1XTKA

Structure of decd to dead mutation of human uap56
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
382
structure length
382
Chain Sequence
GFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDEADKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human ATP-dependent splicing and export factor UAP56
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords Probable ATP-dependent RNA helicase p47
total genus 120
structure length 382
sequence length 382
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2004-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xtkA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xtkA02
1E2LA 1B23P 1OH7A 1W4AA 1KJZA 2ZJBA 3EIQA 2A5JA 3PUVA 3KQNA 2J0UB 1GOTA 2ZRHA 1SXJA 2HT6A 2GK6A 4LYHA 3TSOA 1RRCA 3THYB 1P61B 2VH5R 3NVAA 1R0YA 2FSHA 4D0GA 3VKWA 1XPRA 2VO1A 5CM9C 1KSGA 4F92B 1OFIA 3SYLA 4DT1A 5JRJA 3PVSA 5KDDA 2ZU6A 2AN9A 1ZUNB 1FFHA 1W36B 1J7KA 1XD8A 1E3MA 2F7SA 3G0HA 3DOFA 1TF5A 2L0XA 4FI3C 4R71A 1QHYA 2KB0A 1E9EA 1R0WA 1NJGA 1P5ZB 3FMIA 1E0JA 1TQDA 3W6OA 4QBIA 1XMJA 4QHTA 2ZRJA 4PXAA 5GVRA 4DDUA 3AF1A 1U94A 1FMJA 3W6NA 1VKJA 4W5HA 4QGGA 2FGJA 4MQBA 4ZCLA 4B2PA 3R9XA 5EJEA 4Z8XA 5E7JA 1QHHA 2C78A 2V54A 3QKRB 5CIQA 1JJVA 2CJWA 1O87A 1EFCA 3ASZA 3U61B 3UK6A 3AKDA 1ZCAA 3KUDA 4IDHA 4TZ0A 3DMNA 1FUKA 4LJ4A 2X77A 4BFUA 4IXMA 1KI6A 1GAJA 3RABA 3ICEA 1Q57A 2Z5FA 3KL4A 2FGKA 4UNPA 5KOYA 5L3QB 2OXRA 2ZJ2A 3LWNA 4X8HA 3MCAA 3QJYA 1JJ7A 2I4IA 3VTKA 4KYUA 4MYTA 5EZ5A 3AP2A 3LO5A 4N0EA 1QG2A 4QM6A 3B1ZA 2D06A 3Q85A 2CE2X 3CPEA 1P73A 2W6JD 1B0UA 3QEJA 1UKVY 4H1VA 2IW3A 2ZJYA 4PC3A 1EWQA 3FOZA 1DPFA 4A8JC 1XEWX 3GJ4A 4ABYA 1N0UA 2XEXA 4M2LA 3TVDA 5FUVA 2CLDX 3THYA 2O52A 4KV9A 1E2GA 1E2FA 2QG6A 3C4JA 2YOGA 2GF0A 3HYTA 2J5XA 2FU5C 2F9LA 4OI2A 3L8YA 4OI4A 1Z06A 1JR3E 2DR3A 1HQCA 4PPQA 1CXZA 5DYIA 3SZRA 2LCFA 5TARA 3P4XA 3SC3A 4PC1A 4GZLA 4A15A 1XJQA 2WJIA 2PLRA 3ZS8A 2DY1A 1E94E 3HYRA 1ZNZA 3T5GA 1II8B 1E79A 2R8RA 4MGKR 4Z1MD 2FX3A 4GT1A 5JMTA 3DL0A 4JVNA 4KCGA 1DTSA 3LX8A 3THXB 1XCGB 4ARZA 4PPNA 3U5ZB 4V0ME 2YOHA 4HLDA 2BMDA 1VYUA 3ADKA 4P32A 2PLFA 2XNDA 4DCVA 1ZC3A 4XWKA 1HUQA 2QTVB 3A4NA 4M9ZA 4UXJA 4QGAA 1ZUHA 4B3CA 2IWRA 2E1RA 4NL4H 3EZ2A 4ZDKA 5FUWA 1XXHA 3CO5A 4Q1FA 5HE9A 1EFUA 3ND9A 2NTYC 1E6CA 4WVFA 4GI7A 2BCJQ 4LJ7A 4GMDA 1OHHA 4NYJR 5BW8A 1WCV1 3GLFE 1LV7A 2IS1A 2QMEA 1EX6A 1VCIA 3OEED 4DZZA 4QJ4A 1UDXA 1W47A 2GEUA 1G5PA 1W0KD 2W00A 5GADl 1N3BA 1D6JA 2VQSA 2JJ1A 4HLQB 1E2HA 4Q66C 5JI2E 1DAMA 2MSDB 2WIAA 3PG5A 2ZETA 2PMDA 4B76A 2R6GA 1U0JA 2XAUA 4YMWA 3RC8A 4Q4LA 4FMDB 5EE1A 1KNXA 3WP0A 4AIIA 1W2GA 2ZSDA 4FMBB 2RGBA 1MABB 2EWWA 1VIAA 4AG5A 3PUYA 4XVQA 4DLUA 4CF7A 3K0FB 3AVVA 1SKQA 2ZS8A 1Z8FA 4US2R 4TT3D 2B7BA 4GOJA 1COWA 2QBYB 3C5CA 3SE0A 3L0OA 1TUEA 1NLZA 3BB4A 3VR2A 4H1UA 3WBKA 1DAIA 2PT5A 2VF7A 3D31A 3IQWA 1H8ED 2V4ZA 2Q9AA 2ZSBA 4HAVA 1IXRC 2ORWA 1Z6XA 1UBEA 821PA 3EZ6A 1F2TB 2W6IA 4HSEA 2LWIA 1E32A 4OQNA 1JR6A 3P20A 4S2EA 121PA 5EQTA 4E07A 3EPLA 1K6MA 5EZ6B 4KBGA 4QBHA 4DCTA 1BMFA 2J7PA 4YQFA 2KJQA 3H84A 2HJGA 1A1VA 1CJUC 2BJWA 1X1SA 2P0EA 2Q9CA 3H1TA 4GZMA 4HZUB 3THOA 3A36A 3GJ6A 1VIYA 5B2ZA 2FFAA 5FBWB 3VQTA 3AVWA 3HU2A 4JL5A 4TYWA 5J4VA 2K5UA 2ZQ5A 2W2VA 4ZDWA 2QMUA 4NYJQ 2QGZA 4DJTA 1EESA 4NE2A 4KODA 4YMUA 4DBLC 4MUBA 1N6KA 1VMAA 1SHZA 1H8EA 2GNOA 2XB2A 5JZVA 5JJIA 1G5TA 4TTRA 1YZKA 2GJKA 2H16A 3KKNA 3GJ3A 4QJ3A 3RLFA 2OLJA 5CLLA 4PAQA 2GJ8A 2D4HA 1DG3A 1ZNXA 4BZPA 1E2QA 5ANRB 3L8ZA 3GEIA 4AD8A 4Q7LA 2C77A 3BH6A 4K46A 5FOXA 1Z07A 3WYGA 5DI3A 1CULC 1N5KA 1YZNA 2PJZA 3B78A 4KJZA 1Z83A 3EG5A 1KO4A 1OKKD 2A5YB 3BRWD 4FW9A 5TMPA 2GCNA 5CYPA 2W58A 1W36D 2PEZA 3ADDA 2ZI7A 4NYIQ 1NF3A 3DMDA 1SXJE 3VX4A 5JJKA 4LV8B 4J0QA 1G7RA 2H57A 2ODEA 3QEOA 3RRNA 3L0PA 5L3SA 1HE1C 1G16A 1ZM7A 3K9GA 4M4SA 1XXHE 2OCYC 3H86A 1NN0A 4D4KA 4LJ8A 1LS6A 3JZMA 2VA8A 4HDCA 1DAFA 4D4LA 4F4CA 3EX7C 1CLUA 4TQAA 2PL3A 3EC2A 3GLIB 4RCZA 4E09A 1ZIPA 4QG7A 4KU4A 2XZLA 2J0SA 2VP2A 1TU3A 3NBFA 4BFZA 3AGQA 4V02A 3B1YA 1TAGA 2R44A 4Q1EA 5JLJA 2F43B 1W49A 3CLVA 4NONA 5AJZA 1KSFX 4QNRA 4B3XA 4A2WA 3VR5A 4QNMA 4D0NA 4M8NE 4M1OA 1YR8A 4B71A 1S3GA 1VDZA 1UM8A 4X8OA 2QI9C 5CK5A 1OE0A 2C95A 3RWMB 2IXFA 2BMFA 4UQOA 2QAJA 4RFSB 1G8YA 4M21A 3H4MA 1JXMA 3SN6A 3TNFA 3FPAA 1W5TA 4D25A 3K0EA 1E4YA 1FL9A 1KK2A 221PA 3IBYA 2IYQA 4NCHA 2Q3MA 1BKDR 3B9QA 1ZYUA 4HB2A 1F5NA 3PUWA 2CL0X 3P1JA 2RGCA 4W9MC 4Z1MA 1W4CA 3MAAC 3UMSA 4B3BA 1IXSB 3C41J 5EE9A 2BEKA 1IN6A 1AS3A 3MLEA 2EW1A 4FIDA 5E4FA 2B8TA 4NYIR 2ZVQX 1XP8A 3EC1A 4NCNA 3QQ5A 3GCGA 1I2DA 3QSYA 3UG7A 3K70C 2IS4A 3HPRA 2FPKA 5FR1A 1G8PA 1G1MA 4Q5IA 1HA3A 2R9VA 3N5CA 3IKJA 4RZXA 1G17A 1LTQA 3BH7A 3IILA 4IDOA 4LPSA 1HTWA 2WAXA 3K0AB 3SEAA 3BS4A 3IQXA 5BQ5A 2CHVA 4ON9A 1JEDA 1MH1A 1GNPA 2XTNA 2J3EA 1QF9A 3R8FA 4JIMA 4U02A 5IK2A 2JLRA 2QL6A 5KSYA 2AFHE 3M6AA 4PO8A 1D2MA 2OEPA 4C4PA 2IHBA 1XPOA 3LW7A 4N3NA 4DLVA 3SHWA 4NKRA 3IEUA 4XIGS 3BBPA 2JASA 3TSWA 5BN3A 3CRVA 1D9ZA 1BYUA 4JS0A 3B1VA 4DSNA 4GP7A 2HV8A 4NPHA 3UWKA 1E2JA 4B73A 2REBA 1KK0A 5G40A 1ZRHA 3CIOA 3ZH9B 2AWOA 3ZS9A 4D80A 1OXSC 1G8GA 