2C1ZA

Structure and activity of a flavonoid 3-o glucosyltransferase reveals the basis for plant natural product modification
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
450
structure length
439
Chain Sequence
b'TNPHVAVLAFPFSTHAAPLLAVVRRLAAAAPHAVFSFFSTSQSNASIFHDHTMQCNIKSYDISDGVPEGYVFAGRPQEDIELFTRAAPESFRQGMVMAVAETGRPVSCLVADAFIWFAADMAAEMGVAWLPFWTAGPNSLSTHVYIDEIREKIGVSGIQGREDELLNFIPGMSKVRFRDLQEGIVFGNLNSLFSRMLHRMGQVLPKATAVFINSFEELDDSLTNDLKSKLKTYLNIGPFNLITGCLQWLKERKPTSVVYISFGTVTTPPPAEVVALSEALEASRVPFIWSLRDKARVHLPEGFLEKTRGYGMVVPWAPQAEVLAHEAVGAFVTHCGWNSLWESVAGGVPLICRPFFGDQRLNGRMVEDVLEIGVRIEGGVFTKSGLMSCFDQILSQEKGKKLRENLRALRETADRAVGPKGSSTENFITLVDLVSKPKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-GLUCOSE FLAVONOID 3-O GLYCOSYLTRANSFERASE
molecule tags Transferase
source organism Vitis vinifera
publication title Structure of a Flavonoid Glucosyltransferase Reveals the Basis for Plant Natural Product Modification.
pubmed doi rcsb
total genus 157
structure length 439
sequence length 450
ec nomenclature ec 2.4.1.115: Anthocyanidin 3-O-glucosyltransferase.
pdb deposition date 2005-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2c1zA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2c1zA02
4RIGA 3BCRA 1ABBA 2QN2A 2C4MA 3E3NA 1P2BA 3MRTA 2X6RA 4RIHA 2QN9A 2VCEA 4GZ3A 4N39A 3QKWA 1F0KA 1NOJA 2F3PA 2KS6A 3BCUA 1E1YA 5DXFA 3IA7A 1HLFA 4N3AA 3WADA 2C1ZA 3MS2A 1Y6GA 2AV6A 4HWGA 4KQ2A 3ZCRA 3GPBA 3MT7A 1P4JA 1FC0A 3H4TA 1B4DA 5GPBA 2R4TA 3L7DA 1L5WA 3CV3A 3S27A 3T3IA 1XL0A 2QNBA 2SKEA 1K08A 4BQIA 3BD7A 3L7AA 1FS4A 4WACA 4FZRA 2QRHA 5ENZA 4M60A 3VDMA 3DD1A 3OT5A 5D01A 3HBJA 4F97A 1GFZA 3Q3IA 2R4UA 3BEOA 1E4OA 4GZ6A 3CUVA 3E3OA 1PSWA 4GZ5A 2P6PA 2XMPA 3D0QA 1SXQA 1JIVA 4X7MA 5TMEA 1P4HA 2QRPA 2R68A 3L7CA 2WTXA 3C4QA 3OY2A 1LWOA 1FTYA 3G2KA 2F3SA 2PYDA 1Z6QA 2R60A 2SKCA 4AMBA 3MS4A 1C3JA 4W6QA 1XOIA 3L01A 1A8IA 2C9ZA 1YA6A 1FTWA 3CX4A 3E3LA 3ZCSA 2QLMA 1NVKA 4RBNA 1FA9A 2JLBA 4MRAA 2GJ4A 1NZFA 2QZSA 4MI9A 1L5SA 2GM9A 1Y8ZA 3GUHA 1JG7A 1QM5A 2PYIA 4EKYA 3BCSA 3FROA 3MTBA 5TMBA 1WUTA 1LWNA 1Z62A 5LQDA 4HLNA 3UYLA 1KTIA 5BNWA 2JJMA 4X7RA 5IKPA 4XI9A 1JIUA 3NP9A 