1MT0A

Atp-binding domain of hemolysin b from escherichia coli
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
241
structure length
241
Chain Sequence
b'DITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHKELLSEPESLYSYLYQLQSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hemolysin secretion ATP-binding protein
publication title Crystal structure of the nucleotide binding domain of the ABC-transporter hemolysin B: identification of a variable region within ABC helical domains
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 73
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2002-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1mt0A00
2C9CA 1PLLA 3GJ8A 1IQPA 1S8FA 3CKLA 2Y8EA 4B34A 3AV0B 2WWFA 1VCNA 3QKSB 2AK3A 1P62B 4AURA 2ZSAA 4MRNA 3BERA 2PCJA 4ZKEA 2IC5A 1HTWA 1BS1A 1E9DA 4DDUA 1JQJC 1NVVR 1UBFA 4B3DA 1OSNA 2CXXA 4JLDA 5G40A 4CEJB 4HAYA 5KYKA 4EKDA 2CK3A 3CZQA 4Z1MA 4EJSC 1Z0DA 4NCJA 2N1BA 2ZU0C 4V03A 5IK2D 1W0JD 3ZD7A 4L8GA 4PZLA 3GJXC 2AFIE 3EZFA 4TN1A 4R71A 3CM0A 4O2LA 2YOFA 3EW9A 1AA9A 2GJ9A 2QGNA 4DDVA 1Q1EA 3FTQA 3QJYA 2AKAB 4R2HA 2JLXA 4QFMA 4TMKA 5HE9A 3ADKA 4BFVA 4A8JC 2MSCB 3EIHA 2ZPTX 4KCGA 1P4SA 2BMDA 1VG8A 1DAFA 4HB3A 4IEEA 4BFXA 5M04A 2I1VB 3BORA 3F8TA 4EPTA 2RGCA 4IVPA 4GI7A 3BGWA 5DI3B 4BLSA 2K5UA 2A5FA 4KBGA 2JLSA 1IXSB 4Q02A 1WMSA 1AZSC 1UJ2A 1YE8A 1Z0IA 3K0AA 4G5GA 3D8BA 2V3CC 2HV8A 3BXZA 2HYIC 2VRWA 4XVRA 4KBFA 2ZRIA 3A4NA 1T5LA 4UKDA 5AJWA 4B48A 1NIJA 1SKYE 2JLQA 5FOTA 4MGKR 1ODFA 2QTHA 2OFOA 4I99A 4LJ6A 3ZJYA 4C3ZA 2J7PA 421PA 2Z6VA 2AK2A 4Q1CA 5B64A 2DYKA 5BXQC 2OBNA 1R0ZA 2ZRJA 1GAJA 1QG4A 4LYHA 4UXHA 4DKXA 1IONA 2R8RA 3B9PA 1NKTA 2DHRA 2WICA 4JYCA 3SHWA 3IGFA 2QY9A 1P73A 4U02A 2KJQA 3R7WA 1MH1A 2G83A 2UVQA 4NYJQ 2ZITA 2ZS9A 3BBPA 3AP2A 1SHKA 2AR7A 2HYDA 2V4ZA 3MWKA 4LYAA 2DPXA 1W4AA 1CJMA 2DFNA 2OCAA 1P61B 1E2KA 3QEOA 4Y0AA 1Z2CA 3LBHA 1LVGA 3NH6A 4GP7A 1QG2A 4DC9A 4EQ6A 1BYUA 4TSFA 4Q1AA 2IT1A 4DUGA 2O8FA 1VHLA 2BDTA 2OCPA 2QQEA 3I92A 4LC1A 4TMVA 1AQUA 4TYYA 1G8HA 5DNYB 1GG2A 2BBSA 2RHDA 2XSZA 2F3TA 3B82A 2NMVA 3W6NA 4BLOA 3KXKA 2HF8A 1SKQA 3BE4A 4EPYA 4U7DA 3U4QA 3K70B 5JSZB 5FL7A 5CJPA 1S3GA 1UKZA 4TL9A 4Q4HA 5FPYA 3C5HA 2QP4A 5AJZA 1E2HA 1XXHB 3LQQA 2ZJ5A 1NP6A 2EVWX 3G82C 3VHLB 3B1WA 1ZNWA 2HDNB 5SZIA 1XZQA 2WAYA 4ASUD 4ON9A 2CE2X 1EFRD 3AVWA 2WSSD 1S2MA 2A5GA 2QG6A 3WNCA 1KI4A 1YZUA 4D80A 3LY5A 4Q47A 4ZKDA 3UPUA 4I1SA 3R8CA 3UATA 4LGMA 4GSYA 2WJIA 4A82A 5JFGA 4P3YA 1H8EA 2ERXA 3UANA 4PZZA 3EIEA 5LPNA 1QHHA 3IHWA 2ZRAA 4YDHB 3DZ8A 3RSLA 3M0EA 1DELA 1S0UA 2HEIA 4KI0A 4P0TA 2NO1A 2A5JA 3WYAA 4IHQA 2ZI7A 5KPDA 4C0JA 1AIPA 5KSOA 4YMSA 1C1YA 3IBYA 2JA1A 5BYKA 3KZ1E 3QQ5A 3O8CA 5KDDA 4P32A 5FUVA 1CULC 1W4RA 1Z08A 3FWYA 4PHGA 3KKOA 4QJ4A 3SI7A 2CJWB 3X1XA 3KKPA 3FKSA 1AN0A 2MSDB 3QNUA 2ZS7A 2O8DA 1P5ZB 2VH5R 3HPQA 1G3IA 3CR8A 2IWRA 4DEXA 1RYHA 4CF7A 2UZIR 1W2HA 1GKUB 1H8HD 1U8ZA 4OL0A 4PC2A 4BFYA 4Z54A 3U2QA 1D8TA 3FFBA 1SVOA 5EZ6B 2Q3MA 1RFLA 2QL6A 3GLHB 2ZYVX 2ONKA 4Q66C 3CW2A 2OLKA 4UNRA 1G16A 1XZPA 4PFSA 721PA 5C2JB 3GLIB 1NKSA 1Y63A 3WNBA 3HR7A 2W6IA 1UDXA 5JI3E 3O8DA 3SE0A 5IT5A 4TYPA 1CLUA 1CXZA 2GESA 4GT1A 2ZYTX 3GJ3A 5CIQA 1OB2A 2D2FA 1GIAA 3IIMA 4ZCLA 2ODBA 3Q5EA 4PXAA 1E96A 4OQMA 2V54A 2IYVA 1T9HA 3NEJA 1W47A 4AIIA 5K8LA 3EPJA 3AF3A 1SVIA 2V7QA 4BLRA 4OK3A 5F98A 3CWQA 1ZJ6A 3OAAD 1II8A 2C98A 2A3RA 2G0TA 1JR6A 1XBTA 5JI2E 1LY1A 1ZNYA 4FMDB 3W34A 1U0LA 3I72A 3EX7C 4BQSA 2QM8A 4D4LA 3CONA 3R7WB 4JBWA 1SHZA 2CVFA 1JPJA 5DH9A 1L7VC 3LX5A 3P4YA 4RCYA 4IDNA 1N2CE 1Z29A 3AVYA 2GXAA 2QAGA 2ZI9A 1NI3A 3CIOA 3EG5A 3ZVLA 3U7GA 2WKRA 4MUAA 5AUNB 2I4IA 3RLFA 3AQ4A 2ZJBA 4JT2A 1YR8A 1R6BX 2FG5A 3MJHA 3W3ZB 4ACAA 3GP8A 1XXHE 1OIWA 1ZIOA 4YXWD 3VR1A 1E2JA 2ORVA 4LK2A 1COWD 2F1JA 4LJAA 3MWJA 3REFA 5D3MA 3SYKA 2ZYWX 1Z6YA 4ZI2A 2YKGA 4YMUA 1E1RD 1FNNA 3OZXA 4BRUA 3RDPA 3RS4A 1Z2AA 1ZUHA 3V4RA 2YOGA 4A9AA 1XFAA 5KOYA 4EJSB 1DS6A 1VCIA 1F48A 1RKBA 2ODNA 1OF1A 3OEHA 4TYWA 4X8MA 3KQNA 1RRGA 5CJ2A 4GNKA 3ZYCA 3IEUA 4DZZA 3PEYA 1OKKA 3KB2A 2O8CA 2CDNA 2IF2A 1G3UA 1YRAA 2P6NA 4M1TA 1L8QA 2OBMA 3AP3A 4RKFA 1W44A 3D7MA 4DB4A 1W4CA 2FV8A 1DEKA 2BMEA 2FGJA 2OG2A 2X77A 1GDDA 1BKDR 4V02A 3TMKA 1NMZA 1VPLA 3X1YA 3HU3A 2YYZA 2F1HA 3CF6R 4H9GA 3T5DA 4A8JB 1O87A 2ZI3A 5DN6D 6Q21A 3W3AA 4EFLA 1T5IA 4DLSA 1AS2A 3G5UA 4FW9A 4GPTA 1JQLB 3U3MA 2H5EA 1E4YA 2J7KA 2QA5A 1J99A 4MUBA 5DSZA 1GWNA 2ODEA 3NBYC 1CR1A 3DVLA 3ZIAA 3QPWA 4CEIA 4C0KA 1KJYA 3GLHE 1IY2A 2VSXA 1ZC4A 2WWGA 3K9HA 1NLZA 3OF5A 1SXJC 2UKDA 3VMFA 2OXCA 3MJRA 2VP0A 4EFMA 3P27A 4GL2A 3GLIE 1E94E 2RAPA 3GLFB 2QT0A 1NBMD 1CU1A 1GRQA 1PUIA 1PUJA 3GEHA 3HWSA 3LD9A 3QVVA 4PANA 4PZYA 3I1FA 4TWZA 4UXIA 4Q4JA 5IDVA 4D81A 2ECKA 2IXGA 4QBGB 5DGXA 3THYA 2PL3A 1SXJD 2OAP1 4P4TA 4DSTA 1XPOA 3GJ7A 4ZIRB 1NY5A 2WJYA 2HF9A 1A2KC 3DHWC 5EUMA 1MO6A 4Z8YA 1QHNA 1FL9A 4M9SA 1MOZA 1E9SA 2VQSA 2AD5A 3A4LA 4JVMA 4AKEA 2ZJ8A 1JXOA 3NH9A 1OYWA 4CDGA 2HJVA 1EX6A 3RRYA 4S35A 3K09C 1Q3TA 2IA5A 3AGPA 4P4UA 4Y0VA 4PC7A 3KFXA 4O25A 1P75A 4M8NE 1EG7A 3TNFA 4DCSA 5FTNA 2AKYA 4LJ9A 3FKQA 1LS1A 5E7JA 3ZZTA 