1T4GA 5CK4A 2WV9A 5EXXA 2NZ8A 1S0UA 1KGDA 2QEQA 2ONJA 3CRRA 2ANCA 1P6XA 1NVVR 2KI5A 5KU1A 3NG1A 2BM0A 1EGAA 3TKLA 1BH2A 3IHWA 1E0KA 1CP2A 3H2YA 5E3HA 3JVVA 3VR1A 2AWNA 2ZE7A 3KX2A 3DM9B 4OBEA 4P4TA 3PEWA 2WJHA 2IUTA 4JVSB 1HQYE 3IBGA 2Q21A 3KUCA 4YDHB 4NCJA 5DN6A 5BXQC 3P26A 1H8HD 3SU8A 4ZO4A 2IEZA 4EFNA 2RMKA 3I62A 4D0LB 4H9GA 1G3RA 2IK8A 1L8QA 4QOSA 3FE2A 1GKYA 2D2EA 2J45A 4MITA 3BFKA 4LV5B 1JNYA 3LD9A 4C0AC 1GVNB 2VRWA 1VYTA 3MRSA 4HAWA 2P65A 3KFXA 4LYAA 2ZI9A 2YINC 4EQ6A 2PCLA 4CYMA 4YONB 1X8KA 5CB6A 1TX4B 1QVAA 1U98A 4NH0A 1CR2A 2G83A 1KI6B 1QHNA 2DFLA 1GDDA 4WXPA 2O8EB 4JZKA 1I4DD 5AJWA 2C9YA 1XJCA 2CNWD 2EYQA 2X19A 2QTHA 2VP9A 1Q3HA 1IHUA 4LBWA 2WKPA 2IS2A 1R2QA 3EA5A 3PEVA 5HCNA 2REXB 2HXSA 1CR4A 3QF7A 4DLXA 4LI0A 4V03A 1GG2A 3EWSA 2CLCX 3R7WA 4UXHA 2FN4A 4Q9HA 2DWOA 4MKFA 4JLPA 3GLHE 3AVQA 4OHVA 1J8YF 2QAGA 1G4UR 2Z4RA 1Z08A 4UNSA 2OAP1 1RPZA 5EXPA 1MT0A 1IN5A 5G41A 3IIJA 4KLNA 4Q19A 4F4JA 1NIJA 2A3RA 2OXCA 4IOKA 4OQMA 1KOFA 2QP9X 1OFTA 2WMOB 5FOUA 3L43A 3T35A 2CCKA 4FD2A 3WNDA 2KSQA 4JMPA 2VHQA 4I99A 4NP6A 2W6ID 3QPWA 4U7DA 3W6PA 5BWMA 2IYLD 5K8UA 2GXAA 3QG5A 1DAEA 1ZD1A 3ZVMA 1IY1A 1EG7A 2IA5A 1YZQA 4BLRA 3BAFA 3VR4A 1XXHB 1UF9A 2IBMA 2VHUA 2OFWA 2XOKA 4TTQA 2GXQA 2C2HA 5DLQC 2JJ8A 2C04A 3TVTA 2P5SA 3FMOB 3VAAA 5AJXA 4PO1A 3OFNA 5FI1B 3B85A 1ZM4A 2Q9BA 3CX8A 2GVDC 3DKPA 3R8CA 5JBQA 1WP9A 1BYIA 3N2EA 4WA7A 2WWYA 1KAOA 1OLOA 4TL9A 5J5CA 3TR0A 3THXA 1OIWA 2RAPA 3HR7A 4FWIB 5TVKA 1NL3A 4BRWA 2XXAA 4WZ6A 2O8DA 1V43A 2ASEA 4EPTA 3QNUA 1XEWY 4B3DA 3AF4A 2FDCA 2IYWA 1AGPA 1TUIA 3HPQA 3OE7A 4DLSA 4QKQA 1P7CA 5DHFA 1ZU4A 2ZS7A 4PC7A 1ELOA 3C14C 3SJBA 5DI9A 3GLHA 5DO9A 4LJYA 2VSXA 4RFVA 1X3SA 3NEYA 3BB1A 4RD3A 1Z2CA 5CJPA 2C9OA 1T5LA 3TJZA 1DAHA 3WXMA 5C4GB 3VU9B 1BS1A 3LDAA 1R4AA 4ASUD 4DLZA 5JRZA 2AKYA 1US8B 2Z0MA 2QP3A 5C4MA 2A2ZA 1KSHA 3RS3A 3UPUA 2CXXA 2J87A 5FUXA 4P3YA 5LB4A 2Z83A 2BEJA 4QXAA 2FG5A 3CWQA 1G6OA 5EP3A 2Q3HA 4Q1CA 1OXUA 2ZI4A 4BQSA 1E1QD 1L4YA 3BE4A 5G3ZA 4Q4AB 3LLMA 1D8TA 4IOJA 3QPVA 4G01B 2BV3A 4TWZA 4BFXA 2ZAOA 4PZLA 1L4UA 1SXJD 2ZTSA 3RWOA 1KZGB 2GRJA 4YXWD 4ESVA 1MO3A 3REFA 4OJQA 4AYXA 1ZM3A 1E98A 3DDCA 2ERXA 2YWEA 4EIWA 1JXOA 4LPKA 4LJAA 4Q1BA 5A4JA 4AKHA 4DXAA 3GMTA 4O2RA 3X1XA 3FKSA 4MYHA 4JVLA 2QE7A 3MWKA 4URZR 2W2XA 2OCAA 4LX0A 4HB4A 5FUYA 621PA 2WKQA 3DVLA 3CONA 4TL6A 1R10A 4PHFA 1DS6A 5AUPB 2BIFA 3QG1A 5E7IA 4TMZA 5BYKA 1TNDA 1WXQA 2QRZA 4IEEA 2FEMA 2BC9A 1GRQA 3MJRA 2BMJA 2B21A 2XSZD 4LYJA 3VNVA 1OFHA 2IXGA 3B9PA 4TN1A 4G5GA 3ZZTA 3DKVA 3A1SA 3MWJA 1AKEA 3K8YA 3QKUA 2DHRA 2WVJA 3RHFA 3D8BA 1G5RA 2J59A 2ZSFA 2OBMA 4BLQA 4JLNA 1SVMA 4JLVA 3ZZ0A 4C9BA 3U3KA 3W8RA 3TBKA 1G19A 4GOKA 4AY2A 3AF3A 5JWHA 5KTYA 5FPSA 3KQUA 4KFUA 2J7PD 1TF7A 1YZLA 1Z0AA 4EAQA 4QHYA 1X1RA 2B92A 4Q4AA 4BZQA 3ZQJA 3OAAD 1JAIA 3SYKA 2OFXA 1P62B 4MKHA 1HV8A 3CPJB 1T8TA 1TQ4A 4M53A 2V1UA 2FPLA 3LQQA 4PSVA 2ZSEA 2CJWB 3WHKA 3NKVA 3UATA 2AX4A 2R6FA 2ZRKA 1U9IC 2QZ4A 4A0HA 2QN6A 2FWRA 4PR0A 4WW0A 3K0AA 4EPXA 1HE8B 2D3WA 3PV0A 4LCBA 1IN7A 4DCNA 3OIYA 4KHZA 4UJ5A 2JLVA 1FQKA 5EE3A 2P2LA 4A6PA 2XSZA 4BLSA 3S1AB 1W4BA 3IUYA 1PUIA 2RGNC 4RVCA 1SVKA 3WMEA 2D74A 5F9HA 4UXIA 3IGFA 5FI0B 3SBEA 1A4RA 3VFDA 2HT1A 3U3JA 4DLRA 2O8FB 1G291 2O0KA 2ZRNA 2VSFA 2IYYA 5DSZA 1P3JA 1A2BA 1S4QA 4C0BA 1OXVA 1ZW6A 4EDHA 2HLDD 3P4YA 1ZCBA 2C8VA 2VPPA 2GJ9A 4I1OA 1W7AA 1OHHD 4I81A 4HB3A 3DZ8A 4DB4A 1IXZA 4L15A 2QT1A 1ZP6A 3RYTC 4EPWA 2QGNA 3PEUA 5FOWA 3ASYA 2ZANA 1N5IA 1A7JA 2WJGA 4GOXA 2B7CA 4CEIA 3KKPA 2XTZA 3FB4A 4OI0A 3FWYA 2JLWA 4B34A 1OB2A 3FHOA 2ZE8A 4AYWA 1NLFA 3OEEA 4PQRA 4Q9KA 4ILEA 3K70D 2PZEA 2ZRCA 4JLMA 5H1YA 4G3XA 4KFRA 1R0ZA 2A30A 3GFOA 2G3YA 4BASA 1R8QA 4OKSA 2JLUA 1G3MA 4ACAA 3W34A 1M74A 4JLBA 1N0WA 1OJLA 4JYBA 3W5JA 3EPHA 1I4TD 1ANKA 1X6VA 3B5JA 3SQWA 4LBYA 3K09C 1XD2A 2XITA 2NQ2C 4I1UA 2CE7A 2F1IA 2GEDA 3CUEF 3RS0A 5FTLA 2BWJA 4NMMA 4KXFB 1E9BA 3O47A 4LHXA 1JQJC 1KO5A 3U6KA 3QKRA 5KYKA 1IQPA 2YV5A 1AZSC 4LGMA 2I3BA 3RS2A 2A7QA 2IUUA 2AXNA 4NZYA 5FL7D 3U3RA 4MGYR 2OM2A 3KKQA 1KDOA 2HUPA 2KE5A 3NBZC 4B2LA 1N25A 2QMOA 4QBGB 5LDDC 5FL7A 2XTMA 1CBUA 4D6PA 5F9FA 1J70A 2CNWA 2PZGA 2ZUCA 1OH8A 1XRJA 2I1VB 2E87A 1RRPA 4KI0A 5GJWC 4CT5A 1WF3A 3ZD7A 2W6JA 5DIFA 1PUJA 4V0LA 1GFIA 2PX0A 2NO1A 1G41A 1Z2AA 4X8LA 2RHDA 4JBYA 1Z6AA 4AKEA 4ZDJA 1K5GA 2XXAB 1EFRA 3L82B 2HXYA 2EVWX 4RJLA 2CHQA 4PAOA 2JLYA 1XTIA 1YU9A 2YC4C 1H8HA 1P9NA 3CF0A 4PPFA 4CRWB 1JALA 1HT2E 1N6NA 3LBIA 1G7TA 2ZPTX 2YWHA 3B7GA 1E2IA 5JFGA 2X2FA 1YVDA 4JSYA 2IC5A 4X8MA 1ZM9A 2IYVA 2BHRA 4LHVA 1G4AE 1R5BA 2ZSAA 4OQLA 1AA9A 2F43A 1ZU5A 2G0NA 2FE4A 4URXR 1G9XA 4BFYA 3NDBB 1IJFA 1GWNA 3ADBA 2ZRAA 4PZZA 3GLIA 1HY3A 2FEOA 2HEIA 4KFTA 1XTKA 1XEFA 1ONBA 3CB4A 1ZINA 2R6AA 3WBJA 1GUAA 4U00A 4AKIA 4IDQA 3G5UA 1XEXB 3QXJA 4TSFD 4P4SA 4LK2A 4QL3A 4EPRA 1E1RD 1ZD8A 4RKFA 1WRBA 1YHNA 4Q1AA 1FX0B 3K0FA 1PLJA 2PZFA 1RZ3A 2MMGA 2GILA 3PUXA 5E95A 3PITA 5BN4A 4DEYA 4QFMA 5EE5B 2RGAA 2FH5B 3EW9A 2PMKA 1JAHA 1UKEA 1MO6A 1N6OA 1IN4A 4GBMA 3CRQA 4M9SA 3RSOA 1NMZA 4D4MA 2JLQA 4EJSA 1FOEB 4MGIR 3HU1A 2R65A 2BBTA 4PHHA 