1MT0A

Atp-binding domain of hemolysin b from escherichia coli
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
241
structure length
241
Chain Sequence
DITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHKELLSEPESLYSYLYQLQSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hemolysin secretion ATP-binding protein
publication title Crystal structure of the nucleotide binding domain of the ABC-transporter hemolysin B: identification of a variable region within ABC helical domains
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 73
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2002-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1mt0A00
2AX4A 3EXAA 4W5HA 1GUAA 3AGQA 4LRWA 4HB4A 4IFEA 1MR3F 1G5TA 1TU3A 5EE9A 1GITA 4QXAA 3BIFA 1Q1QA 1U98A 4Q4LA 2PEYA 4LYAA 4CW7A 3GJ8A 1FMLA 2GXAA 1KOFA 4LYJA 4DCSA 2DHRA 1I2DA 1KK3A 5EZ5A 3SJBA 1YZUA 2W6JA 4UXIA 4BZPA 2REBA 5AJWA 5C4MA 1TQDA 1D9XA 1IJEA 1QHHA 2OAP1 3MD0A 5DYGA 2WIAA 4Z1MA 4MA4A 4A8JC 5IDVA 2IS1A 1L2TA 1JQLB 1WBBA 4HEJA 4RD6A 3BOSA 1W0KA 1E98A 3GQBA 4YDHB 4N3NA 1R0WA 4JZKA 4AG6A 2BIFA 1COWD 2JLQA 3CPHA 1NMYA 3B7GA 4F4JA 3CRRA 3OF5A 4KVGA 4F91B 3PEVA 1G18A 1VYVA 4OHVA 4P0TA 1LB1B 4FMDB 1YR6A 4ILEA 2OG2A 4AKHA 2BCGY 1KI6B 2ZETA 2FPKA 2ZU6A 5EE0A 4QM7A 2RGNA 3QE0A 4Z8XA 1IXRC 4BFWA 1SXJE 2W83A 4GMXA 4B32A 3KKPA 2IYZA 4MKGA 5IF9A 3U3KA 1DO2A 5LD2B 2YINC 5J5CA 1NJFA 3K0SA 1W0JA 3RS5A 5DISB 2BM1A 1II8B 2WSSA 3K9LA 2NO7A 2BVNA 4IOMA 4LV8B 2ZJAA 4TTQA 2P6RA 1CF4A 3CBQA 5BWMA 1T3HA 4JSYA 4ASUA 4QGGA 1CJVC 1XTSA 1MH1A 3IQWA 3RRZA 4NYJQ 1Z2AA 5D3QA 5JI2E 2V7QA 4JBWA 3EW9A 1SVLA 2BCJQ 3FKSD 2V3CC 1DAMA 2A9KA 2REXB 1ZMXA 3BS4A 1XU4A 2O0KA 3NDPA 3QG5A 4RD3A 1LY1A 2C78A 3CH4B 2GJ9A 4QHYA 4UQOA 3TUZC 1CRQA 1NSFA 3QKRB 2ZJBA 4DVGA 4E03A 2QUZA 2JJ1D 1RYHA 1AGRA 3DPUA 3PFIA 5EUQB 3SFVA 5SZIA 1CRPA 3CF2A 721PA 5EE1A 3N70A 1KI8A 3QOFA 3WNBA 1ZBDA 3W6NA 3G0HA 4IDNA 1P3JA 2CJWB 2QRNA 2W2TA 4IDQA 1N0WA 1P72A 2A30A 3OE7D 4LV6A 4NYMR 2G83A 4C0LA 1BYUA 3PR1A 4URVR 3BJIC 2GCOB 3P4YA 1ZD9A 4KU4A 1P4SA 2H17A 4XTRA 3EPHA 1M1YE 1Z0IA 3X1DA 2A78A 2CK3A 1PUJA 1WA5A 1P2UA 5KSZA 3LO5A 4TQ9A 4RSGA 3RAPR 3ND8A 3JVVA 4GRAA 1OV4A 4PC6A 4TLEA 1KKLA 4LBVA 3EG5A 2ZRCA 3HU1A 1YZQA 4C9BA 1DTSA 1D2EA 4C0BA 1IHUA 3QF4A 4A6PA 3ETLA 5D3MA 4PSVA 4IVRA 1KJZA 1R10A 1GDDA 4JJKA 1LNZA 3AF2A 4R2HA 4Q9LA 2CE7A 3PUWA 4PO1A 2J45A 4D4MA 1PLJA 3A4MA 3ADDA 1YKSA 1CTQA 1G8HA 4NZYA 4IHQA 1GWNA 3EWSA 4WOPA 1TL7C 3AH8A 3BH6A 5CB8A 3D3QA 4DLZA 1ZD1A 1J90A 4HDQB 1R4AA 3GLGE 2YOGA 4PFSA 5KNBA 2GA8A 2VF7A 1XJ0A 4EQ6B 5HKKA 1W44A 2V8OA 3TUIC 4YMWA 1FUUA 4PSKA 2QSYA 1P7CA 2XX3A 2D7CA 5FBRB 2YZ2A 2ZVPX 1T6NA 2YWFA 4GNKA 2FV8A 3QBVA 3QXHA 4EKDA 3WMEA 2VO1A 1NN0A 2GVDC 1PV4A 2DYKA 2XTNA 1U94A 4MGZR 5J4HA 4H1UA 3RWOA 4ZI3A 2HF9A 1ZJ6A 4PC1A 2GHIA 4LUCA 2GBLC 4AG5A 1E79A 3PIRA 2E1RA 4WBSA 4A2QA 1HEIA 4PR0A 2JJ2A 3L43A 1NN5A 4S35A 4MGKR 2RCNA 4HDOB 1N6KA 2GWHA 4Q7MB 821PA 1Q12A 4LJ7A 3MFYA 4TMZA 3PEYA 3KFXA 3SI7A 3QY0A 3KX2A 2JLYA 3THWA 3B9PA 2ZRNA 2ORVA 4HDCA 4MGIR 4Q03A 1G17A 1Z6TA 3GLHA 4ERNA 3ZDQA 3SJCA 2XZLA 4BFSA 1KDPA 1EXMA 4DHEA 3BORA 3CKLA 3A58B 1ZVQA 4LDJA 4AIIA 5KOYA 3O8CA 4Q01A 2H7VA 4JT2A 2YHSA 4DRZA 4NBSA 2XSZA 4US0R 2GEUA 1NVXQ 2GEDA 1AGPA 2YOHA 1F2TA 3AVOA 4Q18A 3UG6A 5LDDC 1LS6A 1TQ4A 1NJGA 1YZTA 2XEXA 3RRMA 1GNRA 3RS2A 1NVVQ 3R8CA 1KDTA 3U61B 4RKEA 1G5RA 2CHGA 5JRJA 4XOIA 4IOJA 4PQFA 2R62A 1SXJB 2R6GA 5DIFA 2O8DA 4W5WA 4ACAA 1YRBA 4GOKA 3PUVA 1W49A 2I4IA 2ZI9A 4N1AA 2J9RA 2BMJA 3JVUA 3SEAA 4DCVA 1UBCA 2FE4A 3UANA 1E9FA 3DOFA 2WWWA 3DKPA 1CJKC 5FBWB 4TYYA 3PEUA 4B34A 3BXZA 3EAQA 1R7RA 1ETUA 3PVSA 1VCIA 4ZKEA 2ZRIA 1II9A 5JS7A 5AJXA 2BM0A 4V0OA 4PZYA 2QI9C 3MRSA 1T8TA 1GTVA 3GJ4A 1XXHB 1TQ2A 3KKMA 2ZIAA 3CPJB 3KQKA 3R20A 2EU8A 3I62A 3B13B 4QOSA 4A0RA 2QGNA 1NBME 3GJXC 1U0LA 4GP6A 1L4YA 4BUJA 4A0GA 4I1VA 2HXSA 3E1SA 2QEQA 1AS2A 3FMPB 3U7EB 2ZE8A 3OFND 4MDFA 3AKDA 2E87A 4P33A 3I5XA 1F5NA 4BE7B 3NBYC 1IN5A 3UK6A 1DAEA 4LHVA 3U3JA 4KBFA 3RDPA 1E3MA 2VH5R 3GJ0A 3MGCA 4FMCF 4IXNA 2C95A 4GZLA 4QG7A 2LKCA 1HE8B 1OFHA 2QTHA 4TMVA 2ZROA 3KQNA 2ZRLA 4JT4A 4PANA 3GLHE 1I4DD 1QHHB 3K1JA 3K0FA 3RSOA 1W2GA 2ZJ2A 3THYA 4MUBA 3U2QA 2GJSA 4KJZA 5DLQC 1D2NA 4EJSA 4HLUA 1E4YA 1NI3A 1E2MA 3DO6A 4HLCA 2FPLA 2VPPA 2G1KA 3C4JA 3IKJA 3TSWA 1F6BA 2W6ID 5B57C 1PLKA 4MDEA 2RKOA 2XB2A 3HPRA 2FFQA 1MO5A 3QVVA 4DLXA 5DSZA 1W0JD 2OILA 1SVMA 1A7JA 2BWJA 1OHHD 3Q5DA 3PEWA 1N2CE 1GL6A 2R6CA 2EWWA 2P65A 3NEYA 4M9XA 2FEMA 2FWRA 3FOZA 5DHFA 5K8IA 1AQUA 1TEXA 2L0XA 4WA7A 3AUYA 4P4TA 2RGGA 4HSEA 4A1FA 2P3SA 2V7QD 3I4LA 1Z08A 5KNCA 1HQYE 1VG9B 3OAAD 1LF5A 4XH9B 3KKNA 1TUEA 3LQQA 5B2ZA 1DARA 1XX6A 2AKAB 3DM5A 2IHYA 3I32A 3MCAA 3VX3A 2AFIE 2J5XA 4TTPA 5KYKA 5FOSA 1F2UA 1FNNA 4C0KA 4OKSA 2TMKA 4D6PA 3FMOB 4LV5B 4M1YA 2GCNA 3RWMB 4CGZA 1S9DA 4X8LA 4J0QA 5K8UA 2ZUDA 5FPTA 1E9EA 4JL5A 2VHJA 2OBLA 5HZKA 4DUGA 1W48A 1Y3AA 3BE4A 2ZAOA 3ZYCA 2KBFA 5TVKA 3OZXA 2J7PD 4UXJA 2J0QA 1W47A 5JI3E 5EP4A 4JVMA 1E1QD 1E32A 5J47A 1ZIOA 6Q21A 1UKEA 3C5HA 2H18A 4XIGS 2A3RA 1BH2A 5P21A 1CJTC 1P75A 1EK0A 3LV8A 