3QOFA 3H1TA 4UNNA 2JLZA 3M1IA 4JMPA 4POAA 4BECA 3SNHA 1CBUA 2A9KA 4ABYA 4JBXA 2B21A 3G0HA 3QXJA 2FSIA 2F9LA 1CRQA 3UKDA 3D3QA 3X1DA 3ZQ6A 5J4HA 1XJCA 3MLEA 1MO5A 2YJTD 1ZW6A 1V43A 2WWXA 1FUKA 4X8LA 5JZVA 2RHMA 2IEYA 4B32A 3CRQA 3KB1A 1Q0UA 1ZD1A 4PSAA 2REBA 5AR1A 2GCPA 2ZXUA 2QMOA 1U8AA 1OT3A 5FPHA 4DLWA 3MWLA 1OFHA 3C41J 5FOXA 2RGNA 5JJIA 2ZRNA 1JAHA 3AKYA 5BWMA 2AL7A 1YR6A 3GLGB 3UWKA 4NCKA 4HAZA 3LW8A 4NONA 4TT3D 1KY3A 4ESVA 4QHYA 4HZUA 2CNWA 4TLBA 5KNCA 4HAXA 1M8PA 3OIUA 1IN5A 1Z22A 1R4AA 3OEED 4LJ7A 4Q03A 2GJ8A 3EWAA 4EPXA 1OH5A 4AWXA 1XMSA 2FOLA 2ZM5A 1NL3A 3R9XA 2BBTA 2IYYA 3THWA 2EYUA 2P3SA 2ZETA 4QXAA 3ZS8A 2J45A 2GBLA 4FMBB 5L8VA 1RE0A 1J90A 4HDOB 2CHGA 1FP7A 4JLKA 4E03A 4X8OA 2WOOA 3WY9A 2OE2A 5BN3A 4IEIA 1DPFA 1YKSA 2G9NA 2ERYA 2ZRKA 3K0FA 1WP9A 1GRRA 4WW0A 2RGDA 2IF0A 3C16C 1W46A 3CX8A 1E2IA 1M34E 1NLFA 1FZQA 2ZJOA 3NC0C 2NIPA 4L15A 4PPNA 4TYQA 5LDDC 3NHBA 2XNDD 2QE7D 4C0AC 2AN9A 3SOPA 2BJWA 2CLSA 4HLQB 2Q3HA 3RAPR 2GK7A 3W90A 3A1TA 1N6OA 1G7SA 1DAMA 2QSZA 4LSGA 5JCZA 3VR3A 1KDTA 1RZ3A 3B60A 4QGFA 3TW8B 5KNDA 1TQ2A 1U94A 2WJJA 4WOPA 4PPGA 1G3MA 2B6HA 5J47A 1HA3A 2IYRA 5TMPA 5LD2B 1KGDA 1GL6A 1DBSA 2QRNA 1KNQA 2ODWA 4M1MA 2P6RA 2OCBA 3DOEA 2C77A 1MV5A 1ZP6A 3AVUA 2QPAA 2NOAA 4WZAE 3BAFA 2O8BB 3TUJC 1R5NA 1LW7A 1G19A 1XMVA 3JZAA 3SYLA 2I3BA 2D7DA 2C95A 4URVR 2GK6A 2ZRHA 4FWIB 3CO5A 4GMXA 4QGGA 2ZRPA 3C14C 4AK9A 3DM9B 4TMZA 3Q9LA 2TMKA 3BFXA 4URYR 1K5GA 3QKSA 3VR4A 4A15A 1ZD9A 3BD9A 1UBGA 1ZM7A 2DY1A 3B7GA 4IW3B 3IQXA 3K0CC 4LRWA 3BS4A 2G1JA 4CEJA 2W6JD 4IJMA 4DHEA 2QPTA 4WIAA 5P21A 3KQLA 4JZKA 3R20A 5E7MA 1II9A 2HLDA 1N5KA 3NBXX 3ZDQA 5TV2A 1UAAA 2XXAB 1E2DA 5JWHA 1IN7A 1WBDA 1NMYA 1BMFA 2FF7A 2ORIA 2A7QA 3ZVMA 1KO1A 1KMHB 3QKRB 4MKGA 5ELXA 4PAOA 2Z0MA 3N70A 4U5XA 1E9FA 1Z63A 4XD7D 1GFIA 4OHZA 4BFWA 4BGDA 1GNPA 5B58C 3GLGE 2JDID 5BW8A 1GKIA 4WXRA 1D2EA 1SVSA 3NDPA 2ONJA 3W9YA 3SQXA 5J40A 1IN4A 1OE0A 3MCAA 2ANCA 4O3MA 1XB2A 1E0KA 2R6CA 1LF5A 3ECCA 3KJHA 3OFND 4W5JA 4MQBA 1A7JA 4LHZA 1VECA 3WYGA 2HCBA 4MGYR 2FFHA 3IQWA 4DIEA 1E9BA 2REOA 4CGZA 2EWVA 3Q7PA 5DI3A 1XMJA 1EXMA 1HE8B 1KKLA 1XX6A 4JSTA 1LB1B 5CDFE 1GITA 3L82B 2PCLA 3IILA 1VIYA 3LH5A 2J9RA 4L9WA 1Q20A 4AYTA 1Q1QA 3PR1A 2P65A 4JYBA 1KO5A 2IYWA 4KXFB 4BEBA 1U98A 2GAAA 4HUQB 5C4GB 4AKGA 3QVUA 3JZMA 4L4UA 2EYQA 4TLEA 4DT1B 3LRPA 3THWB 2N42A 2ZJYA 1MO3A 2PZGA 4DVGA 1CR2A 2J0UB 4O2RA 2QQ0A 1YZLA 2IS6A 621PA 1GL7A 1S1MA 2XTNA 3ADCA 4PHHA 2HT6A 4CVNA 4GRAA 1AS0A 2WZQA 4I1OA 1JR3D 2CK3D 2RB4A 2F6RA 3K53A 1SXJB 1K8RA 1R0WA 1Y3AA 4MH0R 4HLUA 5TB5A 1NNEA 4B74A 3I62A 1WF3A 1IAQA 2VF8A 2GVDC 2Q9BA 3FHCB 1UEJA 1SZPA 4LCBA 1MABB 3SZRA 4CIDA 2EFHB 3PFIA 4TQUS 2QTVB 2X8AA 1U8YA 3ZLJA 4XJXA 2WWWA 2QTFA 3U5ZB 1XPRA 4QKQA 4NYMR 2IX3A 1KDRA 3IKJA 3PCRB 2DB3A 4UJ5A 3DPUA 1O3YA 2KE5A 2QT1A 1OLOA 3LVQE 5J5CA 5HKKA 3CNNA 1ZU5A 2OESA 1W7AA 1SULA 2EFCB 1JAIA 2YWEA 4QJ5A 5HE8A 4AKIA 1D6JA 1DAIA 2BIFA 2LCFA 2V55B 1P9WA 4EIWA 4OJQA 3BJIC 5JSZA 3O8BA 1KAOA 3FPAA 5L3VA 1KDPA 4ZDKA 1E32A 2AWNA 1XXHA 3W6OA 4NCIA 1VYUA 1X3SA 4Q01A 3THXB 1U9IA 1XJ0A 3TVTA 4DIDA 1YRBA 3T1TA 5EXPA 1BIFA 2ZVQX 5L3RA 2GZAA 4IDHA 1LS6A 4XTRA 4HATA 2ANBA 3AVOA 3UXMA 4Q9HA 3QEJA 5AJVB 4R98A 2R2AA 1Z0FA 4QOSA 3MUFA 2WOJA 2ZR9A 3T35A 2IK8A 2YWGA 1Q3HA 2BBWA 1C9KA 4M21A 4IDPA 4I4LA 1JEEA 5AUPB 3PITA 4F4JA 1KI2A 2R6FA 4PR0A 2BWJA 2W83A 1HE1C 2VBCA 1M7HA 3BC1A 2H17A 4AG6A 2IYLD 3DKPA 4E5UA 2WWHA 1A1VA 4ITRC 2ZANA 4PC3A 1F60A 2CJWA 5H70A 2FGKA 3A58B 5UKDA 5KTYA 4US0R 5F2EA 1F2TB 4IOLA 3UG7A 2C78A 2QENA 2QZ4A 1G4UR 3I5YA 3GPLA 4MYHA 4TSFD 2CBZA 1KAGA 2W2XA 4RD2A 3RRMA 1AS3A 2CHVA 1AZTA 3GLHA 4NP6A 2XOKA 1FQKA 5KNBA 2FNAA 5KO2A 1FMJA 3FMFA 3LXXA 3GLIA 1AKYA 5FL7D 3LW7A 5DHFA 1IM2A 4RD0A 4TL7A 3VX4A 1AJEA 1OB5A 5FTLA 2VP4A 2P6UA 2X2EA 5FR1A 1L2TA 1NBME 4EPVA 1JECA 2C2HA 3BH6A 4A1FA 1ESNA 5KPJA 3AEZA 4DSOA 3A6PC 2DWOA 4L16A 5KSZA 1SXJE 3MD0A 1A5TA 1LV7A 2ZUCA 4DLUA 1GOTA 1H8ED 1NN1A 3NG1A 3HU1A 3RS2A 4G5SA 4FI3C 3V4FA 3OIVA 2W2VA 4NE2A 3RS7A 3OE7A 5SZKB 4D26A 1OFIA 2HCJB 3BH7A 4RJLA 3T5GA 3LAWA 3U60B 4ZPXA 4I1UA 3SQWA 5CYOA 3NKVA 5FPTA 1YJ5A 5KDLA 3UIEA 2FSGA 2PT5A 4JLNA 3ZQJA 2WTUA 2VIIA 2NG1A 1I4LD 3A1WA 2CLDX 3K0SA 2B7BA 4JL8A 5GJVC 4TMTA 1P2VA 1WRBA 3AUYA 3FVQA 3MMPA 3PUXA 4JS0A 4LX0A 5GJWC 5JCPA 4C2UA 2MMCA 3ND9A 4JKYA 3AP1A 3T06B 5EP2A 4X8HA 3LWNA 3QPUA 4PQRA 2OHFA 4M4SA 3RRZA 1ETUA 4NL4H 1Q44A 3L2OB 1QHIA 1G8GA 1W4BA 3FB4A 3K9GA 3LV8A 3I8XA 5IK2A 1KY2A 3S1AB 1W2GA 2WPDA 1W0JA 3C7KA 3F3YA 2AFHE 3NC1C 1LFDB 1OIXA 3WRXC 3REGA 2EW1A 1QVAA 5GVSA 4EJSA 3RHFA 2AX4A 1CKEA 4B75A 3KXIA 1WB9A 5H68A 2BEJA 4LUCA 3TR5A 2O0JA 3B1XA 2XNSA 2FH5B 4GMDA 4H1UA 4C0HA 4M1SA 5JJKA 1M7GA 4FMDF 3W5JA 3KXLA 4IFEA 4LY6A 4Q9KA 2WMOB 1PZNA 2OFXA 2GHIA 3U7EB 2ZREA 4B43A 2PJZA 1OV4A 4M22A 4A8JA 3BB3A 1N6HA 2IW3A 2P0EA 2G6BA 1W5TA 4KVAA 2EQBA 2IUTA 3U44B 1X86B 2IS4A 3VX3A 2JGNA 1NVVQ 1TX4B 1XTIA 5HTKA 2GZDA 4A0HA 4II7A 3SJBA 1KO8A 4XIGS 2C8VA 2VA8A 4ZI3A 2OCYC 4OI4A 4FCWA 3B1VA 3TJZA 1ZM9A 1KSHA 5B57C 2O52A 2YC4C 1G4AE 3GLFA 1KSJA 4JLMA 1Z07A 4Q5IA 4LDJA 4Q7LA 5JHGB 2CEAA 4TTQA 