1K8RA 1RYFA 4KO8A 3LVRE 3JZAA 1EX7A 2H92A 2WKRA 4HUQB 4WXRA 3UIEA 1YR7A 3ADCA 2QTFA 3AH8A 5AK0A 1Q22A 4L8GA 2NO0A 4TLBA 2WWXA 3IO3A 3TRFA 2JLZA 2VHTA 4O3MA 4NCIA 1YZGA 4DVGA 1GTVA 1EK0A 3FFAA 3ZLJA 4JLDA 4KBFA 3O8CA 2GZHA 1E1RA 3GJ5A 1S2MA 3I92A 2EFCB 4CZ2A 1UJ2A 2H8KA 2I1QA 1UBGA 3QVVA 2WSMA 3K0CA 2GBLA 3PCRB 4DC9A 2WPDD 4TMWA 1JPJA 2IYTA 2PH1A 4ESHA 2WWIA 2QSZA 3QKTA 5FOVA 4NBSA 4MGZR 3I32A 4LBVA 4NYMR 5FBQB 2GKSA 2VBCA 1KI4A 4BECA 4LJ9A 1G18A 4RD2A 2BM1A 1A5TA 1NMYA 4FXPA 3Q7PA 1UKYA 3I5YA 4EUNA 4D26A 2DYKA 3VKHA 1GNQA 1GKUB 3C16C 1KJYA 1ETUA 1XCPA 1P2SA 2AK3A 2QU8A 3F0TA 5LD2C 4CEIB 1PJRA 2OESA 4C2TA 4Z8YA 4TL8A 5LBIA 4XWOA 3AP3A 4AG6A 2Z6VA 2NOAA 3N70A 2ZI3A 4KVGA 3NC1C 3AVPA 4PHGA 1NP6A 4TYYA 5B30A 2V7QD 4OK3A 1G3QA 1Z0FA 1N6IA 3U6BA 1AKYA 1KO1A 3QF4A 2ZR9A 2ZE6A 5KNCA 1WB9A 2IYRA 1U8ZA 4R2HA 3TUZC 4ERNA 1COWD 2OCBA 3SHFA 4CVNA 4FN5A 3LBHA 4DSUA 4TQUS 5L3SB 3I4LA 4TLDA 2C5LA 5J40A 1AM4D 2OAQ1 1GL7A 3HWSA 5M04A 3A4MA 1J8MF 4HUQA 2W2TA 1IJEA 3JVUA 5J47A 2IT1A 3A4LA 4MDFA 4QHSA 2EU8A 2AHOA 1S1MA 2GEVA 4IVRA 4EJSB 1D5CA 2ZRMA 2QAGB 4AWXA 4GDFA 4A2QA 4I1SA 4XH9B 2ODNA 4TQ9A 1T0JB 1BIFA 4G5QA 4Q02A 1Q3TA 2ONKA 3F8TA 3NDPA 3KTAA 3T15A 4DT1B 2QSYA 2V7QA 2XGJA 2PT7A 1Y3AA 5DISB 2RCNA 1YE8A 3B13B 4NYMQ 1Z28A 1Z5ZA 2PBRA 2AR7A 4FMDF 1XJ0A 5LD2B 1E99A 1X8LA 4Y0AA 1W0JA 2BDTA 1U8YA 5FOSA 4IW3B 2RH5A 4TMVA 1F6BA 2ZS9A 1N6RA 1Q21A 3NXSA 3MFYA 2H1LA 2YWFA 3BB3A 1CIPA 3LY5A 3PFIA 1AJEA 5SZKB 1TPZA 3U7GA 3THWB 5JSZA 2ZITA 3RRMA 1P9WA 4BLTA 4EPVA 3QIAA 3AVUA 2RKOA 2ZRPA 3R9IA 4RD0A 5KSZA 1G8FA 4N1AA 3E1SA 4XVUA 1P2UA 1CJKC 4M1YA 2P6RA 4Q9LA 3MG9A 1CKEA 1NVWQ 4LRWA 1IAQA 1YKSA 3MD0A 2IYXA 2UVQA 3LXXA 3NH9A 5EUMA 5J4YA 5C18A 3V00A 1DG1G 1G3IA 2NO7A 2OE2A 4C0HA 3EPKA 1T91A 4DLWA 2DBYA 3X2SA 1E69A 2ODBA 4EJSC 2QAGC 3ZJYA 3W3AA 4RSGA 4G5SA 2QORA 1XCMA 3FMPB 1LF0A 1S3SA 3R20A 1RKBA 3PXGA 3IDQA 1CTQA 1VYVA 4KLZA 4B44A 4CEJB 4M9QA 3GLGE 1E2PA 3PENA 1R8SA 1Z47A 2GDJA 2IX3A 1MO5A 1Z29A 4HAZA 2ZU0C 5KSPA 1K5DA 4GSYA 5K8TA 3IPYA 4BE7B 2IWHA 3S1AA 1SZPA 1W4RA 4RY2A 4WOPA 3A1UA 5JJLA 1YR6A 3HDTA 1Z0DA 5B64A 2MMCA 3H0KA 2YNMA 3DOEA 1RRGA 2CL6X 1NSTA 4TSFA 1QG4A 2RGEA 1W0KA 1MKYA 2WWGA 4A2PA 3QY0A 1NBMD 1QDEA 2Z4SA 5FBVB 3EA0A 1F2UB 4PANA 1W0JD 2O5VA 2ZM5A 4WIAA 2FZLA 3QXSA 5HPYB 3A37A 1CF4A 1LF5A 1PVOA 1GZSA 1XD2B 3KTAB 2GAAA 1GP2A 1KI2A 1W1WA 4XD7A 3CF2A 5H68A 5L8VA 5D3MA 2ZIAA 4B3FX 4W5WA 4O25A 3WY9A 1A82A 3OIVA 3Q5EA 2NPIA 3QE0A 5DH9A 5IT5A 4XJXA 1N2CE 4A0RA 5JEDA 2JAQA 5F98A 4BFTA 3TQCA 1Q1BA 2VHJA 1RVDA 4DUGA 1EXMA 1Z0JA 3LAWA 4DLTA 1KI8A 1VCNA 2NO6A 8OHMA 3KXIA 5H70A 3LNCA 3LA6A 2X2EA 2ZVPX 2VIIA 4OK5A 5EP1A 3OZXA 5JS8A 1IN8A 2CHGA 5KNDA 4QRHA 2O8CB 1KNQA 2CK3D 5CITA 4GFDA 1HURA 4JKIA 5HZHA 1NVUQ 4M1MA 1D2EA 2ZRBA 1ZNWA 2HJVA 4Q4HA 1KI1A 3FKQA 1FNMA 5FTJA 1XBTA 4NDZA 4C0QC 4BLOA 1LFDB 1U8AA 1JBKA 1SGWA 3LVQE 3SI7A 5ELXA 1YR9A 2KBFA 4B75A 1IONA 3F5FA 1E2EA 3QI2A 5DHAA 1WE2A 4GRAA 4KFSA 4P31A 4F4IA 2O8DB 4F93B 1TEVA 1AS0A 4AC9A 2NGRA 2FA9A 2ANBA 4Q01A 2N1BA 5AUNB 1F48A 2OG2A 1N6LA 5GJBA 1W44A 4GPTA 4Z51A 3K09A 1PV4A 1T9HA 4C0KA 3I61A 1DO0A 2GZAA 4FCTA 5IK2D 1E9DA 2F1JA 3I8SA 1NSFA 5KHOC 1C4OA 3R7WB 1UADA 4ZKDA 2YOFA 4B48A 2GCPA 2ZYWX 1GNRA 4HLUA 5CM8B 1U0LA 1T5IA 4MRPA 1SHKA 1JI0A 3CZQA 2ZYTX 4DDTA 3K9LA 2ZJOA 2Y8EA 5CIWA 3CNNA 3BD9A 4Q48A 5EUQB 3CRW1 1U90A 2WSSD 5F3WB 1NY5A 2CK3A 1UBFA 5KO2A 4XSHA 1PLLA 3ZVLA 1QHXA 2E9SA 2ZRLA 1NMXA 1J2JA 4LHZA 4C3ZA 1Z6YA 5AUOB 3TAUA 1XB2A 4XWAA 1LW7A 3RVBA 2H18A 3SBDA 5AJVB 3UXMA 4CGZA 4LJ6A 4BLPA 3RAPR 1QRAA 1XF9A 2G6BA 4ZI2A 2C9CA 4BUJA 4ITRC 2JA1A 5UKDA 4B3GA 2V1XA 3KQKA 1XU4A 1XWIA 3ZVRA 1GL9B 1ZMXA 2CEAA 2XNSA 1U2RA 3GLGB 3T61A 2GXUA 4A0FA 1OPXA 2FFHA 1OFUX 3W5IA 3QKSB 2J0QA 2SHKA 5FR2A 3M4YA 3VMFA 4OHYA 2UKDA 3C5HA 4B33A 2PJRA 4KAXA 1QZXA 1P9RA 4XVRA 1TMKA 2YWGA 2V6IA 3WNBA 2XZOA 3LH5A 4Q1DA 3M0EA 2AXPA 4JVMA 3VX3A 3NEJA 1UAAA 2F3RA 3CH5A 4LV6A 1HYQA 4PSKA 2ORVA 5IHPA 1E2MA 3CX7A 4A82A 3KKOA 2AK2A 5FTNA 1NI3A 3L2OB 3K9HA 3UG6A 1GILA 5SZIA 3EPJA 1DOAA 4PSAA 4IFBA 4PQYA 3KXKA 4UJ3A 5KDOA 1NVVQ 1X8JA 4DRZA 1US8A 3UMFA 5K8LA 3EXAA 1ZNYA 2IEYA 1VG1A 1SVWA 4XTRA 3QXXA 1HT1E 4TLCA 1TEXA 5TY0A 4MUAA 2FSFA 1FPMA 2CL7X 3TUJC 3NBXX 5BYJA 1Z0KA 3TSZA 2VP0A 1FNNA 1GL6A 1MV5A 1NG1A 2F6RA 3K9NA 4XSGA 4C0SA 1BO6A 1XMIA 1XEXA 4OYHA 2C98A 4URWR 1T8UA 3U4QB 3V4RA 1KHTA 4JBWA 1VHTA 4HB0A 4F91B 1GRRA 1KTVA 2QENA 4RD6A 3KJHA 2IS6A 3BOSA 2Q6TA 1T6NA 3I72A 1N6HA 1CJTC 4W5JA 2FNAA 4LDJA 1SVOA 2FOLA 1VPLA 4LHYA 1F60A 1LY1A 3NHBA 3SQXA 5DE3A 1NG9A 4IOLA 3E5HA 4G5OA 1KDTA 4BRUA 2NMVA 3GP8A 3HU3A 5JHHB 4Z54A 3AP1A 5A5GA 1SKYB 1V5WA 1S1CA 4TMTA 2ZYUX 4L16A 3F3YA 1QBKC 2BJVA 3BJIC 3GLIE 2HF9A 1R7RA 1RJ9B 2GA8A 1W48A 4FCWA 1Z3IX 2QROA 3PQCA 2C96A 1WQ1R 2V6JA 1UEIA 5FH9A 5JI3E 3U7HB 2MSCB 1N5JA 1YRAA 2WOOA 4A8JB 3IEVA 1QHSA 1G7CA 1XD9A 1Z22A 3A1VA 3BC1A 5TXGA 4B43A 2HF8A 1GITA 1OIXA 3GJXC 1N5LA 1EFTA 3OF5A 4IFEA 2VHCA 4V0NA 1E9FA 1TU4A 4D4JA 2EQBA 2G0TA 3BORA 1II9A 2WAYA 2EFHB 1RJ9A 3UWOA 2A5FA 4KSCA 3SS8A 3PJRA 4C0LA 3B60A 3CR7A 3K70B 2NIPA 1W5SA 