1XTKA

Structure of decd to dead mutation of human uap56
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
382
structure length
382
Chain Sequence
b'GFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDEADKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ATP-dependent RNA helicase p47
molecule tags Gene regulation
source organism Homo sapiens
publication title Crystal structure of the human ATP-dependent splicing and export factor UAP56
pubmed doi rcsb
total genus 120
structure length 382
sequence length 382
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2004-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xtkA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xtkA02
1EG7A 2CLCX 4PQFA 4HLDA 3FMFA 2Y8EA 2R6GA 2ORWA 4JLPA 4OKSA 4QM6A 2GJ9A 2IWHA 3GLHB 2J1LA 3I1FA 4M9QA 3PVSA 5AUOB 4X8OA 1KDTA 5FPKA 1ZM7A 3OFND 2ZJ5A 5F2EA 3D31A 1G291 4Q7JB 4F93B 3GJ0A 5K8LA 1D9ZA 2VQSA 3RDPA 3KDSE 4JL6A 1DAKA 2IT1A 2J46A 1AS2A 1E1QD 1KYIA 4F38A 3EIEA 2P65A 4X8HA 4ACBA 4NYMQ 3KL4A 3N2EA 2GEVA 2XAUA 2E87A 4QG7A 5KUTA 4TSFD 2OBMA 2P5SA 3VNUA 1OPXA 4U5XA 1KSGA 1IY1A 4B2PA 3LNCA 4C2UA 3D8BA 2RB4A 2CLSA 1D2MA 1E2GA 3CPHA 1SXJD 2V7QA 4IHQA 3GEEA 1OB5A 3WMEA 1QBKC 4Q01A 1YZLA 4O2RA 1E2MA 4HUTA 1PZNA 2ZYVX 4QGAA 3SR0A 3VX4A 4YMVA 1TQ2A 2G88A 4EPVA 4JBYA 1U8ZA 5SZHB 2XTZA 3W8RA 3TK1A 5FL3A 4RD4A 3B82A 5IT5A 2H5EA 1NMYA 3MG9A 1OV4A 4UNSA 5AJWA 3H86A 2P0EA 2FZ4A 2OV2A 4P32A 3FGNA 3W5JA 1Q0UA 2ZSEA 2XNDD 3S1AA 2VO1A 4RZUA 1BO6A 3KQUA 1K5GA 4KVGA 3GLIB 1X3SA 1X86B 2N1BA 2VEDA 3FHOA 5AJZA 1UAAA 1K5DA 2F3TA 4D4KA 3HYTA 4PC2A 5AR1A 5K8TA 2BBWA 3MUFA 2AD1A 5HCIA 4JBWA 1KJYA 3I62A 4HUQB 5D3QA 3FFAA 2HYIC 1CR0A 2IS1A 4ZCLA 1F2UB 2HLDA 1W4RA 2IUTA 4TYWA 2A5FA 3RS4A 3DO6A 1HYQA 3VU9B 1RZ3A 4UNPA 5JWRA 3LW8A 1RJ9B 4A82A 1XRJA 1E99A 2ZVQX 3F5FA 2YZ2A 2Q9BA 4LJ9A 1P2VA 4URWR 4M1TA 3QKRA 3TKLA 5DNYB 1E2JA 1HH4A 2KE5A 2PJZA 3A1SA 3LH5A 4LYJA 4UJ3A 4DLYA 3THWA 4RVCA 1JEEA 3S1AB 5JS8A 2EFDB 3NWJA 2P6UA 4LRWA 4MUBA 2ZVPX 3T1VA 1NJGA 4AD8A 2ZU6A 2LKCA 4KJZA 5DGXA 2X1VA 1CR1A 2I1VB 3L0PA 2BBTA 3AF3A 3CNLA 2JAQA 3NBXX 1UKYA 1G3UA 2AFIE 4D0NA 1XPUA 4PO1A 3KKNA 2IBMA 3LBHA 1XB2A 3IO3A 4DDUA 1K6MA 3NH6A 3W90A 4A36A 4PQYA 3DZDA 2MSCB 5LDDC 5AUNB 2QPOA 4O2LA 3ZD6A 2BC9A 3WP1B 4HLUA 4K81B 2DR3A 1YKSA 4LBWA 1P61B 1KI2A 1KJZA 2ZJZA 4QHYA 2W0SA 4I1OA 5LBIA 1GL9B 4F4JA 1GRRA 1NIPA 3OIVA 1PVOA 4ZDIA 4HAYA 2JGNA 3TAUA 2LWIA 3NH9A 3U44B 3KZ1E 2GXAA 1ZNYA 4V0NA 1JAHA 2EVWX 3MLEA 4BLPA 1BS1A 1II8B 1L4YA 1XEFA 3AV0B 2ZI3A 1BYIA 4Q18A 1U0JA 2G6BA 1TNDA 1ZVQA 4GFDA 5CLQA 1GRQA 1OYYA 2IHBA 1NN5A 3DM5A 3OIWA 1I4TD 1WRBA 1Z3IX 3IEUA 2F1HA 2AWOA 3NKVA 3DEFA 1P62B 1GSIA 4C2TA 1A82A 2Z0MA 5JSZA 4MDEA 1N5LA 2G1JA 5EP1A 4OQFA 3RLFA 3GFOA 2QRZA 4GI7A 2HUPA 1SKYE 4ITRC 3KJGA 4KSBA 4QKQA 3LXRA 2RGBA 4KV9A 3OZXA 5KDLA 3B13B 1II8A 1GNPA 3JZAA 1KO4A 1T91A 1FZQA 1YZKA 5JRZA 1HT1E 2ZE7A 1F5NA 5JJKA 1G5TA 4MYUA 4B6EA 2WJGA 1CRPA 4TYPA 5JRJA 2WSSD 4OI1A 1JR3A 3THOA 2IC5A 5FPSA 5FUVA 1M7HA 1E79D 2KWIA 2IHYA 2XSZA 3OE7A 2XX3A 4JL8A 3ZQJA 4ZI2A 1ZUNB 5BN3A 4UQOA 1II0A 2JDIA 3L8ZA 3ZLJA 1SXJB 1AGPA 2BEJA 1M34E 1U9IC 1R10A 1E9FA 2AWNA 2O8CA 4BLOA 5KPDA 4DCVA 2ZUBA 2BKUA 1EFHA 2FX3A 2KBFA 4KSCA 4MRVA 1QG2A 2N46A 4KCGA 1ZU5A 4PQRA 3RS0A 3LFUA 3H4MA 4DDWA 4ZCIA 3GLGA 1OXTA 3ZVRA 2Z4SA 4Q4LA 4TQAA 1NN1A 3LQRA 3J81k 5FI1B 1P7CA 5C2JB 1G8HA 3QUSA 4QBIA 1KNXA 5HKKA 2QGZA 3AF1A 1CF4A 3BH0A 1IXZA 3Q9LA 4ERNA 3BE4A 3KJHA 3Q7PA 4KFSA 4ARZB 2IWRA 4Q4JB 2CE7A 2EWWA 3K8YA 3WHKA 2YOHA 5JS7A 3ZVNA 1XD2B 5E95A 1JNYA 3TBKA 1WB9A 4C0QC 4PC7A 1S1CA 5HPYB 2W6JA 3QJYA 3DVLA 3GJ5A 5EE9A 3U44A 1KMHB 2WTUA 1S2MA 2O8FB 1COWD 3SYLA 3ADDA 4DLVA 1VIAA 2GBLC 1KK1A 4NYJR 4B3BA 2NOAA 1CLUA 4E07A 3ZVMA 1U0LA 1E9DA 2Q0HA 2XOKA 1EWRA 3PENA 1N6OA 1G8GA 2ZJOA 3U6BA 1T6NA 3ETLA 4BUJA 1G20E 2CEAA 2OE2A 3IBGA 4Q9IA 4DDTA 2BDTA 2WJVA 4EJSA 4E5UA 3EWAA 1IN4A 5FH9A 1W36B 3PIRA 1KI6A 1HA3A 2VF8A 5FI0B 1MO6A 1G8PA 4DCUA 4NCKA 4W7SA 4QNMA 3PITA 1IQPA 1SVLA 2LCFA 3NVAA 3ECCA 1FFHA 4PHFA 3HWSA 1OKKA 2GK7A 3MMPA 2IF2A 4Z8XA 1GWNA 3A58B 2CMKA 2GCOA 3QVUA 2H7VA 5L3VA 1BH2A 1QVRA 4DC9A 2XZPA 1H8HD 3SJCA 1GP2A 3TR5A 3EC1A 2CVFA 4HAWA 3KUDA 4M9ZA 4HZUA 4JT4A 4A92A 2REOA 4W5JA 1GOTA 2OFXA 3MWLA 5EP2A 5AWFC 4B34A 3UWKA 3QXSA 4FWTA 2JLQA 1DAIA 3IHLA 3PUVA 4HATA 1ZM3A 4KITB 3EZ6A 4TLBA 1E9BA 4LOAA 1WBDA 1XPRA 3QE0A 1XPOA 4B32A 4G5RA 4URUR 1DAHA 4DHEA 5FR2A 1JQLB 1E1RA 3KXIA 2ZJ8A 4OQXA 4Z8YA 1KI9A 5LB4A 821PA 5KYKA 1GL6A 2PMKA 1CR2A 4OK3A 2F43B 4IVPA 2PCJA 2K5UA 2YYZA 4Q1AA 3F3YA 2F3RA 2Z83A 2ZR7A 3I5YA 2O8DA 2OXRA 1G3IA 4CEHB 3RWMB 1TTTA 3HPQA 1GNRA 1U0HC 2ZYUX 4JVLA 1OFTA 4QBGB 2VSFA 2F9MA 2YWFA 3GJ3A 2C96A 1R0XA 2PL3A 1YJ5A 4DUGA 4KODA 3IPXA 3X1WA 1CP2A 3SYNA 4BGDA 1DO2A 4N3NA 3CNOA 4IKEA 4M0LA 3TGPA 3O8CA 1D8TA 1IY2A 3UMRA 1E2HA 4AKHA 1T0JB 4D4JA 3A1TA 2J0SA 2HEIA 3I3SR 3SHWA 4OI0A 3P4YA 4C7OA 4FINA 2ATXA 1Q3HA 3BBPA 3IGFA 4M1WA 4FI3C 4QHSA 1Z47A 3ZD7A 3GP8A 3TLXA 4ILEA 3TNFA 3A36A 4MITA 4LHWA 4TYQA 3BH6A 1W0KD 2OO7A 5EJEA 4DRZA 4DWJA 4CEIB 3FKSA 4U7DA 4GSYA 1XXHE 