1XTKA

Structure of decd to dead mutation of human uap56
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
382
structure length
382
Chain Sequence
GFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDEADKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords Probable ATP-dependent RNA helicase p47
publication title Crystal structure of the human ATP-dependent splicing and export factor UAP56
pubmed doi rcsb
source organism Homo sapiens
total genus 120
structure length 382
sequence length 382
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2004-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xtkA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xtkA02
3NH6A 5IK2A 3TUZC 2JATA 4B73A 1Q3HA 3WP1B 2D7DA 3GLFA 4OK5A 2WOJA 4II7A 5KDOA 4PC3A 3WYFA 1XDBA 2QORA 4ZV4A 1SVIA 1OW3B 1ZBDA 2IYXA 3HPQA 2ZJ8A 4AYTA 1QRAA 1VIYA 5JEDA 1EG7A 3EX7C 1GRNA 4LYAA 1ZAKA 3KJHA 2AXPA 5FOWA 2ZU0C 4QGFA 2ZRPA 1XCGB 1DOAA 2AK2A 2AR7A 2C2HA 3IIKA 1OH8A 3E2IA 4LCBA 1VECA 4EFMA 4GZMA 4LJ9A 2IXGA 2PZGA 3G5UA 1BYUA 4GPTA 2V1XA 1G5TA 1AZTA 3QF4A 3I8XA 3CZQA 1NMZA 2WWXA 3GLGE 2A3RA 1AZSC 2E9SA 4ZI3A 1CTQA 5H70A 2ZYWX 2ERYA 3GFPA 2ZS8A 1CJMA 2IWRA 3VU9B 3VHXA 1A5TA 1T0HB 3UMSA 2R6DA 1XTJA 1NBMA 3IHWA 1D8TA 2Q6TA 3ND9A 4MUBA 3U5ZB 4OKSA 1EFRD 3K0CC 4C0QC 2NZ8A 2PBRA 1TQ2A 4A1FA 4C9BA 3EC1A 1QHGA 5HZHA 1Z07A 4JYCA 3RS2A 3SBDA 5EE3A 2NPFA 2YYZA 4BEJA 1K8RA 4MH0R 3L0IB 1W4AA 2ORWA 2ORVA 4M22A 1CR1A 4Z1MA 2P5TB 5F2EA 2C5LA 3B5JA 3UIEA 2XZOA 1Q0UA 5FUYA 2ONKA 2RGBA 3M0EA 3WNBA 3AVPA 2JLZA 2DWOA 1OKKA 3EPLA 1KDTA 2FGKA 2HF9A 121PA 3H0KA 3T15A 1IBRA 4A0GA 4PQFA 4RY2A 4HAUA 1G4UR 3RRNA 1EFHA 2D3WA 2NQ2C 3KB2A 4ASUA 4GZLA 4OQNA 1W0JD 2EU8A 5EQTA 1W36C 1U9IC 1NLYA 4B43A 3HJNA 2IHBA 3QXHA 1XMVA 5B57C 3OEED 2QAGC 3W34A 1C9KA 1CBUA 4TTRA 2IXEA 5JWRA 4TYYA 1KJZA 4LBZA 1E4YA 1E1RD 2ZI5A 2HJGA 1MOZA 2FPMA 3CRRA 1OSNA 1E4VA 4M1WA 4CEIA 4OQMA 1DEKA 3MWYW 4I1OA 4UXIA 3U7FB 1RZ3A 3H1TA 3AV0B 1VIAA 1U90A 2DCUA 1N5LA 1CR0A 4PHHA 2PX0A 4HB2A 3EAQA 2CL0X 1YR8A 3L0OA 3FKQA 2P6RA 1G8GA 1II0A 1MO5A 1Y63A 4KYUA 2ZE8A 4M1SA 1UEIA 3E5HA 1X86B 5FPHA 3W9YA 3QKTA 1OLOA 3C5CA 2OE2A 3EPJA 3TLXA 1J2JA 5TDHA 4L8GA 1SHKA 1NG9A 1R2QA 2J41A 5AJWA 2AKAB 2A5DA 3NEJA 2IXFA 4CYMA 4DSNA 1YZKA 3BRWD 2VF7A 2VP2A 4L15A 4KCGA 4BFXA 2CLDX 2VPPA 3T1QA 1QHHA 4ZDJA 4KU4A 2PMKA 5AJZA 5KUTA 4TMVA 5KPDA 4R2HA 3WRXC 4BFWA 2GILA 4A2QA 1ZNYA 3PXGA 4ACAA 1XP8A 1ZU4A 2C9CA 4Q1FA 4PC1A 5HCIA 5L3RA 1M7BA 5DH9A 2PCJA 1D2MA 4FCWA 3AEZA 1WB9A 3Q8XB 1LB1B 5AJXA 4B3FX 2WWIA 3D8BA 3FFAA 3EA5A 4UXJA 3T35A 1SVOA 3N2IA 8OHMA 1XD9A 1W49A 3EA0A 5J4HA 5JFGA 2GK6A 1LV7A 1MT0A 1N6OA 1W4BA 4RD2A 1CF4A 3IO5A 4IVPA 3QXSA 2YOGA 3GJ8A 1DAFA 4URXR 4G01B 3VU9A 5JJKA 2NOAA 3JZMA 4GNKA 1U0JA 3BOSA 4QBIA 3KKNA 5E3HA 1XTIA 2HLDA 2ORIA 4Q1DA 4DWJA 1AIPA 2VO1A 5BYKA 4I99A 4NCIA 2WIBA 1T8UA 2A5FA 1KSJA 4B76A 5CIQA 1T5LA 3K70D 5HR5A 4QG7A 2TMKA 1E2DA 3EWSA 3QXJA 2RKOA 3MSXA 4PO1A 2XITA 1Z47A 1G20E 1AQUA 1OPXA 2IK8A 3LX8A 3LX5A 3R7WB 4EAQA 3QVVA 2IYUA 2XZLA 1F5NA 2PT5A 2QE7A 3CH4B 2W2TA 4YQFA 2OM2A 4BZPA 1NY5A 2GJSA 5ELXA 1DO0A 1VYVA 2ZPTX 1XJCA 4XJXA 2ZE6A 4KYIB 3I5XA 4LPKA 1CR2A 2EYUA 4QHYA 4F92B 3ASZA 2ZU6A 3H2YA 4KI0A 2R44A 1G7SA 1Z6XA 3QEOA 1G41A 3DEFA 3THYB 4V0NA 4GFDA 4O25A 2W0SA 4PC7A 3VFDA 3UATA 5FUWA 3OZXA 3L8ZA 5EP4A 4HZIA 1RC8A 2GTPA 5FTLA 1IXSB 3NG1A 1KO1A 3N2EA 1AA9A 1V5WA 2G9NA 4ESHA 1IN5A 2GWHA 2UZIR 2OEPA 3AVVA 2JLXA 2C95A 4BFTA 2KWIA 2WPDA 4HAXA 4M0LA 3SYLA 2GCPA 2MSEB 5CJPA 1ZUHA 1NNEA 1WDTA 2OAP1 4DKXA 4EPRA 2YWGA 3BFVA 5L3QA 1DO2A 5CITA 1AM4D 4GT1A 3RSLA 5DGXA 4MYHA 2ZAMA 3K0FB 1UJ2A 4JSYA 4BLPA 2V7QD 2GCNA 4BRWA 3AF1A 2QN6A 2XEXA 3FHCB 3FVQA 1SXJD 1EGAA 3CUEF 4OHZA 2WOOA 2J0VA 2O8DA 2AD1A 4D6PA 1KI6A 3IUYA 4XSGA 3WYAA 4LX0A 4LJYA 5FPSA 4Q9JA 2HJVA 4OHWA 5DN6A 1GKIA 4DBLC 1G5PA 4D0GA 1I2DA 2BEKA 4H1VA 4PAMA 3TW4A 2CCJA 1FTNA 1Q22A 1HYQA 4PPFA 2ZE5A 3SOPA 3CX8A 1Q21A 3MWJA 2G83A 1SVKA 3OEHA 1M1YE 2LKCA 2MSCB 4GOXA 2IUSA 4IEEA 2J9RA 4HB4A 4BLSA 2GXUA 1E2QA 4BFUA 2F43B 3ETLA 1NF3A 3B9QA 1E1QA 4RCYA 1GOTA 1G7TA 2QPAA 3D3QA 4PHFA 4EQ6B 2EFCB 2Z43A 1XEWY 2GXAA 2EFGA 3VAAA 3OIWA 4QOSA 4UJ3A 2VLIA 4NTZA 1I4LD 2WWHA 4IXMA 3WNDA 4KVGA 2NO9A 3PIRA 2ZUDA 1VCOA 3N70A 3RVBA 2EQBA 1A2KC 1QVAA 4Q02A 4ESVA 1LY1A 3H4MA 4BLTA 4URVR 1PLLA 1W46A 3ZQJA 2IF2A 3W8NA 2WV9A 3GJXC 3LW8A 2OV2A 4B3DA 4YMSA 1XZPA 1B0UA 1OYYA 2PZFA 2IYYA 4Y0VA 2ZSFA 4K81B 1G1MA 4P31A 4ACBA 2C99A 5FUVA 1U94A 5F98A 4JVLA 4O2LA 4M2LA 1AQYA 1EWQA 1RIFA 1JALA 1E9RA 1NVVQ 4X8MA 1KY2A 1WMSA 1MABB 3IQWA 4JLJA 2BBSA 2WJVA 2Y8EA 4JMPA 5B2ZA 4NYIR 5KU1A 3EZ2A 1JNYA 1HY3A 3TNFA 1X1RA 2QP4A 3THOA 3WP0A 4B6FA 1FMLA 4OQLA 4QNMA 3D6TB 3THYA 1YKSA 3RNLA 4AC9A 5JS8A 4TL6A 4CF7A 3LWNA 2B7CA 2W58A 3BB1A 3I92A 3ZH9B 2BDTA 1BO6A 2RGAA 1BMFA 3T1OA 4M1TA 3JVVA 5DIFA 3KQHA 2BIFA 3AQ4A 1OXXK 4GMXA 3R9IA 1KI2A 4O0MA 4ARZB 3P20A 2ZRGA 4HEJA 5AUPB 2FF7A 2ZVPX 3EZ7A 2XB4A 4IOLA 3A1SA 3AB3A 4E22A 1KJYA 2R65A 2CBZA 3FGNA 4M21A 4US2R 1QHXA 5GJVC 2O8EA 5FTKA 4YLGA 1P4SA 5KOYA 3HYTA 1BOFA 1E2FA 5FOVA 3K0FA 