2QROA 1XWIA 3K8YA 3FFAA 1TF7A 2AD1A 4RKEA 4URZR 3CNOA 2C9OA 4A6XA 4JVSB 3Q85A 3P32A 1E3MA 1T0HB 3W8NA 4ZIRA 2OEPA 4JL5A 1KNXA 3KKQA 2IXEA 2C96A 1PV4A 3SR0A 3B6EA 2KWIA 1KK2A 4LOAA 4XSHA 1U90A 4A2QA 1Z0JA 5KU1A 4DCUA 2VEDA 2XAUA 2A5YB 1UF9A 2A2ZA 2OILA 2XX3A 4HEJA 1NN3A 4MDEA 5J4VA 1QHYA 5FPSA 4D82A 4E09A 1DOAA 1GZSA 4FINA 3HP1A 4HLDA 5CM8B 3CX6A 4K81B 3TIFA 4KLZA 1AKEA 1VDZA 4QL3A 4DLTA 5J4LA 1LF0A 3OHMA 3BH0A 1HV8A 4NBSA 4MYUA 5C4MA 4ZDJA 1RRCA 2IUUA 2C9YA 1OHHD 3TSOA 5E4FA 2NPFA 1MRNA 1RRPA 1JB1A 3A4MA 5BYJA 1NG1A 4DDWA 1FTSA 1VYTA 1XEXB 2JAQA 4YMWA 2BMFA 1UFQA 5FOSA 2W2TA 1T8UA 1VKJA 2GF0A 4JLVA 1PJRA 3Q8XB 4JL6A 5EP3A 2XJ9A 4WZBE 2NO6A 1KI1A 2GXSA 4B3GA 4WXPA 4ASUA 1EFRA 5AUQA 2WSSA 521PA 4B73A 1Z6XA 1HURA 5CK4A 3BK7A 2JLVA 3IHLA 4LC0A 3Q7QA 2CMKA 4M0LA 1DAGA 1TPZA 3GLGA 5D3QA 1E9CA 4F7WA 3TQCA 4Q7MB 1W48A 4J0QA 3IPXA 2Q3FA 5GJCA 4NYIR 5EP1A 4YMTA 4D6PA 1TQDA 3U3JA 1XTRA 3QXSA 4KSBA 1T8TA 2RKOA 1PLKA 2QP9X 2ZSEA 3NBFA 3L0PA 5LB2A 4KITB 3PUVA 5DIFA 3WBJA 1XD2B 2ZUBA 5CLQA 4NU0A 4IXMA 4F93B 5EXSA 3MWYW 1T91A 2R6GA 4Q21A 2EWWA 5JLJA 4LHXA 2ZR0A 1U81A 3A36A 3IO3A 3B8HA 4HB2A 5CDFA 4FWTA 2VYFA 4KVGA 4URWR 3X1WA 2JASA 4XWAA 1K5DA 1VG1A 4MYCA 1E2MA 1IHUA 1I2DA 2O0HA 3D31A 3LFUA 4EPRA 3EPKA 1CJVC 1RVDA 2KBFA 4QGAA 5IRCD 4HB0A 3GD7A 4BEJA 2AWOA 4QRHA 1P2TA 1R8QA 3TE6A 4BFSA 3L8ZA 1NG9A 4PX9A 1GSIA 5EXXA 1XD8A 2RGNC 2NO9A 4B2IA 3U7HB 5CIWA 1ELOA 2CL6X 3FGNA 2RH5A 3B1ZA 5JS8A 2PMKA 5J4YA 1NLYA 3EA0A 5EXTA 1DG3A 4YONB 1YR9A 2FEOA 4N0DA 1JR3E 2BVNA 2JEOA 2YOHA 4TMWA 2RGXA 4RD6A 2GCOB 2ZJZA 3C4JA 4AYWA 1P9RA 221PA 1BO6A 4NDZA 2OUKA 4DLRA 2ZAOA 2O8BA 2BM0A 5LB4A 4FCTA 1F5NA 2ZS8A 1N6IA 1PVOA 1IN6A 1OXTA 3A1UA 3LLMA 4G01B 4Z51A 4LZZA 1ZVQA 1K6MA 2CHQA 1W36C 3RWMB 3EWSA 1DE0A 4FMCB 4MRSA 5TVKA 3SBEA 1ZM2A 2OAQ1 5E3HA 1CJTC 1GRNA 1CJKC 1R8SA 2BM1A 121PA 2NO0A 2ZROA 5L3SB 3F5FA 1X6VA 1KO7A 1GTVA 1Q57A 3SN6A 1W36D 3BFKA 1TF5A 1Z6AA 3ZH9B 1CP2A 1EFTA 1FP6A 1UKYA 2NGRA 2QRZA 4F4CA 4HDCA 1S1CA 3CRMA 4KFRA 1JBKA 4PSVA 2R44A 3QKUA 2Z4SA 3TKLA 3TAUA 2MMGA 1CIPA 1HY3A 1XTJA 4D4KA 3QIAA 4K8OA 2V8OA 4YXWA 2ZVPX 1LNZA 2QMHA 2XXAA 1QHGA 1Z83A 3QBTA 1COWA 3T1QA 2ZYUX 1KZ7B 1XCPA 3BB4A 1KMHA 3QKRA 1GNRA 5A5GA 4GOJA 2W58A 4ZDIA 1F3OA 3PEVA 1SVLA 1QVRA 3AB3A 3NWJA 1E1RA 3PIRA 4LJ8A 1HEIA 1GNQA 4P31A 1E98A 2HT1A 3B5JA 2O5VA 1P3JA 2E9SA 4IDQA 4EDHA 4C0LA 2QGZA 4ZCIA 1CS4C 2QN6A 2XTMA 4PAMA 1E79D 4DCVA 2XTZA 4U00A 2JJ8A 1E2GA 1DAEA 1TMKA 3KQHA 2DFTA 3AVTA 4M53A 4ARZB 1MRSA 2CLCX 2QBYB 1IY1A 2IWHA 2FSHA 2F9MA 4Q00A 5KHOC 5FFMA 3C8UA 2QSYA 1NSTA 3EZ2A 1G3RA 3N5CA 3QE0A 5CLLA 4NPHA 1T3HA 1XTKA 1YZTA 3FDIA 2JJ1D 3I4LA 3I5XA 1VYVA 1R0XA 3WHKA 3C5CA 5DN6A 1P9NA 3M4YA 4RZ3A 1JNYA 1S3SA 2ZE7A 2PZEA 3EC1A 4JBYA 3H0KA 4HUQA 4G1UC 2NZJA 4Q19A 4ACBA 3PJRA 1KI9A 1T3SA 2YNMA 2XB4A 4DT1A 2GA8A 2VPPA 2CL7X 3V00A 3CWZA 5F9HA 1B23P 2J0UA 2DWQA 3NHAA 1BYIA 2REXB 4M1WA 4NCNA 1FUUA 1OFTA 3SEAA 2ZRCA 1NBMA 2ZRBA 3W8RA 5JMTA 1Q21A 3PG5A 2IHBA 4NHOA 3EARA 1SXJA 4QHTA 1BMFD 1H65A 4CRWB 4A36A 1W0KD 4I81A 4G5OA 4P33A 1MABA 3N2EA 2J3EA 1QDEA 5FTMA 4K46A 2BEKA 1EGAA 5KUTA 5L3QB 2E1RA 4M9QA 1KI3A 1G41A 4IKEA 3PEUA 5EE3A 4KYUA 4OJKA 5EQTA 4D4JA 3GLFE 1IJEA 2VHJA 3AF1A 3X1ZA 3UMRA 2FPLA 3RC3A 1UPTA 3FYHA 4AKHA 3QI2A 5FBRB 5A4JA 1QZXA 2GDJA 1ZU4A 2JLRA 3VU9B 4HLCA 4R9UC 1DVRA 1E2FA 3WP0A 1N3BA 1EK0A 1XCMA 2QAJA 4BWYA 3WMEA 3CRVA 3WHLA 3GJ0A 3K09A 3SBDA 3EZ7A 4UNQA 4B47A 3AF4A 2VHTA 1MR3F 3B13B 2FX3A 3Q72A 3GFOA 2Q9CA 4IOJA 3TSZA 1ZAKA 1E0SA 4LYFA 3THXA 1SVWA 4JKIA 2B7CA 3AF2A 3QENA 4V0OA 4DSNA 1KI8A 1UADA 2P5TB 2OV2A 4OI2A 5DI9A 4B2PA 3EC2A 4LHVA 2PJRA 1Z0AA 2ZQ5A 3ZD6A 3TLXA 1CEEA 3DMDA 4M2LA 4XSGA 3EZ9A 1KK3A 2P2LA 2VHUA 4HLUC 3A37A 1E2LA 3T61A 1G8PA 1Z0KA 3VFDA 1RRFA 2J87A 2BJVA 2Z83A 4LHWA 4URXR 4DBLC 2ZE8A 4TT3A 2ZRGA 2FWRA 4CEHB 5JHHB 1ESMA 1R0YA 3HJNA 4B76A 1ZNXA 4W5WA 1WXQA 3QY0A 5FH9A 1FNMA 2FEMA 3OEEA 2HXYA 3KL4A 2D06A 4MRRA 4JJZA 2DR3A 4TZ0A 1V5WA 2R62A 3VNVA 4BUJA 4MA4A 2DFLA 3NEYA 2KSQA 1DAHA 1ZRHA 2MSEB 4P4SB 4XWKA 2FN4A 2JLWA 3TUZC 1FFHA 4R2IA 1F2TA 1SVMA 4KJZA 1J8MF 1E1QA 3H2YA 1XD9A 1XDBA 5BN5A 1FMLA 5C46F 1F6BA 1Z5ZA 2RGGA 3PV0A 1AM4D 1L4YA 3FE2A 4A0RA 4WVFA 1RW4A 4Q7KA 5HKKD 4F92B 3QSYA 5H1YA 1E69A 5FTJA 1TAGA 2QE7A 2XNDA 2VLIA 2IYTA 1CTQA 2XZOA 3TSWA 2WAXA 1FQJA 2V1UA 3QUSA 4PQYA 4RZXA 4PPQA 3U6KA 3B2EA 4Q9IA 3IEVA 4OHWA 4O0MA 3IO5A 3RSOA 2AXNA 1P2UA 1XTSA 5EZ5A 4C2TA 4ZV4A 2X19A 4HAWA 4D0GA 3DDCA 1FX0B 3KX2A 4JLJA 2VF7A 4LPSA 3PENA 3KQKA 1AGRA 3WNDA 4V0ME 4TMXA 1KJZA 2H57A 4PHTA 2QUZA 3QF4B 1G6OA 4IXNA 4B35A 5K8IA 2D3WA 4RFSB 1KI7A 3AUXA 5HR5A 2FE4A 3K1JA 5K8TA 1P7CA 4CW7A 1UKEA 4WAUA 1OPXA 1X1SA 4MRVA 4PO9A 4Z1MD 3ADBA 2KBEA 3MFYA 3AH8A 2VHQA 2Q21A 2LWIA 1OIVA 3ETLA 1U2RA 2ZRMA 4NCHA 1JPNA 1YQTA 1NJGA 4FIDA 3GFTA 2D74A 1OXUA 1IOZA 5KDOA 3WMGA 1M1YE 4KO8A 3CNLA 1GUAA 2EFEB 2CCGA 5CM9C 1W36B 2FDCA 1CJUC 1QRAA 2G0NA 2IYSA 4M1KA 1E0AA 1Z06A 4AYXA 1E4VA 1HT1E 1UEIA 1F2UA 1Z3IX 3RABA 5FUYA 4NYJR 3VQTA 4PC6A 2DBYA 1TQ4A 1U99A 2W6JA 3JVUA 2IYQA 4V0NA 4D0NA 3U7FB 1R10A 5FBLB 1TEXA 5HPYB 4MYTA 4OI0A 3CX7A 5K8UA 