5BN5A 4AKGA 4M9XA 2JDID 2GAOA 3LX5A 3A6PC 3NTUA 1E9CA 1OW3B 4YMSA 3U7EB 3AQ4A 3TH5A 1XNJA 1OKKA 4P0TA 4UNRA 5EP2A 5JS7A 2QP4A 3G82C 4W7SA 1UKZA 1L2TA 3VHXA 2JJ1D 4DIEA 4GL2A 3D7MA 2PX3A 4FINA 3T1TA 2HDNB 3C15C 3SNHA 2D62A 4XD7D 3Q9LA 3ZYCA 1CR1A 1G21E 2ATXA 2BVNA 4IRUB 2W0MA 1ZIOA 4LSGA 1TTTA 1OXTA 5EE0A 3TR5A 4EQ6B 1JECA 1OYYA 2H7VA 3W8NA 3BFVA 2IUSA 3X1WA 2FF7A 3CNOA 5HKKA 1KY3A 4JLJA 2QUZA 1U9IA 4ZKEA 1MR3F 1ZUIA 4TMKA 4IVQA 1E96A 3RS5A 5KNBA 1JQLB 1QHHB 4PC2A 1S9HA 1OSNA 4YMVA 1KO7A 3GLFB 2XOKD 4L4UA 521PA 4HDQB 4NTZA 2QPAA 2JEOA 4ZCMA 4O2LA 2XB4A 3WRYC 3FMFA 3L0SA 1PZNA 3I8XA 4PFSA 1J90A 2NO9A 4Q00A 1AIPA 4MKIA 3OIWA 1KIMA 3IIMA 5TV2A 3VNUA 2WPDA 2JCSA 2WWWA 1RFLA 1CU1A 4IEIA 5EXTA 2J9RA 1UBCA 3MMPA 2QM7A 2ZJZA 2J46A 5HE8A 5FTMA 1II0A 4V0MA 5JCZA 2B6HA 4BGDA 4URVR 1II8A 5LPNA 2WWHA 1S9DA 1Y63A 1VTKA 3U3MA 4L9SA 1OH5A 5CLQA 1OT3A 5G3YA 4B2IA 4JBXA 5KDLA 1NKSA 4L9WA 3FVQA 3A1TA 5CDFE 2ZRIA 2BBWA 2ZI5A 2CCGA 3DM5A 4M0LA 3GLGA 3GFPA 3O8DA 2EYUA 2A78A 1LNZA 3V4FA 1GIAA 4YMTA 2IXEA 2WJJA 2LKDA 3PEYA 1XTQA 2RGDA 4RD4A 1P2TA 3ZQ6A 2OT3B 4HYYA 2FFQA 1Q44A 2V9PA 3BGWA 4ZPXA 4AI6A 4HEJA 2OO7A 2Q0HA 2JGNA 2QQEA 2JLXA 3EIEA 4JJKA 3T12A 3UKDA 1NJFA 1KDRA 3PR1A 1YQTA 2WMNB 3GPLA 4WBSA 5HZKA 5F2EA 1F3OA 2CMKA 5IDVA 3P32A 1BOFA 3GJ7A 1ZVQA 1DE0A 3LRPA 1VHLA 3BWDD 4MYCA 1M34E 2WSSA 2WBLC 2FSIA 3WYAA 2VLIA 4G1UC 2UZIR 1VCOA 4WAUA 3TQFA 2ZUDA 3B1WA 3RANA 3RC3A 2IF0A 1JR3D 2DFNA 1AK2A 4TYQA 1D9XA 3RDPA 1KKLA 3B82A 3UANA 4B35A 2R62A 3KB1A 2P67A 3NBYC 4M1WA 3UMRA 1FW6A 1IOZA 2DFKB 3AV0B 2BCGY 5KPDA 5JEEA 3RSLA 2FJUA 1IM2A 2VF8A 4EPYA 4ZIRA 3U3OA 3K1JA 1SVIA 1JPNA 4ASUA 1W2HA 2ZRGA 1YZUA 4MYUA 4JLAA 3ND8A 4URYR 3O8RA 2LKCA 2JLSA 1P60A 2YVUA 3K0SA 1KI7A 4DCUA 2FZ4A 3KQHA 1Q1QA 2ZAMA 3W90A 3X1ZA 3KZ1E 1KMHA 4ARZB 2VP5A 3LXRA 4R2IA 4Q03A 3AVYA 3KQLA 3DO6A 3CKLA 1KMQA 1U99A 2QY9A 4JJZA 1NN1A 3OEHD 2WOJA 721PA 1DEKA 2G77B 2ZI6A 2ZJ5A 2JATA 3GJ0A 3AF0A 4LOAA 5DGXA 3W3ZB 1ZBDA 3AVTA 3EZFA 3KKMA 3DPUA 3OE7D 2QPTA 4G0NA 1GRNA 3MWYW 4Q4HB 2WTUA 1P4SA 2VL7A 3CX6A 2OHFA 1E4VA 1KMHB 2HYIC 2ORIA 4TT3A 1FTSA 4K81B 5E7MA 1CR0A 2TMKA 3LW8A 2OZEA 2OSBA 5L3RA 2ZRFA 3AM1A 1YZTA 2OUKA 1EFHA 1VECA 3WNCA 1HH4A 2CBZA 4O0MA 1KK1A 4MRRA 4Q9IA 3U44B 1E9RA 3Q5DA 3SOPA 2IYZA 4BFWA 2DCUA 2QE7D 3ZZUA 4RZ3A 2FV8A 3KXLA 1WDTA 2V55B 2H17A 1UDWA 4C7OB 1OXXK 3BFXA 2GTPA 3AGPA 3LBNA 2YHSA 4WZAE 5J4HA 2AD1A 4YC7A 5A0FA 2VYFA 3SJAA 2G1JA 3TGPA 2ZROA 1KAGA 1G3UA 1XX6A 3BXZA 3OESA 4JLOA 3V9PA 1T3LA 2QBYA 2ECKA 2BBOA 2JDIA 2WJYA 4Q4JA 3AB3A 3B1XA 2ERYA 3AUYA 3FFBA 4JYCA 5KSOA 4N0DA 2J41A 1R5NA 2GCOB 2ZRDA 3AF2A 3QBVA 5JWRA 2YKGA 4OK6A 3CBQA 3ZIAD 3GLFA 1G8HA 1G20E 1Q20A 1VG9B 2KWIA 1G6HA 4QBFA 4YDSA 4E03A 3TMKA 4RFSA 1G64A 1KJWA 4KVAA 4F38A 3NWJA 1I2MA 3ZVNA 2IF2A 1LB1B 4MA4A 5EXSA 1IBRA 2J0VA 4HAUA 4S35A 5DI3B 3OAAA 3U60B 2YC2C 2NZJA 2PEYA 3VHLB 1A2KC 4HATA 4DLYA 1GM5A 5FOTA 2V8OA 2UZ3A 2CCJA 5HTKA 4P4UA 4KYIB 3AKEA 3CH4B 1OV4A 2D7DA 3GJ8A 3I5XA 4DCSA 1E2KA 4DIDA 2J0UA 2WHXA 1T0HB 4US1R 2JJ2D 2FSGA 3B2EA 3O8BA 4CEHB 3RS4A 5K8IA 3KJEA 4XTCS 3SJCA 5GJVC 5H8WA 4LHWA 4ZI3A 4E5UA 2EFEB 1XZPA 3MUFA 4R98A 2GVZC 2B8WA 4CW7A 1JR3A 4PPGA 1NBMA 1GKIA 1ZJ6A 3P27A 2C03A 3A58B 4OHWA 3T06B 3TLXA 1KK3A 3T1QA 2DWQA 4BPBA 2ZJAA 3RNLA 2WM9B 3TE6A 1NKTA 4RD1A 3SFVA 4IOMA 4V0KA 1OH6A 4U5XA 4E22A 3FDIA 1SQ5A 2OCPA 1M6NA 1E2DA 1E2NA 2GESA 4CEJA 2RGGA 2O8FA 1P75A 2ZR7A 1KO8A 1Z63A 1NNEA 4PHTA 2O8EA 2DB3A 3I73A 2AD5A 2REOA 4RKEA 4YLGA 1OIVA 1ESMA 3QXCA 4MDEA 4Q7MB 4BEJA 4Y0VA 1C9KA 4PX9A 3U4QA 1LVGA 3AUXA 1R5OA 1WMSA 2R6DA 1ODFA 2GHIA 4JL6A 4M22A 4UNQA 3QENA 5AWFC 2EWVA 3I1FA 3OHMA 4QGHA 2ZJ8A 2DPXA 1F2UA 1SKYE 4NU0A 4Q47A 4A9AA 4QGFA 4TLEA 3A8TA 4OHZA 1Q1ZA 3PIRA 2PCJA 1SULA 4MRVA 1PLKA 3LFUA 4OHXA 4DHEA 3GFTA 4DSOA 2QT0A 3RS7A 4Q18A 3CR8A 3KDSE 4QC2A 2WJVA 2VP6A 3LLUA 4HZIA 4Q9JA 2QRNA 4IDNA 5CB8A 1T3SA 2VP4A 5CJ2A 2JIZD 3VR3A 2HCJB 1ZC4A 1YRBA 1Z6TA 4JKYA 2P6NA 2DFTA 1IY2A 2GXSA 3AEZA 3FYHA 3FKSD 4AK9A 3C7KA 3BIFA 1CJMA 2XJ4A 5HKKD 3OIUA 4NCKA 3MSXA 5D3MB 3HR8A 3DHWC 3NH6A 4EFMA 3ZGXA 3FGNA 4OL0A 2G9NA 4Q7JB 1WBDA 4C7OA 4LC1A 1G7SA 3TUIC 4OI1A 2CVHA 1E9AA 2G1KA 1ESNA 5DYGA 2BKUA 4DEXA 2V3CC 4QM7A 1MRNA 4HDOB 4R9UC 2OV2A 4HUTA 3U44A 3BERA 1QHIA 2GJAA 3M1IA 3TAHA 3X1DA 4A1FA 1E1QA 3CF6R 1CRQA 1DO2A 1U81A 4D82A 1Z6GA 4HAYA 5FPKA 1D2NA 3CW2A 4B32A 4B6FA 4ZCIA 1RC8A 4CEHA 1RE0A 4LBZA 2ZYVX 2RGXA 4A6XA 4I4LA 3KJGA 5FBLB 2QM8A 2QPOA 3REGA 2HYDA 421PA 1E0AA 4FWTA 3KB2A 5IF9A 3D6TB 3U7FB 3ETLA 3CZPA 1CRPA 3QXHA 4UKDA 1T3HA 4CIDA 1OF1A 4CT4B 1AQYA 2F3TA 3T5DA 2XX3A 4MH0R 1NIPA 2OBLA 1RW4A 1KI9A 1N0VC 3Q3JB 1TQ2A 4HLUC 1OYWA 1OB5A 2QNRA 4A4DA 1E0SA 3AKYA 4TTPA 3CM0A 2X8AA 3IHLA 1DELA 1LS1A 3EZ9A 4A0GA 2CVFA 2Q3FA 4JLKA 3SR0A 5B57C 3IO5A 4LJ5A 2QA5A 1NRJB 4HAXA 1Z0IA 4LWZA 4AYTA 4RZ2A 3VKGA 3KFVA 4MRNA 1W46A 2Z43A 3FHCB 5J4KA 1NVXQ 5J4LA 4JSTA 2BBSA 3N2IA 4G5RA 1M8PA 3EASA 1E9SA 4IDPA 1O3YA 2P5TB 1RRFA 3E2IA 3VR6A 1XMVA 3GD7A 2GCOA 4B74A 4BEBA 1DADA 4DDVA 2ZR0A 4NHOA 5FFMA 1E79D 2F1RA 3BK7A 3EAQA 4IHQA 2YJTD 1ZAKA 2F9MA 5JSZB 4LC0A 