3WIBA

Crystal structure of y109w mutant haloalkane dehalogenase data from agrobacterium tumefaciens c58
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
289
structure length
289
Chain Sequence
PHSAFGDGAKAYDVPAFGLQIHTVEHGSGAPIVFLHGNPTSSYLWRHIFRRLHGHGRLLAVDLIGYGQSSKPDIEYTLENQQRYVDAWFDALDLRNVTLVLQDWGAAFGLNWASRNPDRVRAVAFFEPVLRNIDSVDLSPEFVTRRAKLRQPGEGEIFVQQENRFLTELFPWFFLTPLAPEDLRQYQTPFPTPHSRKAILAGPRNLPVDGEPASTVAFLEQAVNWLNTSDTPKLLLTFKPGFLLTDAILKWSQVTIRNLEIEAAGAGIHFVQEEQPETIARLLDAWLTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Crystal structure of the novel haloalkane dehalogenase DatA from Agrobacterium tumefaciens C58 reveals a special halide-stabilizing pair and enantioselectivity mechanism.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Hydrolase
total genus 105
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wibA00
2HU5A 3ANSA 1AX9A 1SC9A 1X2BA 3BJRA 4AO8A 1LZKA 7YASA 5I9IA 3C87A 3LS2A 5I7UA 3DEAA 3HC7A 5KBYA 1GGVA 4J0DA 5LP1A 4F60A 1XRRA 4W1PA 4QDOA 2HIHA 1N1MA 1BRTA 1XZJA 2PBLA 1TK3A 4LXHA 1NU8A 3VDXA 2Q0XA 2AXEA 1SCIA 3KWFA 3H0CA 5A7HA 1UFOA 3HRHA 3BDIA 5AM0A 4FWBA 3BF7A 4IQ4A 1A8QA 1MNAA 4KJXA 4M0EA 3IBTA 2WLSA 3QMVA 4AO7A 1ZJ5A 2VEOA 1UOQA 2WJ6A 2HFKA 1Q83A 3FOBA 3W05A 2C7BA 3LIPA 4Y2QA 4B85A 1QIFA 4W63A 4AZ0A 3L1HA 1QZ3A 1LZLA 4AMYA 3WA7A 4OU4A 4FFWA 4WFIA 5LKRA 5AI4A 3VVMA 1EDEA 1CQZA 3C8HA 5CT6A 3E1GA 4BB0A 4BE9A 2ZJ6A 1LGYA 2VT7A 5CT5A 5EIEA 5YASA 2EDAA 1BE0A 1EDBA 1CQWA 1MO2A 3O9MA 5C8XA 2EEPA 3E3AA 5FV4A 5IVHA 5ALMA 4Y2TA 3ESCA 4YPVA 1FSSA 2DSNA 3QITA 1EXWA 4L72A 5ALOA 3X3HA 3STVA 3H17A 4G9GA 2PSDA 1VLQA 3BIWA 4G4JA 2CMFA 1QONA 1XZCA 5JARA 3TJMA 3WL8A 3C70A 5DNUA 2HA3A 1P0MA 2WHRA 3DL7A 4QLOA 1WB4A 4BP8A 4GW3A 2WUFA 5CURA 1EK2A 1QE3A 5JYCA 4UHBA 5FP0A 2Z8XA 1O6FA 1JU4A 4M0FA 3I6MA 3D2CA 5T4FA 5JANA 1EHYA 3PUIA 3QPAA 2HHAA 4X00A 1XZBA 1QFSA 1AGYA 4X90A 4B9AA 1W75A 2WFMA 5HQ3A 2XMGA 2G5PA 3PICA 3UUFA 3JWEA 4IH1A 4G1FA 1AUOA 3DD5A 2Z5GA 3OOSA 1KEZA 1R9NA 5HF5A 4KACA 1UKCA 3RARA 1D07A 1DX4A 5IH7A 2HA6A 2Y6VA 4BTVA 1G66A 3GUUA 3G0DA 4CG2A 2BUBA 5AK4A 1XLUA 2PSJA 5IVDA 5ALZA 1ZI9A 1Q0RA 3G9TA 4QDTA 2ZYSA 3DLTA 1GXSA 3PUHA 4BDSA 5E4JA 4WFKA 4BE4A 1XZHA 2WHPA 1FFBA 1QIHA 4L3WA 4UHFA 1UT6A 2WKWA 4O08A 4F5ZA 5CT9A 1N5RA 2JEZA 1LPMA 5LZ9A 4ZV9A 5JZSA 3GELA 2ECFA 2OCIA 2CBGA 2O2GA 3OURA 1CR6A 5DJ5A 4EY8A 5ALVA 4C4YA 1EVEA 1GQSA 1WB5A 2J3DA 1U4NA 4DNFA 4UFPA 5AM3A 2XUGA 3WZMA 3V9AA 3C6ZA 2H7CA 4KEAA 1UK7A 2WIFA 3KOOA 3STTA 3K2IA 5CH8A 2XUQA 1F0NA 1T4MA 4N8SA 2WUGA 5KREA 1BN6A 4QA9A 4LIPD 1CFJA 3BIXA 4QE3A 1C4XA 3H2GA 4DLNA 4JUIA 1L7RA 4B83A 1ODTC 3OC0A 4AN1A 5AIAA 1YASA 2C5FA 1XZGA 3P2MA 2OPHA 5K3DA 3WK5A 3F9CA 2HU8A 1UOPA 2XI4A 4PW0A 1ORWA 2FX5A 4U2FA 1MU0A 1LNSA 1IUOA 2AJ8A 3HACA 5ALGA 1F8UA 1ZGBA 5ALXA 4WY5A 2VAXA 2DQYA 3WJ2A 2AJLI 1GKKA 3V48A 3PF9A 1VA4A 1TCBA 5FUMA 3O4JA 1I6WA 1BEEA 4U2CA 2RIPA 5T4BA 4KE6A 3FNBA 2H1IA 5D3KA 5T4EA 1VA5A 4BZWA 1C7IA 1LBSA 3QMMA 3I2KA 2VJDA 4I19A 2XT0A 5IVIA 3I6YA 1GT6A 3I2IA 4E46A 2G5TA 4UBIA 2JIDA 4D9JA 1P0QA 1MX5A 2RAUA 2O2HA 3C45A 3WK9A 1K8QA 2W6CX 4XIIA 3OTQA 2FJPA 4BBZA 2PL5A 3KD2A 1HBJA 2OCGA 3I2HA 1DT5A 3V1NA 1CUBA 1K4YA 2WTMA 1H23A 4U2GA 3VJMA 1LBTA 5AKLA 2WFLB 2QJWA 1JKMA 2XB6A 5AOCA 1ZI6A 3O4GA 4H35A 4EZIA 4FNMA 1K6EA 4PO3X 1CUJA 3N0TA 3C5WP 2XE4A 2XUFA 2WJ4A 3AUKA 3GROA 4HXGA 1JMYA 4HAIA 4FLEA 1IMJA 2VSQA 5AH0A 3BL8A 2Y1KA 5ALWA 1MAHA 5JD5A 2O7RA 1DWOA 4I4CA 4BCCA 3R40A 3R3XA 5T4HA 1XZAA 4DMCA 1L7AA 3KSRA 1AZWA 5K3EA 5IKXA 5DYTA 4X91A 5AKHA 5DNWA 1GQRA 2I3ZA 4FFVA 2WFZA 4FMPA 2G4LA 3FWHA 4FDMA 5DTJA 1XKTA 2GYVA 1HKHA 2PSHA 3C6BA 4BDTA 3R3YA 4EB0A 3O9VA 1IZ7A 4MQMA 3IULA 3W9BA 4QNNA 5JAOA 1QO9A 1E8MA 1LPBB 2GZSA 5ISMA 1WM1A 2QMQA 5CMLA 3IUMA 3BF8A 2VJBA 4W1RA 4YX9A 2OGTA 1THTA 3STUA 3FSGD 4ZXFA 1GPNA 3F67A 3G0CA 2XMRA 4XWGA 3I1YA 4N8EA 3DCNA 1KU6A 3PI6A 3IUJA 3U1TA 1XLVA 2XQFA 5DNVA 4CG1A 3T52A 1ZICA 2B61A 1J1IA 2XUPA 1QIKA 3WA6A 4OYYA 3IUQA 5HK8A 1RWQA 3RLIA 3QPCA 1WPXA 4J7AA 4EHBA 2AJDA 2RHTA 2B20A 4WCVA 3HJUA 3M81A 2YXPX 4HTAA 1QTRA 4ZGBA 4A16A 4Y2SA 2WJ3A 4BAGA 2YASA 4ZWNA 4CCYB 3DS8A 4Q05A 1XZIA 5AICA 1CUWA 3V1KA 1NX9A 2HRRA 2HFJA 1CUHA 2WUDA 3FBWA 1SFRA 2XLCA 2RONA 3O95A 3ED1A 3FLEA 2XUOA 4KAFA 3PF8A 5C7YA 5CBKA 3K9BA 3I2JA 4BRZA 2IX9A 3NOXA 4C4XA 2ACKA 2QS9A 1F6WA 4X71A 3AZQA 3HABA 5CH5A 3WI7A 1E89A 1J2EA 1A7UA 3WKEA 4BYMA 3O0DA 1W1IA 4DTCA 1QIIA 4YK7A 4EY6A 3EQ8A 1WOMA 1UZAA 4Y2PA 1IZ8A 3LLCA 2BFNA 1CUSA 2BKLA 2ZJ7A 3N2ZB 5JADA 4Y9SA 3AINA 6YASA 1TIBA 1HLGA 5AM1A 2HA2A 4OUKX 4E15A 1H22A 5AK5A 2P8SA 4B0OA 2V98A 3R3UA 1T2NA 1EVQA 5AKJA 1XRQA 4BTLA 1G42A 5A2GA 3TGLA 3D59A 3R41A 1XZDA 5JAPA 1QJ4A 4Q34A 5C81A 3DYVA 4I3FA 2WG2A 4FBMA 4AZ3A 4MQLA 1XKLA 3H2KA 1YA4A 2C0PA 1CRLA 2ZYHA 1N5MA 4L9AA 5K3BA 1CUAA 3G0BA 4AN0A 2WIKA 5JD4A 1EH5A 4ARAA 4FBLA 1HDEA 4FHZA 2JGMA 1QOZA 1EINA 5HF8A 4KAJA 3FVTA 2PU7A 4GWLA 1R88A 5ESRA 2VA9A 4H7FA 2I03A 4B0PA 3R0VA 4GDMA 1M33A 5ALLA 3NWOA 5K3FB 2ZYIA 4J3JA 4ZRDA 1FFAA 3C5VA 1EB9A 4RPCA 5K5EA 4WJLA 1KU0A 1QO7A 3TRDA 4W9RA 4BC1A 3ICWA 3VJKA 5LKAA 1P0IA 1L7QA 1MNQA 