3HBMA 9GPBA 4REMA 4Z5XA 1WV1A 3MBOA 2XCUA 4YUAA 3T5TA 1JG6A 2IW1A 4KQMA 3PE4A 1VGVA 2AW3A 4CDRA 1Z6PA 2VSYA 1H5UA 2QRQA 1PYGA 1Y6FA 3G2IA 7GPBA 3CEJA 3MRVA 2IEIA 3RSCA 3NPAA 4LEIA 3MSCA 1FU7A 1L5RA 3S0JA 1C8KA 3NAZA 2YJNA 3TAXA 1YGPA 4M7PA 4N3BA 2GEKA 6GPBA 3TOVA 3OTHA 4BFCA 2XCIA 3CEMA 1XV5A 4XIFA 3S29A 2IV7A 2XGSA 3SYMA 2ACVA 3ZCTA 3O3CA 3WC4A 3EBPA 1L5VA 1UQUA 3HBNA 3VUFA 2X0DA 3MS7A 2SKDA 4AN4A 3S28A 4L22A 3CUTA 2G9UA 2ASVA 2QRGA 2FFRA 1EM6A 2G9QA 5DLDA 1IXYA 2BISA 3CUYA 4YI5A 4GPBA 2X6QA 2PRJA 1UQTA 4LDPA 3RSZA 1XL1A 3IAAA 3ZCPA 4RIEA 3EBOA 8GPBA 2GPBA 4AY6A 1L7XA 4X7PA 5JTUA 3BDAA 4MI6A 2BGTA 1FU8A 1NLMA 2OFFA 3AMVA 1GPAA 4G2TA 2JZCA 3QHPA 1RZVA 1WW3A 1P2GA 2VCHA 2H1HA 5JTTA 1V4VA 1EXVA 2XGOA 2FETA 1GZ5A 2XGMA 4KQ1A 3G2NA 2IYAA 5DU2A 4MHOA 4EJ2A 2R66A 2PQ6A 3MT8A 2G9RA 4WADA 1M5RA 4MI3A 3RHZA 5TMDA 3DDWA 3MQFA 3NB0A 1BX3A 3T7DA 1RRVA 3Q3EA 5C1DA 2FF5A 2QN8A 1F6DA 1JIXA 3MRXA 4X6LA 3ZCVA 1WV0A 1FU4A 1L5QA 1AXRA 4F9FA 4BQEA 3D1JA 3C48A 2QLLA 4CTMA 2HY7A 3D0RA 2QN7A 3VDNB 1XC7A 1C8LA 1NOKA 1NOIA 2F3QA 4NESA 1J39A 4RIFA 1RZUA 1SXPA 3OY7A 3BD8A 4BQFA 2F3UA 2QLNA 2VSNA 4PQGA 3VUEA 2QN1A 3HBFA 3COPA 2X0EA 4GYWA 3OKPA 2GPNA 4M83A 2QRMA 3UYKA 4NC9A 3ZCQA 1GPBA 4AMGA 1IIRA 4AY5A 3OTIA 4MHSA 3L79A 2AMVA 1QKJA 3OKAA 3OKCA 2ACWA 2ATIA 5D00A 3C4VA 4CTOA 1FTQA 3MT9A 5TVGA 4RIIA 2VG8A 4FKZA 2GEJA 3G2HA 2ZB2A 2IYFA 3T3HA 1P4GA 2G9VA 4N9WA 2IUYA 3S2UA 1Z8DA 1AHPA 1C50A 4EKEA 1GG8A 3DDSA 3G2LA 1L6IA 2AZDA 3NCHA 4QLBA 2H1FA 3Q3HA 5I45A 2ECPA 3RT1A 4NEQA 2IEGA 3NP7A 3T3DA 3CUUA 1GPYA 1O6CA 4N3CA 2C1XA 4GYYA 3T3GA 3ZCUA 1P29A 2BGUA 1WW2A 4RENA 3CEHA 4YI3A 2XA2A 1XKXA 5HXAA 2O6LA 3H4IA 1JEJA 2X0FA 2XA1A 2QN3A 1GGNA 3MTDA 2Q6VA 1P2DA 3T3EA 2IV3A 4CTNA 1PNVA 3MTAA 3OTGA 2GT1A 2F9FA 4RELA 3G2JA 3L7BA 4WHMA 3TSAA 4F96A 2BFWA 3WAGA 2XA9A 4EL0A 1WUYA 1K06A 3DZCA 3NC4A 3PE3A 1PN3A 1UZUA 4EL5A 4MICA 3CUWA 3SYRA 2GPAA 3BD6A 5IKOA 1NZDA 2PRIA
chains in the Genus database with same CATH superfamily
