1MT0A

Atp-binding domain of hemolysin b from escherichia coli
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
241
structure length
241
Chain Sequence
DITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHKELLSEPESLYSYLYQLQSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Hemolysin secretion ATP-binding protein
publication title Crystal structure of the nucleotide binding domain of the ABC-transporter hemolysin B: identification of a variable region within ABC helical domains
pubmed doi rcsb
source organism Escherichia coli
total genus 73
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2002-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1mt0A00
2EQBA 3OEED 3FYHA 2HDNB 5M04A 4XH9B 5SZKB 4JLOA 1W0KD 4JLJA 4L9SA 3U44B 2J87A 4NYJQ 3LA6A 4TT3D 2NG1A 4OQLA 1CRPA 3L43A 4LPKA 5E7IA 2IXEA 2X19A 1XTSA 5IHPA 2VTKA 2YZ2A 2EVWX 2B21A 2IEYA 1RJ9B 2I3BA 4H1VA 5HCIA 2G0TA 2F55A 4G5GA 1QG4A 3ZDQA 3B1ZA 3CH5A 4M9QA 3OFNA 3I1FA 2V4ZA 2G3YA 3GEIA 1IJFA 4HAYA 5CDFE 2L0XA 4IDHA 1CLUA 4DCNA 3THYA 2P65A 3C14C 5D3QA 1DPFA 2CCJA 3ZZUA 1XMSA 4C7OB 3QPUA 4AURA 2WWHA 4XSGA 3SDZA 3X1DA 3TUJC 4Q47A 5L3RA 4FI3C 4NP6A 4Q9LA 1UEIA 2BMEA 1U94A 4JLKA 4EPVA 1S2MA 2V55B 2QMHA 2OBMA 4OKSA 4AG6A 3K70C 4FWTA 3T35A 2IS6A 5G53C 5L3VA 1FUUA 3UWKA 5LDDC 4BRUA 2NPFA 2F3TA 4E5UA 3PEVA 2HLDD 3CH4B 2VHQA 4KAXA 2GAOA 1CJVC 4LCBA 2WKPA 5J4KA 1E9RA 1L7VC 2BMFA 3FKQA 3L2OB 2H17A 3LQQA 3PEYA 3RANA 1G8PA 2VP5A 2P6NA 3LH5A 1DAFA 1E0AA 3PFIA 2CJWB 2ZI5A 3TBKA 1W5SA 3HYRA 1Z22A 1M6NA 1GIAA 1II0A 4DLRA 5DIFA 2Q21A 4QXAA 3B9QA 2ZAOA 4JYCA 2QBYB 3I8XA 4X8OA 1WMSA 1P75A 4IXMA 1TMKA 2AD1A 3T5DA 1Z6TA 1VG8A 5FTLA 3WNBA 3KQKA 4MGKR 2ZS7A 1DO0A 5H8WA 3U3KA 1T0HB 4P4SA 3SHFA 1AN0A 1TL7C 3K9NA 1JALA 1KI6B 1SQ5A 5B2ZA 4L5BA 4MRPA 2CXXA 3QF4B 4A6XA 3WHKA 3B5JA 3TGPA 5L3SB 1CIPA 2MSEB 2J3EA 2Z5FA 1DAGA 3QKSA 1QHSA 1P2SA 1QG2A 4UNSA 4Q7KA 5AJVB 1UAAA 3BXZA 3WNDA 1Y3AA 2YWHA 5DH9A 3L0SA 2UZ3A 1ELOA 3LRPA 1GOTA 3A4MA 3ADCA 4P33A 4IXNA 3RABA 3MSXA 2ZJ5A 2RGNA 2WIAA 3ZZ0A 2WJGA 1LVGA 4NU0A 1S3SA 3FPAA 1XF9A 4NYMQ 4Q1AA 2GF0A 5EXTA 1T3LA 2IUUA 5BN4A 5JFGA 4X8HA 1IXSB 3AF2A 2X2FA 3OEEA 4KODA 5BYJA 1W36B 2Q9AA 3GLHA 1KKLA 2AD5A 2O0HA 4LJ5A 2R65A 1N0UA 3V00A 1W0KA 1D5CA 4TTRA 1LW7A 4N0EA 2CDNA 4JL8A 2UKDA 4TT3A 1PUIA 3C15C 1II9A 4Q4AA 4TLDA 1OT3A 3KFXA 4B6EA 2WV9A 2XXAA 3VR6A 4C9BA 1N6NA 3P4YA 5LD2B 1VHLA 4QGHA 4RFSB 2LKCA 4US1R 3PQCA 5JI3E 3UG7A 2YV5A 2NIPA 1MO3A 2IBMA 2OCBA 5JBQA 3RYTC 1IOZA 2NO1A 3MWYW 2JATA 4ABYA 1JJ7A 3NHBA 1PJRA 3I8SA 4X8MA 1UDWA 3QXJA 4JMPA 5EQTA 2J7KA 4JKIA 3TSOA 5CJPA 2JLSA 3SFVA 1TQ6A 4F93B 2ZM5A 2RGEA 3O47A 5E7MA 2AKAB 3AF3A 1Q57A 2VRWA 1RYHA 4JVMA 1TNDA 1W4CA 3RS7A 4QM6A 4EPRA 4Q9KA 4GI7A 4TL7A 2DFTA 4A6PA 2QSZA 2J0UB 2HLDA 1OFTA 1S1MA 5L3QA 3A1VA 3PIRA 2P3SA 1M7BA 3BORA 3H86A 4E09A 3R8FA 2HYDA 2OV2A 2OLKA 3L0IB 4BWYA 3P27A 3KQNA 1W47A 2WMNB 3N5CA 1M1YE 2CHVA 4C4PA 4CW7A 4DSTA 3FWYA 5LPNA 3GJ4A 1BS1A 5JWRA 1VG0B 1RW4A 5BYKA 1W2GA 3PXGA 3BBPA 3GJ8A 2DHRA 3AVTA 5KNBA 2QTHA 5JCPA 3N2EA 5J5CA 2W0SA 2BIFA 2GZAA 1E2KA 2GEDA 2QEQA 4GPTA 4HAVA 4NYJR 3NVAA 4LSGA 4XOIA 5EZ6B 3T5GA 2ZR9A 1Z8FA 1H8ED 2RGBA 4I81A 4EJSC 5EE5B 1C4OA 3OIWA 4OHYA 1FUKA 4LK2A 2GCPA 4LJ6A 2CK3D 2AK3A 4XIGS 5FOWA 1ESNA 5B30A 2GEVA 4URZR 2EYUA 5JHGB 4TLCA 2TMKA 2XEXA 2PT7A 1W44A 1D8TA 1AM4D 4A0RA 3ONWA 4QG7A 1W1WA 3ICQB 1LB1B 3ZGXA 4TMVA 5HTKA 1NP6A 2RMKA 2J5XA 4TYYA 4B3FX 4Q1CA 1ONBA 2PJRA 2AR7A 4YONB 1HEIA 1NN1A 2PCLA 4Q5IA 2BV3A 2ZRAA 1KO7A 2FEMA 4BECA 3W5JA 2FSGA 5BN5A 4BUJA 2A3RA 2WIBA 2WOJA 3HWSA 4LHVA 1KZGB 2OESA 2QRZA 2VEDA 4Z54A 1DADA 3ZZTA 4Q00A 4QM7A 2YVUA 4B2PA 3DM9B 3QXCA 5KDLA 3NHAA 4KFTA 5EJEA 3L0PA 1SXJC 3W5IA 1A4RA 5DGXA 5HR5A 1M7HA 4FMDB 1E96A 1HQYE 1XMJA 4IOLA 1DO2A 4KYIB 1QF9A 5GJWC 2MMCA 1J70A 5FTJA 2QMEA 2CVHA 1QHHA 2GJAA 4Q19A 4TLAA 1K8RA 1GG2A 4IVPA 2PX3A 3QKRA 2BC9A 3HDTA 1CBUA 4JL6A 3DVLA 4O2LA 4BFZA 1TQDA 1WF3A 2YOHA 3QENA 3KQUA 2Z43A 2R6GA 4K8OA 2QAGB 2G83A 3T1VA 2W6ID 2GESA 2VYFA 1ZD1A 4KVGA 2VHTA 4IVQA 2WJYA 4YDSA 1RC8A 2EFCB 4GDFA 1DVRA 1Q12A 4XD7A 4UNQA 4V03A 3CWZA 1N6LA 4G5RA 2IYQA 2WICA 2VF8A 1XDBA 1NBMD 5FBRB 3GFPA 1P72A 2VHUA 2WJJA 3W3ZB 3SBDA 4C2TA 2ZRKA 4QHYA 2CBZA 2ZYWX 2ZSDA 4HEJA 1IY1A 1BYUA 2OHFA 4NCKA 2IT1A 5F2EA 1GTVA 1KI4A 4XWOA 1E94E 2Q3HA 5FTKA 1G8FA 1EGAA 5FH9A 4L9WA 1J8MF 2IHYA 1Q20A 2G1KA 4PAMA 3DHWC 1VPLA 5HZKA 3OE7A 3U4QB 1XMVA 3Q3JB 1Z6AA 4BFSA 2HV8A 2WJVA 2DBYA 4HLCA 3QPWA 4C0SA 1OXXK 4NYMR 3AEZA 3IGFA 4M2LA 3NIBA 5DNYB 1Z83A 1ZC3A 4F4IA 5CLQA 521PA 1EFTA 3GLIE 3WYFA 3EZ9A 2DWQA 3QY0A 2F1JA 3CIOA 4A8JB 1N5LA 1HA3A 4YLGA 4KCGA 3NBYC 2I4IA 3W6PA 4DEYA 3KFVA 3IO5A 4A92A 5CB8A 1OH8A 3QXHA 3KKMA 1H8EA 1Z6YA 2J0QA 1L4YA 4MQBA 3ZLJA 3TH5A 4RZUA 3OIYA 4M1SA 3LQRA 4PPNA 3KKPA 4HAZA 2IXFA 1KI3A 2CK3A 4MUAA 1E9BA 3UMFA 1T91A 2GILA 1TF5A 3KX2A 5HE8A 4KFUA 5TY0A 1Z0IA 1TU4A 2F43B 2P0EA 3ZVLA 1QHGA 3NG1A 3E1SA 4CT4B 4ZCLA 1F2UA 3QKTA 3UWOA 4A15A 1CR0A 4TLBA 2ORIA 4CZ2A 3F8TA 3T12A 1TEXA 3K0FB 2BJWA 3OEHD 1GRRA 1X8LA 1E2GA 1G7SA 2H5EA 3B6EA 4JBWA 4Q1DA 5EXSA 1GNQA 1YU9A 1YZNA 2NO7A 