3ESBA 1CUYA 4Z49A 4KYVA 1TKRA 3AZPA 3MUOA 2LIPA 1DT3A 5K3FA 2XMBA 3ZLUA 5FRDA 1MX9A 3Q8WA 1GKLA 3G02A 1IUPA 4ARBA 3B12A 1JJBA 4AMZA 1MX1A 4U2DA 4FLMA 1AC5A 1ACJA 3DDUA 4LXGA 1GPKA 4X3CA 1W76A 4DNQA 4J0GA 2JEYA 1CV2A 3A70A 2WQZA 3MUNA 2JF0A 1CUEA 2H9YA 4CCWA 2V9ZA 3E4DA 3STYA 1ISPA 3WK7A 2K2QB 1X2EA 2PM8A 2QJRA 4J03A 4ZV7A 2DFPA 2J4FA 1W6RA 5D7BA 3QMWA 3WZLA 4G8CA 1H2ZA 1LPNA 4DGQA 1JT2A 2OQIA 4F0JA 3H18A 5ALKA 1DU4A 1EDDA 2QR5A 3EBLA 3WL6A 3QZUA 4H7KA 5FXMA 1ZOIA 2HA5A 4ITVA 2RGUA 2OCLA 1YB7A 4UBOA 3ZPXA 1QLWA 2QUBA 5JALA 3EQ9A 3D2AA 4P9NA 2PKYX 1ZI8A 4QWWA 4Y2VA 2JGIA 2R11A 1IVYA 4DMHA 4OYLA 2W22A 4UFOA 3WWCA 3E0XA 1P0PA 5C8VA 2ZJFA 3UUEA 1MT3A 1QIMA 2JGEA 3WYDA 1TCCA 4H7IA 3WWDA 5LZ5A 3F8SA 2QT9A 5A7GA 1W52X 4X92A 1Y7IA 5AK3A 2OCKA 2OLEA 4BZZA 3G9UA 1EA5A 2J3QA 2YYSA 1YAJA 3NGMA 4G8DA 4DMKA 2H7YA 2PU5A 3I6ZA 2ZSIA 1XRPA 4CIBA 3D7RA 3H2IA 3QVMA 2PX6A 4E11A 4G4IA 4KE9A 3GZJA 2OXEA 1VKHA 5AOAA 1QIGA 2WTNA 3QYJA 3GFFA 3CXUA 4HRXA 2B4KA 2XLBA 4AB1A 4BRSA 2BAGA 4J0KA 3DL4A 3H19A 5LZ7A 4OB7A 2WILA 1A8UA 4HZGA 5CXUA 5JIBA 4G8BA 4Y2YA 4X6XA 3A2LA 3F96A 1Q0ZA 4BAUA 4GEGA 2G63A 5HF9A 4GBGA 4W1QA 1XQYA 4ZREA 2VAVA 5AO9A 3U0VA 4JH0A 4N5IX 1XZMA 5ALQA 3V1LA 5HK9A 2XUJA 1NU6A 2JBWA 1EB8A 1ZD3A 3CCBA 4BVKA 4C6HA 2JGJA 3G9ZA 5HF6A 3NUZA 3W04A 2BUCA 2DHDA 1UXOA 1JI3A 3WKAA 4UUQA 3WL5A 3F98A 5A7FA 3PDCA 4KR0A 5CXXA 1JU3A 4CI9A 4ETWA 4MYSA 5AI9A 2AJBA 1QIJA 3H1AA 4U2EA 4YASA 1ZGCA 1ODSA 3G0IA 3BXPA 2ZSHA 3AZOA 3K6KA 1VE7A 4LKOA 3FLBA 2WFLA 4CG3A 4DMFA 3DKRA 5AKEA 1VXOA 2Y2UA 3M83A 4B81A 4EBBA 4H7DA 4DIUA 1CUGA 4MEBA 4AQDA 2WIDA 3FLAA 3QBJA 2Z8ZA 4J0JA 2NW6A 4Y7DA 4BC0A 1TAHA 5C8ZA 5AKYA 3ICVA 3FAKA 2BJHA 4X7BA 1UWCA 4UBNA 2QZPA 1SOMA 2CEKA 3FSGA 3WWPA 1YR2A 3CCCA 1N8SA 3A2NA 4OSEA 3ZLTA 5AI5A 1JFRA 4PSUA 5ALUA 1ZD5A 4XX1A 1CEXA 1VXRA 5CT8A 2C4HA 3PFCA 4OCZA 5ALTA 3SWWA 3AJAA 5JAHA 3WKDA 4QDUA 4C4ZA 2GBIA 4UBMA 2CJPA 4A5SA 4G5XA 1XQVA 3CN9A 5K3CA 3BJMA 2X76A 1QGED 1MN6A 2OQVA 3WIBA 4QWMA 1XFDA 4UHEA 1DQZA 1BROA 3D4LA 5A62A 3HLKA 4GECA 1WCYA 3FCYA 2E3JA 5A71A 2FJ0A 3OG9A 4PSDA 3A6ZA 1ODCA 4PSCA 4Y2UA 4KE8A 4TPKA 4BVJA 4FLFA 3R3VA 4ZI5A 3DJYA 3FYUB 5CW2A 1DWQA 3OPMA 5DYYA 1LPOA 4EUSA 4BATA 4PF1A 3ZLVA 1CUZA 4EY4A 1HL7A 4UHCA 2HM7A 2OAGA 5E4YA 4X6UA 2QKYA 1UKAA 1OCEA 2YH2A 1FFDA 5I8PA 5FLKA 3BE8A 5DWDA 1LPSA 1EX9A 1K63A 1XZFA 4TVKA 2IITA 1G5FA 3H2HA 3WK6A 5KWIA 2XUHA 3S8YA 3D3NA 5SYNA 1U2EA 5CH3A 4UBLA 5AKZA 3ZWQA 1CUVA 1LPPA 4CCYA 2OG1A 2XMZA 3ILSA 4K6KA 4L0CA 3PE6A 5HZGA 2GBCA 5AP9A 1XROA 1H2WA 1XRMA 4P08A 4B82A 1ZIYA 3VKFA 5EHXA 1DWPA 3W06A 4OB6A 4P93A 4Q3KA 3WIOA 2QXTA 4BCBA 4UHHA 1GPLA 4KRYA 4BVLA 1XZEA 2OAEA 2XQGA 3GA7A 4G4GA 2DHEA 4JYPA 1LPAB 5F4ZA 1TRHA 1R9MA 5LYYA 2QTBA 2XMQA 3TEJA 3WKBA 1HPLA 2GYWA 2GYUA 2PUHA 3A2MA 4C01A 5ALDA 5LZ8A 5AJHA 4JYMA 2DCMA 5SYMA 4J0HA 5EHNA 1XQXA 2ZVDA 5HKAA 1PV1A 5LLSA 3G7NA 4MEAA 4V2IA 4HS9A 1UK8A 4Q3OA 4EY7A 1WPRA 2Y2VA 3JYHA 1J07A 4P92A 1UK6A 2ES4A 2HADA 1MJ5A 3H2JA 4GHWA 5KWJA 1R1DA 1BCRA 4J0IA 4C89A 5E4TA 4MWSA 1DTEA 5EIAA 4WFJA 3IDAA 1A8SA 2BCEA 5J3JA 4H77A 4Y2RA 1AQLA 4H7JA 3DKKA 1BU8A 1E3QA 4FTWA 4UBKA 3EIOA 4C87A 3I2FA 2QRUA 2O2IA 5AI8A 2H7XA 2J4CA 1QIDA 1ZD2P 3F97A 3W2TA 5HFAA 4CIAA 3C6XA 3O4HA 1E5TA 2XQIA 3O4IA 5FPPA 3HZOA 5AKIA 3I28A 1UK9A 1JJIA 4IO0A 1FJ2A 3QM1A 1MTZA 1QFMA 1CVLA 1HQDA 1BN7A 3IA2A 4AXBA 4J0CA 3KXPA 4K2AA 4NZZA 4EY5A 3IB3A 3D2BA 5ALHA 1X70A 3H1BA 2QXUA 4CFSA 1GZ7A 2PPLA 4DM7A 4X6YA 5AM5A 5DYWA 1JJFA 4X94A 1Z68A 4UFNA 1B6GA 4F21A 5AOBA 4B6GA 4M0MA 1XLWA 4KE7A 1IUNA 2D5LA 2UZ0A 5HQ3B 3BDVA 1UOOA 2ACEA 3DNMA 2PSEA 3KWJA 3VISA 3EQ7A 2ZYRA 4QZVA 4BCDA 1ORVA 3HSSA 4RE5A 4HXEB 2EDCA 2ROQA 3RM3A 1PFQA 2QM0A 3MVEA 5ALFA 3IIIA 4N8DA 1Y7HA 3CN7A 5BOVA 3HEAA 1RYYA 3IVMA 5FDFA 5HFNA 3W9UA 5E2IA 3AIOA 2XUIA 4MJ3A 2HRQA 2C5GA 4BP9A 1XZKA 2WHPB 5HKBA 1F0PA 1OILA 4RE6A 3FCXA 2CKMA 5AI6A 5FPQA 4WY8A 5BV7A 2WSLA 5D3ZA 1ETHA 4H18A 1RP1A 5FKJA 3R3WA 3YASA 5DTIA 3ZV7A 3V1MA 3EF3A 5AKXA 3DOHA 5CT4A 2WHQA 1WB6A 3HXKA 3GBSA 4X97A 1W4LA 4DSZA 4UPDA 1S8OA 1O6GA 3RKSA 4X93A 3D0KA 1CUIA 4GI1A 5JZ9A 2WM2A 5H3HA 3T4UA 3OM8A 4B84A 4IHAA 3C43A 4RGYA 5AM2A 1CUCA 3BWXA 3Q0TA 3WWEA 4K6HA 1R3DA 2VF2A 1ZIXA 5JD6A 2HA7A 2AJCA 5ALIA 1XQWA 2V97A 2BGNA 3WKCA 1PJAA 2OGSA 4AO6A 3SC2A 4QDXA 1FFCA 2XUAA 1R4ZA 1ACLA 1DX6A 4LXIA 4K6GA 2HU7A 4PV7A 4G9EA 4NMWA 4U2BA 1XRLA 2DR0A 1YSCA 2HDWA 1AURA 4E14A 1TQHA 3AFIA 4W1SA 1Q84A 1BEZA 2GZRA 2XMDA 4Q82A 3G0GA 3S2ZA 1BS9A 2XUDA 3LCRA 2FUKA 5JASA 2WUEA 1XRNA 2JGKA 2VJAA 2GBFA 1YS2X 1ZJ4A 2XUKA 1AMNA 1CUFA 1R50A 4PQEA 4FOLA 4ROTA 1E8NA 1SCQA 2CZQA 2Y6UA 3H04A 2WG0A 1THGA 4IH4A 2PSFA 4WDRA 2Z3WA 4HVTA 4PNZA 2JGFA 2WIJA 4NVRA 1C7JA 3AILA 4JNCA 2CB9A 4Q1VA 5BWCA 3AIKA 1USWA 2QVBA 4MWTA 5AKKA 4QDZA 3PFBA 2RI6A 4FKBA 3ESDA 4OD0A 4LYDA 3JW8A 4MYDA 5EHZA 4DNPA 1OXMA 2PUJA 1EK1A 4RNCA 5A6VA 4Q3LA 2VJCA 3UMJA 4DNOA 3I2GA 3L1IA 3WYNA 1VE6A 1YCDA 5FOQA 2Z3ZA 1CPYA 5ALJA 3WL7A 3C8DA 3FVRA 3WK8A 4KAAA 5ALSA 3WLAA 3LIIA 2X8BA 4S0XA 3LP5A 4KRXA 1G4HA 4TGLA 3KDAA 1MPXA 5LZ4A 3WK4A 4H7HA 4B7ZA 2CUTA 3VJLA 4UHDA 2QUAA 5AM4A 1AKNA 1LLFA 5EHQA 