1NIJA 4C3ZA 2J0QA 2VP0A 4YMTA 2GJ9A 5JSZB 1L4YA 4HAYA 1DE0A 1QHSA 3BGWA 2EVWX 4A2PA 4QNRA 3AVTA 2V55B 1F2TB 2NIPA 1AK2A 3RC3A 2FN4A 2QQ0A 1KK1A 2F1JA 5E95A 2ZANA 1P9NA 5KSOA 1XJQA 1ZINA 2IYVA 4HZUB 4RVCA 1GTVA 4JZKA 3K9LA 3WYGA 4M9ZA 3GJ5A 1XMJA 2OESA 5IF9A 2GCOB 3B1VA 3CF6R 3ZZTA 2ZRFA 4CIDA 1BIFA 4NYMQ 1FX0B 5BN5A 4LHXA 3GEHA 1XEWX 1VTKA 2VH5R 4A8JA 4Q7LA 4Q4JB 4B44A 1G3IA 1Z2AA 1E96A 3THXB 5CK4A 4C2TA 3MUFA 1E32A 1JR3D 3RSOA 3EIHA 3IEUA 4PFSA 1YJ5A 4BEBA 2F43A 1CRQA 3X1YA 4DLXA 4XD7D 3QF7A 1IN6A 1VKJA 4Q1AA 1NY6A 1N6LA 5JCPA 1DAHA 3K9NA 1PJRA 1ZIPA 3WBJA 2X8AA 2VP4A 4EQ6A 1ELOA 3PG5A 1IN4A 4JLAA 2B92A 3RLFA 2IX3A 4BWYA 1TF5A 1GKYA 2PX3A 2WJHA 5C18A 1U8YA 2QNRA 1LTQA 3KUCA 4JSTA 4A0RA 2JJ8A 3IIMA 3Q7QA 4RCZA 5EXXA 4B47A 1DARA 4L5BA 1X6VA 3PEUA 4Q4AB 3PUVA 2D74A 4JIMA 4Q47A 1YZUA 4M4SA 1W36D 4NBSA 1TU4A 3NH9A 2B21A 1Q44A 1KI4A 3K0SA 4EPVA 4LJAA 2P2LA 1OV4A 1ZD8A 1L7VC 2RB4A 4L4UA 2XXAB 2AWNA 3WY9A 2IYRA 4P0TA 4QJ5A 3SQWA 3GLIB 4CT5A 1OYWA 2FH5B 1T3SA 2W0MA 2Q3MA 4TSFD 2ZUBA 4ZKDA 1VG0B 4AK9A 2N46A 1KO4A 3B1XA 4PQRA 4IRUB 3TJZA 2R6FA 1KDRA 2V8OA 4JBXA 1S3GA 4RZXA 3OFNA 3ZIAD 3BORA 1GITA 4LV5B 1KO7A 4XVRA 5HE8A 1I4DD 2FG5A 2ZRJA 1TEXA 4I1UA 3QE0A 4A92A 3F0TA 4HAZA 2OZEA 1TX4B 3QXCA 1XD8A 5FL7D 2V6JA 5CLLA 2RGEA 4DLYA 1XF9A 2IS2A 1Z0IA 2HEIA 1NVWQ 2QA5A 3HR7A 2OFXA 1DAIA 2CDNA 1P9RA 5FH9A 1U98A 2Z6VA 4B74A 2OCAA 1J8MF 1UEJA 3H84A 1I2MA 3QQ5A 3TKLA 1CP2A 721PA 1Q1ZA 4C7OB 1NVVR 2GBLC 2J1LA 2JASA 1RFLA 4MRSA 3V00A 2ZJYA 5EE0A 3T12A 4LGMA 1F2TA 4IFBA 2VA8A 1LS6A 2YWFA 3PVSA 4TTPA 3I72A 1CJUC 4HZUA 2JIZD 1G7CA 3U60B 2XB2A 4D4JA 5C1BA 5GJBA 1ZNWA 3F8TA 4FN5A 2A2ZA 2WZQA 3BK7A 4B3CA 3SQXA 3PEWA 1FX0A 1SGWA 1G8YA 1NN1A 3D7MA 2DFLA 2GEDA 3L43A 4RD1A 4QBFA 2CJWB 4B32A 1NKTA 1P5ZB 2AK3A 3GQBA 4Q4JA 2OCBA 5FTMA 4PAOA 4PTLA 4DUGA 3ADBA 1F60A 3GFTA 3I73A 4Q18A 3S1AA 2V54A 4Q9HA 4A15A 2AFHE 3AVOA 3VX3A 2J87A 2ZI9A 4QRHA 521PA 4JLKA 1IY0A 1DAMA 1R5OA 3CIOA 3EZ6A 5EXPA 4U5XA 4C30A 1FUUA 2JLUA 2WWFA 4JLOA 4F4IA 2XNSA 1DELA 2XOKA 3ZLJA 1N0VC 4S35A 3KTAA 5JBQA 3CF0A 4OI2A 3RYTC 4F38A 1S2MA 3NBZC 3ZZUA 2GRJA 2QEQA 3UPUA 2QAJA 5BN3A 1S9HA 3GLIE 4JS0A 3BJIC 1FTSA 4FWIB 2ANCA 3U61B 2CNWA 4NYMR 1OE0A 4Q4AA 3U3RA 3B6EA 1A1VA 3UK6A 2Q3HA 3ZVRA 1D5CA 4QM7A 621PA 3QSYA 3AKDA 4UJ5A 1L2TA 4O3MA 4FCVA 4Q9LA 3THWB 2FWRA 4ZCIA 1G16A 3A37A 3CONA 4BFVA 2O8FB 4LOAA 4X8LA 1DADA 3FKSA 2ZS7A 4YONB 3HPRA 1U81A 1R7RA 5AR1A 2ZRIA 5KSPA 5H1YA 3RS4A 5DYGA 3RWOA 4NCHA 3P1JA 5GJWC 5HCNA 4LJ7A 2BCJQ 1OIVA 3HU3A 1XXHA 2GHIA 2P6NA 2PCLA 2ZUCA 4BE7B 3BFKA 4PC2A 2FEMA 3U3MA 2FEOA 2O0JA 1X8JA 2DPXA 2OT3B 4OHVA 3IQXA 4NE2A 1MH1A 3TR0A 4DDVA 4QJ3A 3LA6A 4AWXA 1XCPA 2BJVA 3Q5EA 4ZDWA 2ODNA 3QXXA 4YMVA 2FJUA 2REBA 3IBYA 1ANKA 2QM8A 2HYIC 3TR5A 4C0HA 5HKKD 4ERNA 3EPKA 2EFHB 4FMBB 3VMFA 5M04A 3AF0A 4GRAA 3BH7A 4LV8B 1CS4C 5ANRB 3C41J 2H7VA 4DJTA 2QGNA 1G291 3T5DA 3VTKA 5HTKA 2UZ3A 3UANA 1E2NA 1X1SA 1SVWA 1RKBA 3ZD6A 3TH5A 3GCGA 2C03A 1DG1G 2G3YA 1TF7A 3FHTA 3R9WA 1QHHB 3F5FA 3GFOA 1H8HD 2YKGA 4C7OA 4QKQA 2HUPA 2PT7A 3CWZA 4RFSA 3UMRA 1XPRA 3MLEA 3QUSA 5B64A 4B3XA 4RSGA 1BS1A 3PEYA 1JQJC 1KAOA 1TUIA 3X1ZA 1NBME 1Z0AA 2IYTA 5SZHB 1KDOA 4M53A 1KSFX 2D2EA 3CLVA 4G3XA 3WNCA 2CEAA 1NLFA 3T1TA 4D81A 2J5XA 2JLQA 4LYHA 2VP6A 5FI0B 3B60A 3CW2A 1ZYUA 3BH0A 4Q5IA 3IILA 2NO6A 3TIFA 1U0HC 2G88A 4MKGA 2CJWA 1T3LA 3A4MA 3TRFA 3FFBA 4LC1A 4A0FA 1VCIA 5AUNB 4TN1A 1IJEA 1KAGA 3AKCA 1R5NA 1P2TA 1JB1A 3NBYC 4OHYA 1FP6A 2BKEA 1GDDA 2F3TA 1E0KA 2YC4C 2J7PD 1E2GA 1G9XA 2NPIA 3MWKA 2IA5A 1W4RA 3EARA 2WM9B 4L9SA 5JJLA 2G77B 1GZSA 1Z6TA 1P6XA 3SE0A 3TSOA 4V02A 4EKDA 3BC1A 1C4OA 4F4JA 2QMOA 3I62A 4JL6A 2AHOA 2R9VA 4FMCB 4JJZA 1F6BA 2CL6X 2OXCA 5DO9A 5KDLA 4DDUA 2VSOA 1D2EA 4G1UC 2XJ9A 3CM0A 1FQJA 4S2EA 1KI7A 3R8CA 2BBWA 4C0SA 3O8RA 4RJLA 2OXRA 1HURA 2J3EA 4NCNA 5B30A 2XAUA 2NMVA 4BLQA 3THWA 4HB3A 1FMJA 1NMYA 4RD4A 4CW7A 1OHHA 4TLEA 2O8FA 4OQXA 1FOEB 5JRJA 2QTFA 3AP2A 2XSZA 4DDTA 2ZR9A 3P26A 4CEJA 2ZVQX 4RZ3A 3TBKA 1M6NA 2N42A 2MSDB 4YDSA 2OCYC 1G7RA 4TT3A 1LFDB 4XVUA 1VPLA 4OK6A 3AP1A 2W6JD 2ZEJA 2XNDA 3PCRB 1Z63A 1D6JA 1ZNZA 4LBVA 4HI0E 4HDOB 2IYQA 3MFYA 1E2PA 1XBTA 1ZC3A 3MG9A 4CRWB 5FI1B 1XTQA 4DXAA 5L3QB 2FPLA 3KUDA 3U6KA 2OBMA 3A8TA 3KKQA 3OIVA 4PPQA 4U7DA 4QGHA 1E79D 2DYKA 3C8UA 4P3YA 3QPVA 1LVGA 2W6IA 1E9FA 2C77A 2YINC 4PR0A 4KFUA 4MYCA 4Q48A 1G8HA 4RKFA 1DS6A 4MGZR 4NMMA 3V4RA 2B8TA 1AN0A 4TYWA 2O8DB 4UNQA 5DYIA 1KI6B 1KO5A 5EP2A 1H8EA 4JKIA 2OCPA 4MRVA 2PLRA 4DCNA 2H57A 4YMUA 1QHIA 1GP2A 2FSIA 1EX7A 2FZ4A 3LH5A 2YC2C 4PO9A 2BC9A 1N5JA 5KNBA 2X2EA 3SEAA 1QG4A 4V0KA 1RYHA 3AP3A 1QDEA 1HA3A 3ZQ6A 2GZHA 1IJFA 1W0KA 1P2VA 1CIPA 3CR7A 3X2SA 1UAAA 3WHLA 3DL0A 1IAQA 1L4UA 1NJGA 4Z51A 1E94E 1BH2A 2MMGA 3AGPA 2UKDA 1COWD 2RGXA 3NBXX 1JR6A 2GXSA 2YHSA 4KSBA 3T5GA 5FTNA 3HP1A 2HT6A 3MD0A 4AURA 1P9WA 2OO7A 4I1SA 2DFKB 3B85A 3QOFA 1A7JA 2R6CA 1GG2A 1VG1A 4NYIQ 4LC0A 5FL3A 1GL9B 1ZM7A 3RS5A 4AG5A 3VR6A 2WTUA 2WJJA 3NC0C 1E2KA 1GRQA 2BBOA 1GL6A 2CK3D 1ZUNB 2OILA 1SKYB 4EPXA 1AS2A 1EX6A 3CB4A 4G5SA 4GP6A 5EZ6B 1A82A 2K5UA 2FGJA 1XPOA 3L0SA 