2FG5A 1GM5A 2ZI7A 2GF9A 4RD2A 3VNUA 1QHNA 4QJ3A 5JRZA 1LNZA 2AN9A 4V0LA 3WY9A 2CLDX 1JPJA 1EX7A 3LY5A 5DI3B 1N6KA 2VP6A 5J47A 1U0LA 1E4YA 3KXKA 2RGGA 2H1LA 4PC3A 1X8KA 4ZDKA 1BYIA 5HZHA 1FW6A 4HAXA 3AVPA 1G8YA 1KY2A 2PL3A 4Q7MB 1Q1BA 3HR8A 2ZRNA 1VKJA 2KWIA 3RLFA 3WMGA 1CJKC 1T4GA 3PG5A 3QF7A 2O8FA 5FOSA 2PCJA 4N1AA 1KMHA 1U9IC 1HURA 2VSFA 4Q4HB 1RFLA 4PHTA 2GKSA 4CEIA 1NIPA 5FBVB 4JLPA 3RWMB 3AQ4A 3AUYA 2OEPA 1G64A 5KDDA 4BLSA 3QXXA 1OV4A 2D4HA 3EARA 4HZUA 2W6IA 2ZJYA 2PLFA 3TQCA 4BLTA 3CRW1 2VO1A 1G7CA 1XCPA 3J81k 3K0EA 2GBLC 3NEYA 1L4UA 5B58C 3K1JA 4I4LA 2A9KA 2QPOA 1NBMA 8OHMA 4R9UC 1JB1A 3CNNA 3ADBA 2QTVB 4ZV4A 4XTRA 2IK8A 1FNNA 1CS4C 1OFIA 1UKYA 3ZVMA 4FWIB 5J4HA 4C3ZA 2IHBA 5AWFC 2FSHA 1CTQA 1W36D 3IEVA 3IKJA 3SC3A 3UPUA 1LS1A 2GTPA 4QL3A 4Y0AA 3BB3A 3DZDA 2G1JA 3U44A 1SVMA 3A4LA 2FDCA 4P3YA 4XVQA 1ZINA 3W3AA 2GRJA 3B7GA 3KKNA 1E9CA 4PSKA 1Q1EA 4QFMA 4DUGD 1DARA 1ZUHA 1KK2A 1B0UA 3LXXA 3FHTA 4URYR 1R0YA 1RJ9A 1UM8A 2ONKA 4D80A 2WWYA 3NDBB 2REBA 1ZM9A 2H8KA 3HJNA 4C0HA 1EX6A 2KBFA 1E4VA 2QU8A 4PO8A 1DAHA 4R7ZA 221PA 1Q22A 2WJHA 4WZAE 3I4LA 3IBYA 3GLGE 1S3GA 1FMJA 1I4LD 4L8GA 4QC2A 4JLVA 4QJ5A 1NVVR 4MITA 2BCJQ 4D0GA 4LUCA 4W9MC 2C9YA 2BBTA 2X77A 1NI3A 1O87A 3HU1A 4A9AA 1KAOA 4EDHA 3DOFA 1EXMA 3FMOB 1COWD 1RRGA 3P26A 2KSQA 2V7QD 4XTCS 3X1WA 1N3BA 2VQSA 1IJEA 4JBXA 2ZJBA 4XWKA 3GLFB 4XWAA 2BKUA 2IYZA 2VP2A 3K0AB 1JPNA 1FP6A 2RGXA 5TV2A 3QI2A 4NHOA 4ERNA 4JVLA 3OEHA 3HP1A 4IDQA 1I2MA 3WRYC 3GLGB 2VSOA 3RHFA 5FR2A 1CULC 1U8YA 2QT1A 4B76A 1ZCAA 2RH5A 4JT2A 2GCNA 1JECA 2QNRA 4MRSA 2CJWA 2FEOA 2O52A 1I4DD 2C95A 5BN3A 1SKYE 1UKEA 2PZGA 4NCIA 4JL5A 1G5PA 3UMRA 3UATA 2QL6A 2ZS8A 1XFAA 1E9DA 2QBYA 1SZPA 2IEZA 2OSBA 1NSTA 4MGZR 4W7SA 5J4VA 1JEEA 2F9MA 3DO6A 2ODEA 3AKEA 2F1RA 2R6DA 1Z2AA 1ZCBA 1RPZA 2XTZA 4Q03A 4BLRA 4QGAA 2R9VA 2ZRCA 1ODFA 1XCGB 1U98A 2FZ4A 3RC3A 5AR1A 1E2DA 1KI6A 1CEEA 3BC1A 4UXJA 3GFTA 3F5FA 2ZRMA 3RDPA 3EG5A 3ZVNA 1IN4A 3QF4A 3CO5A 3FVQA 4NE2A 2GDJA 4Q7JB 1ZC4A 3CRQA 2WKRA 5L3SA 4PTLA 1ETUA 1NVUQ 2XZOA 4URWR 3RVBA 2HT6A 1OFUX 4LZZA 5A5GA 4UJ5A 3AF0A 3NH9A 5JWHA 3IIJA 4KFRA 3RRMA 4NL4H 4B43A 3TLXA 1MRSA 4DLSA 2A5GA 4RCYA 1OHHD 2GJSA 4TN1A 1HUQA 4TWZA 2NO9A 3RS5A 1OPXA 2FX3A 4KHZA 2C5LA 4FXPA 1TEVA 1YR8A 2GZHA 1NBME 1QHYA 2XTNA 3TRFA 1XTJA 4D4MA 4IKEA 3W90A 3CUEF 2BEJA 4OQNA 1P9RA 1ZYUA 3IPXA 4CEHB 3EZ2A 4Q4JB 1ZNWA 2ZJ8A 4DB2A 3QQ5A 2R2AA 2ZRDA 3L8ZA 3AB3A 5H70A 5A0FA 4BLOA 4TZ6A 3EA5A 1Z0FA 4ILEA 1AKEA 5SZHB 3S1AB 4TMKA 1NNEA 4PHFA 3CRVA 1NLZA 2OUKA 3NBFA 3DMNA 1R0XA 4US2R 3P4XA 2FJUA 4NDZA 3WYGA 3QJYA 1UDXA 3U7HB 3DDCA 4GZLA 1E1QD 3EZFA 2G88A 1UJ2A 2XITA 4PSAA 4DUGA 4YXWD 4NZYA 3K70B 1OIXA 3QKUA 2FGKA 1ZD9A 3VNVA 1F5NA 4LJ7A 4RFSA 5AUNB 2ZE8A 2JLUA 1E3MA 3Q85A 1KI8A 4IEIA 1RRCA 1Z47A 2OBNA 5EE9A 3VTKA 4IDPA 2HYIC 4NCNA 1G17A 1MOZA 1N6PA 4EFMA 5AJYA 1N6IA 2SHKA 4HDOB 3KDSE 2ZR7A 1EK0A 3QEOA 4UNNA 3DZ8A 5EUQB 5AUOB 1S96A 4AKHA 1E9SA 3SJZA 1TUIA 2HXSA 3FKSD 2AX4A 1KKMA 1E2EA 4G5QA 1OH5A 4BRWA 3PITA 3CRRA 1IONA 2W83A 2GXSA 5C4MA 1COWA 3CNOA 2ZAMA 5ANRB 2D7CA 3E2IA 2JJ8A 1YJ5A 2OO7A 1UBEA 2WAYA 1XNJA 2J0UA 2JJ2D 2IYLD 1E69A 3H1TA 5KYKA 3GP8A 2AHOA 1E2NA 2KBEA 4GOXA 2A7QA 2XGJA 5EZ5A 5TVKA 2P6RA 3DMDA 1UBCA 1KK0A 2ZE7A 4Q18A 1T6NA 3MRSA 3VMFA 1D2MA 3MD0A 4BE7B 2OZEA 2C9CA 1OKKD 3QEJA 1KI1A 4RD0A 4LOAA 4QGGA 3VKHA 2HF9A 2IUSA 2IYWA 4WXRA 2ZPTX 1US8B 3DOEA 3T06B 2QG6A 3VX3A 1R4AA 2BEKA 3GQBA 4LJ8A 2QI9C 2FSFA 1NMZA 2W58A 5DISB 5KU1A 4BLQA 5KNDA 1NF3A 1YZUA 5E7JA 4AKEA 1U0JA 2ORWA 2J59A 1N6OA 1HYQA 2FA9A 4CVNA 1A5TA 1IBRA 2GEUA 2QORA 3VQTA 4DHEA 1KY3A 3PUVA 2CL0X 1UBGA 3KXLA 1SKQA 2OILA 3RNLA 1Z63A 4QGFA 5FPHA 2P67A 2WWFA 1P2UA 2Z6VA 5FUYA 4H1UA 3X1XA 3IUYA 4EPWA 5B64A 3K0SA 3AVYA 1VCNA 2ZSFA 2JDID 1TF2A 1YE8A 2IF2A 3GJ6A 1XZQA 1OHHA 5H1YA 3LNCA 4ARZB 1VCIA 4QBHA 3AVOA 3SQWA 1RYFA 4HAWA 4BZXA 4Z1MD 4RD4A 2O8CB 4LI0A 1P3JA 3KZ1E 1XWIA 1YZGA 3MLEA 4M1OA 3T1OA 4DB4A 3U6KA 3T61A 1NVWQ 1XXHB 1OXVA 1FNMA 2GXUA 3Q7PA 3THXB 1KDPA 5CIQA 2VHJA 2CCKA 4BEBA 4Q1EA 1G16A 5J40A 2PT5A 4HUQB 4QBGB 3EZ7A 4YMUA 1XEXB 1CJMA 2CVFA 1E1QA 4G0NA 5EP4A 1F6BA 4L15A 1EFRD 4M4SA 3B2EA 4YXWA 1S4QA 1X6VA 4C2UA 5IF9A 4J0QA 4DCVA 1ZMXA 3TR0A 4LYAA 3AVUA 2VSXA 4P0TA 2QAGA 1CU1A 4TMXA 2ZUCA 4M22A 3MG9A 1X1RA 2UZIR 4OHXA 4AKIA 3LX5A 4GNKA 4TMWA 3GJXC 3K0CA 4GZMA 1XX6A 3TE6A 3ETLA 1MH1A 3FKSA 5EP3A 4BFVA 4OK5A 4TQ9A 1T3HA 1XZPA 4MRNA 5JEDA 3AVXA 2FE4A 4RKFA 2ZXUA 2WSSD 2Q3FA 3JVVA 3CB4A 4JKYA 5F9HA 4M9XA 4KBGA 4F38A 5JJLA 1J8YF 2ERXA 2HEIA 5DYIA 2JJ2A 3IIKA 5CYOA 4EJSB 5BW8A 4HLUC 3K9GA 2W2TA 1ZU5A 1JR3D 4KYUA 4MUBA 2GAAA 1GVNB 3GCGA 2FZLA 5TARA 4B33A 4YQFA 1LTQA 4TQAA 3AH8A 3NTUA 4ZCIA 3U4QA 1NRJB 4B3BA 1K6MA 1KJWA 5GJCA 1F2TB 2ERYA 4JVNA 2Q6TA 3KB1A 3SYNA 821PA 2ZRBA 3BK7A 4MKGA 2B7CA 1YRBA 5K8IA 1MT0A 2NOAA 3KB2A 5LB4A 1EG7A 2GVZC 3UMSA 1E2LA 3FMIA 2MSCB 1XEWX 4D25A 2NPIA 1VYVA 2ONJA 1SULA 2VL7A 4HLQB 4PO1A 4A8JA 4OHVA 5IK2D 1G9XA 1VG1A 2ZUDA 2AKYA 2HCBA 5KOYA 2WHXA 1BKDR 2FNAA 3KKOA 2ODNA 1TU3A 1KO1A 3V9PA 4ZIRB 4FMBB 2G9NA 1W4AA 2IA5A 1GUAA 4ITRC 3WNCA 2RGCA 1PLLA 2RKOA 4CT5A 3AM1A 