2WU4A 3I1IA 2X5XA 5EGNA 2I78A 2RHWA 5AHXA 5EIHA 5LIPA 2XQKA 3R3ZA 4XVCA 3DOIA 1SCKA 2VT6A 2BUAA 3QH4A 2VTVA 1CUXA 5EFZA 5CTAA 4HXFB 1E66A 4BAZA 2D0DA 4OU5A 2PVSA 4N5HX 2XMCA 5AIBA 4DYHA 1CIJA 3HI4A 3QPDA 3C6YA 4H7EA 4OB8A 1BCSA 3B3QA 1EI9A 5LZ2A 1YAHA 2V96A 1DINA 4MXDA 1WHSA 5DLPA 4C88A 5BWBA 4A23A 4OPMA 1FFEA 2R8BA 3SX4A 2XQJA 1YA8A 2ORYA 2C58A 4QEKA 1Y37A 1YB6A 3B5EA 5ALNA 4GLBA 3M3DA 2O7VA 2WG1A 2XDWA 5D6OA 2IIVA 3AIMA 4H0CA 3HYSA 2GBGA 4X85A 1VZ3A 1H2XA 1MAAA 4XJVA 1CUUA 5ALEA 4X95A 5JATA 1VZ2A 3STXA 2OGZA 1JMKC 5AK6A 5CRIA 2VATA 1B41A 1J06A 5ALRA 3IURA 2ONCA 1VJ5A 1K5PA 4WDQA 5JAUA 3D5EA 3VXKA 3WWOA 4UBJA 2HA0A 5HCUA 4DSAA 3WMRA 3ANTA 1ZD4A 2B9VA 4B9EA 4NS4A 3MGAA 2WIGA 1CUDA 4HRYA 3M82A 1A88A 1QTIA 5AKGA 4K5QA 3RK4A 4LHEA 4AX4A 1QIEA 2XMSA 2HL6A 1U8EA 3G8YA 5ALPA 4LYEA 3FYUA 2DQZA 3ESAA 1VOTA 1XZLA 5K3AA 4EA6A 5IVKA 2I3DA 2DHCA 1UKBA 4INZA 1H2YA 3WQHA 3WJ1A 2C0QA 3DQZA 4IH9A 5ALYA 3G9XA 1DQYA 2BGRA 2HA4A 3ZI7A 2JGLA 1CLEA 2WU3A 3FYTA 4B80A 3SK0A 4JEIA 5AI0A 2QOEA 1U65A 4Y2JA 4FNGA 3FYUC 1TCAA 1E8DA 5EI5A 4GXNA 1YS1X 4Y2XA 2VQ6A 5JZBA 3STWA 3DYIA 4QLAA 3IUNA 3VVLA 3L1JA 1WHTA
chains in the Genus database with same CATH superfamily
3I5XA 1IY9A 1OH7A 1A9XA 1HE4A 4EGCB 4I2NA 3MTJA 1SC9A 3I8OA 1X2BA 1M1YA 1NLMA 1D0VA 2AX4A 3R20A 4AO8A 2ICAA 5E6RB 2IS4A 3I52A 3BREA 2HQSA 4QOEA 1WUTA 5I9IA 5KYTA 5LU8A 4Z4IA 1PBTA 1K08A 1PR4A 1QC5B 2P7HA 3C3WA 3HC7A 1QO0A 3HA2A 2GQ0A 1J5XA 1SNYA 3CNOA 4PR3A 4KWTA 3E03A 3VVCA 2DLCX 3KVOA 2EBFX 5FR2A 1XRRA 1ZH2A 2H8KA 4ER7A 2HIHA 4OFXA 4FHEA 1IYZA 1XZJA 2PBLA 1UJ2A 4UEKA 3J80A 3IBYA 2ZCUA 4LXHA 5HKKA 1NU8A 5BN4B 1PHRA 1SCIA 2ZSFA 4R69A 3VU0A 3FWNA 1P2TA 3KUCA 1FLVA 4UTXA 3HRHA 3QLUA 3KJNA 4EP1A 5MF6A 2WDZA 1AZLA 4OSPA 5CPFA 2AT1A 3IIEA 3HKEA 4Z3DA 3AP1A 2QTAA 1UEJA 3UA3A 1PGNA 2NYVA 4ZQBA 3NIGB 4RLFA 4G2TA 1CY8A 1GV1A 3EG9B 1MQSA 2ZU6A 4M0EA 1X3SA 3CMMA 3RUHA 3F73A 3AEXA 1E2EA 1TMGE 2W83A 4M9QA 2VEOA 4QATA 1UOQA 3K15A 4C6TA 1WZIA 4CM4A 3EMBA 4QXOA 1ZNXA 1VG0B 1NW5A 2AUMA 3ADBA 4IILA 2GZMA 2D00A 4KWIA 1M2KA 1Z07A 4ZT5A 2KPOA 3FOBA 4EO9A 5BXYA 5K8IA 1EFRA 3LBNA 3CE6A 3W05A 5I45A 3EIXA 4FJ0A 3RYIB 5GOZA 4Y2QA 3DT9A 4QQRA 4R4JA 1FP6A 5TGZA 5C1IA 5FWDA 2ABWA 2QN9A 5BT9A 3UFXB 4PR0A 1STOA 4MA5A 3DMTC 2O19A 2M1ZA 4YRFA 3PCRB 1E9BA 5CYGA 2GD1O 1N92A 5G53C 2MSCB 1LZLA 1HNXB 4AMYA 1FL9A 2ZBQA 2ZB7A 3QYPA 1U2SA 4NV0A 4C3OB 2FJUA 1OQAA 5CVTA 2WC1A 5EMNA 4G5SA 5LQNA 2OUKA 3I04A 1JQLB 2OFOA 1U2TA 4Y9UA 7AT1A 1WU8A 1BMDA 5JYBA 2B92A 1CQZA 4KO8A 5CT6A 4C5AA 1GCGA 4RDIA 4H08A 1MTOA 1NXPA 4J2OA 5T7BA 5ECWA 1F4PA 5KTRA 4EGAA 2W11A 1SC3A 1HXHA 4RD0A 1ZJ6A 2MSDB 3ON5A 4FVTA 4Y1RA 4GS5A 5ERXA 2ZWPA 5J40A 5EIEA 4RH0A 4RC9A 4QC2A 2R7AA 5EGSA 4KRGA 1Q17A 2EDAA 1BE0A 1IXKA 3GZNB 4AP9A 1BYIA 3ZWMA 1CQWA 2D5AA 1NOJA 4YIKA 1N5LA 3QFHA 2W2MA 4GP6A 3TQQA 5J1SB 1WNTA 1OT3A 3PE4A 1NR1A 4BX8A 3GLHB 3DUWA 3FPLA 1DOHA 5C8XA 4D42A 1PZXA 1UANA 3O8OA 3ULKA 4A0SA 4BKPA 3ZGOA 3OPVA 1AD2A 1E3JA 2EJCA 2PEYA 2XCIA 1PWEA 1RLIA 2NU6A 1EWVA 2ZAYA 2EERA 3QVJA 4Y2TA 4YLEA 5H8WA 2ZSDA 1U5CA 3G68A 1PO7A 4DWVA 3UK7A 4B75A 5C1PA 2HWWA 3QITA 4YP9A 4M1MA 5CX1A 3SEAA 1A5AB 3HQ4O 2C4WA 2QZZA 1BGXT 3MCVA 4XYEA 2HSDA 4MP6A 4WXPA 1N6NA 4YRJA 2C7VA 3FX2A 4EHNA 4UUNA 3EGIA 2X1LA 3QV1A 3L0SA 4CMAA 3BIWA 4YYEA 3R3JA 2OZVA 2XNJA 4MUJA 1QONA 5A1TA 1XZCA 2PL1A 3MJHA 1KJWA 3BB1A 5HS4A 1WUIS 4FOOA 4JVLA 4KYTA 1ZRSA 3W79A 3C70A 1U0NA 1PUJA 3O7MA 2ACVA 3WR5A 3DL7A 3AP3A 3CA8A 2HF8A 1US8A 5CVEA 1GD1O 3WLMA 4BP8A 4GMHA 3BMNB 4GMFA 5CURA 1GZ3A 1EK2A 4R3WA 4BNGA 4C3VA 4UHBA 4IIDA 1Q15A 4PS0A 3TRIA 2EWVA 1O6FA 4U6SA 2I7CA 4AY2A 1KY3A 5JXJA 4V03A 4ARZA 2A94A 5CFZA 5LL6P 2KHZA 3KJEA 2NO6A 4QYMA 2CMKA 1CNMA 3IMGA 5IT5A 2NXCA 3PUIA 3QPAA 4L76A 1XMIA 3I73A 3UJCA 4CIYA 5GJVC 2HF2A 3MWKA 4ZHQF 1W75A 2QENA 3IAM6 4XSVA 1U7OA 5HG0A 3ZWKA 1XTKA 3E35A 3HRKA 3PD7A 3PICA 4NV3A 1JTFA 5I8WA 3QUAA 3NATA 4UZSA 4BLPA 4Q19A 5JS6A 4ZC1A 1AQJA 5C53B 3NKLA 1TVMA 3JWEA 4RV5A 1RE0A 3I8XA 3RI3A 2ZUUA 4O6VA 1AUOA 4AJIA 4O4LB 4YCNA 1U2DA 4U7DA 2BGGA 1XU7A 2OQRA 4BLRA 4EFLA 1JKXA 2HWKA 2YRXA 1B0ZA 4GGOA 3WFJA 2FXVA 2Z5GA 1SUDA 3DBLB 4FEAA 3CISA 4R71A 5DEIA 3SICE 3QUTA 5G1NA 2HPZA 1KDRA 4JQCA 1WZCA 1OMOA 4ZFNA 3MWEA 4UMDA 5CP8A 3K16A 4KACA 5HF5A 4EKGA 2B5WA 5JLAA 4Y2HA 3RARA 2ZXEA 2GPWA 4JI3B 2FSVC 3IR5A 2Y6VA 1CEQA 1NC1A 2Q8PA 4RD1A 3W6ZA 3E9RA 3GUUA 2RG1A 1KDTA 1EJ0A 1W19A 2NO5A 2R60A 3HA5A 3N2GB 2NVUA 4Y6RA 4P3PA 3K96A 5T8KC 1XLUA 3V6MA 2QUJA 4AUEA 1JIVA 1IB6A 3DTYA 2DG2A 3HCEA 1QH0A 1VRWA 4HZIA 5LQJA 1ZI9A 4LZZA 2EWWA 2VPXA 1MXFA 2AZMA 3AM1A 1NR7A 1R5BA 3FKJA 3T3NA 2CLDX 4R1MA 1FSFA 1PDVA 2QQGA 5E4JA 5EWMB 5DGIA 5KJEA 3PFHA 3WSVA 3T3EA 4BE4A 4KITB 5L3VA 3ORRA 1P33A 4OHYA 2WHPA 3CZPA 3P27A 4FFDA 1QIHA 4O8ZA 4QAQA 5FTNA 4RULA 3PJRA 3EEBA 5FX2A 1YL5A 4P34A 4AG3A 2ZS9A 3DULA 5E1OA 2WKWA 4W5RA 4H6WA 1BWRA 4X66B 3O1IC 1MJNA 3VTFA 3VPHA 2PUCA 1PI3A 1ONBA 2CFIA 3A4LA 1M34A 2JEZA 2OV1A 1KBZA 2OC4A 3KKOA 2MYNA 4LZJA 5G1OA 3OIUA 5LZ9A 3GVCA 2DHRA 2JS7A 2ECFA 1KFKB 1WPGA 5F52A 1HFWA 2IS2A 3NGXA 4U7WA 3V2GA 4DDWA 3TW6A 1AS3A 1JQ3A 1Q92A 2ONZA 5H3CA 