1MT0A

Atp-binding domain of hemolysin b from escherichia coli
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
241
structure length
241
Chain Sequence
DITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHKELLSEPESLYSYLYQLQSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hemolysin secretion ATP-binding protein
publication title Crystal structure of the nucleotide binding domain of the ABC-transporter hemolysin B: identification of a variable region within ABC helical domains
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 73
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2002-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1mt0A00
4WBSA 2UZ3A 1N5JA 3K09A 4F4JA 5K8LA 1M8PA 3B78A 4G1UC 3FVQA 1IQPA 4PC7A 3TQCA 2VP5A 4W5JA 5EXSA 5CYOA 2ZRNA 1N3BA 1W7AA 4ERNA 3UWKA 2IK8A 3TW8B 4WIAA 2J0VA 2AWOA 4TLDA 5CM9C 3THYA 3OE7A 221PA 3MGCA 3REGA 2C04A 1QBKC 3B1ZA 4Q1DA 4Q7JB 4YXWA 5EZ5A 2IYLD 4M9XA 3U2QA 3CX6A 3FYHA 1FZQA 2H7VA 2GDJA 2WJIA 3C14C 3EZ6A 4LBZA 4CYMA 2ZEJA 1U0HC 4NPHA 2GJ9A 3TMKA 5SZIA 1T91A 1XD2A 5D3MB 1MO4A 4B71A 2ZRAA 3PEVA 4ZI3A 2VYFA 1JALA 4I4LA 5DI3B 5FPTA 3Q9LA 4OQXA 2O0HA 3I72A 3A6PC 3F8TA 1KK1A 2WOOA 2ZRLA 4GNKA 3EPKA 1XD8A 1W5SA 3EZ2A 4V0LA 3SBEA 4RY2A 1GKYA 4PO1A 4IDQA 2QP3A 1OKKA 4JBYA 3CPEA 4L5BA 1KOFA 2QAJA 1MABB 4HLUA 1AK2A 2XAUA 1LNZA 2J46A 4AC9A 4U7DA 4JJZA 4ACBA 2KBEA 4U02A 4WOPA 3BXZA 4NHOA 3UWOA 4MQBA 4TL6A 4FI3C 2XB4A 1Z0FA 2O8BA 2A2ZA 2ORIA 4RZXA 3X1ZA 4C0AC 2FFQA 4B3XA 4OI1A 2JLWA 1TU3A 2YWHA 3CZQA 5GJWC 4QC2A 1KZ7B 3L2OB 4C3ZA 3L0IB 2AXNA 4K46A 1ZM3A 2F3TA 3OEEA 1NKSA 4DCUA 4TLAA 4KVAA 2WOJA 1OIXA 2I4IA 1T5LA 1FNNA 2D7CA 3B85A 1Q12A 3WBKA 2NZJA 3T12A 4N0DA 2PL3A 3CRRA 4HAWA 4RCZA 3T1VA 5JJKA 2XITA 4PHHA 2RGCA 1W44A 1WBDA 3DMDA 2ZJOA 2W0MA 3H0KA 1NKTA 1QVRA 5L3RA 5HZHA 2QQ0A 4LWZA 2V1UA 1KK3A 4HLDA 2JLVA 1NRJB 1E9DA 1G8YA 3CRQA 4QRHA 3QENA 1JR3E 1QG4A 1Z6GA 4LV5B 1OFTA 4DSUA 2JLZA 2V1XA 3FMOB 3QXHA 3FPAA 1AZSC 1XCPA 3L0PA 1W36C 3VR5A 3I62A 1ZCAA 3QBTA 1DBSA 1KTVA 2NZ8A 2F3RA 4YDHB 2R8RA 2PEZA 4RKEA 1KK2A 1EXMA 1TQ6A 3C5CA 1UAAA 1FX0B 4AKHA 1GL6A 3AVTA 1VCIA 2QZ4A 1G7RA 1PV4A 4W7SA 1PLJA 4E07A 2H92A 3U5ZB 3T5DA 3VR2A 3AKCA 1F2UA 4RD3A 1Q21A 1CU1A 2ZRCA 3CX7A 2IWRA 5AUQA 3ZZTA 2V3CC 2Q3FA 1E2MA 1M1YE 1UKEA 2IHYA 3DEFA 1I4DD 2WICA 3IIKA 3IO3A 5LBIA 2ORVA 4O3MA 2ZUDA 1LY1A 3TH5A 4MYTA 2ZE5A 3HJNA 1UBFA 4G5QA 4OHXA 2XB2A 4QNMA 1W48A 4EDHA 5DNYB 2H57A 2J1LA 2QUZA 2WAXA 4FCTA 2H5EA 4AWXA 4CVNA 1E2EA 5DLQC 2EFGA 3EC1A 3ADCA 3PUZA 1C9KA 2GBLC 1JR3A 3IQXA 3PENA 4QGAA 1M34E 2G1KA 4V0OA 1W36D 1QRAA 2FNAA 2VPPA 2RKOA 2W58A 3CR8A 3CPHA 4QOSA 4A4DA 1P3JA 2JJ1D 5IK2A 2IUUA 4KITB 2QTFA 1II8A 2QT1A 3K09C 2HJGA 4LY6A 1Q57A 2ZRJA 4ON9A 4GFDA 1S2MA 2IC5A 4E5UA 3BC1A 3U7EB 4EQ6A 3EW9A 2WJHA 3X1WA 1NVWQ 3QVUA 3Q7QA 3IPYA 1FTSA 5FPHA 2WJJA 2JLQA 4AYTA 1Q3TA 3TR5A 2IYQA 4MUAA 3KKNA 5JSZB 4IDOA 2OV2A 3GMTA 5FOWA 2QT0A 4F4IA 4BECA 1P6XA 3RS4A 2MSDB 4QKQA 5CJ2A 1SVLA 1F5NA 4B2LA 5C18A 2B7BA 1IJEA 1MH1A 4TL7A 5KDLA 1XZQA 1SGWA 4LGMA 3I4LA 4LPKA 4Q03A 4JLBA 2PMKA 1EFRD 1G16A 3ADDA 4B47A 3KJIA 1WQ1R 2WTUA 3PVSA 2WBLC 4IEIA 5EP4A 2Z43A 4DEXA 5FOSA 1E2JA 2CK3D 1DAIA 3K1JA 3ZJYA 5JS7A 3VKGA 5BWMA 1Z0IA 2JA1A 2IS6A 3LXRA 4HB4A 1DADA 1VG0B 2NO0A 1EG7A 1JXMA 1OH8A 1P2VA 2HCJB 3OESA 4EFMA 1VCMA 3GJ5A 4BRWA 1DO0A 4JT2A 2YINC 1MKYA 2ZR7A 2F7SA 2VP9A 3CUEF 3T35A 3TKLA 1NNEA 4TZ6A 1SKYB 2JAQA 3BIFA 3K0AA 4X8MA 3TAHA 1T0HB 1E2LA 3IIJA 4LDJA 4X8LA 1YRBA 1CP2A 4MKIA 1G5RA 4HLUC 4KLZA 4OK3A 3GLHE 3LFUA 4YMSA 3W5JA 3WMGA 5JEDA 4TYWA 5JI2E 2FV8A 1TUEA 2ZI5A 3T61A 3KQHA 2H17A 5JRJA 2O8EB 4R7ZA 2P65A 1JAHA 3TW4A 1VECA 4PAQA 1KAGA 2ZUCA 2P6NA 3QOFA 1GL7A 5AJVB 4JS0A 1NG9A 4PSVA 1N6LA 4Q4HB 2Q9AA 2DFNA 4HAZA 4EJSB 2CE2X 2Z4RA 2WWHA 1E2HA 1E2PA 3QKSA 1F60A 2D3WA 2QSYA 4IOKA 2JJ2A 4UNPA 1E9RA 4M21A 4C30A 1SHKA 3QJYA 2P6RA 2N42A 2QP9X 3SR0A 2DY1A 3LRPA 3NC0C 3WMEA 1XNJA 5FUVA 4FWTA 2GJAA 1S3SA 2H16A 1KO7A 5KOYA 3EPJA 4PO9A 1J2JA 1G6OA 1PZNA 4O25A 1A1VA 1W47A 1UBCA 4DT1A 3K0CA 2QGNA 1KK0A 4BZQA 3DM5A 3G82C 4URZR 4QGHA 1OKKD 2GEUA 4QJ3A 3LO5A 4DLWA 3GJ3A 3RHFA 1CJTC 3DHWC 3PCRB 2YV5A 3ICEA 2OM2A 2C9OA 3H1TA 2C77A 1OW3B 5KUTA 3GLHA 1Q0UA 1GUAA 4Q7MB 3FGNA 1GVNB 2RGAA 1Z47A 4B3BA 1E9FA 2X2EA 1BKDR 3K0FA 1E9AA 2A5DA 2VP6A 4AD8A 2GVDC 4KYUA 1P9NA 1I4LD 4PO8A 4ARZB 4MKGA 4PZYA 4C0BA 2REOA 4TYNA 2FX3A 2GCOA 2QBYA 4FINA 1IAQA 2HV8A 3NDBB 1P2UA 2GTPA 2KI5A 3RAPR 3F5FA 1G6HA 4B6EA 4QJ4A 2FFHA 1U9IA 4NDZA 3U44B 1VYVA 1BS1A 1M7HA 3LH5A 4JLAA 5EXTA 1R10A 4MRNA 3SFVA 1Z8FA 2BBOA 2J41A 2WWWA 4HDCA 5FFMA 5EE1A 4TL8A 5FL7A 3H84A 4Q7LA 2F1RA 2IXEA 1N6IA 1XEXB 1N0WA 2GZAA 3OEHA 2HJVA 2JDIA 2RHDA 2VHQA 2W2XA 4RKFA 3VR6A 1BMFA 3TGPA 2GAOA 3MFYA 1AQUA 1HQCA 2ZPTX 3LV8A 5FTNA 1KY3A 4G5RA 3FMIA 4AY2A 1SXJE 4LHZA 1YZNA 4P4SB 1LS1A 1FQKA 4F91B 4WXRA 3JZMA 3ND8A 1CJVC 4L8GA 4LSGA 3BRWD 4AYWA 1W0KD 3WBJA 4JYCA 4DLXA 5JFGA 3SQXA 1SXJB 4DC9A 3A1UA 3K8YA 4PFSA 5LDDC 4GMDA 4NCNA 2VHJA 5SZHB 1FQJA 1V43A 1QHNA 2I1QA 2QM8A 1A5TA 1KI3A 2ZI4A 1WE2A 4B3DA 3A1VA 1EFHA 3N5CA 3S1AA 3A37A 4EPRA 1M74A 