2J0SA 2EKPA 1N2XA 2HF8A 2N1MA 4BWYA 3CZRA 4I1OA 3GIDA 5K6AA 4OX9B 3K70D 2N75A 2WE7A 3N7UA 1ZP6A 2JGKA 3PXEA 3ZV4A 4D4IA 3WIEA 4DANA 4KWTA 5ALMA 1L4HA 3A4VA 2X9GA 1HDGO 3G85A 2XRZA 2ZS8A 4D96A 2WNSA 3LW8A 4URHA 3CNLA 2XOKD 2ZQYA 4GZ3A 2G36A 1GT6A 3JX9A 3EY9A 4K46A 3GMSA 4KO1S 1P1BA 3CRZA 3P2IA 5DI3B 4G5QA 4QOIA 4L6AA 4EJFA 5A3RA 4IVQA 4DQLA 3DYBA 3HWX1 1U8AA 1Z17A 5TY0A 4F93B 4RHXA 1Y6GA 3ADBA 1QG4A 2AE1A 2IUUA 3SHWA 3VOAA 1PAUA 4GVXA 1R2QA 1UIRA 1IAQA 3VYWA 3V1NA 2HQOA 2C88A 4F6RB 1E99A 1E6WA 1XJWA 2B1JA 2Q6OA 2ZRFA 3O94A 2R8ZA 1ZD5A 3ZWMA 1KAGA 1E1QA 4QDZA 2NN3C 3MN1A 5AT1A 2X23A 3RS9A 4TRMA 1RIIA 4OH1A 4NZPA 3Q8LA 1BXGB 5BOVA 2ISCA 2J3KA 1ACMA 2VNAA 2Z9DA 3GG9A 4IX9A 4LYHA 4DIDA 2W2LA 1ZK3A 1QHGA 1XRNA 3GZTB 3CPHA 5ALQA 4AP6A 2MTBA 5ALJA 5E8RA 3IQZA 4OI2A 4X1IB 4JS0A 5F12A 1KYWA 3EPLA 2O59A 2GK4A 2QX8A 2B2NA 4QNRA 2VYND 4EY7A 2YKGA 2IUSA 4LCEA 3HCCA 2WU0A 4NV0A 1I8TA 3K5PA 1NMXA 5FO1A 4DGQA 4YCSA 3DW3X 2ZYAA 3EXFB 3HV0A 1GGVA 1LTHR 2GF0A 2W2VA 3T54A 1C0PA 4NJMA 3K72B 2QXYA 1X1RA 3R6WA 2ZYUX 4YRBA 3R0ZA 1GZ3A 5CW1A 4I3HA 3RS0A 4IEFB 3CSDA 5ENZA 1XLTC 4M60A 4X8OA 4AKGA 3LWDA 4EI9A 2XKBA 1R3UA 3UAOA 1MHTA 1UDXA 3DHVA 4ZD6A 4O33A 5DH9A 3LY5A 2GFHA 3HWSA 2UZIR 5LJLA 3E9CA 4TYNA 4UJ3A 1R16A 5SYNA 1A9XB 2BFAA 3BK2A 3A1SA 3ELYA 1ZD1A 3A4NA 2P2NA 4L6CA 3JYQA 5TQ0A 1SZPA 1U0JA 1U90A 4II7A 1LFDB 1I14A 1WCIA 4J0GA 1A82A 4QUAA 3T95A 1JFFB 5C81A 2H0AA 2OFPA 3BH6A 5JZMA 1PP4A 2RHWA 4EOGA 5KVCA 5IU6A 3U7RA 1TL7C 3PQ3A 4IO1A 1PR9A 2BMFA 2R6R1 3OURA 2WIAA 3P20A 4ND2A 4N8EA 3TK1A 3X1DA 3GYBA 3C8HA 1GO2A 1NW4A 4X7MA 3HU1A 2YYAA 3RPEA 5GONF 2H51A 1EXDA 2VYNA 1E7QA 1JH9A 2Y1WA 5IX8A 4JSRA 1NW6A 2WTXA 1L3CA 3EJ6A 1NAIA 4TLBA 1GV0A 3SS7X 1M2NA 4NOLA 3IEXA 3JWJA 3MWFA 2Q5FA 1R18A 3OEED 4I9UA 1Z0UA 5DP2A 3G5LA 3QELA 2ZR8A 3CU5A 1LC0A 2BDEA 2ZT8A 3D0KA 4MA4A 3GXBA 5DT9A 5CBPA 3T1HB 1PJAA 3B3GA 2JAOA 1SQ6A 4EG6A 1JSXA 4OQMA 4ZP1A 3T06B 1WXGA 3IVMA 4QA9A 4BNGA 2O8CB 1RAHA 3ZUGA 2I4NA 1YIAA 5A4FS 5E7QA 3NBYC 1T0UA 3VTAA 5DCLA 3NWEA 3J7TA 3M83A 2A58A 3ID6C 1ZISA 1TM2A 1CR6A 2Q5IA 3A9CA 3UF0A 5HKKD 3PR2B 3ADDA 1R6AA 4ZYYA 2BKUA 3GV0A 1UP6A 1QLJA 2VP9A 2J5KA 4LE2A 4QFBA 5FUYA 4LHVA 2RAPA 3HJTA 4MI9A 5LZ9A 3G8CA 4GBMA 5BXQC 4EA8A 3AP3A 1P9WA 4NNPA 4QOFA 1HRKA 2XYVA 4LC0A 5CU7A 1M9NA 1SVKA 1O8BA 1OW3B 1KHTA 4MJ3A 2WAXA 4HDNB 3BFJA 4RGYA 2HK9A 1CP3A 2DULA 3ROGA 2I4IA 2D54A 1Z62A 3FNGA 3GJ3A 