4AYXA 1UBGA 2ZTSA 2GESA 2VTKA 3KZ1E 4AKGA 3GP8A 1HTWA 3M4YA 4AG6A 4G0NA 4TWZA 4Z54A 1E2LA 1IXZA 1ZCBA 3RAPR 2QBYA 5B58C 5JRZA 4QBHA 1S3SA 5EZ5A 1FPMA 4Q4HB 1W4CA 4N3NA 2ZXUA 3B7GA 4XVQA 4MQBA 2HF8A 2JAQA 2Q3FA 4D26A 1II8A 3KX2A 2W2VA 1XZQA 2ECKA 2BVNA 3OE7D 3SR0A 1IHUA 2WSSA 1KSHA 1AJEA 4KFSA 3DHWC 3LXRA 4US0R 1BKDR 3DVLA 2W2XA 4BLOA 1UDXA 4EFNA 2JDID 3CPEA 2JJ2A 1PLKA 2A7QA 2MMCA 1KHTA 2VP5A 4AKEA 1RVDA 4ABYA 1TMKA 1XPUA 2CCKA 3SYKA 1NN3A 2P6UA 3QEJA 4Q9IA 1KI8A 4WA7A 4YXWD 2XTMA 1G6OA 4J0QA 2G1JA 2RH5A 1GAJA 3MCAA 1K5GA 4OHXA 3ZVNA 4QHTA 4CGZA 4Q01A 3V4FA 3CRQA 4TQ9A 5DI3A 3REFA 2WKPA 3BH6A 3FPAA 3QJYA 4TL9A 2O8EB 4PPGA 2PLFA 1NSFA 1S9DA 1Z8FA 4DRZA 2RGNA 4JLPA 1KK2A 5SZIA 4DVGA 2GA8A 4W5WA 4DLWA 2DB3A 1S96A 1E2MA 3KB1A 4G5QA 2JLVA 2GJAA 2CLSA 4ILEA 5FOUA 5FOTA 5JI2E 2IC5A 4DT1B 2FSHA 5SZJA 5CDFA 4QM6A 1IM2A 3HR8A 3LFUA 2GZDA 3Q3JB 1AS0A 5G40A 3NHBA 3DZ8A 3RRYA 4DLRA 2XZPA 1DAKA 1JBKA 2F6RA 3LQRA 4HLUA 1ZM4A 2CE2X 5J5CA 3QG5A 2FFAA 3M1IA 3NC1C 4ZDIA 1Y3AA 1D2NA 3NHAA 4TZ6A 4A8JB 5CB8A 3PUXA 3BS4A 4HAVA 4PZYA 2REOA 1N0UA 1NI3A 3VNUA 4W9MC 1R6BX 3TUIC 3I4LA 4OJQA 1R0ZA 1ZC4A 1JJVA 1XJ0A 1YZLA 2WHXA 3IPYA 5K8UA 3OAAA 5F9HA 1NP6A 1SKYE 3P32A 1VCMA 2A9KA 1KI3A 1SVSA 1ZRHA 3B13B 4DLSA 2DBYA 5LDDC 1UBEA 3UXMA 5JEEA 1VHTA 2VHQA 4OBEA 2XTNA 2QSZA 3KQKA 5K8LA 5FOXA 3WBKA 4URYR 1KDPA 1WBBA 2D2FA 4BECA 4DB4A 3VHLB 4BZQA 3U6BA 4P32A 2JJ1D 3CX7A 4QFMA 3MJHA 4PQYA 1AKEA 3LXXA 1SKQA 3CNOA 3I32A 2J7KA 2VHUA 1GSIA 3R20A 3LAWA 5E4FA 1J70A 2ZRDA 1GM5A 2RGDA 2CHGA 2Z5FA 5JHGB 3Q85A 4HLQB 5EE9A 1XRJA 3KQNA 1JEDA 2VP9A 3B9PA 3VR5A 2OBLA 4D4MA 1U99A 4XSHA 5BWMA 4JLVA 3BAFA 1UKZA 1E2JA 4M1YA 1NMXA 2CLCX 3ICEA 1WQ1R 3NBFA 2VEDA 4HUQB 5CM9C 3NKVA 4MGIR 2WSMA 5EE1A 5EXSA 2QPTA 2R2AA 5IK2D 4KBGA 1U8AA 4WAUA 3BIFA 5FFMA 3AVQA 2ZRCA 4Q4HA 3Q9LA 1R0WA 1KMQA 3KJIA 3PR1A 4DEXA 1XX6A 1DBSA 3W5JA 3LRPA 2XX3A 4A36A 1E6CA 3SYNA 3VR2A 4CDGA 3W90A 4XWKA 4DSTA 2ZRLA 1G64A 1D9XA 2EFDB 3QG1A 2VQSA 3KKMA 4C0JA 3B8HA 4IOKA 2IWHA 2QT1A 3ASYA 1Z0KA 3ZS9A 4KHZA 4ZCLA 2O52A 1E99A 2VSXA 1MR3F 3L8YA 2GJ8A 3KXIA 1CLUA 1KO8A 3W6NA 3LBIA 3VQTA 2V9PA 4A8JC 5A4JA 3KJEA 3ICQB 2RHDA 3CH5A 1YVDA 2GXQA 1NBMD 1EFCA 1J7KA 2C9OA 5IDVA 2P5SA 3AKYA 1EFRA 2HYDA 4DT1A 2IT1A 1VDZA 3B2EA 2XJ4A 3CO5A 1T3HA 2DWPA 4DCTA 2F1RA 2WKQA 1JPNA 1NG1A 3OF5A 4UNSA 4L9WA 5L3SB 3LLUA 4E07A 1IY1A 1HV8A 1XTSA 2CCGA 3TQFA 4Z1MD 4I4LA 4TZ0A 3C5HA 2VYFA 4FMDF 2EYQA 1GL7A 1OKKD 1TADA 3CRMA 5CYOA 1TL7C 1WA5A 3TVTA 3IO3A 2Z4RA 3PJRA 4OJKA 1KKLA 3RRMA 1OIXA 3S1AB 3AF2A 3BFXA 2IYZA 4ASUD 3LO5A 4PSKA 2CXXA 4LV6A 6Q21A 1M8PA 1KMHB 1W0JA 4OI1A 1G8PA 3FMIA 1E0SA 1KK0A 1KNXA 2A78A 2HXYA 4IDPA 4QGAA 3AUYA 3MJRA 4BRUA 5F3WB 4US1R 4E5UA 2QTVB 4FW9A 3OEEA 4IDNA 3KTAB 3TE6A 1X3SA 5FPKA 2I1QA 1GFIA 1E1RA 4NDZA 3K09A 3EPHA 2PJZA 2WIAA 2ZYUX 4GP7A 2I3BA 5BN4A 4JJKA 3SJBA 3A58B 4EIWA 1FW6A 3C16C 2YWEA 2ZAOA 5CK5A 2V1UA 1JXMA 5J4LA 1SXJB 2GAOA 3LV8A 1NLZA 2ATXA 2JLWA 1CEEA 2X2FA 2QP9X 2Z83A 3QKRA 4ZI2A 3LVRE 2ZJOA 1T8TA 3PEVA 4HUQA 1CJVC 3K9GA 2OLKA 2JCSA 4Q7JB 1G3RA 1HH4A 1KZ7B 2FA9A 2OSBA 4WIAA 2VHTA 1YRBA 3GEEA 1JAHA 3NTUA 1XXHB 5GVRA 1J99A 4F93B 4AD8A 2QY9A 2W83A 4CVNA 5G53C 3K0EA 2HXSA 3EW9A 1QBKC 1KK3A 3FE2A 1ESNA 2ZYVX 3G82C 1YQTA 2GK7A 2P0EA 3PUZA 2O0KA 4LRWA 3FDIA 1IOZA 3QKSB 1JQLB 3BD9A 1Q57A 3ND8A 1E0JA 3KXLA 2A5YB 2DWQA 2H8KA 3DOEA 5JCZA 3CNLA 1IONA 3B1ZA 4JT2A 4V0MA 3ZZ0A 1K5DA 5FOSA 5TV2A 1YHNA 1QG2A 4RZ2A 1X8KA 1D9ZA 2CE7A 2EWWA 1F2UA 1ZU5A 1E3MA 2IF0A 3DDCA 4MKHA 2ZI6A 1CU1A 2QG6A 3PV0A 5KYKA 2IEZA 2YZ2A 3QNUA 1EK0A 4AIIA 2BBTA 2HLDD 2BMEA 1T6NA 2OLJA 2A5JA 3A1VA 1P62B 3Q7PA 1S1CA 1DPFA 2WWWA 4RFSB 4RD6A 2C98A 4TQUS 3TQCA 821PA 4IDQA 3H86A 3W6OA 1GNQA 4D25A 1ETUA 4EJSB 1R8SA 3DZDA 4IJMA 1EESA 3EG5A 4DLZA 3SDZA 3KDSE 1SULA 3R9XA 3E1SA 5DNYB 4PZZA 5L3SA 4R2IA 2QE7D 1H65A 2ZRHA 4CZ2A 4Z8YA 1OB5A 5JS7A 5AUQA 3MWLA 1WP9A 3ADKA 5G3ZA 2YVUA 1SVLA 4XTRA 4B3BA 2J0SA 1TU3A 5LD2B 5KO2A 5DISB 3WMEA 4TMZA 2VSFA 4FIDA 3Q5DA 3O8BA 1FNMA 3QIAA 3QBVA 3GLHA 4DLVA 4MRPA 4KBFA 4IEIA 2F55A 1W2HA 3REGA 3B82A 1KMHA 4R7ZA 3WMGA 1P7CA 1SXJE 2AXNA 5LPNA 2YWHA 2BM0A 4B33A 2EW1A 4WZBE 4RFVA 4YDHB 2YJTD 4Z8XA 1VYUA 4A82A 2XGJA 4DIEA 1W48A 1HT1E 2WPDD 4Q21A 2JEOA 4Q66C 4DDWA 1ZJ6A 1RRFA 5J4KA 4QHSA 3EZ9A 4D4LA 1OXVA 1KJWA 4LHZA 1LF0A 4KAXA 1NVUQ 4UNRA 3IIJA 3DKPA 2F3RA 1XXHE 3TAHA 3A36A 4KSCA 3U7EB 2CL7X 2C9YA 2B6HA 2V7QA 1AS3A 2SHKA 1ZP6A 4KLZA 3NIBA 1ZIOA 2VL7A 1XD2A 2PEZA 1JXOA 5FTJA 3LBHA 3RS3A 4D0NA 1SXJA 3X1XA 1N6KA 1VG8A 2WMNB 1S8FA 1T5IA 4NYJQ 4IOMA 3I3SR 3T61A 3GLGB 3IKJA 4DB2A 4CEJB 4KFRA 5DN6D 5TMPA 1NIPA 1GUAA 5GADl 3AM1A 3EXAA 2JA1A 3TMKA 2O8BB 1HE1C 2RAPA 5K8IA 4IVRA 1N6HA 1ZM9A 3T1VA 4OK3A 4LZZA 3FYHA 5CIWA 2YV5A 2OFWA 2HCBA 3QKUA 4FCTA 1Z5ZA 2I4IA 4TLAA 3SZRA 3I61A 4Q9KA 3MRSA 4BFZA 1YU9A 4LHWA 3OEHD 4ZIRA 3EZFA 4IFEA 2NZJA 3GJ6A 3UG6A 1A2BA 5CLQA 5FBRB 1E9BA 2Q21A 1UM8A 5HPYB 1S4QA 3VNVA 2GVZC 1FFHA 1G4AE 5BXQC 2Q9CA 4A6PA 1IXRC 1E1QD 4GOKA 1ZMXA 1M34E 1RW4A 4JL8A 4FD2A 3QKSA 1DG3A 4NONA 2FDCA 1ZW6A 1TUEA 3OESA 1JI0A 5JLJA 3D31A 1NN0A 5GJCA 