1DAGA 2GZDA 2IEZA 4TLEA 2IXFA 5HCNA 4M9SA 4IOMA 1TQ2A 521PA 4QM6A 2PH1A 4PR0A 1IY2A 2ZITA 2ZIAA 1KI4A 2JASA 1DAFA 2GXQA 2CL0X 5B2ZA 4B3GA 2BHRA 4RZ2A 1G5TA 4DHEA 2C9YA 3MRSA 1T6NA 4FCVA 4II7A 4Q9HA 4MKHA 4CEIB 2OZEA 3D31A 4H1VA 3CRW1 1OPXA 4MGIR 1R0ZA 4V0KA 3RRNA 1AQYA 5J47A 5J4YA 2RGDA 5DN6A 3HYRA 2J87A 4DDUA 1HUQA 2QRZA 2O8FB 4RCYA 2FF7A 4Z1MD 1E2KA 4HAVA 4KFSA 4DLRA 3TBKA 3CF6R 1Z0JA 1XMSA 5FOVA 2H8KA 2ZJ2A 1MO6A 3HR8A 1E2QA 3A1TA 1SVWA 3EASA 3Q7PA 121PA 2O52A 4TT3A 1KMQA 1UBEA 2GXSA 3WP0A 1E2GA 1BOFA 5AUNB 3FKQA 3TSZA 2QU8A 3U3OA 1E9CA 2ZE8A 1RVDA 2GETA 1G7SA 2XTZA 3QBVA 2RHMA 4PQRA 3MWYW 3IHLA 4Q00A 5BN5A 4NU0A 3VNUA 2F1JA 2R6FA 3RRMA 1COWD 2L0XA 4POAA 1VIYA 3R9WA 5JJIA 3AP3A 3HU1A 5E7MA 2EFCB 2OUKA 2V54A 2VSFA 1AS3A 1CR2A 2YHSA 2CL6X 4N0EA 4CT4B 5BXQC 3KL4A 1VTKA 4LPSA 3R7WB 2QMHA 5FTKA 1IN5A 2PLRA 2EYUA 4E22A 2CXXA 5EE5B 2YWFA 2Q3MA 3AF0A 1QHHA 1X8JA 1NN5A 4F38A 3BGWA 1N0UA 1JNYA 2BVNA 1FW6A 4UNQA 2FSHA 3OFND 3PEWA 5KPJA 2J5XA 1Z28A 3K0CC 1GM5A 2AFIE 4HB2A 3W6NA 1DG3A 3ASZA 2BBTA 4Q66C 4AURA 2DPXA 3DKVA 1KSFX 2OXRA 2FN4A 1OE0A 2CCJA 2CDNA 2AD5A 1US8B 3FKSA 3EZ9A 2FFAA 3R9IA 2HUPA 4AKIA 1UEIA 3GQBA 2QROA 2DBYA 4JLKA 5JCPA 2ZAMA 2V6JA 3WHLA 5J4KA 1ZUHA 2Q9CA 1LF5A 5KYKA 1QHYA 3CBQA 4EAQA 3LLMA 4US2R 3OIUA 4PC2A 5FBWB 4K81B 1ZBDA 4BRUA 1YZGA 3GEEA 4GI7A 2V8OA 3PIRA 3AP1A 1S96A 5KNDA 2G0NA 3UPUA 5H8WA 1MRNA 3PUVA 4MYUA 2Q3HA 4URVR 3SU8A 3AF4A 1U9IC 4HLCA 1RYFA 2FDCA 5C1BA 4XSGA 5GJCA 1W36B 2JCSA 1FOEB 1G8FA 2ZYWX 1AIPA 2W00A 2G1JA 3R8CA 4P4TA 1JECA 3U3MA 4LHVA 3FHCB 1GFIA 4I1UA 4DUGA 1FUKA 4P32A 2HYIC 2ZRMA 1DG1G 1VG1A 3REFA 2PCJA 5G40A 2RGNA 4ESHA 2ZRDA 1VYTA 1L4YA 3VMFA 2EU8A 3GFTA 5IDVA 4C0JA 1NIPA 2Z6VA 3QI2A 3NC1C 1G3MA 2O0JA 4LYFA 1XZPA 1ANKA 2J0UA 2H1LA 2AKYA 1U81A 4HZIA 4C7OA 1OFIA 1E4VA 2B21A 1MT0A 2IUSA 2V55B 4JLPA 4YQFA 4P31A 4UNRA 4NCIA 2CEAA 4OHZA 2HCBA 4X8HA 4JBWA 3Q5DA 5DYIA 2ORWA 4M1KA 3WYAA 4HZUB 1E69A 3U7GA 3KQKA 4A15A 2OFOA 1M6NA 2Z5FA 5EE3A 5F98A 4E03A 3W3ZB 1K8RA 1P2SA 4M2LA 1L4UA 4DCNA 3Q8XB 4D2IA 1AKEA 4IJMA 1OYYA 2YVUA 3MJHA 4PPNA 3AKYA 1R5OA 5FL7D 3KX2A 4Q1AA 4ZPXA 5A0FA 4MRPA 4DLYA 3FOZA 2UKDA 4B76A 4BEJA 1G7CA 2Z83A 4PSKA 2JDID 4D4KA 3DVLA 3RYTC 4D4LA 4O0MA 2FSIA 1KSJA 1YR8A 4EFLA 1G18A 2ZI6A 2QP4A 4Q1FA 2ZSAA 3LLUA 3GLFE 4IW3B 1OXUA 2XNSA 3N2IA 3TSOA 1LFDB 4DJTA 2ZRIA 1Z08A 5K8IA 3THYB 1NLYA 5LD2C 1D9ZA 1MR3F 3EIEA 3SJAA 4NONA 3UXMA 2VSXA 4YMUA 3HWSA 1NG1A 3HPRA 3VR1A 4PHFA 2NTYC 4HYYA 4P33A 4HDOB 1GKIA 1KI7A 2NG1A 2JLYA 2GRJA 1FMJA 2I1VB 3U6KA 3G0HA 3C8UA 1LB1B 2VA8A 2ZS8A 1DOAA 3KB1A 4M8NE 4Q9KA 1TX4B 3ZDQA 1UDXA 3TIFA 1U98A 1O87A 1X6VA 3AVUA 4RZUA 1DAMA 4IKEA 2DFTA 3O8RA 4W5HA 1XD2B 4RFVA 2IHBA 3QSYA 4DB4A 1JQLB 3TSWA 1SULA 3I32A 5DYGA 4ZDWA 2A5YB 3EA5A 2AXPA 1H8ED 2W2TA 3VU9A 1T3HA 3GLGE 1I4TD 2C2HA 2B92A 3NH9A 5JJLA 5CIWA 4FMCB 5KO2A 4TSFA 2ZR9A 2ONJA 2P5TB 1HTWA 5AK0A 4UXIA 3T15A 6Q21A 5JCZA 2FZ4A 3LD9A 3SC3A 2VIIA 3N70A 4IVRA 5HKKD 5HPYB 3ONWA 1ZW6A 2ERXA 1NBME 1OH7A 1G7TA 1BIFA 4RJLA 2BWJA 1JJVA 1TMKA 3W5IA 2R6AA 5CM8B 1IJFA 1S1CA 3GLFA 1Q1EA 4R98A 1Z0KA 2OBLA 1SXJD 1YJ5A 3IEVA 3GJ6A 1IBRA 1TF7A 3P26A 4FMBB 5FI0B 3FHOA 2JIZD 1TTTA 2O8BB 1MV5A 5FOUA 3T1QA 4KSBA 1GZSA 1X8KA 3AVQA 3EZFA 4A6PA 4ZDIA 1G19A 1XX6A 1G3UA 2WIBA 4NZYA 5KNCA 4PC1A 1VHLA 1P75A 4M53A 1XMJA 1P9WA 2IYYA 3NHBA 3EZ7A 3CRVA 1KI2A 1UDWA 3I1FA 3RS0A 3U3RA 3FB4A 2G9NA 4AG6A 2ZJ5A 4R2HA 4U00A 3GP8A 4LX0A 3EC2A 4M1YA 4WXPA 2OESA 5AJXA 3TK1A 4BLOA 1NMYA 4JL6A 1UKYA 2QAGA 1DTSA 3GJ7A 3RS3A 1NF3A 5C2JB 1N6NA 4UXHA 2J0QA 1W4RA 1I2MA 1OV4A 1ZP6A 2VTKA 3GLGA 1XWIA 4KSCA 4S2EA 3DO6A 4B2IA 5JLJA 1CRPA 4FXPA 3EWAA 3P1JA 2FWRA 2GWHA 3DZDA 1KNQA 3ZVMA 2ZSDA 1FL9A 4TYYA 1OXSC 2P0EA 5KPDA 2MSCB 4XTRA 3UKDA 1JXOA 3DOEA 4PTLA 2H18A 3P4YA 1LF0A 4A1FA 1W5TA 2WZQA 3I8SA 1NBMA 3LBHA 2FPLA 2A7QA 1P7CA 1E4YA 2ERYA 3R8FA 1OXXK 1J8MF 2E87A 2RGNC 2GK7A 2GXAA 4ZIRA 3FKSD 4KCGA 1E1QD 2ZANA 3P32A 4LV8B 2IS2A 3ASYA 4LJ7A 1F2UB 4TQAA 4PZLA 3ADKA 3EPLA 1XP8A 1XTJA 3HPQA 3AUYA 1G64A 5B58C 1ZNXA 1XTKA 1P62B 5TMPA 4B33A 1P72A 2A5FA 2ZJZA 4DXAA 2RH5A 3AKDA 1ZM4A 3ETLA 4TZ0A 4IRUB 4HEJA 4BGDA 1T8TA 1E9EA 1ZVQA 2WM9B 2GF0A 2BV3A 2F9MA 1NMZA 3MG9A 4ILEA 4IOLA 4NE2A 2VSOA 4GL2A 1YR6A 4KJZA 1G3IA 1Z83A 3ZVLA 4KV9A 4TQUS 1NVXQ 4MH0R 4TQ9A 2W6IA 4BFYA 4GP7A 2CNWA 1II0A 5DGXA 4DRZA 2QPTA 4TMTA 1L8QA 4BFUA 4MDFA 3V4RA 4D81A 2C98A 2ODWA 1N5IA 1U0LA 2ODBA 3THXA 1JEDA 2QE7A 1II8B 4MYHA 2C8VA 4DUGD 4JBXA 3T1TA 4OQLA 3HU2A 4NCJA 3RANA 4B3FX 4JLOA 4EQ6B 1XJ0A 2ZVQX 4Q4JA 3BH6A 3R20A 5B57C 1D9XA 2A5GA 4RD2A 4OK5A 5B64A 2BMJA 4LYHA 5DO9A 3E1SA 1FTNA 2F6RA 4LCBA 1R0YA 4ASUA 2WJVA 5KSPA 2GKSA 1GNRA 4A0RA 4DLVA 4H1UA 1IY0A 3O47A 4DDVA 2BBSA 5JHGB 5FPKA 1CJUC 2VHTA 5HCIA 5BN4A 3JVUA 3O8BA 2BM1A 3BFVA 2IA5A 2OT3B 5E3HA 5J4VA 1A2BA 2G88A 1XEFA 3SBDA 1IN6A 3B9PA 4M1TA 4LRWA 1DEKA 4CT5A 4R71A 3T06B 4MRRA 3NH6A 1UEJA 4K8OA 1N6RA 1W0JA 1IN8A 2EVWX 1T5IA 2WWXA 3QKRA 4GMXA 3AVXA 5DHAA 5DISB 2F43A 4ZKDA 1Z63A 3ZQJA 3ZIAA 2R62A 1ELOA 2QRNA 3C15C 1X3SA 2FOLA 1UF9A 1FFHA 3RWMB 1XD9A 3WRYC 4BLTA 2IL1A 4L4UA 4LK2A 3UMSA 4BFTA 