3U7QB 4RDHA 3CHYA 4G8BA 2FDRA 1Q91A 3D8UA 3A2LA 5IKPA 2YZMA 3GEBA 1ZI9A 1E18A 3T5CA 4REMA 1XHFA 3CF0A 3CUEF 2XDQA 2YN4A 3L9XA 3M1LA 4V0KA 4EFLA 3PL5A 4HAUA 2A7XA 1H8ED 1HLPA 4LOJA 4RTQA 4N12A 2CLOB 2D4HA 3CVYA 5LD2C 3WRYA 3F6EX 2C7VA 1MNQA 1QE3A 4HVTA 3EQ9A 3IERA 4Z9AA 2ZAOA 3I64A 1NJ6A 1JKFA 2CEAA 4C3OB 4ER3A 1L7EA 3U26A 3H5IA 3DZIA 2BI8A 5AK4A 3FPCA 4HRAA 2CXTA 3ORYA 3OCCA 3BJRA 2P30A 3RQIA 3URKA 5JV5A 3A0UA 1AGYA 4LOHA 1ZL2A 4MYHA 3HJUA 2JK1A 2GK7A 2V98A 2OPHA 3ZXXA 1TYAE 1YDEA 3DXFA 2Y9MB 3JATB 3O4GA 3PNPA 4IZ6A 1E1LA 4WIAA 1GPUA 3TRKA 5KQPA 5JMTA 3CPSA 5HTOA 5E95A 1ZJZA 4BLOA 1VA4A 4F60A 2OHGA 1V11B 4X45A 1KH1A 3PBKA 2W6OA 2AN1A 2WLSA 5K0NA 2X7HA 5JNWA 2YJNA 2YWXA 2ZRJA 4Q6WA 3WLTA 1GQFA 3ZNNA 2BEKA 3EZLA 4OB6A 4YECA 3MTQA 5KKCA 4F71A 5KTYA 2BBTA 4IFIA 2WEKA 1QTRA 1BS9A 1P7VA 3D8BA 1QKKA 4PSCA 5KOHA 1SU4A 1EVIA 1U6IA 5ALGA 2H4WA 1C0EA 1UBMS 4MQ4A 2W6JA 4IJQA 1IHYA 4IICA 4HDQB 3WKDA 4ZQFA 2YINC 3H9CA 3AHEA 4BZQA 1SC3A 3QQ5A 2C99A 2IBMA 3WS7A 4OBEA 3TRFA 1ZJ6A 3E8XA 2ZJ2A 2FP4B 3WYCA 1A5SB 1V8FA 3LPCA 4WT7A 2ERXA 1YULA 3O4HA 4YCDA 4EW1A 2HJ9A 2NNWB 2CJYA 4C20A 3RVMA 4L8GA 4RV4A 1Z9BA 1XQ9A 2Q4BA 1LBEA 3RF7A 1JU3A 1SZJG 2HPHA 2PQ0A 5A4DA 3NOOA 4AWAA 4BJ1A 1U7DA 3GA0A 5BUSA 3ZEAA 2FOIA 3P4YA 2I4OA 4AJ2A 4CPDA 3TDKA 3LQ2A 4OAPA 3L7IA 4F5DA 5JYEA 5FEUA 4TYQA 2ZU6A 4IG4A 4BE7B 5GAJA 2P27A 2DG2A 4JWKA 4D3ZA 2ZYGA 3FB1A 4ZCRA 1KGDA 3IAAA 4HFNA 1R5OA 3MMNA 1RXIA 1WXHA 5FI5A 2I03A 2HHLA 4MVJE 1TUEA 4XIYA 4WOBA 4ZAZA 1NC3A 3KR2A 4Y6PA 3GJXC 3TPCA 3GLHE 2JFBA 4QC2A 3P1JA 4NH0A 3QOWA 1QIEA 1A76A 3BGVA 4BVHA 1WLSA 1E1DA 2WUVA 5LDHA 3F2VA 1Y48E 1SMKA 1TZBA 3GAMA 4ND8A 5SZKB 4INOA 4ANFA 4ETMA 1LDGA 3QWIA 2PSDA 4J0KA 2H1HA 4KO8A 2FOXA 4JQSA 2XXBA 1SBCA 3LZCA 4ZOAA 3ZGLA 1MX1A 1RWPA 2QE7D 4TRRA 4DRXA 3B6ZA 3O1LA 4M0UA 3VPBA 5A02A 3IT0A 1KL7A 3T9EA 1JAIA 2QUBA 2FETA 2GNOA 4C5AA 5K5EA 1SKUA 4JB0A 3X1ZA 1JA0A 5CEFA 4DQVA 3T3OA 3WKAA 1UPXA 4RVDA 5E9QA 1PNRA 4G4SO 1XCMA 2C0PA 4HDSA 3C3DA 4XVQA 1M34A 3VC3A 3RF6A 1ADFA 1HURA 5MDHA 3A11A 1Q74A 3A1VA 5ADVA 4AFNA 4TKVA 5A1JA 1HRDA 4U2GA 5AESA 1SG0A 2W2OA 5DYGA 1PD1A 3QH4A 4PC1A 2AFVA 4XRGA 1TXGA 2PZBA 4OXRA 5U4QA 3HS3A 4RSMA 3VISA 4CFSA 