1M2GA 1CR6A 1M5UA 2MTBA 3MCUA 4WGFA 3UHAA 4BVAA 1T10A 4RAOA 4QJIA 4CIDA 4HVLA 1AKYA 3NWPA 2IV3A 3ZW9A 4C9BA 3IAM1 4XIYA 1GQSA 1V16B 1WB5A 3VU9B 1X7WB 2GJ8A 9ABPA 3W4JA 3ZYZA 3LXUX 3I01A 2BW0A 3ZE8A 2AR9A 4WZAE 3CZAA 4HQRA 4V2IA 5CYPA 4IXNA 3D8RA 1IZ9A 5KOHB 4Q9KA 2QV7A 2XUGA 5AM3A 3GYGA 4KFCA 1CY4A 2H7CA 3T9BA 2BRUA 2Q5IA 1WXDA 4YI5A 4DGSA 2RB4A 2H0QA 3K73O 2IUUA 1I2CA 3E9NA 1HT1E 4W5QA 4QG3A 2ZSAA 1U28A 2X58A 4CL0A 2J5QA 2WIFA 2R8YA 2ZANA 2H1WA 1W87A 1UM8A 4D3ZA 4YAUA 3SHVA 2QMHA 3N6RA 4LYYA 1IONA 3M6FA 2JFUA 2WT4A 1J0CA 3T94A 4DLWA 5EP2A 4XEUA 2HW8A 1F0NA 1T4MA 1ID1A 3A1EA 5MHTA 1XCLA 4I1OA 4YWHA 1ESDA 5IMSA 2YZMA 3I61A 1JT9A 3CRVA 1XTSA 3BRWD 3F5QA 1CFJA 4D96A 4QE3A 2JVJA 4N7MA 2YTZA 4ZVSA 4UU0A 5L4NA 3MGCA 3L0BA 4GUDA 1H5UA 5JS2A 2MMCA 1L7RA 3CSDA 1E96A 3AF4A 3PHGA 1Q0PA 4P4SA 4B83A 3W3AA 1QK5A 3P45A 4GXQA 4QYWA 5ADVA 1YRBA 3V34A 3U4QA 4J3FA 4MWDA 3G2JA 2OPHA 4E5MA 2Y4NA 2AE2A 4P7FA 2G9ZA 1W9MA 2F4NA 5L95A 2XA2A 3EAFA 2Z6VA 4FT4A 3WK5A 1VHQA 2HU8A 4MLCA 1XBTA 3HFSA 4M60A 2FUG6 1FQWA 2YJ5A 5CBPB 3M2TA 3Q7RA 3PC2A 1UT8A 4YR7A 3LHDA 5BUZA 4RHEA 1Y6RA 3ML1A 5JRDS 5LLDA 2FX5A 4NCXA 2WR8A 4U2FA 1PL6A 1FYFA 3RIYA 1G8MA 2AJ8A 1IUOA 2OZLA 2PYDA 3A6GA 4Q3CA 4NXNB 3SQOA 3D7LA 2C5HA 3NHAA 1JIXA 4BGUA 1XE3A 1LUAA 3ERCA 3RSZA 1B73A 4KPUA 5EZYB 1Y5IA 4A2CA 2XTMA 3G1TA 3UOAB 2HQOA 1MV5A 4WY5A 4AWAA 5IFKA 4P4GA 3QFFA 5A3RA 3DPSA 3F1KA 4ZYZA 3KYJB 3Q6NA 3SVTA 2AJLI 2P9TA 3DDCA 2NU8A 1U2ZA 4GAEA 4WCFA 2WPDA 1SBTA 3PR1A 3V48A 5BN1A 3V6LA 1SB9A 1MBZA 3O4JA 1I6WA 1P6XA 4QREA 2I2WA 2PSSA 4TXHA 4U2CA 5KB3A 2RIPA 5LN1A 3TQFA 1VJGA 1HE5A 1Q1AA 1TQ8A 3AY3A 1GA1A 3JX9A 3KDPA 1DPFA 4HB0A 4PX5A 4RCZA 4OMDA 4TWBA 2UZ1A 2WOOA 1LBSA 1UDCA 5IX8A 2VJDA 1PUXA 3DZGA 3HDHA 5TB5A 3L43A 1Q77A 2QRGA 1H1TA 2P6MA 1VTKA 3UT0A 1Z45A 1KORA 4HDAA 5FEMA 1T5IA 1FRFS 4DIMA 3MK31 2AFRA 3GLHE 4UBIA 4YRRA 3U19A 4B7AA 1EFPB 2FR8C 3KCQA 5HHTA 2MSLA 3PEVA 2O7SA 1T8TA 3MJTA 4HH4A 4O4IF 3S2SA 5JNWA 3VR4A 3DPUA 1L4LA 1X7YA 2GRJA 1Z12A 5KTYA 1KOGA 2O8VA 3L0CA 1DDGA 4FHDA 4MMXB 2IODA 1YDGA 1Q1NA 2W6CX 4QUHA 1SUWA 1G9XA 1B43A 1K9VF 2AOVA 3TR0A 2R751 4XIIA 3GWZA 5HUQA 3OTQA 4KQ2A 2FJPA 1FQKA 2H4WA 4FB5A 2JLZA 1FPQA 3RIMA 1THMA 1L8XA 1Y63A 1KHHA 2YS7A 2EGHA 4QO7A 1HBJA 1Z16A 3ETGA 4OYHA 5LWQA 1FFSA 3PX3A 1DT5A 4B35A 1KMHA 3WGHA 3CR8A 3MJDA 1CUBA 1XZNA 2WTMA 4GPTA 4KG7A 3VJMA 1A8IA 2YS6A 4M1EA 1AUQA 3WADA 3OQMA 2TMKA 3R1IA 3W4KA 5AKLA 2QJWA 3SM9A 2BDUA 2FUG1 2EU8A 3I0MA 4ZVPA 5TF0A 4KTVE 4LI3X 3GMDA 1LJUA 3E81A 4OIFA 2AH5A 1I32A 1K6EA 2GXQA 3IMFA 2I8AA 2OLJA 3OKPA 4NSNA 4O2RA 2H2GA 1Z5WA 1LTQA 5C1BA 1E2MA 2NLOA 1BJRE 1RR6A 3TZKA 1VLMA 3GO4A 1J70A 3INGA 2WJ4A 5B12A 4AL4A 1NY6A 4NFLA 4UM8B 4DDVA 2J0SA 5C9ZA 3WAJA 2V03A 3FRHA 3OPQA 2CMHA 5IKOA 4ZZ3A 1KRXA 4IHJF 4F5WA 3VUFA 2QVXX 4HAIA 4FLEA 1IMJA 6AT1A 1W36C 3N1UA 2A9JA 1O57A 1KY5A 2ZSKA 4JBIA 3MAJA 4LSWA 2Q5HA 1DNPA 4XI9A 1DIAA 2ET6A 5AH0A 2VZLA 3DFMA 4IF4A 2ODAA 5EJFA 5CEJA 4L51A 2HLPA 1MAHA 4QL3A 1GL6A 4AZWA 3I9JA 4EL0A 1DE0A 1H0HA 2ZSUA 3C15C 2COEA 2V7GA 3U3KA 5J2TF 2G82A 5A0FA 1M2JA 5B1HA 1U1FA 5D87A 1ZW6A 1I1QB 2PWZA 3K5PA 4C4AA 2FN9A 2QYTA 4X54A 5F73A 1E69A 1ZDMA 2ZETA 4WLOA 5JLJA 2RK3A 4BMNA 1SU8A 4KQ6A 2PX5A 1G3QA 1L7AA 5HTKA 3BWYA 4S24A 2HPAA 4DCSA 1CZHA 2HLDA 2PD6A 3KFVA 3GJYA 5K3EA 4GSYA 4Q7JB 5AKHA 5CIYA 5D8DA 2IPMA 2HSEA 3MTGA 3NBAA 4DV5B 4FP9A 2QVZX 3BD9A 4OGFA 5DNWA 5DX8A 5EMHA 1OFIA 4BMDA 4BNTA 4IIBA 2JKYA 4D41A 5B4VA 3ADCA 2WRZA 1U5AA 1WULS 2QIOA 3EUFA 3TIGA 2BKAA 5KDOA 1P0FA 1DC4A 4HATA 5JH7B 1QVZA 4MP3A 1OFHA 1NM5C 4EDFA 3S4YA 1TA4A 4F8JA 1Z56C 2FWAA 2B1GA 2VKQA 5DTJA 3V7WA 3CVWA 2V7PA 1JLMA 3W5CA 4AJ1A 2N47A 4DUYB 1MC4A 2JBAB 3PDJA 1TEHA 1NE7A 1RTKA 2J4DA 1L7DA 2PO7A 3C6BA 1ZK3A 3FKSD 2I55A 4Y6SA 1GYPA 3GLSA 5I4CA 5BPHA 5KVQA 3ZD9A 1KI9A 4RY8A 2JI7A 5HQJA 3TIVA 4HBZA 1P61B 4ZHQA 2AN9A 3B7GA 4Q93A 2OM2A 1L5NA 3TBHA 1ADYA 3VTAA 4C7VA 5TDHA 3KYCA 3OY7A 2H5EA 3BVPA 3CNBA 1QO9A 3LYUA 1E8MA 4QNNA 3TLGA 5I9TA 3R74A 2GN4A 3H7AA 5FLEX 3MTQA 1E5QA 2GZSA 1TU3A 1IJBA 2QMQA 2ZPUA 4U0JA 3A4VA 5ISMA 1NQVA 4EW2A 2HSJA 4IAOA 3MCZA 3IJ5A 1BXGA 1JDBB 4ALNA 2N46A 4OJMX 1EYZA 3LKZA 1RIFA 1VPTA 1H4SA 1UJMA 5C5IA 1WE2A 2C61A 3OE7A 3QW4B 4EENA 5EL0A 2FMIA 1WQ4A 2GCPA 2X2EA 4MQFB 3VFDA 5J5AA 6ADHA 1DBRA 2R3SA 3F67A 3MT8A 3QPWA 3OM9A 5EKXA 1L4YA 1XD8A 4XWGA 1PIWA 3WBKA 1Z2CA 1A4RA 1R4MB 1X8JA 2AG0A 4TS9A 3WIEA 2W2OA 2UUPA 1TT5A 4DA0A 2ASVA 3DNPA 3U1TA 1L5KA 5EJ5A 1XLVA 5HRAA 4L9RA 1YKSA 2DKNA 3QXJA 1TZBA 3C41J 1AGRA 3OJEA 2AJTA 3V7NA 3UJ7A 8GPBA 4CG1A 1LSOA 2HMWA 2ZQ5A 3TSCA 2FRVA 2W2KB 5SYAA 4MI1A 1ZICA 2B61A 2WNHA 3RTCA 3TBKA 1QPZA 3UA4A 1ZOSA 1U4OA 5TEVA 3DCYA 1T9GS 1A27A 3WA6A 4C6SA 2CNOA 1FS4A 3RVPA 4HLCA 4AFNA 3RLIA 5JW6A 3QPCA 4W8HA 1O96A 3O92A 2J3JA 2H4XA 4WKOA 3RJZA 3V1TC 5BRNA 1BNCA 1KFJB 1YBVA 2EEZA 3R0ZA 4W7SA 2A3NA 2AI3A 1ZD1A 2B20A 1NKTA 4MKGA 4WCVA 4D4KA 3M81A 1Z6PA 4W9NA 2YXPX 3TTYA 1QH8A 1QTRA 4ZOLB 2IEIA 4NONA 3ROZA 5B7NA 1ZOLA 4FU0A 4Q7KA 1TM4E 3EAGA 2Q9AA 3EVNA 3HKBA 3QP9A 4NE2A 2E4AA 4KMRA 4Z9YA 1ZGGA 5KQGA 3O75A 4BAGA 3T1HB 3VR3D 3QF4B 4ZWNA 4CCYB 4Q05A 4R2HA 