3WMFA 4XWAA 3W90A 1G9XA 4B35A 2IS4A 1CJMA 4Q48A 5FUXA 2VO1A 2D06A 3K0AB 5TARA 2ZROA 2WWIA 3CH4B 1IHUA 4OBEA 5TB5A 1Z5ZA 2RGXA 3DKPA 2GJKA 2XZPA 2IEYA 2N1BA 2W2VA 1XTSA 4DVGA 3GFPA 3A1SA 3LW8A 5E4FA 4KU4A 1E1RA 2IYVA 4JSYA 4V03A 2ANBA 1VPLA 2OAP1 4B43A 5AUPB 2IUTA 3AF3A 1NY5A 3TUIC 5FPSA 1Q1BA 4BUJA 3HU3A 1JPJA 2R2AA 4LJ4A 4L9WA 2ECKA 3KXIA 4I1OA 1TEXA 4P4UA 1YQTA 3QKSB 1EFCA 1KO5A 3SJCA 4XD7A 4XWKA 4KYIB 1GNPA 1CRQA 1ESMA 4M9ZA 5L3QA 1JR6A 2QM7A 1KDRA 4AG5A 1L2TA 3F0TA 2R9VA 1NJFA 3PR1A 3SYNA 3GPLA 3W9YA 2QAGC 3KKOA 1RKBA 3I61A 3LNCA 2PEYA 4QBGB 4RVCA 5JRZA 4TMZA 4BLPA 5CK5A 1RYHA 2ZRHA 1R7RA 4LC1A 1KSGA 2ZRGA 4DT1B 1Z2CA 1Y63A 1MO5A 2RB4A 2D2EA 2EFHB 3W8NA 721PA 3EXAA 3GLIE 2J7PA 4AYXA 2AD1A 3AP2A 4KFUA 3ADBA 3HYTA 1MO3A 3OE7D 2XZOA 2GZHA 4YDSA 2WV9A 4B6FA 3TUZC 1RZ3A 1KHTA 4Y0AA 2J7KA 2P67A 4JVMA 2PZEA 4Q7KA 3WHKA 2WWYA 2O8DB 4QHTA 5IRCD 1XDBA 4BFWA 4YXWD 3I5XA 1ZNWA 3GLHB 1UKZA 3RSLA 3W6PA 1AS0A 2FMXA 2YOGA 3EPHA 4TMWA 3K9HA 3B1YA 3K0FB 4OK6A 3O8CA 5L3VA 3BAFA 4WZ6A 2OG2A 4LV6A 5TDHA 4L16A 4ZV4A 4Q1BA 2QMEA 1AA9A 1XU4A 2PX0A 2GCOB 4C0SA 4C0LA 4TN1A 2QBYB 5HZKA 3MCAA 4P0TA 3T1OA 1OSNA 1G5PA 2OXCA 4C2UA 1G17A 1HE1C 1ZD9A 1CR1A 1YZLA 2ZTSA 1OJLA 3UATA 1RRFA 1OIWA 3UANA 3GJ0A 4IFBA 1S0UA 3PFIA 2P2LA 4LBWA 3B2EA 1LS6A 4GSYA 1S3GA 2JLUA 2VF7A 1G3QA 1DAEA 3AVOA 1IM2A 2J3EA 3KQNA 3T5GA 4E09A 1E9BA 4UJ3A 5A5GA 5KU1A 3B5JA 4TLCA 2XTMA 1D2EA 3NBYC 3QXJA 3VR4A 2RMKA 4OYHA 2O8DA 2XOKA 1Q44A 1XXHE 4BLSA 2QQEA 3QQ5A 5M04A 3GLIA 2IYWA 3SOPA 5IF9A 1NBMD 2Q0HA 4QGGA 2ZETA 1C1YA 5KSOA 5F3WB 1Z0AA 5AJZA 1EX7A 3EG5A 4H9GA 1YU9A 2YZ2A 4JLDA 1P4SA 3QY0A 5JWHA 2ZXUA 1Z29A 1SVIA 1ZCBA 2AL7A 1OIVA 3BORA 4KHZA 3OEED 1T4GA 1E79A 4BLRA 5KDOA 2ZYTX 4LHWA 3AVPA 3GJ4A 3OF5A 3VKHA 2QN6A 3BH0A 4B74A 4DDTA 2G83A 4LI0A 3THOA 3E5HA 3S1AB 1N6HA 1CR0A 1LV7A 4J0QA 4EPYA 2G6BA 2IYUA 1GAJA 3LY5A 4UNSA 2VH5R 1A2KC 4GZLA 2R6CA 1XB2A 1JI0A 4MITA 1J99A 3IUYA 2A3RA 4EPVA 2G3YA 3SN6A 1Z6AA 3OIYA 2F55A 3GCGA 3VQTA 1GG2A 4Q01A 5HE9A 3AM1A 4DSNA 1E2DA 2F9LA 2W6ID 4XTCS 1G8HA 1NVUQ 4IHQA 2X2FA 4BZXA 4GRAA 4PZZA 2C5LA 1X86B 1E2NA 5JMTA 1TEVA 3BOSA 4B32A 2HLDA 4PAOA 5LD2B 1YR9A 2PZFA 1W2HA 2QE7D 1XXHA 4A0HA 2BKUA 2ZE6A 4CW7A 3ZLJA 4KBFA 1DE0A 3MWKA 2UVQA 1WP9A 2X77A 3W8RA 2IF2A 4I1SA 4JIMA 4QBIA 3QUSA 4LJ5A 5JS8A 2PJRA 2B7CA 1KMHA 3KUDA 1EK0A 4A2WA 1CBUA 3ZZUA 2EFDB 3FMFA 4JKYA 1IONA 3RSOA 2DWQA 2OFXA 4RZ3A 4ASUD 4LHYA 4GT1A 2QI9C 3FDIA 4Q1EA 3CM0A 2JLXA 4DLTA 1JBKA 2OFWA 4UXJA 3M0EA 3SHFA 3W6OA 4FMDB 4Q9JA 3T34A 3AEZA 1W46A 3QKUA 5CLQA 3AH8A 1H8HA 621PA 2XZLA 4KFTA 4QG7A 3AUXA 2VF8A 4HAYA 1BO6A 1ZNZA 3CO5A 5C4MA 5JECA 1IXZA 1GRNA 4GBMA 1NSFA 4LBVA 4CZ2A 1JR3D 2BM0A 3KQLA 5H70A 4PHTA 1XPRA 5EP2A 1NP6A 1T3LA 3GJ8A 3I8XA 3P4XA 3ZIAD 5IK2D 2AK2A 1QHHB 2ZS7A 1M7GA 2BC9A 2Q6TA 2FEOA 1KJWA 5KSYA 2XXAA 1SZPA 3M1IA 4MRVA 3LDAA 4A0FA 1HEIA 1NLZA 5SZJA 3U7FB 4XIGS 3WY9A 3EAQA 4PXAA 1ZAKA 3V9PA 1QZXA 4G5OA 1GNQA 1NIJA 2HF9A 5FTLA 1XJCA 2ASEA 2OBNA 3A4LA 1Z6XA 1GKUB 1NY6A 4S35A 2ZI7A 3UIEA 1NSTA 2IYZA 2V7QA 3ZZ0A 5BYKA 1T3SA 4P3YA 4JVSB 2PZGA 1A82A 3EX7C 3VR3A 3HP1A 1E1RD 4YMVA 1ZINA 5F2EA 1CR4A 2NPFA 3SNHA 3TE6A 1IXRC 2GEVA 1YZKA 4JKIA 2BBWA 2DWOA 1K5DA 1ZU5A 4OL0A 2CCKA 3IILA 4HUQA 2GCPA 4DIEA 2KJQA 3O8DA 1P9RA 3L43A 2QGZA 4OI0A 1ZD8A 3B13B 3ND9A 1M7BA 2NIPA 4Q4AA 2OCAA 4FMCF 2DB3A 1OFUX 1G20E 2ZE7A 4XJXA 3PG5A 4NMMA 2YJTD 4M1OA 4Q9LA 4CGZA 1AN0A 4URWR 4Z8XA 3M6AA 4D25A 1RFLA 4MGYR 2ZJ8A 3CRMA 2XEXA 1E6CA 3K70C 3QF4A 4MDEA 1TNDA 4W9MC 1Z6YA 4TWZA 3SEAA 1WRBA 2A78A 3EWSA 3U60B 2O8CA 1A4RA 4QFMA 4KFRA 1EFTA 1E3MA 2ODEA 3A4NA 2J0UB 5IT5A 3KDSE 4RSGA 1OF1A 3A4MA 2QA5A 4JZKA 4RD0A 4C9BA 4C7OB 1FMLA 2OE2A 1AGRA 5EXXA 3M4YA 1FPMA 3EARA 3QVVA 3MWLA 3UG7A 2OSBA 5GJVC 2JJ2D 4IDHA 4BQSA 821PA 5DE3A 3I3SR 2VRWA 3TVTA 1S4QA 3WXMA 1N6OA 1KI6B 1Q3HA 2ONKA 3FE2A 4URXR 3KJGA 4GOXA 3U6BA 2QMUA 3CNLA 4DBLC 4KAXA 2ZREA 3GEIA 1N0VC 1B0UA 1T9HA 4FWIB 4TLBA 5EUMA 5LB4A 4WZBE 2C9CA 4A0GA 3U4QB 1KJYA 3QXSA 5FUYA 3DL0A 3H2YA 2AK3A 3K0SA 4N1AA 3KTAA 1E0JA 1R5NA 2DHRA 2XX3A 4A92A 1F3OA 1DARA 2GNOA 4BPBA 3W3AA 3FWYA 4D0NA 4W5WA 4JLMA 1SQ5A 1IXSB 3LX8A 4DCSA 2SHKA 3K70D 2XOKD 4YC7A 4FN5A 3CIOA 3SE0A 3OZXA 1UFQA 1MRSA 3QPUA 1KNXA 2D62A 1IN7A 5BQ5A 3UMFA 5BN3A 4PPFA 5AJYA 3CLVA 1XBTA 3ZVNA 2IT1A 1LTQA 1N25A 5JEEA 1KI6A 1DAKA 1NMXA 1F2TA 4LC0A 4A8JA 2CHGA 1G41A 3L82B 4Q18A 4WVFA 1GWNA 3BB3A 4GPTA 2WWFA 2D7DA 3KXLA 1W1WA 3QXXA 4JL8A 2Y8EA 3U4QA 1DAHA 3BK7A 4NYIQ 2CJWA 1QDEA 3QIAA 4NYJQ 2FPMA 4C4PA 3PEYA 4RD4A 3AVYA 1QF9A 3VU9B 1AM4D 1D2MA 4CEHA 2GJSA 3C16C 4I81A 1G4AE 3OEHD 5K8TA 4D80A 2DWPA 1BMFD 5HTKA 3TR0A 2X19A 4WAUA 1GILA 4B48A 2AFHE 2KE5A 2F1IA 3LBNA 1HQYE 4R9UC 1B23P 3RNLA 3Q5EA 4EPWA 4JLVA 4NYMQ 2HLDD 3GLFB 1WCV1 1AGPA 1TU4A 2X1VA 5C4GB 2WSMA 2WMNB 1U90A 4CEJA 2OCYC 1DELA 2ZJAA 3A58B 3D3QA 1EWRA 3I73A 2IW3A 4M9QA 2YKGA 2QG6A 1HA3A 5H1YA 2IS1A 3EIHA 1GRQA 3R9XA 4DLUA 2FU5C 4MGZR 4HB0A 1PUJA 1KI1A 2GK6A 4Q47A 3JVVA 3DPUA 5A4JA 4GZMA 1TPZA 4ESVA 1HE8B 1XRJA 4OQFA 3PUYA 5FI1B 5AR1A 5IHPA 2WIAA 1VMAA 2QAGB 4HDQB 1P73A 2GEDA 4G5SA 4IEEA 2HT6A 