5TT0A 4TLLB 1TQ8A 2H1WA 2VO1A 5E4YA 5F7JA 3ETLA 4V1CI 1KJZA 2QY6A 4A82A 4ND5A 1Z12A 3QHQA 2HRBA 2QN8A 2VZ0A 1JVNA 4UVHA 1J1ZA 2I2WA 3FLMA 1P2SA 3M89A 4YB8A 3DF9A 3TQCA 5L4LA 2RKBA 1PFKA 1I4DD 3KU4A 5JFTA 1ILEA 2DYKA 2QUJA 3PVSA 3PGJA 1N57A 1AXRA 1I4EB 2C61A 1Q1EA 2CNBA 1I32A 1BAPA 1BROA 4Y2SA 2A5YB 3IAM1 4WWHA 1QZUA 2YY7A 5CB4F 4DKJA 4P4GA 4JLDA 3UHJA 1TQHA 3FOZA 2ZYSA 1IM8A 3VDNB 5ALIA 5AJZA 2G0NA 4AXBA 2J1LA 5B7QA 4O2BB 3TSYA 3E15A 4N5DA 3DLBA 1NONA 4MB6A 4Y6LA 1YZLA 2C3OA 4E03A 2H2WA 1SA0A 1Y9JA 1Y9AA 4KXLA 5I51A 1SXJA 4D9MA 2DXIA 3HN7A 2PQ2A 2E4XA 2ZTMA 3SZRA 1UBTS 2ZRHA 2QQFA 3A9SA 2NU6A 3D6MA 5EIHA 3RTBA 1LEHA 4CUZA 1O4WA 1WCV1 2PY6A 3EVEA 1Q7EA 4QU8A 5CT4A 4MRSA 2MJLA 3HBFA 2O5RA 4TLEA 4AYXA 2J6BA 1QHSA 1JDJA 5F7XA 1X3LA 5E6SA 2AT1A 5T8KC 3UCFA 4RVGA 5A03A 3TB4A 2JCBA 1A2BA 4DSAA 1XTIA 1ZEJA 4O59O 5KSYA 2NO5A 4Z4FA 1IZZA 1YMUA 3HMKA 3NS7A 3ER6A 4M83A 3B8EA 5BR8B 2NNLD 1ORHA 3CTMA 5DNUA 3D8RA 4D45A 2X8JA 1XJCA 1RC1A 4BZWA 1KYYA 3NM6B 3M8KA 3G0DA 1TQDA 5D51S 3J81A 1FP7A 2A35A 2I5PO 4DXAA 5EJ2A 2C7GA 1P45A 3KJGA 3OQ6A 4NL4H 2I62A 3K4PA 4DKXA 5KHLB 2ZRBA 3N2IA 2AIRA 2X6TA 1K7XB 4RKWA 4BNYA 2H7YA 3GBVA 1LDBA 4BRUA 3QE9Y 4DZZA 1ODLA 1GCAA 1UXOA 2BCJQ 3QWFA 1E2JA 5K8UA 1AQLA 3B6JA 4Y0AA 2PJDA 5CNIA 2FJ0A 3MVEA 2WRZA 4G2NA 4D41A 3F98A 1M74A 4EI7A 3UC5A 3QF4A 3QV2A 2AC7A 1L4YA 4NYJR 3H1BA 3SEZA 2V7UA 2OCYC 1R9JA 1LSJA 2V54A 3B7PA 1N2OA 4H1VA 4PS1A 3MT9A 4Q4LA 3TI9A 1GNRA 4C6TA 5K8CA 4ALLA 5C5CA 4FKZA 5FOVA 2VZLA 4C7OA 4EBBA 2HJGA 4BQSA 5IT5A 5DYIA 4RLSA 2ZKLA 3S5UA 1G41A 2WIFA 2H4ZA 2UV8A 1GPMA 1WHTA 2UUPA 4YASA 5KNBA 1GZSA 1UBHS 2G0AA 2O3JA 2QMHA 2CJWA 3SVZA 3L4SO 1KI6B 4HH4A 3BQMB 3GB9A 1CC1S 2V7QA 4TMTA 3TR5A 5MFZA 1JR3D 3MJVA 1W8IA 4ARAA 3OCWA 1ENPA 3CF2A 4ZMBA 4F5ZA 2NU7A 3TBHA 2IXBA 4IIBA 1RYBA 2WJ4A 1OH6A 4B6JA 3GAAA 1U2DA 1DBRA 1M8JA 2ETXA 4JQZA 4OHXA 4R3WA 3PWKA 1VLHA 3OETA 3QJGA 1E32A 1X1AA 2P68A 1CUBA 1L8XA 3WGOA 2AZXA 4FHCA 3ROFA 3R7AA 1CRZA 3MMSA 5C34B 4C04A 1N2ZA 2H54A 1PWHA 4QJ4A 1TKCA 3PWSA 3KL2A 4N3CA 4OYRA 2WWTA 5E38A 1TPZA 1Q0SA 3T3GA 3WHPA 2OV6A 3IXLA 4C0QC 1MDBA 3CEHA 3PJGA 3FCAA 2QVZX 5EXTA 1CDOA 5JFGA 3L2OB 4K3UA 1V5EA 3E0QA 4KLNA 3VAAA 