2MSDB 1KK1A 1VYTA 1ZNZA 3I3SR 1A7JA 3O8BA 1GRNA 3GLIA 1SXJB 2F43A 3MWLA 4TTPA 3BOSA 4GFDA 3LX8A 1LS6A 2JDIA 5P21A 2JLRA 2ZETA 4MRRA 3H0KA 3A58B 4JSYA 1S1CA 2JLVA 3THYB 4DSOA 2ZSAA 3BH0A 3D8BA 4HDQB 2A30A 3SJAA 4WW0A 1ZD8A 3MCAA 1KI9A 4Z1MA 2WWWA 2B8TA 1Q3HA 4RJLA 3EC1A 4CYMA 4Q7LA 3I62A 4FD2A 3LAWA 3RS3A 5DI3A 4TMZA 2OXCA 1YZKA 5E3HA 3ICEA 3MMPA 4DRZA 1NJGA 5DO9A 1XD9A 2G6BA 2CLCX 1KSHA 4Q9HA 2PLRA 1G3UA 1M74A 2NQ2C 2DR3A 3NWJA 4DLUA 4PPGA 4OBEA 1KAGA 4OQXA 4TYPA 3U3JA 4LPSA 2GETA 5SZJA 3SFZA 2JIZD 3KJEA 2VP9A 3U7GA 3A4NA 3KXIA 4I1SA 4DLWA 2CEAA 1B23P 2KB0A 4Q4HA 4IOKA 2OBLA 1W7AA 1FQKA 1KHTA 1DE0A 2CE2X 3IBGA 4KVAA 4OJKA 2GXQA 3RRYA 3ZH9B 5FUVA 5KUTA 1PZNA 2PZEA 1MABB 3W6NA 4NKRA 1F48A 5G41A 4QNRA 4WOPA 1Q0UA 3NBZC 3JZMA 4HDCA 5KNCA 2N1BA 1MO5A 5FOTA 4LBVA 1PLKA 4KBFA 2ZRFA 4C0QC 5G3YA 1AZSC 5K8LA 1KYIA 1FZQA 2VP0A 3NH6A 2R6AA 4HB0A 4KI0A 3A1SA 3THOA 1NVVQ 1W46A 1R2QA 2VPPA 1LF0A 1YR6A 4DXAA 1IXRC 2O0KA 2GJ8A 4PC6A 4EQ6B 1VYUA 1XEFA 3KQHA 4M1WA 1ZAKA 1OJLA 4TL8A 4YMVA 2WSSA 4TYWA 4Q9JA 1FL9A 2J41A 2B6HA 5AJZA 4DIDA 5IRCD 1G41A 2H57A 2WZQA 4W5HA 5JS7A 1KI2A 2FN4A 4JZKA 1YHNA 4YMTA 5FPSA 1GDDA 1FP7A 5DHAA 4B32A 3BERA 3M1IA 1YR9A 4LHWA 3UXMA 5J4LA 2QGZA 3O8DA 2JGNA 4B47A 5KPJA 3K70D 2ZRIA 4IW3B 2BBOA 3AVWA 1QVRA 2BBSA 2O8BB 2REXB 2ZRJA 4BEJA 1OYYA 1Z0JA 3OF5A 3BD9A 2F3RA 4LV5B 2X2EA 3C7KA 5BWMA 4TL9A 3QNUA 4OL0A 2JLWA 4M21A 4M0LA 1CJTC 2FFAA 1BOFA 2GJKA 5IK2A 3OESA 2QROA 3FMFA 3TVDA 2VLIA 1MO6A 4DDUA 1R0ZA 1RKBA 3A8TA 2G0NA 4WVFA 1CJUC 3QIAA 4OQFA 1K5DA 4Z8YA 1Q3TA 1IN7A 3SU8A 1EWQA 2XSZD 2R8RA 2X8AA 4F91B 2FFBA 4R2IA 4ZI2A 4DLVA 1P5ZB 3QG5A 4DLXA 1CP2A 4D4JA 4DDTA 1VHTA 4MDFA 5KO2A 4DSNA 4M8NE 1JJVA 2F9LA 5E95A 4YDHB 1R6BX 3GLFA 2QT0A 3ADKA 3K0AA 2GA8A 3L0OA 2EW1A 2AL7A 1AGRA 1P9NA 3GLGA 4HAUA 4LX0A 1J90A 2YHSA 1XB2A 4ZI3A 4V0MA 3VX4A 2XNSA 5EP2A 1FX0A 5FFMA 2DB3A 5TXGA 4DLZA 2GZDA 2RGNC 1JAHA 4A1FA 4PSVA 2IYVA 3NC0C 4ZPXA 4DT1B 4BPBA 4DC9A 1OIWA 3VR4A 3PVSA 3SE0A 3A1TA 3TK1A 3C16C 1KSJA 3BB4A 3UKDA 2QAGC 4C0LA 1JQLB 4B3CA 2QE7D 5UKDA 2ZI4A 2IYXA 3B13B 2WTUA 1IN8A 1AK2A 1IN6A 2ANCA 3BS4A 4MA4A 3WBJA 2JLZA 1XCMA 2YNMA 3K0CC 3U3RA 4ASUD 4Q9IA 2C78A 1E2FA 3CWQA 3R9WA 2IWHA 3BJIC 4B44A 3SJCA 3AF4A 2FPMA 2OAQ1 4G5OA 1WBBA 2BHRA 3VU9B 3LD9A 2ZRHA 3LO5A 1TQ2A 1Z2CA 3LV8A 4PXAA 1E1RD 1G20E 3RAPR 1E2IA 1X3SA 2R6FA 4KFSA 4DDWA 2V3CC 1VCOA 1Z6GA 1GITA 2NZ8A 4RKEA 621PA 2XNDD 3A36A 2C2HA 3TUIC 2IX3A 4JSTA 4AKGA 1Q1ZA 4PQFA 1Z06A 2AWOA 1W4RA 2Q0HA 2XX3A 4DCSA 1JQJC 2AXNA 1XTKA 1S9DA 1G6OA 3BFKA 4FCVA 4Q4JA 4OK3A 1I4TD 1UF9A 2B7BA 4BQSA 4IEEA 1T5IA 3EASA 3RRNA 3SYKA 4W5WA 5AJWA 3JZAA 4OI0A 1NVXQ 2F6RA 2GK6A 2Z0MA 4PC1A 3S1AA 4Z8XA 1D2NA 1QVAA 2ZI6A 3CR8A 1KJYA 2OM2A 1JR3E 3BIFA 1FFHA 2I1VB 4TLEA 4R98A 3W34A 4AWXA 3B1VA 1QDEA 4EUNA 5GADl 4Y0VA 4UNRA 1XPUA 3FB4A 1WQ1R 5CJ2A 3IO3A 4AY2A 3PR1A 3FMPB 2D7DA 3WMEA 1RE0A 4Q48A 2EYQA 1E2HA 1ZM2A 3M6AA 1N6HA 2J45A 5TDHA 1NY5A 1AA9A 5FBLB 2CL6X 4A2QA 4CF7A 3SS8A 4JBYA 3K8YA 2ZE6A 1G8GA 2P2LA 5FR1A 3C4JA 3MJRA 3BAFA 4DCTA 1E32A 5FOVA 4ZKEA 1HTWA 1IQPA 2C77A 4D2IA 2RB4A 2PZFA 3QKRB 4KXFB 3VKGA 4PO9A 1JI0A 2XSZA 2YWFA 3U61B 1E2QA 3IDQA 1WXQA 4CIDA 4QKQA 1G291 4Q21A 3TKLA 5EP1A 3ADDA 3U60B 3MWKA 3GLFE 2YWEA 5H68A 3NDPA 4HLDA 2EWWA 4NCJA 3Q5DA 3QVUA 4U7DA 1VIAA 5HKKD 1U81A 3BB1A 1FPMA 3UG6A 3KJIA 1GL7A 3U6BA 1UBFA 3G5UA 1SVKA 2ZQ5A 4LY6A 1JXOA 4V02A 4V0ME 3IQXA 1VCMA 3MGCA 3VHLB 4O3MA 4C7OA 1GNPA 1AGPA 2IS1A 1J99A 4WA7A 1H8HD 1ZVQA 3L8YA 1WE2A 3CF2A 3AKDA 4PC2A 4XVRA 3U7FB 1U8AA 1U2RA 2WKQA 4P31A 4Q01A 5DYGA 4GMDA 1NMYA 1JAIA 1OH6A 1P2VA 3QE0A 2V9PA 4CDGA 1WB9A 2ZI9A 3EAQA 2QE7A 3LVRE 5DLQC 4MKHA 5BQ5A 4OYHA 3HPRA 5KSOA 3C8UA 4R71A 1WP9A 1N6RA 1GL9B 2BWJA 5JI2E 1MO4A 1HV8A 4PX9A 1G8HA 2A78A 1HT1E 4ASUA 4E22A 1G7RA 4PZZA 2P5TB 3GFOA 1KDOA 2GCOB 4TMTA 1SXJD 1MV5A 2VBCA 3FFAA 3OIUA 4G5SA 2OCYC 1F3OA 3THWB 1KDRA 1NMXA 1IM2A 4BASA 4D0NA 2AFHE 1E1RA 1TPZA 4UKDA 1AS2A 3EWSA 4U02A 3ZS9A 2ZEJA 3HYTA 4LYHA 4LJ9A 4O0MA 4ARZA 3N2IA 4LGMA 1R5NA 1T5LA 3IQWA 5CITA 2D06A 4RSGA 4ACAA 2XNDA 2O8CA 4IVRA 4JLAA 3EPJA 3K09A 1KTVA 2DWOA 1XTQA 3U3OA 2GHIA 2JA1A 3B82A 1GRQA 2ZANA 3IIMA 1LY1A 4HB3A 4TTQA 1XXHA 4Q02A 2AK2A 3THXA 5SZIA 5CB6A 1ZNXA 3SJBA 3BWDD 2G77B 3CX7A 3R7WB 5D3MB 4HYYA 4EKDA 4HUQA 1N5KA 2QP4A 2Z4RA 3ASZA 2J0VA 1A1VA 4PPQA 1XEXA 1G21E 2JLQA 4II7A 4WZBE 721PA 3U2QA 1FTSA 3IHLA 4DZZA 4QOSA 3TR5A 4B3DA 1HQCA 1NSFA 1M34E 3B60A 2EU8A 2GVDC 4HSEA 4C0KA 2V1UA 1TAGA 1AIPA 2H18A 1IAQA 4MYCA 1E0SA 1FMLA 2QPTA 1D6JA 3LBNA 3T1TA 2ZU0C 2CCGA 1W48A 4EAQA 2GNOA 2WJIA 2AXPA 4URXR 1AKYA 4M9ZA 3A37A 4FMCB 5E4FA 2BM1A 2CNWD 1F60A 4F92B 4MKFA 2BOVA 4LC1A 2KE5A 1T0JB 4MYUA 2WMOB 4KJZA 2OCPA 4US0R 4YMSA 2CE7A 1T8UA 1HE1C 3DKPA 4HZUB 4ZDIA 4I1UA 1XD2B 2QUZA 4QHSA 4L4UA 2RAPA 3AVQA 5FI1B 5C1BA 4PQRA 5LB2A 1KOFA 1SGWA 4RD6A 4AK9A 4EJSA 5CK4A 5HKKA 1DAIA 2QGNA 2O8DB 5K8TA 3PUXA 1UPTA 3PCRB 3CZPA 2YOFA 1YQTA 2DY1A 4UXHA 2GXAA 1GKYA 1F2TA 4OHZA 3T1QA 3RSLA 1H8HA 3C5HA 4ON9A 1DAKA 1ZUIA 4A2PA 2OFOA 4BZQA 2BM0A 2QTFA 4WBSA 2V7QA 4M1MA 4C0JA 4YC7A 3C41J 2QP9X 3KTAB 1G3MA 