1OH7A 2CVHA 4HDCA 2KBEA 1ZUIA 1XMIA 1O3YA 1LW7A 2FFQA 4NZYA 1UF9A 4W7SA 5G41A 2WICA 1Q1BA 4URZR 1JPJA 3O47A 3C14C 3SJZA 4D4KA 2DHRA 3ZD7A 1X8LA 2DY1A 2VBCA 5LD2C 1YZQA 1P73A 1MO6A 2AWOA 4NH0A 2ZJAA 3U3JA 4PXAA 4D80A 4DEYA 2KB0A 4G5GA 2J46A 4EJSA 2X19A 1R0XA 2FZLA 2QAGB 1K6MA 5DI9A 4ZPXA 3U4QB 3WHKA 3TK1A 3K0AA 4HDQB 1E2EA 4AYWA 2WBLC 3AF3A 1E69A 4IKEA 4BPBA 3L0PA 1KNQA 1FNNA 1PVOA 2NG1A 4QC2A 4XTCS 4X8OA 5A5GA 5GVSA 2ZJZA 3N5CA 1XEXA 1CJTC 1LF5A 4FI3C 2Z0MA 3U7GA 3AF4A 2ZREA 3SBEA 5EUQB 2IYLD 4IHQA 4KVAA 4KODA 3WRYC 3I5YA 3SN6A 4AKIA 1U2RA 1BMFD 1G19A 1GWNA 2F1HA 2QBYB 4XIGS 1CULC 1HUQA 5D3QA 4M1KA 3HWSA 5KSZA 5KNCA 1DTSA 4V0LA 3OIUA 3PQCA 3ZVLA 2GDJA 4FXPA 3NDBB 3K1JA 2Z4SA 4LBWA 2B8WA 3B78A 1RJ9B 1II8B 4AI6A 4GOJA 2F7SA 2QPOA 5SZKB 5KHOC 2QROA 3IEVA 1TNDA 1XTRA 4GI7A 1UKVY 4W5JA 3KXKA 1NSTA 2AX4A 5G3YA 4B2PA 3P27A 1IN7A 5TXGA 3ADDA 1US8A 1JR3E 4HB0A 2IS4A 2BMDA 1RE0A 1Q1EA 2P65A 4E03A 1N3BA 4EUNA 4F7WA 2ZE7A 3ZJYA 3U44A 4TYNA 4TYQA 2AN9A 3SNHA 1JEEA 3PITA 4HYYA 3GLGA 4AKHA 3P4YA 2G0TA 4X8HA 5FPYA 1NL3A 3RANA 3TW8B 2O8BA 1UKYA 2ASEA 4LI0A 3LQQA 1MRSA 3VKGA 1E98A 5JJIA 2J45A 2FSFA 1XTKA 4DZZA 5IRCD 1Z6YA 1N6RA 2NO7A 5DI3B 3R8FA 5F9FA 1KKMA 4KFTA 5JZVA 1UDWA 1QZXA 4PHTA 1UPTA 3IHLA 1JR3A 3MAAC 3MGCA 1Z28A 1W1WA 4ZDKA 1Q20A 2WWYA 2VIIA 3EWAA 3K0CA 2ANBA 1E9SA 3OIYA 2QTHA 2G0NA 3SJAA 4JLDA 4DCSA 4XD7A 4C0BA 2REXB 3AKEA 2ZYTX 4DSOA 3AVXA 1P61B 2IYWA 4HLCA 4IW3B 1AKYA 1E9DA 4LHYA 4HAWA 3A1WA 3W8RA 3EC2A 1TQ6A 2LWIA 4Q7MB 1LNZA 3CRVA 4CEHA 1RRGA 2R6AA 4NYJR 1QHNA 4IDOA 2OUKA 4WVFA 5C2JB 3CF2A 1VCNA 2H92A 5H68A 4IOJA 3BB3A 2ZROA 4LJ4A 1JJ7A 4B2LA 3DKVA 2GF9A 5BW8A 2ZRMA 2PMDA 4U00A 3GPLA 2P3SA 1UBFA 4IDHA 2PH1A 5FBVB 4BUJA 4JVMA 1QVRA 1E0AA 4EPWA 4HATA 5E7IA 2WVJA 3LD9A 5JHHB 1U9IA 3DMNA 3LVQE 1CR4A 4MGKR 2ZSDA 5A0FA 1Z0FA 4R9UC 2H18A 2QAGA 3U4QA 1DAEA 4TTQA 1JAIA 3LDAA 3U2QA 3ECCA 4LWZA 1HQYE 2CVFA 4JBYA 1GVNB 4TSFA 3AGQA 4NCJA 3RHFA 3A1TA 4RZUA 1IY2A 2I1VB 1RYFA 1WBDA 4MGYR 1P72A 5AJYA 3PENA 4P33A 3QENA 2AD5A 1OH5A 1U0LA 2OHFA 2Q0HA 2H16A 2YOHA 1WF3A 3I1FA 3OFND 4JBWA 1FL9A 3ZIAA 2C96A 2IYSA 1P3JA 2QGZA 5J4YA 4PSAA 4PSVA 4MUAA 2WAXA 4E09A 1ZM2A 3W5IA 3VKWA 4M9QA 5FUXA 4XWAA 1U8ZA 5LB2A 2J59A 4POAA 4P4TA 3CZPA 5FL7A 3CWQA 3QY0A 1M7GA 3SFZA 1VMAA 1RJ9A 4N1AA 4Q1CA 1E2HA 3UG7A 1HE8B 5FR2A 2LKDA 4IXNA 5DHFA 5HZKA 4PPNA 1KSGA 4JT4A 4UKDA 5EUMA 5C46F 3WXMA 1WCV1 4EDHA 5JMTA 3AVYA 2RGNC 4KJZA 5DHAA 3OHMA 2X1VA 5J40A 5C4GB 1VG9B 2ZM5A 2CHQA 2GVDC 1YZTA 4WW0A 1G5RA 3VKHA 2R8RA 4TL7A 4TMTA 2BEJA 2HDNB 4TYPA 2O8CB 1UBCA 4B3GA 1GRRA 1TEVA 1N5IA 1VYTA 2D7CA 2WWGA 3GD7A 3PFIA 2JIZA 3RS7A 4JLNA 4HLUC 5CDFE 2E87A 4LJ6A 3GJ4A 2EWVA 1G21E 1YZGA 1Z6AA 3K9HA 1TPZA 3EIEA 2FFBA 2KSQA 2W00A 2R62A 3HYRA 1TTTA 1EWRA 1NJFA 2F1IA 2AL7A 2PEYA 2NO1A 1NVXQ 1Z2CA 4DUGD 1KGDA 3O8DA 3RRZA 3I8SA 4LY6A 4KLNA 2WJYA 1Z29A 2VRWA 2GF0A 2WJGA 1Z0JA 1OIWA 2ZI7A 3BB4A 4P4SB 5AWFC 3BERA 4PAQA 1W44A 4Y0AA 4YC7A 4XWOA 5TB5A 5IHPA 2UVQA 1JECA 2ZSAA 4ZO4A 3UMFA 5BYJA 1MRNA 4NCKA 2JLRA 4EPTA 3W3AA 3NEYA 2FPKA 4KXFB 4DC9A 2XOKD 4JVSB 3FHOA 2FV8A 1XNJA 3QBTA 4F91B 1Q12A 1RPZA 1LS1A 4PHGA 2RCNA 2RGCA 3DOFA 2FOLA 2ZJ5A 3TUJC 1P2SA 4PO8A 1FUKA 2YOFA 4PANA 3AUXA 3UWKA 2BHRA 4GL2A 2CNWD 3RWMB 2QI9C 3FMOB 4W5HA 3ZVMA 3PUWA 1M74A 4C2UA 2DR3A 3QVUA 4NU0A 1W47A 2YNMA 5EP3A 1PUIA 3SJCA 3FKSD 1G17A 3BBPA 1KYIA 3PUYA 1W2GA 1GNPA 4N0EA 3CRW1 4DLTA 1CKEA 4TLDA 4BZXA 1KIMA 4WZAE 4OYHA 2KI5A 2QZ4A 5EXTA 3ZYCA 5JWOA 5L8VA 3SFVA 4RD3A 2ZRBA 4RD0A 4M1OA 1ZNXA 3DMDA 1UFQA 4LUCA 1FP7A 2BM1A 3IBGA 1XB2A 2ATVA 1ESMA 4LHVA 1E9CA 3UKDA 1GILA 4WXRA 3VR3A 2H1LA 4B34A 1KTVA 3KKPA 1DVRA 5CYPA 3FTQA 4C0KA 2JLSA 4V03A 2D06A 4ON9A 1Z6GA 2NGRA 5JECA 1KOFA 1YRAA 4H9GA 4K46A 5HKKA 3ZGXA 2H17A 4LYJA 1YR6A 3P4XA 3QKRB 3W6PA 4ITRC 3LNCA 1YZNA 5J4VA 3DO6A 4LPSA 3V9PA 1E9AA 4HLDA 1IQPA 2GNOA 5FBWB 5LB4A 2C04A 1OXUA 4OL0A 3A6PC 3SS8A 2Q9AA 1WRBA 1QF9A 1NN5A 3KFXA 2A5GA 4R98A 3CBQA 3T06B 1MKYA 2G6BA 4M9XA 3KKOA 1OF1A 4QXAA 4B35A 1MO3A 2ZSEA 2ERXA 2QMEA 1YE8A 4JL5A 2QT0A 2X77A 5TVKA 5FPTA 2AKYA 3NDPA 1H8HA 1C1YA 4A6XA 3FOZA 4KO8A 2HV8A 1II9A 1ONBA 1TAGA 5L3VA 3MMPA 1OXSC 3T34A 3DM9B 3VR1A 3W3ZB 2KBFA 3FWYA 2O8CA 4Q7KA 2BWJA 3X1DA 1WXQA 2R6GA 2ZQ5A 2OAQ1 3GMTA 4V0OA 5DSZA 1CJKC 2ZRNA 5FBLB 3R7WA 4MDEA 3BE4A 3ONWA 2J0UB 4MA4A 1W7AA 4Q4LA 2QENA 1AGRA 1XFAA 4PZLA 2CHVA 3B1WA 4LJ8A 1EXMA 1F2UB 1N6IA 3GJ7A 1PZNA 3M6AA 3F3YA 2BCGY 4TMWA 2QP3A 5K8TA 4DLUA 1SZPA 2ODBA 2XTZA 5LBIA 3SU8A 4URWR 1F3OA 4JLMA 2IUUA 3SC3A 1TF2A 3CKLA 1XEFA 4P4SA 2J7PA 1Z22A 4GDFA 2WJIA 2ZRAA 4JKYA 2HCJB 1T91A 3TAUA 1G8FA 1SQ5A 1YR7A 4BASA 2QMUA 4B71A 4D2IA 4RKEA 3K70B 3EIQA 1ZM3A 3ZDQA 2LCFA 2ZETA 4NPHA 1E9EA 2BJWA 5KSYA 2Q9BA 4I1VA 2F9MA 2QM7A 1G18A 1GIAA 5E7JA 2IHYA 3K09C 2JGNA 4A0HA 4UXHA 3X1WA 3B1YA 3JVUA 1S0UA 1UADA 4QJ4A 2BOVA 221PA 3NVAA 3L82B 3U7HB 1WE2A 3GLHB 1OFUX 3HU2A 4ZKEA 3LBNA 5CJ2A 2N1BA 4TLCA 1CRPA 1OHHD 4NKRA 4URUR 1G3UA 1N0WA 1OFIA 1I4TD 2XSZD 4MYUA 4U02A 5HE9A 1B23P 1RRPA 1W5SA 1Z06A 4TT3D 1XCMA 2C8VA 4MKFA 5JWHA 2XNDD 4BLRA 4Q1EA 4A9AA 4EPYA 1Q1QA 