5TARA 1DEKA 1XJCA 3T5DA 3K53A 3RYTC 4IDHA 1AS0A 2J9RA 1O87A 2GF0A 2QROA 1OIXA 1XMJA 4ON9A 5HKKD 5K8UA 1NNEA 3R9WA 1CU1A 1ZMXA 2ZI6A 3CW2A 1ZIPA 4ZDJA 4C9BA 2EW1A 2JLVA 1N5IA 2EFHB 4L16A 4CDGA 4H9GA 2J59A 2GTPA 5CIWA 2NO0A 2JLRA 2QI9C 4KBFA 5BWMA 2DHRA 2ZAMA 1IAQA 1DS6A 2ZE8A 5LB2A 5KU1A 3ZDQA 2D3WA 1RVDA 3KKPA 2QAGB 4OK5A 1MO4A 1E2NA 2CL6X 3QEOA 1KJWA 1KOFA 1KSHA 1OLOA 4BFTA 3AB3A 4NPHA 3AP3A 3CZPA 4QNRA 3OE7D 2FEOA 1TUEA 4GT1A 5IF9A 1YHNA 4LYFA 4EKDA 1R8SA 2WKQA 1KAOA 3I72A 3THXB 2J0QA 4D81A 3QKUA 2ONJA 3B60A 2BVNA 4Q9LA 1G19A 1WCV1 1XMIA 3A4LA 1XDBA 3BXZA 4A4DA 5FPYA 1CTQA 5L3SB 1AGRA 3P27A 3QPUA 5C1BA 2A5DA 2ODNA 4PC3A 4GZMA 1W0JD 1QHHB 4J0QA 5C4MA 1PLLA 1G16A 2O5VA 1GITA 2V9PA 3BS4A 5DI3A 1TL7C 1X1RA 2FFAA 4TLCA 4IOMA 3TQCA 2YC2C 4RD1A 3WRYC 2HXYA 2XEXA 4FWIB 4AK9A 3K70B 2QBYA 4LDJA 5EUQB 5KO2A 2JJ1D 1NBME 4NH0A 2IUUA 4OQLA 2WOJA 5BYKA 1PLJA 2CHQA 1XZPA 1PUIA 4E09A 1XBTA 1Z6YA 2FU5C 3X2SA 1A2KC 5FUWA 3ZYCA 4PHTA 2BWJA 3TE6A 1LS6A 5JI2E 1F2UA 1YQTA 2C9YA 4LGMA 4AYTA 4G0NA 1DELA 2V6JA 3HR7A 1WE2A 4GMDA 1DAMA 1MR3F 2GZHA 2D62A 1E4YA 2GAOA 2XB4A 2IXFA 3QXHA 4XJXA 4C30A 3U3RA 2FGKA 2NTYC 2XTMA 1HTWA 3QOFA 5J5CA 1R2QA 4K8OA 1ZM4A 2BCJQ 1QHHA 4TWZA 3CLVA 2DWOA 3ZZ0A 3WYFA 2P5TB 5DI3B 3GLFA 1Q3TA 1NVVR 3ZGXA 4OHXA 2OG2A 3SBDA 3ZS9A 2D7CA 4EPYA 1Z83A 1A1VA 1JAIA 2JCSA 1A2BA 2FH5B 2NGRA 3W3AA 1V43A 3OEED 4C0SA 4YMWA 1NLYA 4PAMA 1UBGA 4FN5A 5JCPA 4LC0A 3N70A 4C4PA 3UXMA 4GP6A 5FPTA 1SZPA 3IQXA 3B1XA 1QF9A 3G82C 5A0FA 2IYSA 4DLSA 1U8AA 4YMSA 4B3GA 2DWQA 5KSOA 5F3WB 1N3BA 1NKSA 2P67A 5KSYA 4II7A 2AR7A 4NBSA 1ZD8A 4XWOA 3ICEA 1W2HA 3GJXC 2GK6A 1HEIA 5EXPA 4X8MA 3HDTA 3GLFB 4GOKA 5CLLA 4HAVA 5HTKA 1YRAA 3GLHA 4TZ6A 2FGJA 4LY6A 2HF9A 2WJJA 2XTNA 421PA 1U2RA 5D3MB 1XJQA 3EPKA 3FMOB 1J70A 5CJ2A 1ZUHA 3NDPA 2R8RA 3LVQE 3CIOA 1XTQA 1KO5A 3DPUA 4U00A 2J87A 2A78A 5TY0A 4A1FA 4Q7LA 3ZIAD 1Z6GA 5FL7A 1F60A 4XVQA 4CEJB 2F7SA 2D4HA 4KFUA 2WPDA 4TL6A 3EAQA 1YR7A 3TQFA 2WJYA 1N5KA 2B21A 5H8WA 1ZJ6A 3O8RA 5TB5A 4IOJA 2JJ2D 2QMOA 2ZSBA 2PH1A 3QBVA 4QOSA 4WXPA 4PR0A 5TV2A 2GA8A 1KDPA 2C78A 3DM9B 3UATA 3EPJA 4KXFB 3K0SA 1NI3A 1SXJE 2JIZD 4FCVA 4EFMA 1Z0KA 2NO9A 4TYYA 1FL9A 3MGCA 1AK2A 1VIYA 4QXAA 1UBEA 1W5SA 2FFQA 2FZLA 2QA5A 1WA5A 3OEHD 2QMUA 3E2IA 1JXOA 1XEWY 4PPGA 2Z4RA 5KOYA 1G3RA 1DE0A 221PA 4Y0VA 5EE3A 5L3RA 2KBEA 1GDDA 1NLZA 2KI5A 1OXSC 3T1QA 2ZM5A 1AA9A 1KI3A 2XJ9A 2RCNA 3T06B 1FUUA 2YC4C 3AF4A 3VR2A 2O0HA 2QQ0A 3TSOA 2QSZA 2ZRHA 1ODFA 3B6EA 4OK6A 4BPBA 5FTMA 5KNCA 1ZIOA 3UIEA 1JR3E 4M1SA 3GEHA 1VECA 5DIFA 3TVTA 3CO5A 1E2QA 4LUCA 2H92A 4AKIA 2Z6VA 4EPWA 3BAFA 3DDCA 3E5HA 2JLXA 1QHNA 2BHRA 4EAQA 4TZ0A 4PO9A 4RFSA 4IDOA 1KIMA 2G3YA 4GOJA 2Q21A 1IOZA 2Z5FA 4L4UA 2RH5A 5CK5A 1LY1A 2BEKA 5BN5A 2IS2A 1IJEA 3PQCA 2A5GA 1VCOA 1V5WA 1Z8FA 1ZC4A 2HCJB 3I73A 4OBEA 3B7GA 3VQTA 1Z22A 1HQYE 3F0TA 3X1YA 1IN7A 2CXXA 4ARZA 1PUJA 4B35A 1AM4D 1TEVA 4Q4AB 3VKWA 4URZR 1JBKA 1N0VC 3OFNA 1MH1A 1XX6A 2UVQA 5FOVA 4PAQA 3AGPA 5F9FA 1EFRA 4IW3B 2W6IA 1P72A 4POAA 4B75A 4IRUB 4JLMA 3BFKA 3L0IB 2JJ2A 1QDEA 2OBNA 3JZMA 2IX3A 4TQUS 3U5ZB 3REGA 5D3MA 4M1KA 3SC3A 4PO8A 4ZIRA 2ZS8A 4MH0R 4DVGA 2JJ8A 3GQBA 1KY3A 1MO3A 2BBSA 2FFHA 1XJ0A 2B7CA 1HT2E 1S0UA 3ADCA 4MKGA 1KI4A 4EDHA 3AVUA 4RKEA 1W5TA 1QHYA 3U7GA 4M21A 1CBUA 4JKYA 1BMFA 5KNBA 4NYIQ 5KNDA 3AF0A 2G1KA 5JEEA 3UANA 1JI0A 4FW9A 2MSDB 2OT3B 4JZKA 4YMTA 2O8EB 2VTKA 2BOVA 3KFXA 3FHTA 3IIJA 1E2IA 1Z0AA 3R7WA 3TAHA 4A8JC 1XEWX 4XOIA 3B9PA 2QMEA 3GLIA 1GTVA 4BFWA 1TU4A 2OBLA 2XITA 3U3OA 1OHHD 4C3ZA 1ONBA 3PR1A 4TTRA 5GVRA 4TMKA 3HU2A 1LW7A 5UKDA 2BBOA 1TQ6A 3I4LA 3ASYA 3IIMA 3KQLA 4RZ3A 5H1YA 1FW6A 2ZI4A 3T61A 1Z63A 3RRMA 3MSXA 1KGDA 3RRNA 4AIIA 1ELOA 2WWWA 4CYMA 4B43A 1TQDA 3TUJC 3K0CC 4BLQA 2XZOA 1LF5A 3PUZA 3R8CA 3QSYA 1RC8A 2P3SA 4RJLA 2REXB 3CM0A 1G5PA 2ZJ2A 5JSZB 4WAUA 1ZBDA 2EYUA 1QHGA 4YDHB 3C4JA 2R2AA 4LHXA 3ZJYA 2XJ4A 3FDIA 4HDOB 3EW9A 3RRYA 2F1JA 1J8YF 4AYWA 3W6NA 2O8DB 1ZD9A 4R98A 1GKUB 1Q1QA 4IVRA 3OF5A 3FMPB 4LI0A 5EZ6B 1XTRA 2J0UB 3W3ZB 5J40A 2GXSA 4BFVA 1N6HA 3RWOA 3MFYA 2VHJA 2YWHA 2H57A 4DB2A 1G7CA 4TYNA 4FMDB 2QE7D 4TTQA 4L9SA 5CM9C 1DG3A 3RAPR 4B71A 1E0KA 2QP4A 4RZXA 1EFRD 2ATVA 3D7MA 3OHMA 2ZRFA 2XZLA 1VYTA 4DSNA 2WM9B 4G01B 3B78A 5DHAA 1GFIA 4M9SA 4MUAA 3BORA 3CB4A 2BM0A 3EIHA 3R9IA 1ZNXA 2JJ1A 3BH7A 4LK2A 5EUMA 4XIGS 1DVRA 3GFTA 2PT7A 3GLHE 2CCKA 1ZINA 3CPJB 4NHOA 2GCOB 2ZI5A 3PUYA 1NF3A 4I1VA 3V4FA 1WQ1R 4B3XA 5BQ5A 1J2JA 4NDZA 3X1ZA 3CF0A 521PA 3ONWA 2CBZA 5J4YA 1M2OB 4LV6A 5EZ5A 3T1OA 3W6OA 5G41A 3MWYW 2GVZC 2VSXA 1WXQA 2AKAB 5GJVC 1UKVY 3T15A 3IUYA 3LW7A 1F2TA 2VYFA 1E0AA 3HP1A 1VYUA 2ZYTX 1SGWA 4A0GA 2ZRCA 5FBWB 3ZVLA 2HT6A 2GJKA 1XTJA 1CJMA 1UBFA 1XD2A 4OJQA 1H8ED 3VAAA 3FB4A 4DCTA 3K9NA 2C5LA 3G5UA 1DADA 4QBHA 5HE9A 4DLZA 4GL2A 3EPHA 4IDNA 3TW4A 3FTQA 1DAFA 4M8NE 3TSWA 1KMHA 3VR5A 4JBXA 3W6PA 4B2LA 4BEBA 4M53A 4CEHA 5E3HA 2IS4A 1X8JA 2OFWA 1M8PA 3OEHA 4CVNA 2ZEJA 3ND9A 4FMBB 4PZLA 5FBVB 2IUSA 1P9WA 4ABYA 2JIZA 3I61A 5JFGA 1SVKA 2GVDC 3O47A 4NU0A 2QY9A 5DISB 3WBKA 3UG6A 2CE2X 3VKGA 3AKCA 5FOSA 5IK2D 2QAGC 3LVRE 5AUQA 