4LBZA 4QBFA 2D3WA 3FHOA 1I2DA 3TQFA 3LWNA 2YWGA 3EPLA 1CR4A 3SQXA 2Q3MA 3BFVA 4ZIRA 1DAEA 4POAA 3AGPA 4G3XA 2K5UA 5JHHB 4O25A 4C0AC 3BRWD 1PLJA 1ZBDA 1Y63A 1P4SA 2DFKB 3AP3A 2UVQA 1UADA 2YINC 3MWJA 2FWRA 5KDOA 1SXJA 3K53A 5G40A 3GPLA 2QM7A 2HXYA 4OHWA 3IEUA 4Q66C 2OAP1 5DHFA 2J9RA 5FPTA 5FPKA 4FN5A 4URUR 4LC0A 2BDTA 1NKTA 3WBKA 2FMXA 2H92A 2AFIE 3EZ6A 2B8WA 4PZLA 3O8RA 2J0SA 4JIMA 1TADA 3E5HA 3CPEA 3DPUA 3M4YA 4KSBA 3P1JA 3TJZA 4ACBA 5ELXA 3T15A 2OT3B 4DWJA 4FINA 1KI7A 4A0HA 2REOA 2O0JA 3VR3A 3FDIA 2BJVA 2QZ4A 2WPDD 3TAUA 4B73A 4P32A 1FTNA 2XB4A 1JNYA 1LFDB 4JLMA 1XXHE 1YKSA 4V0KA 4D81A 4AIIA 1IY0A 1CKEA 3SZRA 1KSFX 3TAHA 2W2XA 2A5YB 1S0UA 1SVSA 4WIAA 4CRWB 4KU4A 3TW4A 4TYNA 5C46F 2DWPA 5C2JB 2ZRGA 2XZPA 3EIEA 4M1TA 4CEJB 1E9EA 1W0JD 2NZJA 2IYSA 3RS2A 4LJAA 4DSUA 4C30A 4EIWA 1YR7A 2QPAA 1CRQA 1P2TA 2YC2C 2ZYVX 1E0JA 3KJGA 4YMWA 2IWRA 4B2IA 2FF7A 2E1RA 1OH7A 3CNLA 4HB4A 4PANA 4WAUA 2VA8A 5CIWA 1Z08A 3EIQA 3TW8B 1MABA 4F7WA 1II8B 1XJCA 3QVVA 2EWVA 3B78A 2O5VA 3T34A 5CK5A 4HZIA 2FPLA 3MAAC 5FBQB 1T9HA 1XPRA 2CNWA 2FFQA 2YKGA 2OLJA 2W6JD 4TSFD 1XBTA 3ND8A 4TZ0A 3GJ3A 1QZXA 4IRUB 1O3YA 1ZNYA 3IILA 2PJZA 4EQ6A 4PAOA 3L82B 2ZYTX 2E9SA 1G7TA 3AV0B 3I61A 3AKCA 2JLXA 3WXMA 4G1UC 1WA5A 3GMTA 3I92A 1DG3A 3ECCA 1VTKA 4FCWA 5JECA 1N25A 1ANKA 1G19A 2ZI3A 3HR7A 2O8EB 3UIEA 2ZSEA 5FL7D 1Q21A 4JS0A 4NBSA 1J2JA 4WZ6A 5F9FA 5FUWA 2RGDA 4HATA 2DYKA 3LXRA 2E87A 5IT5A 2QY9A 1IHUA 4PHHA 1CF4A 4ESHA 4GMXA 3H84A 1J7KA 4D4KA 3DM5A 1P60A 3SN6A 1KDTA 1XRJA 3AP1A 2O8BA 2BMDA 1Z07A 5AUPB 2W2VA 4EPXA 2ZJAA 5JSZB 2QQEA 4GBMA 1L8QA 3X1YA 3HU3A 3O8CA 2FOLA 4M1KA 1NN0A 2ZITA 1XJQA 3GJ7A 5JWOA 3QBTA 1OB2A 4DEXA 4NONA 2IS4A 2NO0A 3OIVA 4S2EA 1E0KA 2ZROA 4QRHA 4OQMA 1G18A 3PUYA 1G5RA 1R5OA 1T3SA 1MR3F 2F7SA 4GOJA 1W49A 4GL2A 1WRBA 4ZDJA 1OKKA 3DL0A 4LJYA 4XJXA 3K09C 1U8ZA 2ZS9A 2N46A 1N0VC 2WAXA 5BXQC 1TTTA 2FH5B 1SXJE 3QUSA 3RRZA 3ZVRA 3CRMA 5KSYA 2WWIA 2D2EA 4I1OA 5FTMA 4BFXA 2VIIA 4Q4LA 4QBIA 4AD8A 2C99A 4XD7D 1U9IA 4IOMA 1NJFA 1OXUA 1NKSA 4BLPA 4ZCMA 2ZVPX 3I5YA 2IYUA 2QSYA 2WWGA 4PFSA 3VKWA 3NEJA 2ZRLA 3X2SA 4JVSB 2AWNA 3GD7A 3LBHA 1Z0AA 3D3QA 3D31A 3SBEA 1TUEA 4S35A 3QSYA 1KMQA 2BKEA 5A4JA 2XAUA 5JLJA 4HUTA 4DT1A 2WPDA 1UEJA 1VMAA 2OFWA 4TL6A 4B3GA 1ZP6A 5FBWB 2ZJZA 2QMOA 5GVRA 2GBLA 3WHLA 4TYQA 4M53A 3K0FA 1Z3IX 3KKQA 3V4FA 2HCJB 1W36C 1Z28A 4LRWA 4D6PA 1PUJA 1SVIA 4Q1FA 3OE7D 2QP3A 1W0JA 3RC8A 2C96A 2QA5A 4JLNA 4OI1A 1Z0DA 3B85A 1P73A 4DLTA 1KSGA 2J46A 3ZIAD 1Q1QA 1G3RA 2WVJA 3R9XA 3VHXA 3GEEA 2C9OA 1G4UR 2EFEB 2ATVA 3EW9A 3MJHA 3QPVA 5IDVA 2C04A 1SVLA 2D62A 1G1MA 2X1VA 1SHZA 3EC2A 4JLDA 5EXPA 4BFTA 4P4UA 3VU9A 3R20A 5LD2C 3R9IA 1RRPA 2YJTD 2XB2A 3RWOA 1XTIA 1ZIOA 1P7CA 3A1WA 3I32A 4D82A 3JVUA 4FCTA 3CX6A 3WMFA 4B71A 1EESA 4ESVA 1WDTA 2OCAA 5JCZA 1KK3A 3PENA 4RZXA 2W6JA 1KO8A 2YYZA 1YZLA 4FMCF 1C9KA 2D2FA 4TSFA 5DSZA 4BFWA 1Q44A 1EFRA 2EFDB 1W4BA 5DN6D 1E99A 1ZU4A 1XJ0A 3FE2A 2W0MA 5C18A 1HH4A 1ZM7A 1M7GA 2FV8A 5HE9A 1N0WA 1NY6A 5GJBA 4RD1A 2YOGA 5JJKA 1L2TA 3B1XA 2OE2A 1JEDA 2ZR0A 2QM8A 2EFHB 2MMGA 4P4SB 4M1YA 4RVCA 2JEOA 2WM9B 4UJ3A 3TUZC 5FOUA 1EFCA 3AKYA 3RS4A 4JYBA 1E98A 2RGAA 4BZPA 5B57C 1AJEA 4JLBA 4JT4A 5FL7A 2ZVQX 1Z29A 2V1XA 1S9HA 1AQYA 1ESMA 2GK7A 2VHCA 1XPOA 4NTZA 2F1HA 4FIDA 4IHQA 2VH5R 4AI6A 4O2RA 2ZE5A 3CKLA 1GWNA 4LJ4A 4DCUA 3QKSB 4K81B 4ZKDA 1R0WA 4Z51A 3QG1A 1EFUA 2RHDA 4QNMA 2A5FA 1VIYA 3GLHE 5TMPA 1X86B 4RZ2A 2HJGA 4P4TA 3LBIA 3U5ZB 4G01B 4HB2A 3CM0A 1TQ4A 3SI7A 4OJQA 5FPYA 1JR3A 2ZIAA 5JRJA 3B1WA 1Z6XA 5GJVC 3ZS8A 3OHMA 3X1ZA 3VFDA 1NN3A 2I1QA 1PVOA 3FGNA 3GJ5A 1OXTA 2A5DA 3F3YA 1P61B 1HT2E 1LF5A 3REGA 1ZW6A 1NIJA 4LHXA 2WOOA 3RSOA 4ZO4A 4D0LB 2J7PD 2H7VA 4DBLC 3GLHB 4EFNA 1VDZA 2QENA 2Y8EA 5EE0A 4K46A 4QHTA 3SHWA 2B92A 3GEHA 3WP0A 1PV4A 1FQJA 4GSYA 2Q9BA 4XVUA 2JASA 4Q4AB 3CW2A 4KSCA 2NGRA 2A5JA 2ZYUX 4OI4A 3EPKA 1WBDA 1N2CE 2FPKA 4L16A 5FL3A 2XXAB 2NO6A 2QQ0A 1OYWA 4IFBA 2OG2A 1E9AA 1AS0A 2GJ9A 4NMMA 5TB5A 3H2YA 4D26A 1ZM3A 1R8QA 4Q1BA 4TQUS 1MKYA 3Q7QA 3CR7A 1SVOA 3R8CA 2IF0A 5EE3A 1OLOA 1GZSA 3CF0A 5LBIA 1G3IA 3KUDA 1EFHA 3U3MA 4E03A 4LBWA 4R2HA 3ZJYA 3SNHA 3LVQE 1GFIA 1OE0A 1UKZA 3ZIAA 1N5JA 4UNPA 1C1YA 3AUXA 1E2MA 4H9GA 3AGQA 3CF6R 4PC7A 4D4LA 2GCOA 3D7MA 1TF7A 1D9ZA 4UXIA 4AYWA 5JMTA 2GWHA 3EIHA 2RCNA 1XEWY 5L3QB 2C8VA 3KL4A 4MGYR 1DTSA 4MGIR 3THWA 1LV7A 1HE8B 2IYTA 3EX7C 4UQOA 3TSWA 2Z4SA 4GP6A 3ZD6A 3F0TA 3K9HA 1UFQA 2CMKA 1KNXA 2JIZA 2C98A 1R10A 2QN6A 2KJQA 1OW3B 2W00A 4XSHA 4B35A 4I99A 1GL6A 2XOKD 2IYYA 5DN6A 1A2KC 1YZQA 1KIMA 1K5GA 5EUMA 1V5WA 3GLIB 4MDEA 2A2ZA 4V0OA 2PMKA 4B34A 1OSNA 2V6IA 2CL7X 4OK6A 3AP2A 1DS6A 2PBRA 3SYLA 3DKVA 4FW9A 4W5JA 4B3XA 2LCFA 3R7WA 5D3MA 1GILA 2WSMA 2FU5C 5C4GB 3VR2A 1G4AE 3VR5A 5K8UA 2ECKA 3Q72A 1NLFA 4B2LA 4C0BA 2BBWA 1SVWA 4MKIA 4LHZA 4NYIQ 4IOJA 1YRAA 5HPYB 5GVSA 2J1LA 4GP7A 1VECA 5FTNA 4CEHA 1ZUNB 4KLZA 1IY2A 1NN5A 2JJ1D 3OAAD 4LV8B 3AF1A 3SOPA 2P5SA 5JZVA 1JBKA 1E79D 2ORVA 1A82A 1KZ7B 2ZRPA 1BO6A 2HF8A 4IFEA 1KO4A 4DVGA 5JJIA 3D6TB 2H16A 5AK0A 4A8JC 1BMFD 3VR1A 1X8JA 3W8NA 1RIFA 1R7RA 2ZUBA 3N70A 1OFHA 2CHQA 3OZXA 3MFYA 