1G1MA 2EFGA 4LBZA 5DI3B 2Z6VA 1Q3HA 1T8UA 4C0JA 2NO6A 2FSFA 3VKWA 4BLOA 2GDJA 2QMHA 4FMDF 1TNDA 4LHXA 2WKQA 4II7A 1UKVY 4KFUA 2ZE5A 4Q1EA 1TQ6A 1KAGA 1W46A 1JB1A 2VQSA 4JJZA 4DDWA 1RJ9B 5TDHA 1II8A 1Z0KA 4A15A 5J4KA 3B1VA 3U60B 3VAAA 2GNOA 2AHOA 3BERA 3RC8A 4RZXA 3K9GA 4UKDA 2H57A 3QF4B 4A82A 3ZVRA 3ZS9A 4G1UC 4JLVA 5D3MB 4BLPA 1OH8A 1JR6A 1CJUC 2FN4A 2QT1A 2DWPA 4PHHA 1SHKA 5HKKD 3FMFA 2KBEA 1KSHA 3EX7C 2QP9X 1N6RA 4B44A 4HI0E 1G41A 3H84A 3WBJA 3LWNA 1E9AA 5LBIA 5FR2A 1CJMA 1FX0A 2ZS8A 4PZLA 4MRNA 5EXSA 1R5OA 1KNQA 4JLNA 1KSFX 4G5GA 2QMEA 2QPOA 1IJFA 1BIFA 3QXCA 5DGXA 4KITB 3SFZA 2AL7A 2ZRFA 2FSGA 1J99A 3HDTA 1LS1A 4EFMA 2J0VA 2CJWA 1N5LA 3LX5A 1II0A 3T1OA 1RC8A 2YWHA 3LDAA 4B3BA 2RGAA 1N6PA 2DWOA 4LJ8A 5G53C 3JZMA 5AUQA 1XFAA 1GILA 3HYRA 1CP2A 1XD2B 3DMDA 4NPHA 1VG0B 2WPDD 1E9CA 3TUJC 3LAWA 3FHTA 2ZSEA 3PENA 3AKEA 5EQTA 2VEDA 4RFVA 4OHWA 4OQLA 4TLBA 2DFLA 4HLQB 3IEVA 1EWQA 3UPUA 5EP3A 3Q9LA 3X1ZA 1IM2A 3THWB 1ZC3A 2EFCB 3GD7A 2F6RA 3GLHB 3TQCA 4A0FA 2G0NA 4TWZA 4PHFA 1ZP6A 2IL1A 1G3QA 3R9IA 2HF8A 4B35A 2OCBA 3EARA 1X8KA 5TARA 4QM6A 3OIVA 1GRNA 1E2QA 2QQ0A 3GFOA 1GL9B 4NCIA 3OHMA 3Q7QA 4BFUA 1E96A 1F2TB 2ZI7A 1QF9A 2OXCA 3QBTA 4G01B 2ECKA 2FZLA 2P0EA 4O3MA 4D25A 4EQ6A 3PXGA 2ZM5A 5H70A 3LQRA 3EZ7A 2FZ4A 4XSHA 4M0LA 4YMVA 1F3OA 3EPLA 2DCUA 1N5JA 2BDTA 4GMDA 4KSCA 3DMNA 1X3SA 4PAQA 5G3YA 4B48A 1QHIA 4HAXA 1CS4C 2P2LA 2WWXA 2ZI5A 3EC1A 3PUYA 1Q1EA 2C99A 4MRPA 1KJYA 3B82A 4QC2A 1GNQA 5IRCD 3K70D 1AJEA 4QL3A 1CBUA 1O87A 2RGBA 1W36B 3MJRA 5C46F 1XCPA 1NKSA 4TMTA 1E4VA 2GXUA 2XOKA 1S2MA 4DB2A 4A4DA 3KTAB 3EIQA 2ZR0A 1X8LA 4Q00A 5C1BA 1IY0A 2WM9B 1CU1A 2R8RA 2RGXA 2ZS7A 2V55B 3SZRA 3H86A 3KJEA 1VYTA 1NLYA 4HAYA 4RKFA 3U7FB 4L5BA 3K53A 5FPSA 3ZZUA 5TY0A 3UMRA 3CLVA 1OKKA 2WICA 5LB4A 3VHLB 3Q5EA 2ZSDA 4A8JB 4UNNA 2W58A 4MH0R 1YZNA 1Z5ZA 2IF2A 3WHLA 1KI1A 1T5IA 5AUPB 2EW1A 1X86B 3WHKA 4O25A 3T5GA 3ZIAD 2O8EB 2CLDX 1XTRA 1Z2CA 1F60A 2YWGA 5BN4A 1OFIA 2Q6TA 1UBGA 2ZU0C 3AQ4A 4TLCA 5G40A 3PJRA 4BLTA 1KO1A 2G1JA 4Y0VA 1SXJA 1T5LA 3AKYA 3VU9B 3IIKA 4OL0A 2C5LA 1G7TA 2C03A 3VKGA 1HA3A 5G3ZA 3K9HA 4DCTA 1QG2A 2DFKB 1LF0A 4Z51A 3KQHA 3TR0A 4RCYA 2JEOA 1Q44A 421PA 2QMOA 2GJAA 1QHSA 5CJ2A 1Z07A 3TIFA 2GF9A 1DADA 3QSYA 4A36A 2FFAA 2PMKA 2Q3FA 1D5CA 2WWIA 4I99A 4RD0A 5FOTA 1RW4A 1T0JB 5GVSA 1ONBA 1KK2A 1U9IC 3EZ2A 4GL2A 1MV5A 5B58C 1EX6A 1S96A 3L0SA 4PC3A 3Q7PA 3QXSA 2Z4SA 2IYLD 3CR8A 2JAQA 3DZ8A 2OCAA 2AD5A 2BMEA 2QA5A 2UZ3A 3I73A 1VMAA 1ELOA 4Q21A 1Z3IX 4GZMA 3D31A 3X1WA 2WZQA 1BYIA 1HE1C 2R6AA 4HAVA 4C4PA 2AWNA 3F8TA 1OB2A 2ZRJA 5GVRA 3I92A 4IDHA 1I2MA 5FL7A 2FDCA 5AJYA 1QG4A 3IIJA 4TLDA 1OE0A 1U8YA 1TX4B 5K8TA 4JIMA 4NCKA 3TH5A 5JHHB 5H68A 3A1UA 3TSOA 3A4NA 3Q8XB 4O2LA 5FTNA 1F2UB 4AWXA 1G19A 5JZVA 1YZLA 4PC7A 3QKSA 3UKDA 4Q1AA 2IXFA 4I1UA 5FTJA 2HJGA 1H8HD 1OF1A 2D62A 1OB5A 3B60A 3MWKA 3RABA 3KJHA 2QL6A 3VFDA 5IK2D 1OXUA 1G8GA 2BMDA 1Q1ZA 1OFUX 3ZH9B 3EPKA 1Z63A 4DSOA 4PPNA 4Q5IA 2C96A 2NG1A 2JASA 3VQTA 4DDUA 1JXMA 1JAIA 3THXB 2ZRHA 4PQYA 3B78A 5KDDA 2PJRA 1FOEB 2AK2A 2CCGA 3WP1B 3K70C 2JIZD 4HATA 4KI0A 3QVUA 1QBKC 1HT1E 2IYWA 1N6NA 5FUXA 4D26A 1FPMA 4RZ3A 4BEJA 4ZCMA 4ZO4A 3LW8A 4GOXA 4D0NA 2AWOA 2EWVA 2A2ZA 1OXTA 1P60A 5GJWC 3SHWA 3IPXA 4MKFA 3GLGA 1G20E 1Q57A 5J40A 5FFMA 1EFRD 3HU2A 1XF9A 2X1VA 3W6OA 2OFXA 5H8WA 2IS2A 2N42A 3TK1A 4GFDA 1UEJA 2QE7D 3OESA 3H2YA 2FA9A 3S1AB 1Z0DA 5BN3A 3I8SA 1T0HB 4Q7JB 1AKYA 4EFLA 1R8SA 1W5TA 2G6BA 1W4AA 1NRJB 5JLJA 5EXXA 4FN5A 4AURA 4JVNA 1YE8A 3F3YA 3I72A 1YZKA 4YMUA 4B2IA 1GKIA 1EFHA 4D0GA 2FMXA 4ESVA 5FOXA 3TE6A 2BKUA 2Q3HA 2A5DA 1GOTA 2BBWA 1M2OB 1IXZA 4PPQA 3NTUA 4BFXA 4JLKA 1N6IA 4P31A 2ATVA 2GJKA 4GPTA 4QNRA 3P4XA 3PV0A 4M9SA 1FX0B 3U3RA 1EG7A 4URZR 3KJGA 4AI6A 2V54A 2WV9A 1JJ7A 3RS7A 4TMXA 1KKMA 1IY2A 1ZNXA 4DSNA 2Q21A 2JCSA 2NQ2C 5FTLA 1FW6A 3CNLA 2ZVQX 3LW7A 4YXWA 3U5ZB 1HY3A 2KI5A 3VR3A 4AKIA 1P5ZB 5TB5A 4TSFD 2B8WA 4HAWA 4CF7A 4B43A 4QBHA 1Z47A 1G8YA 4TMWA 5DI3A 4DSTA 2RGCA 2ZANA 3W6PA 2BBTA 4A6XA 5JJKA 4P4SA 1IN6A 1U8AA 5FL3A 3SQWA 1US8B 2ZQ5A 3PQCA 3TAUA 3PUZA 1T3SA 4OQMA 4V0LA 3VR5A 4DDVA 2WMOB 1AS3A 1A2BA 2NZJA 4XVUA 1RJ9A 3SBDA 2ZJOA 3MSXA 3E70C 1W1WA 1SQ5A 5F9FA 4MYCA 5AJZA 3B2EA 2CMKA 1VYUA 3A4LA 5FUWA 3AVXA 3C16C 2QAGA 1S1MA 3OEHD 3LLUA 4B6EA 4O2RA 1E69A 2HLDA 3RS3A 4FWIB 4DJTA 5GADl 1LVGA 3LXXA 4CRWB 1TU4A 2GILA 2ZRMA 2F43B 4BQSA 2QU8A 4RFSB 3TLXA 2XB4A 2IEYA 2CVHA 1J7KA 1L8QA 4CEIB 3QQ5A 4MUAA 2RMKA 1XD9A 4XVQA 2YC2C 1ZIPA 3REFA 2O8BA 5CYOA 4IKEA 3CO5A 5GJVC 2RGDA 4V03A 2O0HA 1NKTA 2RGEA 5TMPA 4U00A 4Q7LA 4I81A 3W8NA 1I4TD 4OQFA 3ASYA 4PPFA 1NBMA 1XEFA 1XEXB 3D6TB 4ZIRB 1IXSB 1ZM9A 2C9CA 3KKOA 4M53A 1FL9A 2O5VA 1JJVA 5SZKB 4WZ6A 5LD2C 4HB0A 1M34E 2FFBA 2IYSA 2PJZA 3L82B 2C2HA 5L3RA 1RYFA 5DHAA 3IIMA 4CEJB 3TAHA 1TEVA 3MG9A 1DAGA 1KYIA 2ZR7A 4JL6A 5A0FA 3CWZA 1KY2A 1E9SA 3HR8A 1IY1A 4KODA 1E9BA 1N5KA 1XD2A 2CXXA 1NVUQ 1N5IA 3HWSA 4M8NE 2JLUA 1OH7A 3ZQ6A 2XNDD 2ZYVX 3KUCA 4L4UA 3BH7A 1OKKD 3EIEA 1SVOA 2XZPA 5GJCA 2XJ9A 4MGYR 4L16A 1DPFA 4XSGA 4BPBA 5KPJA 4IDPA 4C7OA 4ZDWA 3WMFA 2VA8A 3KFVA 1FTSA 3B9QA 3MWJA 4OYHA 2ZUCA 