2W6JA 1R0YA 5KTYA 4TLBA 1SVMA 4XH9B 1AGPA 3QI2A 2C78A 4OI4A 1Z83A 2IBMA 3IPXA 5JI3E 5AUOB 3GEIA 3QPUA 1E79A 1N6PA 1ODFA 2W6ID 4N0DA 5DE3A 5J47A 1OFTA 1CXZA 2PL3A 2ZRKA 2AFIE 4TMXA 1XD2B 1E2IA 2H5EA 2V4ZA 1OJLA 2QUZA 5CM8B 3CPJB 1M7HA 1H8ED 5FBQB 2GKSA 4HUTA 3O8CA 3TSWA 2DFTA 2QMHA 2IS6A 4G5RA 2OFOA 2KJQA 4LJ5A 1QHYA 4LYFA 2EFEB 4ZCMA 3U3KA 3IGFA 3RS0A 3L2OB 3KJGA 2ZI3A 4V0ME 3RDPA 1W0KD 3WMFA 3EASA 1OB2A 2BV3A 5EE5B 4ZIRB 1G3MA 4MRNA 4B6EA 5D3MB 2WMOB 3HDTA 3KFVA 4LDJA 1N2CE 4WBSA 3BWDD 4A4DA 3RC8A 1XU4A 5EJEA 3KQLA 1S1MA 1J8YF 1Q3TA 3FB4A 5TARA 1COWA 1EFTA 4FMCF 2IL1A 5BQ5A 4BGDA 2KE5A 4NHOA 2DFNA 4KITB 3K70C 3QPWA 4KV9A 3TSZA 1KI1A 1N6NA 3U3OA 1OH6A 2GAAA 4I81A 2ZR7A 2J0UA 2RHMA 4GSYA 4H1UA 4HSEA 4PX9A 4QL3A 3CR8A 4FINA 2PZEA 1RRCA 2ONJA 1MABA 2FFHA 3LW7A 3J81k 4F4CA 2OG2A 4OI0A 4MRRA 2ZJBA 4BFSA 5IT5A 1M2OB 5FR1A 2BKUA 4DCVA 2CK3A 2VHJA 1TQ4A 4B48A 4NP6A 1XWIA 4WOPA 1HQCA 3DPUA 1P75A 4Q00A 2V6IA 5UKDA 1PV4A 1W5TA 2WAYA 2IUTA 4WZ6A 2L0XA 1ZVQA 1Z08A 2ZR0A 3GLHE 2PJRA 2B7BA 4WXPA 5P21A 4ARZA 4M1MA 4JLBA 4MKIA 4C4PA 4LSGA 2QRNA 3GLFB 1KZGB 3AH8A 3HU1A 3K0AB 3NWJA 1A4RA 3DM5A 4O2RA 3RABA 3C7KA 2FX3A 1ZCAA 2D62A 2WSSD 3OE7A 5KDDA 1KI9A 4JVNA 3GJ0A 4TQAA 1ZD9A 2GETA 3K8YA 4Q03A 2ZIAA 3CNNA 3LY5A 2ZJ2A 1XEXB 1XMSA 2JJ2D 5JSZA 4D0LB 4UNNA 2JDIA 1VHLA 1FZQA 1O87A 1PLJA 2QU8A 2ZI4A 3CX6A 2FE4A 1SXJC 4UNPA 1KY3A 2E1RA 2D4HA 4GBMA 3SHFA 2O5VA 1YR9A 1P2UA 1T9HA 2GCOA 2GJKA 1TQDA 4LK2A 4XOIA 3ZS8A 2ZS9A 4YXWA 4A2WA 3QF4B 3C15C 1Z0DA 4C0AC 1FQKA 3A4NA 3KQUA 4B2IA 1OT3A 421PA 4BQSA 4DHEA 4Q19A 4NL4H 1BYIA 2IEYA 3A4LA 2IS1A 2NTYC 3TGPA 3SHWA 4EFLA 2RGGA 3THXA 2FMXA 5AK0A 2QL6A 2VF8A 3C4JA 1R8QA 2RMKA 4DSUA 3ADCA 3GJ3A 3IDQA 2GBLA 4QGGA 1R10A 3SI7A 2FNAA 4B75A 1NKSA 1N5KA 1ZD1A 1HT2E 1US8B 5DLQC 4C0LA 4GMDA 3FMFA 2IW3A 3UWOA 1R4AA 1GKUB 5CB6A 5KPJA 1L8QA 1OXTA 4LBYA 2FU5C 2NO0A 3E70C 3U44B 4MDFA 4Q1BA 3AVUA 1HEIA 3AVWA 1G3QA 2FSGA 1MO4A 4K8OA 4TMKA 2GZAA 2OBNA 4MITA 3KL4A 4IVQA 3K53A 4JYBA 2O0HA 1GNRA 1P60A 4QBGB 1J90A 2G1KA 3VR4A 1N25A 2ZSBA 2P67A 4DIDA 4UQOA 5C4MA 2HT1A 1SHZA 1V43A 4L16A 1F48A 1PUJA 2ZITA 3Q72A 2ODEA 5AJVB 2JLYA 3TVDA 3OAAD 4M9SA 2F9LA 4TL8A 1MV5A 5D3MA 3G0HA 4OQFA 4MYTA 2BMFA 3LLMA 1G6HA 5EP1A 3BXZA 2QRZA 4P4UA 1NRJB 4EJSC 5TY0A 1T4GA 2XXAA 3VX4A 4FWTA 3NXSA 2JJ1A 4AY2A 2WKRA 3GLIA 4CEIB 1UKEA 2GEUA 4CEHB 4R71A 2VHCA 3GLFE 4BFYA 1EFUA 4M8NE 1Z3IX 3JZAA 2QQEA 4YMWA 4DCUA 4D82A 3CPHA 2V3CC 1T0JB 2BMJA 5H8WA 2CMKA 4FMDB 2A30A 3FMPB 2QSYA 2GEVA 5KNDA 1W36B 1IN8A 1OFHA 4PC6A 4CT4B 1R5BA 3A1UA 4G5OA 2ODWA 5E7MA 1DAGA
chains in the Genus database with same CATH superfamily
2WVGA 5IK2A 4F04A 4Y1RA 4B73A 5BSHA 1SD5A 1CLEA 2O7RA 2HJ9A 3D7RA 4OK5A 1E1NA 3M6MD 4II7A 1PR1A 5JG7A 3W7BA 3R4VA 3WYFA 1QYRA 2P2GA 4GYWA 1OW3B 1WUJS 4ZCQA 1VIYA 5EOVA 1NFRA 3EX7C 4DJ5X 3Q7EA 2I65A 3E81A 3HADA 3MWGA 2NSYA 4L2IA 5JVDA 3GT4A 3JV7A 2ZRPA 3GMDA 4EEKA 4RJTA 4B83A 5I7VA 5I45A 5DN9A 3FNGA 4XM2A 5EJMA 5IVKA 2C3YA 1FCJA 3IIKA 3NAMA 4DMKA 2Y0BA 5K9ZA 1C1DA 2GZ3A 1DRVA 5CB4A 3E2IA 4BYGA 4MW7A 4LCBA 3E22B 4EFMA 3G5UA 1BYUA 3UXEA 2AEFA 5IASA 1KH2A 4XD2A 2ZJ4A 4GPTA 1AO0A 3QF4A 2QNBA 5AW1A 1NMZA 3IDAA 4LDPA 2BFCA 2QVYX 1AZSC 3BZUA 2E9SA 3G7NA 4GR9A 3HZHA 1CTQA 2BFDB 2ZYWX 2QZJA 1O9GA 1YT5A 1E59A 1JJBA 3H19A 4IY1A 5ALUA 2X40A 2AYYA 2XHZA 2DPLA 1Z45A 2QLTA 3VU9B 3ETDA 3F6EX 3AI2A 3LU1A 5TQVA 1A5TA 5DPMA 3REQB 5IAOA 3SIRA 2QJOA 4P54A 1AKNA 1SIWA 4ZVQA 5H0IA 1QFXA 1Y7LA 2AMLA 3L8FA 1LEHA 1MEOA 1USIA 4GYKA 4RVUA 1XWFA 1U5AA 3R0QA 1Y5LA 4L7QA 4MIOA 1QKKA 4OKSA 1HRKA 4JBHA 3TIXB 1X92A 2NZXA 2NZ8A 3VMMA 4Z2AA 6REQA 4F3TA 1SXHA 3DULA 4C9BA 1C3EA 3MERA 1UJ6A 3DFZA 3EGVA 2XUQA 4EUFA 1ZK2A 4E4YA 2R66A 3HFSA 1YIDA 3QVGA 5EE3A 2NPFA 1ZRSA 3ZYCA 2CNOA 2OMEA 1TW2A 2YYZA 1K8RA 2G9VA 3DPSA 1WW3A 2AG1A 3C4VA 2XCSB 3CLRC 1NBOA 2E5FA 3KCQA 1LLQA 3NUGA 2PY6A 1PDWA 3L1VA 2PUGA 2OV8A 2Q3DA 1WSDA 5F2EA 4Z7QB 1HKUA 4JB2A 4ER6A 1T26A 4KQMA 1Q0UA 4QTXA 3M0EA 2RGBA 2DJ5A 3KNZA 3LIIA 3AVPA 3ULKA 1TECE 1OKKA 2DWOA 3R24A 4FM9A 2FGKA 3S3TA 1ZD3A 1M2VA 1PR5A 4XJTA 4CCSA 3ZWXA 3SNKA 3T3EA 4DYVA 4XWTA 2ZAYA 1F6DA 2CZCA 4UC0A 5AK6A 1E2BA 1EHYA 4UQPA 3HJTA 1W36C 4XGQA 3FLMA 3A9TA 3CINA 5EQTA 3WKBA 1VMKA 5AKZA 5IMSA 3T95A 5JANA 5HP4A 1I9GA 1SQGA 2GLXA 5BVGB 2XQGA 3RVSA 3QH4A 2EP7A 5AW9A 1K7CA 2OBFA 3HJNA 5AVOA 1O0SA 4FR0A 4W7HA 5CT9A 4BDSA 2VR1A 7MHTA 2XKAA 1T36B 1KZ4A 3HUEA 4R8KA 3W2TA 1FJGB 3ECSA 3FOFC 1M3SA 4KUHA 5JWRA 4LBZA 1E4YA 1E1RD 1R9JA 1VLJA 2HJGA 2ZI5A 3CRRA 3N7AA 4QOIA 4BCCA 1S2GA 1QTNA 3OOYA 4M1WA 1U2DA 2HHLA 3BM5A 4NBLA 4K9RA 4I1OA 5H3HA 4YAWA 4OGWA 3VZBA 1EK5A 3R5KA 4CF3A 2Z3ZA 1FDIA 5BORA 2DCUA 5JH7F 5KYNA 1LJLA 2H0RA 3U4IA 4V3CA 5IJZA 4KR2A 1JDZA 2PX0A 4HB2A 4KIFA 1WKVA 1ADFA 1YR8A 2CL0X 4N7RA 4RZIA 4C3OB 3H2BA 1O4VA 1Y63A 3CLUC 3HN7A 3GFQA 3I2GA 3PQEA 4AWAA 1L8OA 2POCA 3TGLA 3HXQA 1X86B 4L4ZA 3NHSA 4BNZA 1EP2B 9LDTA 3EPJA 2MSNA 1TM3E 4RY8A 3TDNA 5TDHA 2IE0A 3B20A 1QB7A 1CT9A 2QL7A 3MHPA 4KB5A 4N8EA 1HF3A 4R40A 4E12A 1E20A 2A5DA 3NEJA 1WHTB 3CVOA 1OI4A 2QTTA 5EJ6A 1USUA 3EVBA 4MTLA 3PQ2A 2R87A 