2HLDA 2IHYA 1N6PA 5DNYB 2GBLC 4MRSA 3FTQA 3GQBA 1SVLA 1UFQA 2A5GA 2H5EA 2ODWA 4IXNA 4DWJA 2A5DA 3SFZA 1RYHA 3QBTA 1QVRA 2VEDA 1Q1EA 1SVSA 1M7HA 4GMXA 3FHTA 1VG0B 1U0HC 4L5BA 2GK7A 3QOFA 4A92A 4A36A 2MSEB 5AR1A 4POAA 3HJNA 4GNKA 1KZ7B 4GP6A 4BFVA 1XFAA 5CDFA 1M2OB 3CNLA 5DN6D 4I1VA 3AVOA 1MOZA 3TIFA 4PZYA 2AFIE 3PUZA 4MKGA 5GVSA 3Q7QA 2FMXA 1TADA 4P33A 1AN0A 2J7KA 3T1VA 1MABA 2AKAB 3EARA 3LQRA 3Q8XB 3L0IB 5SZJA 3WYFA 1DARA 5KUTA 3WMGA 2OLKA 4US0R 1HEIA 1JEEA 1M7GA 2N46A 1DVRA 2O8BB 5HR5A 3NIBA 3W9YA 4M1KA 3RRZA 5AJYA 1R0XA 5FL3A 4ACBA 2JJ2A 4TZ6A 1KKMA 1AQUA 3CRMA 4P4SB 2GZDA 2ZREA 5LB2A 2AL7A 4CDGA 1DAKA 2ZEJA 4KITB 2GWHA 2FPMA 2OFOA 1DBSA 3IPXA 4Q7KA 3DZDA 2BMEA 4TYPA 4IJMA 3E70C 3C8UA 1TL7C 1IY0A 3LV8A 3WHLA 1EWRA 3K0CC 4ZIRB 2O8BA 3CPHA 5FBRB 3RRYA 3QUSA 2IL1A 4Q21A 1MO4A 3BH0A 1SXJC 1FUUA 2JIZA 3ONWA 5JECA 4DKXA 1AGRA 3IIKA 1VG8A 1ZD9A 3EIHA 3THWA 5C2JB 3ZIAA 1Q0UA 2GJSA 3D3QA 4C30A 3AVXA 3U2QA 1P72A 2P6UA 2F55A 1XTRA 4K8OA 1X86B 5FPHA 2VSOA 4YXWA 4D2IA 1UPTA 1H65A 5G53C 3VU9A 1J99A 5IRCD 4TLAA 1CEEA 1NY6A 3QVUA 4ZV4A 4Q4JB 6Q21A 5FTKA 1FP6A 1MRSA 5KPJA 1UEJA 2WWFA 3B8HA 3J81k 3X1YA 4PQFA 4TYNA 4DDWA 3ZDQA 4JT2A 1KDPA 2VTKA 3GLHB 4DSTA 3QKSA 3B6EA 1XDBA 4FCVA 2O8CA 5P21A 4C0JA 2N42A 5D3QA 5L3VA 4AURA 1C1YA 2HCBA 4C2UA 5FPTA 5SZHB 1L7VC 4HZUA 4UNNA 3A1WA 1XTJA 1WBBA 1FQJA 2ATVA 1I4LD 3EZ7A 1RIFA 1R6BX 4M1TA 3I3SR 2XJ9A 1W36C 1XMSA 1SXJB 2DWPA 1M1YE 2ZE5A 4KSBA 1WA5A 2QQ0A 3ZD6A 3ICQB 3QF4B 2W83A 4LUCA 4OQFA 2WZQA 1EFRD 3Q72A 4XOIA 2ZXUA 1ZM2A 1NBME 2F1HA 4FMCF 5JCPA 4DB2A 2O0HA 4HI0E 2WICA 2R2AA 4OQXA 1QHGA 3MJHA 4IVPA 1XPUA 1DAGA 2GF9A 2XNDD 2ZUBA 2D2FA 3GEHA 2O0JA 1AZTA 2D7CA 2BKEA 4WZBE 4TMXA 1FP7A 1TF2A 5JWOA 2RHMA 1M7BA 3AKCA 5FPYA 5JHGB 1CJVC 1NN5A 5CYOA 5GJCA 3WP1B 4LYFA 4F7WA 3R9WA 3GEEA 4DUGD 4BFSA 1YJ5A 2W0SA 3ECCA 1AS2A 3QPUA 2IYUA 2G88A 4II7A 1TQ6A 1NN3A 2CDNA 5L3QA 2XZPA 4B6EA 3MWLA 4D81A 1GSIA 3OFND 5AUQA 2YZ2A 5TDHA 1KYIA 2GETA 4LY6A 3SDZA 1CS4C 4JT4A 4PO9A 2C99A 1S8FA 2KBEA 3TW4A 1FTNA 1FMLA 2NG1A 5TB5A 5C46F 2J1LA 3WMFA 1XZQA 2NPFA 2RGNA 2QMHA 4HLCA 4B47A 4FMCB 3WRXC 2BOVA 5EP4A 2R6CA 4PAMA 3SYNA 2P3SA 1P2VA 3OEHA 3SJZA 2OILA 3T1OA 1FZQA 3DEFA 4QJ5A 1KY2A 4EFLA 2WIBA 3TW8B 4RCYA 1JB1A 2CLSA 2EFDB 3T34A 4TL7A 5B58C 1KSJA 4PTLA 2IYSA 1KI3A 4PC6A 4ZDIA 4R7ZA 2EFGA 4M1SA 4JL8A 3NC0C 3TK1A 4RZUA 2A9KA 4OJKA 2FFBA 3NHAA 1BMFD 3EWAA 4BWYA 2X1VA 5HCIA 4EKDA 4BZXA 3KJIA 4A8JA 2YYZA 1FX0A 1F2TA 4V0OA 1VCMA 1XTSA 1NLYA 3HP1A 4LZZA 5C1BA 2OBNA 3CWZA 1S96A 3MGCA 4URUR 3K53A 2RB4A 1Q12A 4IKEA
chains in the Genus database with same CATH superfamily
2RHLA 1W4AA 2FWBA 3IPAA 4EF4A 1DXOA 1DQSA 4BU0A 3KAQA 3ZU6A 2ZRHA 1RQNA 3PR2B 4QQFA 2B20A 3THYB 2OV4A 2IEDA 2I87A 2N9UA 2FSHA 4D0GA 3GL9A 3IUEA 5CM9C 3G2OA 1KSGA 4F2PA 5EY5B 2OHOA 2W43A 3JYPA 3LHIA 5FD8A 2NTVA 1KGSA 2JHAA 2VXYA 1W36B 1E3MA 5GM1A 5COQA 5I7WA 4ZCTA 2XDQB 1NNUA 2H2FA 5JJBA 4QASA 1UR5A 2CLIB 1R0WA 3E0XA 2EXXA 5AXBA 3FMIA 4BKOA 1E0JA 1TCVA 4R2WA 5AM0A 1XMJA 2AN5A 3D8RA 2H2DA 5GVRA 2ZPAA 3IQFA 4B6SA 2LUOA 2AJBA 3N6RA 3W2HA 3SXPA 2CLOB 1WZCA 2FGJA 4EVQA 5EJEA 4Z8XA 5E7JA 1ZX1A 2RBEA 3V7WA 2NTJA 2V54A 5CIQA 5K4GA 2XT6A 1ZH0A 1E60A 1TK2A 1FS5A 1EFCA 2M32A 4KDFA 3D7LA 5BMVA 2W93A 4OOFA 5A7HA 2HAEA 4ZRMA 2F64A 4LJ4A 3DAGA 3IURA 1ZRMA 4DTCA 4ZGGA 3GT3A 3MBIA 5CT8A 4B4DA 1FJ2A 2PU5A 3ICEA 1DQZA 3HEBA 2FGKA 1CX9B 1PG0A 1QHEA 2ZJ2A 2G9UA 3UV7A 1JJ7A 1RQPA 3TEMA 1P77A 3VTKA 9LDTA 3CVXA 4ZI7A 3PXAA 1JH9A 5TVGA 1FU7A 1RWVA 1KAQA 2D06A 1E7MA 4U7HA 1OREA 5LJIA 1XR3A 4WY5A 2JG3A 2R25B 5BRAA 1T3ZA 1G42A 1UKVY 1PYDA 4PC3A 2W48A 2O14A 1LDEA 2H9AA 1V4BA 3HUDA 3FZEA 4IXDA 4QECA 1N0UA 5DSTA 4M2LA 3FCYA 5FUVA 4AJ1A 4BFCA 1F8YA 4G5HA 2Y1FA 3OJWA 4X6XA 4RA9A 4ZQGA 2CXUA 4HJXA 4WV3A 4BNXA 3HYTA 2XD9A 2R8XA 2VTBA 1UM9B 3PS9A 1ONPA 3DBIA 2ZR8A 4HVTA 3UT6A 1P80A 3RRJA 1ZR2A 1RM0A 3T52A 2J9XB 5H0IA 4I50F 3P4XA 1WHSA 5AT1A 1IZZA 2OV6A 2YFKA 4D8UA 4TVOA 1AHIA 3SF8A 2PLRA 3ZS8A 4M1EA 1EVJA 4LXGA 4ZOCA 1ZNZA 5GONB 4GDMA 4FOTA 2VR1A 1E79A 3OHPA 1NM5A 2DRIA 2R8RA 2D59A 3ZQUA 4YCSA 4E6PA 1TPYA 3KLBA 1HZJA 4KQFA 3PXXA 1I3KA 1IIRA 3KZMA 5TGZA 4OQ4A 1EG2A 5TGDA 1JBQA 2J9ZB 2WW8A 3IULA 2B8EA 3PQ6A 1T13A 4BNGA 4E11A 4I4IA 1YS6A 3CURA 1G2QA 5CGZA 3CW9A 4HTAA 3D3JA 3WNQA 1JDJA 3QEKA 2DH6A 4KE6A 1VYUA 5IM4F 1V71A 4XWKA 1HUQA 3Q8LA 4QGAA 1ZUHA 4YT5A 4V1CI 1J21A 1WBJB 1ISPA 2C59A 5FUWA 5HG0A 3W05A 4L4ZA 5K8CA 3QWBA 5BNTA 1Z8NA 2YIMA 3LRTA 5T5QA 2K4MA 1Q19A 2XGSA 3P97A 3TGWA 1YAHA 3SKYA 1OILA 4LIPD 1U0RA 1S3IA 3U62A 3CINA 1BXZA 4R1MA 2O4CA 1WCV1 3ZZNA 2RARA 2QMEA 2WT4A 1A9RA 1VI6A 3EDQA 1VCIA 2ECQA 4PVCA 3RT7A 3ZD8A 1NI5A 4GRIA 5EYPA 4QFDA 2V7BA 1P5HA 1W47A 1N4AA 4CQMD 3PWZA 1G5PA 3FVWA 3K4PA 5K8VA 1T8WA 3AWDA 1GN9A 3L8FA 4KIGA 2Z3WA 1S2GA 3R7FA 3LTEA 2MSDB 2WIAA 3OIGA 1SC3A 1MH9A 2R6GA 2XAUA 1R4MB 2AJ8A 3SZ3A 3RC8A 4IQ4A 3T0FA 4ETMA 3MTDA 1W2GA 5JSUA 2ZSDA 4E3ZA 1WB6A 4XVQA 4E08A 1YZYA 4LNUA 4JXXA 3PT9A 5YASA 1B8NA 1OXKB 1Z8FA 1L4NA 3LT5A 1L8LA 4TTTS 5AW9A 4R9SA 4YHHB 1EKXA 3V8RA 2A0KA 4UASA 2VPWA 5SYNA 1Z4QA 4H7KA 3AM3A 