4YMUA 2WWYA 2BBWA 1NT2A 5A71A 3AXSA 2YV4A 5G0TA 3CH5A 1B41A 3MOGA 2WICA 1CKEA 4O4JF 2D1YA 5LC1A 4L3OA 4PGHA 1HPLA 1OF1A 4RK4A 1Q50A 4F1JA 3DMHA 2IIBA 1VXOA 1UJCA 1I3OA 2JAPA 3ZD9A 3PLAE 2YHSA 1QHYA 5TIIA 1FJXA 5EE0A 3M6VA 1NTRA 1NXVA 3R41A 4RELA 4ZAXA 1HUQA 4Q05A 1TU3A 2FG7C 3IVRA 5A4IS 1UC5B 4HWOA 3IAFA 2ZYTX 1DEKA 4Y2YA 4C22A 1K8YB 1N3YA 2O5CA 2XA9A 1E1RA 1T2VA 3BMOA 4MA5A 2X42A 4ONEA 1YIOA 2PZGA 4GFDA 5BQPA 3TD2A 1NVDA 3WLOA 3PE3A 5CVTA 1U0EA 1POWA 2D1SA 4D0NA 3RK0A 2ZBPA 3NNNA 4E70A 3F6BX 4FT4A 4RS3A 4JVOA 2R62A 5AHWA 5HGJA 1QO0A 1HYQA 1XQXA 2C4NA 4CT4B 1T4CA 1ECPA 5LLDA 2DKNA 3EXHA 3GRPA 1U7ZA 3IH5A 3P2MA 5JSFA 3NXKA 2CF5A 1C8VB 4IIDA 5BRJA 2W2KB 3A1DA 4XGRA 3AP2A 1SBNE 3E9ZA 4L07A 2ILVA 4QPNA 5CPFA 2QQEA 3MWJA 5FULA 4AO8A 5FWDA 1Q83A 1GDHA 2HU5A 4PBTA 4BMCA 4J75A 4TTIA 4PCAA 5JBIA 3VU9A 1D6NA 1XQ6A 1YI8A 1P44A 1D2AA 3DTYA 3NTVA 3OZCA 4JP2A 1HFWA 1ID1A 1NOJA 1Y82A 5DM4A 5IUNC 5HX7A 1B6TA 1EE9A 1J2JA 1BE1A 4R8LA 3INTA 2FKNA 2QIPA 1SD5A 4IF6A 4IOKA 2ZRKA 1IHUA 5JARA 4LRWA 2CCJA 2IZ1A 4FZVA 3L8CA 3O8QB 4C0XA 1RBMA 1PLKA 2J6CA 4BRSA 3L93A 2AV6A 3AHFA 1C3OA 5JMWA 4P31A 5FBZA 2QA5A 1SURA 3I9MA 1ODJA 5DT2A 3AF0A 5IJ9B 3F7MA 5FIUA 2FPPB 2Q62A 4CM8B 4HEA1 1KXJA 5E1DA 1R0KA 4JITA 1STOA 3MAAC 2YMMA 3FPHA 3U4QA 4B8YA 4ZVSA 3KXDA 3UXYA 3GFVA 3R5XA 5EHQA 1JF8A 5GPBA 2BTQA 1OYOA 4DJDC 2WWGA 4PHGA 4JR2A 1QFMA 2AK2A 4C6TB 3H84A 1O97C 1NF8A 1WJGA 2CZQA 4C0BA 2XUJA 2QRZA 4E31A 3OICA 4G4SP 5CJJA 1UKYA 4FEEA 1G5RA 3SZMA 1I5OA 3FH0A 4X85A 4FCCA 1U3CA 3F8TA 3R4CA 3UV3A 3R7NA 2FZEA 1K08A 2LV8A 2WFZA 2TYSB 2V6IA 4JUIA 4NDNE 4XM1A 4DLAA 4EJSB 2MR6A 1I10A 4IDEA 1V43A 2J46A 4XJXA 5E6RB 4EHLA 1ICIA 3C41J 1J70A 4NPHA 4F1KA 3AZPA 2CLDX 1RM4A 3I05A 4R3NA 2HRCA 1OH5A 2JI9A 1NM5A 1ZMOA 4L73A 3DEZA 4YRJA 3WLSA 4GQIA 2UVQA 2MSEB 3MILA 1BE6A 3MHPA 1U3DA 5JD6A 1GFZA 3Q3IA 3KDAA 3M0EA 4IQFA 2H1RA 1DCKA 3QX8A 3ZVLA 4PTZA 2Y93A 3TR6A 2QI9C 3LT5A 2RKWA 3PIIA 3OOJA 2YUTA 1YQGA 2VUTA 4L5JA 2DUJA 3EISA 3GLRA 1JIVA 1PGNA 1EM8B 3PX2A 3H5AA 5TMEA 5AK5A 3H3JA 2GA9A 4XLLA 3CGWA 3RROA 2YWHA 4WZAA 1GT91 3PXCX 1LDNA 2IOHA 4U2EA 1KQ3A 1TIPA 2NZYA 2XEXA 1CUIA 5TF0A 1FEZA 2I76A 3PC4A 4WZAB 4YQYA 5I8WA 3HVRA 2KLBA 