4JLVA 2I1QA 1RRGA 1Z5ZA 1MRSA 5JJIA 1UM8A 3SJAA 4DLXA 3IILA 1IBRA 3CWZA 2P6NA 3K0AA 4CZ2A 2GAAA 3TR0A 2BM1A 4LSGA 4B73A 5J4HA 2QBYB 4O25A 4Q1FA 3FFBA 4UXJA 4RFVA 4NONA 2DPXA 1OIWA 4YLGA 4UNRA 3VR6A 4I1UA 1FMLA 4PANA 2NO1A 4CEIA 2QG6A 5A5GA 3EARA 1VCIA 4Q4HB 2CLDX 3BWDD 4C0AC 3CZQA 4D4LA 1VHTA 3HR8A 1UFQA 3QKSB 3GD7A 4RD3A 2QP3A 3H2YA 3LA6A 3VR4A 2OXCA 1CULC 1OIVA 2RGAA 1Z06A 3NHBA 5KSPA 4DUGD 1UDWA 4MRNA 3PXGA 2IYRA 2PMDA 3IKJA 1RYFA 4TLDA 1QG4A 1OH7A 1S9HA 2F6RA 2GJAA 2QT1A 4YQFA 4D0GA 2Q3HA 3BD9A 5FTJA 1JPJA 3WNCA 4KI0A 4WOPA 4N0DA 4JYBA 1AIPA 4C0HA 1CEEA 4OQMA 4TMXA 1RFLA 2YKGA 5G3ZA 2D06A 1S3SA 3OAAD 1WP9A 4PAOA 1ZUIA 2L0XA 3QG1A 3SZRA 5E7JA 1IXRC 3KJEA 5JCZA 1E2KA 2AD5A 1E98A 4TL8A 2HCBA 1I4DD 4G5GA 2H1LA 1QHIA 3SOPA 2MMCA 3BB4A 3CWQA 1DG1G 1IONA 2E1RA 121PA 3M4YA 4EJSB 3T12A 1GKYA 2RGDA 3AP2A 1KNQA 5KDOA 4AYXA 3GMTA 4C0LA 1VG8A 3GLIE 2IS6A 3IQWA 4PZYA 1W47A 3AVYA 4ACAA 3BC1A 4B47A 4CRWB 1FTSA 1KY2A 1OKKD 3T35A 1T8TA 1C9KA 5C4GB 3SU8A 4RY2A 4HYYA 1AJEA 1FNMA 3PEYA 1RE0A 1CJUC 1F6BA 2QM7A 3TSZA 5CJPA 4MQBA 2CHGA 1P2UA 2VHCA 3FVQA 4BFYA 4BQSA 5ELXA 4EFNA 3PEVA 5H70A 1NP6A 2C2HA 4MYCA 4IEIA 2PZFA 5KSZA 3CNNA 3LY5A 4JJKA 3G0HA 2ZRIA 2GDJA 1QZXA 2XOKD 4DBLC 4DSTA 1Q22A 1AQUA 1DO0A 1MOZA 4B76A 1W0JA 1Z28A 1ESMA 3H1TA 5JECA 1TMKA 2ZSAA 1COWA 2AXPA 3B2EA 4QGGA 4TTPA 1A7JA 2QL6A 2ZTSA 3NBZC 3RVBA 5GADl 4Y0AA 2ZITA 1GZSA 3EZ2A 4LPKA 2FSIA 1SXJC 2WJIA 4JVSB 1ZC3A 2YWGA 3LV8A 1E9SA 1NBMD 2C9CA 2CJWB 4KAXA 2CNWA 1AS3A 2R6CA 4HI0E 4Q9JA 3W9YA 4ZDWA 3LRPA 3QPWA 1NVVQ 2OAP1 3FHCB 3OIUA 5JHGB 5EE1A 3JVVA 2FDCA 1OXXK 2FV8A 2ZSFA 3CRRA 5FBRB 3LDAA 3QIAA 5BXQC 3EZ9A 1UDXA 4QBFA 1E96A 1GILA 1S96A 4LC1A 3VU9A 2ZRMA 1VTKA 2Q6TA 2VIIA 1LV7A 3NBFA 1R0WA 2HYDA 4AG5A 1Y3AA 4GRAA 4NCHA 2EFEB 1G4AE 2ZROA 3NHAA 5CYPA 1EFUA 1HQCA 1CJVC 4LPSA 4M2LA 3CX6A 4ZO4A 4FMCB 3VHLB 1Q12A 3FWYA 1GIAA 5M04A 5FTLA 1D5CA 3VKHA 4Q00A 1L7VC 2X77A 1MO5A 4KVAA 1SQ5A 3VX3A 4DLTA 5JEDA 4LBVA 4KLZA 1Z0JA 3SJBA 2G77B 3TRFA 2CNWD 2KB0A 2KSQA 1PJRA 1II9A 2WSSA 4OQNA 2QGNA 4UXIA 4IEEA 2GZDA 4Q1BA 2C77A 2ZR9A 5FBLB 1XCMA 1UKEA 4W5HA 4NZYA 1HV8A 5FOXA 2ZE6A 3RS5A 4DXAA 4TMTA 4QRHA 3SS8A 2WWIA 3K9LA 4CEJA 2ZRJA 4LJ6A 1OH5A 4Q4AA 1XTIA 4V0KA 4KYIB 2CL0X 2DWPA 1G17A 3RS3A 2ANCA 3QF4A 1R4AA 4JLOA 4V03A 1X8KA 1L8QA 1U99A 2A5YB 3K0CA 1W2GA 2WMOB 4QGHA 5BYJA 3UKDA 4URXR 1JR6A 4P3YA 2O0KA 3QG5A 1LF0A 1N6KA 1MKYA 3NC1C 4BZPA 3K9GA 4AI6A 4JVMA 2AN9A 3AH8A 1TADA 2ZI9A 4BLSA 3THXA 3CONA 4HZIA 4PPNA 3RNLA 1ZNWA 1GL7A 1VHLA 2PEZA 4LJ8A 2V3CC 1ZCBA 3MWKA 1ZW6A 2X8AA 3CH5A 3ZZTA 3CKLA 1IN8A 1VCNA 4Q7KA 3PCRB 3BIFA 2PBRA 3D6TB 3U4QA 4B48A 5L3SA 3SEAA 2GHIA 2NMVA 1M6NA 2NIPA 3K0FB 5K8IA 1JJ7A 4EPTA 4MGIR 1E1RD 3BFVA 3CRVA 2J3EA 2JLYA 3R7WB 3A1UA 1JECA 2DBYA 2QPTA 4CGZA 4OHZA 2D7DA 4DLRA 4PSKA 2IF0A 1R5BA 3WYGA 4YC7A 3A1WA 3I8SA 2QQEA 2QMHA 2HDNB 1R6BX 2B6HA 2H16A 3CRW1 5B30A 3UPUA 4HAXA 4LV8B 4EQ6A 3EX7C 4FMCF 1KSJA 1H8HA 3MD0A 3N2IA 4ESVA 1MRNA 3SQWA 5IRCD 2FJUA 4Q03A 5EP4A 3BK7A 3OIYA 4G1UC 5EE5B 2QENA 1T3LA 1NMZA 5DSZA 3GLFE 3Q5DA 1Z6XA 1GVNB 3TUIC 1FMJA 1G6HA 3KQKA 1OFIA 1JJVA 5CK4A 5JWHA 1OW3B 1XU4A 2OFOA 2FA9A 4LHYA 2CHVA 2YOFA 2RGGA 3MRSA 2ZJBA 2JASA 2CCJA 2MMGA 4D2IA 5J4LA 2OSBA 2IYVA 4PPQA 1LTQA 3T1TA 3AKYA 1A5TA 3MWJA 4G5SA 4PC1A 1B23P 2P6RA 4HUQA 1N25A 3BB3A 5LD2B 2YV5A 1MABB 2J0UA 3KJIA 3IEVA 4C0BA 4D26A 2REBA 5JLJA 2HF8A 1KSFX 4I81A 5F9HA 3K0EA 3GJ7A 1TU3A 1ANKA 1E2FA 2FWRA 1GG2A 1XF9A 5ANRB 4A2PA 4R7ZA 4CW7A 3CF2A 3I8XA 1FX0A 3QI2A 3PUWA 4WBSA 1J99A 3EG5A 5IK2A 4GBMA 3DKVA 2VP9A 4P4SB 4B6FA 4MKFA 1NRJB 2C99A 5CDFA 4R9UC 5G53C 5JHHB 3TMKA 4C0JA 1IM2A 3C14C 3QQ5A 3M1IA 1MT0A 2RAPA 2CDNA 4Q5IA 5A4JA 1KHTA 4P31A 1W4CA 3CPEA 1E0SA 1YZGA 4BZXA 4JS0A 1MABA 1U90A 2DFNA 5F98A 1OH8A 3AVPA 3W34A 3SYKA 4Q02A 2BJVA 2VLIA 3C8UA 4LV5B 2JDID 4DZZA 621PA 4R71A 4TL7A 1F2TB 1FX0B 1E79A 1RW4A 4PHGA 1NLFA 2FSFA 4QL3A 5HZHA 1E3MA 4P4SA 1WMSA 2V7QD 1SXJA 4L8GA 3L43A 3ND8A 2IYYA 2IXGA 5JI3E 4A6PA 5HCNA 2HJGA 5SZJA 2YVUA 4MRRA 4Q47A 2X19A 5FUXA 5E7MA 4CIDA 3FE2A 1ZP6A 2OCPA 2R6AA 3CX8A 1NVUQ 4PFSA 3SDZA 2WKPA 3IDQA 2R65A 4TSFA 3GLGB 4BLTA 4Z1MA 3NBYC 3SNHA 2IYXA 3B8HA 4OHWA 1U81A 1OXUA 4NCIA 2JLSA 3L8YA 4B3FX 4G3XA 2VSOA 4DSUA 1ZCAA 2ZI7A 3SQXA 3SE0A 1DOAA 2CCGA 1NSTA 2HXSA 1SVMA 4LJ7A 3SFZA 4RD6A 3QKTA 4NMMA 1XEXB 1BKDR 3P4XA 3LD9A 2A9KA 2DY1A 2OCAA 3GJ4A 4XH9B 3FKQA 4BFUA 5J47A 3UWOA 4L5BA 1G7SA 2X2FA 3C5HA 3KB1A 2AXNA 1XP8A 2W2VA 4V0OA 4C0KA 1EESA 4N0EA 4US2R 4ZKEA 3GFPA 1Z07A 3DMDA 6Q21A 3ASZA 1N5JA 1UKZA 1TF2A 1Q44A 2WZQA 2J41A 2WAXA 4MGKR 4D6PA 1YR6A 2GETA 3DOEA 1AQYA 2PZEA 4E03A 1GRNA 1XTKA 2OZEA 3PJRA 2IL1A 4R2IA 4LJAA 1TF5A 3CRQA 2BV3A 1KK3A 3RABA 4BZQA 2BMFA 1VG1A 2ZRKA 3QXCA 4JKIA 4OHVA 1TF7A 1UBCA 1TUIA 4NYJQ 1G7RA 1XMSA 1R5NA 3PV0A 1XEXA 1W46A 4W5WA 3THYA 1R8QA 3AVTA 2NZ8A 2C9OA 2H17A 2A2ZA 4US1R 3DL0A 1EGAA 4V0ME 1Z0FA 1R0ZA 4ZIRB 2AL7A 4IXMA 3KKOA 1G21E 3X1XA 5FPHA 3AVQA 2OM2A 4IJMA 2KJQA 4E22A 5CIQA 4XD7D 2NPIA 4IFBA 2CVHA 2EYQA 4ZPXA 3BB1A 4CT4B 1RYHA 2ZRAA 1IY0A 2H18A 1C4OA 1VKJA 3ZS8A 2ZRLA 4JL5A 2NQ2C 3V00A 