3IP8A 5DTQA 3C5CA 5I9IA 2PYDA 3GA0A 3N8DA 1NLZA 1MOQA 1V2GA 2F8MA 4KH0A 3WBKA 4ALNA 1DAIA 2YWDA 4H6XA 4UVIA 2QX7A 3KQPA 4P36A 5G4KA 3NRCA 3IAFA 3EFEA 1O95C 3BDAA 4HAVA 3RFCA 3WWDA 5D85A 1R8JA 5ADVA 1Z2NX 3QUBA 2LWIA 1E32A 1X1CA 4JENA 4OQNA 5AI8A 1YIDA 1NDUA 3L0CA 4P82A 4F60A 2Y05A 1K6MA 5EZ6B 5T8KC 1XRQA 3NATA 1HSZA 2QZJA 3JAKB 4XM1A 2XTAA 1O95D 3GQBB 5HVNA 3VYRB 1WOMA 4CDNA 1DJPA 2EW2A 5JNVA 1VGRA 2P0EA 1GZHB 1PWXA 1OYVA 1YZFA 3PNQA 3TINA 1TM5E 3WWOA 1XXLA 4DNQA 5DCWA 2I33A 3BG5A 3ZDYB 2RC6A 3JQRA 4G1CA 2CFOA 1PD1A 2O3QA 1S89A 3GUZA 3R3WA 4UATA 4ZDWA 1OASA 3DGFC 2QMUA 1EP3B 2G4LA 2WFLB 4EI2A 1FA9A 4Y0NA 4KODA 1H69A 2X5JO 2QL5A 1ZGJA 4DW8A 1HFKA 4U7TB 2XMGA 1N6KA 1CQIA 3GEPA 5LU9A 1CVIA 2OC4A 2PVCA 1XDGA 1M1XB 1TZMA 2G04A 2Z98A 4MCHA 3JY6A 2OHIA 2VQ6A 3RLFA 4DIUA 2OLJA 5CLLA 2XMCA 1A97A 3R3UA 5FYDA 1ZNXA 1JLLB 2MJLA 1W75A 4UQLA 4TVSA 4X24A 3TGLA 5DM0A 3FOWA 1T9KA 1V3UA 2PWAA 3NM5A 4C21A 3BHIA 1KVUA 5DIZA 3S55A 3S28A 2M6RA 3VSDA 1XIVA 3WYGA 1CULC 4ZAXA 3CSUA 1XV5A 4MMYB 3B78A 1R6DA 4ETNA 1VL8A 5HM8A 3ZN2A 2A5YB 5FBZA 5BVGA 1O77A 4QYXA 4TS3A 2W58A 2PEZA 2VJLA 4UW9A 2ZI7A 4EA6A 4PV7A 1SXJE 3ROGA 3VX4A 4EECA 1Z25A 4LV8B 1UDCA 2ZBQA 3GRAA 1G7RA 3PSAA 2BMAA 3LRXA 3O2NA 4JX9A 3QEOA 4BNVA 1C50A 4L74A 4P35A 4Y6OA 1L9XA 1HE1C 1G16A 1YJBA 2PH3A 3N28A 5HQTA 3L05A 2WYWA 5U4XA 4AULA 1PJ3A 4N0QA 4PLFA 1TYEB 3OZIA 1KJ8A 5AJHA 4AN4A 2W8BB 2FSPA 3CLUC 4LJ8A 3EVEA 1SUIA 1LS6A 2HJRA 2VA8A 4IO1A 5HRCA 5KIAA 2VDUE 1TM7E 3HVKA 3AOGA 3BCSA 4ZOLF 3TF5A 3H19A 3OTQA 4TQAA 1RTTA 1E20A 1M2EA 2PL3A 3OP4A 3EC2A 3F97A 4KEAA 1OX5A 1W4LA 4WXHA 3KVVA 3U49A 2B4QA 1UPXA 4XI9A 1HYGA 1TU3A 3IC5A 4BFZA 1NDQA 3B53X 5JT1A 1C8LA 1NXTA 1M2GA 5JD3A 4WBNF 1W49A 3CLVA 5AJZA 4YTEA 5A4DA 5JAHA 3URKA 3O90A 2VT3A 2PS3A 4PE5B 4A2WA 4QNMA 1FZTA 2RHOA 1YR8A 2X8JB 2W2PA 5IP5A 4B71A 1M2JA 3V55A 4X84A 4ALJA 2AMLA 2WSBA 4LW8A 1NSYA 3ZY3A 4EFDA 4G23A 4JUIA 2BMFA 4U9IS 3D6VA 4UREA 3FY4A 1NC3A 3MAGA 4QOHA 1BFKA 2BEWB 4CM4A 2DEUA 3FPAA 1E4YA 1KK2A 2UVPB 5KTOA 3IBYA 1OVGA 4UU0A 4ZPJA 3RC7A 5JXWA 1XMQB 2Q29A 2Q3MA 3B9QA 3ZKWA 1ZYUA 1A5AB 1KY4A 4OP1A 3KEGA 4RS3A 2NTNA 3P1JA 1VZ2A 4IIUA 2RGCA 2XMRA 3D1LA 4P93A 2EZUA 2WU1A 4EVSA 3UMSA 1CY7A 5CXQA 5A0TA 4TTJA 1IN6A 4DV0B 5LUAA 1AS3A 2EW1A 1S02A 4Y9SA 5BYBA 3W2EA 1ZOIA 2B8TA 2WUDA 2FZEA 1XP8A 3EC1A 1SXIA 2QRJA 4KXUA 3GCGA 4U2EA 5J2TB 3QSYA 3UG7A 3AFHA 3CRNA 2BEVA 4BATA 1TDJA 2I2BA 3FTEA 1UPUA 4FSDA 3DQZA 4R5MA 5FOQA 4Q5IA 2GB4A 1RWKA 4C4TA 1G17A 1Y8QA 4KPUB 4XASA 1LTQA 2WUEA 3IILA 3R5FA 3V8QA 1HTWA 2QIPA 3IKMB 1JR2A 3KTDA 4O2AF 4MI3A 4EARA 4EHHA 5K20A 3HMKA 5BQ5A 1RHJA 2PVSA 3VH4A 2QX9A 1G0NA 2OGUA 1M3SA 3R9XB 2J3EA 2O0MA 3P96A 3R8FA 5KSYA 2ECPA 2CNDA 3BQNB 5JADA 5CA1A 1LQTA 2O8VA 3T9DA 3QVGB 1Y9AA 1QORA 4UUQA 5FWAA 1G8MA 3VBEA 3WO0A 4C4PA 2VTVA 4EEZA 1XPOA 3G2JA 3LW7A 1VA5A 1ACJA 1NUTA 2EF1A 2YBDA 3RIGA 4BUCA 2JI8A 2BTEA 3AU8A 1YTLA 4NKRA 2COEA 3IEUA 4HDKA 1T25A 1YDFA 1MBZA 4DJEC 4CIWA 3D6NB 4HDNA 1D9ZA 1JLKA 3ND7A 4JS0A 2ZUFA 3PSHA 4N6GA 3LZDA 5A3VA 4D7AA 1W1UA 2VNHA 3ZC3A 4NPHA 3ROXA 3UWKA 4ENRA 4Z7QB 2H00A 1KK0A 2Z3VA 3TLKA 2RI0A 1KF0A 3ASUA 3KJZA 3T3OA 4Y6SA 4Y9UA 5KC8A 4MVXA 5THKA 3WWCA 4AX4A 3D1VA 1XKQA 4CG2A 1A5ZA 1S0UA 3KKEA 3L02A 2PJDA 2ANCA 1NVVR 1V6CA 1A8QA 4PLPA 3NG1A 2FSUA 1I6KA 5AHWA 4LOIA 1KYZA 1BH2A 2PS1A 1X9HA 3JVVA 2AFRA 5DP1A 3DM9B 1U7XA 3WADA 4TV9A 3WLPA 2VUSA 5IASA 3B6JA 5FUQA 4HVCA 4OU5A 3B1KA 4FGWA 2FWPA 2ASVA 3P26A 4WNYA 4G97A 2WHEA 1E3JA 5BOSB 2IEZA 4BFLA 4H0NA 1YWGO 1IHPA 1JDUA 1VE9A 4H9GA 2J4CA 1N7HA 3IP7A 4C6TA 1L8QA 4J16A 1GKYA 4MITA 4LV5B 2Q49A 4HQKA 1BE0A 1Q3KA 3DNFA 1AKQA 2VRWA 2PGIA 1JSCA 1RHUA 2ZI9A 2YINC 3NV9A 3LUGA 1B14A 3OPYB 4CYMA 4J0FA 1GQRA 1M67A 5TMDA 1QHNA 1HE5A 1AGXA 3D7SA 1IBKB 4FOPA 3ZHZA 3LLVA 1QQBA 3RVPA 4RORA 1O6CA 1Q6ZA 2C9YA 2I67A 3GD5A 3PWSA 2FFJA 3ML1A 4LBWA 2IS2A 4YS6A 1B42A 1RCFA 1EDBA 2PFGA 4ES6A 5FJJA 5BYAA 2REXB 1DSSG 1CR4A 2X0EA 4KQ9A 1QH9A 5ESRA 1I6WA 2P4QA 2QJFA 4LI0A 4ZODA 2W6NA 3MGBA 1GG2A 4LE2A 4ZK2A 1ENYA 5A5EA 4S1VA 3EDYA 4IWYA 5DT2A 3P0FA 2FN4A 2ZYGA 1GTSA 2QG9A 3A70A 2W2NA 3TLZA 5KC9A 5C4IA 4JZYA 2DLCX 2GH1A 3GLHE 3C3WA 1EB8A 3AVQA 1YFLA 1EVQA 4EJ2A 2FZCA 1Y8QB 4FIZA 4BCBA 4RA6B 3N87A 1Z08A 2W2KB 2XE7A 3DL7A 5A02A 1MT0A 1M2NA 2CZCA 1UOPA 5FUBA 4K2AA 1O5OA 2CB9A 3IIJA 2QK4A 3DVSX 2GK3A 3ETJA 4KLNA 4OQMA 4Q19A 4YDRA 4F4JA 5KMGB 2WMOB 3B1FA 4MWSA 5K2OA 4MGEA 1HZZC 4CKWB 3WRYA 1YBMA 2ZT5A 3RUDA 4G81A 1R1DA 4EELA 4UBLA 4WX2B 4JMPA 1WVIA 2XOXA 2QTCA 3VZPA 4TTSA 1CERA 2W6ID 3Q3GE 4Q12A 2QUIA 4ZVVA 3W6PA 3PXDA 2I03A 3LY8A 4FUQA 1E89A 4HPJB 4RK6A 1WDLA 3MJTA 2C5FA 2IVZA 4R8KA 2EKPA 4F2HA 5HQ3B 2P6OA 2P9YA 4AAYA 3CVYA 1U5AA 2Q3LA 1KFJB 4HDNB 1DUIA 4N3BA 5TPZA 3UWMA 2VC2B 2XOKA 3ORFA 3TIVA 1KEWA 3CEJA 3DYBA 4X20B 1PZFA 5DLQC 4JP5A 2JJ8A 1F7VA 4GM1A 3FMOB 3VAAA 2QTVA 3PA8A 5CVCA 3OFNA 5MFZA 2ZAYA 5KHAA 3WGQA 1WP9A 4FHGA 4Q3EA 4BBJA 3KL2A 2WWYA 2XY4A 1BGVA 1KAOA 5ALUA 1CEYA 1C3OA 1CVLA 1OLOA 2EKDA 1AV7A 2OGZA 2W11A 3B8EA 2BP7A 4HQLA 2O23A 1NL3A 4KX3A 4BRWA 2O8DA 2MHCA 1M33A 2IGTA 4FX2A 4MR9B 4BMSA 