1R8SA 5GVSA 4GOKA 2XTNA 1TUIA 1U2RA 1XJQA 4Q1CA 3GLGB 4Q4LA 1CF4A 3KXKA 5DN6D 1E99A 2HYDA 2BKEA 2ZSBA 5GVRA 1HV8A 1XMIA 2Z4SA 2VP4A 2E9SA 3SJBA 5JI3E 2C95A 3FTQA 4D4JA 3THWA 4UJ5A 4ZCIA 5AUOB 4Q02A 5FOXA 2QORA 4KLNA 3QPWA 3OIVA 5G3YA 3RWOA 4TT3D 4DCVA 2CL7X 4HB3A 3TVDA 1SHZA 1XPOA 2YYZA 4PPQA 1KIMA 4LBYA 3ZD6A 4MYCA 4ZIRB 3CF0A 3LBIA 2ZRBA 4LJ9A 4DIDA 3MSXA 4ZDKA 5FH9A 2V7QD 2DR3A 1KYIA 1UM8A 1JAIA 5EP3A 3TNFA 3LAWA 3OHMA 3KB2A 2D4HA 3NEYA 4DDWA 5FPYA 1BH2A 5TVKA 2LKCA 3NVAA 1Q20A 4NBSA 4ZI2A 1S8FA 1R4AA 4Q9IA 1T0JB 2HT1A 3B60A 4OJQA 4M1SA 4NYIR 1G8GA 4HUTA 3G5UA 4I1VA 4NYJR 1ONBA 4Z54A 4MRSA 3QEOA 4XVQA 2HDNB 2QMOA 1U94A 3AKEA 2PJZA 5TV2A 1K5GA 4RFSA 4D0GA 3LX5A 3MMPA 5ANRB 3CB4A 1G21E 1RJ9A 2WJYA 1RRGA 4RD1A 4DLZA 1A7JA 5HR5A 5FL3A 4A36A 2JLSA 4JSTA 5L3SB 1GP2A 1E0KA 2QL6A 5FBQB 2YWEA 3SHWA 3IPXA 4PSAA 5GJBA 2GVZC 2KB0A 1OYWA 1CULC 2ATXA 5SZKB 3THXB 1P61B 4NYMR 3PV0A 4C0HA 2V9PA 4HATA 4JLJA 2CBZA 2FG5A 3AF2A 4OHYA 1RPZA 1DS6A 3FFBA 1X1SA 4PX9A 4B3CA 2GF9A 4BE7B 3FMPB 2FFBA 4Q4JB 4A6XA 5FR1A 4XVRA 3ZGXA 2BMEA 2G0TA 1R8QA 5TXGA 1XCGB 1ETUA 5ELXA 2ZI9A 1EWQA 4KBGA 4DEYA 1D8TA 2WJGA 4BFVA 4B44A 2WVJA 2OILA 2BCGY 1J7KA 2YWGA 5LB2A 2E1RA 3LWNA 4OHWA 1YZQA 3TUJC 3B82A 1Z6TA 5D3MA 3B9QA 4MKFA 2DYKA 1QHIA 4NTZA 3AB3A 2KBFA 4A8JC 1J8YF 2REXB 3KJHA 2G77B 4FIDA 5DI3A 3QNUA 2Z0MA 2NQ2C 5F9FA 2X8AA 1YVDA 2NO1A 1HT1E 5L3SA 2WMOB 3SJZA 4JMPA 1TAGA 2GHIA 1CEEA 4NL4H 3QKRB 4PC6A 4JYBA 4QJ5A 1Q22A 4TMVA 2F43B 1OB5A 3ECCA 5G41A 4C0QC 3LW7A 1VHTA 2VHUA 2ZUBA 3NXSA 4URYR 1XTQA 2PCLA 5CK4A 5DHFA 3RS2A 5G3ZA 2WPDA 3IIMA 4YLGA 2WKQA 1F48A 1MABA 1M2OB 4ZDJA 4LYAA 4A82A 2ATVA 3DMNA 2OO7A 1KKLA 2WKRA 5KSZA 1Q1ZA 3IBGA 1WMSA 2OCPA 4F7WA 1KZGB 1S1MA 4WA7A 1HT2E 2QSZA 2WSSA 2GXUA 2J45A 2XSZA 3BFKA 5C46F 2IX3A 3SFZA 4LJYA 4EIWA 3TLXA 2NOAA 2XJ9A 1W0KA 4G3XA 2I3BA 5K8UA 1KGDA 3C7KA 3KFVA 4JT4A 1ODFA 4BFXA 1HURA 5LPNA 5EP1A 1HYQA 2JATA 3Q72A 3PJRA 2NPIA 5EJEA 1CLUA 1MOZA 4TMXA 3IGFA 2DCUA 3B6EA 1UKVY 2AHOA 2FE4A 4WZAE 4NKRA 4DB2A 5L3QB 2WWGA 4GDFA 1P2TA 1KDOA 4MUBA 1R0XA 1OH6A 5FOTA 1YR7A 2ZS9A 3GJXC 1KO4A 2QNRA 2PX3A 2C96A 1N6KA 3HDTA 4L15A 1KJZA 1NL3A 4EKDA 1TF2A 1OXVA 1WDTA 5P21A 4DSTA 1JJ7A 4BWYA 4RD6A 3VX3A 3CPJB 4YMWA 3KQUA 2QEQA 5H68A 4XVUA 1XPUA 2W6JA 1VCNA 1ZM9A 1Z22A 5JHHB 4FCWA 3B8HA 2ZJYA 1S9HA 1KO1A 3PQCA 2WHXA 1EGAA 4PANA 3WNDA 2NO6A 4BFSA 3NBXX 3ICQB 4OJKA 1FX0A 2QY9A 2YNMA 4Z1MA 2CHVA 3IO5A 3B1WA 2IBMA 2NO9A 3QPVA 1WBBA 1D2NA 3SYLA 1KSHA 4HAUA 4JJKA 4N3NA 2GILA 3BD9A 3X2SA 2BIFA 3MWJA 1HY3A 4D82A 1NN0A 5FTMA 2FPKA 1X8LA 1OT3A 2EFEB 2PLFA 1VIAA 2R6GA 3B7GA 3IEUA 2ZR0A 3NG1A 4PC3A 5E95A 3B1VA 3OAAA 5BW8A 1KO8A 2GAAA 4JVNA 1FNMA 4FMDF 3A1WA 1NJGA 4IDPA 1NVVQ 2FSFA 3AGPA 2CLSA 1COWA 5AWFC 5FBVB 4US1R 2R6DA 3BB1A 2R44A 4JL5A 3WYGA 4CRWB 4TSFD 3CNOA 1ZC3A 1WXQA 2BOVA 2UZIR 4QBHA 4OQMA 1Z07A 2QTVB 5DH9A 2W83A 5J40A 1E98A 1G291 2CVFA 3V4FA 1AZTA 3KKQA 3K9GA 4LHXA 1KY2A 4ABYA 2Q21A 2VQSA 4B34A 4QBFA 1SKYE 5KDDA 3U61B 3GFOA 1XF9A 3BE4A 4MGKR 4A2QA 1E0SA 3A8TA 3K70B 3PXGA 3GLIB 3OFNA 1XEWY 3VNVA 2P5SA 1RE0A 1YE8A 2W0SA 3SI7A 4XWOA 5E7IA 1SKQA 4G01B 2PT5A 2NMVA 3CKLA 3X1YA 1E96A 3C41J 3AVVA 2XNDA 5JSZA 4TTQA 1N6PA 4TMKA 4G5GA 3RVBA 1CJKC 3CW2A 2K5UA 1PLLA 1VG8A 2GJ8A 1OFHA 2ZRKA 3GD7A 1W4CA 2FA9A 3PITA 4IVQA 3QG5A 4HSEA 4PQFA 1QHSA 1ZYUA 2ZM5A 4I99A 4QHSA 3K9LA 2ZSEA 3CX8A 3D6TB 1SVSA 1NN1A 3PUWA 1P5ZB 1XTIA 2RCNA 4ZO4A 4Q21A 4CDGA 2NO7A 2B8WA 2KSQA 1CS4C 2R65A 3MAAC 2D74A 1W49A 1ESNA 4QGFA 4BEBA 2LWIA 1RRCA 3KKMA 2ZYVX 3SYKA 4B75A 4JLNA 2J9RA 1UPTA 2EQBA 2ZQ5A 3K0EA 3AV0B 5KTYA 1UBGA 2BDTA 1G4UR 1KAOA 1LVGA 2FJUA 2IYRA 2P3SA 3ZD7A 1GITA 1XXHB 1CKEA 2LCFA 3RLFA 1Z06A 3LVQE 2FEMA 5GADl 1F6BA 2O8EA 3D7MA 2BEKA 2N46A 5JZVA 1YHNA 3UG6A 4BZPA 1KMHB 2BMFA 2JGNA 2QTHA 4B73A 2CLCX 1D5CA 4KI0A 1JPNA 1TQ4A 4ACAA 4PAMA 4Q4HA 5D3QA 1U8YA 1R5BA 1U8ZA 4EJSA 1U0JA 3DM9B 5CIQA 5DIFA 3BFXA 2AWNA 1SVKA 3IBYA 1XCMA 2EYQA 5JWRA 1NVVR 1ZMXA 1VG9B 2F1HA 4DZZA 2MSEB 2JEOA 4ZCLA 1LW7A 2VHCA 3H86A 3TAUA 2IF0A 1PUIA 4AK9A 5CITA 1WB9A 5F9HA 2BEJA 4Y0VA 2VP0A 3A36A 3LQRA 1ZIOA 2CNWD 1YZTA 1AKYA 3OIWA 5CB6A 3CZPA 3PEUA 3NBFA 3AGQA 1N2CE 3P27A 4URUR 1R6BX 1G8PA 3TQFA 5FR2A 1YKSA 3AF1A 4C2TA 1CXZA 2WPDD 4NP6A 3PUXA 2XXAB 3VKWA 3I5YA 4V02A 4IXMA 4XH9B 2ZRPA 4PPGA 4Q19A 4BLQA 1H65A 4OQNA 4O2RA 3LVRE 3DOFA 4QNRA 4MA4A 3KKPA 2FGJA 2VBCA 3X1XA 2XGJA 2LKDA 1IY1A 2WSSD 3BJIC 4XOIA 1QHXA 1XTRA 2XSZD 3NIBA 4HI0E 5J4HA 1Y3AA 2A9KA 2YC4C 4EUNA 4CF7A 3BBPA 2ZRFA 2AX4A 421PA 2ZYUX 2C78A 1OHHA 4ARZA 3U7HB 2JLRA 4V0ME 4F92B 1RW4A 4IXNA 3NEJA 4FD2A 1K6MA 3CWQA 1TQDA 3ZS9A 5B30A 2OLKA 2KWIA 4YMTA 1FP7A 2FZLA 2NGRA 2WKPA 3MD0A 4HUQB 5DSZA 5TY0A 3U44A 4UQOA 1O3YA 1W0JD 1WA5A 1XEWX 4LJ6A 4PQYA 3TRFA 3SDZA 4LYJA 3NWJA 1H8EA 3L0OA 2DFKB 4Q4AB 1UADA 4AIIA 4LZZA 1XEXA 4Q5IA 2A5JA 4C0KA 4JVLA 2PT7A 1J90A 1E94E 2AKAB 1IOZA 1U8AA 5J4LA 1PVOA 3JZAA 4KO8A 1OXTA 1OH5A 2W6JD 1JEEA 1ZJ6A 3EA0A 4P4SA 4HAXA 5HKKA 1QHGA 3J81k 4Z51A 2HXYA 4M0LA 1ZRHA 1E2IA 1E2FA 1D6JA 5EZ6B 1I2DA 3AVWA 1S9DA 3QF4B 3RS7A 4LUCA 2PMDA 2ZSFA 2HEIA 3RRZA 1GL9B 3CR7A 2ZJBA 