1JALA 1Q1BA 4Q21A 4HEJA 4LBYA 1DAGA 3GCGA 1ETUA 1G8YA 1ZM2A 4DSOA 5HZKA 3TW8B 4M1OA 2HLDD 1OFUX 2IYQA 5DN6A 2FNAA 4F4IA 3AM1A 3QY0A 4M22A 2ZS9A 1EFCA 1G64A 4M1YA 5GJBA 2QEQA 1XTSA 2HJVA 4W9MC 2D2EA 4LJYA 1RRCA 3A6PC 3F8TA 1CS4C 4RD0A 4EFLA 1IXSB 3NG1A 3KKMA 4PZZA 4DJTA 1I4LD 1NIJA 2XNDA 1L4UA 4D82A 4RCZA 4BLRA 2W6ID 2RGXA 1EXMA 2CK3A 4GDFA 1ZRHA 3ADBA 1KZ7B 3EA5A 3R9XA 1HE1C 2X2EA 3VNVA 3EZFA 1QVAA 5FOTA 5CB6A 3QBTA 4LYAA 3FPAA 5DN6D 1AZTA 1KDRA 4IFEA 4Q9KA 5B58C 4ZKDA 3GJ6A 4O3MA 2W2XA 3WYAA 1N6RA 1Z0IA 3FYHA 3U6KA 4NCJA 2EWVA 1G9XA 3LBIA 2XB2A 4LYHA 2HV8A 2BMJA 3KKQA 4DIDA 3U2QA 4WW0A 1P2TA 3MJHA 1EWQA 4PTLA 1ZNZA 1W7AA 4AURA 1NSFA 2W00A 4NCNA 2QTVB 2V6IA 721PA 1KDOA 3QVVA 4KBGA 2IYTA 2UZIR 1P9RA 3CUEF 2B7BA 1RKBA 2TMKA 2SHKA 4JYCA 4KHZA 1CIPA 3WXMA 3B1ZA 1US8B 2ZU0C 3IIKA 4PPFA 2WOOA 2WWFA 4RD2A 4XSHA 4QJ3A 2ZUDA 2FPMA 1FP7A 1FP6A 3L0OA 4A8JA 4IOLA 4WA7A 3H0KA 4A6XA 5SZKB 2Z43A 4HLUC 5FR1A 3K09A 4Q66C 2VP0A 1I2DA 2QTHA 2ZJYA 4HB3A 4KU4A 1TQ4A 1W49A 1ZM9A 5FTNA 2PZGA 3LX5A 2HT1A 3RANA 4DB4A 2AK2A 3U61B 1D2EA 1RPZA 4GNKA 2J5XA 5JMTA 1YU9A 3C5CA 2ZANA 3I32A 2O8BA 1WDTA 1N2CE 4HDCA 1KO8A 2VA8A 2WPDD 4C7OB 5B2ZA 1JPNA 2IK8A 4BRUA 1E4VA 5FL7D 3ZIAA 4KLNA 1ZU4A 3QF4B 4DCNA 2G9NA 2ZRDA 4JLJA 3REFA 3DKPA 5KPJA 2VBCA 2IYUA 2IYZA 1LNZA 1VPLA 1J8MF 1M74A 1W1WA 4FXPA 4URVR 2P2LA 2NO6A 1QHSA 4QM7A 1Z6AA 5G3YA 1N6NA 1X1SA 1IN5A 3R8FA 2ERYA 2ODWA 4BEJA 3N5CA 5LPNA 4LJ5A 2JLZA 4A9AA 1J7KA 1Q1EA 1U8YA 4ZI3A 2N42A 2QSYA 1BYUA 3UMSA 3U7HB 2GF9A 4JSTA 1KK2A 2ANBA 2VP2A 2Q9AA 3LO5A 3HU3A 1YE8A 3WHLA 4B3DA 4I1SA 2R44A 4YXWA 2W2TA 1W4AA 4Z1MD 4JLBA 4US0R 2WWHA 4HDQB 3BGWA 3L0SA 3U4QB 4JIMA 5GJWC 1VCMA 4IDQA 1Z2CA 4XVUA 5JBQA 2OCYC 1KO1A 3EC2A 4TT3A 1E2LA 2C95A 2QAGA 3CH4B 1P9NA 4NYMR 3AGQA 2JEOA 4A2WA 2PCLA 1G3MA 3AP1A 4QHTA 2OAQ1 5FOUA 4P0TA 4QC2A 5DO9A 3TVDA 3AVOA 5KHOC 4PXAA 1SHKA 3LLMA 2IYWA 3HYRA 4WZBE 1W36D 2VP4A 3X1DA 3AKEA 1OH6A 5BW8A 4PC6A 1SVWA 1G8FA 3OEEA 4OL0A 1M1YE 2WAYA 1G7TA 5CDFE 1GM5A 1HURA 2ZRPA 2D2FA 1RIFA 3U3MA 4TQ9A 2BKEA 1PLKA 3K09C 3EIQA 4XVRA 4DT1A 3RRZA 1Q1ZA 1FTNA 2O0JA 2V55B 2R6FA 3AVWA 1G41A 2GNOA 3EXAA 3M6AA 1TPZA 3U3KA 4HB0A 1US8A 1D2NA 3WP0A 2DFTA 4YMUA 1SKQA 1UEJA 3AQ4A 4A8JB 1E9CA 4CF7A 1KZGB 1H65A 4ASUD 2R9VA 1WF3A 5TVKA 1E94E 1TX4B 4A0HA 1JXMA 1NL3A 4G5OA 3T34A 3WY9A 3KX2A 1SHZA 1OE0A 4U02A 3VR3A 1E6CA 5LD2C 4AG6A 3WNBA 3V9PA 4JSYA 4N1AA 1B0UA 2W83A 1D9XA 4KYUA 1PV4A 1XCGB 4A15A 3LAWA 5DE3A 2NPFA 4WIAA 1IN6A 1CR4A 1E9AA 1TAGA 2WVJA 4LBZA 5CITA 2ECKA 3LXXA 5HR5A 1VMAA 4IOKA 1W36C 1XMVA 1HUQA 2GJ8A 1N0UA 1UJ2A 3PEUA 1KAGA 1HY3A 4M1MA 2IEZA 1UEIA 1N0WA 1BIFA 4TL9A 1NVXQ 3GJ8A 2QPAA 4Q48A 4K46A 2XNSA 3AUXA 3NIBA 3GLGE 4KO8A 2DYKA 3CR7A 3KQHA 2C03A 1RRPA 2ZRBA 4AKEA 4BECA 5JZVA 1XZQA 2C8VA 1T0HB 3SFVA 1CXZA 2FOLA 2QUZA 3IPYA 3UG7A 2E9SA 3R20A 3WRXC 1OB2A 2VL7A 2D74A 2I4IA 4UXHA 2FEMA 1KK0A 4P4TA 4Q9HA 3K70D 2FFBA 4LHVA 2ZUCA 2GILA 4HLQB 1OJLA 4H1UA 3ZH9B 4AY2A 5DI9A 2EFCB 3AF2A 5AJVB 2FSGA 2QAJA 5EP3A 1DAEA 2OEPA 3TIFA 2PLRA 2YNMA 3I5XA 2JLWA 3L2OB 1S9DA 2JATA 2ZRNA 4V0MA 3THWB 4B3CA 2GKSA 3CF6R 2ODEA 2W0MA 5EE0A 3NTUA 2C98A 1P75A 2IEYA 2VHQA 1YZUA 4B33A 4MRPA 3FKSD 2OUKA 5AUPB 1GAJA 3PUXA 1W0KA 5FTKA 3RC3A 1R5OA 3LLUA 1P60A 2ZXUA 3QNUA 1T5IA 4MKIA 1SULA 1SVSA 5FOWA 3KFVA 3B1YA 4UNNA 3C15C 1S3GA 3QEJA 3NEJA 2RGCA 3DMNA 2EU8A 3OESA 3P26A 2V1XA 4RSGA 2V8OA 5AJXA 1DTSA 4A2QA 1Z29A 4EUNA 2G83A 3KUCA 3EWSA 1UF9A 2BCGY 3TJZA 3CRMA 3D3QA 1FPMA 2XXAA 2NZJA 4MYTA 4YDSA 2VRWA 4DIEA 1DBSA 4F91B 5SZIA 2B8WA 1NY5A 3RC8A 3P32A 1VG0B 2QTFA 4AC9A 4IXNA 3QXJA 1KKLA 1YRBA 5P21A 4X8LA 1RRFA 3B5JA 4PX9A 4MGYR 2GWHA 2GZAA 3V4RA 2MSEB 3C7KA 1AKYA 3DOFA 3ZZUA 1G6OA 2V54A 3A4NA 2OESA 2J7PD 3C16C 1RJ9A 2EQBA 1ESNA 1Z6TA 2IYLD 3B1WA 5DYGA 3IBYA 1TEXA 2FF7A 4QGFA 4Q19A 1YZTA 1EK0A 1Q20A 5CB8A 2FMXA 2GEUA 2ZJAA 1ZYUA 4DEYA 3WMFA 4OYHA 3E70C 4BRWA 2Q3FA 1VYVA 3B9QA 1LVGA 4S2EA 4ZCMA 3T5GA 1T5LA 4DCSA 1A4RA 4GOXA 3PEWA 2PEYA 3NEYA 2B8TA 2GXUA 4RFSB 2BMDA 3KXLA 4G5QA 4YONB 1C1YA 1S8FA 2AFHE 2LKDA 5FUYA 2ZRGA 2ERXA 4MGZR 1G1MA 4NP6A 1OT3A 1QHXA 1YVDA 4WVFA 4JMPA 5G40A 2OILA 4TMWA 4HB4A 5FFMA 4NE2A 4XWAA 4JLDA 5TDHA 3VHXA 5L8VA 1E9EA 2WSMA 3K0FA 1XXHB 1KMQA 4D0LB 2DFLA 4FD2A 4OI2A 2H8KA 3A8TA 3B1VA 2RMKA 3P20A 4MA4A 3AVXA 3LBNA 1XWIA 1NBMA 4OJKA 1KO7A 3WMGA 2WMNB 2AKYA 3NDBB 1EX7A 1X8LA 2O8CB 4JLKA 1ZD1A 3AKDA 1S1MA 4LWZA 4FIDA 4IDPA 4OHYA 4BFZA 4Q1DA 3JVUA 4HB2A 4L15A 1L2TA 3EASA 2ZETA 5CYOA 4LCBA 4EQ6B 2A30A 1FQJA 1KI7A 2UZ3A 3NC0C 3Q72A 4Z51A 1E9RA 5L3QB 1K8RA 2F9LA 1N6IA 2W6JD 4MYHA 3U7EB 2J7KA 3Q5EA 3RHFA 4EPXA 3HU1A 4DKXA 3A4MA 4FCTA 2F1IA 2ZPTX 4JLAA 1CRQA 1OFHA 1XCPA 2O52A 1KI1A 4Q4JA 1XXHA 1XFAA 4L9WA 1JB1A 3QKRB 1AZSC 5AJYA 3THYB 2WIAA 4ASUA 3Q7QA 3K70C 3MAAC 1GKIA 3LWNA 2WKRA 4QJ5A 4UKDA 2ZS7A 2XXAB 3BJIC 2OLKA 1GNQA 2F55A 2GJSA 2RKOA 3AUYA 2YJTD 3PG5A 4R2HA 3Q8XB 2AX4A 5EXSA 2OLJA 4AKGA 3IO5A 1OXVA 5JJLA 2V4ZA 5DYIA 3SN6A 3SJZA 5L3QA 2GBLA 2OCBA 3DZ8A 3GPLA 3ZQ6A 1ZAKA 1AN0A 1UPTA 4B2IA 2BJWA 3VFDA 2ODBA 2XSZD 3HJNA 2ZAOA 1EX6A 3VR1A 2WV9A 2ZQ5A 4LZZA 