4M1YA 1VHTA 3DL0A 3S1AA 4KSCA 2VO1A 1XEWX 4C0SA 3K0CA 2XITA 5FBQB 5BQ5A 1KO4A 3CH5A 5GVRA 2P5SA 4XD7A 3ZZ0A 2VSOA 4A2WA 2JDIA 4MGIR 3QXHA 3V9PA 1D9ZA 2QM7A 4KYIB 4M9XA 3AVXA 5EP4A 4DLXA 2ZRFA 3MAAC 4D25A 1XEWY 3ZVRA 2FPKA 1HUQA 3OFNA 1G5TA 4ZCMA 3ND8A 1D2NA 1QBKC 1VCOA 2IXFA 4Z8XA 4QJ3A 4DDTA 4TTRA 1XTQA 4IVRA 2B8WA 2ZRLA 2X1VA 1A4RA 2GXQA 2GKSA 4RD4A 3B85A 2J7PD 1Q1ZA 2OBLA 2FSFA 5EJEA 3KTAB 2WJGA 1FPMA 2CCKA 4DCTA 1E2PA 4HZIA 2VP9A 3KJEA 3W5IA 2DWPA 4L9SA 1UKVY 3LBNA 4LYJA 4C0QC 4EFNA 3U44A 1UDWA 5GADl 3VKGA 1XP8A 2JIZA 1QHSA 1T6NA 2E87A 3BRWD 1M6NA 4G3XA 5AJYA 4F91B 5J4KA 4GDFA 4DRZA 3LXRA 1E2EA 1SVKA 3L8YA 2B92A 3RNLA 1KI6B 2YWHA 3VAAA 2QORA 3P1JA 1Q22A 3TQFA 5JWRA 4PPFA 4BZXA 1NY6A 1EFCA 1T4GA 2PH1A 1MO4A 3KUDA 2FPMA 4RVCA 1ZIPA 4DUGD 3LO5A 2D7CA 2W0SA 3R9WA 4B3FX 3LX8A 4TTPA 5FUXA 4W5HA 1JR3A 2WSMA 4TQ9A 2XSZD 1TUIA 4NMMA 3KJGA 2G88A 2V1XA 1G291 2R9VA 5DISB 4F4IA 2ZE6A 2WPDD 2I1QA 3IPYA 3LDAA 3NXSA 2G1KA 1YZNA 2Q0HA 3EIQA 1KYIA 5FBVB 4OI1A 4Q4AA 3B1YA 3K9LA 1ZNZA 2PEZA 3FOZA 2YV5A 3GFPA 1W49A 3T1OA 4US1R 5TARA 1YZKA 3EPHA 3EAQA 4QG7A 4MKFA 4BLTA 2IL1A 4XOIA 1YR7A 1G20E 1ZYUA 1KDOA 3WRYC 1GM5A 4QBHA 1MT0A 5CB8A 2F43B 2JJ2A 2VSFA 2BKUA 1NRJB 5IHPA 3UMFA 3T34A 4NKRA 1XEXA 1NMXA 2J41A 4QC2A 2Z43A 2O0KA 3UMSA 3HU2A 5DO9A 3U3KA 1CF4A 1NN0A 1R7RA 3I73A 3IIJA 1OH7A 2B8TA 2QMEA 3TBKA 3VTKA 1NVXQ 3RVBA 1LTQA 2C03A 4TL8A 3SC3A 1D5CA 1S9DA 3HR8A 3FKSD 4PO1A 3H4MA 2BCJQ 2FFBA 3CB4A 4A0GA 1ZC3A 3VR5A 4LPKA 2IS2A 3QXCA 3WXMA 5B2ZA 2PEYA 1DARA 5FTKA 3GJ6A 3EA5A 4NTZA 1F2UB 4UJ3A 3BIFA 1DO0A 3T1VA 4N0EA 2RGEA 3CPHA 4JJKA 2H92A 3LA6A 1KIMA 4G5RA 2NZ8A 3SJAA 1N6RA 4YMVA 1G6HA 1XMIA 4JLAA 3WYFA 4BZPA 1TQ6A 1XD2A 2PLRA 5FOUA 2CL0X 1N5JA 1W1WA 3K0EA 1OFUX 3ASYA 4NYMQ 4WZ6A 5JRZA 3U61B 1C4OA 4IRUB 1KSGA 1G5RA 3PUZA 1OXXK 2ZSFA 3BWDD 5FL3A 2W6ID 1T3LA 1ZCAA 2VL7A 1JXMA 4Q7JB 5FR2A 4RD3A 1KK0A 2EFGA 1N5IA 2VP6A 4GOKA 2RGAA 1XJQA 1N6KA 4V0KA 4KAXA 4DLVA 2XEXA 4RY2A 3PUYA 1G64A 4GOXA 4UNSA 5JJLA 1S96A 3FHOA 3QKTA 2QNRA 2V7QD 1HT2E 4A4DA 3OIYA 3PEWA 5F3WB 2ZUDA 2F55A 4C7OA 1G1MA 3SU8A 2QAGC 1OH8A 3KKMA 3P20A 3U3OA 4YQFA 1RJ9B 4CT4B 4LJ4A 2H7VA 2F3RA 1J2JA 2G77B 1J70A 2WVJA 1G7RA 1T0JB 2IEZA 3M6AA 2X2FA 2GCOA 5EE9A 1KOFA 4TZ6A 2ZJ2A 4OQNA 1Z28A 2L0XA 4BFZA 4BFUA 2J0SA 2VP2A 2BV3A 1UBCA 5FI1B 1P60A 2ASEA 3ZVNA 2N46A 1M74A 2PBRA 5GJBA 1JI0A 3WP1B 5G41A 1IY0A 3I8SA 2A30A 4HDQB 2GZHA 4G5QA 2D4HA 3ICEA 3DM5A 3Q3JB 1NSFA 4A6PA 1TUEA 5L3SA 3RS5A 1P72A 3KKNA 4RZUA 1VG0B 3GCGA 4I1VA 2IHYA 4AD8A 4Q4AB 1FW6A 3CF2A 4LBVA 1S4QA 5IF9A 1KTVA 3VKHA 2F1IA 2ZI5A 2ZIAA 3OEHD 4AY2A 4XVQA 2JLUA 2IYUA 2J5XA 3MSXA 2KB0A 3FMOB 1J8YF 1OKKD 3AF0A 4Q1EA 3VHXA 3O8RA 1E9AA 4KODA 4RCZA 2SHKA 3PQCA 3U3RA 1ZBDA 3X2SA 4M9ZA 4ESHA 4DJTA 4KU4A 3THOA 3CPEA 1JJ7A 1RYFA 1GILA 3EASA 1N25A 2D62A 4TLDA 3TH5A 3CLVA 1GVNB 3TK1A 4B6EA 5LD2C 3SHFA 1IJFA 4FD2A 4MDFA 4BRWA 5EUQB 2PMDA 1XEFA 4FCVA 3BOSA 3K0AB 3MRSA 2W00A 3OIWA 4R7ZA 1G8FA 2HJGA 1KMQA 3ZIAD 1G7TA 3LVRE 4C4PA 4ARZA 3RANA 5JBQA 5KSYA 2QBYA 1WBBA 5B30A 4FMCF 3GMTA 4B3XA 2GTPA 5EE1A 4CZ2A 3JVVA 2ZSBA 4HB4A 4US2R 4YLGA 2R6DA 1CRPA 4NZYA 2DFKB 4JVLA 4XH9B 1RC8A 4JT4A 4B3CA 4IFBA 1KKMA 1DG1G 1S9HA 1AQYA 1EWRA 4HAVA 5TY0A 2JLYA 4C0BA 3FMIA 3EXAA 4LBZA 5JEEA 4JSYA 1G5PA 1YZGA 3TW4A 1N6LA 4BASA 4D0LB 1XRJA 2QI9C 1FTNA 2YZ2A 3SFZA 2YVUA 4OK5A 1TEVA 2WM9B 2VTKA 4OKSA 1HH4A 4BLQA 3EZ6A 2KI5A 4LHYA 4HUTA 5DLQC 2CCJA 3DZDA 3ADDA 4QNMA 4BE7B 2FJUA 4JLPA 5DYGA 4DCNA 2GILA 4L5BA 3R9IA 3TVDA 4A0FA 3LNCA 4EQ6B 5JEDA 1OXVA 2O8FB 2ZU6A 2QP3A 3FMPB 1H8HA 4RFVA 2ORWA 3T15A 2WJHA 1E2QA 1G7CA 1TTTA 4V0MA 2V9PA 3LBIA 1N6NA 5FI0B 2H16A 3AKCA 2R6AA 2GJKA 2EFDB 4Q4LA 5CK5A 1KK1A 4LWZA 1G17A 3K9NA 2QU8A 3U4QB 2ATXA 3L0OA 3VNUA 4A92A 4IVQA 4FN5A 5L3QA 1J7KA 4Q4HB 4C7OB 1G18A 2ATVA 2JATA 1OYYA 2H18A 1G21E 1UBEA 1YHNA 1R2QA 3AGQA 4URUR 4ZDWA 2GCNA 4OK6A 3KFVA 5JRJA 2UZ3A 2JCSA 4A2PA 2Q6TA 2GXUA 3VU9A 1VG9B 4XWOA 2DCUA 1ZCBA 2WV9A 4B33A 4N3NA 1YU9A 3ONWA 3CH4B 4B3BA 2FMXA 2OFWA 2H8KA 4UXJA 1OHHA 1U0HC 1QHHB 3OAAA 4PQFA 2CNWD 3TGPA 2BOVA 3RC8A 4HYYA 1NIPA 2GBLC 4XTCS 1N5LA 2NPIA 1OH6A 5JWOA 2ZI6A 1EESA 3C15C 5DE3A 5ANRB 1EX7A 3ASZA 2HUPA 4MGZR 4OBEA 4WBSA 4QHSA 4AG5A 1N6PA 1DADA 4LV6A 2NQ2C 4XVUA 1ZM4A 4Q18A 1B0UA 3N2IA 2O8DB 4LI0A 4GP6A 5FPKA 3F0TA 1X1RA 3TAHA 2ZTSA 1E9RA 5CB6A 3J81k 4CEHA 2YWFA 3TR0A 1AK2A 2WWYA 2C04A 1N0UA 2RGBA 4QGHA 3SS8A 1TU3A 3ZS9A 2ZR7A 4LJ5A 4B71A 4OYHA 4Q9LA 2H1LA 1OJLA 5JS7A 3LLUA 4UQOA 3FHTA 1G3QA 4QM7A 4WA7A 4JLBA 2EU8A 2FU5C 4YDSA 4HI0E 3RRNA 4V0LA 4E07A 4EUNA 3HDTA 1VMAA 4P4SA 2XGJA 1OW3B 2OSBA 2IUSA 2IYZA 2OT3B 2BBOA 3RYTC 2CE7A 2OXRA 5HZHA 4D2IA 1UM8A 5LBIA 3Q5DA 4S2EA 1WQ1R 5DHAA 3CF0A 2ZEJA 2GRJA 4OHVA 1M7BA 3QG1A 1X8JA 5HCIA 3A8TA 1II8B 1BOFA 1U0JA 1E6CA 5CYPA 3DEFA 2RMKA 1DAKA 2WKQA 5KSPA 4QBFA 3CR7A 1GP2A 1KJWA 4NYIQ 2C99A 1FX0A 4RZ2A 1CR0A 2NTYC 2P67A 3PUWA 2GEDA 4ERNA 3P4XA 4TYNA 4W9MC 1QF9A 3QF4A 2VHCA 3B78A 2QAGB 2PX0A 1Z6TA 1NF3A 5AJXA 1SGWA 2OM2A 4RFSA 1VCMA 5TXGA 3KJIA 1XPUA 3MGCA 4DB2A 4Q1DA 4OHYA 1Z8FA 2LKCA 5SZHB 1P6XA 2HLDD 2WHXA 3GJ5A 4TLAA 5AWFC 