1M8FA 1NJ5A 2CMGA 1JQDA 4EPTA 2NZ2A 1XEWY 4K3UA 4KR0A 4LRYA 2XUZA 1KBQA 1Y3FE 2IYWA 4IIBA 1QC5B 2PL5A 2FDCA 2FPIB 1AGPA 1SIWA 2HSGA 4TKZA 3P9XA 1ABFA 1ZU4A 2ZS7A 3AFGA 5A7FA 4PC7A 1ELOA 3WK7A 2R1TA 1ZHOA 3IAS6 3N7AA 5DO9A 2VSXA 1KJ9A 4PLTA 4L8YA 5IZCA 3NEYA 3IUBA 5IZCC 4CM8B 1XVIA 4QOFA 5FJIA 3A26A 4F3NA 1P3DA 1B26A 2EKLA 2VDLB 4UBMA 1S3FA 2BMWA 5KQPA 3LDAA 1R4AA 4ASUD 1XVAA 2V3VA 3LGAA 1EAYA 4ZAZA 2C2KA 2HA2A 4M60A 2Z0MA 3L0ZA 2EARA 1XZBA 1QVZA 1O97C 4PGHA 4R7GA 4GG1A 2J87A 3L06A 5FUXA 2WQ6A 2I91A 5LB4A 4QUJA 4YMIA 4G8BA 4YRKA 4EENA 1DCTA 3CWQA 3GROA 1COZA 4M37A 2H1WA 4Q1CA 3G1WA 4PSCA 4DDHA 1DG9A 4OHCA 1G55A 2LIVA 4ZZIA 1Y9ZA 5H81A 5JY1A 2UU9B 3LLMA 4B3MB 3QPVA 5EG5A 5KX5B 5EKDA 3G89A 3ME5A 3RS8A 4XAQA 5IAAA 2HMWA 3Q3EA 3PUIA 1TLFA 3WYDA 5AW1A 5BSUA 4EW6A 4WINA 1KZ6A 3VDQA 4YXWD 5CDSA 3KOWA 4I1YA 1E98A 4KFCA 3MD9A 3WLQA 3NWEA 4Y1RB 1YMUA 3N53A 4J94A 1K7FB 4LPKA 2C57A 1ZRSA 2J6HA 1JDPA 3E4CA 4J29A 4JH0A 4PONA 3WK6A 4AKHA 1TVMA 5IKOA 4TKUB 4NULA 5K0EA 2VATA 3D1JA 4URZR 2AG8A 3UWDA 4B6JA 4HMQA 2OCXA 4N7RA 1OI3A 4XJTA 2V6FA 2X0KA 4PHFA 5AUPB 3Q12A 4LF8B 2XGOA 4I6GA 2HD4A 1N1GA 5TLSA 4NS1A 1GRQA 1Y37A 2BMJA 2XSZD 4YUYA 2QLLA 1QCYA 4DQ0A 3B9PA 4HNHA 1KE1A 2JD1A 3OM8A 3MWJA 3SX4A 4UM8B 4LZJA 1YJ8A 5F4ZA 3RJ9A 5A4FS 1IMOA 4KG7A 1SB8A 2DHRA 1EGHA 3C7TA 1ZVVA 4PXSA 1G5RA 1PX2A 1V48A 2Z8ZA 2ZSFA 4PRZA 4EKYA 2J9FB 4ND1A 2PUAA 4BLQA 2XA2A 4X91A 2P2GA 3LYHA 1XLVA 4XR4A 3MWFA 4REQB 1XZKA 1P29A 3NASA 3TBKA 4DXHA 2JHGA 3AF3A 4AY2A 5KTYA 1CDZA 2P1RA 2F67A 2HIHA 2J7PD 1YRQA 1YZLA 1WABA 1X1RA 4G1MB 4BZQA 2GM4A 1K0UA 1XJWA 4GAEA 3GP5A 5FPPA 3I42A 4S0ZA 3CPJB 5I9BA 2H4XA 1TQ4A 3K5PA 3R3ZA 2Q1WA 5KYXB 3DCNA 4AO7A 4DNPA 4CU2A 3P8ZA 2CJWB 5D1NA 1E4EA 1FTYA 3HKCB 1L5NA 4D9GA 4N3GA 1QPGA 5HK8A 4HYQA 2A92A 3HFJA 1U04A 4HEHA 1IPEA 4EABA 1EJBA 1U9IC 1SCDA 4A0HA 1P1BA 2FWRA 3BTSA 4Y1GA 3LP5A 3GGCA 4DV4B 4UDYX 3DV9A 2WYVA 1U5BA 1V45E 2AVNA 3AJAA 4LCBA 5E1DA 4UJ5A 4KHZA 3H75A 1NOIA 1FQKA 5FORA 2P2LA 2HPHA 1ESEA 1WPRA 3LXMA 2ISQA 2ZSIA 1VMKA 4UEWA 1W4BA 4TRJA 1MT3A 2YMMA 3EXHC 1HTTA 2PTGA 3MTAA 4BNWA 3QP9A 5K6AC 2NUBA 1FDUA 2F4VB 3I09A 5FI3A 2GBIA 5FTWA 1PGJA 4M49A 2ZCVA 5FI0B 3C3AA 5IWCA 4N4AA 4QAQA 3DGEC 4O5AA 3VFDA 2HX1A 3T5TA 3ZE0B 1G291 4U7WA 4F9GA 1V3QE 4C6HA 2OY0A 1YI0A 2IYYA 2WINI 1HLDA 3NHSA 2BTQB 2ZWAA 1E9VA 1A2BA 3LWDA 4JT9A 4Q0MA 1DBWA 1BXRA 4QQNA 5HSGA 1OUMA 1ZW6A 1USVA 2JW5A 1EE9A 5KAMA 4CIYA 1YTUA 3OZBA 2WVHA 2DH5A 3OE1A 2C9MA 5HJ2A 3WBBA 2YQZA 3FBGA 4C7JA 4QFCA 3CNEA 5KKNB 1IXYA 1R88A 4L15A 4EY6A 1ZR4A 1ZP6A 4ZMBA 2IDZA 2QGNA 1EWTA 4L51A 5HJEA 1XK7A 4GOLD 3MK31 3O21A 4NATA 1EWYA 2WJGA 3OX2A 2I54A 2RJ3A 3K8OE 3WYNA 2Z2XA 3K2BA 4OI0A 3CCFA 3T4XA 3AR6A 4ZTBA 1FBNA 4F2GA 3EVGA 4JJ8A 3ZG6A 2ZE8A 4AYWA 3QUTA 4RE5A 2A33A 5BVHB 3OEEA 4PQRA 4ILEA 2ZRCA 2OLEA 4JLMA 2AUMA 1OBFO 1NUSA 4KFRA 2ZYAA 4Y67A 5I9NA 4QULA 2B82A 4GYWA 2G3YA 4Y7DA 1YDGA 4BASA 1R8QA 1OLSA 1Q6YA 1L4BA 1M6VA 2ENWA 3QU5A 3HKDA 4JLBA 1NXWA 1T8PA 3DB1A 4DMFA 1QFZA 3MTBA 1UAYA 1XKTA 3W5JA 2V7VA 1F2DA 1T2EA 3JQ6A 5CPFA 4DGQA 4LF6B 2VH1A 1JLLA 2MR5A 3B5JA 5EIFA 1F6DA 1XD2A 4O4JB 3ED1A 3VAYA 3WB1A 4BYGA 2NQ2C 1LBHA 1PQPA 1E1NA 1N5DA 1Q16A 2GEDA 3CUEF 3PXBA 3QPAA 4R84A 3S8MA 4EJFA 5BMVB 4KXFB 2HCTA 1E9BA 1LPBB 1NV9A 1QG0A 2AOXA 3UFBA 3CSDA 3U6KA 4D8VA 5AI6A 3UN1A 3KJQA 1QGOA 1BA2A 3QELA 2B4YA 3STHA 1MC1A 1SG9A 3JPYA 5E9WA 2IUUA 2EOAA 3JW8A 2AXNA 4JBNA 5FL7D 3U80A 4D45A 4PN3A 4MGYR 4ZQFA 3TSYA 1L8XA 2OM2A 1EBUA 4BN0A 4EB6B 3KKQA 4YCNA 2KE5A 2FJ0A 3L0DA 4NV1A 2QMOA 4QBGB 2IZ1A 3FSGA 3W6ZA 3HCOA 4MTLA 5LDDC 2CZQA 2R7KA 4HQFA 4D6PA 2L69A 1OH8A 3E9QA 2QF7A 3FUTA 4HQ0A 1WPGA 3RUAA 4CT5A 1L7RA 1WF3A 4I4CA 2W2LA 2W6JA 1XL1A 1ZVKA 1PUJA 2BGUA 1H1LB 3QELB 1GFIA 1TC1A 1VGQA 2BUAA 2QRLA 3ITDA 4NZOA 4Z0PA 3RIMA 3ZWKA 4ZZ1A 3U16A 1I4OA 2DQYA 5DTRA 2V74B 3MCVA 2JFPA 5LYJA 5TC4A 4B0OA 2GPJA 2RHDA 4D4GA 2JFBA 3FZYA 2W2MA 3HVHA 4G09A 3N2KA 4L50A 1PFUA 4AKEA 5ALWA 3L82B 5CFPA 2L82A 4LVUA 2QMYA 3D4PA 4RJLA 3EVTA 4PAOA 3ZE9A 1LV8A 4BP1A 2FAXA 3BHNA 1YU9A 2H07A 3F96A 2XVMA 4LZPA 1SOWA 4BP8A 1H8HA 3GN1A 4L72A 4ALMA 2RE8A 3RUHA 1JALA 2FCAA 3AI3A 2M6KA 5C8ZA 4CKCB 1DAOA 2YWHA 4GLBA 1Y8CA 1DT5A 1I24A 1E2IA 1YOVA 5JFGA 5KYTA 1YVDA 5ARDA 4X8MA 2JAOA 3OFKA 3OOSA 1XTBA 2YQ5A 1I36A 1R5BA 4OQLA 1XQVA 2FMHA 4J07A 1AA9A 1ULBA 2TS1A 2QYHA 1O95A 3P9ZA 2O7RA 1AUVA 4AKSA 4BFYA 3TS1A 3BUSA 2A3NA 5B2FA 5INTA 2CNOA 1FVXA 3O1IC 3QXGA 3ADBA 1EP9A 3H5RA 3R77A 1N78A 3RTCA 2GERA 3H6GA 1HY3A 3VYSB 1Q0HA 4GKVA 4DREA 2GD0A 3PWKA 3EIFA 4B6QA 4ZYXA 3TM5A 4EYEA 1R0LA 5DM70 1X7ZB 4CM7A 2JFNA 1M66A 2QLMA 4JJEA 4TSFD 4WN3A 2ACWA 1AQLA 4ZVQA 2H4JA 4CFYA 1JILA 4XWYA 5DASA 3L6UA 5F51A 3PFGA 2HW8A 5EUBA 4TLMB 2I3ZA 4Q1AA 7MHTA 2L19A 4KAFA 2ZB3A 1J23A 3L4BA 4X71A 1TO1E 2PZFA 2MMGA 4G9BA 3QEAZ 1E61A 3I4FA 1CIJA 5BN4A 2OTCA 4DEYA 5EE5B 4U7FA 5ALPA 3K20A 1UKEA 1MO6A 2IIVA 3RSOA 3CRQA 1NMZA 2JLQA 4LRXA 3SFTA 4UTPA 5KTNA 1UXIA 3HU1A 3LX6A 2CDBA 4I5DA 2PQ2A 5GGYA 4F4UA 1FYVA 5DYTA 1ZG3A 4HUQB 3AL2A 1I32A 4WXRA 5C8DA 2QTFA 4Y1EA 2XUHA 4K6KA 4L8GA 2NO0A 1L9KA 4TLBA 