1GO2A 2GJ4A 4Y1EA 5AVJA 5G41A 1N33B 4IUCS 1NI3A 2PZJA 4C4PA 4MLPA 2GZAA 5DNEA 1ZR4A 4JZYA 4RJKA 2XGMA 5G0SA 1GLVA 1NX9A 1IUKA 1S4QA 2HRRA 2OBNA 2P1RA 3IPXA 3RV4A 2V7EA 2WAMA 3HCNA 2HFJA 4RVNA 1SB8A 2J09A 1EBFA 3A32A 1RC1A 3KO8A 3PCXA 2RONA 3EC2A 3KQOA 3KZOA 3FDXA 1RAAA 4PGFA 3ED1A 1OAOA 4KQJA 4LF7B 2O06A 3A6JA 1RIIA 2GLXA 5AVVA 3B53X 4KAFA 3QLVC 2PL9A 3BN3A 3DZHA 4B48A 2DPXA 1JJ7A 5CBKA 1EUYA 3BM5A 3BXFA 2AB0A 2ZXUA 1N6OA 5DYNA 1G2QA 1QK4A 5F7JA 2X6RA 4ASUA 1G5HA 2BHNA 1JG6A 3TCXB 2R1TA 3BD8A 1RI4A 1Z47A 1Q7CA 4KVZA 1BHQ1 4ZGGA 4NG5A 5LVAA 3WLNA 2JLXA 4WASA 3RRMA 2QS9A 1F6WA 3NHWA 2X4DA 3GD7A 4NG4A 2ECKA 1PK9A 4TLLB 4POAA 2NUTB 4TV9B 3DVLA 4DDMA 3P9IA 4RF5A 3VSAA 1PLLA 1T1RA 1LDYA 2NIPA 2E49A 3COWA 7MHTA 1YRLA 2NSDA 2V6JA 5ICMA 2BONA 4RQTA 3WI7A 5A4FS 3II6X 3KZNA 2VZEA 5CG1A 2EP8A 3CRW1 3I6QA 4LXTA 5F5LA 1FFXA 3W3AH 2XVZA 3GFGA 3OQNA 3NC1C 2KQUA 4DXAA 2H2WA 3ID6C 2QYHA 1EM8B 4LNUB 1E20A 1JSCA 5EXDA 5FOXA 1QIIA 1WL8A 3X2SA 1T29A 1E9VA 1DBVO 1JILA 1F4VA 1T9DA 3BMQA 2VP4A 3IE2A 1JHXA 2RFLA 3P52A 3EDOA 3RKUA 3TX2A 1UUFA 3UAGA 4RTJA 4WZBA 4CMIB 1B8NA 1CUSA 2ZJ7A 4F1WA 3IAUA 1CT9A 1X92A 3RNLA 5HIIA 3FNGA 1QG4A 5AXBA 1D4ZA 1P2FA 2LW7A 1V47A 3IKTA 3PPWA 4QYIB 1D4FA 2COKA 2ZXFA 3EODA 2CLKB 4EWLA 4FM9A 1TIBA 5K45A 1QQBA 1PYDA 4U5XA 2VKTA 4FYYA 4PHGA 1WBJB 4PLYA 3WMFA 2AL7A 2XNDA 4IXDA 3H5VA 3IHWA 2D8MA 4QOGA 3E1KA 2WKSA 2CF6A 2X19A 3L1VA 3ZV4A 5BSHA 1OIWA 1J24A 1SHJA 2GJKA 4B0OA 1YHZA 5JO0A 4J29A 3ROEA 2C3UA 1J39A 5TJHA 3B1YA 3IXMA 1OKKA 3JPWA 3IAFA 3PZRA 1GFWA 1XRQA 4JLSA 4U63A 5B3AA 4BTLA 1GZHB 3GAZA 3LF2A 2QZ4A 1R6AA 4B8YA 1DCTA 1XZDA 2QAGB 1O94D 1WXWA 1YJ5A 4YP7A 3V4SA 4ND6A 2OXTA 4C7BA 4H6VA 3TLBA 4GH5A 1GY8A 1M8GA 2QLMA 1QNLA 2RGEA 1QJ4A 1R74A 4O4IA 1W2HA 2H5LA 1Z0FA 4DQDA 2EJVA 2ZBEA 3F0TA 3RRZA 2O8BB 3P1JA 3WRWA 4PRYA 1M6VA 3O3NB 3P0EA 3E70C 2FZ4A 2Q2NA 2WHXA 3NHBA 3PHLA 3M9XA 4PTYA 3VR4H 3L6RA 1CRLA 3K0AA 1PWZA 3EIQA 5E0OA 1HFEL 3F4BA 1SKAA 1RYDA 4G6ZA 3ELBA 4UTVA 2F3UA 3BXHA 4MPPA 4QVGA 1CUAA 3QUBA 2E4UA 2WUVA 1RKUA 4AN0A 3FF1A 4TSKA 2V8OA 1PZMA 4I08A 3RREA 3VZBA 1ZGJA 1CR2A 1HLPA 1NKSA 4DLVA 1ZMTA 3H3FA 1RYNA 3DZ8A 4C0SA 1GQYA 2YWHA 1NZFA 3HBMA 4M1ZA 4D6YA 2E4YA 2ETVA 2SKCA 2WM9B 3OQPA 4TM7A 1T3SA 4IEEA 1QS0B 1NC3A 1NXXA 4NMLA 3TDMA 3TK1A 1MB0A 1D1PA 3ETDA 4MVJG 4Q4AB 4HNUA 5JCOA 1LJLA 4FHZA 4R1UA 5H68A 4S05A 5FBRB 5LXTF 3IKMB 4YJFB 2R1VB 2UV8A 5JFOA 5KAMA 1Q0UA 1E92A 2Q1YA 3CKMA 2OM6A 3WGKA 2UXDB 4L7VA 2ZROA 3S1SA 4IHJA 3HY6A 5IANA 1NF3A 4LVCA 5AQEA 5ESRA 4B3DA 4EYQA 3GPCA 1J9ZA 1GSIA 2ZJAA 3KALA 3L46A 1GGEA 1L9KA 3AIIA 1X7XA 3NP7A 3NV7A 3EC1A 3GP5A 5D00A 4AU1A 4GDMA 1HYQA 3GUYA 1GUZA 4TTPA 2BZ0A 4RGBA 4WUTA 2DR3A 4Z51A 4V0OA 3MINB 5J2TA 4OHUA 4OM8A 5ALLA 2B3DA 3B5JA 4P81A 5GIOE 1E5VA 1YJXA 2C2MA 3NWOA 4EG8A 2Q2VA 4J3JA 3RBXA 3C5VA 1RMTA 1EB9A 3UPTA 2PUEA 4BNMA 1E3WA 2KI5A 4WJLA 5K5EA 1YBHA 1KAHA 4Z2YA 3ZU4A 4M0LA 4CF6A 1JL3A 3CUKA 4W9RA 4WN9B 4BC1A 1PVOA 1Y4DE 1RI1A 4JASB 1PEAA 4B3RB 2JFNA 1WLYA 4M0DA 2XWBF 5E1MA 2IZ1A 2FW7A 3EYAA 1JS1X 2J6HA 4BB9A 4BS9A 3QGMA 4BPBA 3MD0A 1RQNA 3ISJA 5LKAA 1PFYA 3D6VA 4UU1A 4BU1A 4QHSA 5JPIA 5I8ZA 4P7GA 5EZ6B 2LRHA 3MQ4A 2JARA 4GKVA 4BASA 1U7HA 3SHTA 1SGWA 4XPIA 4Z49A 1EVLA 2WTXA 1AO0A 3SEQA 4W6QA 4PN3A 4YYZA 1DC5A 1TKRA 2XE7A 4CV1A 1SHKA 2IH5A 4EPTA 3T9FA 3KTFA 1D4AA 3UW1A 3C3MA 4DV6B 5IYZF 4RMNA 4AKHA 3A1TA 1PK8A 1M8KA 5K3FA 4ZOCA 5FWYA 2X40A 2EATA 2GD0A 3CVVA 1GKLA 4BJHB 5L3SA 4BMCA 4RGQA 3COVA 1GM5A 3AR9A 3VOAA 1T25A 1LW6E 4FS3A 1LF5A 3RBZA 1MX1A 2IYRA 4XXHA 4FLMA 5A5FA 3P4UA 1ACJA 4MR7B 2AKYA 4KQMA 4KFTA 1SHZA 1SQFA 5EHIA 2ZPTX 3T1NA 621PA 5AJUA 1FYVA 1L4GA 1UMDB 1SHLA 5DI9A 4RXMA 7REQB 2ASEA 1W76A 1ISFA 2DWUA 4JLVA 4PCAA 4DIFA 3OZTA 3U4IA 1I2BA 1KZGB 4J0GA 2J30A 2JEYA 2P69A 1CV2A 4RNDB 5EMJA 1PFVA 3L6UA 3QNMA 4Z9BA 3V7FA 2ZUTA 4UAUA 1JDVA 3DOFA 4J8PA 3KJQA 5FAKA 1JIQA 2ZZNA 3IDQA 1C30A 1HEIA 3A9UA 1KJQA 2V9ZA 2X1VA 3C2QA 2QZ9A 1NP6A 1M9NA 1JXAA 1IHDA 3H1EA 4BMXA 1T2VA 3DAPA 4ER3A 3T3PB 3DWFA 4K8RB 3TTUA 4MIYA 1H6DA 3LPDA 4C78A 1QCZA 4JL6A 2FWPA 3BBLA 4WBNF 1XAHA 4N03A 3VDMA 1DC6A 2DFPA 2J4FA 1Y1KE 3S5JA 1XJ0A 2Q3BA 3FPHA 3S2GA 4JB8A 1NOKA 2H1RA 3NH6A 5CNKA 3BB4A 2FEWB 1II0A 1C50A 1OC2A 1NUQA 3KHKA 4JOQA 1WSAA 4R31A 4TKVA 4M8LA 5FA5A 1C80A 2NXWA 4LY9A 3BS4A 4XYBA 4LV6A 3Q9UA 4F0JA 3H18A 1P3DA 2WU0A 5B1SA 1LVHA 1VIYA 3W5BA 2XVYA 1OWNA 1P1KA 1ULSA 4DQLA 4EH1A 3OEED 4F11A 4N5DA 4DKJA 2QR5A 2PUFA 1UJBA 4IY1A 3LUHA 4P5DA 1DAOA 4H7KA 5L3ZA 1EHCA 1ZGZA 3H7IA 3KZ1E 3F6RA 4M8KA 5FL7A 1BX0A 2C1ZA 3QI2A 3NHSA 1I5OA 5DI3B 4CDNA 2IYFA 1UINA 2XW6A 3NBQA 1M0TA 3PFNA 2YUIA 5ES3A 2NO7A 1OY1A 1HYEA 3VPGA 4AVYA 3QVWA 1RCFA 1JX6A 5KYWA 2QUBA 1T9BA 4Q9LA 5JALA 1R3UA 1SQSA 2X9LA 3CLKA 3LUCA 4BLUA 1TK2A 4ZCQA 4B2IA 4IRMA 4QDJA 2OT3B 1J20A 4XRGA 2H9AA 5J5CA 3UBMA 4JIGA 2FX3A 3VSBA 3T3OA 2UVQA 1ZI8A 1CHDA 2IYLD 3IP3A 3COJA 1II8A 2BBOA 4OI1A 1L8OA 2R11A 3DE6X 4G89A 1OR8A 1RQ7A 5FYDA 3SJUA 4DMHA 3KQLA 1NI4B 3UBTA 3FYHA 4G07A 4QOIA 4AJ9A 9LDBA 4UFOA 1W0JD 3H9BA 1A9TA 1Z36A 4M8NE 4JHLA 4P38A 2GR9A 3MQ2A 1M6YA 2VQ3A 2OHIA 1P0PA 1V43A 3E8MA 3F2VA 3NR2A 