2WILA 3C14C 4GSKA 3N2NA 5BQXA 4P4TA 2PSJA 3K6KA 2IHZA 3LD9A 3WXBA 3REOA 5I9LA 1CR1A 1YE3A 3V32A 1NNLA 1CJBA 2D5IA 3UANA 3SI7A 4DSNA 5FUQA 2H4YA 1DLIA 2CDBA 2O07A 2PT5A 4Z0PA 5B5SA 2B1RA 2KBEA 4A26A 2I7CA 1BSVA 1X1EA 4DREA 2WMDA 1XUOA 3U49A 1UC8A 1S3IA 2YN0A 3ZNQA 3UPUA 2ODQA 2VOJA 5IBPA 3UKOA 3O90A 3PITA 3QWBA 1QV9A 1SUBA 2A86A 3I0MA 4HDRA 5DCWA 2GD0A 3TW8A 3GROA 1NR5A 4JV5B 3IQDB 1HMYA 3PKJA 2KI5A 2J3IA 1XMOB 5ENDA 3ZGNA 4GM1A 4UEKA 4HLNA 5LOVF 2NPOA 1Q57A 2LPMA 5AHXA 3N2GA 2FA9A 4COOA 4BO4A 3HY4A 4GKKB 1I4LD 2OLEA 1GN8A 4HBZA 3NM4A 4WUTA 1EUQA 2BP7B 1YS4A 4Q7MB 5HKOA 2FMHA 2RCNA 4PC2A 3CWZA 3I4FA 3U9TA 2JLZA 5ARBA 1DKMA 1OQAA 1LRLA 3PFKA 4BGDA 4YUAA 2RARA 3L05A 3UK6A 2GHRA 1BS1A 1V1JA 3HNOA 2NUPA 1C9EA 4FGSA 3U48A 5JJ5A 1FS5A 1YHYA 2GTHA 4IWYA 4MAFA 1MQAA 2DKOA 2EJWA 4J4HA 5T5QA 2OBNA 2D1RA 3K96A 2W2NA 3D2LA 3L49A 4ZT2A 4LBYA 1RXUA 1Z4JA 5AICA 5DM2A 3OQVA 1CFZA 5H4GA 3KZKA 1QR6A 1XLTA 1OIWA 3DPUA 2CKMA 3ED1A 3QXXA 4TV9B 5FPPA 4BFTA 3M3DA 4EY4A 4J9VA 1ZINA 5KEIA 4RZ3A 2J9RA 4CF5A 4EHIA 1GL9B 5K4GA 5KQGA 1RRKA 2Z3WA 2C9CA 2DKFA 3GN1A 1SC4A 3C98A 1KR5A 3M6IA 1E9SA 1I3CA 3NPAA 1T0HB 3ADKA 4KQCA 2BEUB 4RJIA 3L6OO 4RPLA 4E1AA 2DZDA 3E5HA 3LQRA 1L5RA 5COAA 3BWYA 4E14A 2JLVA 1UJ4A 4MV9A 1LQ2A 1XFAA 1NQOA 2Y76A 3IUPA 4NZOA 2O4CA 2ZBDA 2ECQA 3LC2O 3D8SA 3B9RA 4Q21A 5A9SB 4W9MC 3K2QA 2R1TB 2WQZA 2B36A 2IY8A 3ASUA 3NHUA 2RHTA 1N3LA 5FI0B 2GRAA 3RAFC 1XEWY 1ZIDA 1YQXA 2EW8A 1JHRA 2DVMA 2ZSEA 3O9MA 5AM0A 4RJTA 4R83A 3KOOA 4QUKA 5I9TA 4NS1A 4ZJZA 2QM3A 5K3AA 1UJ2A 2IV7A 3KHUA 3R77A 1NI3A 3VR5D 5CLFA 3C6BA 3F9CA 4DBVO 1ZIXA 4GWKA 1WG8A 4JL6A 3OOHA 3SAJA 3C45A 1G3IA 3WDKA 2CFTA 3K0KA 4UMFA 2QAJA 1EFPB 3MD0A 1E2IA 5E9WA 3TN7A 5KTKA 3HJHA 3EBPA 5AM3A 3JRNA 3VDQA 4IHJA 4DABA 4EO7A 5AJVB 1S8OA 3K8OE 2NZ8A 2CD9A 4LNUB 3WISA 3EEFA 4IYJA 4C1BA 4WCFB 4E5YA 1KFEB 5EIXA 3PJRA 1LBTA 4O2LA 5P21A 4DG8A 2XTZA 1HG1A 3OCUA 4OXNA 4C29A 1N0UA 3LY7A 4K2AA 1WZIA 2Z04A 2ZRIA 4H9GA 4ZREA 4DV5B 1PT7A 2G9QA 3SHFA 4X0EA 1OFUA 2NPIA 4DIBA 3GP8A 3HJBA 4LE0A 3K1AA 1QAMA 2AJTA 3URMA 1XZKA 2C57A 1OZAA 1J07A 2Y0PA 1CPYA 4RVUA 3KFLA 4RV5A 2AUTA 1GTSA 1QXSA 5ES3A 4CM9A 4I36A 1IRIA 4O1MA 3TM4A 4EA9A 2QMYA 3KHKA 