1ZUNB 2O8CB 1SXJA 3RDPA 4XSHA 3EIQA 1QG2A 1ZIPA 1C4OA 2ZI3A 2REBA 2JIZA 1TF5A 5FBRB 2IXGA 5BYJA 2V6IA 1ZD1A 4YONB 1VKJA 3D8BA 4XD7D 1DVRA 1OLOA 2ZVPX 3OAAD 4OI4A 3IQWA 4V0MA 3E70C 5CJPA 5EUQB 3CWZA 4EPXA 5UKDA 1Z3IX 4AKGA 2IYSA 5G53C 4DSOA 3CNNA 3IDQA 1ZU4A 3LA6A 4IOJA 3QXCA 1IN4A 5E7JA 1NI3A 5EXPA 3RC8A 3VHLB 2B8TA 3QF7A 2D2FA 2OBMA 1TADA 1GSIA 2IYXA 2P6UA 2YOFA 2V4ZA 1UJ2A 3WP1B 2ZU6A 1FP6A 4M1WA 3KJEA 1KDTA 4CEIA 1AS2A 4AKEA 4F4CA 2RGBA 2BJVA 2TMKA 3KTAB 3LXXA 1VDZA 1AJEA 2AR7A 4DWJA 2J7PD 1T8UA 4QL3A 1OB2A 2GESA 1XMVA 4B2PA 2O8FA 1VCOA 3L8ZA 1R2QA 4KODA 1HH4A 3K9NA 2CHQA 3E2IA 1NN3A 4V0NA 1PJRA 1BYUA 5CYPA 3ZYCA 4WW0A 4F93B 3WRXC 3WYFA 2MMGA 3BERA 2VP2A 3DDCA 2OEPA 5FBLB 3K53A 2XNDD 1KDPA 1W4BA 2YC2C 1E1QA 1GIAA 1BYIA 1JQJC 2CCGA 4DKXA 5J5CA 2CMKA 1F2TB 1VYUA 4R2IA 4LJ8A 2EWVA 4A8JB 1J70A 2VEDA 3HR7A 4EJSC 4LJAA 1Z0DA 1ZUIA 3DZ8A 4PHGA 5EQTA 3I92A 3SZRA 2OLJA 3QG1A 4GOJA 2RGGA 2CJWB 1GTVA 3P20A 3TJZA 8OHMA 4TL9A 1E32A 1N5LA 2EWWA 1L7VC 2FH5B 4DLSA 1TL7C 3RABA 3FHTA 4ITRC 4UNNA 3R7WA 4CEHB 2MMCA 5KNBA 2RAPA 1EX6A 2EW1A 4AI6A 5AJWA 1KI9A 3C5HA 1DO2A 2VL7A 4US0R 4A2PA 3UMRA 2A30A 4M4SA 1RIFA 5CDFE 1Q1QA 3QE0A 4EPTA 1W2GA 4IVPA 3QKTA 2GA8A 4A9AA 1V5WA 3VAAA 1EFUA 2ZAOA 2C99A 4D4MA 3RC3A 3CF2A 1ZNYA 5CLLA 3AQ4A 4FW9A 3L0SA 3H4MA 1US8A 4CEJB 2GCNA 1E79D 2OAQ1 2B6HA 1G3RA 4QXAA 2ANCA 2BMDA 1II9A 3N2EA 4NCHA 5CB8A 1SVMA 4DCTA 4HLQB 4KVGA 3BH7A 3RRYA 4CIDA 1KI8A 3FFAA 1GOTA 1G1MA 3MUFA 5EE9A 2IYTA 4G0NA 5DI9A 4ZCMA 1SVOA 3NKVA 4OI2A 4QHYA 3KZ1E 3ZS8A 3VTKA 2WAYA 2CVHA 1Z2AA 3B1XA 1ZC4A 1RC8A 1N5KA 4NH0A 4D6PA 5HE8A 3BWDD 1GDDA 5EE0A 3LQQA 3L8YA 1DPFA 4TYQA 3BB4A 4IDNA 1QVAA 2BCJQ 3BS4A 3U3JA 3VFDA 1JB1A 2PBRA 3NDPA 2CLDX 3CONA 3ZH9B 4QM7A 3MJRA 3SS8A 3F3YA 2JJ1A 3X1DA 2YOHA 3KUCA 4KXFB 3THWB 3C4JA 1EESA 4UKDA 5JWOA 1U99A 4BASA 1YRAA 5CDFA 3WNCA 1CTQA 3QEJA 4TTRA 1ZM2A 2OHFA 2QPAA 2ZU0C 3ZVRA 3SQWA 4M22A 2JJ8A 4TYPA 3ZQ6A 4OHVA 4D26A 1CIPA 3NTUA 2O0KA 2C03A 3VX4A 4ZKEA 2O5VA 5KHOC 4GP6A 1W4AA 2HXSA 5FTJA 2IWHA 3IKJA 3UK6A 4D0LB 3V00A 1RRPA 3IHWA 1YZUA 1SXJC 3NBZC 1ZM7A 2VLIA 3NHAA 2QPOA 2HF8A 2RGEA 1E0AA 2Q9BA 3U3KA 1XFAA 2FSGA 5L8VA 4OKSA 1R0WA 3Q3JB 1NLFA 1OHHD 1EFRA 2AN9A 3VHXA 1GRRA 1H8HD 3W34A 1KKMA 4EFNA 5JBQA 3GEHA 1FUUA 2QENA 4HZUA 4U5XA 4IFEA 3WNBA 3CH5A 1PLKA 4L9SA 2CK3A 5FUWA 2OCBA 4Z8YA 1P60A 2XJ4A 1WF3A 4BFZA 1X1RA 2ODNA 3Q85A 2GBLA 2CE7A 4X8OA 3RS5A 3KFXA 2FGKA 2J0SA 2BJWA 4M1MA 4RFSB 3MLEA 2J59A 1RJ9B 4O2LA 2DFLA 4LOAA 4NCKA 1E9SA 4TTPA
chains in the Genus database with same CATH superfamily
2PQMA 3UV7A 5AVTA 3KCNA 5HMMA 3UUEA 1XYYA 2OORA 4G1UC 3TQCA 1Z38A 3UXEA 3KOYA 3WOVA 4DNFA 2VP5A 4W5JA 4BQIA 1HE3A 3BMOB 1J33A 3WS7A 2OD7A 1YA6A 4L74A 2XQKA 4I0WB 3DZKA 4YIKA 1E1MA 4I08A 3UA3A 5DTQA 4D8UA 1Y82A 3AY6A 1IC6A 3GO4A 3MWEB 1E3MA 4N40A 3REGA 1CQIB 2C04A 3ZHXA 4DRXB 1QBKC 2Z5GA 5E7QA 2LRHA 5JVDB 4Q1DA 4YXWA 4NFLA 3STTA 2OO5C 3H13A 4R9VA 5EZ5A 3BRSA 1M2FA 4MGHA 4IMRA 1JFTA 1GGFA 4LMPA 3HKEB 5LWHA 1H22A 4LBZA 4CYMA 2F2TA 1U0HC 4RK5A 3C3BA 4F2DA 2QX4A 2C8LA 3HEAA 4K6OA 2PT9A 2MOKA 1M8FA 4BQFA 1HPLA 5D3MB 5LYYA 3HB9A 3RFFA 3SIXA 3Q2OA 4HNTA 3FTDA 1LJLA 4I4LA 3H7IA 3BMQB 3Q9LA 4ALKA 1H93A 2X0KA 2HWWA 4CTOA 1DZ3A 3I72A 4GGOA 1DO8A 2PX5A 2FAXA 1FXWA 3PJFA 4DV2B 3JWIA 1WABA 1QBGA 1A9QA 2PH3A 3UCEA 1S2IA 3T4PA 3HP7A 2ST1A 2ZWIA 3B6ZA 1W5SA 3BMOA 3DWIA 3EZ2A 3NHFA 1ZJ4A 4J9VA 4V0LA 5FYQA 3SDBA 3TPCA 4AN4A 5KWEA 3ND7A 2XZTA 1PWHA 1KOFA 3DQZA 2UYCA 4KQJA 2OB1A 4PBRA 2IH4A 2GUGA 1ADFA 2CB9A 2J46A 4JJZA 2B8JA 4OIMA 1QNLA 4AJ9A 1CQIA 1KFEB 4B3MB 3D7RA 3FNEA 3QOYA 5DGHA 3SBOA 4NHOA 3UWOA 4MQBA 3WA7A 3O4HA 3E9EA 2FOXA 2XB4A 3CZAA 3E3OA 4HDRB 4XUEA 4MUYA 4MEBA 3IVMA 4RZXA 5F78A 4B80A 2FEPA 2P77A 3WJ1A 2D54A 3GJQA 5C0OE 1UBMS 1OFVA 1QGDA 2XUOA 3D8RA 4XX1A 3BAZA 1ISPA 1KZ7B 3E8SA 3L2OB 1G5FA 3AZPA 2PTHA 5FWAA 4A10A 1M0WA 1JLMA 2JFGA 3ETEA 4R8SA 4JOCA 3PICA 3FPLA 5AJTA 3B85A 1FNNA 4GMHA 3E4DA 5CW1A 1UT5A 4X7BA 1L7QA 2VRCA 3GCZA 3T12A 1ZIYA 4N0DA 1XTZA 2ECFA 5K6AA 4CKEB 2PPVA 3JVEA 4MVCA 4Y2QA 1TMOA 2FZVA 4E21A 2ZAYA 3FPCA 4N49A 5L3RA 2AZXA 1NLMA 4M0FA 3QELB 4HLDA 2UXDB 2JLVA 1D2HA 2CNOA 4INOA 3CRQA 4UNIA 2QY6A 3UXHA 5A04A 5A0VA 3M6LA 5KNBD 4DV3B 1PJBA 5FT9A 1SXQA 2JLZA 2ZFUA 1RWNA 3A6ZA 4XGQA 2ZAIA 1JS1X 3ZQ4A 1YTLA 1RI1A 5ALJA 3VU3A 2FLWA 1AZSC 1XCPA 2WU3A 2FPRA 1MJFA 3BFPA 1VSBA 3CNBA 1TCUA 3ADOA 1KTVA 4QUDA 5HFAA 4JI6B 1G9SA 3J7AC 1NT4A 4M0DA 5IS2A 4GSLA 4ND2A 2DPMA 3K9CA 1TA4A 2QVLA 4X1KA 2Q0QA 3SHOA 2IVZA 5FA6A 3LFTA 1SG6A 2QLBA 1K5HA 1VCIA 1Z2DA 2YS7A 5IPFA 1KEEA 5DNVA 3EQZA 5LKRA 3DMYA 1C8LA 2RDMA 3AR3A 1PLJA 4BRSA 3F6SA 3VR2A 2NN3C 5JMOA 1C3EA 1RBZA 4Z7NB 1XI2A 1F8GA 1K97A 3ZCUA 5IC6A 2IWRA 5AUQA 4X62B 1DXYA 1M1YE 3NQ41 3KKLA 4EOGA 1NBHA 3EHDA 3IIKA 3IO3A 3L1VA 4GE0A 3TTSA 4DE5A 4O3MA 2PLWA 1B8OA 3TH5A 2FJ0A 1EMDA 2I6FA 1R9MA 5A9TA 5HILA 4QNMA 2H5IA 2CN1A 4EDHA 1OC2A 4WZAB 2H57A 2J1LA 2QUZA 2K7ZA 2H5EA 4LOKA 4C21A 1F0YA 5DLQC 2EKQA 4U8GA 2EFGA 5T6MA 3X2FA 3RRXA 4F6LA 2AQHA 2W11A 5ECGC 1SG0A 5THKA 3NJ4A 4YVFA 1Q77A 1ZHFA 1N4DA 2R6R1 3LK7A 3R24A 1QRAA 3VI4B 5AFSA 