1XTIA 1RYMA 4I9GA 1KY4A 1Q1BA 2QVLA 1PF7E 1M0EA 2ODQA 4HTFA 3MPUA 4D9BA 2FI1A 3FOAA 4U9HS 4DV2B 4UAVA 2CV2A 5DGDA 3GDHA 4MIEA 3QJ5A 3O2SB 3U9LA 4H7IA 4Z7JA 3HK2A 3WWDA 2C2YA 3ZDRA 3JARB 4M0KA 1MVLA 3MELA 3KJFA 4QBFA 2KS6A 4HUTA 5A03A 2DUNA 1R0RE 4DLRA 3FHTA 3T7DA 1ZHFA 1KAQA 3ETNA 3GUHA 5D1NA 3WBBA 2SNIE 3D7SA 4IJ5A 2OC9A 2EZTA 2PX2A 4HGPA 3O26A 1MENA 2XTAA 4TROA 4HAUA 5A7GA 4ZCTA 1K6JA 2FGKA 2PO5A 2CVPA 3BL5A 3IE0A 4YMIA 4PVDA 3DVSX 2C4NA 3ZHYA 4AKSA 1QFZA 2JFZA 3Q8KA 1IM8A 2FTKE 5CLGA 5FUXA 4BJ5A 3U60B 4BO6A 4EJFA 2W2TA 3AEUB 3ER9A 4RW0A 3TSOA 3MEQA 2PLNA 1N9KA 2YWFA 1HF3A 3DZJA 3EE6A 4F56A 1T8RA 3Q3CA 1YD7A 5DNAA 4RVDA 3EDQA 1PG5A 4RQBA 4DEVA 1QR6A 4I9HA 4BYGA 2G8NA 1X74A 3I6ZA 2B7BA 4GQAA 1I10A 3EAQA 4A8TA 1ITZA 1DDOA 4Z4GA 1XL0A 1KI6A 1ZAKA 5BR4A 2ZR8A 4Q3BA 3FTCA 4M1QA 2OGUA 2KW5A 4F9EA 3DEJA 2BC9A 3PXXA 3GMIA 4U7JA 1G0NA 1U2GC 1OGIA 2OXEA 1VKHA 3FMVA 1JU9A 2D1TA 3EZ9A 4KSBA 3UAVA 2PKQO 2C4MA 5LQRA 1ESCA 3O4VA 3WHPA 3LDGA 2XZTA 1A0OA 4EJSB 3JQPA 1YH3A 2B4KA 2FNAA 2XLBA 5IWCA 4HNRA 3WDLA 1MG0A 2BAGA 4RWEA 1KFEB 1TTPB 5FFFA 5BNTA 2ZAMA 1VG8A 3H19A 3LUKA 2VBCA 3V4RA 5LZ7A 4GOND 1OBVA 2VYQA 2WILA 5AVWA 1SCAA 5JWOA 1ZC3A 1WXXA 3QG5A 1I80A 1QQ6A 1KK0A 1VIVA 2QZSA 2DT5A 3A26A 1FZQA 4G8BA 4JSYA 4KB5A 4PNHA 3Q2IA 4N5NA 4PLVA 1Z18A 3ITEA 2VNIA 1TMOA 1QQ7A 1SOVA 3A2LA 4RIFA 4PAOA 4OAQA 4HI0E 4X6XA 4TKUA 2I34A 4C0XA 4UXJA 5CB4B 4FC7A 5AUQA 2NZYA 5CB8A 2XKBA 3V2UA 1AHHA 1NF2A 3F96A 3H9CA 1Q0ZA 4RQUA 1VL8A 2FWNA 5FPSA 4I1SA 4BQEA 5IZCC 2NWQA 4GP9A 1QB8A 5FOUA 3PQ7A 1KIMA 3L79A 1KC1A 1XQYA 5B6PA 3GLRA 5ER9A 4RTNA 3KZXA 4B3BA 3U0VA 2YICA 5CVDA 2DETA 1XZMA 3JQ8A 1TKCA 2HJWA 3V1LA 1E5LA 3ZXIA 2CWDA 1NU6A 3B3FA 3OOEA 1N4AA 4PVCA 2ZZKA 4EJ0A 4CUZA 1QJCA 4QUAA 5DSTA 3V7YA 1GUAA 2JGJA 3M34A 4ZAYA 4QPDA 5J58A 3KB1A 3OZRA 2BUCA 4WZAB 2EP7A 1JV2B 4TYWA 4KK4A 3Q2KA 3SZ3A 2X42A 3NWEA 4YRGA 2NYRA 1UXOA 2OBFA 3N2NA 3M6MD 1R5NA 2EFJA 4MMZB 5F12A 1P1CA 3THWB 3T7RA 4EFDA 1I1NA 1SELA 2HK7A 1C3OA 1TVKA 2Q07A 4FMDF 4ILEA 5T41A 5LXTA 1RC8A 3B1KA 3LGXA 4X1KA 2HDHA 3SF8A 2G5GX 4Z8XA 1T1JA 5IVPA 3O94A 5BR1A 4ZO6A 2HRZA 1QWOA 1U6JA 4F2HA 3KG2A 4QARA 3NVDA 2A4KA 4KH0A 4ETWA 4JT2A 4MYSA 1J97A 1N2IA 4Z4EA 4H60A 5HMLA 4FYJA 3RPEA 4QIHA 1Q2UA 2RHRA 4MUMA 1ONSA 1I6MA 2ZE7A 1J90A 4JUDX 4OOFA 4PYOA 3LVFO 4U2EA 4YASA 2YNMD 4EJ6A 4HGRA 3GRYA 4WI1A 3G0IA 4WKBA 1GTG1 3BXPA 2Q2WA 3IQXA 4OK3A 4R6XA 2PEZA 2BE9A 3D8TA 2F7SA 5L3QA 1TRKA 4AUNA 3NOOA 1VE7A 3KYDB 4M7WA 1DZ3A 3REQA 4KXNA 1EEHA 4YCMA 2YVKA 1J0BA 1F8YA 3L7MA 4LKOA 1CXZA 2BMEA 5HXAA 1Y6GA 3ZY4A 2C9CA 3I5UA 1PJTA 2WFLA 3B48A 3DDOA 1NRJB 1RJGA 6REQB 4ZI7F 5K0BA 2BF7A 2ZIXB 2IJGX 4UNSA 1Y34E 2X4GA 3SN6A 1NMQA 1WRBA 2Y2UA 4B81A 4G2NA 1YVPA 5LM3A 1VJDA 2OOSA 2POCA 4EBBA 4BBPA 3EASA 2GM9A 1AXRA 2J6CA 2FPRA 2Q4DA 4LRSB 1QHHB 5H02A 5F77A 3TCKA 3T35A 2IVZA 3FLAA 3JASA 5IJ0A 3UGJA 1Y3FE 2WIAA 4XZ3A 3WGNA 4S2UA 3CY6A 2IXAA 2PT5A 1FMLA 3K2EA 2DBVO 3KXKA 1JEDA 4QHTA 3WLRA 2W9XA 4ENPA 2AEFA 2ZRKA 3S40A 5JNLA 5K6RA 1IY1A 1VLHA 2VI5A 1SWVA 4ZVMA 3KKQA 3ICVA 4M86A 1QWSA 5IYZA 3FAKA 1GDDA 1CS4C 2YHSA 5B58T 3HVHA 2EP5A 1KC3A 3FVVA 2O8DB 2QX6A 2QZPA 1SOMA 3IELA 3ZS8A 3V33A 3HCAA 2JAPA 1LA2A 4PCUA 3TQCA 3QYAA 4RPKA 2CCKA 3GR6A 2I4LA 5PNTA 1IN1A 2I99A 1NVMB 4UMFA 1CY0A 2P78A 4ITRC 1YACA 2ZRHA 4QPJC 4URUR 2HCTA 1FUYB 3VAZA 5AW3A 2VEDA 3OOHA 5TT0A 1XP8A 4PRKA 1M5RA 3GA0A 3MIIA 3ZLTA 4EUKA 4QT4A 3UJNA 1J5EB 1Y98A 3I9KA 3SIWA 3SHOA 3FI9A 3OOJA 1JFRA 4PSUA 4BU0A 4A15A 4Z4CA 4M1SA 4NOKA 4XX1A 1DLIA 2QSZA 1NDHA 4EOGA 4ZIRA 4NKRA 4PRLA 3OIWA 4TLMB 5CIWA 1W8IA 2DMRA 2Z58A 4HSEA 4RY2A 5K6AC 4BVBA 2YZGA 4FEGA 3U39A 4M87A 4YALA 3S29A 4KBYA 4XVQA 3SWWA 4E2ZA 4QDUA 1JJAA 3W5JA 3RJTA 4AJPA 2EKBA 4G5XA 5KYXA 4PWYA 1XQVA 2ZYTX 3KVRA 1NBMA 2P68A 1NVXQ 3PUXA 3DMHA 2DVMA 4MRRA 3ZBUA 4BGIA 4WBNA 2HEIA 2YYAA 3OQIA 4MB2A 4H17A 4ND7A 3FMGA 3RVMA 1K4KA 1NPDA 2A1UA 1NR5A 2ATVA 2HN9A 3A1DA 4QGAA 2C7GA 1SU4A 2YWEA 1BFUA 4TL6A 5DRYA 3TLZA 3KLPX 1YZGA 1M6HA 4M6WB 4CEHA 4W7HA 4C2UA 3LDUA 3KWMA 1VGVA 2FRDC 4MVCA 2P2SA 4O02B 3RUCA 2HDNB 2WF6A 4U8GA 3SFVA 3WDSA 4RL6A 4MYUA 2R86A 3DE7X 3ZQUA 3GJTA 4NZNA 4RA9B 4YMVA 5A62A 5BR8B 3MRSA 3HLKA 1VPWA 3AP2A 3CEPB 2NMVA 2WQ6A 2BDEA 1GN9A 1EWYA 3EZ6A 4O63O 3CZ4A 3BGOS 4JGGA 5A71A 5ABPA 2E4XA 1PP4A 4WEOA 1SZDA 3MWDB 3QOYA 1J2TA 3KOUA 4EM6A 5ELMA 5AVKA 1O5OA 4GXTA 4C7OA 4PSCA 3ZY2A 2WT8A 2ZWVA 3IQFA 2XH8A 4JEUA 2C7PA 2D7DA 1KO4A 2A5LA 3PUYA 5F98A 1QF7A 3IHLA 4KE8A 3W34A 4QJBA 3M0EA 1QVVA 2E5WA 1SXIA 4MWBA 1C2YA 1U0GA 3R3VA 5DFAA 3L2OB 3EY4A 4Z0PA 3R9KA 3C1TA 3OPMA 4Y18A 5DYYA 1XD2A 2V4UA 3B8HA 4EUSA 4BATA 4LI0A 3ZLVA 1YJAA 2D4HA 2NV6A 5HP4A 4LV8B 1HL7A 1SHTX 1H1LA 5ITVA 2IHYA 1FU8A 2HM7A 2OAGA 5E4YA 1C9KA 2Y1OA 3FFWA 1GUYA 2QIPA 4CQNA 1L2TA 4RMGA 5JUWA 1XMJA 1TU4A 2QKYA 3L8HA 1UKAA 2NPIA 1WLSA 1OCEA 2UYQA 3EZGA 3ZS9A 4DDHA 2BEUA 3HVJA 2YH2A 4DIOA 3HV2A 2X9NA 3FDFA 4Y9DA 5DCLA 4E4RA 3BE8A 3K9HA 2PWYA 3D1JA 4G1CA 2VXYA 4KOAA 2GCIA 5HUHA 2Z95A 5GZ3A 3FPFA 1JDBC 4F2DA 3EZ2A 2YY7A 4X8OA 3P2YA 1G5FA 3A1CA 3UWMA 2RCYA 2JLCA 2X3FA 4B87A 1M6WA 2QX4A 4IQFA 2DU8A 2AOWA 2XUHA 1O4WA 