3AF0A 2H16A 2K5UA 1Z0FA 5AJVB 1YR8A 3B1ZA 4R71A 2AD1A 1NF3A 3PCRB 4IRUB 1KTVA 3WP0A 2F1HA 2EYQA 2R44A 2IYQA 3EC2A 4NTZA 2ZPTX 3UIEA 2IYRA 3UMSA 1N6HA 3IGFA 2HYIC 1ZC4A 3NVAA 3UWKA 2JDID 4L9WA 4NYJR 3T1VA 5JWOA 4PQRA 4Q1CA 1GNPA 4OK3A 1Q1BA 1G7SA 3HYTA 5E7MA 2NZ8A 1BOFA 3HPQA 5DN6D 4HB2A 1R2QA 4RD1A 2D4HA 5CIQA 1GAJA 3K09A 2G88A 1YVDA 2GRJA 3FHCB 4FI3C 1GIAA 2V1UA 4XD7D 2VP9A 2OBMA 3R9WA 1JR3D 2IHBA 1J70A 2QZ4A 2V6IA 1Q0UA 3DOEA 2FU5C 4CIDA 4NONA 1DVRA 2CNWD 2UVQA 2WAXA 1G6OA 1EFTA 2FJUA 3AF3A 4AKEA 3H1TA 4GT1A 5FOUA 3GEEA 2X2FA 3BC1A 4KYIB 1MKYA 4OHYA 1AZSC 3GJ3A 5CB6A 4IEEA 1ESMA 1XRJA 4JKYA 2WJJA 1LTQA 3CM0A 2BJVA 1WE2A 5H1YA 3KTAA 4M21A 1EESA 3SC3A 1Z83A 2VP4A 5CK4A 5FOVA 1UKYA 3QPWA 2ZYTX 1XJQA 4LI0A 4QKQA 1H8EA 3PUXA 5IHPA 1KJWA 1FUKA 221PA 4EPWA 3REGA 4KLNA 2WJHA 4OHXA 1VIYA 4K8OA 3CRQA 2C04A 4A8JA 4IFBA 4G5SA 5E95A 4C0SA 2W6JD 2WKRA 2W00A 4Z1MD 1KAOA 1TF5A 2FG5A 3KXLA 3QXJA 5L3QB 1XTIA 2MMCA 3TW8B 2C77A 4OQNA 4QHSA 5F2EA 3KXIA 4R7ZA 2O8EA 3QNUA 3MMPA 1W0KD 4OK5A 3QKSB 1MABA 2H1LA 2CVFA 2PLRA 4RD2A 3VU9A 3IBYA 1L7VC 1E6CA 1V5WA 2WVJA 4D0LB 3IQXA 1OYYA 1FNMA 4L8GA 3QEOA 2PBRA 3R9XA 2IYVA 1XTJA 2G77B 4QJ5A 4BFYA 1NLZA 2HYDA 2P6NA 4IVPA 1OXSC 2ONKA 1ESNA 3K0EA 1G7CA 2LWIA 2YNMA 3WMGA 4OHZA 1NLFA 2OESA 2X19A 2VP0A 5E3HA 2J3EA 4JS0A 4U7DA 4BECA 1NIJA 2KJQA 4LBWA 2KWIA 4KVAA 4D2IA 3B85A 5KSPA 4OK6A 4EPVA 3W9YA 3RYTC 3EZFA 1U99A 3GP8A 3KUDA 1UF9A 2WSSD 2ZSBA 2ZRKA 3LBHA 121PA 4B3GA 1M8PA 1DO0A 4DKXA 3LLMA 2GVZC 1KZ7B 3QKUA 4ASUD 4DCNA 4JKIA 2Y8EA 1BMFA 1HT2E 3GLGB 2BV3A 1CR2A 4LJAA 4BLQA 4FWTA 4CVNA 1WCV1 4ZI2A 2PEZA 2D2EA 2ODNA 3T34A 2ZEJA 3EIHA 1EFCA 4DLUA 2NO9A 2EVWX 1W5SA 1QHGA 3UMFA 4BFVA 4AYXA 3KB2A 3IDQA 2VHUA 4Z54A 1NL3A 3WNDA 2QROA 4FXPA 5SZJA 3QUSA 4TYWA 3L2OB 2QPAA 4FCVA 5C2JB 5JMTA 2ZYWX 2CCKA 2QAJA 2W0SA 1NG9A 2MSEB 1FP6A 3VNVA 3LBNA 4JBYA 1XP8A 4WAUA 4LJ9A 4JLJA 3L0OA 1UFQA 4PX9A 3I5YA 3KL4A 4ZCLA 2VSFA 1OXXK 4B71A 1A2KC 1Z22A 4DWJA 2J0SA 1NP6A 4MRRA 4Q1DA 4Q1FA 3MWLA 2VL7A 4A2PA 2AR7A 2WMNB 4DLVA 3V4RA 1EFUA 4JYBA 1Z6GA 2PZEA 1NVVR 3L0IB 2F3TA 4B73A 2OXRA 4TL8A 3ADCA 2EFEB 2QTFA 3THXA 1NN1A 1HYQA 4QGAA 3K0CC 2W2XA 2CK3D 3K8YA 4ACBA 2WJYA 3NBXX 4DSUA 5KTYA 4AY2A 1D2MA 4EUNA 4GDFA 2PCJA 1KNXA 3DDCA 2ANCA 5C4GB 1FFHA 1X8JA 2IT1A 2QG6A 2GETA 1G16A 2RHDA 3BWDD 1ODFA 1E2LA 2JLSA 3U7HB 4YMSA 2C9OA 3LXRA 4P4SB 2Z4RA 4C2TA 3O8RA 2A5YB 3WXMA 2YKGA 2IS6A 1GFIA 4HZUA 4KFTA 1IAQA 2GAAA 4NP6A 3GEIA 3ZVLA 4WXRA 2YV5A 1G21E 3LX8A 1S8FA 3NBZC 4JSTA 4TMKA 5JEDA 3A1SA 3S1AA 1ZNZA 4WZBE 1RPZA 2OEPA 2IXEA 1NMZA 2QP3A 3T06B 1CKEA 2QAGB 2KB0A 2IEZA 2ZRAA 2BBOA 1SKQA 4AD8A 2Q9BA 1NVWQ 3EZ6A 2D3WA 3UWOA 4XWOA 2ZREA 2PL3A 2CL7X 1KSGA 4DXAA 4LHYA 3BGWA 4TL7A 1S3SA 4XVRA 1COWA 3QENA 3BB1A 1P61B 1GKYA 2GBLA 1GSIA 1WQ1R 3BRWD 5HTKA 2JLZA 3THOA 3N2EA 2O8BB 4QRHA 3UG7A 4ZV4A 3MAAC 4LPKA 1E79D 4OI2A 3CH5A 2GK6A 1P9RA 2CCJA 2W2VA 5SZHB 2HJVA 2GZHA 2JJ2D 1R0YA 2RGNC 1A82A 2AK3A 2IUTA 1KK0A 3ZGXA 5HCNA 2HT1A 1E2HA 3FFAA 3VR4A 3SU8A 3EWAA 1KO5A 4WVFA 4D4LA 2YJTD 1RE0A 2RHMA 2XTMA 4HUQB 1UAAA 4JLPA 3X2SA 4YQFA 2ZJZA 3KKQA 1W7AA 4NE2A 3HR7A 1FP7A 3SDZA 5KSYA 1JEEA 1XPUA 1US8A 3FKSA 1KHTA 1Z28A 4BGDA 3QEJA 3BBPA 4LSGA 3W3AA 4IDOA 3NHAA 2XSZD 4C7OB 4HYYA 1KY3A 3A36A 4FD2A 1E99A 4B3CA 1TUIA 3A37A 2IA5A 5HE8A 1VG8A 3E2IA 4C30A 2JJ1A 3WRXC 1FMJA 3IHLA 2QENA 2QY9A 2F3RA 3ZZ0A 2F43A 2DPXA 1MO3A 2WIBA 3VNUA 2R65A 4GI7A 4RFSA 4DEYA 5B64A 4OBEA 3IEUA 2QM8A 5HR5A 1N0UA 2PX0A 3KQUA 2Z5FA 3QKTA 3FYHA 4E22A 4CEIA 1XBTA 4LBYA 2IYYA 1XMVA 2VIIA 1VKJA 3OE7A 4W9MC 1JALA 4L9SA 5K8LA 4BFZA 1VIAA 1KIMA 4MQBA 1P62B 5FUYA 5L3VA 3AKCA 5E4FA 5EP1A 3L8YA 4LK2A 3DKVA 2A7QA 3HP1A 1XEXA 1VHLA 4X8MA 1AM4D 3RS0A 2UKDA 1XTQA 5BYKA 4F4IA 4ZIRA 1Z8FA 4WW0A 5JS8A 1YZGA 2Q9CA 5KU1A 2CHVA 2CLCX 4I4LA 3R8FA 5JHGB 1B0UA 2EFDB 2ZRPA 3DZDA 2FX3A 5FPHA 4M1MA 1YU9A 1IONA 4CEJA 1ZM7A 3GJ7A 3TMKA 1YR7A 2E9SA 3MJHA 1GL7A 1RIFA 3CZQA 4TN1A 3JZAA 1J8YF 2IWRA 1DAHA 5DI9A 1XCMA 2JGNA 3AP2A 4Q1BA 2X8AA 1KMHA 4G5QA 2O8FB 1AN0A 4KLZA 2MSDB 4D80A 3TGPA 2JATA 5JWRA 1RRCA 1MRSA 4OI4A 5FPYA 5CLQA 1X1SA 5JRZA 1E2EA 5DO9A 1R0ZA 4NHOA 4NYIR 1ZM4A 4LCBA 3B8HA 4A0HA 2WBLC 2H5EA 1ZUNB 2NO1A 4PAMA 3T1QA 4LX0A 5J4LA 2W0MA 1A4RA 3RANA 3W90A 4US2R 1HURA 1DAFA 2PZFA 2R6DA 3X1XA 4TZ0A 1UBFA 5CDFE 2QBYA 3O8DA 4NH0A 4CZ2A 1E9RA 1NNEA 1ZD8A 1PLLA 1JAHA 3C41J 2PX3A 4PHGA 2YOFA 2H8KA 5EUMA 2VBCA 3VR1A 1MABB 1UM8A 4LGMA 3WRYC 2HUPA 5KHOC 3T5DA 4H1VA 3QG1A 1E9DA 2QSZA 2ZITA 4DCUA 1N25A 1Q22A 3CX8A 4KYUA 3VMFA 1QZXA 4MKIA 4B75A 1W4RA 1T4GA 3NG1A 5HE9A 2XXAB 3Q85A 3VKHA 3ECCA 4GSYA 3SYNA 3SNHA 3W5IA 3I61A 5KUTA 4TQAA 4D4JA 4TLAA 5FTKA 1MOZA 1XNJA 1UPTA 3CPEA 4BWYA 1E2IA 5F98A 4DLYA 2WJGA 3G82C 2FFHA 3N2IA 1Z6XA 4LHWA 4F92B 3F5FA 5EP2A 1MO4A 3T35A 2KSQA 4DT1A 3BFKA 4NCNA 4GBMA 2CLSA 4M9ZA 2ZXUA 3ZS8A 4WXPA 2OT3B 4PAOA 3T15A 3NH6A 2OM2A 3BB3A 3AF1A 1D8TA 4NYMQ 2OZEA 3O47A 1NY5A 3CWQA 3I1FA 1XZPA 3BH0A 5FI0B 3M0EA 3GLIE 4B74A 2LKDA 3EZ9A 1S0UA 5EJEA 3T61A 3NWJA 4CEHA 3QXXA 3J81k 3X1YA 3C8UA 3CX6A 4LC0A 4NL4H 3TSZA 4DBLC 1R5NA 3VR2A 4ZDIA 1Z29A 4DUGD 5L3QA 