1WUIS 3TXXA 3BRWD 4BWGA 2FW8A 4GIBA 4L15A 2VPPA 7YASA 2NX2A 1D2GA 1PE0A 5DCYA 5AJZA 5KUTA 4B7UA 3SWWA 2OVBA 5LZ9A 4A0QA 1RQPA 3WRXC 2QG9A 1JG6A 5EI5A 4A2QA 1OZAA 4HX5A 3PXGA 2TMDA 2WI8A 4B7XA 3GCXA 4QTZA 5F5LA 2QRLA 2GYVA 1M7BA 3E61A 5E8RA 5L3RA 5DH9A 2OXIA 1NOIA 2H4HA 1D2MA 3E82A 4BMCA 5ESXA 4CMKA 1X1EA 1YMQA 1SCUB 1U6IA 3T3DA 1SVOA 2D0OB 5FWAA 1XD9A 4GKBA 1B4DA 5JFGA 2W8ZA 3EA0A 2PSSA 3PPYA 3ZE7A 3ZJ5A 2ZBEA 4B6SA 2QY6A 1JGTA 3FBGA 3R0IA 4IVPA 1WUKS 1EZZA 2BFDA 2VQ3A 4URXR 3NWBA 3ONNA 1LPSA 2ZIWB 4BUZA 1K5PA 1M83A 3VU9A 1GQRA 1YQQA 1OX5A 1ITZA 2P5UA 1AT1A 4ZVLA 5G0SA 1RT9A 1U0JA 2LBPA 3AK4A 4QBIA 3S44A 5E3HA 1IEQA 2ORIA 4Q1DA 5BPFA 4CHTA 5GM1A 2X0RA 2FHPA 3L8HA 4I99A 1NRWA 1T8UA 3UC5A 1ZK1A 1KSJA 4B76A 1GHTA 4S1VA 2IV3A 1NZDA 3GFFA 4AZWA 5MF6A 3K70D 1NJ5A 3TVYA 2HDHA 2EJBA 2TMKA 4QAJA 2Z5LA 3QXJA 4V0QA 3I83A 2RKOA 1XI2A 3OQIB 3LFHA 1U0GA 1Z47A 3H2SA 3VYSB 4FB5A 4B3MB 4O3FA 2OFFA 2ISSD 3D7SA 4D8VA 1FDOA 2YYYA 4RMNA 4KVFA 4FWBA 2PT5A 1BWQA 3CH4B 4MR7B 2W2TA 1UL1X 1ZD5A 1HKHA 4PYOA 3J80A 4OO3A 4KPEC 1VYVA 4XPZA 2J4DA 3UKOA 4DY6A 3PSAA 4YCNA 3IPRA 1YF3A 2VPTA 2G17A 3O4RA 4HG2A 4LPKA 1CR2A 1Z2DA 2V0NA 1SM4A 5CA1F 4ARIA 2ZU6A 3H2YA 3QEOA 3THYB 1G41A 3DEFA 4I6EA 3IEMA 2NUTB 4GFDA 4HWGA 2W0SA 5TGZA 3ZNOA 4EJ2A 4MWGA 5HM6A 5FUWA 1H2BA 1F51E 1DG9A 1B43A 1UXKA 1ZH4A 4BQQA 3R5TA 1T1GA 2DUMA 3Q6MA 5J1SB 1UH5A 1R16A 1W4LA 5T64A 2GTPA 3ZK8A 5FTLA 1KO1A 1HDIA 3GRVA 4EHDA 2G9NA 4PLYA 3GDOA 1IN5A 4TV9A 1SKMA 2VYNA 3PZBA 4MX8A 1C9DB 8LDHA 1IPFA 1T36A 1X7ZB 2PUTA 3O4IA 3AVVA 4K6OA 4N40A 5BR4A 4BFTA 1PAUA 1LPAB 4I9HA 2ZIVB 2GSDA 1YA8A 1P1JA 4PYLA 1I7DA 2V6BA 1WDTA 4CCYB 1C9JA 3BFVA 1NUUA 1DO2A 1H69A 4YN3A 3VGPA 1GCAA 5L3QA 1AM4D 4OYLA 4FYYA 2OGZA 4YAOA 5JUWA 3D5EA 1UJ2A 3KYJB 4BLPA 2FN7A 5IKEA 1RPTA 1YK1A 2GCNA 3OE4A 1JG2A 2EKZA 5FULA 2XEXA 3A7EA 3L3BA 3OZFA 3HE3A 4MMZB 3CUEF 1GTMA 1KKUA 1GQOA 1RXIA 2WOOA 2FLVA 3TDMA 4BKQA 4D6PA 2EFYA 3O8QA 1KI6A 4F96A 3Q8LA 2I67A 1TA9A 4KDCA 3S40A 4WK6A 3M5DA 2IXDA 5GTDA 1WZEA 2RB5A 4J76A 4LJYA 4Q9JA 5JARA 5IS2A 2HJVA 2NNWB 2P2ZA 3G2PA 5MGNA 5EGSA 1Y0BA 1GKIA 2YV4A 4GI1A 3R1IA 2CXNA 2Z08A 2WG0A 2ZIUB 5EUBA 3TW4A 2CCJA 4DBLE 5LYJF 1HYQA 1U3CA 1WHTA 2CMGA 4PPFA 3HCOA 4BMNA 4WBNB 3MWJA 1AUQA 2Z1DA 4ZVOA 3BE8A 2GRUA 4A3SA 4WCFC 4XA8A 4WNYA 2M6RA 1Z17A 4IQ8A 2FLWA 2F3QA 4GOXA 1A27A 1JW9B 3MN1A 4DIKA 4IDEA 2IY9A 2F43B 2O2CA 3RJ5A 3BWVA 3CZ5A 1RJFA 3B9QA 3H13A 4RCYA 2HRRA 1GOTA 3D3QA 1RLUA 4PHFA 4LGYA 1ZGJA 3HXOA 1VSTA 3L6UA 4R2MA 5AKKA 1TKAA 2QMZA 2BF4A 1SCUA 3TIIA 2EFGA 1Y82A 2YH2A 3VAAA 1O9HA 2VLIA 1QP8A 4EJ0A 1I4LD 4IXMA 1EVQA 2XOXA 4KVGA 4CNBA 2NO9A 1RIIA 3FPLA 2PWBA 3RKUA 3PIRA 1UDCA 2ZUDA 3LCRA 3UJPA 1W19A 3N70A 3RSZA 4COKA 4DMUB 1QMPA 1QVAA 2NYUA 2P4QA 5HKOA 1U11A 3LNTA 4BIIA 4URVR 5TLSA 1PLLA 2B69A 1W75A 3HCWA 4FYPA 2V97A 1FYXA 2YJ5A 1B3BA 2Y1CA 1B0UA 2PZFA 5B6IA 4DCMA 3F97A 4ACBA 4ETMA 3DEKA 2C99A 4ID3A 5FUVA 1P5RA 2YW2A 5A5VA 4OQDA 4O2LA 2HSDA 1ZRMA 1EWQA 3O1IC 3GCWA 1NVVQ 3DOJA 1KY2A 4X8MA 4Y2HA 3EODA 4MR7A 1TTQB 2I2DA 1MABB 3IQWA 3H65A 4G89A 4BU1A 3C43A 1KJNA 2QN9A 3GLKA 3Q3EA 4KR6A 1JHDA 3RVQA 5DNAA 1XAIA 4PRZA 1HY3A 1A9OA 2ACEA 2RKWA 1RP7A 5LIRA 4KNYA 3D6TB 1ILEA 1YKSA 3C24A 4J0KA 3THYA 4TL6A 5DTQA 2NUTA 1U7PA 2ZKIA 1YNSA 3GVHA 3ECAA 1VLVA 3BB1A 3I92A 2PUFA 2HV9A 3DL2A 5EHGA 1JLMA 3DYBA 5KNCD 4GMXA 4KLRA 3WKCA 4R5MA 1YHYA 3FLEA 1DO8A 3UT6A 4C7JA 3P20A 4HEJA 4YWJA 4WKNA 2JFXA 2P8SA 2QS9A 4B7AA 4KRFA 3O7WA 2ZVPX 4I14A 3VDNB 4UMFA 1OR8A 4IOLA 3AB3A 4J75A 4C43A 3HKCB 4KPUB 4QUJA 2R65A 4MI9A 3U9TA 4BZZA 4FGJA 3PHHA 2UXBB 3ANLA 5KKCA 1QX4A 4X1IB 2VJYA 4CCYA 5A2GA 1TYZA 3R5HA 1P4SA 5KOYA 1H2RS 2C0PA 1Y6FA 1E2FA 2XYHA 1D4FA 1VSVA 2C4WA 4YMTA 5KJ1A 2J0QA 4J1TC 1MG5A 2R4UA 2ZCUA 3BGWA 4A2PA 4QNRA 1ENYA 4G23A 1YZ3A 2NIPA 1AK2A 1H85A 3ABIA 5E95A 1NE2A 4A91A 2ZSUA 2B9VA 5CXXA 4RVCA 5F78A 1GTVA 5H5JA 4LCEA 3ZKAA 1XMJA 1XN1A 1ZLYA 2OESA 3TZBA 1JTFA 2Y1GA 3B1VA 3PDUA 3ESBA 4M7WA 1E3SA 3CF6R 4ZXFA 1QLHA 3ZZTA 4CIDA 2DLNA 2RG1A 4NYMQ 4GI2A 3RFCA 1YI1A 3OZIA 1XEWX 3DLTA 4CDNA 3L40A 4RJJA 3O83A 4FDLA 1Z2AA 2UYCA 1A98A 1OTYA 3F6YA 4MJ7A 4YTEA 5K45A 2BLLA 1NNUA 1I14A 4BMDA 4RH1A 2ES4A 5JO0A 4E7PA 3EAGA 1JR3D 4KW7A 4CMJA 1PEKE 1TB4A 3DCIA 3MQFA 5EIOA 1VSBA 2HWXA 1HL3A 3A7DA 3FY4A 2ZUEA 3G1TA 1U7XA 2F43A 3X1YA 1N2XA 1ISRA 3OM9A 5TE9A 4EO9A 4FBMA 3LGSA 1IN6A 1IM8A 2HA5A 3ISTA 3QF7A 1NY6A 3DQQA 4GGMX 4HQLA 4FNAA 4Q1AA 1DOZA 2QUKA 4Q6BA 1DAOA 1DJMA 3AI3A 3K6SA 3C97A 4WK4B 3WIBA 2C8JA 1VKHA 3FOCA 2YXNA 1WMAA 1TF5A 1KQPA 4AJOA 2PX3A 2WJHA 3WS7A 2K4MA 5C18A 1U8YA 4ZAGA 3AY6A 1RWKA 3KUCA 4A0RA 4H6PA 2AXQA 1CDZA 1MB9A 5EXXA 3WGQA 4B47A 3QVLA 3ENKA 2I5PO 5M2QA 2QMQA 2GNAA 1M66A 5CFZA 1CEXA 3PUVA 1NFQA 2KX7A 4B85A 2FI1A 3ETJA 3D6NB 4TS4A 4UEJA 4ZANA 2JEZA 1JBQA 1PJZA 3PX3A 3HMQA 4G65A 3TRKA 1I36A 2B21A 2V03A 1LZLA 1Y81A 4EJFA 4IJ5A 4F72A 2FSVA 4X20A 4J4HA 1ZD8A 2XWQA 4M89A 2AUTA 2WA1A 1L7VC 2RB4A 5AM1A 2EJVA 4G4JA 5I3ZA 2XXAB 4H17A 1B0AA 3N87A 3IUQA 3AF6A 3HMKA 2AWNA 3SQWA 4P0TA 4QJ5A 5TQJA 2C3MA 2Q8PA 1OYWA 3TEJA 2BFFA 1XKTA 3A9VA 3FNHA 5AVRA 1XU7A 