3SHFA 1E2DA 2JLUA 3OAAA 1JR3D 2NO7A 4TLAA 3KTAA 2J7PA 1VDZA 2ZSDA 4GMXA 2VF7A 3RSLA 4EPRA 1E2PA 1OYWA 4D80A 1UADA 1G5RA 1P6XA 5EQTA 2R6DA 3A37A 4JJZA 1NY6A 2IA5A 3UMFA 4MKHA 4B74A 5B57C 3MJRA 1W4BA 4DLUA 2ZIAA 3C41J 4HZUB 2ZE5A 1YZQA 4MDFA 3K9HA 5H68A 3GEIA 1P73A 2XGJA 2Q3MA 3VTKA 4NYIR 2BIFA 3RSOA 3HPRA 2O8BB 1CKEA 1NG1A 4NL4H 1T3SA 1Y63A 2IW3A 2O8EA 1Q21A 1E2EA 1Z0DA 2AHOA 3P1JA 3W8NA 2CL7X 4H1VA 2QU8A 5TMPA 5E7IA 5CM8B 3FMIA 4BE7B 1OF1A 2QRNA 3WNDA 4ZDKA 1JQJC 1CJKC 1N6PA 1QRAA 2RGEA 4CT5A 2V1UA 4JVNA 1SVOA 3KB2A 1KI8A 5BN4A 1FOEB 1IHUA 3MCAA 2VHTA 3QXXA 2J0VA 2VH5R 4F7WA 4DLWA 2QZ4A 4URYR 3FOZA 3RS7A 3U3JA 4HSEA 4IVQA 2VP5A 3NXSA 3BERA 4S35A 2A5JA 5J4KA 4P33A 1FQKA 3ICQB 1DARA 1IJFA 2FE4A 1KI6B 1P3JA 4P4UA 3Q3JB 2PLFA 2NG1A 4AWXA 2FPKA 3CX7A 4BFXA 2WJHA 1VG9B 2GEDA 3U7FB 1SVIA 3KQNA 2FPLA 2QP9X 1E69A 2FN4A 4FCWA 3SI7A 3AVVA 2AK3A 2G0NA 1YZNA 4XTCS 1H8EA 4TMVA 4NKRA 3QF7A 3Q85A 4Q1EA 3TUZC 2DCUA 2RHMA 4WXRA 4D25A 1SKYB 1NN0A 4BASA 5KDDA 2G0TA 3L82B 1JEDA 1T3HA 2PJRA 4LHZA 2J45A 1EFTA 1BOFA 1KKMA 1I2MA 1F48A 1CJTC 2ONKA 1P5ZB 2WICA 3TH5A 4GPTA 1G4UR 1P4SA 2GESA 4HAUA 1NVWQ 4A0FA 3CR8A 2VP6A 3U60B 4LJ4A 2YHSA 4KFRA 4ZV4A 1G3QA 3AEZA 4DDVA 2EFGA 3BFXA 2F43A 1FUKA 3KTAB 5DLQC 5HE8A 4BFSA 4A0RA 3K0AB 4LX0A 4TMZA 2IXEA 3EZ7A 1N6LA 5GJCA 4V02A 2GCNA 3K1JA 4B44A 3QPVA 3UK6A 5KTYA 3KXKA 1W44A 1P2SA 1T4GA 5EXXA 1NMXA 2FG5A 4QJ4A 5JWOA 3DHWC 5DH9A 2WWXA 5DHFA 4KFTA 4PSVA 4XWKA 2O8FA 1LS1A 2RGNA 5IDVA 1NJFA 1DPFA 1E0JA 1Q57A 1HE8B 2CK3D 4D4MA 2QT0A 2UKDA 1O3YA 1MV5A 1FNNA 2QORA 4TN1A 1NN3A 1Z2AA 3E1SA 4WZ6A 2QE7A 1R0YA 3CBQA 4UJ5A 1WBBA 4FMDF 1M7GA 2ORIA 2QM8A 1LB1B 2Q9CA 2WWGA 1T8UA 1YR8A 3BOSA 3M0EA 5IHPA 2W58A 4QFMA 3H84A 4I4LA 3EPLA 5B64A 1XD9A 2YWEA 3EA0A 3QENA 2DFKB 4MRSA 4HLCA 2C04A 4EJSC 4WZAE 1U9IA 5AK0A 3I92A 2WIBA 4V0LA 1XNJA 3W5IA 1AKEA 1U94A 4Q1CA 2CJWA 1R7RA 2VHUA 4XSGA 4RZ2A 3SBEA 1W48A 4UNQA 2ORVA 5C18A 4Q7MB 1F3OA 1NG9A 3PFIA 2I3BA 1M7BA 4M4SA 3VMFA 1S4QA 1D6JA 1NKTA 4JLNA 4DEXA 4I99A 4GZLA 1G18A 3ADKA 2DB3A 3B85A 4XD7A 4PHHA 4TT3D 4EIWA 3BRWD 2WHXA 4DT1B 1U98A 2OHFA 2PX0A 1OSNA 2RGNC 2BMEA 2VPPA 1E32A 1KTVA 2FSHA 4XTRA 3WBJA 2YINC 2RHDA 3IHWA 2ZREA 1OHHA 4F92B 5FBQB 2JA1A 4YXWD 1X6VA 2ZR0A 2WBLC 4F4CA 4M9XA 4GP7A 4BWYA 1T9HA 3RS2A 1GUAA 4TLEA 1E1QA 4O0MA 3O8DA 2QNRA 5C46F 2GRJA 4RCYA 2A3RA 3LX8A 4HAZA 4OI4A 2WWYA 4JT2A 4Z54A 5TXGA 4Q4HA 2GXQA 4ESHA 2PT5A 1BMFD 2ASEA 1XD8A 2ZYWX 1Z08A 5E4FA 3QKSA 2R62A 3LQQA 1LFDB 1YR9A 8OHMA 1J90A 2A7QA 2B92A 2YOGA 2PX3A 3A1VA 4PSAA 2QN6A 5EXTA 2F1RA 5GVSA 5J4VA 3O8BA 2GCPA 4RKFA 4NTZA
chains in the Genus database with same CATH superfamily
1FU7A 1NV8A 4MKZA 1ZK2A 2I5PO 2R11A 3DULA 3F5QA 4PQFA 5CLFA 5A4DA 2YWBA 5GMOA 3WIBA 3IEIA 4OKSA 3W34A 2GJ9A 2J1LA 2OFFA 1NF2A 4M9QA 3CH6A 1XROA 3PPVA 3ANYB 4MUJA 1YS9A 3I2YX 5F51A 3ZWDA 16PKA 3LUCA 3JY6A 4Q7JB 4ABTA 4P5PA 3GJ0A 4PIPA 1Q14A 1ZKMA 2VQSA 3WKDA 1AH2A 3KDSE 2IT1A 4BZWA 4Z4HA 1E1QD 1JEQA 1TO6A 3DKRA 3MT8A 1L1EA 3WDMA 5CG2A 3MUEA 3PXUA 4H1HA 3GG2A 3PSHA 2XT9A 3WL3A 1PGOA 1IK6A 1YB6A 3HRKA 1KJQA 4NYMQ 3CTPA 2Q2NA 2O5CA 2J4CA 3H6KA 2YJ6A 1H94A 1YFKA 1A97A 1ABFA 4EVQA 4NV1A 4IUYA 2B8EA 3C1AA 4OXXA 3TDNA 5BR4A 5KX5B 1PX2A 1PX0A 1KP3A 1CQWA 3VUFA 1IZZA 1V6SA 2PL9A 1RLTA 1O89A 2I03A 1TW3A 3ONDA 4Y30A 2QUJA 2PH5A 4KOAA 4KIWA 3W5DA 4Q3KA 2WVGA 1R9MA 1V95A 3I9LA 4Q7EA 1RLMA 4FYKA 3PGKA 1XVUA 1ULZA 1ND5A 1YZLA 3RQSA 4AT1A 2RBEA 4I5FA 3SR0A 3VX4A 3IUQA 3T1HB 2F8TA 4ZA2A 2VG8A 4RH3A 1JQBA 3HBJA 3LP6A 1CUZA 5F2KA 3UO8B 3UUEA 4A6EA 5CA1B 3MVEA 1O94A 3TK1A 1YVRA 4RD4A 2C9MA 3TW6A 2HMVA 3EF0A 3O1LA 3E03A 5DKFA 4TV8B 3FYUB 2XWPA 3JAMA 1LTHR 2NLOA 3Q8WA 4XGQA 5LOVF 4YQZA 5DOVA 4HNHA 3WQRA 4P32A 2ZJ1A 4G4SO 4JZYA 4NULA 5DTIA 3W5JA 1T8SA 1JFVA 3AR7A 5FCDA 3WZLA 2QRGA 3GP5A 4OXRA 3BGSA 4QUBA 1K5GA 4KVGA 1CZUA 3M3HA 2DERA 3FHOA 2VEDA 3AIKA 3W9SA 5JCXA 5KTNA 3WLEA 5LU8A 1UAAA 3HYTA 4GXNA 1IUPA 3GA7A 3MUFA 3V1TC 1ML3A 2AD1A 3FR7A 3PJGA 4B7AA 2PSFA 4JBWA 3I62A 4HUQB 2BTQA 3FFAA 1QYDA 4FJ0A 4Q34A 2NZYA 3F97A 3KK0A 4XB2A 3STHA 4ZCLA 1F2UB 4X20B 3X0DA 5CXUA 1D8AA 3P2OA 4E51A 3DO6A 3Q9UA 2PPVA 3VU9B 1L6RA 1G66A 1OLSA 3LW8A 1RJ9B 3A7EA 3KKLA 1NW8A 4TV8A 4ENVA 3QFRA 1LBEA 3AOEA 1NBAA 3G5AA 5E9JA 4H1TA 2BGMA 5F1YA 3WVNA 5IYZF 3LVBA 4PINA 5HQ3A 1HH4A 2PJZA 4LRSB 4LYJA 4B8WA 4LCJA 4MPDA 4UJ3A 3RS8A 3T3HA 5BNTA 4RVCA 3D8NA 2HRZA 5DV9A 4UE2A 4LRWA 4BFLA 1L5QA 4DR7B 1Q50A 2H2WA 2GFIA 1EDBA 1YJ8A 3MMNA 1WUJS 4ZYVA 3BA6A 2ZU6A 4CFZA 2LKCA 1XN1A 5DGXA 3Q3GE 2WW8A 1GV1A 1WUIS 2QW8A 1SIBE 4AMUA 2ZUFA 2AFIE 2UZ0A 3KZKA 4G65A 3R74A 5AKHA 3KKNA 1WLSA 2VRNA 4YBRA 5JALA 3D8HA 3VPDA 1XB2A 2WD7B 1TO1E 1ZY2A 3H87A 2QUHA 1B43A 1U7XA 3HCFA 2Y05A 1RVV1 3ZD6A 2FR0A 1SG0A 3FDZB 4XYBA 4K81B 4F45A 4P3OA 2L19A 1YKSA 1P61B 1OC2A 4QOHA 3LWBA 4EB6B 1KJZA 3H2HA 4JOQA 4UARA 1VKZA 4GBJA 3SNKA 5HWSA 3TM5A 1YDGA 1ZL0A 2HLHA 4K5QA 4MCAA 5FTWA 5IAKA 3L4JA 1Q11A 2C7GA 3C8HA 3HUEA 4AB1A 1GRRA 1PT5A 1ZDMA 1MQ8B 2I3GA 4ZDIA 1OI4A 3TAUA 2LWIA 3NH9A 4TMWA 3BRCA 3U44B 4LRXA 1XRNA 5FOQA 5EN4A 3MCWA 4QSHA 2MHCA 2P41A 3EGIA 3MLEA 