2JLWA 4E07A 3AGPA 1CXZA 4IJMA 1G8PA 1U90A 2HEIA 4R9UC 4DB4A 1WBDA 2VHQA 2OFWA 4AYTA 2J46A 4EPYA 3DHWC 5KDLA 5IT5A 2GF0A 2BKEA 3M4YA 1G6HA 5TXGA 2GK7A 5JWHA 2FPMA 1E2KA 2H92A 2C8VA 3I8XA 1E0KA 4FW9A 1OFTA 2J1LA 2MSCB 1P6XA 4UNRA 5ELXA 4TTRA 1VCNA 2UZIR 2XGJA 1KI2A 3OFNA 3P1JA 1U81A 3AVPA 4ARZA 3U6BA 5CJPA 1YQTA 1RRPA 5BYJA 2F9MA 1YHNA 5KSOA 1D6JA 1OIWA 1PJRA 4C3ZA 1CULC 2FF7A 2OV2A 4QGHA 4UNQA 4S2EA 1JPJA 1VHTA 1B23P 2ZSFA 1W4BA 1WDTA 3HU3A 4YC7A 4Q9JA 3VHXA 1SVIA 1E0AA 4BLSA 3TNFA 2ZUBA 4LYFA 1AKEA 4HZUB 4JLOA 3TR5A 2X77A 4V0ME 4X8HA 5BQ5A 2HT6A 5UKDA 1VDZA 5C18A 4M1SA 4M1TA 2GEVA 4LWZA 4RD4A 2QT0A 4WIAA 4Q4HA 2CHQA 3IPYA 2VTKA 2W6IA 2F55A 2B21A 3NH9A 3DEFA 2GZAA 2IUSA 4EJSC 1Z06A 3NC1C 4HLUC 3SHFA 5HZHA 1LFDB 4Q4AA 3AVVA 1DE0A 2VSXA 3CNOA 4M1KA 1OHHA 4DLTA 1Z6AA 2J87A 3U44A 4QJ3A 4P32A 5DH9A 1FQJA 1KDOA 2VHCA 2VLIA 4I1SA 1TF2A 2OCYC 4WZAE 4QNMA 2G3YA 2V6JA 1D9ZA 4NKRA 2CL0X 4ZKDA 3H0KA 4MYHA 3FB4A 4QBIA 1JR3E 1XXHE 3TVDA 2AXPA 2JLRA 1G4UR 3LD9A 1RKBA 5KDOA 1GP2A 3OAAA 4B3DA 4JLMA 8OHMA 1AS0A 3CF0A 4Q9HA 4FMBB 2IW3A 4RCZA 4B2LA 3UXMA 5L3SB 3KXKA 4NCHA 3GCGA 2CE2X 2ZRGA 1ZM2A 3E5HA 3U3MA 2NPFA 3RRNA 3DVLA 4FINA 3FVQA 1J8MF 3LA6A 4TL9A 3IO3A 4CT4B 1MT0A 2B8TA 2OUKA 3AF4A 3RRYA 2ASEA 3GJ6A 3OIWA 3H4MA 4PSAA 1E0SA 4TL6A 4Q66C 4G5OA 4RVCA 2IYTA 2DB3A 3SBEA 3RS4A 2J7PA 3NXSA 2IC5A 4PTLA 1SULA 1XZQA 3LFUA 2DFTA 1E1QA 3P27A 3SR0A 2N1BA 1LW7A 1E2GA 3TRFA 4B2PA 4BZXA 1ZRHA 4FCWA 4PHTA 2IWHA 5F9HA 3SQXA 2RAPA 3IILA 4AC9A 3NEJA 1N3BA 3NBFA 2IS4A 3K9NA 2YVUA 2EYUA 4BEBA 4DLRA 4G5RA 3ZD7A 1LV7A 1NSTA 4HAUA 2V1XA 1DS6A 2ATXA 2J0UB 4QBGB 1S9HA 2FNAA 1Z6YA 3AP3A 4AK9A 4F4CA 4DIEA 1IN4A 2XNSA 3M1IA 5CLLA 4ITRC 2CL6X 4JMPA 3R7WA 3SOPA 5JCPA 2Q0HA 5DE3A 3CRMA 1OYWA 3GLIB 1TADA 2XOKD 1GRRA 5CM8B 1ZCBA 1UJ2A 3P20A 4HUQA 2V9PA 2OBNA 4YLGA 3A6PC 5FPKA 5AK0A 1C9KA 1Q21A 3ICQB 1A1VA 2F1IA 2OHFA 2YWEA 3GFPA 1KMHB 1P9WA 4DEXA 1KI7A 4MITA 1CEEA 3GEHA 3NHBA 3SS8A 4NCJA 1XWIA 4MKHA 1GM5A 2FOLA 1M7GA 1AQYA 1AK2A 3K0AB 1AA9A 4DIDA 2VF8A 4D82A 3TJZA 2RB4A 4LPSA 4F7WA 4B76A 4BLRA 1P73A 4TT3A 4KAXA 1IN8A 2BEJA 3CX7A 3Q72A 4LZZA 2G0TA 2Q3MA 3FFBA 4KHZA 3W3ZB 3FHOA 5EXPA 1UKZA 2ODWA 2QNRA 3DM9B 3G5UA 4A2WA 1SXJD 2QBYB 3U4QA 2ZYUX 4M2LA 1CR0A 1XJCA 4MYTA 1TMKA 4PC2A 1OJLA 1YRAA 1GRQA 3QIAA 2O8CB 2BHRA 2R6FA 4UNPA 2FGJA 3EPJA 4NDZA 4OJQA 4URUR 5JSZA 3B6EA 5CM9C 1CIPA 1VECA 3CRVA 2VP6A 4KFRA 1DAKA 3SYKA 1U9IA 5EE3A 4F38A 5EXTA 2WPDA 4QHTA 1U2RA 1MRNA 1AZTA 1RRFA 2IYXA 4HZIA 5KPDA 3VTKA 4XTCS 4O0MA 4B3FX 3D8BA 3AEZA 1K5DA 4PZZA 4V0NA 5KO2A 4AKGA 1BO6A 5JBQA 3N5CA 1JI0A 1KI3A 4Q47A 1OPXA 4IVQA 4KV9A 5E7JA 2REOA 4NMMA 1OW3B 3P32A 1PVOA 4NU0A 3LVRE 2Z0MA 4BRUA 2P67A 3D7MA 2O8FA 4PO9A 4DT1B 4LC1A 1R6BX 5FL7D 2A5JA 1RZ3A 3ZVNA 2NGRA 2HXYA 4Q4JA 1EWRA 2I3BA 1G9XA 3TVTA 1ZYUA 2GKSA 2N46A 5A4JA 5GJBA 4CYMA 3QPUA 4MRVA 2BJWA 2ZI4A 1ZU5A 2FSHA 2HCJB 3KDSE 1R0XA 3P26A 2ZJ5A 4EIWA 1E94E 3V4FA 1E1RA 2ZJYA 4IOKA 3WBKA 3GMTA 4Q02A 1SGWA 3NIBA 1ZINA 2OSBA 2NIPA 2I1QA 2CBZA 2F1JA 4CEHB 3U6KA 2J59A 5FH9A 1H65A 1QHYA 5FUVA 2B7BA 1JEDA 4JL8A 5DNYB 2VP2A 2V4ZA 3KZ1E 4LJ4A 5TV2A 1Z0JA 2O0JA 5CIWA 5LPNA 2R2AA 4E09A 3AUXA 1O3YA 3EASA 1GVNB 1Q3TA 1C1YA 1G3RA 2FH5B 4TYPA 2QMUA 4UXHA 4DLWA 4I1OA 2NMVA 1IBRA 1OIXA 2AXNA 4B33A 1ZNYA 1ZW6A 1E2FA 3VX4A 3QI2A 2FEOA 4LHZA 1OH6A 1NY6A 3V00A 2XXAA 3LNCA 4KSBA 3MLEA 5J4YA 3B1WA 1GZSA 4HB3A 1K5GA 2ZRDA 3T12A 5CK5A 3FMIA 1C4OA 4TQUS 2P5TB 3ADKA 4IOLA 1ZUHA 3W34A 2ORWA 2ORIA 4ARZB 2PT7A 3SYLA 4JBXA 3AM1A 5JFGA 1HTWA 1U0HC 1TAGA 3UATA 3GLFA 1JBKA 1NG1A 4A92A 1SVWA 1ZAKA 3PG5A 2QORA 2WTUA 5E7IA 3ZD6A 1VCMA 1I4LD 1MO6A 3AVUA 1OT3A 1IQPA 3LBIA 2ONJA 4BASA 4C0QC 3A8TA 3ZZTA 1RVDA 3IUYA 3ZIAA 2P5SA 2WWGA 5BW8A 2BEKA 5DYIA 2C98A 4KXFB 1X6VA 5BXQC 1UDXA 3GPLA 1XPRA 1QVAA 4QFMA 1FZQA 1VG1A 4C2UA 1NMXA 4DZZA 2DR3A 4RY2A 1G3MA 3ZVMA 5FBVB 1SXJC 3OEEA 3IHWA 1DBSA 2LCFA 1N0VC 1T3LA 1R8QA 2BBSA 4C0AC 4Q4HB 5JEEA 3QF7A 2KE5A 1OSNA 1P2TA 4OQXA 1M7BA 5JJLA 3DL0A 4LJYA 1G3IA 3AVTA 3B5JA 2DY1A 1S3GA 2ZI3A 2ZRBA 1ZNWA 4Q4AB 4E5UA 3FKQA 4YXWD 2GESA 3NC0C 1KSJA 3U44B 1T91A 2B7CA 4QJ4A 2DBYA 3CRW1 3RNLA 2NPIA 2GAOA 1HUQA 4C0HA 1E0JA 4UJ5A 1KGDA 1JECA 1KDRA 2PT5A 3A1TA 3BD9A 1XMIA 3CZPA 3FPAA 2WWYA 1S1CA 4URYR 2ANBA 4UNSA 4YDSA 1JQJC 1BKDR 2BOVA 4W7SA 1F48A 3PITA 4LJ5A 3TW4A 4PPGA 1SVSA 4A9AA 5A5GA 1TF7A 4ZDJA 1S4QA 5HPYB 3IO5A 4OI1A 4B47A 1P2SA 2QP4A 2WJIA 4HLDA 1SKYE 2PCLA 2VHTA 1KO8A 2B6HA 3GFTA 2IX3A 4Q7KA 1VCOA 1K6MA 5CYPA 1G7RA 2BC9A 2VP5A 5BN5A 1DG1G 1HH4A 3FWYA 2ERYA 4ZPXA 4LYHA 4ESHA 1SHZA 2OLJA 5JJIA 3BK7A 2HLDD 2PLFA 4YONB 1OLOA 4X8OA 1ZUIA 2EQBA 5KNDA 2ERXA 1A5TA 1H8HA 5AUNB 2OCPA 4KFSA 1G291 2WOOA 4UJ3A 1ZM3A 2YC4C 4P4UA 2Z83A 5IK2A 2B92A 2AKYA 2OFOA 3U7GA 5FBLB 2QM7A 2PZGA 1DEKA 4EPXA 2PMDA 4M9QA 1KI6A 5FTMA 1QDEA 3GLFE 3V9PA 4M1OA 3NKVA 2D74A 2OLKA 3Q3JB 4NYIQ 4XJXA 1KO7A 2AN9A 1EX7A 1HQCA 2D2FA 1NBMD 4R2IA 1G3UA 3ZJYA 1XB2A 2JIZA 3AVWA 1WXQA 2CEAA 1WF3A 4ZDKA 4KCGA 2GJ8A 3SE0A 3CUEF 1W4CA 3WYFA 2HDNB 2ODBA 3CR7A 2WAYA 1XEWX 5FR1A 4D81A 1W2HA 2GXQA 3QJYA 621PA 2NO0A 4G3XA 1OIVA 4DDTA 1EFRA 1CLUA 