3CUEF 2F1RA 4IOMA 2O8EA 821PA 4OQFA 5D3MB 5TDHA 5G3YA 5EE5B 3SJZA 4QM6A 2V6IA 1KSFX 1ONBA 3IDQA 1E1QD 4DWJA 2OO7A 5C1BA 3DO6A 4TL6A 1I4TD 4HAUA 1WCV1 2J59A 4TQAA 4B2LA 2XB2A 4MKIA 3CRRA 3UG6A 2GETA 4FXPA 1AGPA 3A1VA 3E70C 4JLOA 3HYRA 1YZQA 1I4DD 2Z4RA 3P26A 4W7SA 4DSUA 3EPLA 2WBLC 2O8CB 1VTKA 4IDOA 4PSKA 1EFUA 3DOFA 4PTLA 1TADA 5HCNA 3D6TB 3PVSA 4AC9A 4YC7A 3H86A 3CPJB 1TU4A 1P2SA 4LV5B 3W6PA 2A78A 1WDTA 4GFDA 3I61A 2QPOA 5DYIA 5HZKA 1EWQA 1HQYE 1ZM3A 3NVAA 3HYTA 2VP5A 5CITA 2WWIA 4KLNA 3KUCA 4GBMA 2XJ4A 3A1SA 2CVHA 2A5DA 4ZO4A 1Z6GA 2RCNA 3VR6A 2R65A 3VR2A 1A82A 3TUIC 4IOKA 1E79A 3DKVA 2PX3A 2QMUA 1N0VC 2FZ4A 2WIAA 5AK0A 4DEYA 1JJVA 4LJYA 2BKEA 1NN5A 1WE2A 5JECA 2YINC 4CEIB 3ICQB 4PO8A 4MKHA 1HQCA 3SFVA 2J0QA 4UNPA 5F9FA 4Q1FA 1US8A 1X8KA 1Q1BA 4KHZA 4Q1BA 1R5BA 1M2OB 2AXPA 3KTAA 3O47A 5C18A 1QHXA 3QPVA 3GJ4A 4Q4JB 2JJ1A 4H1VA 4DLYA 3THYB 3CBQA 3NIBA 1HYQA 1XU4A 2HXSA 1Q12A 5FOWA 1N0WA 2GWHA 5A0FA 3UWOA 1DO2A 3L0SA 1VIAA 1NVWQ 1IBRA 5SZJA 3WBKA 5EE0A 1IXRC 3SJCA 1BH2A 1TF2A 4KFUA 1E0JA 1W5SA 1KI6A 1II0A 1E9EA 4OHXA 1IXZA 2PLFA 2XZPA 2AHOA 3AVPA 4BZQA 3QBVA 2BCGY 4BLPA 3K70C 3HPRA 2YC2C 3BFVA 4RSGA 1XF9A 4RD1A 1RIFA 1YVDA 4CYMA 2OLJA 4OQLA 1D9XA 3NTUA 1U9IC 2ZSDA 2QEQA 2GAOA 3SYNA 4DLZA 1W0KA 4QBIA 4N1AA 3K70D 2YHSA 2ZJAA 2IBMA 3IBGA 2OZEA 3UK6A 2GF9A 1JALA 2W0MA 4OQXA 1DTSA 4GZMA 2GJSA 2D2EA 2XZLA 1E2NA 4B6FA 4KV9A 4TLCA 1ZINA 3LQRA 3U6BA 2FA9A 4NH0A 2BMJA 4LBYA 1FOEB 3QG5A 2F43A 5G53C 3T12A 1KHTA 4HSEA 4BPBA 1ZMXA 5H8WA 3H84A 3L43A 5AUOB 2BC9A 3B9QA 4PC1A 4AI6A 4HZUB 4GZLA 2NO7A 2F7SA 4BFTA 4Q9JA 2FFAA 3DMNA 4M1OA 5FBWB 1EFHA 3KDSE 1RPZA 2JIZD 1GL9B 4PAQA 3BB1A 3VKWA 2GEUA 2C5LA 1TL7C 5E95A 2O8EB 2GVZC 3PXGA 4E22A 2ZAMA 4JVNA 3AVQA 4QNRA 2WIBA 4CT5A 5E7IA 1ZUNB 2FZLA 5BN4A 1XCGB 4PHFA 3NDBB 3QXXA 2ZE5A 3GEIA 4KFSA 3KQUA 2WMNB 1G9XA 3CRW1 2PT7A 2LKDA 2ZI4A 3AKEA 3AVVA 3R8FA 1JEDA 4D4MA 3K0FB 1ZUIA 3I32A 3IIKA 3TRFA 4EAQA 2IS1A 3WMFA 5FUWA 1MKYA 2GEVA 3CZPA 2XOKD 1NVUQ 1SKYB 4KFTA 3GEEA 4G0NA 2WJVA 4B44A 1L4UA 4C30A 8OHMA 2J1LA 2PZFA 3RWOA 5FOVA 1KZGB 3IUYA 2V6JA 1OXSC 3L0IB 2Z5FA 3E1SA 2Q9AA 3I3SR 4LV8B 1SQ5A 1XNJA 3MG9A 1ZD8A 2WKPA 2IYXA 3RS0A 1IN8A 1D2MA 4DXAA 1A2BA 1ANKA 5G3ZA 2GNOA 3AKDA 4EPWA 1G8YA 1R5OA 3E5HA 2JJ2D 3OESA 4ILEA 3NBZC 1I2MA 1Z47A 4MRPA 4C9BA 1X8LA 1TNDA 1US8B 2J46A 3ZZUA 1PLJA 3SDZA 1NJFA 2ZRDA 3QF7A 3AM1A 3GQBA 3ZGXA 4F38A 1GKYA 3OE7D 4Q48A 4MITA 2GJAA 2BHRA 1WA5A 2G3YA 4JIMA 3E2IA 4LBWA 1E99A 2FFQA 2J0VA 1CR4A 3RS3A 1RJ9A
chains in the Genus database with same CATH superfamily
2C9CA 3D5EA 1U1FA 1ZUD1 4PYQA 1UKBA 3T3EA 5LOVF 2VI5A 4EL0A 1XMPA 2P9JA 2EQ5A 1HSOA 3JYLA 4RDCA 2WWFA 4HFJA 2H3HA 1HDXA 4AMVA 3NFYA 5J2TF 5LQKA 2XUJA 1RIIA 3E35A 4AURA 5LMNB 4MRNA 3PHBE 3OX1A 1QG0A 1WG8A 2IC5A 1CCWA 2WIKA 3KO8A 3MCWA 4KIGA 5JD3A 1E9DA 4ZKEA 3RRFA 1JQJC 2WIJA 3RUPA 3W8EA 1NVVR 2GN9A 4EUHA 1QRSA 2IX9A 1EJ0A 4JXZA 2ATEA 4CEJB 4ZVPA 2VC2B 3OOYA 3PXAA 2AZTA 4UHKA 1DDGA 1J0DA 2PLAA 3GJQA 4WNAB 2GN2A 4EJSC 1Z0DA 2C4NA 4Z49A 4IXDA 4X1IA 2ZU0C 3WQQA 1YFJA 1RKUA 1U8FO 4IFIA 4PZLA 1M2HA 4YMIA 4B79A 2WIGA 5AXAA 3M34A 3ZDZB 1QSGA 1AD2A 2P1RA 1BFDA 1WUHS 4FIZA 5LYJF 2GZ1A 3ZI7A 5F1KA 5AVJA 4BEWA 1T9AA 3NHWA 1SH7A 4XWTA 5BPHA 2M6RA 4DQXA 2O1WA 1XNQB 3UH1A 2JLXA 2RHCA 3K8OE 2PTHA 5SY9A 3TQIA 5AW1A 1VHDA 3EXHA 5HE9A 4V1CI 4A8JC 1BVYF 4URFA 3UJ3X 3UTDA 2ZAYA 1RXIA 2JGFA 3SQDA 1ZMTA 3CNEA 1M73E 2JAUA 5M04A 4G8CA 3BORA 4WSOA 3VPAA 2YS6A 4Q37A 3R7NA 1DV2A 3I8OA 2G07A 1BJRE 3BVPA 4GI7A 5E9QA 4ND3A 3WK6A 3OLCX 4EG5A 2GPSA 2K5UA 3CUVA 2A5FA 4QYIB 4WXHA 3U7IA 3DO5A 4KBGA 2Q1YA 4GUAA 4MUYA 4W8GA 1IXSB 1IJBA 4C6TB 1LRKA 5KINB 2A9VA 4R7TA 1Q7BA 1AZSC 3GFVA 5K0FA 3A05A 1DQZA 2NU7A 2NXJA 3GOHA 3HXMA 3VV2A 3UJ9A 2HV8A 3K30A 1QHEA 4ETMA 2WB2A 1TM7E 2FN3A 2XCQA 2PGDA 1S6YA 1VHWA 1S01A 2J6IA 2B0CA 4HGQA 4DF3A 1MAVA 2FRDC 5AJWA 4U3JB 2R8EA 3NI2A 4MGKR 2X7HA 1BHO1 5EKSA 3CW9A 5B7QA 2QZZA 2BFDB 1GTRA 4HDSA 1EPUA 1PT7A 2QVCA 4LJKA 3WMXA 2J3MA 2Z6VA 1EFVB 4DR3B 1Q6YA 2JFGA 5B64A 1FS6A 4JI2B 4XAQA 5AM3A 5HCUA 1EK5A 1WXIA 1T2EA 4PV7A 1Y6GA 1UBNA 5JG7A 1IONA 1NVTA 1H4TA 3ZXIA 4G0PA 2QM3A 1IVYA 1TECE 3G17A 3I0ZA 2KJQA 4QQFA 1I4EB 3BRWA 3HWWA 2YUTA 3ZWXA 3LUPA 4NYJQ 5I01A 1X92A 2BKAA 2ZS9A 3R23A 3MJFA 3SXJA 2HJ9A 4MWZA 2Q2NA 1M1NA 1MVLA 2XYPA 1YV9A 1CJMA 2DFDA 3PFFA 2OCAA 1P61B 4Y0AA 3O8OA 2J9FA 1LVGA 3LBHA 3NH6A 1KMCA 1T29A 2H6EA 1R4ZA 1OZHA 2BRUA 3GH1A 3RUHA 1TC1A 1XEAA 5E2IA 1BYUA 1KPIA 3ED5A 3IP9A 2IT1A 3RSQA 5KQGA 1V4VA 2LPMA 2JCYA 3ANNA 4MXDA 4P98A 4TYYA 1T5DX 5DNYB 3I04M 4O1HA 1CF2O 1KS2A 1W4LA 2JG3A 3MW8A 1LI7A 2DQSA 3JWGA 5E6SB 3U3ZA 4BLOA 4EF6A 5T7BA 2HF8A 3GJRA 4QU0A 3BKWA 1YI1A 4RY0A 4U7DA 3U4QA 2GTHA 1Q7RA 5FL7A 3WZLA 3E7PA 1FU4A 5FPYA 3C5HA 2C20A 3KB6A 5AJZA 1E2HA 1I36A 3GRKA 2ZJ5A 3IEIA 3LQQA 1AU9A 2EVWX 4GI2A 1L7BA 1TQHA 1QX4A 3EQ9A 5EMNA 3RUAA 1DGQA 3GRCA 3B1WA 2NSHA 5SZIA 2BGWA 1XZQA 2MYPA 2Y1XA 3H2BA 4ON9A 1EFRD 3HCOA 3KJXA 3EAFA 3NVMB 3AVWA 2GM5A 2QG6A 5L4NA 3WNCA 3UC5A 2AUNA 5TEWA 1KI4A 4CM4A 1YZUA 1B14A 3RCBA 4QOEA 1YKFA 3LVFO 1QB7A 2OFFA 4A82A 2BLNA 4RNDB 2ERXA 