4WNCA 5FFFA 3HSYA 4JB8A 4M49A 3U4MA 4AW9A 4JGIA 4Q18A 5E38A 4ZVQA 5K8VA 4RL4A 4ZEWA 1EE1A 1DKMA 2QR3A 1Q95A 4WK0B 3WQBA 4Y1FA 2WG1A 3O9ZA 1GGMA 1OYYA 3FZEA 4AULA 3N8GA 1PG2A 1I4TD 3BXEA 1A27A 3AHCA 2AWOA 2I6QA 2J6HA 1RPAA 2NZUG 2EKQA 3GI1A 1P62B 2OG1A 1GSIA 4RCVA 4CCYB 2Z0MA 5FI5A 3KJFA 4M7PA 4ZQIA 4HP8A 2XCLA 1K7YA 1OZHA 1QH8B 2G1JA 3V8NA 1O8CA 3RSSA 1X1EA 1SUCA 4GI7A 2X7HA 1V3TA 1SKYE 4G1BA 5B2FA 3F1KA 3V7WA 1ZN9A 4YJ2A 3C3DA 1MBZA 3L6CA 4ITRC 5DGHA 1XQWA 1UJ6A 2FMHA 3VZPA 4V0SA 1AMUA 4WJZA 1QRUA 2RGBA 2PUTA 4EF4A 4EHJA 1PD0A 2JKVA 2YDXA 4FUTA 2G70A 4O2BF 5E6RB 3N2GB 1PGJA 3GZTB 3AEKA 1T91A 1DB3A 1JZSA 2AH5A 1NXWA 2OZKA 2WTBA 3DV9A 4YWHA 2WHYA 4L51A 2ZE7A 2JLBA 3Q7TA 3A6DA 4PNPA 1RKVA 3IEXA 2R00C 2WSSD 4E3WA 1TTHA 2AVNA 1RM3A 4ZVMA 1EVQA 2H5LA 1PWHA 1WCWA 1Y3BE 4EYGA 3WKCA 5BV1A 2KWIA 3CSUA 2DPGA 4FQ5A 2IHYA 2XSZA 2B83A 3M6FA 3OE7A 3VZBA 4CKBA 1ZUNB 3GNTA 1XCBA 2H31A 3L8ZA 4W6QA 3U9SA 1YKGA 3ZLJA 2BEJA 2HWXA 3RRXA 3T5TA 4UTRA 3Q3HA 4P82A 4AMBA 1R10A 4XE5A 2Z30A 2JHGA 1T6XA 1HDXA 4EKGA 2RHJA 4XFJA 4I50B 1JZTA 4XPIA 1ZMRA 1EUDA 3RIHA 5B6IA 3S2FA 2N46A 2D1SA 4PQRA 3NHUA 5A71A 4EEKA 1K89A 2QD3A 1L4LA 3KT0A 2XYVA 1QVWA 2Z4SA 1SG9A 1NN1A 3ZPXA 3G68A 3UBTA 5FI1B 4B9AA 2R1UA 1G8HA 2GB4A 4A7PA 2F00A 2X2OA 1IY9A 1QU3A 1CUGA 5HKKA 5F12A 5JJBA 1CF4A 2PJDA 2G80A 5JH7A 2OO5C 2ACVA 4TTSA 2FUCA 4KFSA 1PJBA 1M10A 3N87A 4E6PA 1AE1A 2OV4A 2YZGA 1GQYA 2JFUA 3GV0A 4ZT7A 1ZWKA 3HUDA 3VMMA 3W4IA 4UMDA 2VHVA 2DSNA 2MSLA 3L8HA 3MWEB 5DYYA 4DILA 4CNQA 5IC4A 3QLUC 3UB2A 1R3UA 1KQFA 2GN6A 1WB9A 5HPYB 3SXJA 3C1UA 1SXQA 1GN9A 3DNMA 4POOA 3GG9A 1Q7CA 3GJ5A 3KHTA 5BSGA 1ID1A 4NX2A 3WWOA 3H0EA 3E2MA 1COWD 3MW8A 5CPFA 2ATEA 9LDTA 5H16A 4HPWA 3SX0A 3IT0A 4CV1A 3F90A 4AY5A 1Y6FA 1WOYA 1V9LA 1KK1A 3PQ2A 3ZC3A 4WSOA 4CMEA 5LP6F 2PUHA 3KQMA 3ZVMA 1ZGHA 2B1RA 1Y48E 1CP3A 3ZDAA 3DW3X 1G20E 1TVMA 2W6OA 2VYCA 1C3OA 1E5LA 2C2YA 3M49A 4HF7A 4L75A 4LSWA 3AU8A 4Q9IA 4GKJB 2VCYA 4FHGA 4RF2A 1J1ZA 3OZVA 4B4DA 4DDTA 3FOAA 2BDTA 2WJVA 1CD5A 4EJSA 2CT8A 4NBNA 3ZWMA 1J9EA 2XCSB 3QX3A 5C8YB 3CT4A 2PGIA 6PFKA 1NUPA 1YS6A 1J4AA 3C8MA 3P2YA 4MIKA 2LZ0A 1W1IA 3NT5A 1EBUA 4MVYA 3PITA 3VO9A 3KM0A 1F4PA 3IQGX 2LCFA 1XVLA 4MQFA 4OO3A 4PHFA 1RE1A 1Z0UA 2GK7A 1YE5A 2JPDA 4Z8XA 4CQMD 2CMKA 3QVUA 4R01A 1F7VA 4DC9A 1KMMA 2XZPA 4QYIB 5C8DA 1N9KA 1K68A 2FN8A 3ESAA 3MRXA 4FS3A 2DTDA 2R6JA 4L72A 1TM7E 1U65A 4DGQA 3KOOA 4M9ZA 2OBYA 4KR6A 2BFEB 4Y2YA 2REOA 4KW7A 4LXHA 4B34A 3MWLA 3GLVA 4E7PA 3FHLA 4BV3A 3IURA 4Q3CA 3DBHB 3U7QB 4BWFB 3U1TA 4FWTA 4Z9YA 3DVAB 3EEOA 4XQ9A 4TLBA 4LOAA 1A7UA 5K3OA 3RTCA 4C01A 3QE0A 5FLKA 1XPOA 2RG7A 4B32A 1XPRA 1M0TA 2GMWA 3VPXA 1CIJA 1VIMA 1DDIA 1JQLB 3KXIA 3H1BA 2PMKA 1BWSA 1CR2A 1L7BA 3FZNA 3QW4B 3RHTA 3ZN2A 4HFMA 4V24A 3E0QA 4B31A 2G4VA 4N6NA 5EXDA 4OG2A 5FBKA 1KA9H 3X2FA 3WQHA 3ZHXA 2IH2A 3DE5X 4B3IA 4ERXA 2DE0X 3BD6A 1MXHA 2WHQA 3HXKA 2ZR7A 4U2BA 1B73A 4RIGA 4Z7QB 1EZ1A 3I01A 2Z6AA 2NSLA 3JQDA 3RWMB 5TQ0A 5I7VA 5FBZA 4KPYA 1L4FA 4MQ5A 1U0HC 1U2GC 4RZHA 4URHA 1OFTA 5KOJA 1A5SB 3DMTC 3PNPA 1W4LA 2YWFA 3NAQA 3UJ8A 4PFKA 2Q27A 3JYLA 3KDAA 2C96A 1Y1SA 2PL3A 5HS6A 3ROTA 1UH5A 1YJ5A 3NGXA 1NM5A 5LYJA 1BVYF 3IPXA 4AKSA 3AZQA 2IXTA 4PIMA 1M2EA 2HSGA 3U19A 1RXSA 1QOPB 1V48A 4ENQA 4MKXA 2W71A 1BCRB 1IY2A 1E2HA 2L2QA 1Y5IA 1FB5A 3QOXA 4AECA 4RLFA 4TUYF 3BXGA 3A1TA 1H6AA 2HEIA 3I3SR 2GI4A 4BN4A 4KIJA 1XOIA 1NAHA 1VJGA 5FUBA 3DPSA 1D2AA 1JIIA 2BMVA 3BBPA 5JZBA 5K4HA 2XWQA 4FEYA 4BB0A 4FI3C 4QHSA 3ST7A 3ZD7A 1KZ6A 3CKYA 4KXQA 4Z1OA 3STWA 4ILEA 5KEIA 2OZLB 3IRVA 1MJNA 3MZ0A 1W0KD 2OO7A 3I4CA 3IJRA 4DRZA 5J9FA 4CEIB 5BWBA 1M8FA 3RSQA 4GSYA 1AXEA 4I1RA 1XXHE 1G42A 4E21A 5EIBC 3QY9A 3T5DA 3WHPA 1DC8A 4IDHA 1KEZA 4DQVA 2VYVA 2J9RA 3VISA 3KYDA 2FLWA 1XRRA 2QROA 1PNVA 2NYVA 2WEKA 1QYIA 1J23A 1Q91A 2ZYAA 1EGVB 3AJAA 4N6OA 4MVJH 5KVQA 3CW2A 1TTQB 5JVDF 4MOWA 4C9BA 2EW1A 1BCRA 1YJAA 2FPUA 2QVBA 2OKGA 3O4IA 3QLVC 1W96A 4B4VA 5BUZA 1DRWA 1QRSA 3DUFB 5EHQA 2J59A 4R8RA 4HR7A 3OF3A 5CIWA 2NO0A 3RUCA 2QN9A 1ZH8A 2QI9C 2XW6A 4KBFA 4EG7A 2QRMA 4N9QA 5BYAA 2ZAMA 2VUSA 1T3TA 2QJWA 5EPEA 1WDWB 4LJKA 1CDOA 1BN7A 4JC4A 4JITA 4TLLB 1FRZA 3R7LA 3KCNA 1KOFA 3AWDA 5KJ6A 1KSHA 2IVZA 3V42A 1R4NA 4BFTA 3AB3A 4EF6A 1KBQA 4RY8A 4C7MA 4QOFA 3IULA 1TUEA 3H2JA 3MWDA 5SY6A 5IF9A 2V03A 3C7DB 1R8SA 3C3XA 1Q74A 3USES 1HNXB 2J0QA 3Q3CA 3MTQA 3B60A 1FYXA 1MZVA 1HWYA 1ZOLA 3GOHA 3QV1A 1JKFA 1Q0TA 1G20A 1SRRA 2JCVA 2H63A 5JDIA 2OWDA 3G0OA 1O77A 3PDCA 2F3SA 2JHFA 4PLFA 3OX2A 3JSXA 2R7MA 1QE5A 5JRDS 1X19A 2EP5A 3JQ7B 4JWKA 2YCLA 2YQ4A 1HTTA 2C42A 3HABA 2H00A 3M6VA 4AZ0A 2C94A 1EP3B 1W0JD 2AJCA 1VFPA 4FFPA 2YV1A 3M3DA 1G16A 6AT1A 3WV5A 1X1RA 5K8CA 1QG6A 2XEXA 4IMIB 2X0EA 3GFGA 2QBYA 1KEKA 4X7PA 1HNWB 1LDNA 2EJWA 2JJ1D 2X23A 4JELA 4KWIA 1M66A 2X5KO 3EF3A 2D6FA 4NH0A 3STXA 3UQZA 3AC0A 1QLHA 1Z4IA 2WOJA 3BHIA 1T1RA 1I6WA 2EEZA 2PKEA 3M5DA 1XZPA 3ZU4A 1PUIA 1QX3A 1P1CA 3LSTA 4O1IA 4ZVRA 3RT1A 5FUWA 3H11B 3X2SA 2BWJA 4MULA 1BQ3A 1F2UA 1YQTA 4X20A 3NOQA 3AHEA 5CAEA 2V6JA 4JYPA 2FMIA 2XKJE 3IP1A 2GZHA 3EGCA 3QXHA 1YZFA 2GKOA 2I9PA 3U3RA 2D1RA 3W04A 