2ZTSA 3R7WB 4BRWA 2WHXA 3CIOA 4XWAA 2O52A 3MWYW 3KB1A 5ANRB 2QE7A 3BAFA 2WKPA 3O8BA 3QPVA 2IYUA 2ZI6A 3BFXA 5JECA 5HCIA 3NDBB 1PZNA 5FBQB 5CDFA 4K46A 4JLDA 3FGNA 5L3SA 2JA1A 4QBFA 1ANKA 2XTZA 1YR9A 3QKRA 2D06A 3AB3A 4EFNA 4TT3D 4GOJA 4TYQA 4ABYA 1XDBA 3FDIA 1XMJA 3L8ZA 3CONA 4Q19A 4POAA 521PA 1KMQA 3M6AA 1FQKA 3LVQE 1G8FA 1U8ZA 1Z0AA 5AUOB 1OH5A 1WMSA 1UADA 4JLBA 4OI0A 4GP7A 4N0DA 1G64A 3CF6R 4V0KA 4K81B 2EFHB 4TYNA 4URXR 2I1VB 5EE5B 2AFHE 3EA0A 1UBEA 2IXGA 5JCZA 2QTVB 3L0PA 4Q9KA 1Q20A 2BMFA 3ICEA 1IOZA 4US1R 4HUTA 2GCOA 2IF0A 2JJ8A 1BS1A 2G9NA 2C9YA 3BB4A 2IBMA 4OJKA 3U4QB 4TSFA 2A5GA 1OXVA 1CR4A 2FGKA 1N6OA 1E2JA 4IXMA 1J2JA 1T9HA 3U3OA 2GCPA 4EDHA 3ASZA 3AVQA 2JLXA 5JSZB 4IEIA 3HJNA 2GXSA 2J0UA 1QVRA 4R98A 2JLVA 3AVYA 1WB9A 1JXOA 2CDNA 4JLAA 3W5JA 1E2DA 2ZAMA 3F0TA 1AIPA 3A1VA 4Q48A 3WYGA 5J4VA 1W36D 1P9NA 2IUUA 2WWHA 2GZDA 3GLIA 3BFVA 4D4KA 1EGAA 1DG3A 2Q9AA 4HAZA 4Y0AA 1ZCAA 2ZE6A 4U02A 2XAUA 2RH5A 4PXAA 3C14C 4W5JA 3OEHA 5EZ6B 3C15C 1H8ED 1R5BA 1E1RD 1XTKA 1HV8A 3AV0B 5L8VA 1SZPA 3CNNA 4EPTA 3LRPA 2VYFA 4KO8A 2O8DB 4ZCIA 4LJ6A 2QAGC 2D7DA 1E2PA 4IW3B 5LB2A 1XPOA 4Q4JB 3VR6A 4FIDA 1M7HA 1TPZA 1GKUB 4EPRA 2ZR9A 3RSLA 1TTTA 1JPNA 2F9LA 4Z8YA 3K0AA 4KBGA 1CR1A 4B3XA 2DWQA 1M74A 2QPTA 2ODEA 4N0EA 2QQEA 4L15A 2F7SA 1XMSA 1KI4A 2F1RA 2P6UA 2ZJ8A 2XZOA 2WJVA 3C7KA 1RFLA 3KQLA 3ZLJA 2PH1A 2WSMA 4M4SA 2XITA 1JNYA 1XCGB 3WY9A 1V43A 1X1RA 1QRAA 2Z43A 4URWR 2VRWA 4G0NA 1VTKA 3SN6A 2O8CA 4QGFA 1SKYB 3LH5A 4AYWA 2MMGA 2ZS9A 1KK1A 4H9GA 3K70B 3CB4A 4TZ6A 1DELA 4CT5A 1KZGB 3T1TA 1IN7A 1K8RA 1UEIA 2WWFA 2XNDA 1PUIA 4ON9A 1VPLA 1N6LA 1E2NA 2QGZA 4U5XA 3SJZA 1NN3A 2R9VA 3A1WA 4FMCB 4V0MA 2GTPA 4M22A 3W8RA 1XEWY 2SHKA 4RJLA 4Q9IA 1QHXA 3TQFA 4B6FA 1ZU4A 3SJAA 2IK8A 4CDGA 1BMFD 3KJIA 2NTYC 3RVBA 2VSOA 3OIYA 3RC3A 3GLFB 4EAQA 1WP9A 4MRSA 3WNCA 4DLSA 5B30A 1P2VA 5G41A 4RZUA 3ND9A 3WYAA 3ADBA 5FI1B 3OIUA 3EA5A 3K0FB 3LY5A 1L4UA 3THYB 1KO4A 2FSIA 3TBKA 1DAIA 1KI9A 1YJ5A 1WRBA 3OEED 4XWKA 4EJSB 2JDIA 3B1YA 2X2EA 3RLFA 1SVKA 4JVLA 4JYCA 2XJ4A 2WOJA 5AR1A 4RZ2A 2OE2A 3TKLA 2QRZA 5DN6A 2DFNA 4LY6A 2HV8A 2A5FA 1DOAA 1GG2A 2YYZA 2ZSAA 3I3SR 3IBGA 4YMTA 1XD8A 1QHNA 5AWFC 2OAQ1 4MYUA 3GJ5A 1NIPA 4F93B 3FTQA 4XD7A 4BZQA 4JVSB 3ZQJA 4DC9A 1JR3A 4BFTA 1XXHA 3K09C 1Y63A 3FE2A 5CITA 3RHFA 5M04A 1G5PA 4V02A 2CNWA 3K0CA 1G4AE 2NOAA 2ZE7A 1U0JA 2QN6A 1RRGA 5FOWA 1M6NA 2J41A 4LOAA 4PO8A 5F3WB 3C5CA 4P3YA 2J7KA 3CW2A 3MUFA 3ONWA 4M1WA 1FTNA 2HCBA 4FCTA 3AP1A 3B1XA 1UDWA 2OO7A 1W36C
chains in the Genus database with same CATH superfamily
4EI9A 3NHFA 3W5AA 4YAKA 1SC3A 3UCEA 1NPTO 1TEHA 1BX3A 1X38A 1Y6RA 1MR3F 2I9PA 2QVBA 4EF6A 4WACA 4G36A 3CTPA 3G2JA 3IPAA 4UVIA 2LD4A 3KHUA 3LQKA 4Q4LA 4H7HA 4CW7A 1FMLA 4TS1A 1LSOA 1KOFA 3P0EA 4X54A 4WNAB 1NQOA 4OJNA 4Z7QB 1XAHA 2B30A 3UAZA 1GD1O 3P19A 1TM4E 4LYYA 4MCAA 4UXIA 5AJHA 5C4MA 3BREA 2QLMA 2OAP1 4Z1MA 4XUEA 1Y7LA 2HGZA 3EQ7A 1M2EA 3OSZA 4A8JC 2FAXA 3UK1A 1W4LA 3VZQA 5CLIA 2VI5A 4YDRA 1YGPA 2C3PA 5EKSA 4EABA 1W0KA 1KYTA 5JR3A 1E98A 5EZYF 1OX4A 3O6VA 1SCAA 1R0WA 1SEPA 1UP7A 3KT3A 2INGX 2Q4DA 1M2HA 3HGTA 1COWD 1VFPA 3W05A 1RQLA 4EARA 4BCBA 5BUZA 2PUEA 3OF5A 5LOVF 1WXHA 3S1SA 3D3EA 3EXIA 1N4DA 5ALMA 1A5AB 4G0QA 5E9WA 2FDRA 4L50A 2VXBA 4ZCTA 4JEHA 5KOHA 1AK1A 2GPAA 4QM7A 3UT5B 2B1QA 1XO1A 3QE0A 4Z8XA 4BFWA 2A1TR 3LLVA 2W83A 4RENA 4X1KB 2OFFA 3B6MA 3KKPA 2IYZA 2YMMA 1BXGA 2AE1A 1DO2A 3DWGA 4MV0A 1X9HA 4WN3A 2R6JA 1W0JA 4RIIA 1MRZA 2W2QA 1EFPA 1PSWA 4QD3A 3UTCA 1RBMA 3W1VA 2GD2A 2X8JA 3D0QA 1LSSA 2IXAA 2PKWA 1CF4A 4QVGA 1NFFA 1RQ2A 5BWMA 4CLDA 1U1DA 2PTGA 4JSYA 2GD0A 4WKGA 4ASUA 2NP6A 1CJVC 4Y2GA 5BQFA 1KETA 3PDIB 3V3TA 1J8VA 3ZUGA 1XZCA 5ERGB 2D2VA 1M8GA 2CXNA 1ADCA 5E2AA 5HEKA 5B7NA 5DRTA 3T7EA 2ETXA 3SHQA 3DCJA 2A9KA 1RI1A 3ERCA 1ZD3A 1QX4A 1XU4A 3FWNA 2RAUA 2OTCA 4EDFA 4Z4FA 3HKEA 3OLYA 5KYNA 1JA0A 1PJ3A 1H2YA 1NVBA 4CQNA 4P0QB 1ABEA 3G8BA 2GJ9A 1I0LA 4ZO9A 1O54A 3WLRA 1NSFA 4V2UA 3OQIB 3GIWA 3LZCA 3H9EO 4DVGA 3L4JA 5HFJA 2JJ1D 1RYHA 5JROA 2CSXA 3GX1A 4CKZA 1X1QA 3O9MA 2NZWA 1XZBA 5EJ8A 3NX4A 1XWFA 2WWTA 4JB0A 5AOVA 5C5CA 1ZK2A 2GRUA 4JP1A 2GO1A 6REQB 3FR7A 3G0HA 1EKXA 1P3JA 4IDNA 3H75A 3LQYA 4UM5A 3G0CA 1HLGA 1IFXA 2VJYA 3F5MA 4IDQA 1M2VB 5LKAA 3GRUA 3U49A 1NYTA 5T4FA 1JDBC 1WO8A 4Q3DA 2ZB2A 3BSYA 4YJFB 2GCOB 1Y3HA 1ZD9A 4JDUA 3LPMA 2EDCA 1QYDA 4F84A 1R12A 3OPNA 2Q1XA 4TUYA 5K4GA 3ORYA 2EBUA 4CV3A 3R44A 3PBKA 3GEBA 5JNLA 5LN1A 1Z7WA 3GGOA 5B1EA 1K6EA 2JZNA 1U0GA 2BKLA 2O0MA 3OZBA 4MA5A 1B23P 3SHTA 3EG5A 4UTNA 1NOIA 3QXGA 3OQHA 4IPTA 1RHKA 1YZQA 1D2EA 4A6PA 2XGGA 3QF4A 4KLAA 2FYTA 3ETLA 1A3CA 5BPHA 1M0SA 3CGGA 3TDMA 1JPVA 1LNZA 1GQSA 3HP7A 2AYXA 4GMGA 3Q3GE 4OBXA 1GG9A 2A9FA 3DDHA 3HS3A 1S3FA 4LRSB 2GK3A 4TM8A 2PKRA 1UANA 1QGED 1TYCA 2Q5HA 3I2HA 1I32A 1R4ZA 3QEMB 1V8FA 1VMDA 2H31A 4JP8A 4LYEA 1DKOA 4YS6A 2V3VA 2OA0A 3QH4A 3RASA 1OAOC 4K6FA 4WOPA 1T9DA 1TL7C 5F78A 3FCCA 2W7TA 5HILA 4QOJA 4C3UA 4ESOA 4EVQA 5CB8A 2DAPA 1NWCA 1V39A 4DLZA 2XMSA 4TRJA 2YJ5A 4U2CA 3QVGA 1V5EA 1XIVA 1XN1A 5KNBA 3SSMA 1SHJA 1E4EA 2GX6A 1QU2A 3SZMA 4F12A 1XJ0A 5EZQA 4C6HA 5C4GB 