3TRFA 2JLZA 4O3MA 1F0YA 2VHTA 1YDEA 2RHJA 3TTWA 1XNQB 3HCPA 2IZZA 3UXEA 3ZLJA 4KBFA 4Y9TA 5IJZA 1O4VA 2GZHA 4DV2B 1E1RA 1JJFA 1ZZEA 3Q8MA 1N0IA 4CR7A 1S2MA 2OWEA 3H0EA 3I92A 1BKSB 2VPXA 1HG1A 1QV9A 2DCMA 4XDGA 2H8KA 4JT8A 1UBGA 2ZUWA 4YAEA 1TKCA 2IOFK 2WE7A 3O4IA 2SCUB 3X3HA 3ZNOA 2CFTA 1UBKS 1UMDA 2PH1A 3KJNA 4ESHA 3QKTA 1VLVA 4LBVA 4QATA 2GKSA 4FILA 1S6YA 1U0OC 2PSEA 4G5FA 4E5YA 4BECA 3S40A 2PAAA 3D4NA 5IUNC 1BMDA 4P81A 4NEQA 1PIWA 4IDGA 2A1TS 5IDWA 3DONA 4JI3B 1P5RA 2QM0A 3KPJA 1JVBA 2H1VA 3OZCA 1SZCA 4YP6A 1RFGE 3RAGA 2FRDA 4J0GA 4FLMA 1WOYA 1K88A 1OAOC 3DBRB 2EKQA 1Z4KA 1GKUB 3K0KA 5ED0A 4S0XA 2HEGA 1ETUA 1R6XA 1JL3A 3MF4A 4C2TA 2B78A 4DBZA 3HYSA 4TL8A 5LBIA 4PN7A 4UTNA 2J4FA 2Z6VA 4XQ9A 2VQEB 3FHJA 1EGVB 1I0ZA 1N2JA 5G4LA 4NXNB 4KVGA 1RJDA 5FNVB 3NC4A 2CXOA 3A2MA 3EGWA 1O6GA 3OO1A 1VZ3A 2QD1A 4YRAA 3OC0A 5LNK6 1TW3A 1PT8A 3P9SA 3QF4A 2ZR9A 3HL4A 4ZV9A 3OJFA 4FDVA 1AT1A 1VRWA 1OX4B 2IYRA 5J5VA 3SBXA 4V0SA 2EWMA 3L01A 2VNAA 2Q45A 4WLEA 3A3NA 4D4IA 5CDYA 4BNFA 4I4TA 1MU0A 1Z6QA 3QITA 4G4SO 1F20A 4TQUS 3O1JC 4UE3S 3UC9A 3PQDA 4DSUA 5ITSA 5L3SB 1CDDA 5FO1A 3CXUA 4BMYA 2OAQ1 3I28A 3ZJ5A 3RJZA 3G0OA 5M04A 2J5KA 3A4MA 5CT9A 2AOVA 4FNGA 1RMQA 2B94A 1LPMA 1IJEA 1LLDA 3C5VA 3JVUA 5SYAA 2HQSA 1M1NA 1CUIA 4QHSA 2EU8A 4JC4A 2AHOA 3HXTA 4L6AA 4KZKA 2ZRMA 4DCGA 4A2QA 4I1SA 4I2NA 4XH9B 2OCIA 4FJ2A 3H9JA 1U3CA 1BIFA 4G5QA 4R1TA 4YO7A 1O0SA 1Q3TA 2QJTA 4MVJH 4W7IA 4ALLA 3NDPA 8ATCA 4R1OA 3LTNC 1FRQA 4KRXA 5E9AA 1RKQA 1P3Y1 1Y3AA 2X7HA 2RCNA 1YE8A 1M83A 3C70A 3G8DA 1H05A 1Z28A 3O8QA 4L5JA 3HM9A 2PBRA 2R8EA 2AFHB 2IPAB 5AVXA 2E5FA 2FE1A 4TMYA 5AHRA 1V37A 2IZ0A 2ZIXB 3Q5GA 3FPHA 3WE7A 3X43A 2DMRA 3COSA 1FFGA 1QFMA 2HO5A 1N6RA 3Q9UA 5ITZB 3QRWA 5FNVF 2EBUA 2ID4A 2JBAB 7GPBA 4COOA 2ORED 2H1LA 3QWHA 3PFIA 5SZKB 5HCUA 3U7GA 1FCJA 2YY6A 1LNQA 1WHTA 5E2BA 2BGRA 3V1TC 3HBMA 3E7XA 1RP7A 1VFNA 2VAVA 4KN6A 4GI5A 3L8GA 4MR9A 2GAIA 3JQBA 2VEOA 3E1SA 2Q0XA 1VSBA 2WU0A 1GGFA 1JU4A 4PZPA 4Q9LA 1KMCA 1JG1A 3ESCA 1BJRE 1TMYA 1CKEA 1OX6A 4MQFB 2ZJ0A 1M1UA 3ONFA 3BWMA 3MD0A 4JUBA 4RGBA 5K3SA 3X2FA 1B8OA 1FE8A 1GJRA 2UVQA 1M0WA 3PK0A 3V00A 4TZTA 5K4HA 2G25A 2NO7A 4TUYB 3RJ5A 3TLCA 4AUNA 4BNYA 4DLWA 3K6SB 3C6BA 1E69A 2ODBA 2ATCA 3D3NA 3HCBA 4YCBA 3UO8B 2WF6A 2B0CA 3W3AA 4CF3A 1A9TA 1LI7A 2Z9DA 3MWEB 2W6OA 1RM4A 3AY7A 1WDMA 4R4JA 1RKBA 5DYWA 4WCDA 3DYVA 1PJZA 3JQGB 1T10A 2DQSA 4P7GA 3D3KA 4KLZA 4B44A 5AKEA 4DQVA 1E2PA 1CY2A 1NF8A 2XI4A 2FN9A 4GMHA 3RRBA 3IV6A 4FZJA 3VZQA 4JSRA 2WVAA 1MO5A 5JUWA 1U6JA 4WOCA 2NUTB 3IPYA 4BE7B 3WS7A 4UU1A 3FVVA 4YJFB 1A8PA 1TCUA 3S1AA 1SZPA 1X74A 1I5OA 2CJPA 5JJLA 2CC2A 3L6CA 4A6DA 2ROQA 3WA6A 3ZGNA 1CY8A 1Z0DA 2MMCA 1PF7E 4XUDA 1RRGA 4H15A 4TSFA 1QG4A 3HYCA 3RYHB 1WSAA 1NFRA 3FOBA 1D4OA 4Z49A 3F67A 4MUIA 3M1AA 4EX7A 1P4JA 2WWGA 3T9FA 4A2PA 5JISA 3L0YA 3N7TA 1KQGA 1QDEA 4NBUA 3EA0A 4K6HA 2O5VA 1YC5A 2ZXEA 3QXSA 5HPYB 1U5CA 4MP8A 3O8QB 1LF5A 3V1KA 3BMCA 1GAWA 4EY8A 4GZ5A 4CL8A 1RR6A 2ISSD 1Z5GA 2YYSA 4RPLA 4XD7A 4Y2VA 5L8VA 4D3FA 4B3FX 4W5WA 2I9KA 4B3JA 4HWKA 4RVHA 4EMTA 2CY0A 4FBLA 3EOZA 1RWQA 4LFCB 1N8SA 1PZEA 5F3DA 4FEYA 4A73A 3AETA 5BSGA 4CCWA 3CZAA 4JKOA 5HM6A 1R64A 3RU9A 2JAQA 1RXYA 1R9NA 3L5KA 3TQCA 3C85A 4BFTA 1Q1BA 3G3EA 5EWJA 3X1JA 1E7YA 3TLGB 3LS2A 3IVXA 3FYSA 3GELA 3VPHA 4DLTA 3CLRD 4L5YA 3SEQA 3IOEA 1DKPA 3FCUB 4H7JA 3IRUA 2HMYB 2VIIA 5CGQB 2OK8A 5EP1A 5B3JA 3S68A 4NZZA 1YJAA 5JS8A 3ZI7A 4RZHA 2QPLA 1SG6A 3BL8A 3LPAA 3MWEA 1UWLA 3LVBA 3P45A 5H9WA 3AG5A 5DK6A 1RPJA 1KNQA 1TYCA 3E22B 3MB5A 4JV5B 1GU0A 1ULHA 1TW2A 4Q4HA 1VP9A 3EDOA 3MWDA 5FTJA 1ADBA 1YACA 2X9QA 4ER7A 3PGLA 1JBKA 2Q5JA 3VR5H 4EGCB 1T6XA 1AXRA 4IQFA 4V2UA 3PKIA 3A2NA 3RJMA 2OZKA 4CMJA 4GWKA 2KBFA 2FHPA 4B75A 4OX9Y 1E2EA 4MV4A 2HBYA 3QI2A 1N9ZA 2H8GA 4D9MA 1XDDA 2RJOA 1FXSA 4KFSA 3W5BA 4AVYA 4AC9A 1PV1A 2M1ZA 1YV9A 2W4MA 2GHQA 5FRDA 5AUNB 3F4LA 3H1PA 4DL9A 4HEQA 2CB0A 5EHXA 4Z51A 4BCCA 1WMBA 2R86A 1WCIB 1XDUA 1PV4A 1AO3A 2VHYA 2FMTA 3N2ZB 3SZGA 2HIGA 4Z0TA 1AF7A 1E9DA 4ZP1A 4IJVA 1FFXA 5KBYA 1K66A 3BXPA 5KHOC 5AJUA 1Z82A 1UADA 1B0AA 4P4LA 1DKQA 4UM7A 3EY4A 5KNBD 1T5IA 4FXOA 3ZJUA 1X7DA 4H35A 2ZQYA 5B4TA 1JI0A 1SK9A 4BEWA 3ZWCA 4DJ5X 2ZUUA 3IQGX 5FHRA 1EUZA 3CRW1 3VH1A 2WSSD 3ILVA 3GWGA 2CK3A 5CURA 5F1YA 5KNCH 2VYVA 4HS9A 3FJYA 1PLLA 1CUWA 2R8OA 1XTVA 4X3CA 1QHXA 3OQJA 1H2XA 2E9SA 4GS5A 3DTTA 3WGIA 5I9LA 1YJXA 3SQDA 1Y89A 1BFDA 3E3LA 4MDYA 1Y8RA 1GAQA 4Y6RA 3RTAA 4LHZA 3O4RA 1RKXA 4UDOA 3AEUA 2KHZA 3K5HA 5E8JA 3RVBA 2Q3DA 1OROA 2Y2UA 3TAUA 1E1CA 4QPNA 3G2MA 4NOKA 3RAPR 1ES9A 3DT6A 3DVQX 1OVMA 4IG4A 2GZ2A 3RUIA 4WDRA 2JAUA 3MEQA 3PLRA 5KVSA 4RMNA 2XUAA 5T4BA 2JA1A 3U9TA 4YCLA 1SUCA 4GKAA 1XWIA 1NU8A 3VDNB 1JQ3A 4LVOA 1ZMXA 2CEAA 3CGWA 1SUAA 3NYWA 3T61A 2GXUA 2IDKA 1G9TA 1D8AA 1ZN7A 1KVQA 3ZWXA 2J0QA 1XHFA 1GPAA 3OM1A 1Q2XA 3M4YA 1CB7A 3C5HA 1NP3A 3FFTA 1NBEA 4KAXA 1VBFA 1SRQA 1W5FA 3L9WA 1TFRA 4AU1A 5CH3A 4B1FA 1DRVA 3TFWA 3MC1A 3TOXA 2B1GA 3M0EA 3TNYA 1M9NA 1H0HA 3M3PA 2OYRA 1JEAA 4OFWA 4BPRA 1YDMA 3SC4A 4CV1A 2C4WA 2JAPA 4LV6A 2YMQA 1E2UA 5IAGA 2YRXA 5SV2A 2NU8A 2ORVA 3K96A