2N75A 3UANA 1IXYA 3T3MB 2UXBB 1VPEA 2RKWA 3QV1A 2OC4A 5HF8A 1S0UA 2XDQB 3NO4A 4KREA 1ZSYA 3VPBA 2A5JA 4EJMA 1Y8RA 2PSJA 4NY1A 4ZREA 3WRYA 4AF6A 4E5YA 5KSOA 4U8GA 4Y2UA 5DGDA 1YZFA 4LE2A 5FO0A 5CA1F 1A9SA 4P32A 4E7PA 3GI1A 5HDQA 1P31A 3PDIA 4G37A 1W4RA 4QJ4A 2CNLA 3PTLA 3NGMA 4JSRA 1QUFA 2ZWIA 3KKPA 2MSDB 1C50A 2EFJA 5FWYB 3ETEA 1KQGA 4YX9A 2VH5R 1W5BA 2OLEA 2YFHA 3CR8A 3OKPA 1RC0A 3LCUA 4A1OA 2R96A 4EG8A 5DBIA 1W2HA 3JR3A 1NI5A 1TLTA 1T0PA 2JHFA 4MSUA 1J8QA 1RWKA 4DNPA 1RFLA 1RBYA 1QAMA 3KQTA 4ZOLF 3CW2A 3HL4A 5ALSA 5IYZB 2XR1A 1GGEA 3F5QA 4EVSA 1R6TA 1XZPA 4PFSA 4UNRA 721PA 1WXGA 4PW0A 4JQOA 4NFYA 1XA3A 4AZ3A 1J8VA 1Y63A 4GX1A 4Q0MA 1H6DA 2GF2A 3BTVA 4BZWA 4TLLB 3TE7A 5EHGA 3O8DA 2MSNA 4WWHA 1GDTA 4TYPA 4HP8A 2FWAA 1EWVA 1K4KA 5CIQA 3KTDA 4EY8A 1OB2A 2CYAA 3ZEAA 3OM1A 2DLDA 1Z2NX 4ZCLA 4BVLA 2ODBA 3EMBA 3U56A 5ALOA 5IHXA 4WMLA 1Z33A 2MSWA 2V54A 3SE7A 1EVJA 1V3TA 3EYAA 4TTVA 1T9HA 2A59A 2DKNA 3O1IC 3QMMA 2NTJA 2QTTA 3OCWA 4HOYA 3SC4A 2BT4A 3QBDA 4U2FA 2V7QA 2FW7A 5T5QA 4PIPA 3ERCA 4Z0NA 3UAOA 4U4AA 5ALFA 4CMAA 4FILA 5JI2E 1JR6A 3SSOA 1CJCA 1ZNYA 5AKIA 2G76A 4FMDB 5H9VA 3K7EA 3A06A 4UVIA 5AESA 3I72A 4LVNA 1YFZA 1O95C 3VPXA 3VNBA 3ZJTA 4XJSA 1TAHA 4M7WA 4BQSA 2QM8A 4YAEA 4JBWA 3HNPA 3M33A 3VKUA 4U6SA 3C2QA 3ETJA 4RACA 5DH9A 5FFFA 3LX5A 3WRWA 4YJHA 1SC1A 2HK8A 4ENTA 2FPPB 4IDNA 1N2CE 4N6NA 4RCYA 1OZAA 2V03A 2W48A 1NI3A 2ZI9A 3CIOA 1O77A 1A76A 2HFJA 2WKRA 1T9DA 5DULA 3AJ9A 3C8DA 5FPPA 2WRZA 3C70A 4AP5A 3WGKA 2W2QA 3RLFA 4TMFA 1CS0B 4NJEA 3O8QA 2FRXA 1VXOA 3PNOA 4JT2A 1PEAA 1UBMS 3H1BA 1T0UA 5M29A 5HP4A 1XXHE 4FYMA 1ZIOA 4YQEA 4XARA 2D8AA 2Q6OA 3OMXA 4IWYA 1SCUB 1Z2DA 5ITSA 2WTEA 2G4VA 2D1QA 1QR6A 2HJSA 4HNRA 4AP9A 4LJAA 5M5BA 5EERA 4KXWA 4IMJB 1E1RD 4HR7A 5ADUS 3HM9A 2ZB7A 5KTSA 3GVHA 1A5AB 7ABPA 2XWBF 4GZ5A 2GBIA 5IDWA 3NJ8A 3V4RA 1XFAA 3FPKA 4YXWA 4CF6A 3O26A 3RAGA 4X8MA 4QGBA 1RRGA 1J20A 2GASA 2JH8A 1VMEA 2YCLA 3QOXA 1THZA 2IPOA 1OKKA 2PYIA 3RIMA 2ENWA 1GLNA 4QUJA 1KVRA 2C2KA 3T52A 3JWEA 1GTMA 1K8ZB 3QHQA 1W44A 1ZISA 2ZBFA 3L8MA 2OG2A 4UTXA 1DEKA 5FWXA 3TMKA 2X77A 2CW5A 1UAGA 3OE5A 1XAGA 1NMZA 4GRDA 2FZCA 3X1YA 3A9TA 1O94D 1T1GA 1IG0A 3T5DA 4FFBB 1Q2XA 1NYQA 2DAPA 2HO5A 1DC7A 3GQVA 3BQNB 3LC1O 4IIUA 1T5TA 4B6PA 2GNPA 4EHNA 5LVAA 4EFLA 2OAEA 2B30A 1GAEO 3I6YA 1AS2A 3UMCA 2Z8YM 2FPRA 1TYAE 3N7UA 4FW9A 3P9ZA 3H3FA 3B1JA 4BAZA 2X58A 2IHVA 1N4DA 5E3IA 2Y1LA 5DSZA 4YP5A 5ICMA 3NBYC 1IZ9A 3FPFA 5LIPA 5EIFA 4CEIA 2IOYA 3KKKA 5BYAA 1KJYA 3E3MA 4R54A 3Q0IA 3OF5A 1SXJC 4QTTB 3H2IA 2QLJA 2ZB2A 4EFMA 4UM9D 5FT9A 1YL6A 3GEHA 2O50A 1GRQA 1FTQA 5LQDA 1PUJA 2OB2A 4FNOA 3J7AC 2P9GA 3I1FA 4L74A 4UFPA 1I2CA 3BE8A 2W7TA 3INTA 4D81A 5CCXA 5LL6P 2IXGA 1RYYA 1I3CA 3QX3A 2OAP1 2H4XA 4P4TA 5B6PA 3H9JA 3IAS6 3MBKA 4OMFG 4MA0A 4KSYA 4EBFA 4KXLA 4MQ5A 5FLEX 2WJYA 2HF9A 5EUMA 1PWXA 2VXYA 1REQA 3NCHA 1QKKA 3P0RA 1FL9A 3QV2A 1BN6A 1V0JA 4ND7A 2JGDB 5ED0A 3C3MA 3DCIA 4DLLA 2WHPB 1JXOA 3RK4A 4NABA 2QX8A 2HJVA 2PS3A 3GPDG 2C84A 2HO4A 4P4UA 1XTPA 1FYVA 2GO7A 1O89A 1HPLA 4XLZA 3NTLA 2JANA 2C8JA 3K0HA 5FTNA 2JGLA 2XKKA 2AKYA 1I5RA 4LJ9A 3S7TA 4TZKA 3DFKA 5E7JA 1ZK4A 2JLZA 1NJ6A 5B6JA 4POAA 1UDBA 4UNIA 3WKDA 1J07A 4QX6A 1O03A 3UJ7A 1S2DA 2WUFA 2A9KA 3DA8A 3ZKWA 1ZRNA 5K2OA 2VHXA 2YXNA 3QXJA 3NB0A 4ROTA 3G0HA 3DBIA 2F9LA 2IXDA 5DU2A 2FTKE 3ZQ6A 3D3QA 2C82A 4PO3X 1XJCA 3PIIA 3LBYA 1NVAA 2IEIA 1FUKA 2E49A 3R09A 3KR9A 5THQA 2NWQA 4QDKA 2X8JA 3CRQA 1S4MA 3KSZO 3J81A 2ZXUA 1PL0A 1T5OA 1T5HX 4UHFA 5B1HA 1U8AA 5CYGA 1VZ2A 2OENG 2AEMA 3NANA 1OFHA 1NUPA 3C41J 4YP9A 3WLRA 2XRMA 5G2OA 3KSBC 5BWMA 1L5SA 3MIIA 2I5PO 3NORA 4H0CA 3UWKA 3AJAA 4YTEA 3ZK7A 1SQGA 5EWJB 1V8DA 1EHYA 3VDXA 4QFBA 2CLFB 4DPKA 5ALXA 3G1TA 3AJRA 3AR9A 1ZY2A 3IURA 3FOWA 1VA4A 3FLMA 5JALA 2YWXA 3A2NA 1R4AA 2D00A 5JMPA 2HA4A 4LDPA 4LJ7A 3DVSX 1PX0A 3JQCA 4B2YA 4EPXA 3DTVA 4WFJA 2QI9F 5LJIA 3ZV7A 3JARB 3WA6A 1K9SA 2RK6A 1QTRA 5A6SB 2EYUA 4I1RA 5HQJA 3USES 3ZS8A 5IZ4A 2V96A 3NWBA 2AQHA 4JT9A 1RE0A 3PE3A 3LOQA 4JP2A 1QF7A 4JP1A 4KGZA 4E14A 2ZTLA 4E03A 5JSFA 1A3CA 3ANLA 4UE6A 2HB6A 1DPFA 1A7AA 2ERYA 2ZRKA 3QK7A 1VCHA 1Y5IA 3C16C 4HEHA 2PN1A 4PPNA 3HVJA 4TYQA 4C0WA 2NIPA 3PHJA 4MWBA 3GARA 2EFYA 1CDEA 2Z1DA 2D5AA 1FQWA 2XNDD 1R12A 5J9FA 2H8GA 4ZZ1A 4H3HB 4KQFA 3L4EA 1XDZA 2H1WA 5NULA 2AN9A 2PBFA 3H0CA 2Q3HA 1TPYA 4XFDA 3R76A 2CLOB 4BVHA 1G7SA 5JCZA 1SMKA 4LSGA 4G84A 3ZDYB 4KMMA 3VUFA 1KDTA 1IZYA 2ZR8A 3KZNA 4BVGA 1NYTA 3AI7A 4O08A 5KNDA 4FU0A 1TQ2A 1I5EA 1U94A 3BWEA 3EVAA 2BR5A 1NX6A 2WG0A 2Y2VA 3N07A 4JP3A 4ND5A 4WOPA 4ZARA 2C29D 3CSDA 1HA3A 2FW0A 4PCUA 4E12A 5I45A 3FOCA 4EZEA 1SUDA 2FDRA 3L93A 3N8GA 1BKYA 4QBTA 4UZFA 1DBSA 2ODWA 3WNZA 4BWVA 3JU3A 4MO9A 4FXOA 2C88A 4N01A 1KRHA 1MV5A 1DQPA 3IP5A 4N9QA 5U4XA 1FP2A 4WZAE 5CH8A 2NNWB 3V6MA 2O2YA 5G4KB 1Z56C 2XUZA 3LIPA 2NUPA 3CUUA 1XMVA 2IDKA 3EFOA 2V97A 1L5RA 4UULA 2GK6A 5H83A 4DW8A 4OLHA 5BW6B 4MWCA 1BTOA 2O3RA 1S8OA 2QTNA 4JWTA 1DU4A 1GTZA 3C14C 3E9QA 2X2PA 3IB6A 4QSHA 5EMKA 2BZSA 3JXEA 4P84A 3ZCUA 3BFXA 1EUDA 5TEVA 1K5GA 1NVDA 2OC9A 3BA1A 4TSRA 4KC0A 2F4NA 4L0QA 1KQFA 5L9AA 1UBGA 1J0CA 4XR4A 1H0KA 