1UKVY 2ZU6A 5FI0B 1G5TA 3GJ0A 1TX4B 2IC5A 3LFUA 3PEWA 1E2JA 1DELA 1RRFA 3PV0A 4GRAA 5JEEA 2FSIA 3BH6A 1OIVA 1GKUB 4NPHA 2J7PA 1XD2A 2PEYA 4PZYA 1G6HA 2CHGA 2ZREA 4MH0R 4N0DA 4DJTA 1E6CA 3C5CA 4NCHA 2V6JA 2BVNA 4E07A 1GSIA 4A0GA 2ATXA 5FUXA 5FOXA 5F3WB 2YC4C 5KTYA 2O8DA 2XJ9A 3EPHA 2HJVA 3CPHA 2XJ4A 1QHHB 5DI9A 4PAQA 1BIFA 3Q9LA 5KSPA 3PEUA 2ZSBA 2IW3A 1QHXA 3FTQA 4B48A 3EA0A 4IJMA 1KNQA 2IL1A 1NL3A 1CR1A 3KUCA 1U0HC 3QOFA 4N3NA 421PA 4KO8A 3ZYCA 1NG9A 2JAQA 3CBQA 4U5XA 2IYRA 3KTAA 2NMVA 1M8PA 1JR6A 1KO5A 3NXSA 2XZLA 1ZM4A 3DEFA 1E2PA 3B9PA 1YZTA 3CZQA 1KJZA 3NC1C 1GP2A 2DFNA 4PHGA 4ZDWA 4AYTA 1XU4A 2IS2A 1V43A 3KJHA 3W6OA 1GAJA 5KPDA 4RY2A 2LKDA 5AJXA 1SHKA 3FOZA 4DDVA 2BCGY 1Z5ZA 2P6UA 4A2WA 3H4MA 4PR0A 3TIFA 3WRXC 1DEKA 2LWIA 3M0EA 1EWRA 3W9YA 3UK6A 4RD3A 5CM9C 2RHMA 2R62A 1IXZA 2JCSA 1M2OB 4RCZA 4DLYA 3B1YA 1US8A 1FOEB 3HPQA 2R6CA 5DE3A 4DIEA 3LW8A 3I5XA 4BFYA 1U90A 2QRNA 4WXPA 2BMJA 4B74A 4HI0E 3W8RA 3CLVA 5EXXA 3G82C 5JS8A 3V4RA 3CONA 1HY3A 2OFXA 3MUFA 3I73A 2HT1A 3HU2A 1XTRA 1YVDA 1QHIA 3EWAA 4EPYA 3UANA 2PH1A 2XOKA 4LDJA 4MYTA 1Z0KA 1ZRHA 4RZ3A 4X8LA 2FFHA 3BGWA 3AVVA 1KGDA 4MYHA 1D9XA 2HUPA 2DFLA 2QMUA 4OI2A 2XTMA 3BE4A 2FGJA 1CR2A 3OFND 3SEAA 3G0HA 2ZJ2A 3NBXX 4QJ4A 5KSZA 1QRAA 3KQLA 2QAJA 5CDFA 4NH0A 4URVR 1X1SA 2NTYC 3B8HA 6Q21A 4BFUA 3TSZA 3LLUA 1OF1A 1RZ3A 2ANBA 3FFBA 4LYJA 5G3ZA 4CEJA 1N5IA 3P32A 2ZJOA 2CLSA 1W5TA 3P20A 121PA 1FX0B 3WP1B 3WYAA 4F4JA 3ZD7A 2C03A 4DKXA 4EFLA 3Q5EA 1DOAA 2F1IA 4JJZA 3VAAA 4B6FA 3RS0A 2ODBA 3Q8XB 1AS3A 3LDAA 2Q9CA 2ZTSA 5J4YA 2KI5A 4LWZA 1F2UB 4GOKA 3EXAA 1II8A 2JJ1A 1XD8A 3OAAA 1GKIA 2VP4A 1E79A 1XP8A 4HLUA 2R44A 5KHOC 1DG1G 3TMKA 3E70C 1OB5A 1BH2A 1JXMA 3ZQJA 1A2BA 1BMFA 1NG1A 3ASYA 4FMDF 1DBSA 3TNFA 1SKYB 2Z83A 1P6XA 1IN5A 2IXGA 3LLMA 1AZTA 1AQUA 3CPJB 1QBKC 2PEZA 2V54A 3A1UA 3SR0A 1ZIPA 1GNRA 1R8SA 1P62B 2D74A 1OXSC 1D2EA 2DCUA 5L8VA 4A0FA 2N42A 3LW7A 1E9FA 1XMIA 4RFVA 4A36A 1VG9B 3PUWA 3PUZA 4A4DA 3CX8A 4PPFA 2IUTA 2O8EA 4F4CA 3ND9A 4U00A 4A82A 4KITB 2O8FB 3BFXA 2EFGA 3IHWA 1KMHB 1NLYA 1G3QA 1W2HA 4I1VA 4LBYA 5HCNA 4B75A 4BGDA 1T8TA 2V8OA 4CEIB 2PMDA 3K9LA 5AUQA 4M9SA 2WBLC 1RVDA 3REFA 1MRNA 3NKVA 2PX0A 1R5BA 4V0NA 1H65A 5JSZA 2DPXA 3U7EB 4MRVA 5CYPA 4PQYA 1P9WA 2OXRA 2VF7A 2WWXA 1ZJ6A 3I72A 4LV6A 5CM8B 5EE1A 3ZQ6A 4AYXA 3QXSA 4LYFA 3IPYA 4CGZA 1DAMA 2JLYA 4AG5A 2ASEA 3QBVA 3PJRA 4KV9A 1CXZA 3FHCB 4NYIR 4EPTA 2ODWA 4GT1A 4LHYA 4AC9A 3TVTA 4IDOA 3A6PC 1S8FA 3BH7A 4KLNA 1U99A 4JJKA 5CLLA 4IDNA 5F98A 1WCV1
chains in the Genus database with same CATH superfamily
2JIRA 3B6JA 4MQEA 3OTIA 3FYHA 4JQZA 3TCXB 3ZG6A 1GSOA 2HDNB 1Q77A 1S2NA 3ENKA 1OBFO 5D01A 5ALQA 5JLAA 4JLOA 4RIFA 4YN3A 1KC3A 3FX2A 1X13A 4BO2A 3U3DA 1J0XO 2J87A 2HRBA 1M72A 4EGAA 2P2CA 3LA6A 5TQ0A 1GA4A 1PR4A 3GEBA 3H1EA 3K6RA 1T0PA 3SBXA 4LPKA 2XMSA 3P9SA 5E7IA 5GWXA 3ANMA 2QAIA 2X19A 1XTSA 3P2MA 2E55A 1WMAA 1YZYA 3VR4H 1EBFA 2VTKA 3H1AA 3HKDB 1DJMA 1CNEA 2EVWX 4KACA 3LHSA 2FW8A 1BXKA 1SB8A 1ZIXA 3CBGA 4ARAA 4MVJM 4N49A 2VJQA 1FXWA 2HY7A 4UUNA 2MDTA 1V37A 3I1FA 3DA8A 3DAFA 3U7RA 1H5UA 2J9FB 1WCIA 1XRLA 1YMQA 3GEIA 4U3JA 3VVMA 3HABA 3GGCA 5D6NA 2WWRA 5E3JA 3BVPA 2ZZKA 3UJPA 3V4ZA 4X00A 2I2WA 6REQA 4J03A 3GJTA 1XMSA 3K6SA 1KEZA 4XZ3A 1XZIA 2G9ZA 1UQTA 2IITA 3QPUA 4NF2A 4OAOA 5ELMA 3SDZA 4AJPA 4BX3A 4Q47A 2VF4X 5E6RA 4Q9LA 4NP6A 4Y98A 3ITKA 4LE2A 1QFSA 1UEIA 2PVSA 2QUKA 1IXKA 1O08A 4EPVA 3IB6A 4J90A 2IZOA 4NLLA 3TB6A 3WL7A 4L50A 4FZVA 1BA3A 2WJPA 3K70C 1QF6A 3MERA 3HBMA 4TTTS 4FWTA 1JKMA 5GZ6A 1KYQA 4N41A 1FUUA 1NDUA 3DMYA 5F12A 5B58T 3UWKA 3IELA 4CCWA 4EA7A 3EOBI 4NS1A 3PEVA 3U1BA 2B4AA 2Q8PA 3WAJA 2XUDA 3DZCA 4LCBA 1B6GA 4RSRA 5J4KA 1E9RA 3FKQA 4I3HA 3LQQA 3PEYA 3BRCA 4UOEA 3TOVA 1I1QB 2VP5A 3LH5A 5AW0A 1T6ZA 2ZI5A 5ADVA 4O59O 2Y9PB 1YCHA 3O8OB 5CA0A 5PGMA 2Q1WA 2HPAA 3AI2A 3L93A 4C88A 3NALA 5I3CA 4YJDA 1GR0A 2WILA 3JVDA 3PBKA 4WTOA 5IMBA 3RVRA 4F4UA 1WXWA 3I8XA 4X8OA 3QYFA 2AD1A 1GGEA 1QH0A 1OX4B 3B5EA 2C4TA 4GVPA 4ND2A 4WN3A 4YROA 3S44A 3W2FA 1PR6A 1ZI9A 3H1BA 2H2GA 3QE2A 4H6VA 4DL9A 3KAPA 2NT3A 1A9OA 1ADBA 1DO0A 1NBIA 1PEAA 4MS4A 1JA9A 3EQ6A 1T0HB 2P2SA 3K9NA 1GZ5A 1WXGA 3ESDA 3JARA 1UDBA 3TRKA 3CKKA 3FZYA 4F9GA 4NZZA 4G24A 1SQ5A 5G1OA 1Q0RA 1K7YA 5CDGA 2CJXA 2P2GA 3RTBA 1NVEA 3WHKA 4UHCA 4LGYA 3DVAA 1RBYA 4LJLA 1MX1A 2GERA 2IZ0A 1I3KA 3EUEA 2NU8B 2J3EA 1QKJA 5TPZD 1QLWA 2PUGA 3AEYA 5IVPA 4Q1VA 1D6NA 2CFCA 2RCYA 1T5HX 2WLTA 3L0SA 3VDQA 4RX1A 4B40A 4G97A 2QKYA 2EATA 1GOTA 4ARSA 4HDKA 3EGDA 4HF7A 1U2GA 4HS9A 5AW3A 3JQDA 4IXNA 5MHTA 4EGFA 4Y2GA 1C7QA 1H0HA 4WKCA 3T6KA 1OCEA 3P2EA 4GQIA 3VO9A 2WJGA 3HYSA 5F2OA 4E1BA 3HJAA 3FPAA 4OBBA 2QD3A 3GUYA 1MJNA 4HDRA 1U7PA 4MQ4A 1DQSA 4HN2A 5JH7B 4HNUA 4NYMQ 2FQYA 2GF0A 4DQVA 1T3LA 2NTNA 3M6UA 1KAEA 2H5JA 1SC1A 1IXSB 4GOLD 3DMRA 4X8HA 3FZEA 2H5LA 5HJ2A 3J7TA 4KODA 1JQKA 5KNCD 3GLHA 1PZMA 2P6PA 3HBJA 4LJ5A 3FIJA 2OBYA 5ECDA 3HWX1 3ND7A 1W0KA 1H3NA 5A5DA 3VAYA 4HTAA 3QLUA 3CVJA 1M8JA 3BMOB 2BFWA 2H2IA 1XZAA 2UKDA 3KVOA 3NATA 1OAAA 1II9A 1LBQA 1XLVA 3K72B 3MWEB 4TT3A 1WPXA 1BHO1 1ZA2A 3KFXA 2QOEA 5FUMA 3QUAA 1RRMA 2W93A 