3KSAC 3QA9A 4LMBA 3FHLA 4YMWA 1P3DA 1FUUA 3ISJA 4EWLA 5AVRA 1P7CA 3F3MA 4UZSA 3S99A 1C4XA 1ZRSA 4LSMA 4UEJA 5FBRB 1GAQA 5A06A 2ZVPX 2IUEA 4EKDA 5AKYA 2F4VB 2GVDC 4XEUA 3MMZA 5E1BA 5EY5B 1U94A 1ZLYA 2PRZA 2QN7A 3BRWA 3RWOA 4BUZA 5ALHA 4NENB 2XWBF 2N9UA 3RUIA 4CWAA 4EHHA 2OO5A 1L5ZA 3WRYA 3KOWA 2GHIA 4LUCA 2GBLC 3REQA 4XYGA 4AG5A 1W1IA 1ZY2A 2VPXA 5KOJA 4KRFA 2G9UA 4WBSA 3TRDA 3TLAA 1U2SA 2IHUA 4F9EA 3HVHA 4M8LA 1JRLA 1MOQA 1NQUA 2P91A 2VDRB 2JAHA 3K20A 4OLHA 4E5DA 3FETA 1C1DB 1E63A 4HPXB 3QV1A 4RPGA 4KPEC 4NPAA 4F5ZA 4RZSA 821PA 1FVHA 3OQ6A 4X65B 3MFYA 1C30A 4M76B 3ESDA 1TA9A 4LWQA 4RF4A 1RBYA 2JLYA 3THWA 3MTIA 1CUXA 1QK5A 2ORVA 3Q5GA 3IUQA 3RKSA 1WZEA 1Z6TA 4ROSA 4ERNA 4ZT7A 3AHDA 4NBNA 3JU3A 4R2KA 2CDBA 4RSHA 2OV1A 1SWWA 4MAAA 5A4KA 2VH2A 3GCDA 5K51A 3OTIA 4LDJA 5HIAA 1ZOSA 4QPNA 5B53A 3H16A 5KTTA 3ZKAA 4DR4B 4DRZA 3NONA 5A7HA 1PW5A 1ABBA 2YOHA 1AGPA 1H3NA 1P18A 5EJGA 4TQGA 4LAFA 4QLAA 4XPZA 1TQ4A 2C2BA 4XYBA 5CX1B 4DSAA 4CG3A 5JW6A 3RS2A 1N36B 1J06A 1GZDA 3ZG6A 5CBKA 4RKEA 1G5RA 2RI6A 3HADA 1TJ4A 3PJGA 4G0YA 4IOJA 3DDUA 4XOIA 3TQSA 2VK2A 4W5WA 1ZGCA 4PYQA 3V32A 4DR5B 1SUIA 1E9FA 2B9EA 2Q62A 2BFOA 1PJCA 3CZ4A 3ESXA 4J7XA 4RL4A 2HREA 4FJ1A 1FRNA 4WJZA 4U0JA 3EAQA 3NTLA 1UBTS 5BWCA 1ETUA 3PVSA 3DOCA 4IILA 1LBQA 3VYTB 3KKKA 4LW8A 2H2DA 1LZKA 1WLSA 3PEFA 2ZT6A 1Q91A 1JDNA 3L0YA 4GX2A 1NAIA 5SYNA 1T5TA 5AQEA 2FKNA 3OQ1A 3HBJA 3ZV3A 3WWZA 3F6EX 4QXMA 2ZIAA 5EQFA 1CZOA 4JQYA 5CMLA 1CUVA 3O73A 2EU8A 1TCUA 1I14A 3EGXB 3AR3A 2BFPA 2QGNA 4EZBA 4PRYA 5CPBA 1VBKA 3NKFA 4JELA 1I1OA 4YT5A 4M38A 5FTWA 4JU8A 2D00A 3FMPB 3WWOA 5AVQA 1MVLA 2BT4A 4IV5A 4GI3A 3CX3A 4L27A 1E3IA 1N2BA 3VC2A 1AUXA 2WYWA 4JAVC 4DF3A 1TECE 4BVBA 3O0DA 2YX1A 3WG9A 3L9WA 1XKXA 1JIJA 2VR1A 2XMCA 1PDVA 2C92A 2XUKA 3ETDA 4REOA 3NBYC 1IN5A 4G0MA 3JSXA 5FF9A 2A9RA 1DDIA 4LHVA 3JV7A 1K1EA 3IAM1 3HA5A 1IL0A 4UDXX 5A6SA 4ZVLA 1EZ1A 3OIDA 1ZRMA 4KBFA 3RDPA 5IJWA 1KRHA 1KU6A 3MBIA 2CEKA 2HWUA 2C95A 4ZYTA 2C4UA 4YWJA 1NUAA 4RK1A 3ZBTA 2H4WA 3LLCA 4L8YA 2I9KA 1BTOA 2YZGA 4Z4GA 4TMVA 2ZROA 3IAXA 3LCRA 3NORA 5IZCC 1FF9A 4AMUA 2YS6A 4CF4A 5CDTA 2OMKA 3K1TA 1I4DD 2EX1A 3K1JA 4E5YA 2I4RA 1W2GA 3WKEA 1EE2A 3UK7A 3OMXA 4Q37A 3DOJA 2A4KA 2GJSA 2G5TA 5DLQC 4F3RA 2FR0A 3UOAB 4EJSA 3INGA 3NW9A 1E4YA 3DO6A 3ZNQA 2VPPA 1EXWA 1OX4B 4XFKA 4V0QA 3SMVA 2CVQA 4MULA 2XMDA 3QW2A 4CM4B 2COKA 4GOND 5LLSA 5CT4A 3VYSB 1B73A 5SY6A 4YCCA 2I6XA 5HSGA 1XVLA 2PSDA 2GF2A 5H3LA 1A7JA 1GRVA 5JCXA 1MX3A 2RIPA 1N2CE 4XPIA 3ZWYA 4D79A 4ENVA 4YQYA 5KOHB 4MWEA 5INTA 4FJ2A 3P9KA 4H4DA 3NEYA 1TLFA 2WEKA 4HQ0A 1RDFA 2W9XA 3EG9A 5ILGA 2FWRA 3E48A 3ZHVA 3NHRA 1AQUA 1TEXA 3DEAA 1DBIA 3SZOA 3AUYA 4M0UA 1CJSA 5BV7A 3I4LA 3I9OA 4LQLA 2CXRA 4MJ3A 3F5QA 1Z08A 4FHEA 3Q8LA 1JIKA 4IDCA 4RVNA 5FYQA 2X8JB 3PS9A 2VHVA 1V9LA 2P4QA 5LP6A 3OAAD 3PDUA 5C31A 4LRYA 2GMWA 3RFTA 4P98A 1O8CA 3SQOA 3WKDA 5CDHA 4LF9B 5B2ZA 3RYIA 3R0VA 3FF1A 4KXQA 1XX6A 2AKAB 3MCAA 2CNLA 4C6RA 1VLMA 3BWMA 4F4HA 1E3JA 3DLCA 2JJQA 1F2UA 5FOSA 3KM0A 4OKSA 5H82A 1K08A 4D6PA 2Q3JA 3BL5A 2XYGA 5J43A 5HIIA 5CFOA 1QMGA 1FP4A 1O77A 3VTFA 4YCDA 3T9EA 1BW9B 4X8LA 4AP5A 4J0QA 5FNVA 3ROQA 4BAGA 4CGZA 3UT0A 2Z8XA 1VSUA 4WKBA 5FPTA 4W8OA 1NNSA 2C4VA 4AMBA 1GPNA 2VHJA 3IKMB 3P2IA 1HZZA 1OV6A 2IOHA 3E7FA 5HJ5A 2X41A 3DBLA 3PA8A 3QITA 4YP0A 3P9QA 2MOKA 2J7PD 3ACDA 1DC5A 3HJAA 2JH9A 5JI3E 3TLKA 4AMYA 4NMHA 3OOEA 1ZIOA 1JKJB 1VMIA 1CNEA 1O94A 1Q0ZA 1DDOA 1HG0A 1X74A 2G6TA 3PC3A 4B82A 4XIGS 1N1MA 2IYNA 2R7MA 1ZD2P 2ZBFA 5P21A 4LBZA 3IKLA 4DSZA 5BUQA 1Q3HA 4C0JA 3P0JA 4UPDA 1C3JA 4BLOA 4LDPA 2BKVA 4C0WA 2GDJA 2C2ZA 1QP0A 4FYPA 2DU8A 2HA0A 2JBAA 2D7JA 4LHXA 2QYSA 4Y9DA 4TUYB 3EVTA 4NDNE 3T5BA 5CXQA 2DWUA 5JVDA 4YB8A 3A0RB 3WKCA 1EVIA 2FLWA 1D6SA 4PTYA 1KAGA 2H0RA 1JB1A 3A2KA 1RJ9B 1AB5A 5HG0A 1TKBA 2ZSIA 4M3NA 1SCUB 3UPTA 4Y1GA 1QGZA 2ZYSA 3VAAA 1MVOA 1T1EA 3U60B 4E03A 1DEOA 2DLCX 4UASA 3ET5A 4OM7A 4A8HA 3LYHA 1L1EA 3QF4B 3RJ5A 1OH8A 2WKWA 1CJUC 2V5AA 1ORTA 3Q6MA 4QO8A 4F2DA 1SHKA 3D54D 3LDHA 1LX7A 5BR8B 2WHPB 3P9ZA 1UKAA 2KBEA 3GYBA 3AFIA 3N2GB 2G5CA 2AG5A 2VWHA 4KXLA 4U5QA 5JU6A 4F45A 4MW0A 1N6RA 3WHIA 4HI0E 1X13A 1KAMA 3K73O 1S2NA 3H84A 3WBJA 2ALJA 3QVGB 3GPIA 4P4LA 1U5CA 3RO7A 1F38A 2ZS8A 4PZLA 2J4DA 2JHGA 4UEWA 5TMBA 2A59A 1AY0A 1M10A 4JLNA 1QRRA 2LE0A 4Z4HA 1PL7A 4G5GA 4IHAA 5CB4A 4P58A 2QTGA 2QN3A 5IDYA 4RVDA 3SFZA 2ZRFA 1RS0A 1J99A 2R6HA 1LS1A 2C2KA 4UDOA 2BLNA 1RABA 2J0VA 2CB9A 3A9UA 1CUGA 1GGEA 4NSNA 1VL1A 1HOTA 4QT0A 5MGBA 2P11A 4W7IA 3STUA 1RC8A 3PX7A 2HWKA 4B3BA 2CZQA 2RGAA 3BMQA 4LJ8A 4EVRA 2XCIA 2ZZMA 2OP1A 1PQUA 5TPZD 3NM6B 4OBWA 4YO8A 2AEFA 2BZ1A 4NPHA 1VG0B 2PN1A 5J59A 2Q6KA 2WPDD 4HKTA 3JD2A 2Q49A 1B76A 1C9JA 4P5PA 3DS8A 5DNDA 4Z9BA 3SIXA 2QR2A 3WB2A 4RTSA 1JQKA 4JX9A 1PJZA 4N40A 3WSVA 3U9SA 2BY4A 1FU4A 3AKEA 2RHWA 2CF5A 4RFVA 2Q5JA 3QX8A 3IEVA 4ZMRA 3THWB 2NXJA 1ZC3A 3G5AA 1J00A 2RHJA 1FW8A 5C52B 2EIXA 2F6RA 5J2UF 2I4MA 4E2ZA 4TWZA 1V95A 1G8MA 1P1RA 4L6AA 1EVLA 3KLMX 5JO9A 3R9IA 3L8DA 1C81A 5DM0A 4P3XA 4YRDA 3EARA 5JT1A 2ZUEA 4YT4A 4QM6A 2Y0DA 1GRNA 4HNSA 2H54A 1R9GA 3DE1X 1UINA 5H4GA 3FFXA 3R5SA 