1PJQA 3U16A 2IU6A 1GGMA 1L4FA 2CLSA 2QD2A 3B2NA 4MV9A 3S8YA 3D3NA 2ZRIA 4F3CA 2BCGY 4HCJA 3RAFC 3CKLA 1SK9A 1VHTA 1XPUA 3OX3A 4HNVA 5CH3A 3DTNA 3CLTD 3VZRA 1P5ZB 4Z5XA 5KVSA 1LSSA 4J4HA 1K1EA 2PY6A 4OXNA 4RK1A 3RT9A 3MTBA 1BIFA 2NV2B 3PCTA 4C0AC 2ADFA 4JI8B 4TVSA 1ZUHA 2AVNA 2PZFA 4LJ9A 4E70A 1FP4B 3P4YA 3BTUA 3SIPA 1DQSA 1NQOA 1NJFA 2GCEA 3FCEA 3PFIA 2R7MA 5KOIA 2Q45A 2UYOA 2FQYA 2C92A 5DSZA 1L5FA 3KT3A 2GBCA 4NEHB 5HZGA 3OF2A 4BFWA 4D3XA 1H2WA 3OX4A 4UOQA 4JYCA 1GOTA 4PGAA 1WDKA 2V8BA 1S4MA 1EKXA 2AFIE 4O2LA 5JAQA 2EJBA 3KBOA 1WAMA 1PGPA 1DWPA 2BSAA 3UTDA 1D6NA 3EVAA 1E79A 1P3JA 1GRQA 2G0AA 4P93A 3GMTA 2QXTA 2W93A 1PGJA 1P2GA 5P8WA 3DLCA 1BE6A 4Y0VA 1H6CA 3OJ0A 3K70B 2BR5A 3VYRB 1KP9A 4J91A 5LR6A 2PVCA 3I4CA 1KK2A 4KRYA 2O50A 2CFSA 4BVLA 1RXSA 2ZS8A 3QU7A 1BH6A 4Q1CA 5CDFA 3N2KA 4CDGA 4B6FA 3OLWA 2NXEA 2OAEA 2H4YA 3IEKA 4PO8A 5G0UA 2Z6AA 4GKKB 5IRCD 3BQMB 4G0MA 4G4GA 1TGVA 4N5MA 4BLVA 3FJYA 3PR3A 1RACA 4C4SA 3BCHA 2CNKA 5G4KA 3IQWA 1LPAB 2CDAA 5JT1A 1Z75A 4J6FA 4NZPA 2JJ1D 2PRJA 3CR7A 2ZLBA 2XOKD 3J7TA 5LYYA 1UFQA 3W9YA 3I83A 1ODFA 1C0EA 3N86A 5LCXA 3GRZA 2VDJA 3R0IA 1HPLA 1MAWA 2J0UA 1L4KA 1ORDA 4ZYUA 5ALDA 5F9MA 1XDDA 2AOUA 4X62B 4LYHA 3LPMA 5ARCA 3OEWA 5AJHA 5JCZA 3KUDA 4YAWA 1UFKA 5BN5A 4FMBB 5E2BA 4IOKA 2NTYC 2CSXA 3EN0A 4ZVTA 2FF7A 5SYMA 1WUJS 2PJZA 3HKCB 4J0HA 4N9WA 4M0CA 3KUKA 4K6FA 3RVKA 1TD9A 2Y92A 1E2QA 1BKYA 3EJWA 3EX7C 3HEMA 5AVSA 4OP2A 1DIRA 3AVYA 3VYUB 3EGDA 3GCWA 3KZKA 3K1ZA 1UK8A 1O94C 3OUTA 4P1ZA 5CDTA 3I04M 5C5DA 1C7FA 3JYHA 2GLUA 1J07A 2VHJA 4O4JB 4EW1A 3VH4A 2C3MA 3HFJA 2ZYUX 3K0CA 3IPAA 4P92A 1M7GA 3PRYA 2FEXA 1XEXB 3SC6A 2K5UA 1O89A 2QPAA 3R5KA 1FDRA 4CM9D 1EVIA 1Y6QA 2ZBPA 4HAVA 3O5AA 1LLUA 1QGUB 1QKIA 2LV8A 3CPEA 5HE8A 1W0CA 2Y99A 3PHJA 4IFEA 1OW3B 2WSMA 1NAHA 1KFCB 1RWBA 2JEOA 2BFCA 1TO2E 1ZIDA 1UXIA 4CI0B 1ILWA 2WSYB 1RWMA 2BBTA 2DJIA 2BGJA 3D6HA 4ZQCB 3WGTA 1BDIA 1ETUA 2XCRB 3K70D 4QFMA 4YUVA 1D2MA 3UXEA 2D7CA 4CUJA 1Z8NA 3PUWA 2NX2A 4GLFA 1KGDA 1X77A 4L74A 3WGZA 4S04A 1JSZA 1K97A 1LFAA 1X87A 3KQHA 2EIXA 4DAEA 2ECPA 2IKSA 4O2BB 3IDAA 2AMVA 2PGDA 2D2FA 4H77A 4Q7LA 2XT9A 3QVVA 5EIOA 1RQGA 4H7JA 3DKKA 1BU8A 1WPQA 2X77A 2XGJA 2G1PA 3DVAB 1DRKA 3K6SB 1JFTA 3JY6A 1UQUA 1E4VA 1SEVA 3KJXA 3JQBA 4QICA 5IBCA 2F9FA 4UVIA 4U4AA 5KDDA 3S7ZA 4C87A 1U63A 3FPAA 3RC2A 4FGKA 3PNBA 1P5HA 3QKSB 1QORA 4KBFA 3SVLA 4DA9A 2OFFA 1VP9A 2YWCA 1ZD2P 4QD3A 3ENZA 4ECEA 1VDMA 1V7ZA 1AN9A 3S68A 5AHOA 5KNBA 1QP0A 2A5YB 3LKDA 4Z9AA 4CIAA 1C9MA 2VL7A 1YE5A 2XQIA 1T9CA 4HZUB 2JGDA 1HG0A 3EGCA 2XDYA 5F3WB 1DOZA 1KMCA 1ML3A 1BZYA 2R5WA 4ZI7A 2QAGC 4EUHA 1QHIA 4ZT4A 3OLVA 2RH8A 5K51A 1JJIA 1UPFA 1Y0BA 2VOJA 1G7SA 3CIOA 3OP1A 1B7GO 2XRFA 4KDEA 4MYRA 3S0JA 1SCNE 2ZPAA 3QM1A 4GE0A 3V7UA 3OHSX 1QFMA 4IMJB 1E7QA 3FTEA 3IA2A 4QFCA 2OCAA 3IBCA 3MJ4A 3Q15C 3KXPA 4P3OA 1WCIA 4EI8A 1QZXA 3OJXA 4K2AA 4NZZA 4EY5A 4G97A 3UJDA 1RRCA 1GZVA 2HXSA 1GL7A 1QH1B 2QXUA 3GLTA 3M3HA 2PGOA 1GZ7A 4AJKA 1H3NA 3R6TA 1JB1A 3NIDB 1CEYA 4X94A 1LDGA 5GV7A 1Z68A 2IYQA 3EVBA 5CG2A 1HNWB 3QJGA 5DCUA 5AOBA 2PV0A 2ZJ3A 4B6GA 4I55B 3D8UA 2JJ2A 3RRXA 2P3QA 2VRCD 2JLBA 2D06A 3L4EA 2FXIA 3DMDA 4U7GA 1W85B 2YJZA 2YV5A 1B0AA 4OF4A 5GAJA 2WINI 5M7EA 1YNOA 1VLVA 2Y76A 1NW6A 1IUNA 1JDNA 1UPCA 3GBPA 1YKFA 2GZHA 2UZ0A 4MPRA 1KSJA 3H9QA 3T7CA 1QYXA 1HORA 1O9BA 2L19A 4RTOA 4WCDA 4WKCA 3PQEA 1TPYA 5D51S 4ZCPA 2RK6A 3DNMA 1G41A 4FWIB 1XU9A 3FRJA 4IINA 4DAOA 3IP7A 1O0CA 2VN8A 2IP2A 2R00C 4C03A 4MVJF 1KYZA 2DE0X 2HHJA 3EQ7A 2ZYRA 4KR7A 3K2QA 3HSSA 4IOMA 2JLAA 2CVFA 4YMGA 2HPVA 4W5HA 3ZNOA 2AC2A 3RM3A 4Q0MA 1MB3A 1PFQA 1NUPA 3DF7A 4JUBA 2ZR0A 3L6DA 3FUXA 2F64A 4XUEA 3DDWA 3G49A 4F12A 1NP3A 1T6ZA 4PE5B 3TLYA 1QRRA 2Q3EA 2AD1A 4TMWA 1FBNA 4X6LA 1M2OA 5CXSA 3RVLA 1FDTA 2C2OA 3IP9A 1Y7HA 3CN7A 3WXBA 3OFND 4D8XA 1I7LA 3MJCA 4CKYA 3HEAA 4FYKA 1GHTA 2E18A 1CP3A 1AQNA 5EKTA 2PUGA 4PLTA 3R3SA 1ULTA 5DMHA 1KKMA 2HT1A 1MGPA 2O7QA 4IIYA 3CPSA 1WG8A 2CMGA 1PWYE 1VFPA 3E3OA 2D2VA 3FXAA 5HFNA 2ZRFA 3ANYB 3ZCTA 2XUIA 1MQ9A 2BEKA 4DJTA 1JEQB 1GXSB 4OFWA 2CUKA 1L8AA 1K5DA 1GNQA 4KLZA 4A8HA 2VPPA 1P2VA 5FO1A 4BP1A 3P0HA 3NONA 1N2CB 1WX1A 3EUEA 4C7MA 1OILA 4RE6A 3ANXA 3FCXA 5MFPA 1A95A 2CKMA 3I01M 3KQPA 5FWAA 1MJGA 3IT0A 1OPXA 1U02A 4WZ6A 1WY7A 5B6IA 1ETHA 1PD1A 2ZI7A 1Z0IA 3KKZA 4LNAA 3SMQA 1QYWA 4M88A 1N2SA 4QBIA 4ACAA 4HB4A 2JCVA 4XSGA 1NQXA 1U0OC 2BFAA 2X3YA 4ZU1X 1JF8A 4EABA 3C3CA 3BSFA 1IB0A 4AXXA 1Z0UA 3AM5A 3GRKA 5DTIA 5TJ9A 2FX2A 4E5DA 2CXPA 4CRWB 1B1AA 3T5MA 2C96A 2C8KA 3CSSA 5BXQC 1WB6A 3HE3A 3M6UA 4DM3A 4J0QA 3NHMA 3OVMA 3WC4A 3CO0S 4BNKA 2JAUA 3WGJA 3L8GA 1WMFA 4BV3A 3OLQA 2OXFA 1I5EA 1CVRA 1C8VB 1I8TA 2NTJA 2Q7XA 2WP0A 3I5YA 2VK2A 3LOQA 4JKYA 3C5HA 3IOYA 4R98A 5C80A 3E7DA 4P35A 3M7IA 2E5FA 5KQRA 4JYAB 2YOHA 1SVNA 1RRKA 4I8IA 4J07A 2JRCA 4XOUA 4X93A 3D0KA 2B98A 2W2VA 3MZ0A 3CG0A 3SFTA 2WB2A 4GL2A 2YOGA 4Q1AA 4BMVA 2YV3A 5H3HA 5EXTA 1VSBA 2R7KA 2CHEA 4I1PA 4QGFA 1OGJA 1O95A 3ZJ5A 3OM8A 1RYHA 4B84A 1OJ7A 4PGHA 3R5SA 5LYJF 1Z35A 1JR3A 2EX4A 1DG9A 3C43A 1G8AA 4RGYA 3TMAA 1NQWA 4BJ1A 1BYUA 3BWXA 3Q0TA 3WWEA 2P9GA 4C7JA 5D3MA 3N2YA 1UBEA 