2ZUBA 2R4TA 1G8JA 3GA5A 1A2OA 3ISVA 4PG7A 5CW2A 4G86A 2C1ZA 1KO4A 3WDKA 4O4HF 3TJZA 3ZE1B 4HDAA 4YRAA 1ST3A 3F5SA 4MB6A 3ZIAD 4B8ZA 5LQAA 4V1CI 1SXIA 2H0QA 4HSGA 2VQFB 2GAJA 4E5VA 5HE8A 1I4DD 1ZJYA 2C4NA 3OU6A 1QS0B 2C9MA 1D7OA 1SBYA 2ZRJA 3D6UA 5K7SA 1UC9A 2WRZA 2VXYA 3F6SA 4HAZA 4HR7A 4RDHA 3UB3A 3KKLA 4KKVA 4IIGA 1XF9A 2NU9A 2AUMA 2HEIA 1NVWQ 2HWWA 3NOVA 4IIYA 4R1MA 1Y34E 3HKCA 2NVWA 4KPUA 4YJHB 5H7XA 2X9QA 3GI1A 3F5MA 4TXMA 4B74A 4EVSA 2XADA 1OC4A 1SPBS 4PGHA 2DHEA 3OZEA 2BGRA 1Y9DA 2C5BA 1ID1A 1DFIA 3DEHA 4HVCA 3H84A 2Q5IA 4ITUA 3DT6A 3ZE6A 1Y7PA 1Q1ZA 4MUFA 4GM4A 1MDBA 1NVVR 2GBLC 2FR0A 4TV8B 1YDFA 1OQAA 2ZJYA 2IOQA 4H7JA 1WOMA 1HDZA 1JDNA 5LYJA 4FHGA 4LGMA 4IFBA 5GQSA 2FPIA 2VA8A 5H82A 5KNLA 1NVGA 4XGNA 4TTPA 2CFCA 3RW9A 3G2LA 2JIZD 4HEQA 5HOQA 2RGWA 1W8DA 2I29A 4ZEMA 5C1BA 5FIUA 1YTLA 4JZYA 4J4BA 5F1KA 5LUAA 3L7DA 1CIJA 2CEKA 1GPAA 2GT1A 2QTBA 2XDAA 5GOZA 5A03A 1BE8A 2R6JA 1YC5A 1G8YA 1NN1A 3K20A 2DFLA 3OPMA 3L43A 3QU7A 4J7AA 1RJWA 1FX1A 4QBFA 2H6EA 5DZSA 1P5ZB 4ZTBA 3UQZA 4MAFA 3AUJB 3VR0A 3NONA 4LOHA 1I3MA 3I01A 4LXIA 3CTMA 3FFXA 4BVAA 3C7TA 3QX7A 4PTLA 4C6RA 3VHXB 4II2A 3RUFA 1DJQA 3F7OA 4OQZA 4Q18A 1DINA 4RBNA 3S1AA 5K8VA 4RXUA 2UXDB 1IWBB 1ZJ5A 2J87A 2PKQO 5I9IA 3NAQA 2OYCA 1DAMA 1Y7IA 3EZ6A 5DHSA 2OD2A 3OKFA 4E88A 4IS2A 3OX1A 4OGGA 1FUUA 3T4XA 2Q6IA 2JLUA 4A73A 3P9QA 2OA0A 1TCBA 2P9HA 3T5CA 5JDIC 1DELA 4OBXA 2QR2A 3HXKA 4C1BA 3MYYA 1L5GB 1KQGA 1T9DA 2O6HA 2XBUA 2LIPA 3CU5A 4QQFA 2E4UA 1ZH8A 2Y66A 4TVOA 2TS1A 1JA0A 1X1TA 3JWPA 3LOPA 3F8SA 4NOKA 4OSOA 2BH2A 2D5LA 2QEQA 3DD1A 2XKBA 4FFNA 2D4AA 1W5FA 3FWKA 4XFJA 1KORA 3WA6A 4L0QA 3PC7A 4BNMA 2F8TA 4FWIB 2ANCA 2I4LA 1U8EA 2IEDA 4NYMR 3C5VA 4PX2A 4F5ZA 3BT7A 1U7OA 3OY2A 5CURA 3U3RA 2JVIA 3QHQA 3UK6A 2NSJA 4WE3A 1NW4A 1L2TA 1ACJA 4B84A 2Y0CA 1BW9B 2YNMD 3ML1A 4TM7A 3A37A 5K8CA 4LOAA 1DLIA 3WNZA 3ANMA 4YONB 1DKQA 3PI7A 3WLNA 1U81A 1EHCA 1FFXB 3BSFA 2R84A 2ZRIA 4M86A 3K9FC 4KR7A 4IJQA 4E5NA 3QTBA 5JPCA 4G0VA 2ISQA 3OPYB 5DYGA 3PJDA 1VMEA 5F2NA 5HCNA 2GFQA 3KV3O 2P3QA 1OIVA 4D9MA 2HQ1A 5JAPA 2BI8A 3DJFA 3NCHA 2HX1A 3X1KA 4LJKA 5BSGA 1YDGA 2A35A 1MH1A 1AC5A 2GHTA 5ALNA 1JMKC 3TR0A 3OJOA 3V55A 4DDVA 4QJ3A 5IF3A 3QQPA 3ZY3A 1J1ZA 2BJVA 4F8EA 4JENA 1EBUA 1Y6QA 4YP0A 1INLA 1C9EA 2FJUA 2REBA 2QM8A 1SQFA 1L5LA 1M8JA 3AHGA 4UE3S 3T5AA 4LISA 4C0HA 5HKKD 3HCDA 4L4XA 2Q0SA 3EPKA 2IXTA 3IUSA 4M98A 3NYRA 1WU7A 4IINA 3ROMA 5M04A 5CG1A 2GNPA 1QS0A 3QY9A 3SQDA 1CS4C 1C7RA 3PXBA 1C7EA 4JQCA 1XTUA 4JVOA 3FVWA 3I0ZA 2H7VA 1ZMBA 2F9FA 1T5SA 3D3KA 1W29A 5JCJA 1SVWA 2BHTA 2OFPA 3LOQA 1WZIA 4YJHA 3U4AA 1YVPA 2PQ0A 3W8DA 4BBZA 3V8BA 5AW4A 1WXIA 2O50A 1JG3A 2H3EA 1O97D 1Q92A 2QKYA 2AOTB 3A10A 4ENVA 3I6BA 1PNVA 3P8ZA 3C6YA 3G89A 4QASA 4TYMA 1D3AA 1W35A 1ZK4A 3NTXA 4QKQA 2HUPA 2YKGA 3ZWMA 4GMKA 3UMRA 4H15A 3SSAA 2H1OA 2Q49A 4HDNA 1NVTA 3K1ZA 1V96A 1TUIA 2A7XA 2HIAA 1Z0AA 2WHPB 1MLDA 4FDUA 4BLWA 2Q0QA 1YCGA 1K88A 3RQIA 4DARA 4YRMA 4IWNA 5HSGA 5KTKA 2RBKA 3N9IA 3RVMA 3UAGA 4XDGA 2VI5A 1K3UB 1ZFNA 3CLVA 4YCAA 5JATA 3WNCA 1TUBB 4R9NA 2WIFA 1AKQA 3OCVA 4FZ5A 2NU8B 1NP3A 2JLQA 4LYHA 1T34A 4BKRA 2VP6A 3BZWA 4X85A 1X70A 2H1WA 3ROZA 1K4MA 1GG5A 1HYBA 2V7PA 3CEMA 5E9AA 2G88A 4MKGA 4K6KA 4YI3A 4HGNA 3D5QA 1DQPA 5DMXA 3ILHA 3TRFA 3NASA 4TN1A 3RYFB 2PM8A 1JB1A 3QU2A 4OP3A 1GDDA 2PUDA 3C3BA 2F3TA 4EB8A 4KQFA 5E6UB 1VZ2A 3FRIA 2O3RA 2J5BA 4QFBA 5ED4A 5JCOA 2NPIA 2EEZA 3GIDA 3MWKA 2WABA 2XYVA 5G0VA 4BBAA 3IELA 4XI9A 3SC6A 3COJA 4L9SA 1N4AA 1WL8A 1X42A 4NBVA 3HXTA 3SE0A 3TSOA 4EKDA 2Z57A 4FZRA 5KBYA 4INPA 1C4OA 3PGJA 4MLDA 1M1UA 2G0AA 1JFFB 2R9VA 2VG8A 4RJ2A 2WHRA 3L1KA 5K51A 2E6KA 2JHCA 4RPHA 1F6BA 1XDGA 4FEGA 4X3OA 3RF7A 4DDUA 4DV4B 1MIOB 1XRMA 4G5YA 1U2DC 4G1UC 3UMBA 4L5AA 3VYRB 2VZ8A 4MI1A 1LNSA 3GPDG 4NSNA 1K8YB 2JZCA 1DJOA 4OMDA 1ZH2A 3ZW7A 3UCXA 3WQSB 2Z9BA 3VXKA 4RJLA 5ITZB 4EJ6A 2XAUA 3AG6A 1CVIA 3JALA 1HRDA 4MQMA 3SCZA 4HRAA 4CW7A 2FWPA 2OCXA 3D8RA 4MLPA 3DNFA 3F47A 2RH8A 4IIEA 4IIUA 2X5JO 3P26A 4FTWA 3H1PA 2L2QA 2F8MA 1FFXA 2OCYC 4YRBA 3VI4B 2BTEA 1LFDB 1PG2A 3LL4A 3OC6A 4XVUA 3FOWA 1GG9A 3OPYA 4OK6A 3WQBA 4M0PA 1Z63A 3PC3A 1IMJA 3O4VA 3VNAA 4LBVA 3KETA 3FUCA 2C59A 1E2PA 5A2QA 1F20A 3MG9A 3TMYA 5CP8A 2GAIA 3ZXYA 1ZO8A 1F6WA 4REMA 4YREA 5JNSA 2OBMA 3A8TA 2CV1A 2IHVA 1A7AA 5C31A 3Q0EA 4O4IF 3T7TA 4AB1A 2PU7A 1LVGA 2W6IA 4B3SB 2PSHA 1EE9A 1KRHA 1GU7A 2YINC 3R09A 4OFWA 4F4DA 1G8HA 1WLSA 5BSEA 4OM8A 2B8TA 1M0WA 1TCUA 2JIPA 1K3FA 1PFYA 1B14A 1Z7YA 2EG5A 2R1UA 4IIJB 4UNQA 4BO6A 4B3RB 2GO1A 1H8EA 3ENWA 3IAS6 3UGQA 2P68A 4MRVA 4DBZA 5HQ3B 1A9SA 3FNEA 4U6NA 1QHIA 3L04A 4Y67A 4YMUA 3R74A 1NW9B 1FW8A 2DUJA 2FSIA 1GAXA 4ETWA 2JKYA 1X9HA 1NPYA 5ARCA 2YC2C 3S2FA 1HNNA 2ZZNA 4L51A 1IRXA 1C1XA 3SEAA 1QG4A 2DT8A 4V0KA 1RYHA 2VBGA 3A26A 4HNGA 3VDRA 3ZQ6A 5IKOA 4GWGA 1P2VA 2I78A 4E30A 3TLKA 2VSNA 4HWKA 1L7AA 4D98A 4HMQA 4JOBA 2W98A 4J6EA 2AOTA 1S7CA 3EOBI 4OATA 5I4KA 2LIVA 3AGPA 1WXXA 3PNBA 5FXMA 1EK6A 1MU0A 1JXQA 2RGXA 1JR6A 3R7BA 5KOHB 3PKJA 2YHSA 2C2BA 2C7PA 2Z5GA 4A27A 4M0CA 4AURA 4D4IA 1KE2A 5K3AA 1LSUA 3BTOA 1LRJA 3B85A 1K75A 4OH7A 