1T9KA 3OKCA 3ICVA 3WIOA 2QRGA 4HADA 1JHDA 4IW3B 2XMGA 3EMKA 1N2XA 2Q41A 3IQXA 3VKFA 4QTZA 5DGHA 1AGNA 3FWKA 1PR1A 3RGWS 1U9ZA 1QLHA 5KVCA 1PKXA 2FK8A 2J3IA 1DIRA 4IJMA 2Q7DA 4DHEA 3RIYA 3KQLA 3H5WA 4XX0A 1X77A 2P9BA 2V6MA 2PXCA 3R77A 3LT5A 1UAAA 3ZDDA 2A0WA 3U16A 4YEDA 4LFAB 2J3KA 1IN7A 1YGYA 1NMYA 2I80A 1BMFA 2N3ZA 1W25A 2ORIA 2PJDA 1KO1A 3OSUA 3QKRB 3DO8A 4IQ4A 2ZB4A 2Z0MA 3QWHA 4IXWA 1QIJA 4J0HA 2CBGA 9ABPA 3CZ9A 1H0HA 4U5XA 3CH7A 5HZGA 2ONZA 4OHZA 2ZIXA 3JZFA 1SWVA 1GNPA 3GAMA 3GPBA 2P78A 3SYMA 1GKIA 3TZQA 1SHLA 1SVSA 2L69A 5J40A 4EKNB 4MW4A 4F45A 5IFLA 4R8KA 5AI6A 5GINE 2R6CA 3OFND 2XUQA 1LF5A 1KFBB 4ZVNA 4W5JA 4MQBA 1ST2A 3BK1A 1GVHA 2BW0A 1ZMBA 5E7QA 4W5QA 1M2GA 1ZI6A 3NT2A 4A26A 5HVNA 5F5LA 3EXG2 2HCBA 4MGYR 1JXAA 1QOZA 3ZHXA 1L3BA 1MX9A 3WIEA 3K1AA 5F23A 1S2NA 3ESAA 4FGZA 4BMPB 4BX9A 3EBLA 3EVCA 3HVHA 3MGAA 3D9QX 2A14A 3OX2A 1F06A 4JSTA 3V8EA 5MF6A 3STUA 1SU8A 2FN9A 1GITA 3OT1B 3P0EA 3L82B 1JBEA 4IKOA 3IMEA 5EIXA 4D9IA 3I6ZA 4EGAA 1N5MA 1Q20A 2DPHA 2FZVA 3PR1A 4JYBA 3QUCA 4AYTA 4UAGA 1O4VA 3UWDA 3ZD9A 1FDSA 1KO5A 2IYWA 3CYFA 3E84A 3DJFA 3COZA 4OJYA 2A4MA 1BXRB 3QVUA 4TLEA 2ZVDA 4CMGA 1Y5RA 3A25A 3VHRA 2YDXA 3DEAA 3KPUA 4RH3A 1EDEA 3MJTA 3AOEC 5CX1B 5TLSA 4PZCA 3VI3B 4DVGA 3KQSA 4RHYA 4UM9B 2I99A 5DLEA 1S1MA 1D6MA 2XTNA 621PA 3UOWA 3CWCA 5FQNA 1ORHA 4GRAA 4MVYA 2A8YA 1DTWA 2CK3D 4R5HA 1EK6A 1A5BB 2WB4A 4QO7A 1R50A 1WHSA 5H82A 4N5IX 1UXGA 2R85A 4W5RA 1R0WA 4MH0R 5EJ2A 4HLUA 3UQYS 3U61B 4R68A 1HDOA 2BGJA 4RVHA 4Z53A 5F9HA 4LCBA 4WHMA 1JG7A 1UEJA 5LU8A 4BAGA 1P29A 4O2BF 5DYTA 3BGDA 3PFIA 3M3HA 2QTVB 2X8AA 5L4SA 3ZG6A 1I94B 2K7ZA 1XVVA 1Y4AE 2NQ8A 2DBQA 4QU9A 3RYIA 1RHJA 5ALVA 1MW9X 1TRKA 3HLTA 4NYMR 3IMGA 1IY9A 1KDRA 1WXDA 1V4BA 4JDPA 4OHUA 4DLWA 2GYVA 1D0SA 2QVZX 3OQIB 4WZBA 3TZBA 3O74A 5HUJA 3LVQE 2B2XA 2ISQA 5J5CA 4J2HA 3EGXA 4FFSA 5FBHA 1SULA 1W29A 4MW7A 3OLYA 2XLCA 1O5IA 1R5JA 2W11A 2MSKA 2BIFA 4LRUA 2LCFA 1W9HA 1ZR4A 4OJQA 1GUZA 3K1YA 2AC7A 2W6NA 3QNMA 2NYUA 4ZDKA 4KO3S 4MVJA 1E32A 1C9DB 1LC0A 2I3AA 3OJEA 4U5QA 3WG9A 3R9KA 4L4RA 2D0DA 1SCIA 4XJVA 3THXB 1XJ0A 5IWCA 2TECE 4G0QA 3A3YA 4GPZA 4HATA 3R3JA 2C7VA 2V6FA 2ANBA 4EYQA 5A1TA 1SXHA 2BMAA 9ATCA 3LXMA 2HCRA 4W5OA 3LPDA 2AFHB 2HCTA 2Q3EA 4P4GA 3T35A 3VR5D 4KXUA 2IK8A 4DABA 2PH5A 5I3ZA 4ZEOA 1C9KA 3TLJA 1M76A 4M21A 3O8LA 1E6MA 4IICA 2A0UA 2R7LA 3A2MA 2F3UA 3FM9A 3RBVA 5ICCA 1A7UA 1DWPA 4ODIA 5LQUA 2XCTB 2FQ1A 4JC5A 1HXHA 4DNQA 2W83A 1HE1C 3I58A 3WC4A 5CDGA 2C5SA 2I7DA 3U4AA 2G5GX 2WWHA 4DARA 1A1VA 3ZDBA 4AJ1A 3ZGZA 4X7RA 1W581 4FQ7A 4EW2A 4HMQA 4L0MA 2WJ6A 1P9OA 3U40A 2J8ZA 2R1UA 2DFVA 1G4HA 3A58B 3FSRA 4RA6A 5KTYA 3NYRA 1O2DA 1XDDA 4MEJA 4H7KA 5BN1A 2NM0A 4N0PA 1ZAYA 1L5QA 3H1AA 3FX2A 2PJRA 3GPLA 1PDWA 1Q11A 2CBZA 5BN5B 4QARA 1XZLA 3BYZA 3H7IA 4UBNA 4B9AA 3HGMA 2QMYA 3M82A 1A04A 1DKQA 2VZ8A 4IJKA 1RYNA 2JFVA 1GARA 1H66A 4WTOA 1WDWB 2FEKA 3ESQA 3H2ZA 3UHOA 3X44A 4PYKA 4BNLA 5KNBA 2NZUG 3Q7IA 2FNAA 2X0RA 4CCYB 3DWGA 1B7GO 2RKBA 5TF0A 3HXPA 4MQMA 3JAKB 1VRVA 5CVDA 2C0CA 4R1OA 5I8WA 3GMDA 3R5SA 3OOSA 4JITA 4UCQA 4WEOA 1XNRB 1EM6A 3D6VA 4A73A 2X2EA 3DULA 4E7OA 1SQSA 1EDBA 4TV8A 1JECA 4BQPA 3PC6A 2C2HA 4A1FA 2TYSB 1TYBE 4DSOA 2CGEA 3N53A 3A6PC 3S68A 1VBNA 4D8TA 1B6RA 2EV9A 4K1LA 2E4AA 3KEQA 1S2GA 5E1DA 4O63O 2ZJ4A 4AKTA 4DLUA 4L4SA 1H8ED 3FCOA 5BMOA 3HU1A 5BOSA 3CUTA 1ADYA 3E48A 3JQBC 3M1AA 1SJ9A 3F6SA 3V4FA 1H23A 3UKOA 3EDOA 1PSDA 4AFNA 3FCAA 3N6VA 3PHHA 1PNQA 3QTTA 2GPWA 4D26A 3WICA 1DBIA 5IH3A 1OFIA 2QTMA 4RANA 3GG9A 4NJMA 3VOBA 2DBZA 3FPEA 3CPSA 4ZPXA 1W1IA 2ET6A 3SQWA 5ALRA 4BNDA 2QJOA 4M87A 1O96A 3UIEA 4BNVA 2FSGA 2P3QA 2PT5A 4EO7A 2FPIB 4JLNA 1VI2A 2N47A 3ELBA 3PDCA 3ZQJA 5CFMA 5DNVA 3KWLA 4RL4A 1H2YA 4UAVA 1I4LD 2JFHA 3A1WA 5IYZF 1V71A 2CLDX 3D3WB 1CE8A 1XUOA 3OWXA 2FQYA 3KQQA 5JCPA 4LX0A 3BGOS 2HPVA 4L76A 4NDNE 1Y8CA 1I3NA 1UMDB 4II3A 1EK2A 1YL7A 3C6YA 4JKYA 3AP1A 3OTGA 4IIBA 3Q11A 3LWNA 3QPUA 1QVWA 2VPWA 1LLQA 4QQ8A 1Q44A 5CD9A 3MXTA 3LV8A 1QHIA 1G8GA 2ZIWB 5KMGB 2AYYA 2FPSA 4ZQEA 2X0NA 2XGOA 4R4JA 1BWSA 5CAEA 2WPDA 5CB0A 3D3KA 5ITZA 2X5NA 1L5MA 2IDJA 1YB4A 1G60A 1LFDB 1OIXA 2E0IA 2WZCA 1QS0A 1D04A 1GO2A 4JELA 4ZPJA 3NIWA 4EJSA 1O6BA 3KXIA 4MAMA 3NNNA 1XRSB 4QOIA 4WH0A 3G5MA 3PJEA 2Q49A 3TR5A 5BUSA 1JVBA 3B1XA 1DEXA 4M1SA 5ALPA 1M7GA 3RHTA 4FMDF 1Q74A 4NAUA 1JTFA 4UPEA 1WUIS 1Q91A 4Z9XA 3PTZA 4RS3A 4DM7A 2OPHA 2FR8C 2FLVA 1OV4A 4M22A 4A8JA 1CQPA 4DC1A 1LPSA 5KKCA 1FNSA 2IW3A 5K20A 5AK6A 1RXVA 3SK0A 3G59A 3P0IA 1HKHA 2XDYA 2G6BA 1W5TA 4KVAA 1FFGA 2IUTA 4RSRA 3U44B 3JPYA 5A02A 1K7EB 2JGNA 3U37A 5HTKA 2GZDA 5EZQA 1NGSA 3K1ZA 3KM0A 3Q40A 4JJEA 5EIEA 1DZ3A 1H42A 1KO8A 3NVDA 5G02A 1RBMA 4G8JA 3PWTA 2AOUB 1RD4A 2H9IA 2PWYA 1CD5A 3B1VA 4FNAA 5B57C 1GA6A 1WW2A 1U8XX 1NUHA 2YC4C 4ATNA 5GV7A 4IGKA 1G21B 4TKVB 4JLMA 1C1DB 3K15A 1HFJA 5FLXA 4B5KA 5BR8B 4HGRA 1ILWA 1S3IA 1TM4E 5U4QA 3K73O 3R0QA 1XWIA 2FRDA 3FFAA 1G38A 1DINA 1TF7A 2XGSA 4H7FA 3O94A 1IB0A 2PSDA 3FSGD 5EQDA 1B15A 1AUVA 4JVSB 2AW5A 3Q85A 3P32A 4MI1A 4UBOA 2IXEA 2Z1NA 4LN1A 2B5WA 4HNVA 4LEIA 3KWMA 3C45A 5EQJB 1EVKA 3CSSA 5AM0A 4LDNA 1QFJA 