2VYND 2I65A 4G65A 3H8WA 4KH1A 4KN8A 4F04A 4Z1OA 2FG7C 2LPMA 1E3DA 1R00A 2F1HA 4O8CA 2CVQA 4DLPA 5K0GA 2DTEA 3GK3A 3HP4A 4U02A 2EGGA 2HA7A 4NYJQ 3SE0A 5ALIA 3AHFA 5ITWA 4WNAA 3WKCA 2OGSA 4JV5B 3SC2A 4J3NA 3IFSA 4NMMA 1HDZA 3B1ZA 4Z1MA 4DCPA 4YPOA 3GQBA 1KEEB 3TLEA 1XMXA 2QN8A 5AVOA 4OQXA 1FNMA 1DX6A 4LXIA 4EMUA 4FZRA 4EYSA 2HU7A 4QGSA 4EA7A 3ZOKA 3IQDB 5KJ1A 4NDZA 1PK7A 5B4UA 5ILOA 2RARA 2C94A 1ECJA 5J4YA 2Q0SA 3BZWA 5LB2A 4E14A 2FFHA 4CQJA 3AFIA 5C32A 4W1SA 1YU9A 3IPRA 3M9WA 1BEZA 4OUDA 3E9QA 2HCBA 2DKOA 2C42A 4LDNA 5CDGA 1BS9A 1IZZA 3UJ8A 3BXGA 2JB9A 1IXYA 1ZAYA 4X0EA 4EO7A 2DFDA 1ZRMA 1XRNA 3RVQA 2GBFA 3AHIA 1CX9B 1OGYA 5EKUA 1ZA2A 4EHHA 1VC2A 1CUFA 1RQ2A 2ZJ1A 3TRJA 4EYKA 1FVFA 3ZGLA 1ZBDA 1E6WA 3I6BA 5DV9A 4DPMA 4RTMA 2VP2A 1WQ1R 1SCQA 1X3LA 1H2RS 3JALB 2HUNA 2LVBA 1H9BA 1ZXXA 4IH4A 1I4TD 5TS3A 5CFPA 2HK9A 1L5WA 2FFJA 3CJRA 3Q5DA 4QBKA 1KK3A 4WDRA 4QJ3A 1ZKMA 1C0IA 1SZCA 2Z3WA 3ZE7A 3DTTA 1UQRA 2GEJA 1RLUA 2W6OA 2WJYA 3ADPA 2BFDA 3T99A 4B5KA 1U5BA 1M0SA 2XEXA 3G59A 4HADA 3ZX5A 3CLSD 2ZVPX 2O8EB 1DC8A 1RBQA 4TUYB 4J7XA 3ROMA 2VG8A 1USWA 2G72A 2HZBA 2QVBA 3CZQA 4H3VA 4QU9A 4BO1A 5KYGA 1GPWB 4QDZA 4K0RA 2G7ZA 3PFBA 1R0SA 1E7WA 2PKEA 3MB8A 2AMFA 5DX0A 1V35A 3R7LA 1ZA1A 4EPYA 3DE0X 2QQFA 5HR5A 4OD0A 1L5VA 1XCMA 2Q9CA 2JHGA 3JW8A 1T8UA 1VSQA 1FYXA 2OFXA 2IOYA 3PEUA 4DNPA 3H5TA 4B8ZA 3IMKA 3EBPA 2BP7B 2I6FA 4Y6GB 3W8FA 3L04A 2QDXA 2AUTA 4MPDA 3LGSA 1U3TA 2QK4A 5A6VA 1XL1A 3G2KA 2ZT6A 3QHPA 2VJCA 4RD3A 2GERA 5FADA 5K0LA 5JJBA 3IEMA 1FP2A 5BN3B 1EESA 3C85A 5IXSA 3PYMA 3NKVA 2VVTA 2WB4A 5EVCA 4JXKA 2HBRA 5EY5B 1P2BA 3WYNA 3QVGA 2VCEA 4XUGB 5DWQA 2VHVA 1GEGA 2F1RA 1ZHOA 4E88A 4OHPA 2HCFA 2JFHA 3FPJA 2GTIA 1NV9A 2BMFA 1R8SA 2X23A 2B4RO 3EVTA 4TSFA 2Z3ZA 5AW9A 4BUJA 4KREA 3C8DA 1KXJA 3GFQA 1F2DA 4HDMA 3MT7A 3K2BA 1WVIA 4ABTA 3ND8A 1B8UA 1BSVA 4XM1A 4GMGA 1V96A 5KYUA 5L45A 4KDCA 1XALA 4HQ0A 5GOTA 4Y98A 1UKVY 4EJSC 1JXOA 3KPVA 1L8QA 2P2ZA 4S0XA 2Y1LA 5J59A 1U8AA 1M1NB 3DOJA 4N6NA 4E4TA 3LP5A 4PAGA 1Y9EA 3WJ7A 3C74A 1QG6A 3E2IA 1FFWA 4FR0A 4NCKA 2DM6A 3FNRA 1OPRA 3QELA 4MQUA 4LOJA 3I0ZA 3PC7A 2HIMA 3D7NA 4IR7A 3Q3JB 5D2CA 3CGGA 2FHPA 1M67A 1S02A 3FHOA 3LCMA 4P32A 3R7NA 2NZ2A 1CZNA 3U4GA 2P11A 3VO1A 2OMKA 3QNUA 3QKRA 1WV0A 1SA0B 3LSYA 2FPLA 2WAXA 4ZVNA 3PXGA 4W99A 3IVCA 3T3DA 2QMYA 3ZWNA 2UU9B 3LQKA 1IAVA 2FWMX 2I2XB 3ZIUA 1I14A 5EHQA 2FFQA 3NBXX 5HKLA 1ECGA 2ACWA 2PQ6A 4C08A 4CBVA 2F8SA 4MS4A 1DEOA 2VHWA 3HB1A 2I87A 2IXEA 3I1IA 3MG9A 4I5EA 4P80A 5DXFA 2OXIA 1Z39A 5D3QA 4EB8A 2IH4A 1CYEA 3NV9A 2MSEB 2I78A 3SJCA 1TUBB 2JJMA 2R6ZA 2RHWA 2WD7A 4OFBA 3AI1A 5AHXA 4A8JA 3THXA 3HCCA 3WYBA 3R3ZA 2N0SA 5FUVA 3GJSA 1SCKA 1L5OA 3MD9A 2JFPA 4FZ3A 3C14C 2BUAA 4GOJA 3W3ZB 3QH4A 1DIBA 1I4LD 1Z88A 1VFNA 2VTVA 4IP0A 4RYDA 4MV4A 2NZ8A 4MV5A 5FI5A 3PD1A 1DTWA 1YVRA 4PM4A 1KI8A 3RS5A 1T6XA 2Y71A 2XT6A 1DMRA 1KP2A 2D0DA 3X1ZA 4AIIA 4D8UA 1UZNA 3HVRA 2POQX 4OU5A 1TYZA 1N2CE 1JAHA 2XMCA 4DWOA 1T3HA 2V1XA 4K87A 5CNIA 1LVGA 2KM1A 1BKDR 2PRKA 3S3TA 5KTKA 4QBGB 5J2UF 1G7TA 2AQKA 2B6HA 3RUAA 3PTAA 1F2TA 1AH2A 3C6YA 1BCSA 4ZMBA 4MVJA 5KOYA 3KAKA 1JXMA 3DMYA 1YAHA 1DINA 1C1XB 1H5NA 2M9MA 1N3BA 2OCDA 1R0ZA 1WHSA 3KAJA 2QX9A 4RD6A 4YRQA 1P9WA 2QE7D 4MS1B 2R8BA 3FE2A 3HP7A 2G0NA 1L5MA 4V0NA 5IUNC 2VWHA 1JHAA 2ADMA 3SM3A 4BTEA 3H6GA 1GRNA 4MUBA 1TTQB 3TB6A 4IIJF 1PCXA 3Q87B 3ZHSA 4QEKA 4CKEA 4F3NA 3ADOA 1PT7A 2QX8A 3U4MA 2CNDA 3N7AA 4MGZR 3B5EA 1OSNA 4J7CA 2C8JA 3WGQA 5BUSA 4UEJA 3NBMA 4QU8A 4F6RB 2O7VA 2WG1A 2IYSA 2GCGA 4KLCA 2IIVA 5I51A 2AC7A 3VNUA 4H0CA 3AR4A 1YDEA 4HB3A 2X1MA 1RQLA 2QF7A 4C3UA 4ZYYA 3NJ8A 4RSHA 4DCVA 2V5VA 3QVLA 3PFFA 1QOQB 3QOFA 1YVEI 4DCJA 5KMGB 4CEIA 1EGHA 4XJVA 4YXFA 1S89A 3E3NA 4H0NA 5KOJA 1O6CA 3TUIC 3OT5A 1CRZA 1UR5A 2XHZA 5HWSA 5JZVA 2CLMB 1M8FA 4M98A 4E5UA 2QD5A 1F7VA 1T8SA 4BKMA 3VYTB 5IG2A 3LBIA 2XOXA 2P5YA 4L85A 4NJMB 5CRIA 2Z56A 3P9SA 2FG6C 1DELA 4TS1A 1LS6A 4ZAXA 3RDPA 4KRFA 1A5ZA 1VE9A 3CEJA 2P65A 2IXBA 3AW9A 2CDBA 5HGJA 1F2VA 4WDQA 5JAUA 1HA3A 5EJ6A 5I7HA 3AGQA 2ZBGA 1EQAA 1PYGA 2Z5FA 5SY6A 3ANTA 3ITNA 4F71A 2ZBUA 2Q6IA 1Q0TA 3PR2B 2EAUA 1HZZA 4E2WA 2DFNA 3NETA 4P3XA 2IWHA 2B9VA 4ZRNA 1JIKA 1ACMA 3GEMA 1W7AA 3GHHA 1V37A 1QR2A 1TIPA 4QFBA 3O1JC 1JI0A 4U7FA 3AY0A 3LFUA 4HNAA 1HETA 4IXMA 2D5IA 3HBJA 1YULA 1H8HD 4E1BA 2I6UA 4NS4A 2WW8A 3EGXA 3NTLA 1F12A 4HNTA 2PIAA 4M53A 1HK7A 5EMMA 2C9OA 2ZB8A 3OE1A 3QVSA 3VV3A 3W8DA 1JE0A 4JDUA 5CD1A 3PQ3A 2P6OA 1RJ9B 2QHXA 2GPBA 4PLZA 2CEAA 1GGKA 1NJ8A 1UZLA 4PX2A 4R7TA 1WZNA 1TT7A 4RCVA 3L0IB 4TWAA 3A14A 3Q4GA 1V8FA 4ZTUB 1UQTA 3V1YA 4O25A 2ZW9A 3BZUA 4UJ5A 1WV1A 4CM3A 3GLIA 3JQFA 1UIRA 4HDQB 4LHEA 1WW3A 5ICSA 3QA3E 2IYXA 1ZR2A 4JC0A 5CYFA 4RA6A 4YJ2B 5LYJA 4UTRA 1LRJA 1JIJA 3CVOA 3KC2A 2J48A 2VBFA 1KEPA 1M3SA 4ZKEA 5BMVB 4MAAA 1PUIA 2HEGA 4HYTA 3G23A 4J2TA 5ALPA 1HE8B 1D2GA 3MCWA 3Q11A 4FDLA 4XFJA 3S55A 1NY5A 5GGXA 3ZI4A 4RXUA 3AETA 5FULA 3CNQS 1ANKA 2Q6LA 3IAHA 3LNCA 1HZJA 5TPWA 2GFHA 2OWDA 3RASA 4EL5A 1H2HA 5BVHA 1J1UA 4RMIA 2GPTA 1MO6A 1F8FA 2WOJA 5K3AA 4CT0A 4LE2A 1BHSA 4A3SA 4ZU6X 4EIWA 5IVKA 2BR3A 2I3AA 3PS9A 4INZA 1H2YA 2G9QA 3CBQA