1TUBA 2I2XB 2R6CA 4NYIQ 2PNJA 2NU8A 4RV5A 5FL3A 3RK0A 1HR0B 4AG5A 1YZVA 2K6GA 2JJYA 3FZQA 2GERA 3KB8A 3RS5A 4HS9A 3UAWA 5ALGA 3QPAA 2PR2A 5CLIA 4ZCSA 1CY0A 1PYOA 2GKGA 2R8YA 1E2KA 3MZ0A 4O5AA 1YHZA 3WLOA 4NU5A 1TO2E 1GL6A 2CK3D 1ZUNB 2COEA 1SKYB 3D3WB 4QU0A 4IILA 1SR8A 5DSXA 4EPXA 4Y18A 4IG4A 3CB4A 7ABPA 5ICSA 1PWEA 1D7AA 3HDYA 1ISHA 2AI2A 2H4XA 3O2NA 1DHRA 5E6UA 1R37A 4RADA 5CA0A 3ZWNA 4MUGA 2GESA 2VTKA 1OT5A 4LNUA 4QELA 4AYXA 1TRKA 3EQZA 1HTWA 4DM7A 1RZRA 4TWZA 3TX6A 3ZY2A 1IXZA 1ZCBA 4DS3A 5FWYB 4EELA 5JRZA 4NARA 1GFSA 3CE6A 2DU8A 5B1SA 5HJ7A 1XRQA 2C42A 2XNHA 4G2NA 1DIOB 5EZ5A 3ELYA 4K05A 1FPMA 2PH7A 4UUAA 4WNCA 4RJIA 2JD1A 4XUEA 5D5HA 3LT0A 1A9ZA 1JFFA 1T6ZA 3T94A 1IM5A 2H5JA 3LPAA 3KX2A 3OZAA 1XZQA 2FN9A 2BVNA 4IDFA 4L8FA 1U7WA 4RLSA 3CEJA 1IHUA 4GOMD 3G23A 3FPJA 2LNDA 4JP2A 1TYCA 3FAZA 1KSHA 2OTCA 3OCYA 4LQLA 5BV2P 3P9ZA 3D4PA 2PTGA 2JKZA 3LXRA 4RPJA 3OP4A 5FB3A 1QO7A 5AKIA 2K7ZA 3QX9A 4EFNA 1GRCA 4FLFA 4K7JA 1XMXA 3C48A 5AM3A 2F4VB 3ES9A 2VP5A 4AKEA 3GUYA 2O0MA 4MV8A 1TMKA 2JCYA 4MVJM 4UNIA 3QEJA 3MXTA 4Q37A 4QD3A 3TZCA 4EGAA 5K2OA 5JVDB 3VZDA 1VIDA 2VHVA 2HMAA 3V8VA 4QYMA 1H1LB 2XTMA 1AV7A 1G6OA 3V32A 1RMTA 1MX5A 2G1JA 3ROXA 4GR5A 5D8DA 4YR7A 1FFCA 1GAJA 4G1VA 4BO2A 3MCAA 3L8GA 4FS8A 3IC5A 4QHTA 1WUTA 4CGZA 2BN4A 1G6KA 4Y9SA 2AW5A 5CH8A 5CLGA 5EZSA 1H5NA 3CRQA 4OA8A 4BWVA 1Y7TA 2X9NA 2WKPA 2OHIA 3BH6A 4MA0A 4TL9A 3VDMA 4BMYA 2W2LA 4BEWA 4EJMA 5BNZA 2I03A 2O8EB 4YV0A 1S9DA 4L3OA 4ZMRA 1P44A 4DRZA 2RGNA 3BWXA 3N28A 5SZIA 4E2YA 5DHQA 2OB2A 1UZMA 3N5KA 4JXXA 4P9NA 2AX3A 4ESEA 2XF2A 4G5QA 4HGYA 2GJAA 2CLSA 2H3HA 3O3OB 5FOTA 5JI2E 1N33B 4Z4QA 1QTIA 5FJIA 5CVCA 3TOSA 1W30A 4G4SO 2VOJA 4QM6A 1G5QA 3HR8A 1G21A 3Q3JB 2AE2A 2WWYA 5B1DA 4WXMA 4MDEA 3CZMA 4NFHA 5H4HA 3UWDA 5JYDA 2CE2X 2FUEA 3W5AA 4J7UA 1Z5OA 4ZC8A 5ALZA 1GQFA 2JI6A 1WD7A 3LYAA 4JC5A 5KC8A 3H9JA 4RIIA 1Y3AA 3II6X 1YJ8A 4R8VA 4DQDA 3VR4D 4NATA 3HCRA 4OXXA 4U7HA 3EDQA 4A8JB 4PZYA 4HAVA 3RRFA 3GXBA 2IU3A 3MWFA 1MVNA 3T1YB 1N0UA 3ZDFA 1N8KA 1V8DA 3VKUA 4BFCA 3GJZA 3W77A 1R6BX 3VNUA 2CFOA 3I4LA 5GIPE 1VFNA 1JJVA 1YZLA 1SUWA 3RSSA 2GFIA 5K8UA 1SKYE 2ZTLA 2OWDA 1RLMA 3CYFA 4OIFA 4H60A 1ZRHA 1YRYE 2G71A 1TVMA 2VF2A 2DBYA 3IAS1 3ZHQA 1UBEA 3UXMA 2QN3A 4XX1A 5KOHA 4ND8B 2CLMB 3KQKA 2KQUA 1V6SA 3CW8X 3R5FA 5A1TA 3EXIB 3VPCA 1WBBA 3ZDCA 3CKYA 4AMZA 5AYVA 4BZQA 3AEUA 3VYTB 3MJHA 1L7OA 1K27A 3LDFA 3CNOA 1A50B 3EGOA 2VHUA 1OWMA 1RM0A 4RVGA 3U37A 3LAWA 2I54A 2ZRDA 1I3CA 2CHGA 2Z5FA 5BN4B 1QE0A 4M0UA 4HLQB 3T5BA 3M3PA 5EE9A 1XRJA 5F4BA 1UJCA 4J7CA 4PTZA 3RARA 3SZGA 5EMNA 5CB4F 3D3WA 4Q7EA 2RFLA 4XM1A 3T9CA 4C4SA 3EVEA 3ZWVA 3B9PA 4NABA 1U99A 1FDRA 4RLQA 4XSHA 4JLVA 3U09A 3JZFA 5KNDD 1Z7EA 1E2JA 2P0YA 4H0FA 1FFYA 1T9CA 3LHIA 3RVKA 5CB8A 2YIVX 2Z2ZA 3D6HA 4G84A 4CNQA 2Y3IA 1KWKA 2G28A 3NBFA 5CM9C 3USCS 3WWDA 3NKVA 5JASA 5FWYA 1L4GA 2R2AA 2R85A 4WZAA 3W5BA 3PX2A 4J9VA 1ZHHA 2QUHA 3QJ5A 4KBGA 4WD3A 3RU3A 3U0BA 5LP1A 3WLEA 2XWPA 2ZRCA 4UULA 1KYZA 4R1NA 2FAXA 1EVEA 4GECA 4HO1X 3U9SA 2BKAA 3P2EA 2CLKB 3QX8A 4E3WA 1JG7A 3DMPA 4JA0A 1E6CA 1QX3A 4YCSA 1BGXT 1E3WA 2HSEA 2ZM6B 1FFSA 1M5TA 3ILVA 3IP3A 4KMMA 3MCUA 4X6UA 2Y4NA 3C6MA 4D4GA 2H4ZA 1OZFA 3L8MA 2ZRLA 1VHDA 2Z3VA 1DDGA 2VQDA 3KVVA 1E6KA 2W4QA 4QEKA 6CHYA 1VLQA 2EFDB 3VSCA 4X94A 3RO7A 1A5SB 3KKMA 3WZMA 1VXOA 2NXEA 4YCLA 2QT1A 4RPGA 2CVPA 3IQIX 3UICA 5FLEX 2ZT6A 3W7AA 4ZCLA 1ZJ4A 3P9IA 2IPXA 1H1LA 2VPYA 4WPGA 1UBRS 2OL4A 1VJGA 3SIPA 4EGSA 1MR3F 5CH3A 5LLDA 1VJ1A 2L82A 2Y1OA 4LWOA 2XMRA 1YI8A 3ICPA 3COZA 3A2LA 2QRJA 4ME6A 5KTSA 4IGFA 5DJ5A 3GBPA 3P5SA 4CIXA 4U5QA 3A3OA 3VC3A 3GPBA 2GXQA 1RFGE 4GMFA 1T9KA 4B8YA 5H3LA 2HBYA 1DCMA 1EFCA 1RYZA 2ETXA 3H16A 2C9OA 4XCVA 2IIBA 3JR7A 5CVJA 1J2EA 2GEBA 2P5SA 1ORVA 1YR3A 3FYDA 4I9UA 3RYHB 3K3PA 1JVBA 3BGIA 1YJQA 4ZZ3A 1CB0A 4BO7A 1R6XA 4XQ9A 3PXCX 1UCFA 2WLSA 3LSTA 4XCXA 5T57A 5ICGA 2CVQA 4FR2A 1K66A 2QUAA 1QYCA 1HDOA 2D2VA 2F1RA 3D9QX 3N2YA 1JPNA 4L28A 4DUPA 4ENSA 2J5KA 4UNSA 3L84A 5L3SB 1E18A 1UP6A 4LYEA 4YPFA 4E07A 1Z82A 1ZXXA 1RPAA 2CCGA 4DJAA 2QX6A 3HNPA 3IUJA 5KCZA 1S6YA 1EBFA 4BAZA 2OBBA 1E3JA 2GPWA 2LTAA 3AIKA 3IQGX 4MZDA 5AT1A 2YWRA 1D8AA 3UT5A 2RGYA 1I2ZA 4EZIA 2EBWA 1DFGA 4U39A 1Y9ZA 3EE6A 3ZOKA 4QZVA 3TVTA 1B6SA 3IO3A 3P2OA 3H8VA 4RNDB 4CHGA 4CM8B 4PSUA 1Y5NA 1OYVA 5REQB 5KEIA 3AF2A 2Z30A 3BUSA 3FLAA 5P8WA 1D4ZA 2NN3C 1UWKA 2CXXA 1MNAA 2BEWB 1N3LA 3LUKA 3PGVA 4IMIB 4C1NA 3K5WA 4OI1A 2IRWA 4RGQA 3M6VA 5C7OO 1KK0A 2NTNA 4GI5A 2ZT7A 3BGSA 4BN5A 5EKTA 3O4JA 3RYIA 3GZJA 1B3RA 1C7IA 3MJRA 2D2IA 4NLLA 2PQMA 4TWBA 4FW9A 4W8OA 5EC8A 3C7DB 5DEIA 5KYUA 1BJRE 5FLXA 3A1NA 2I1QA 2G1UA 2AVNA 1WPGA 2Q1TA 4NDZA 3K09A 3EPHA 2HAEA 3IVCA 2WIAA 1DJNA 2UYYA 3FI0A 3C3KA 3H2ZA 3NHRA 4GP7A 4RKQA 3TD2A 5BN4A 3SJBA 4XRGA 4MDYA 1CY7A 3EFOB 4JI1B 3V42A 3C16C 9LDBA 2WEKA 1A9YA 2IIVA 3S4YA 4PNEA 3B3FA 1XE3A 5CCDA 1WB6A 3N75A 1JXMA 3OFSA 2IKSA 1SXJB 2JLWA 4TKUB 5DWVA 1CEEA 1ISJA 1XKXA 5TQ2B 1A8HA 1QV7A 1UJ5A 2QP9X 5JAOA 1NUPA 4QU5A 2ZJOA 1P8JA 4J91A 4BV2A 3KQYA 4HJRA 1N0HA 2WSYB 2JCSA 1MQSA 1V48A 4IQ4A 2XH8A 4WIAA 3GJTA 1BFUA 1I9CA