3BRWA 5LBTA 1VSVA 4I1YA 3VR6A 4C9BA 1N6NA 1LKZA 3R0VA 5LD2B 1UJ4A 4QGHA 1B74A 4FUQA 2Z9BA 3FBGA 3NHLA 3FW1A 1Q7BA 1N32B 3KFLA 2P4HX 2MYPA 1LBSA 4ILKA 3T1NA 1P1BA 2BKXA 1EBUA 1YI0A 3L02A 2IH2A 3MWYW 1ZMTA 2Q5LA 2XQVA 3NHBA 1PJRA 4ZMBA 4JMPA 1MVOA 2LP4Y 2J7KA 3KPWA 2YJGA 1NYLA 5J63A 1SVNA 3V7FA 4CIVA 1CEXA 5AW8A 3SFVA 1TQ6A 3OM1A 3TN7A 2BGGA 5K45A 4FZ5A 1CRZA 4X1IB 2CNDA 1YQWA 3K35A 4JGBA 4NCAA 1ACJA 4KQCA 4PFKA 2V9ZA 1AHIA 3MW8A 4RQAA 1J2EA 2C5EA 3RBZA 3DXZA 1PW7A 2GM3A 4UEQA 3RS7A 1C81A 3HZHA 1P9OA 1CQJA 4P54A 2IHTA 3JRNA 1UWLA 4HAIA 4IUBS 4TL7A 3IJRA 3CNHA 3L05A 4A6PA 2J0UB 1OFTA 2UUOA 5HFJA 5K05A 4JP1A 3LYHA 2OZLA 3KXPA 3QBDA 1NW6A 1TC2A 3IBTA 2Z08A 5ICGA 1M76A 3UMMA 4CFSA 3U7JA 1COZA 3L0IB 3P27A 1TZCA 2NNLD 1W47A 4D3ZA 2EJVA 2QTWB 2AZMA 3OCCA 1AF7A 1NQAO 2JFYA 3OKFA 4NMLA 4XVHA 5AOBA 5J9FA 3I9V6 4V3CA 5AM0A 4BX8A 2WF6A 1C9MA 3GJ4A 1RXVA 1JYSA 3UJCA 1FLVA 1CF9A 4GL4A 1VG0B 4XQEA 5B4TA 3O8NA 3PXGA 5KS2A 3GJ8A 4FC6A 4HWTA 4HS4A 4U2CA 4MQ6A 2W0SA 1FFCA 1E2KA 2GEDA 2QEQA 1WXEA 5ESRA 4C78A 4NYJR 2EZ4A 3OY2A 4XOIA 5LQMA 4K2HA 1AQIA 3RYHB 2IRWA 4WZZA 1RM3A 4IEFB 9ABPA 3OIWA 1VA4A 2IXAA 2CK3D 3RU9A 5T4HA 3WS7A 5FOWA 1DZIA 1TU0A 3TDMA 4BTVA 1HDCA 3GP5A 4XGKA 4URZR 2RJ3A 3O3OB 4UCXA 4FHGA 5EZQA 4Y2VA 2GUGA 1GFZA 4HWKA 5FX2A 5KQMA 4X1OA 4TKVB 3C6BA 2PT7A 3ZCXA 1W44A 1JXQA 3PNPA 3FNFA 1D8TA 1SBIA 2I7DA 3WC4A 1G42A 1SY7A 4JLWA 5EIFA 4DIBA 4FJ1A 1JF8A 1SD5A 3ZGXA 1SUEA 4G0QA 5KVCA 4PZ9A 2J5XA 4A8HA 3LZCA 1VL5A 3FPSA 2FMUA 4V39A 1D8AA 1ONBA 5EHIA 2P9YA 4MDYA 5JT1A 1L1RA 1WNFA 4HWGA 4R16A 4ZT5A 5FHRA 1A98A 4UTNA 3V9AA 1NN1A 2UAGA 1GPWB 8ABPA 2X5NA 2A1TS 2KPOA 1KO7A 4EHJA 2FEMA 1HLGA 1Q19A 4M7RA 2BUBA 4NDNE 3OIFA 1JG2A 4BUJA 4MPTA 3LPNA 5JPCA 1D1PA 4Z54A 3AR7A 3EVCA 3AETB 4L0DA 3TECE 1AUXA 2WG0A 1N7IA 2JHFA 2XTAA 3DM9B 3EBPA 2K7FA 4KFTA 4IQ8A 5EJEA 5KJ6A 1J8FA 4LSMA 3ROGA 3WRYA 3HMQA 2VJLA 1M7HA 1XMJA 4TUYF 4J9UE 3UJNA 1DIBA 3VGJA 3JVEA 5GJWC 2MMCA 4E32A 2IW1A 1ZHHA 4J7XA 2VQFB 2ONYA 2GJAA 4P7GA 1EJ6A 4WKOA 5LZ4A 2A7XA 1IPHA 2BC9A 3MINA 3RWBA 4Y6RA 4DCPA 3HDTA 4KGDA 2N9UA 1SKBA 1MXFA 4NULA 5AHKA 5DP1A 1JIVA 2QU7A 3OPYI 4ZRNA 3ZE0B 4DM7A 1WF3A 2OCXA 2XPCA 3CSSA 3ETGA 5IC5A 1HLFA 4RVUA 2XUPA 2QAGB 3WA7A 1P0PA 1Z7WA 2G83A 4HNGA 5ALMA 2W6ID 4KGZA 4CU2A 3RF7A 4MTCA 5BRAA 5C51B 3HLTA 1ZD1A 4KVGA 1L5YA 4DWWA 3MWGA 1UQUA 4Y3UA 4PN3A 3TZ6A 3CWZA 2IYQA 1F38A 1JJFA 1L4KA 1T4BA 1TJ5A 1BTOA 1FQOA 1FDUA 4RPIA 3GFPA 1P72A 2VHUA 3FYDA 4AY6A 4UVGA 1J49A 1SPXA 2YV1A 1P19A 2ZRKA 3ICPA 3TCNA 1BZYA 4QHYA 4C2TA 1TKAA 4AXXA 1PEDA 2Y1FA 4HEJA 3OJLA 3SBOA 1XFDA 4XWTA 3ME5A 1CEQA 3Q8WA 4E5KA 3OBIA 5K0TA 2ZUSA 4UDYX 5E1MA 1IRXA 1XN1A 4NBWA 2CZCA 5FTKA 1ZJ5A 2OBBA 3HXPA 1M2JA 3BFJA 3JQBC 3L4JA 1BHJA 3D7LA 3PE4A 2NUTB 2J4FA 2OK8A 3BGOS 4MI1A 2G1KA 3FM9A 2J85A 2FK8A 1E18A 5HZKA 1VBFA 1DT5A 3T5BA 3DL7A 3Q3JB 1Z6AA 1XQ9A 4Z5XA 3T5MA 3AT1A 2WJVA 2J9GA 4NESA 2I91A 4C0SA 2VYQA 2Z1MA 2RH4A 3AEZA 4GBED 3LQ1A 4ZGWA 1ZH4A 2JFQA 4F4IA 4HDNB 3U37A 3GLIE 2GCGA 4WOJA 3WYFA 3D5QA 2AN4A 2ETVA 1KYYA 2QTCA 3DE5X 3CIOA 3HDVA 2Q50A 3L7NA 2GTIA 3GPIA 3QY0A 3AHGA 4HMQA 4Z9FA 5AD1A 2AJBA 1UKBA 1V7CA 3KT8A 3TXYA 3WDSA 3CPSA 1L3IA 3NBYC 3PZBA 1QCYA 3HRIA 3W6PA 5ES4B 3SG0A 4WZAA 1L8LA 3KFVA 4YREA 1YA6A 2IIBA 2DTXA 5ALRA 1M8FA 2CYBA 4Q3OA 1KFBB 3WGKA 3ZU5A 1S2DA 3OZEA 1H8EA 4ZCPA 3E82A 4NJOA 1R0SA 4PWZA 1L4YA 4MQBA 4A0SA 4E2FA 5KNBA 3V8QA 3K5WA 4YT5A 2IZZA 4FFOA 4BIIA 4BQIA 1FYXA 2E18A 3NANA 5HE8A 4D41A 3FOEC 2HJ9A 3ZNOA 3NG1A 1BDIA 4ZCLA 3O0TA 3TLYA 5JXGA 1CR0A 1F0KA 2Y1OA 1R12A 4MVJH 1R4NB 4F5YA 4KQ6A 3DULA 3S70A 1PJBA 4OH1A 3A4VA 5EXSA 2JI6A 2JBAA 1YAHA 3ZHZA 3PFNA 4YAGA 2ZI7A 3DBVO 4OD0A 4W5QA 1PK7A 3NAMA 4QJ3A 4B3RB 3ZOZA 3QTBA 1LNZA 1X77A 5JRZA 1AMOA 3DLIA 4R9SA 5FAKA 5KMGB 1I4EB 1QIJA 1BMTA 1UDRA 4LSWA 5DI3B 5K0SA 2XODA 3REOA 1XQWA 3Q3EA 3CB2A 5F3RA 4BEWA 1U0LA 5J47A 4KDRA 3ZE1B 3K20A 4OCZA 3LO8A 3L4SO 4IIYA 3SZGA 4PC3A 3S2UA 4ZDKA 1CDEA 1Y9ZA 4HAXA 5B1DA 2HMSA 5FEUA 2IYPA 4Y9TA 1QX3A 1G8YA 4DMRA 1QIGA 3HA5A 1Q1BA 2V97A 4RZHA 4Y1EA 3HK2A 2KWIA 1KR5A 1T4GA 1Y33E 2ZB2A 3NJ8A 3PG5A 3RV3A 1I51A 1V1JA 3E58A 3PCTA 4G1CA 3MJVA 4RVOA 1Y3DE 4PHTA 4C89A 3KYBA 1G9SA 1NIPA 5ICEA 1RXCA 2V65A 3AQ4A 2MU1A 1F8UA 3AUYA 3STYA 4BLSA 3ONEA 5DNAA 1OV4A 1R8YA 3IXLA 4TTSA 2NTVA 1JHZA 1BRTA 1G20B 3C6MA 3C3BA 3HDGA 4QOEA 4AP9A 4JYZA 3WIOA 2WJAA 4Y2QA 4IFTA 2XBLA 5DNVA 4GLBA 1I8TA 4X6LA 1PL6A 5B58C 3W6UA 3K1JA 3G13A 3FD8A 2JA2A 4TMFA 4U7JA 1NBMA 4HRAA 1RHKA 3RD5A 3ADBA 5IBQA 1XMXA 1KRWA 1GGKA 1U80A 5F3DA 3D7NA 4I08A 3NT2A 4XTRA 4JI5B 3QJ5A 5CT4A 1Q0LA 2IK8A 1CK4A 4YIKA 1PDWA 3B70A 5FLXA 4CM8B 3RC2A 1NPTO 5AW5A 1KBZA 1UOOA 6YASA 1YHZA 5KYYB 1DBWA 1RMQA 4CKWA 3KZCA 1V3VA 5KTMA 2QVLA 4JK3A 3W9BA 3ZNPA 3LMKA 1IXYA 1USUA 1EI9A 2IHBA 1DO8A 3EIUA 3EVTA 1K6IA 3N0WA 3AJDA 1DG9A 3O7WA 4H7DA 3SC3A 1LS1A 4QL3A 3DG9A 3GLQA 2RD2A 2HRRA 3IOMA 1VP3A 2G1JA 2ZBEA 3BJRA 3U44A 3U3ZA 4LWOA 3DWEX 4Y2PA 2JFNA 1BEZA 2FDCA 3PVZA 4LMAA 5CLGA 1L7XA 2O1XA 1ZINA 1TZBA 2A9JA 3QEMA 4IGIA 3RVQA 1ECBA 1OREA 3MOGA 4QFDA 5JCJA 3UMVA 2DHDA 2E5WA 4OXYA 1KE1A 3M5CA 1H66A 1TE2A 