2OP1A 2VPPA 3TM4A 4B31A 1X13A 2NAPA 3A26A 4J3JA 2FUNB 3TO5A 1P3JA 4UU1A 4N54A 3KXPA 2QTFA 1K4MA 1WM1A 4HFNA 2FW8A 2AI2A 3K09C 5H80A 4I4TA 1CLEA 3TOVA 3UAOA 3PDIB 4GFDA 2AW3A 1M34B 3TCNA 4BUZA 5JCOA 2IC5A 3QI7A 2CJXA 4IFTA 4U2GA 3Q7QA 4YAWA 2X23A 4AZ3B 2FPWA 4NZZA 4HD8A 1Q3TA 5EIAA 1ETHA 2IYQA 3KLNA 3RNOA 3GDWA 5FOQA 1JIJA 2C3OA 1EFDN 3ZHBA 4QYWA 1ECPA 5FJJA 2QT0A 4V1CB 4F4IA 1P6XA 2H9IA 2ZBQA 1TKBA 4ZVOA 4XLZA 4B2LA 1KETA 4PRZA 4D9NA 5L53A 2IH2A 4ZT4A 1IJEA 3H16A 3K4HA 4LGMA 4LMBA 1XRLA 5ALDA 3NAMA 1ZJWA 4I1IA 1KEWA 3FA2A 4L4YA 4EP1A 2C7VA 1HQDA 1G16A 2AQ8A 4DCPA 3ADDA 3KJIA 1T2EA 1DKRA 5TNXA 4Y6OA 5AI5A 1GUFA 3PVSA 3ZHRA 4BNDA 1IQ0A 2I66A 3WE7A 3CURA 2Z43A 2O2XA 4DEXA 5KJCA 4LN1A 2ZBFA 3I37X 5C1OA 1DQPA 3ZJYA 1TTQB 4H4DA 2VSNA 5BWMA 4FSHA 1U8TA 8ATCA 5KNCH 4JROA 2JAOA 4HB4A 4BATA 5CFNA 2WIFA 1RPJA 4G65A 4HNSA 5AVJA 4YUAA 2KX7A 3DMGA 2H4WA 1UDCA 4EHKA 4G4GA 3PDIA 1O54A 1C9DB 1M34A 3LBAA 4QOJA 1DO0A 1PX0A 1ZH6A 2ZR7A 1JB9A 2AYZA 4J0FA 3TJMA 2BGUA 3JW8A 2EF0A 4F4DA 4LDJA 4YCBA 1YRBA 2NTVA 1CP2A 1O5IA 2Q6VA 3EXHB 4Z9YA 4YR9A 3LL4A 4LXYA 1Q7GA 1DT3A 2PKYX 4X84A 3TZCA 4IUBS 4YUVA 2O8EB 2WFLB 4UHBA 1MC8A 1RXIA 1ZJ5A 1H0SA 2DECA 3R2JA 1L6RA 5CIYA 4DCGA 2C5BA 2ODTX 5FI5A 3I52A 1SB9A 4JS0A 2NNLD 2QN1A 1KOJA 1N6LA 4FR5A 1UZLA 5F5XA 4HAZA 1PE0A 5AI8A 4EF4A 4EJSB 1UAYA 3S2UA 3CVVA 1ESCA 1GGJA 3I2IA 4PX3A 1CZNA 4AWAA 2JJ2A 2NX2A 4FBMA 4LYYA 4TLMB 4CMJA 2PUAA 1FVHA 4GICA 4WGGA 1SB8A 3G0GA 1DC6A 4HC4A 4BNVA 4AN1A 3ME5A 3WMEA 3PPVA 1UZMA 3Q7SA 2YYSA 3Q2IA 5DGCA 2N75A 1KQGA 4FWTA 4RLFA 5GM1A 4MK4A 3SEFA 2PKQP 3KZNA 4CCSA 4F9EA 3BTOA 1ZJJA 2ZJ0A 1PZNA 2EW2A 1XVLA 1W47A 3F6EX 3LA8A 3RBXA 3EXIB 5J5VA 3BTSA 3V8NA 1ZIDA 3GYGA 2VTEA 3GGGA 1GRCA 1L4EA 1RJDA 4YLEA 3Q9UA 4ENRA 2NYRA 2HAEA 2Y0EA 3DM5A 5D84A 1O6CA 1QGYA 3CIFA 3VHRA 5KHLB 3KTFA 4JBNA 8ADHA 2GEUA 1K0UA 1T29A 1UPAA 2C8KA 1ZFNA 1KFJB 4BZZA 4XUDA 3IKTA 3LO5A 4YMHA 1LUAA 3LHIA 2GPYA 3B2QA 1UK6A 3JQAA 1AMUA 2R79A 4G8BA 3WKEA 2C5HA 3OZCA 2YVKA 3PCRB 3ICEA 2OM2A 3UOWA 2C77A 1C3OB 1VLQA 2NNWB 3GLHA 5KUTA 4EA8A 1GVNB 3I09A 4DM3A 3N2LA 3PTLA 1EDDA 2RGAA 1VBMA 2XTAA 3DZFA 4W1QA 1L5SA 3K35A 2X2EA 3QMMA 4XW2A 1B4DA 2R1VA 2RHCA 3KPJA 2R87A 4DY4A 1N5DA 1JQBA 2FW0A 4FGZA 1P9NA 3GBSA 2GSDA 4P80A 2YV4A 3WWCA 2P4SA 1PGOA 1I4LD 3EAGA 3VC2A 4PZYA 3C85A 4ARZB 2REOA 2Y92A 2GCOA 1VI6A 1FQWA 1TZ2A 1XXLA 1GGHA 3HCWA 3RUCA 2PWBA 3ADPA 4G9BA 4B6EA 2QRPA 2FFHA 3GT7A 3QLTA 4QLOA 4TM7A 5SY6A 3EXIA 3KEQA 4GXNA 5IMBA 2HM7A 2GT1A 4WLEA 1YQ9A 3K8OE 3SFVA 4XB6B 1Z8FA 3WWEA 3F96A 3X1JA 5FL7A 5GPBA 4NU6A 4COOA 1KVRA 1LW6E 1WPQA 4Q7LA 1RXSA 5CW2A 3ZY3A 3K9FC 1H2AS 3W5UA 3ANMA 4HNHA 3NI2A 5I4KA 2VHQA 4QAQA 1YCDA 2LDXA 3KRTA 1AQUA 1FYWA 2ZPTX 3TNYA 2R85A 3LV8A 3VI3B 5JDCC 4RTKA 4G5RA 1YAJA 1TIBA 1YZNA 4GMGA 4LHZA 4GBED 4KGZA 2JVKA 1FQKA 4JP3A 2IHNA 1NI4A 2YJ4A 3AUUA 3JZMA 3ND8A 4R1QA 4XFJA 5LDHA 2UXBB 3DCJA 4KWEA 2H06A 1W0KD 4AYWA 5K01A 2CNDA 5LP1A 1V3UA 3IE0A 1CERA 1JSLA 1CFZA 1I7NA 1SXJB 3A1UA 1H85A 3BJEA 3O1IC 5JS2A 1U6IA 1MDFA 2QVBA 3OCXA 4H4EA 4J91A 4RGBA 3W8FA 4K2HA 2VHJA 3C43A 4OU5A 5EY5B 3BGVA 1V43A 4ND8B 4HQFA 2RBKA 5HDQA 4ZYLA 1P2DA 4GIBA 1A5TA 5K4AA 1YVPA 1WE2A 2V6MA 4EPRA 3PEEA 4NFSA 2GHQA 2CNBA 2GZDA 2IEZA 4TLEA 4AQ7A 1TQ2A 521PA 4QM6A 4F71A 2PH1A 4PZPA 2ZITA 4GM4A 4QECA 3AHEA 4Z99A 1ISMA 3AL0C 4I3FA 1CS0B 1R50A 3HKDA 4LQDA 3PF8A 5ED0A 1KFCB 2V6BA 4P81A 3EY9A 3SK0A 3WWOA 3P45A 4K3UA 2ZT6A 1Z5VA 3LUKA 1UFVA 3MCTA 3MRSA 4FCVA 5F7ZA 1NFQA 4YRMA 4L7QA 1FA9A 2IJGX 2L42A 4H4CA 3AFIA 3PNPA 4H1VA 5BRJA 3CRW1 3FUTA 4KC0A 4MGIR 5JQWA 1AQYA 2R751 5J47A 4OO3A 2RGDA 4B7AA 3B3AA 3I2FA 3HYRA 2FSUA 3QPBA 1E7RA 1PUXA 1XQXA 3UK7A 3DE6X 1NKVA 5AOBA 1JQDA 3FZYA 2FF7A 2YNMD 1E2KA 3ECSA 5E2BA 5AW9A 3T0FA 4UATA 4OPMA 1D3AA 3CF6R 1Z0JA 1JHPA 2EGHA 5JS1A 2NU7B 4LVCA 1KBZA 2CC2A 1A5BB 4I4IA 1SUBA 4BKPA 4Q3LA 1RCUA 4TT3A 1KMQA 3MMNA 4UHCA 1PS0A 3TSAA 4AXXA 4O1MA 1QQ6A 2F8LA 3FOBA 1W88A 4IIBA 1GSOA 2IRWA 1X7YB 3HJHA 3FKQA 3TSZA 4G8CA 3B3GA 2QU8A 4WKGA 5L4SA 4RDHA 1RVDA 3KV3O 2GETA 3HI6A 2C0PA 2CVPA 1G7SA 2PN1A 2XTZA 1U5BB 4G1VA 4NAHA 2RHMA 4NE9A 3QWBA 3D3JA 2WWTA 2AE1A 2O3UA 3B5EA 3NP7A 1WZNA 1PYOA 5ITVA 3GZNA 1XNHA 1YUNA 2AXQA 1EB8A 2D5BA 3BA1A 4F46A 2L0XA 1C0PA 1EA7A 1YGPA 2ZJ4A 3HI4A 4POAA 3VYUB 5DP2A 3TB4A 4LF5B 3R9WA 2VR1A 4EA7A 5JJIA 2Q1WA 3S81A 1CYEA 3UA4A 2Q5OA 2EFCB 3E7DA 3ROQA 2GCGA 4AJ2A 3T5AA 2OUKA 5B36A 2VSFA 5LKAA 3FR8A 3I9NA 1CCWA 2YHSA 5BXQC 4CT4B 1VE6A 2QSUA 1O95C 3R7WB 1W4ZA 4IX9A 2CFCA 1H0RA 4GEKA 3DNFA 4ZAFA 3C8HA 2PLRA 3HWWA 3LNTA 1T9KA 4F85A 2AJLI 1NG9A 4CLOA 2BRUA 1X8JA 3TQHA 3ZW9A 3PDUA 4OREX 3RI3A 4MTCA 2BVNA 3QYAA 2P9GA 2PIDA 4C01A 4ZMBA 2FSHA 4XCXA 1ULAA 5KPJA 2X7XA 1DIHA 1KZYC 2X7HA 1CDDA 5D3KA 4RS3A 1CY0A 4HGRA 1AVTA 3TD6A 4B2YA 1CUGA 2IIPA 1HE4A 4Q6BA 4AURA 2DPXA 2OXRA 2FN4A 1VL2A 1OE0A 3E9CA 5AM5A 3RODA 4DQ0A 2CCJA 2XIJA 1EI9A 2XDYA 3ILSA 4B46A 4W6ZA 5JV5A 4WL0A 2ZYSA 3EZ9A 1BG6A 3GVIA 3T7SA 2HUPA 4E46A 5TVGA 4O4LB 2C8JA 4CV1A 1V7ZA 4IV5A 2NW6A 3JD1A 4NCXA 3WGYA 4AKTA 3VR4H 3WHLA 4G5HA 2X1LA 1M9NA 1EFPB 2AVNA 3TEFA 1QHYA 4DQXA 4US2R 5JZSA 4MGEA 