1L7RA 4BFUA 3TLGA 2VYCA 4BP9A 3AL0C 2HPVA 3S2IA 4EENA 2Z95A 3BVPA 1QV6A 5AOBA 4ZVNA 3P9SA 4BO2A 3UYKA 4JITA 3SZUA 3JQ8B 1KBQA 1AURA 2EGGA 2FZLA 4CF3A 4JYMA 1N2CB 4OQPA 4EQ6A 3DEKA 3FLBA 2ZBRA 1O6FA 3VSDA 3KLBA 3EZ7A 2BFMA 4YMVA 1GQFA 5ISMA 1NXTA 1MNQA 1Y5MA 3ESBA 1H1DA 2OBXA 3NV7A 4MNTA 4RH1A 5HIMA 2DCUA 1N5JA 3KC2A 4JEMA 4O4LA 2X22A 4DQ0A 1FRQA 4H7IA 4ZEOA 2XGSA 3F4LA 3WL8A 3ESCA 1QP8A 4H1TA 2P0AA 2I7XA 5M29A 4BJ1A 1WMBA 3F9CA 5G0TA 3OOHA 2E5WA 1QHIA 4ZA2A 3VPXA 5ES3A 4B48A 5CA1F 1ES9A 3L8CA 2GD6A 2IFTA 4MW6A 2DJ5A 2C2MA 4S0XA 1UIMA 5E6SB 2C99A 1SCDA 3IUNA 5H3CA 1DKRA 4ENSA 1KJYA 5DNEA 4AZSA 1P7VA 1SRQA 4R1PA 1W36B 1X1AA 1YB1A 2Z5VA 2DT8A 3L02A 2P8JA 3GU3A 3MJRA 4TMTA 1E4VA 1T8SA 5HFAA 1Q0LA 1F7UA 4LGYA 1S2MA 1U2EA 2P0YA 3MAGA 2RBEA 3KT8A 2Y92A 3C2QA 4FFLA 5IVPA 1CFZA 1J2UA 5LXTB 2ZR0A 3KQSA 5I9BA 4WE3A 5KWIA 1CU1A 2R8RA 4P7JA 1K27A 2JHFA 2V55B 2NP7A 3MWDA 4JB2A 4K1LA 5HUJA 1VYTA 5DWDA 4D98A 5HQ3B 2BD0A 4HYEA 1T6BY 1QO0A 1T2VA 4B4OA 5LB4A 3VHLB 4Z3DA 1QPBA 2ZSDA 3CJTA 1M6VA 5LA6F 1Z15A 5FLYA 3RSSA 5I47A 4PLTA 1Z0UA 2W58A 4MH0R 2YZMA 1PFYA 2ZYGA 2SKCA 3M5PA 4KPGA 3ZWNA 1F8XA 3S7ZA 2EX4A 1T5IA 3WHLA 4RTLA 2CLHB 1BHO1 4IJWA 5FX2A 3ZWPA 3H97A 2RBKA 1KEVA 3DEZA 1QIJA 4UBJA 4WX2B 3ZIAD 5FDFA 4XX0A 1E3WA 4LZWA 1KEPA 4ZD6A 3GROA 3CNQS 3LPDA 4G85A 2Q6TA 4O2AF 3N5KA 4TLCA 1BE1A 1B42A 3HCPA 5KX5B 2GHTA 3GUVA 3KRTA 3L49A 3LUGA 2G1JA 1U2PA 2ON6A 3E9NA 1SXJA 4Y0VA 5ESXA 1NV9A 2ADFA 4OL0A 3AM4A 5K0BA 3VKGA 1G20A 2JKZA 1ATZA 1Z17A 1HA3A 4F2WA 3WFZA 5IX8A 3K9HA 4IH1A 3KQHA 4RCYA 4CQMD 3LHIA 4D3FA 3G9ZA 4ZOLA 2GWRA 4JT9A 2W6QA 3MS7A 3QSYA 4MVYA 4RZIA 2YV2A 2HRQA 2LIVA 4RLQA 4BBAA 2PMKA 2QTRA 1D5CA 2WWIA 3JR7A 4I99A 2FY8A 4RD0A 3QELA 1ZK4A 3ZU5A 3G0IA 1RE1A 4GBED 2PZKA 4FT2A 4XPIB 1U0BB 4GL2A 1EVYA 3PHLA 3ZU4A 1D6NA 3DP9A 1E1DA 3E3MA 2IOQA 2UXCB 3L0SA 3UENA 4J91A 4PC3A 3QXSA 5PNTA 2Z4SA 3BN3A 3CR8A 3LYLA 3CO0S 2QA5A 3GRRA 4Q21A 2QXUA 4AJIA 5DM1A 1BU5A 2LXNA 4YRZA 5DHUA 2WZQA 1BE6A 3A6JA 4HAVA 4C4PA 4YT8A 3UFXB 3W1EA 2AWNA 5CCDA 2FN3A 5TGTA 5LP6B 3QNWA 4DQDA 3H13A 1HNNA 2JIDA 1I2MA 1H93A 2WHEA 4IDHA 5H83A 2BP7B 1QG4A 4TLDA 3SGLA 1TX4B 3RYIB 4ZQBA 3FRHA 1GUBA 3TH5A 3ZWVA 3GNSA 1ZS9A 1TW3A 3A1UA 1WWKA 1GQYA 4MVXA 3OVMA 4RAOA 4LN1A 5L4LA 1F2UB 3RC7A 2O07A 2XW6A 3IBCA 1G19A 1M5UA 3LG2A 1EE1A 5HHTA 3QPDA 2SBTA 3FVTA 2ODPA 2BHLA 4D9BA 4EG4A 2LW7A 3QLEA 1FP4B 4U9HS 2IXFA 3G5LA 3RIMA 4ZCRA 2HJGA 5C51B 2D62A 2PUJA 4GP9A 1X70A 5A5VA 1M1YA 1HYGA 3C6BA 3MWKA 5IUJC 5IDXA 2BPOA 5LP1A 1L3IA 4D8YA 1G8GA 2NW6A 5BYAA 5GM2A 4AXXA 4JI0B 1KXJA 4L57A 1AU9A 2E3JA 1HRKA 2C96A 4IEFB 2Z9BA 3CEPB 3TX6A 2EL7A 2JB9A 1UBUS 1JAIA 1FTQA 1O6BA 1NJ5A 1SIOA 2ZRHA 1EFAA 1DMRA 4BZZA 1IH8A 5KDDA 5DCWA 3EUAA 4ZGWA 3PDCA 3VH3A 2PJRA 3SAJA 2CCGA 2JIZD 4HATA 4KI0A 3HMQA 1IIBA 1SB9A 1U2GA 3QVUA 3SWWA 4KVZA 1Y4ZA 1SBYA 1GPDG 2PKYX 3W04A 3HG7A 4AO6A 3OEWA 2G5PA 2ZTVA 2E89A 3N9IA 1Y8ZA 1JVBA 2XQJA 2VDJA 4GOXA 4YRBA 1OPRA 2X3UA 4FYXA 4ZVVA 3SF8A 1PEAA 5EWMA 4RPKA 3D8UA 1G20E 5JVDB 4MUXA 2YCLA 4XGIA 5FFMA 3HU2A 1QTRA 1XAIA 5IMBA 1IJBA 4AP6A 3M6FA 3W6OA 1E7YA 2OFXA 3I3OA 5CDYA 1MORA 3JAKA 2IS2A 1NZJA 16PKA 1UEJA 2Q5LA 3TNLA 5A9TA 1M0EA 1YK1A 3OM0A 3S1AB 1Z0DA 5BOSA 3EOBI 4PM4A 3I8SA 3TRHA 5J9FA 5BN3A 3I6MA 1AKYA 4YTEA 2XZOA 1VB5A 3TF5A 1MAAA 1IQUA 1W5TA 1HYHA 1W4AA 2G6BA 4R83A 5CEFA 1NRJB 1X9IA 3GJTA 3WA6A 4HEA6 4AURA 4FN5A 3HNPA 3DPIA 5KTOA 1JHYA 1YE8A 4OXXA 2O2YA 1YZKA 4KXVA 2DBRA 4B2IA 3MIIA 4ZU6X 1C9EA 2FMXA 1M8FA 3UXYA 4RNDB 1DX6A 3IE2A 5FOXA 2Q3HA 3KYDA 5JAQA 3ANSA 5HS4A 4H6PA 1M2OB 3M6VA 1IXZA 3OD1A 3OQBA 3R6GA 1RHJA 1DP4A 5EIFA 4YQEA 4TT8A 4JLKA 3G0GA 4DA6A 5A4MS 1SXPA 1AV6A 4QNRA 3P4XA 3T41A 1EBUA 3GUHA 4BXOB 1SUSA 1W5EA 2R68A 4MQMA 4AI6A 2WV9A 3JQEA 4ETIA 2ZBGA 4EFKA 2OV3A 2YY6A 4N7RA 1KKMA 1IY2A 1LNSA 3TMYA 3O7WA 4V38A 1EHIA 2G17A 2YUIA 3T9BA 5FTLA 1FW6A 1UMBA 2X7XA 1VBNA 2NX2A 1QWSA 2ZVQX 2VQFB 3U5ZB 2F8TA 1PZXA 1D7OA 1ZIDA 2XDYA 1P5ZB 2HTEA 3P96A 4CR7A 3RAFC 1ESEA 1QYXA 1ZO8A 5JAIA 2Y0PA 3MTQA 2VTDA 4FGKA 2HJRA 4KUEA 4HAWA 3RB8A 3UV6A 4C4TA 4L3VA 5I8ZA 1JWAB 2NV6A 1DHTA 2PV0A 4KW7A 4QBHA 1OC4A 4ZYLA 2GA9A 3GT0A 4E51A 3PFGA 3G8CA 3MB8A 2R48A 4M0KA 4KQIA 3T3PB 2ISQA 4P4SA 3SQWA 2H1VA 3NP9A 3U4DA 1BMDA 2NXCA 3JZFA 1T3SA 4V0LA 5IBQA 2WMOB 3UMBA 2I65A 4DDVA 1A2BA 2NZJA 4Q82A 3SBDA 3WLQA 4QG3A 2QUHA 3E70C 4W1QA 2XE6A 1S2DA 2PAFA 3GLQA 5BUSA 4N6OA 2Q3CA 2LP4Y 3AO0B 2QRUA 3A4LA 3C16C 1S1MA 4KXMA 3RS3A 1RJFA 3KJNA 4JJFA 5GADl 1HEYA 3LXXA 4OOFA 1NASA 3ZHCA 2ZRMA 1P0PA 5JS2A 3H1FA 4JQOA 1FFWA 4OQEA 4CFSA 3N6VA 1XUOA 1ETHA 4CLEA 2RFLA 1Z5NA 1A2QA 4PLHA 2C20A 2FF5A 3TLGB 1J7KA 3HTXA 1XJ5A 2VZEA 2C5EA 3DJFA 4CEIB 2RMKA 4CIXA 2YC2C 5AW1A 4MS1A 3G2HA 4G0OA 2I62A 2P77A 2PH3A 5F3RA 3UAXA 1WZUA 5LQSA 1JR2A 3REFA 3IPLA 3CO5A 2A67A 4X7RA 4G65A 2WY2D 2COEA 4G4GA 2RGEA 2PMWB 3GLTA 4IS2A 3EYWA 5I5GA 1L4FA 2GAJA 3OKAA 3EY4A 1XEFA 3PXCX 1XEXB 1Y8RA 1WMDA 3D6TB 4CMEC 4D9EA 1YI8A 1IXSB 1ZRNA 2O5VA 1JJVA 3QU2A 2FN8A 3H4TA 3TOCA 3MWEA 1M34E 2IYSA 1RI4A 1PI3A 1YVEI 2LVBA 3HRIA 2UYOA 3L82B 4INAA 3LQ2A 4DA0A 4ARIA 2H2WA 5DHAA 3TAHA 1QAOA 