2NXNA 3LUFA 5BT9A 1KK2A 4L76A 2P1RA 5B4VA 2HK9A 1XN4A 3T0GA 1L5FA 4RE6A 2WD7A 4BUZA 4D9KA 1RJ9A 3W1VA 3DV9A 2BI8A 1SHTX 4AZSA 1RWOA 1TUBB 5CT9A 4N76A 1I36A 2H8KA 3DBLB 4TT8A 1EX6A 2AI2A 3ZWAA 4C0HA 2X5OA 2A4MA 2QU8A 3IPLA 5CHYA 1D2AA 3KKZA 3I1IA 1JFVA 3LX4A 4GWGA 4WZAE 1GQOA 1JI3A 1D1SA 1VPDA 3I4LA 4EVSA 4XR9A 3GLGE 2X5JO 2WQ7A 2G1AA 4D0GA 4MITA 2BCJQ 3A9UA 2H06A 3BQMB 4K1LA 4XR4A 2C2KA 4D9IA 2G5PA 2X77A 3ESXA 3ZV3A 4EW3A 1NI3A 1O87A 4I5DA 5LLTA 4A9AA 4HGQA 5EWLA 3UKOA 5JOQA 1U3VA 3FMOB 1I3MA 3NHRA 3P26A 4XTCS 3X1WA 4BAGA 4ZTBA 4ETNA 1N3BA 1T2FA 2OY0A 4P34A 3TVYA 1AUOA 1Y5LA 1DC3A 3I2HA 4JBXA 4EF4A 4EG4A 4XWKA 3IIIA 2XVAA 1SCIA 2XA1A 2W9XA 4R2KA 1U2QA 3HKEA 4PEVA 4ERNA 4GM0A 3OEHA 4I5EA 5FD8A 1JTEA 3CC8A 1BS9A 2CFSA 3GA5A 3GLGB 2Y3IA 1I5RA 2VSOA 4XUEA 5D7BA 3RHFA 1IUPA 2K6GA 4YRIA 1CULC 4R5MA 1PZEA 4RM2A 3W5VA 1A9YA 3ZWKA 5BUZA 1U9JA 2FF5A 3EGXB 1FTGA 5E2AA 3WR5A 3VI3B 4DREA 1YDWA 1KQGA 3K5IA 1N57A 2PZGA 3EBOA 2ZS8A 4G1MB 2ZIWB 2AEEA 2AXQA 3MRTA 1OD6A 1T15A 1SZPA 2G72A 3DUFB 3L1KA 3NRBA 2QV7A 3HCDA 5D00A 1E66A 4KMOA 1DGQA 5MGNA 4X3CA 3FETA 4FDVA 5AVSA 1YCGA 3AKEA 2F1RA 4RULA 2GARA 3R7FA 3AY0A 1Z2AA 1WLYA 4H7IA 5KNDD 2YXLA 3Q2IA 4JENA 4Q03A 4BOYA 1BN6A 4ZP1A 3C2QA 2BSQA 2X1HA 3AERB 5HF9A 2C4WA 3V1YA 1XCGB 4CLDA 5AR1A 4X41A 1GHTA 3WE7A 2EJWA 4H7FA 1KI6A 1CEEA 1P0CA 1A2OA 5JALA 4FLEA 2B4KA 2Z95A 2Q27A 4LQ4A 5G4KA 4K7JA 1UAYA 2VJAA 3EMBA 5JQGA 2O5EA 4MVJF 1I14A 3L4EA 1NKVA 1G5QA 2OHVA 1X38A 2OV8A 1R9MA 3FVQA 4BMXA 3K7EA 3CRQA 2WKRA 1S2LA 2P27A 1ETUA 1NVUQ 3Q0EA 1V7ZA 4TQGA 1EQUA 3OZUA 1NONA 4YEDA 2HT6A 5A5GA 4W1QA 3VSEA 1V8OA 2B5WA 4EB6B 3NH9A 4GBJA 4BNHA 3S1SA 1OILA 1CS0A 2C2GA 1TZMA 2LZ0A 1HUQA 4BU0A 1Y0BA 3PQ3A 1NJ2A 4P7KA 3MBIA 4MV5A 1EM6A 1ADCA 1TEVA 1YR8A 3KEQA 2GZHA 1NBME 4IJUA 4RSMA 1XTJA 2LIVA 3IUPA 2VSQA 3CUEF 2DZDA 3WK5A 3KB8A 3IPXA 3UMJA 1VKHA 2C42A 3CZAA 3M9LA 3H5NA 1ZNWA 2X0JA 3QQ5A 3KHTA 1H2YA 1KZ6A 2G8NA 3E4DA 4X95A 5FLKA 2HOQA 3CVUA 1NNEA 4TMKA 1RBQA 1FTWA 2ACKA 1L7DA 2UZ1A 4EL5A 3QJYA 4WZBB 1O2DA 5MN6A 4BQRA 1RPAA 1E1QD 1CUGA 1N5MA 3NGLA 5IP5A 4WK4B 3L1HA 3UUGA 2G88A 5HS4A 2CY0A 3OETA 4FBLA 4LSZA 2FPSA 2XITA 2AC4A 4FSXA 5EMLA 3WK7A 4EBFA 1X1TA 1ZN2A 5IJ0B 1OIXA 2FCRA 3Q2KA 1LQ2A 1VB5A 3C3DA 1A9TA 4OXQA 4HQ6A 5T4FA 4AN4A 2BGIA 2B4YA 3AIIA 1RC0A 2DBQA 2RC6A 3KKEA 3R3YA 1E3MA 1JV2B 2H4WA 4IEIA 4L5YA 4B4VA 3A6LA 4H31A 2VAMA 3FHJA 1F1JA 4NCKA 3FLMA 4NPCA 3GWGA 3E9NA 2VQEB 5DCUA 2G5TA 4YFVA 2UXBB 1PWZA 5FTWA 4AQDA 1JVBA 3R6GA 3PHIA 4ZALA 3F9CA 3KDSE 1BOOA 1Z37A 1M6VB 1AXEA 3OQHA 3WNQA 4WESA 4UNNA 5EUQB 5U4QA 3UTDA 1S96A 4QSMA 3ZY3A 3LGXA 4CNQA 3PXDA 3LBAA 2ZT7A 4Q3NA 2Y99A 1VYHA 1S2OA 4IWYA 4K3VA 3TIIA 2VT7A 4GGMX 1O6BA 3BHMA 4G5QA 4QDUA 1BKSB 2OR3A 3N6XA 3OCVA 1IONA 3AESB 4MIOA 1U1IA 1PKXA 3IUSA 4M89A 4YRDA 3V48A 5JDIA 1J4AA 2BFEA 1E4EA 2ZAMA 2ZXFA 4RBNA 4B7CA 4FT4A 4AJNA 4CM7A 3AF6A 1H2EA 1VE1A 3DMTC 5IT4A 2WAYA 5GTDA 1X7DA 1GNTA 3FPCA 3QPCA 2IYLD 2WEKA 1DC5A 3DV0B 3H1TA 1HDXA 2RONA 4XLLA 2ZCJA 3KQTA 3P0JA 1F6WA 1C1DA 5KHLB 3VO8A 1E2NA 4O8ZA 2NAPA 2VI5A 2G71A 4F2GA 3L1IA 1KK0A 4D6YA 1P4RA 3CG0A 1T6NA 3W78A 4ZTZB 3MRSA 4BE7B 4II2A 3ONNA 4QDKA 2C9CA 1A8UA 1OKKD 4S1PA 3NBKA 3IPCA 4AX4A 1GY8A 1WW3A 3FSEA 4ZZ2A 3GDOA 5BYAA 1EINA 2Q1SA 1H9BA 3M6LA 4HGZA 1RP1A 5DTQA 1US8B 4TMYA 3KUUA 3DW1X 2PR7A 4PBSA 4ZCQA 2BEKA 4NS4A 3GQBA 3RFCA 2QI9C 5C0OE 3STUA 3BRSA 4BN4A 1NMZA 5DISB 5KU1A 1WXDA 3GRFA 3T3GA 1SHLA 3KOZA 1RCFA 2I2BA 1YZUA 3B1JA 3I2GA 2D1TA 4RPCA 1U0JA 3KEFA 3WOVA 4REOA 3NDRA 4DMFA 1HYQA 4I46A 1URPA 4N5DA 3BMQA 3KZXA 1A5TA 1YQEA 3NX4A 1IBKB 1UXIA 1JHAA 3PUVA 1SO8A 2I6FA 4ZCSA 5LL6P 2ILVA 1A97A 2O1SA 4QGFA 5LA6A 1Z63A 3L77A 2OSVA 4DA4A 1BAPA 1A76A 5FUYA 4C22A 1L7BA 3V8RA 4EPWA 3MFQA 3F3KA 3SDBA 2RH9B 3AVYA 3NFRA 1VCNA 2JDID 1HE2A 1KIFA 4NAHA 5TEVA 1NM5A 1GCUA 2OCGA 1QTRA 2JS7A 3EZXA 1XZQA 5BVGB 2B94A 4RJJA 1AKWA 1H3FA 1OHHA 2DR0A 3UJHA 3GZNB 3VJMA 4DAOA 1OZ0A 1F8GA 4ARZB 5JNSA 1QIEA 3JATA 4G8JA 2JFZA 1PWXA 3OZGA 3RU7A 4A2CA 3DB1A 4Z1MD 1CQIA 2HTFA 2O8CB 3RVNA 3AEKA 4IIEA 4PQGA 3JAKA 3KZ1E 1ZWKA 3A0RB 3KEMA 3MLEA 2XUHA 2A9FA 1UKAA 3PR3A 5C37A 3KSBC 1X1CA 3NHYA 1DV2A 4DB4A 3K9QO 2VJKA 2AS0A 3ODPA 3I01M 3EW7A 3T61A 3E2MA 2H52A 4X5OA 4ZYTA 2IP1A 4TTVA 1FNMA 1M9NA 1KJJA 3THXB 3QV2A 1C9YA 1FYEA 4FYJA 3TIXB 1PJ8A 2FWBA 4BEBA 1A7KA 1G16A 2CBXA 1GQSA 2Q5EA 3C8DA 2FWJA 2RARA 3NQ41 1GR1A 3PGJA 4GXRA 4AS2A 5IANA 1ARZA 2A1IA 2J9ZB 5EIOA 4DGSA 1EUYA 2CHEA 2ZAIA 1P7ZA 1U3FA 3H2KA 2C3PA 3R4CA 1Y3CE 1L7RA 4G0NA 4I5FA 1A5BB 5EP4A 4BKMA 5L4SA 4GDMA 1O8CA 3S68A 2GQ0A 2WF5A 3QYAA 3SSAA 4OYRA 1DP4A 3AZOA 4U5QA 1DV1A 5AK5A 2I87A 1T5BA 3WTCA 4YDQA 3B5IA 3BTUA 1ZMXA 2X6TA 1Z2PX 4P0TA 4YJ2A 4BVGA 2OCDA 4BZZA 4HJRA 1TB4A 2NXWA 2DF8A 1U3UA 4BKQA 3S8YA 1ODKA 1UAGA 1PVVA 2Y0BA 4M22A 4PZPA 3URMA 4B7UA 5G0TA 2COKA 2JVIA 1FNSA 1X1RA 2UZIR 3E84A 5F64A 3LX5A 3UM9A 4MWSA 2VCYA 2E37A 3K31A 5CVTA 3HEBA 1H1LA 2IUYA 1CZRA 1HPLA 1QLHA 3VSAA 1C8KA 3K0CA 3IOBA 4JBHA 3WMXA 2Q6LA 4GZMA 3MIZA 1XX6A 3H2JA 3TE6A 1VE5A 3EHEA 1Z5UA 3FKSA 4ND6A 4BFVA 1PEYA 4QU5A 4RKQA 4AULA 2D0OB 4P93A 4E6EA 3T3EA 1U2TA 