1S7CA 2FPPB 1H9BA 1G21B 2H8GA 1HTWA 1R3DA 2XTMA 4KUGA 4R1OA 2AW5A 1VFNA 1BFDA 1N2ZA 1BXKA 1W2WB 2BCJQ 4P7KA 4C7BA 3TOCA 1ZJ4A 4C1BA 1Y81A 4Z9AA 4WN3A 2OG2A 3ZS9A 1TJ5A 4OFBA 5IZCC 2KMLA 5E7QA 3I30X 1WDMA 2FH5B 4S1TA 3B6IA 1V43A 2J31A 3OEED 2AC4A 5JG7A 3WMWA 4JXXA 4PAMA 3RKUA 5CFOA 3HXLA 2CMFA 4E08A 2QLNA 5JCPA 1PFQA 2HHHB 2QUBA 4GOOD 5BSTA 1BDHA 4GP6A 1BGVA 3T3OA 2YX1A 4JEIA 3HBNA 1L4EA 1MZPA 1DIBA 1SZPA 3WGNA 1RQNA 2EOAA 3G82C 3L07A 3CVUA 3LC2O 4RW0A 6YASA 2FTKE 4YMSA 5ALSA 2DWQA 4DSAA 4JB2A 3FNQA 3SS9X 4EHFA 2NVWA 3BGDA 2P67A 3K0BA 3ROQA 1RZVA 2BUAA 4JHLA 4DOMA 2WPNA 1U2QA 1AXRA 3D02A 2UUPA 4JGBA 4XJSA 2PZ8A 4FBMA 4NBSA 1U3WA 2WVAA 5T8KA 4TTJA 5T41A 5CLJA 4NABA 1EDEA 2QT9A 1T5SA 1W2HA 1XZ8A 1YU6A 2GK6A 1HPLA 3AERA 3GJXC 3OT1A 3IP7A 4X8MA 2CDRA 5EXPA 4N39A 5CLLA 5HTKA 3NFRA 2OQVA 5KYUB 5KKAA 3GJRA 2XA9A 3GJQA 4GM0A 1FP2A 1GJRA 1X7HA 3GLUA 4F86A 1CEXA 1N2GA 4A26A 3WLTA 4EG5A 1JEAA 4O4JF 2WG2A 5I9MA 1U2RA 2CFRA 2Y1KA 5CYGA 1FVOA 1PEYA 2HL6A 5BSKA 3E53A 2C7OA 4EABA 1XSEA 3AR4A 3EOZA 1TJPB 1ZUHA 2HIMA 3H9QA 5CJ2A 5BSUA 2FWAA 1BFUA 1I24A 3H6GA 3SM9A 4BGEA 5ITZB 5HNKA 3CIOA 3STUA 3PD7A 1JHXA 4Y0NA 1JQ5A 4J0DA 2J87A 3WGQA 4ZJZA 3FSRA 4I3FA 6REQB 4MP6A 3PA8A 4G63A 2A78A 1VKOA 4L8VA 5EFZA 2ZZKA 1BU5A 3HZHA 3ZE7A 4ZZ0A 3ZIAD 5FL7A 1AKTA 4BO3A 1Z3CA 4FPXA 4XVQA 1NASA 4DJJA 1V5FA 1UKAA 3EAQA 5F5XA 4CCYA 1TKCA 3TQFA 4FS8A 5H8WA 1GA4A 3H1AA 3ACBA 2HTEA 2JJ2D 2QMOA 1HE2A 3ZTTA 4ENTA 5F2NA 2JVKA 3QBVA 3AJ8A 5TV2A 2GFHA 1KAEA 2C78A 3EXHA 1AUOA 4FCVA 5DBOA 1FL9A 2FN3A 1AK2A 4Y2VA 3G7UA 3I6IA 5LA6B 2QA5A 3ZEIA 4EGAA 4Z7OB 3R3XA 4P4LA 1V7PC 4PPGA 4RUKA 5KOYA 3DDOA 5CT9A 1FS4A 5B1HA 1V11B 2ZBQA 4F0JA 3W5CA 4IIBA 2A0FA 1NXOA 3DOUA 1FFBA 2H1FA 2VAVA 1H05A 3B6ZA 4QFDA 5CGZA 3WISA 5HVNA 2NU6A 1KRHA 3B6EA 4Q39A 4A5OA 4GRIA 4GX2A 3IUSA 2HGSA 4CKEA 4EHDA 4EKIA 1QQTA 3UIEA 1JR3E 4GEKA 1EIWA 1PZGA 4MA5A 2P75A 4P84A 1TKRA 1BSVA 4GX5A 3DUWA 1Z73A 2B4YA 4H3VA 3DJYA 5E8RA 3BL6A 3R7BA 4JUAA 1NX6A 4NAUA 1JHRA 1FFDA 3ZOZA 4EPWA 4KUHA 1QDUA 3MS2A 4TZ0A 1T2CA 4KDRA 1M34A 1Z45A 3SSOA 1RPTA 4BQEA 4N0QA 3C3JA 5AK3A 5J1TB 4WUVA 2A9QA 4ZP1A 2OB2A 2YV4A 4J76A 1UFRA 2Q21A 4YHBA 4QAJA 4WASA 4QPCA 4QLOA 2JVJA 3BWVA 3RIMA 3TFWA 1LY1A 2BEKA 2IS2A 1FJ2A 2WJZB 1IJEA 1GAEO 3EXEA 3ANNA 1EZZA 3AW9A 3D59A 2A5GA 4PYMA 4ZD6A 3BTVA 5IAGA 2VXYA 1RR6A 4OATA 4I0WB 4G0WA 4L8LA 3OU7A 4YRQA 1IN7A 4YK7A 4B35A 5I7WA 3H9CA 1AM4D 2GHTA 1GKKA 4HDSA 3V9AA 4WBNB 3AJRA 4K05A 1B8OA 4DYHA 3O2NA 3DLCA 2HA6A 4FHZA 1JBKA 1N0VC 3OFNA 1MH1A 4URZR 5FOVA 3REOA 2BHTA 1D1PA 4JP1A 4IW3B 3RW9A 1P72A 1HX7A 4D9JA 1B8NA 1TQ8A 3HDHA 4EEZA 1E4OA 1GU1A 1QP4A 2PA0A 3KQTA 5TMBA 4BMXA 2C58A 2MIIA 2FW0A 1TMOA 4IQGA 2OBNA 3TNLA 2IX3A 1XELA 3DXZA 2COEA 1IWPB 2YQ5A 3HHEA 5D3MA 2E48A 2BZ0A 2NUPA 4LZWA 2UYHA 5C8ZA 2G67A 1L5HB 3BBLA 1I1QB 1O1YA 2OL4A 1XJ0A 2B7CA 4KXLA 3ADCA 1ZN2A 4Y2GA 4PM4A 2RONA 2YMMA 3KYCB 4RKEA 1G2OA 4JBHA 1QTNA 1QHYA 5EWMB 3EEQA 4M21A 2NU8B 4B2YA 4A73A 4F2WA 1CBUA 1QWSA 4RK4A 3SZMA 3VBCA 5HS4A 1PSWA 3NNSA 4XB1A 4FFLA 3D6HA 5KNBA 1SC9A 4NYIQ 2SKCA 1OZ0A 1QIGA 2G1KA 2R4UA 1JI0A 3WAJA 1Z5PA 4JZKA 2OPHA 5HIKA 5IT9A 1FMFA 2XCQA 4YMTA 3HRIA 3IR6A 2O8EB 2AOTA 2NSHA 3L7NA 3R7WA 1GL3A 4M37A 1MN6A 4RL6A 4RXMA 1XEWX 3CEHA 4QDOA 1CX9B 1JLLB 1NXPA 1T1SA 1JHQA 1FU4A 2V7EA 3FPLA 4HEA1 4MR8B 3EZLA 2OBLA 3L92A 3WDKA 1UQUA 1KPGA 4J4BA 4Y2JA 1EKXA 1ONBA 1U2TA 4C3ZA 5BUQA 1RMYA 3PR1A 4ZRNA 1U2ZA 2WYHA 1M8JA 4AJJA 4G0QA 4INPA 1YVEI 3TPFA 1FW8A 4GUDA 1K6IA 4WNYA 3BE8A 1FS5A 3A6ZA 4PYKA 1DTWA 3NAGA 1V8ZA 2WK1A 2P2CA 3UJ3X 4RZ3A 1AZWA 1TECE 1WM1A 2Q3BA 3EZNA 1RMQA 3I42A 4OLHA 4OP3A 1ELOA 4K1LA 5HFJA 4MCHA 3OTIA 1DKPA 3GVCA 3ND6A 3CN7A 2VJKA 5FJIA 3R8CA 3QSYA 2VJPA 1GGFA 1YL7A 2REXB 3DAYA 3HVUA 2ZJ2A 3G8YA 3GFVA 3P9CA 5IT0A 5ALWA 2PDAA 1YZHA 2EYUA 4FHFA 1QHGA 1KL7A 1TJ4A 4ADSG 1FSSA 3FDIA 4JQOA 1GQFA 1CUVA 4R8VA 1J8YF 1Z4QA 4EP1A 5K20A 1GPWB 4IINA 4ND4A 1GKUB 4IVRA 4R98A 1JIKA 3OZWA 4X62B 1X7ZB 1V1JA 1BMTA 4LDAA 4RPJA 5DGCA 1Q2XA 1A2OA 1V47A 4BMOB 1OLUB 2J0UB 4ZOQI 1ZK3A 3H8SA 2VTBA 2J8ZA 2X3FA 5CNMA 5BN5B 4BXOA 1FLNA 2P8JA 2C4VA 1P0MA 2JVIA 2IEDA 4GKVA 2H6EA 2VJAA 5IEBA 1DG3A 2GH1A 2NVOA 4LOLA 3GK3A 2QP4A 3O2SB 1EFRD 4TSKA 2ZRFA 3KJZA 4KNVA 2PMEA 4NAHA 3AG5A 5EJIA 1GFIA 1U4SA 3KETA 4D3DA 3EUFA 2VKTA 4RVUA 3MGGA 3OZFA 3L93A 1IIBA 5IBRA 1BS9A 1DVRA 1F2VA 1PW7A 4KH0A 4CM3A 4E1VA 4D96A 4KGDA 5IBQA 3T3PB 5HM8A 1ZOOA 2EX1A 3QVXA 4LNAA 2BKAA 3IDOA 1ULUA 2Q5FA 1NBIA 1ODCA 3H2ZA 4TSRA 1PT6A 4KOEC 2H29A 4NFYA 1J2JA 1QZTA 4NDZA 2I0FA 3CF0A 3ZWNA 3M4NA 1GZ3A 2AZ4A 2CBZA 1NNSA 4C6HA 1OLUA 1UOPA 4JHXA 5B3JA 4LF8B 2AMLA 2F4NA 4B3SB 3O4JA 4QPZA 2PAFA 3Q40A 3WBBA 2XF8A 3GX1A 3X44A 2XZDA 4GOMD 1RKQA 2Y1LA 2VSXA 4L4RA 5CFRA 2HDHA 5HZGA 2PU5A 1TYCA 3NRBA 3AHHA 3N7AA 5EIOA 4CCWA 4GO1A 1WZIA 1WKBA 3JQ9A 3HP1A 4AJ4A 5DBEX 4YFYA 2ZRCA 5CFNA 3B1JA 1RFGE 5LM3A 2PUDA 1DXYA 2WAAA 1JR2A 1S02A 3MWEA 4OJQA 3RIEA 1H1LB 2I55A 2C5LA 3B3GA 4M1EA 3LHKA 5J43A 3OCCA 5HE9A 1YR2A 4DMFA 3LXMA 4X6LA 1B0AA 1MB0A 1Z13A 4GR4A 5F76A 3FTQA 4B2LA 2AN3A 3W6PA 4BEBA 4JBXA 4MJXA 4ND6A 4WK6A 