1VJRA 5AICA 5TPWA 1DQRA 5T4EA 2ACWA 1DAGA 1G0NA 5FB3A 3FDZA 3WYCA 1GPAA 2BSQA 3HR8A 3KBOA 4KODA 4LI3X 3K9FC 5K0ZA 4N5IX 1Q17A 3HSSA 3TKAA 3UK0A 5BMOA 4RDXA 4ARVA 4EGFA 4UTXA 5HDBB 2XHZA 3KUCA 1KYWA 4L4UA 1OKKD 3I2JA 3ND5A 4ZRDA 3EIEA 1SVOA 1B16A 3G6WA 2XZPA 4RMJA 4DCMA 1G4HA 4DWOA 3PGVA 1U04A 3NNDA 4RTNA 2F3QA 1TZJA 3DMGA 5KPJA 4IDPA 2GH1A 3RV4A 3WMFA 4P80A 2HPZA 4RVOA 1FTSA 2OKCA 4N3BA 3IX7A 4BPRA 4CT0A 3H2ZA 2K5UA 1KOGA 4IGKA 5AJVB 4EBFA 1BD4A 3RTAA 1M6VB 4HMPA 1JX6A 4NNOA 4ZMSA 2EFYA 2RK6A 1PYGA 3AFMA 1KP3A 5A03A 2R44A 2IYQA 3L4EA 2C8JA 2PSEA 2ZPTX 3M4XA 4J1TA 4NTZA 3FYDA 4WRRA 5B6IA 3QQPA 4BB0A 3OQMA 3E0XA 4MQEB 5LC1A 3NVAA 3VTAA 4L9WA 2NZ2A 1E3WB 2GHRA 4NYJR 4BKOA 4EITA 5HUQA 1HRDA 5AM5A 3ETNA 1Q1BA 2P6PA 3L7AA 5E7MA 3O1IC 5F12A 1BOFA 5AESA 1R2QA 3LU1A 4RD1A 4EFDA 5E1DA 4KPFC 1QSGA 2BW0A 2GRJA 1G20B 3RFVA 4I5IA 2VP9A 4U7WA 1GGHA 2I8LA 3UJBA 3R9WA 1JR3D 2BMVA 2JJMA 1TIPA 3V97A 2CMFA 4CIDA 2FU5C 2Y6VA 4NONA 3JYQA 3H5TA 2CNWD 1C0EA 4JJIA 3WZ2A 3E35A 1V8PA 1SXHA 3H8SA 1PK9A 2FJUA 3AF3A 3PKIA 1UQTA 2FUKA 3H1TA 4NIMA 3MUEA 3EXFA 4D7AA 4NXMB 3TEJA 1QJCA 3QELB 4KYIB 3NBKA 3L8FA 3RGWS 1ADBA 2VOEA 3ZUPA 3BE5A 4EW6A 5ALWA 5FWDA 2P9EA 4M8IA 3NHLA 3WB9A 1F8GA 4P82A 4L9RA 1PJ4A 2BJVA 5AHOA 5H1YA 2VNAA 2JGAA 2A8YA 1SY7A 3VKFA 1TT5A 4OEHA 3VZSA 3KWFA 1RXCA 3OZEA 3I76A 4WHMA 3DVAA 3I9JA 3F7MA 4DL9A 1SBQA 1EZ4A 2VHYA 2WTAA 1T3GA 221PA 2EERA 3QSGA 4D3SA 4EPWA 1DIAA 2WJAA 1QH9A 3O4HA 1FVOA 5DGIA 1M2NA 4A8JA 1Y81A 1CK4A 2QTAA 4IFBA 4G5SA 1MC1A 1HT3A 1PT9A 3CE9A 3B20A 4EUHA 2HHCA 2WKRA 3U17A 5D7BA 3H04A 1KAOA 4EATA 2C4MA 4Y2SA 3BSSA 3TTWA 2FG5A 2JLAA 3HDJA 4ZVKA 1I3LA 2C77A 4OQNA 1JBEA 2BI7A 1P8JA 3R7NA 4FDMA 1MABA 2F3PA 2GZRA 2H1LA 3EGOA 3NHJA 2JFUA 1YFJA 3FY4A 4P54A 5I4CA 4C01A 2B4AA 4RD2A 4DDMA 1M1YB 3VU9A 4LJRA 3EF0A 3TOVA 2ZATA 1GKLA 5CCXA 4R05A 4XR9A 3AG5A 4I66A 1SHLA 4I7EA 4QDKA 3VO2A 5B6JA 3R9XA 1IZ7A 4B5LA 5HR5A 2FX2A 2G77B 1CYDA 1G21A 1L4BA 5CU7A 2HYDA 3TL6A 4IVPA 5C34B 2O2ZA 3K0EA 3KWLA 2LWIA 2YXBA 2PK3A 3WMGA 5ADVA 1BWRA 1DUIA 5EIEA 3K2IA 4KPYA 5LQUA 2CC2A 1A98A 1GT91 3E3LA 2KJQA 1T2EA 5ICMA 2X0RA 3C8MA 3B85A 5JAPA 2OC9A 3W9YA 1YIOA 4PINA 4EPVA 5EIXA 3BA6A 1YS4A 4OQYA 2CWWA 3BMOA 121PA 1H42A 2R8ZA 3LGXA 3VNAA 4NCAA 4W99A 4LQCA 5F52A 5FWAA 1DO0A 1M2FA 3RI3A 3SF8B 4OLBA 2CLIB 4DCNA 5EWMB 1Z2DA 4F2PA 2DM6A 3ROTA 1Y3DE 1FU7A 1MAVA 1J6UA 5FT9A 1ECPA 4I55F 4L4ZA 3PUHA 4LDNA 1OI4A 1UWCA 2D2EA 3EDOA 4IRMA 1I7LA 3E3OA 1EFCA 3H8VA 2C31A 4DLUA 4JJ8A 3P9NA 4GR5A 3G59A 5K3CA 3OLZA 3TD9A 3V8RA 1RFGE 2OQIA 4NK4A 4NFHA 5CXUA 2O3UA 2VHUA 4TV9B 4Z54A 3WNDA 4FXPA 4D8VA 1UBMS 2QPAA 1T2DA 1XTPA 5JMTA 3WFJA 2ZYWX 1M34B 1NUSA 1SAYA 1GUFA 2WILA 4HNRA 3WO0A 1EXNA 4YRRA 1EIZA 1PL8A 2ZXFA 4WAUA 4BV3A 5L53A 1L5QA 3L0OA 4INJA 4PX5A 3RCBA 4EY4A 1IHPA 1EVZA 3HDGA 4EG7A 1O5OA 4I2NA 3KL4A 1ADYA 2VSFA 4K87A 4LMRA 4ZCLA 4Z3KA 1ZIXA 2OORC 1J2TA 2V58A 1Z22A 3MINA 3CLRD 3G7SA 5F1KA 2HMVA 2X58A 3D9QX 4MRRA 4DWJA 4DZRA 5LU9A 2XMBA 3IMCA 4A2PA 4JJ6A 3MMNA 4UCWA 3S7TA 4Q05A 1XQVA 1Z6GA 2PZEA 1UP4A 4EGJA 3ONEA 2F3TA 5CVEA 3KTFA 4PLWA 3THXA 3WIVA 5MFZA 3K0CC 4PLGA 2A0YA 2JIMA 3BWBA 3NBXX 4DSUA 4FS3A 2VTVA 5TX7A 4GDFA 3H42B 1IY8A 2PUBA 1G16A 2IKQA 1ODFA 1NDHA 4IIYA 5FBKA 3ZIUA 4YMSA 4CHTA 3VDXA 1H4VB 1EU1A 3AI2A 4P4SB 4HJXA 3BA1A 4C2TA 3O8RA 4QDZA 2FR8C 1OAOA 2YKGA 2JARA 2IS6A 3E58A 1GV0A 2QTNA 4GYWA 2Q1UA 1AGXA 4NBKA 2J0EA 3ZWDA 4HMOA 1G21E 4KR9A 4AT1A 1S8FA 4TMKA 4EYOA 3STXA 4MICA 4XDYA 4WZBE 2ZJFA 5C81A 2IXEA 1T25A 3QMMA 5ALLA 1CKEA 4M6WB 2WU0A 3PNMA 2Q6LA 1VPWA 2HNKA 3MERA 2ZRAA 5G0WA 4AD8A 1SKQA 3S2ZA 1NVWQ 3UWOA 2CL7X 3ROFA 2GZ1A 2PSHA 4K26A 2PGLA 2PHZA 2HRDA 2ZWMA 3BGWA 4FS8A 1SD2A 4TL7A 5FRDA 3BB1A 1P61B 4NZNA 5TJ9A 3NATA 1GKYA 2GBLA 1NUPA 5CHEA 4WK0B 4MS1B 3VVCA 4ZAVA 1XTTA 1Z75A 1M0TA 2VBGA 3QA3E 2JLZA 1NF9A 2QB5A 1ZSVA 3D0OA 4NR0A 4X1OA 5KC9A 5IVDA 5J2TA 1E79D 5EHXA 3CH5A 1P9RA 3JATB 3K8OE 3O8OA 2W2VA 1Y6ZA 5EPUA 2V6BA 1NBHA 2JJ2D 2W5UA 1JHAA 1V1RA 4BIMA 1Z5WA 2JIOA 4TVOA 1BG6A 1XZLA 1RQXA 3IUMA 4UREA 1E2HA 2JF0A 3FFAA 5E2IA 4G9GA 3ITNA 2HMSA 1A0OA 1SR8A 4D3YA 4D4LA 1RE0A 2AEEA 2XTMA 1LI7A 2ZBQA 2PX5A 3NHZA 4HUQB 1UAAA 3PZBA 3PNSA 3LC7O 4M0FA 4EB6A 3FDZB 4YQFA 3VOBA 4IIEA 3HR7A 1FP7A 1UBKS 3ML1A 4QEZA 3FPBA 4E14A 3SDZA 4XYLA 3CW9A 1KEWA 3NVKI 5KSYA 2A58A 1JEEA 2QN9A 1US8A 3WVNA 4COKA 1Z28A 4BGDA 2F1KA 3IP8A 1QFZA 3ELYA 4UTRA 4B17A 4I3FA 2IU6A 2IZ1A 3VR5D 1CB7A 4DQUA 3GPCA 3W3AA 1ZA2A 2FMUA 4IDOA 4QPPA 1KIAA 4FHCA 4YN3A 3L7KA 2XSZD 4Y1RA 1PJBA 2XMGA 1I3MA 4RO0A 4FD2A 3BZUA 4N9WA 3OCYA 8LDHA 5CTJA 3IYLW 2IA5A 1VG8A 1O9HA 4DJDC 3ROXA 1I7SB 3WRXC 4YCNA 5DMHA 3ZC3A 4ER3A 3FZEA 4HGRA 1YDWA 1L5SA 2YN4A 4ZVRA 2I1WA 3QBEA 4DEYA 5B64A 3KD3A 4U2GA 2BYTA 4K6KA 4JQCA 4UOEA 4RU1A 1SUWA 2GTHA 4E22A 4G24A 3I2FA 1DX4A 1P7YA 3M89A 2E6KA 1YR3A 3M3HA 1X77A 3BXHA 3NVMB 2UYYA 4R7GA 4ALMA 2RG1A 3OE7A 2VRCD 3FCSB 1JALA 3AEQA 4L9SA 4AS1A 2POQX 5ALRA 4G97A 4N3AA 3C5VA 1ZI8A 1P62B 4MQFA 5FUYA 5L3VA 1ZQ9A 4HGZA 4MWTA 3UB4A 4EW3A 1SH7A 1BH6A 3ZY6A 3FVRA 2ZCUA 3GARA 3HV2A 2EG5A 2GD1O 4QZVA 3RAEC 2JGIA 1XTQA 3PQ7A 2QI9F 3D8NA