5E9AA 3VJKA 3ZI4A 3OM8A 1JFFB 1IULA 4MP3A 4F85A 5HWSA 4PVCA 1W93A 2WAAA 4YCMA 4FBGA 3FYCA 4S2UA 1RRKA 4ZI7A 4NAVA 1S7CA 4J1NA 3CVOA 2IQ5A 1W76A 1G1AA 1PBNA 1YQEA 2IDMA 3VO8A 2BEUA 4E09A 2X3YA 1T2FA 4OMUA 1W6UA 1GZSA 3CTMA 3QYPA 3GDHA 3TIFA 1GAXA 4LDZA 5LZ9A 1T2VA 1UPAA 1UFVA 2R1ZA 4QL3A 4QXMA 2Q27A 3E5NA 1SBYA 4AMYA 2Y27A 3I76A 3L0DA 2IOQA 4OGLA 4FFRA 4ER0A 1C7IA 3BH0A 3LYAA 4H1HA 2I29A 2GEKA 1GPWB 2HV9A 4NBSA 4MYUA 4RETA 4ZDJA 2QUJA 5LJLA 1RRCA 4C4SA 4JLUA 3QLVC 2NPFA 1MRNA 3WK8A 1RRPA 1JB1A 4X90A 4ZOEA 2JKYA 4A8TA 1V6AA 2H2HA 3B6ZA 3RAEC 4YMWA 1VYTA 2JAQA 2PMEA 4KR6A 1UFQA 4NOLA 4PG5A 2J07A 1WZCA 2GF0A 4JLVA 1PJRA 4JL6A 4PZ9A 2NU9A 2X6RA 1X7XA 2XJ9A 4WZBE 2NO6A 4B3GA 3D8SA 2CXNA 1K89A 1Y8QA 4EB0A 4WN9A 1EHIA 2PGIA 1OCEA 4EJ2A 2WM2A 1HURA 3WYDA 1WPRA 3IHLA 3UH0A 2PANA 3Q7QA 4M0LA 1DAGA 3H7AA 4GXRA 5DGIA 2O23A 5D3QA 1IUPA 2HSGA 5CUQA 3GLGA 4Q7MB 4RTPA 3GZ4A 1DUSA 5EP1A 1E60A 3LDUA 4E4RA 1E3DA 2QMQA 4EF5A 3ZCPA 1TQDA 2FEWB 4QWMA 4CKWB 3U3JA 1ONPA 1ULZA 1XTRA 1J9GA 3V1TC 2RKOA 3OTOB 2ZSEA 1LFAA 2XNCA 4KITB 4D4HA 1UJNA 5DIFA 2G67A 3AZPA 5ALYA 3EMVA 5D85A 5JAHA 2VPQA 5CLQA 4NU0A 4D96A 5EXSA 1BW9A 2AF3C 2EWWA 1C0EA 2HHCA 4GOMD 2ZR0A 2QR5A 1U81A 3A1DA 3A36A 1L8OA 1VJTA 1RHKA 3IO3A 4LGYA 4CQJA 4HB2A 5CDFA 4FWTA 4KVGA 4CU5A 3M4XA 1OU0A 3X1WA 2XXJA 4XWAA 4CU2A 4I14A 3TYXA 2E18A 2F59A 3BPSA 4MYCA 3D31A 1DIGA 4OSPA 4PGFA 1HDIA 1JR4A 1WSAA 3D0KA 1Q3KA 1A95A 5JSYA 4BNTA 1BXGA 3GFBA 5CT8A 4G6ZA 5IRCD 2R11A 3NRBA 3OCXA 1U3GA 2G9QA 1ZBQA 4L5CA 4ZT2A 3VMMA 3M6XA 3SDSA 4BEJA 4GO1A 1NQVA 4O4IA 3D81A 3G2QA 2B4KA 5A9TA 5CBPA 2C59A 1SBIA 1TDJA 3EULA 4BFSA 3L8ZA 1C1XA 4UUBA 3BXXA 5EXXA 4EGJA 4ZT6A 3M2PA 2NO9A 2IH2A 2Q4RA 3ZY2A 5CIWA 3O21A 4U39A 5DTJA 4CR6A 4DADA 1BEZA 3ABQB 1JB9A 4MARA 3QMPA 3IUJA 4CLEA 1BE0A 1AK9A 1S3FA 1MEEA 3EA0A 1DG3A 3GRVA 2ZTVA 3QVKA 5KKAA 2FEOA 5JXIA 1RCUA 1Y3HA 3K9CA 1JR3E 2JEOA 3GOQA 1C9JA 3IAUA 4J90A 3CA8A 2C5GA 1NP3A 5DYYA 5FIUA 1R64A 1GQRA 4RD6A 1RLTA 2E55A 3C4JA 3VC1A 3WLMA 1DCTA 4N4AA 3CT6A 1U5AA 4L5YA 3RF6A 2ZW9A 2O8BA 1XLUA 2BM0A 3G8CA 3IJ5A 4FLMA 4N49A 5LB4A 1F5NA 5DHPA 5KNCD 1E7RA 3LLMA 4G01B 5LA6B 5AXBA 3INRA 1UBKS 3QVWA 1W36C 1DE0A 5TVKA 1PZEA 2RSLA 2XZDA 5E3HA 1J42A 1G0OA 3DEYX 4PZEA 1ESCA 2X4DA 1MX1A 3T7EA 3RKRA 3U09A 5K8VA 121PA 5IVHA 1R6UA 3EGWA 5L3SB 1F51E 3GB9A 1B42A 3TDMA 1GTVA 2MHCA 1JJAA 3ZH9B 3PX7A 1SN7A 1UKYA 4HDAA 3UMGA 2H3EA 2BTOA 4G8BA 1JW9B 1IBKB 1O95A 2P2SA 2CMGA 3CRMA 2OM6A 1RCTE 4KFRA 1M3SA 1Z7BA 3TKLA 1ORRA 4PY2A 3LQFA 2BGNA 1CIPA 2MMGA 4J1QA 4TXNA 4D4KA 3QIAA 5JVDF 9LDTA 3OWOA 1MOPA 1LNZA 4O29A 2WTMA 1SIOA 3PGKA 4J0FA 1LK5A 5AVXA 2ZYUX 3ZV6A 3BB4A 2R97A 3EUFA 3HGQA 3QEMB 5A5GA 4GVPA 5FV4A 1QDUA 2W58A 1W73A 1F3OA 3DHYA 3UB4A 1EUYA 1QVRA 2NU6A 2QTWB 3AB3A 3NWJA 4HX9A 4OHFA 2NVUB 2ECQA 2WNSA 3TRKA 1X94A 1LUAA 1XRLA 3VR6D 2ISSD 2PUJA 2E9SA 3OQJA 1IIBA 1O97D 2QGZA 3GRYA 3U31A 1PJ4A 2XTMA 3HUUA 3GT3A 1IOVA 4B4UA 2XTZA 4H6XA 3M6VA 4U00A 2PRSA 4RDIA 2JJ8A 1C4KA 5IJAA 4XVCA 4F0JA 3KYIB 2QL5A 3UUWA 4ARZB 2CLCX 1L5HB 2IWHA 1VE5A 2F9MA 4OXXA 3ILVA 4G41A 5KHOC 2DXIA 3WLAA 4Y8VA 4UTZA 3WQBA 5HEKA 3C6MA 2UDPA 1YULA 3AERB 4NMLA 4JJGA 3GLQA 2PUEA 4BEVA 4NPHA 4RBNA 3VZSA 2JJ1D 3OY7A 3QU2A 4MV4A 1R0XA 2K7FA 4DGQA 4Z4GA 4XRRA 3C5CA 5DFAA 5GPBA 3TN7A 5I9BA 4OKIA 1KVQA 3VO9A 1VMDA 2B35A 2ACWA 2JGMA 2PZEA 3AXSA 2QZPA 4XM1A 1KDVA 3LC2O 3T4PA 4RJIA 5DWVA 1FSFA 1KI9A 1JEOA 3HM2A 2I8CA 3MA0A 1RU3A 2FX2A 4GWKA 2IGBA 3T9FA 4DT1A 2B4TO 4E30A 1UIRA 5ELMA 2J0UA 4IJ6A 5LDGA 1QU3A 3LGAA 1BYIA 2QXYA 2XNJA 1OFTA 1JJFA 4ALNA 1NBMA 4O8CA 4YGYA 1SEVA 2HRBA 2Z9CA 3IERA 2NU8B 5C37A 2GN8A 2ZRBA 2F17A 5JMTA 2F64A 2QJFA 5E2BA 2IHBA 1XRQA 5DOVA 4DREA 4EYKA 6CHYA 5K99A 1SXJA 3OLQA 2VJAA 4I50B 4CRWB 1H65A 5KJ1A 2EP5A 4PG6A 1MUUA 1EQ2A 1V26A 3DLCA 3NIFB 4I81A 1K3UB 1K7YA 2HIAA 4BO3A 3TR6A 4G5OA 1KXJA 3UF0A 1RQ7A 2B8NA 2EP8A 1VXRA 2V7GA 3H4VA 3I0MA 5GM2A 4KJXA 4LOIA 2PK3A 1XKXA 4R8LA 1A50B 4IV8A 4URHA 5EQTA 2X5KO 1SC6A 3ZWWA 3EBPA 3WGTA 1BZYA 4OQYA 5JE8A 1H22A 5JAQA 2AOXA 1N3IA 2FPLA 2GM3A 2XQFA 1IUKA 3AEKA 4IJ5A 4JBIA 2BD0A 3RC3A 6ABPA 1UC8A 3I42A 2YUIA 5JAZA 1PR4A 1W75A 4E08A 1PZFA 2JLRA 3FETA 4G1CA 4EMBA 5KWEA 1DVRA 5C8ZA 2DHCA 2H1CA 1N3BA 2FZ5A 1QE3A 5EJ5A 3N2NA 3W05A 1JHQA 4NBKA 1BX1A 2WQ7A 3HLYA 3ZU2A 1DQRA 3EZ7A 4UNQA 5GZ1A 4M9UA 4OHOA 3L6DA 4L3VA 1NYRA 1C7EA 1SY7A 3AF4A 2VHTA 3WFZA 1MR3F 1QGAA 1WMAA 2FX3A 2ZDHA 3WFJA 3STXA 5KC8A 4AG3A 2WY2D 2QQFA 1ZAKA 1L7OA 1P7YA 1E61A 3HUDA 1SVWA 4JKIA 3AF2A 3DWEX 3KU4A 3OPNA 4V0OA 1KERA 1UADA 4DNFA 3S5UA 1LU9A 4OI2A 4EY7A 4F3TA 4K9NA 1U7OA 2F3SA 1SEPA 4LHVA 3AFNA 1MU0A 4C4ZA 3MGKA 1PGPA 3TLXA 1CEEA 3DMDA 3ZUGA 5KAMA 1PK8A 3RI3A 1SUEA 4DQKA 2C4HA 3LSYA 1KK3A 5DWQA 1S02A 2H1IA 4IDAA 4QIHA 2H5LA 2Z09A 3GJSA 5SICE 4MKRA 3AY7A 4I9FA 1X1AA 3T38A 3ZU6A 4DBLC 3ZY3A 3FSJX 2XYVA 1AZWA 4CEHB 4PBTA 3WFIA 3HJNA 4B0OA 2PS9A 4B76A 2H2AA 4GR9A 5DYWA 1OBVA 1MJGA 1V8PA 3TNJA 4HH0A 5J2UA 2RGYA 1PJLA 3QY0A 1TMOA 3KEFA 3OEEA 3SBOA 2FMKA 1ODSA 2HRZA 1FFYA 4JJZA 1D3AA 1VLLA 5IDXA 3D1JA 3WWDA 1YTUA 1CV2A 1KETA 4BUJA 3LFTA 5ITWA 1HR0B 4LF9B 2KSQA 4K28A