4M53A 3ETHA 1I1HA 1LBIA 1JGTA 3OEHA 4RORA 1L5LA 3WJ7A 1HGXA 4ODIA 4FMBB 3S2IA 1YQWA 2W2QA 3DXYA 3I9V1 4PZLA 4V0RA 3AYXB 3T7KA 2J9GA 4CMCA 3I61A 4I6GA 2GM9A 1OWPA 1PHPA 1SK8A 1TM5E 2CHUA 1INLA 3IBTA 4KK3A 1RHRA 5CD9A 3L06A 2OGTA 5I8WA 3ZZ1A 3NLLA 2DR2A 3QMMA 2CJYA 1GNSA 3EF1A 4I1PA 1EUCB 2FLKA 4ZOLF 3NHJA 2J5BA 1JHDA 3CY6A 2ENWA 3LVRE 3NJRA 4JLVA 5AUQA 3V4LA 5L51A 3CKKA 1T36B 1E1MA 5IARA 1BTOA 5BVGA 1YIDA 2DTEA 2QK4A 3IILA 1BG6A 3K0AA 3CWZA 1SCDA 3FPHA 3K4QA 1OWLA 2INGX 4FSHA 2C2WA 3C4QA 5ECGC 3TR0A 3V4ZA 3V8MA 3NTLA 1UUFA 4RA6B 4O25A 1KDVA 3C0KA 3D7RA 3FFBA 2D8AA 3F8WA 5EKSA 1OT5A 4UNRA 5DLYA 4PANA 4QT0A 2QG6A 2IUEA 1E20A 3BE6A 4BNKA 3I5AA 3EARA 4B7UA 5CCDA 4U8GA 1VRCA 2CLDX 1SHTX 1YE3A 3JRWA 1ADJA 3ES9A 3OKAA 3QKSB 3TCNA 1TVKA 3H2YA 2WA2A 3DOJA 3EXG1 4EMSA 3QYPA 4EGJA 5KNBH 2SECE 2VBGA 2YMQA 4DUGD 5LR6A 3E8SA 1Z5OA 3KQSA 3RUHA 2HI0A 4NEGA 4NK4A 3D4OA 3QU7A 2F6RA 5DSXA 1D7AA 2QT1A 2XYQA 3DLAA 1WAMA 1XWFA 5JV5A 3MOIA 1JPJA 3RVKA 2P9QA 3TR6A 3WNVA 3LDFA 2LIPA 4JYBA 4AQ7A 3ZGVA 4WLUA 4BLUA 4XGKA 4JR1A 4TMXA 5U4XA 3WLKX 4C0HA 7REQB 2D06A 1SUDA 4YP9A 4YJ2F 3I2KA 5KOJB 3FI9A 1N9ZA 1IYZA 2EQAA 2IHTA 2Q49A 1ZUIA 2NUTB 2OC9A 2R3SA 4MW9A 3QG1A 3SZRA 4DV1B 5B6PA 2G0AA 4HRXA 3G5LA 3JYHA 2AD5A 2DKFA 2QN1A 5D01A 4MWGA 2HCBA 1MX3A 1TM3E 2ZIFA 3E84A 3IUPA 2I8AA 4MS1B 1DG1G 1IONA 1GQRA 1EVIA 2G40A 121PA 1CUIA 3M4YA 3MC1A 1GKYA 2RGDA 1FDUA 1YDFA 1KNQA 4HUJA 5JXIA 1TJYA 5F2OA 2SNIE 3GMTA 2E6KA 1VG8A 4BTVA 3IQWA 3ZNQA 3ZKAA 1W47A 3AVYA 3U62A 3QE3A 3WYCA 5I3ZA 1OKKD 4BNXA 4G0YA 1ZK1A 5I45A 2HDOA 1T8TA 1Y1PA 4LMPA 1OTXA 3DEIA 3JATB 4RY2A 3UMMA 3HKCA 3K1ZA 4MSUA 3IPCA 4OA5A 5CJPA 1GD1O 2OGSA 3R3ZA 3HJTA 1JH9A 1KEUA 4LGCA 5AJUA 3GEBA 4GGPA 3RJ9A 3QA3E 3FUVA 3H4VA 5H70A 3QRWA 4MYCA 5E1OA 3HKBB 3I0ZA 4IEIA 1SCKA 1FUIA 4GPD1 4KHPB 3V48A 2PPLA 3G0HA 1RJGA 1Z4LA 4FU0A 5D1NA 2I4RA 1Y1KE 4DSTA 4L74A 5LL6P 2FUNB 1CUSA 1Z28A 3E6AA 1ESMA 2IIVA 3DL4A 3W7VA 3H1TA 3KT6A 4CODB 5TGTA 2D0PB 4K6KA 4TTPA 2QL6A 4MARA 3NBZC 5F73A 3RVBA 1AHPA 2ZSKA 5GADl 2IH4A 2ZITA 3W8FA 4MWTA 2FSIA 2AYYA 2PUVA 3KR1A 4ZAWA 1J22A 1ZC3A 3AR9A 3KSZO 1NONA 1K8ZB 2C9CA 3DOIA 3QITA 1Z74A 4KAXA 3JQ6A 5IDWA 4RHTA 4HWGA 3ZW7A 2ILTA 2R6CA 4N12A 4KQJA 4TXHA 3UVEA 3L7OA 5DRYA 5IAOA 1G9SA 1UBOS 3LRPA 3CSDA 3NGMA 3NNNA 3ZHRA 2FDCA 1E7YA 1G6KA 3AY0A 5FBRB 3QIAA 1EUYA 3EZ9A 3W77A 1GILA 4JP5A 4GZ3A 4LC1A 3WFIA 3UA4A 2ZRMA 1JVNA 2Y1OA 4H3KB 4BCBA 3DEHA 3F67A 2O2SA 3OQHA 4J9VA 4AG5A 1Y3AA 2BFPA 4MKRA 3NIFB 3P0HA 1CJVC 1BVRA 4CM4A 5ERXA 4WHMA 2XVXA 4OBBA 5BQ3A 5JYCA 5M04A 4DV3B 1BJKA 2HBQA 1GIAA 4XQGA 5FD8A 3H3XA 1K7CA 1T9AA 3V1MA 9LDBA 1D5CA 1PG5A 2IHJA 1I8TA 4N3CA 1W85A 4Q00A 1LI4A 5TVGA 4F8JA 4GZ5A 3EYAA 3FWZA 4KVAA 4H7DA 2Y99A 1Z0JA 3TIXB 4D6XA 3TRFA 5TT1A 3U16A 4MGEA 4KJXA 2O7QA 2BFBA 2QGNA 4BMSA 4D7AA 1MD9A 3HB7A 4GMKA 4IEEA 4F2GA 2GZDA 6ADHA 3IXLA 4ECEA 5K0EA 4PLPA 2C4NA 3ESDA 5IFLA 3RSHA 1TK3A 3FXAA 1MC8A 4X7BA 3ZJ4A 4DA8A 4NZYA 1O97C 4ZGWA 2DLNA 3SS8A 3T9CA 5LZ9A 1PZEA 1NLMA 4RO0A 1BE1A 1U9JA 2ZRJA 4MUEA 1KOLA 2H0QA 4BX8A 4HNGA 2DWPA 2PUAA 4G0VA 2QG4A 1U5BB 4E4YA 2ANCA 1I1OA 5EA2A 4JLOA 1KVSA 4V03A 2QM0A 1L8QA 3K0CA 4QGHA 5BYJA 3OJCA 2R2GA 4URXR 5GIPE 2B1GA 1YT5A 2O0KA 1CUJA 2IPXA 3BSWA 5D84A 4RTNA 1J42A 1AURA 1KEVA 2Q4DA 3L0DA 1MKYA 1RAFA 2BEVB 3MLAA 1QK5A 3NP9A 2C88A 2KS6A 1OR8A 2I78A 2JBHA 2PSJA 4BLSA 3ERCA 4C5AA 2W5UA 4CPDA 1VHLA 3B3JA 3N8DA 4LJ8A 1ZCBA 1ZW6A 1PR4A 1ZI6A 3CKLA 3MBKA 4YCCA 1VCNA 5A04A 3PCRB 2IOFA 2V9CA 1J9ZA 1PD1A 3M7IA 2R7LA 4CTKA 2QTLA 1VL1A 3G88A 4XDHA 4TVOA 3SEAA 1KJIA 1P17A 2IP2A 1OYOA 3GUZA 1XZCA 4NBWA 5ETJA 3CZ5A 1KWKA 2P0YA 2WLSA 2VUTA 2ZTUA 4S2UA 4O1MA 1E1RD 1LZKA 1I33A 1BGXT 3BFVA 3CRVA 1E60A 3F3SA 2DT8A 3PXXA 4NJOA 2J3EA 1LSSA 3BULA 2JKYA 4JLUA 5ESRA 3R7WB 2FR1A 1TKBA 4F71A 3NDRA 2W2NA 3M9XA 4DRXA 2ZJ3A 3N0TA 5BMVB 2D7DA 4PSKA 2IF0A 5JSHA 1UP4A 4CKEB 2DHQA 9ABPA 3AUJB 2WIJA 2AI1A 4X6UA 3TNJA 2VH2A 3S81A 2VJOA 2HDNB 2O5RA 2DX7A 3UB4A 1QU2A 1ULTA 4X1OA 3AKZA 3CRW1 3L7CA 4OSEA 2IDMA 5JYEA 4FOLA 4H17A 3BJMA 1MRNA 2COUA 5IRCD 5EP4A 4EJFA 3U37A 4G1UC 2FSUA 4NVRA 3UHJA 3MJTA 4JXKA 4YCLA 5JO0A 1T3LA 1U3VA 4DA9A 3CVJA 3FNHA 3DEKA 1RQXA 1Z6XA 3E9DA 3TL6A 2BM8A 1YZVA 2RI6A 2Z5LA 1ORDA 3MHPA 3TUIC 5JWHA 4BYMA 2XT0A 4JT8A 4WUTA 3QGMA 2RHHA 1XU4A 4KGXA 1SCJA 2R5FA 3HBMA 1YA6A 1JH8A 1PNQA 2PLNA 1P6UA 3ABSB 3LPCA 2GS9A 2C97A 2RDMA 2YOFA 1QP8A 3UK1A 3ZV6A 3TIVA 4HQOA 1KS9A 4YALA 3ZY3A 5B53A 3DE1X 1JRLA 4CV2A 5J4LA 3COPA 1QGUA 4PPQA 3IE2A 4G8JA 3HGMA 1A5TA 2Q7DA 4N7JA 3AEQA 3D7LA 3EJ6A 3EVBA 4OUKX 4R1SA 4ZRDA 4ITUA 1MABB 1YZ3A 2J0UA 2J4FA 2LXNA 3IJPA 1RXVA 2M2IA 3LL4A 5DX8A 5CJJA 4D26A 5IPFA 1KSFX 2NN3C 2VPZA 3I2GA 4I81A 4MQMA 3GJ7A 1TU3A 2CV0A 4ZN6A 1YB4A 3W06A 3LX4A 4A2PA 4CW7A 2OB1A 4DREA 4YMLA 5IM4F 1W73A 1KJ9A 3OUTA 4KWHA 5H83A 1E62A 3DAOA 5E6UA 4Q3NA 4D8XA 1FX0A 3PUWA 3LT0A 4E5VA 3DCJA 1F0YA 4I46A 3HLKA 3DKVA 4W1SA 2AOUB 4P4SB 4HNVA 3E9ZA 4O33A 2Y6VA 5EWLA 1F1JA 1M9NA 4R9UC 2F90A 1E4EA 2I6TA 4F6CA 4XGIA 4WGFA 3H1FA 3WKEA 4V1CI 1PVVA 1IM2A 4M0MA 5JHHB 1WB4A 1U3CA 2H1IA 3F5SA 1K8QA 2D0OB 3IOMA 3M1IA