1DINA 5AICA 5I7WA 1JHZA 2OCLA 4K81B 5KTOA 1JQ3A 3AY3A 3HHEA 2VYND 3K30A 3O75A 5CT4A 4GI7A 4N0PA 4KH1A 3PIRA 3OZAA 4FB5A 2QSJA 1O95D 3C3XA 3A1NA 5ALRA 3ZE1B 1A1SA 5AJHA 4HOYA 1CZHA 4WN9B 1R4NA 3WLKX 5COAA 3D5TA 5GJCA 4R8VA 1H1DA 3DPIA 5LIRA 2CLOB 1Z74A 3WL8A 1AIPA 4G1BA 1D07A 3V33A 5ES3A 2BW0A 3TTTA 1D0VA 1JFFB 1SZJG 3I9V1 4BVBA 3QX3A 1QF6A 3AFOA 3SIPA 4DUGA 3U9TA 1X94A 3V2GA 4OMFG 1P1IA 2P8JA 2Z1DA 1CV2A 3VMFA 4BB5A 1N8KA 2EU8A 3DW1X 3KPVA 1DTWA 3EGWA 4BBZA 1JE1A 4LDZA 1G3MA 2XUJA 3BWBA 4LSZA 2C31A 4LYFA 3ESXA 4OAPA 4F4HA 3JAMA 2FHPA 2AKYA 4GU5A 1YJXA 3NGXA 4C7OA 1OFIA 4ZV9A 1QVZA 2HPVA 3TDKA 1ACMA 3RTDA 3FD8A 2IUSA 3OETA 3K05A 4AJPA 4YQFA 4NCIA 4F06A 3GDOA 4KQHA 1NOKA 3T99A 2XB8A 1P7PA 1EP9A 4HYTA 2PQ6A 1DMSA 2J5KA 4HGYA 1HGXA 2JKYA 1IB6A 1H9AA 1YU6A 4JBWA 3VHXB 1SCQA 5ALFA 3CZRA 2XGGA 4WACA 1O9HA 1C8BA 1T1JA 4M1KA 3N6XA 3UJBA 2PGJA 3WLIA 1REQB 1MZVA 3BE8A 3ZWPA 3IQGX 3M5PA 4R1SA 1MAVA 4ERXA 2YH2A 5CLIA 4A15A 4MQLA 4P86A 1ZJYA 3HA7A 4RLSA 5E0OA 1ILEA 4DCNA 4D2IA 2G76A 2PGDA 4PVCA 1RJFA 1WMEA 3HJBA 4IJMA 4BHTA 3MJHA 3ODPA 3GBPA 4UAUA 3IEKA 1ZN8A 4WEQA 2QJOA 3NAGA 1G8MA 2EIXA 4KXWA 4DLYA 4XLLA 5A4IS 1MHTA 2MYTA 5KS2A 3FJYA 1QONA 2Z83A 4P2GA 2JDID 2QD3A 5AM1A 1TZKA 3TEJA 1IOVA 2AEMA 3MJCA 4O0MA 2BFAA 3SP1A 3U80A 4EFLA 4BU1A 2ZSAA 3EGDA 4N76A 3SMQA 1MVNA 2IUYA 3TSOA 1LFDB 3ZGLA 4DJTA 1Z08A 3FIJA 1HFKA 5A03A 2EP8A 1U80A 1IZ8A 3MTJA 5AI0A 1ZMRA 2J3LA 1SMKA 4E2WA 2I91A 4QULA 1WHSB 3ZGVA 3JQEA 4YI3A 1UZNA 3JALA 3T7TA 3E9QA 3OUTA 5J1TB 3CKYA 1NG1A 1HORA 3KU1A 4FYKA 1C9YA 4GW3A 4JJEA 5AKIA 3X2EA 4HYYA 3U13A 4HDOB 4PFKA 1KI7A 2NG1A 3FPGA 3NHUA 2JLYA 1UOOA 5U9CA 3U6KA 3G0HA 4MAMA 4P6VF 1JFSA 3CG0A 4FQ7A 1ZVMA 5DK6A 4Q9KA 1MX3A 2E5LB 1Z5WA 1YQGA 1Z75A 2WG1A 1IZ9A 3CVJA 3TIFA 3AVUA 5L7YA 4RETA 2EP7A 1DAMA 3PT9A 4IKEA 1XCOA 1YCGA 2FWPA 4RFVA 3VO8A 5TMEA 2J9GA 4ZFNA 4REQB 1IQUA 4AULA 3QSYA 4GLLA 4QDKA 4DB4A 4TTJA 1AH2A 5B1EA 3TSWA 1SULA 3I32A 4V0QA 1YDHA 5DYGA 3ZDFA 5CT5A 5KYXA 3UMCA 1T3HA 4MR7B 1I4TD 2ZB2A 5CURA 5B4TA 4K6MA 3OT5A 5CIWA 1SCAA 5KO2A 3WRYA 4ZVQA 2JJQA 4A23A 4EKIA 3PDWA 2ONJA 1XA4A 2P1DA 2GA9A 2GS9A 2P5TB 3R1IA 4UXIA 5ALHA 3ZQKA 2FZ4A 5JCZA 1MBZA 3ZC3A 3N70A 4YJGA 1Z4QA 3PXBA 3FGPA 3ONWA 3WGVA 1NAHA 2IEBA 2H7XA 1ZW6A 3AJ9A 4G25A 4Y9RA 1OOEA 3GNLA 1SOAA 4TVOA 2ZDGA 5DSTA 3SXUB 1TMKA 1S2DA 1SH7A 3SKYA 3W5IA 2Q1UA 1PFVA 5C34B 3GMSA 2VJKA 2GR9A 3HDVA 2YQZA 3IODA 4D5EA 1YJ5A 3IAHA 5HRCA 3GJ6A 5KQPA 5FA8A 1P3Y1 3OLCX 4E30A 2A33A 1N9GA 3L40A 4YB8A 4G0YA 1IHPA 2QTRA 1MV5A 4B4OA 1Z7EA 3QE9Y 4I1PA 3VUEA 3H3FA 1K6EA 3EZFA 4P3NA 4GE3A 1JHXA 1RQNA 4LJKA 1G19A 1RHUA 3DP7A 3DF7A 4AUNA 3PLAE 1VHLA 5DHTA 1P75A 3AW9A 1XMJA 3INGA 2PK3A 3NYWA 1P9WA 1E3QA 1IHXA 3P2IA 3QU9A 3EZ7A 4HY3A 4L22A 2OK8A 2FQYA 4TKUA 3MYYA 3UV6A 5BNWA 1BCRB 2ZSJA 3FB4A 1Q14A 4U00A 3GP8A 1B00A 4LX0A 4AUMA 3S5UA 3H0EA 4MP3A 1ABBA 1JDTA 2GZ1A 2H1VA 3HYCA 4EX7A 2NUTA 3RS3A 3SZMA 3PJGA 3OHPA 3GPBA 4ZMRA 2J0QA 2H85A 3ONFA 1N1MA 1PFYA 2P79A 5LJLA 4DYVA 1WF6A 3HWRA 5E3IA 3DZJA 2ID7A 3I2HA 1E1NA 3HO1A 3NTXA 3DDOA 5SYMA 4R0MA 3P1JA 2FWRA 3RHTA 3DEAA 5KKAA 3SXUA 4ZVKA 4QREA 3RR2A 2YMPA 1PQ4A 2IZ0A 4PBTA 1J25A 2P0EA 4RVDA 4S1PA 1JXOA 1H6AA 2H18A 1RM3A 5IVDA 1COZA 2IPOA 3LBHA 4YRGA 3CUUA 5CRIA 1UMCB 2C5GA 4TUYB 2PUEA 3HLKA 2DBQA 1SHTX 2ERYA 3DB1A 4C7MA 1PR1A 1VIMA 2BUAA 2C9BA 1FY2A 1OXXK 1QV6A 3PYXA 4OD0A 2QN7A 4LIPD 2F3SA 3ZY5A 1G0NA 2GXAA 8LDHA 1J09A 1NFFA 2Y1DA 3FKSD 3DFUA 4KXLA 4FOLA 3ZNQA 4D1YA 5EHQA 2GGSA 3P32A 2LD4A 1K06A 5EYPB 3G17A 4M7OA 3AR9A 1W35A 4M6WA 3AF6A 4UBKA 4FLMA 3S1SA 2PXCA 5H02A 4FYYA 4TXNA 4QOGA 1XTKA 3MINA 2GN6A 4PLVA 4PX5A 4BKRA 2D2VA 1X1EA 3I2KA 4NBRA 1H0KA 5CH3A 1HFJA 1C9EA 4IHJB 5TMPA 3OF3A 1A4XA 2ZJZA 4O8CA 1XP5A 5TF0A 2Y2VA 4AICA 1ZM4A 2EGGA 1P2GA 4IRUB 1NV9A 4PNZA 4BGDA 1T8TA 1AF4A 1E9EA 3K1YA 1RYNA 4JC5A 1A76A 2BV3A 2F9MA 1Z56C 2RBGA 3DVQX 4UW9A 2VSOA 4URHA 1MB3A 4QQNA 3D2LA 4KJZA 3C7TA 4KV9A 3T5TA 1A8SA 2PAFA 5E8RA 2CFRA 2GNPA 3LUBA 4PIPA 1HR0B 2BR4A 3K7EA 4Y1FA 1P8AA 5JY6A 3DOCA 3OQOA 2AJDA 2CNWA 5DGXA 3JCZA 3PL1A 2P2NA 3LIIA 4MKZA 1JGTA 3OICA 4TMTA 3WTBA 3FOAA 3PVZA 4BFUA 4DRZA 3UMMA 4MDFA 3NPAA 2ODBA 3SM9A 1ISIA 1I32A 3HFGA 4TTTS 5CDUA 2C8VA 2J08A 2VDMB 3R09A 2AN1A 3JAKA 3UOAB 2FR0A 3VYSB 2G8NA 3MMXA 1E0DA 2HJWA 3GMDA 4FP9A 2O20A 4TWBA 5EYPA 2B7LA 1KQOA 2W4IA 3MTDA 4S0ZA 4Q4JA 3CH6A 1D9XA 2A5GA 1Z6PA 2HRQA 3ULKA 4ATNA 4HT3B 1KJ8A 3EULA 1W59A 1NBWB 2EHJA 5AOVA 5TQJA 1FTNA 1R0YA 4DLVA 3KWLA 5KSPA 1GNRA 4A0RA 3L93A 2EQAA 1EGVB 5JYDA 3T4XA 3M6FA 2ZBRA 4H6XA 4HLNA 2WIJA 1EJ0A 1YFLA 3O8LA 2BBSA 1FLVA 5HCIA 4MPRA 3JVUA 2C2MA 3BFVA 4BYMA 2IA5A 5J4VA 4R9NA 5F4BA 3TDNA 4P82A 2AG5A 4RVNA 1AO3A 1W0CA 2E85A 1Z39A 4XB1A 3SBDA 2IOHA 3B9PA 3ESQA 1XLVA 2FUCA 3TSYA 3AERB 4C5CA 5FORA 1KE1A 1WMBA 1B2LA 1W581 2AOXA 2WNHA 5FRDA 1JKIA 4KGXA 3CUWA 3UJ7A 4DDMA 1Z6ZA 4ZHQF 1N6RA 3TI7A 1W0JA 5J58A 4QLBA 2HLHA 3QKRA 5DM1A 1LDGA 3S4YA 1LJ8A 1U9YA 3ZIAA 1QGOA 2BE9A 2R62A 1YBMA 2QRNA 3NKLA 5FQNA 3HZZA 3C2QA 5KB3A 1GQ2A 1J6UA 4NNJA 4OQPA 2FOLA 4ZN6A 4WT7A 1FFHA 3JRNA 4ER5A 4BLTA 3LHKA 1JLRA 4AZ0A 3TG8A 4L4UA 