1JQ3A 1XZPA 3FHLA 2V59A 4MRNA 4YNBA 3FWKA 2FE4A 1S2GA 3CLKA 2DWCA 3GT3A 4WY5A 4YRFA 2ZXUA 2WSSD 1I7DA 1A5SB 1L7AA 1ULAA 4G56A 5CPBA 3DVRX 3IBCA 2PVPA 1QF7A 3SC6A 4F8YA 2A9PA 4KWIA 5K8VA 1KYVA 1J8YF 1YK0A 4XLTA 1BFKA 3TXXA 2AF3C 3E7WA 2KLHA 3F6EX 3HYCA 5E1BA 1FRNA 1CZUA 5E6UB 3TZLA 5BW8A 2D0IA 1DJLA 3HE3A 1NDQA 1KYTA 3GCGA 3MTQA 2RHTA 4XEHA 4CKBA 1E2BA 2BE7A 3MRVA 3KVRA 3OD1A 5HRCA 3U4QA 3MB5A 1MCZA 1XZMA 1EA5A 1NRJB 1XZHA 2KX7A 4B3BA 1KJWA 3MLAA 1QUFA 4CLRA 2QXYA 1ND5A 4RQTA 2FPWA 2VUHB 2ZRBA 3BK7A 4MKGA 4W1SA 2H9IA 3B89A 3CFYA 2YIDA 4BWFB 4OVKA 3UEOA 3O4RA 1EG7A 1J7JA 1EG2A 2VHWA 1TVKA 3HLKA 4RAOA 4PO1A 3RHSA 5IK2D 3OFSA 1UMCA 2AKYA 2HCBA 4G86A 4GNRA 1V8PA 5LYJF 4MW0A 5JMPA 3RB8A 1AZWA 4ZIRB 1PSDA 2AQHA 4FMBB 2QG9A 4N82A 4BNJA 4GG1A 4YI5A 2VKTA 4G2NA 1SEPA 2PR2A 1E62A 3KLOA 4FBGA 5AKEA 3ZVLA 4BJ6A 4BQNA 4F2DA 4WOCA 1JBEA 2PLWA 1X1DA 1ZQ9A 3Q0TA 2FVYA 2MSDB 1KHHA 1EQ2A 2HK6A 5CFMA 2IE8A 5EMMA 5SYNA 1E60A 1SXJB 3DE2X 1WX1A 3MHPA 3UYKA 4DBLE 2HR1A 1I2AA 3JWJA 3NCTA 3PX3A 3BOSA 3ER6A 1SOAA 3SC2A 2GYUA 5EWMA 3EFHA 4B0PA 3HCWA 1G0OA 4HWPA 5CX4A 3THRA 3THYB 4LECA 2QJOA 4TV8A 3BH0A 3D8BA 5IT0A 1LD3A 5T8KC 4ZQEA 1EGQA 4QQ8A 1ZD8A 2E0IA 3E22A 3QWHA 3GIWA 5DGHA 5ESDA 2P0YA 2PYZA 2WWWA 2B8TA 3CEHA 4OFXA 3T9BA 4RJLA 1NTRA 3EC1A 3A10A 2EIXA 1SQSA 2V98A 4BLUA 4CYMA 1LVHA 4YAKA 5T7BA 3GRUA 5E3HA 3EAGA 3CS3A 5DO9A 3CNBA 2G80A 3CXRA 3PPXA 1M2VB 1QFYA 2YYAA 2CLCX 4REQB 5KI6A 1H2FA 4EG7A 1JEAA 1S2IA 2M6KA 1CB0A 2WMYA 1G3UA 3FWHA 3KRTA 5CX1A 2IV2X 3SX2A 3H1PA 1N3IA 2DLDA 3URKA 5KVAA 1MNQA 5SZJA 1NDHA 1K63A 2PX4A 3KJEA 4MVJE 3U7GA 3KXIA 1RXSA 2C00A 4I1SA 4BNMA 2CEAA 4Q4HA 1SUPA 2OBLA 1ZGAA 4C87A 1W7AA 4IHAA 4PBRA 2B1IA 2HIHA 2RK3A 1V1RB 5E6SA 4JJ7A 2OV6A 1BWSA 1FLAA 3KYCB 1O5TA 1GT6A 2CV1A 2IQIA 1WHTA 1O0BA 4GF5A 1IHYA 3W6NA 3AMVA 1F48A 1E5VA 3V8EA 4IMPA 3OJFA 4RVSA 1EUZA 2PKQO 3KT6A 4L8YA 1Q0UA 3QX3A 4DSZA 4V1CB 3JZMA 1NWHA 2P4EA 4M99A 4DEVA 2XHZA 1NNI1 4URHA 3RNOA 4AROA 1JDPA 2IKQA 5K4HA 1RYYA 1UBOS 2A33A 1I32A 1HTBA 2C94A 3I5MA 2GASA 3ZK7A 2QLBA 1YVUA 1H9CA 1U6IA 1TVMA 4HRYA 1TI7A 2QRQA 3A1SA 3THOA 2PPLA 4R9RA 9ATCA 1P29A 1UOPA 4YAUA 1R2QA 1YOVA 1IXRC 4C4RA 1SMKA 4BJ5A 1XEFA 3BIWA 4FZ3A 1FVOA 2R2GA 2RIRA 3OC0A 4Q9DA 3DF9A 4B4KA 3ECSA 3SWWA 1MRZA 3H6HA 3K16A 1WD5A 4OP1A 4LISA 3VZSA 1XTPA 3SZLA 2JH3A 1J2UA 3WHIA 3ZKWB 4B79A 5IRCD 1HNZB 1P80A 1G41A 2VYVA 3N2GA 2HQBA 1E8NA 4CM4B 2ZUFA 1PT8A 1XA4A 4FJ0A 3FTEA 5JVDF 3KAKA 1QRUA 1OXBB 1GDDA 4BNDB 4RKYA 4Y8VA 5B36A 2CVPA 3NGMA 1YR9A 1AO0A 4LHWA 5JDCC 3UXMA 1VOTA 4L9RA 3YASA 5J4LA 1UFOA 2FEAA 3IIEA 3MD9A 2PN1A 2ZRIA 2BBOA 4OB7A 1QVRA 2O8BB 2ZRJA 1QRTA 1E6UA 3IEIA 5I3ZA 3D2BA 5JCXA 2JI7A 4K9DA 4Y2YA 3WYCA 4LV5B 4YX9A 2CDCA 4KUGA 4NOKA 4TL9A 4UUAA 1T5SA 1NAHA 3M9WA 1IEWA 2EP7A 4IHJA 4M21A 4R8MA 1UINA 2FFAA 1BOFA 4WQMA 3OESA 5BSTA 2FPGA 1N5DA 3EUAA 5ALUA 3V46A 1TYCA 1ULHA 1MO6A 1Q7CA 4WVFA 5ALXA 5BW6B 2VDLB 1WM1A 2RAVA 1CJUC 2SKEA 2IU0A 3SCZA 3PRKE 2NSLA 2PX8A 4KXXA 3W0LB 2C2WA 2HBRA 2QIOA 3AL3A 4MMYB 2R8RA 5J2UB 5TGTA 3VPDA 2FFBA 4R2IA 4A10A 2JJMA 2WWVD 4JP8A 4D4JA 3PD7A 4DDTA 4XJXA 5DCLA 5KO2A 3OIGA 1GG8A 3C6KA 4KGVA 2CEKA 4JBNA 1THGA 3MOSA 1R6BX 3E48A 4XDHA 3GLFA 4AY4A 2QT0A 4OUDB 1KMMA 3KWJA 2P2DA 2A1UB 3E61A 4N3CA 4QUHA 4Z0NA 3TRIA 3UAGA 1V2HE 2BEUA 3C3EA 4FFLA 5DNDA 4V0MA 5CB4F 1QWOA 2QN8A 3H83A 4IL5A 1RWVA 3VX4A 3G8BA 1U2GC 2GBCA 3OT5A 4IQGA 4N7BA 3DFKA 1R27A 2EBWA 4UREA 4A7PA 4E14A 1E3SA 2VNKA 1DJOA 3KZVA 4N7RA 5TXGA 4DLZA 2JFPA 2UVPB 2OHXA 5JZSA 3H13A 4N5MA 1PNRA 4PSVA 2IYVA 2D5LA 4B6SA 4BPBA 3MS4A 2HCRA 1DIGA 1OIWA 4DV6B 3ORSA 1WY5A 1FDVA 3EUWA 4M98A 1KSJA 3BB4A 2FVXA 2QAGC 4XM0A 5EZYA 1RKUA 1KDVA 5F51A 1JAYA 1HE4A 3PICA 3QLEA 4F12A 2QE7D 1GG5A 1XWFA 3GRZA 3O0DA 1FRZA 1U7OA 1XCLA 3INNA 3PI7A 3QELA 4YJ3F 3TZCA 2NSHA 2YX1A 3OECA 4RIIA 4WJKB 1H2ZA 1XCMA 5I01A 1FUEA 3ZCPA 1N9ZA 5FJJA 1A9QA 4Q9IA 4EKEA 1MBZA 3R9WA 3OPVA 3FI9A 2W71A 4K6FA 3P5SA 4B44A 3W79A 5IASA 5LXTA 4Z3KA 4L8LA 2BHRA 3RAGA 1B0PA 2ZRHA 3LO5A 4V38A 4UZFA 3T95A 1E5QA 1N7GA 1Y7PA 2PMFA 4IP0A 3SZOA 2AFHA 1Z25A 2BEWA 1JDTA 2E1PA 3HNPA 2C5FA 3JPWA 3KSZO 4G23A 3O4FA 1X3SA 2R6FA 4KFSA 5DULA 3SM3A 3HBAA 1KRXA 1GLVA 2HSEA 3LP5A 4J1SA 1WMFA 3UV7A 5B12A 1KFKB 4FDAA 4PAMA 1DMSA 2XNDD 4G4GA 4WNIA 1GUDA 1L5WA 3IUEA 1N2OA 4JSTA 4YAWA 1SRRA 1Z06A 4PLVA 2R5FA 3SMVA 5CD1A 1INLA 1JQJC 4DCSA 4JOBA 1XTKA 2YY6A 3BFKA 4FCVA 4ES6A 4Q4JA 5H0IA 3RSHA 3ZDFA 5IHXA 3KD3A 3RRNA 1NJ5A 3TG2A 4OM7A 4H6WA 1NVXQ 4OMDA 4L28A 5J2TF 4PC1A 4DMGA 4Z8XA 2JGDB 3P7MA 1H22A 1D2NA 3JSXA 3RK0A 4E1AA 1XVIA 1M1NB 3QFTA 3F96A 3ZC3A 1JR3E 3W34A 1X2BA 2GZ2A 3BJEA 2EZUA 1QDEA 2WUGA 3ADPA 3NWBA 3AFMA 4G07A 1NFRA 4X93A 5SY6A 1EP9A 2C2OA 3T38A 3VOSA 1F9EA 5MN5A 4RHCA 4PQEA 1KFCB 4ZYXA 5TQ2B 2R1TA 3CR3C 3F3MA 5BQOA 1OWPA 4UPEA 4Q48A 1XMPA 3IOYA 4H3KB 1AKVA 1H2WA 3DBRB 5ED0A 1GKLA 1N6HA 3HJBA 1NY5A 2ZUVA 3O92A 2PUBA 4B6PA 3UJ3X 3OX4A 4QU9A 4JCOA 1I33A 1RAIA 1BHSA 5CBPB 5DNCA 2W8BB 2NACA 4Q7EA 2PSHA 3ROMA 3G0GA 2QLFA 1FS5A 3C4JA 3PUJA 3PQ7A 4IDFA 1E32A 5FR1A 1DOZA 4DCTA 2ZQYA 5D6OA 4BLVA 5THXA 1IQPA 2WJ4A 4PYMA 1G8JA 2YZKA