4LK2A 4PGFA 1NJSA 2E4VA 3LU1A 3WMFA 3PGXA 3KG2A 1UT6A 1CJMA 4R9RA 4P83A 1IRIA 3RVJA 1RQLA 3DZBA 3SZLA 3NCTA 1MQAA 2BTQA 2ZROA 1RI3A 4YJFA 1EJ2A 2CKDA 2NM0A 1JG7A 3R4CA 4QU0A 4U39A 5T67A 3NVKI 2YR0A 4V38A 3UW3A 4XD2A 1P0QA 4EUKA 1Z5ZA 2RGXA 3N0RA 3G13A 4M7RA 1BVUA 4ARIA 1QGED 2MYUA 1U3WA 5J1SB 1XTSA 1U0RA 4GKJB 3COSA 1WETA 1DIAA 3A1SA 5ALSA 1E5QA 4JSYA 2IYVA 4XAQA 2ORED 1ZXXA 2FW1A 2XWPA 3GROA 4V03A 5C3UA 4B43A 3AF3A 2YV2A 3QZUA 3I3OA 3PNQA 4P58A 5FPSA 3RYIB 1Q1BA 4P3XA 4BUJA 1L4NA 2W6PA 1DX9A 1YHYA 2R2AA 4PLPA 3PPIA 2UUOA 1J00A 4LJ4A 3TIVA 3OOEA 4I1OA 4P4UA 3UV3A 3VVCA 4WRRA 3DTVD 1M5TA 2IPNA 2UDPA 1VA4A 3QV2A 4EELA 2AC7A 4CIYA 1GNPA 4M9ZA 3U31A 4B7ZA 3MPOA 2QTBA 4XDGA 3UF0A 3KUUA 4GMFA 4L5YA 3EAFA 4AMYA 3B5IA 1L2TA 3F0TA 4YJ3A 3N1UA 4KLAA 1AXRA 1UBSB 2GAFA 3SYNA 1W76A 2X2PA 3BQ9A 1T4DA 3CNHA 4P35A 3S8YA 3GPLA 3W9YA 2QAGC 1Y80A 4BQOA 3LNCA 4GUDA 5AW5A 5JRZA 1K0FA 4YEDA 5CK5A 4HPWA 5C32A 2ZRHA 5JYCA 1R7RA 4LC1A 3P96A 1KSGA 4DT1B 2ONYA 4A73A 1GGEA 1Y63A 1X92A 2D2EA 2EFHB 3TTVA 4C06A 1VRVA 4UHFA 4NV1A 4WY5A 3GN2A 1CB0A 2XZOA 3BBLA 2WV9A 4B6FA 4Y0AA 3HLYA 2P67A 1RI2A 3I6QA 4JVMA 4OYLA 5DGTA 4MP8A 2WWYA 4EF5A 1I10A 4BFWA 3I5XA 1ZNWA 2AMYA 4U2FA 3TRHA 4BAZA 2DSTA 1ENZA 4HAIA 4UHDA 1DBVO 1AS0A 1GSAA 1QH8A 3W6PA 1RHMA 3E1GA 1ADJA 1U5AA 3KYCB 1JHQA 4E3WA 2QRMA 2P9ZA 2XYGA 3B1YA 3K0FB 4RBNA 5CMLA 3OPMA 3O8CA 1GNTA 4EVRA 3BAFA 3LWZA 4CMGA 2OG2A 3U3ZA 4LV6A 3EVNA 2XUIA 4ZV4A 4Q1BA 2QMEA 3NFYA 2QRVB 1DG9A 4JP2A 4YHBA 4YAIA 5F1OA 2V7PA 1RZRA 1CUUA 1DAPA 4OJTA 4B87A 4MSUA 3T1OA 3AJ8A 4P08A 2OXCA 2PE5A 3IMEA 1ZD9A 2X0NA 4EGAA 2ZTSA 3N8GA 5AKZA 3UATA 1RRFA 4IXTA 3WGIA 1JXAA 2ZG6A 3LHDA 4YGYA 4PGGA 2VJYA 3K0KA 4GSYA 1KTIA 4ZEWA 3U1VA 2JLUA 4UARA 1DAEA 3AVOA 1IM2A 3KQNA 3T5GA 3DAHA 4J3FA 3GT3A 1E9BA 1P0IA 2WYUA 4UJ3A 5DBFA 1NUQA 1E8NA 4HN9A 5AIBA 1CEYA 1V45E 3CMCO 5IJXA 5JD5A 1N3LA 4JLSA 1SU8A 2ZXEA 1ZK0A 4K9PA 3SAJA 4HTFA 3A25A 1CT9A 1H2ZA 2O2IA 4D3YA 2NT4A 3GUCA 4LE2A 1XXHE 1XL0A 2QQEA 3NR2A 3QQ5A 3IOCA 2GARA 2XVAA 3R6GA 4FI3F 2B4RO 3DXYA 3GLIA 4JA0A 1NBMD 5DNWA 5F77A 3D3KA 3WHIA 1CY2A 1UC9A 2NPOA 3EVZA 2DG2A 2VBGA 3QLJA 4JWKA 1SCNE 5JJ5A 1HKUA 2CJPA 3ILHA 4J0HA 2CSUA 1EX7A 2ZXUA 1YU9A 1A5AB 2Y1FA 3N2KB 2Q28A 1H1TA 4WCFA 1Z29A 3ET4A 4ER3A 3FLAA 4C4AA 3HJUA 4G5XA 1NUHA 1V5FA 4UHEA 4DG8A 7ADHA 1B93A 2PVCA 5K0GA 3T4EA 1E3EA 1E79A 3L6RA 4BLRA 1BJRE 3BGSA 1JBEA 3CY6A 1I4EB 3DOUA 3AVPA 2HI0A 1J1ZA 3GJ4A 2WU1A 3EPRA 3OF5A 4H59A 1OI3A 1YI0A 3B9RA 3C3DA 4M0CA 3TXXA 1TAHA 1QFZA 2QN6A 1DKOA 3E5HA 3LT4A 4PYQA 1HDGO 4LDRA 5BW4A 2YHAA 5FHQA 4GUAA 1HDEA 1LV7A 1TT7A 4ZT7A 4EPYA 3W2HA 2XB9A 2G6BA 3F97A 1XRPA 1GAJA 2V6FA 3KXDA 3KOXA 3ZLTA 2ZCJA 3TRIA 1KXJA 2JBHA 1A2KC 1U7UA 3HUTA 5LYJB 4J16A 1M8KA 1RKQA 4MITA 1Z26A 2WVHA 2QOEA 2Y0CA 3IUYA 4HZGA 4JYMA 2Y0PA 3B51X 5E3JA 2I8LA 3PI6A 5AM3A 1MXFA 5MHTA 4M7PA 2MINB 2B2CA 1IAVA 1MN6A 3FCYA 3ISTA 1E2DA 3AESA 2ZIUB 3W2IA 4I46A 2JH3A 4XTCS 1J0DA 3DV0A 3S6JA 4IHQA 1JSXA 1NQVA 4YY3B 4GRAA 3DMFA 3KYIB 4F1WA 5IN5A 3BOSA 4ESEA 2VUUA 3KYJB 1K3FA 2IP2A 3WVNA 1W2HA 4FHEA 1U7ZA 2DLNA 1KY5A 1VM6A 1WHTA 3CH7A 3ZLJA 3SC2B 4XM0A 2C0QA 4KBFA 1N8NA 5KYYB 3V1YA 2BFOA 4IYRA 3W8RA 4QBIA 3GLUA 3ZDYB 3D6UA 2IIBA 1QQBA 5JS8A 2PJRA 2W8BA 1KMHA 1ODLA 3KUDA 4A2WA 5LJIA 1CBUA 3EWIA 4Q6WA 3IYLW 4M1ZA 3Q12A 4F12A 1HQKA 4M8LA 2QMQA 3QNMA 1XWFA 4OFZA 1M1NA 2OFXA 3AYZB 1FVXA 2ZIXB 4WKNA 1PWZA 1VRCA 3R3VA 3TMYA 3P9PA 4AUKA 5DBEX 5IASA 2JLXA 2OFWA 1U7OA 3M0EA 4PZDA 4W8OA 3W6OA 1PHPA 2JFVA 4JB8A 2QRJA 3FDJA 2AYXA 2PS3A 4IHKA 3AUAA 4OSPA 3QKUA 1RSZA 2EZ8A 4L5AA 5LYJA 3UJ9A 2JLCA 1TLFA 4UOZA 3ETJA 2OGUA 2FPPA 4CL3A 4YS6A 5I9NA 4AXBA 2PX2A 3CO5A 2OP0A 3RUAA 3OC0A 3G2LA 4RACA 1UBRS 5DXAA 3RJ9A 1X0XA 2CLFB 1SOUA 4WPGA 4WBNF 4ZOQI 2DR2A 1R16A 1TJ3A 2BM0A 2N3ZA 2J3JA 1V0JA 4AL4A 4QU8A 5HIKA 1EP1B 3CKMA 1JIQA 4PHTA 2HK9A 3CU5A 4PSDA 1Z2EA 5GIOE 5DMHA 1CY6A 4ZC1A 3CEJA 1DDIA 1E4EA 4B79A 4O1IA 4GO1A 3ST7A 5IK2D 4KPEC 4NCBA 1CUJA 3AFMA 2BC9A 1ISFA 5AI6A 2C7RA 3QPCA 5KYYA 2XXAA 5U1PA 3GHYA 4AJ1A 3ZUPA 1HEIA 1NLZA 1YJQA 2WUWE 4WEOA 1GEEA 3UH0A 3TX2A 3WY9A 3ENKA 2ZUEA 4PXAA 1ZAKA 4LKOA 1L5OA 3Q1KA 2Q3BA 1GNQA 1P4HA 3HSKA 1Z25A 4X92A 4BWVA 2ASEA 4RL4A 3WMWA 1UJBA 1VLLA 2X8JA 3A4LA 1LSUA 2XNHA 3H5OA 3LCCA 3OKFA 4Y1RA 2ZI7A 2ZIXA 4YN3A 5T8KC 5BYKA 3FLBA 2A7XA 4JVSB 2E0IA 5JDCA 2JANA 3GQBB 2G09A 3HP1A 1GAXA 4Z2YA 1L7XA 5C7LO 1ZINA 3DLPX 4IQFA 4R6WA 2EF1A 4ZZ2A 1DHTA 2DM6A 2BBWA 2OECA 1WY5A 4JC0A 4EVSA 5JO9A 1K5DA 1ZU5A 4LS3A 1CJCA 1PNRA 4OL0A 5ECDA 1W1UA 4IPTA 1TB4A 4JI4B 3V55A 4N0MA 1AKMA 2R4TA 5CFOA 2FWJA 5B1IA 4KIJA 2Z09A 3L43A 2QGZA 5G1PA 2D1FA 3RFXA 1FK8A 1I7PA 1WB4A 1EUYA 1ZHHA 3B13B 3ND9A 4XRRA 2KLHA 2NIPA 4BZWA 1JN0A 4FMCF 2QS9A 5JFTA 2EBWA 4RKRA 3TQIA 3PXDA 2ZE7A 4XJXA 1QNFA 3SBXA 1XKXA 2PZLA 4C89A 5CG1A 2D1YA 2PGIA 4M1OA 3T1NA 5BWOA 2W37A 1BA3A 1XKQA 4HKTA 4YUYA 3S8EA 3TYXA 1IJBA 3KLMX 4N7RA 4WXMA 4ZQBA 5HQJA 3ZX4A 2I4MA 2VYQA 4EM6A 1N33B 2D1QA 4MGYR 2ZJ8A 1WZ2A 2VHXA 3KKZA 3GF4A 3GDFA 5CCEA 4BNGA 2C9MA 2AGVA 3E27A 1H6DA 1AGYA 4FU0A 4MLPA 3SEAA 3SC6A 1GCAA 2VTVA 1A4RA 3Q3GE 1RQGA 3IPCA 4TTSA