3OBBA 1ISRA 1GARA 2VPXA 1SKMA 2ZUSA 3JQDA 1EG2A 2FKAA 2BGNA 4EPTA 1FL9A 4EJSA 1CEXA 1CJVC 2NZUG 2Q2VA 1SIBE 4ZVOA 3ZDFA 1XU9A 4ZCPA 1B7GO 1UZLA 3QXGA 4EO9A 2OCLA 3VBCA 4Y9TA 3TH5A 4IFTA 4OH7A 5HIKA 5JROA 2P3OA 4KK4A 1U1IA 1RRCA 2BMJA 3VXKA 2Q0HA 1JXMA 4MHOA 3WYAA 1XMPA 4DNXA 4GSLA 5AUQA 4WK2B 4DCVA 1LK0A 2WNHA 3AHJA 3OZ7A 2VN8A 4EG0A 3GT3A 2ZVJA 3G49A 4JEIA 1CP2A 2AYXA 1LVHA 1RCTE 4QDTA 2HA2A 4HUQB 5FOXA 5TMDA 3RHZA 3VC1A 4EWLA 5DW0A 2C2YA 4OJYA 3U37A 3HXTA 4CI9A 1DJPA 2I8CA 3CEPB 4FD2A 1DBIA 4U7WA 5IC6A 1ZSVA 2J9XB 3RTGA 3KR0A 5H7XA 3TE6A 3OJXA 1Z2PX 4MV1A 2PKQO 4RZXA 3CUSA 3DWGA 3Q7QA 1OLSB 4Y1FA 5I7FA 3MW8A 4B43A 4R7TA 2RCYA 2WE8A 4LJKA 1W2WB 4PZAA 5I7SA 1RWQA 4LJ8A 1VHLA 1M0WA 4JLMA 1YJBA 1WV0A 4HH0A 4MGZR 4XYLA 2MOKA 4OQ4A 1AKUA 2ZIZA 3BB3A 3F5FA 4PC3A 4JLNA 4PX5A 1NJ5A 4K9SA 1E9FA 2R7MA 2N3ZA 2JARA 2WU3A 2DPXA 3G82C 2RHLA 1ZNWA 1GHTA 3H86A 3KS9A 1SKYE 4G3XA 4TTRA 4XX0A 4TT3A 5H02A 1C3VA 2FN4A 5D5PA 3W4JA 4I7EA 5DMHA 4MW4A 4KVZA 3VJMA 3E5MA 2IHVA 4HMQA 4B74A 3KKNA 1BX1A 1W5AA 1ZNXA 2HC9A 3O6VA 3O31A 1V3UA 4MS4B 3TIFA 1CXZA 1AHNA 4YDRA 4ETWA 4Q9LA 1PL7A 3HWRA 1QDEA 4AVYA 5FWYA 3PLRA 2G76A 4A8JB 1K8QA 4WCFC 3E05A 4YRGA 1J8VA 3C70A 2WAOA 3OWHA 3VR4A 2X9VA 4YRLA 4B17A 5EIBD 1N5JA 1KEUA 1S01A 4K88A 4YP0A 4ZYTA 3QZUA 1VL6A 2ZSAA 3DBIA 4OQZA 4R8SA 3PFWO 2AOVA 4H3KB 4MQUA 4U5QA 3RRJA 4G84A 2I34A 3N87A 3AVPA 3IJEB 3L46A 1LY1A 4ICIA 3TNJA 2VT7A 1RVV1 4J3FA 2X0EA 2A78A 3RU9A 5IVHA 1C9JA 2D3TA 4M53A 1SK8A 4Q4DA 3LQKA 3LVBA 4YK7A 3WG9A 1E2NA 1H0SA 5JQGF 4PN3A 4O3MA 4YFVA 1WXEA 2FSFA 3W1EA 3P0RA 1ZN2A 1ZGCA 3V4SA 4KPEC 4R2XA 4LMBA 4TYWA 5AOVA 2GBFA 3BX1A 2O5VA 2HA3A 1G9TA 2WVHA 3WL5A 1P31A 2WZCA 3WQSB 1F7VA 3LAWA 2FSVC 2JIRA 3GH1A 5H0IA 3PRYA 3DL2A 4H3HB 5GV7A 5C37A 3OF2A 1DKRA 1OAOA 4HH1A 5EKXA 4AZWA 4BYMA 4KE7A 4I6GA 1XEXB 4MHSA 4QNNA 1P5HA 1B14A 3JARA 1G8SA 3AR9A 3RS3A 4AROA 3OU6A 4ZVKA 1P5FA 1YV9A 1GQSA 3BE8A 1TMKA 4BVJA 1MJFA 1PVOA 2FG5A 4KTVE 2ZBUA 1N6PA 2RHBA 4A36A 4WBXC 2ID9A 2PUJA 2BN4A 3U44A 2HX1A 3RR2A 1Q0PA 3EFOA 1MQSA 4LVOA 3I6ZA 4Q48A 2BCEA 1SD2A 1OJ7A 3IQIX 1U0GA 4UBIA 4X5OA 4EKIA 5B6PA 3NHPA 1T15A 2P9HA 3C1AA 4KGXA 5HRAA 2BLLA 4NZYA 4WY8A 4NE9A 1F0PA 2QTVA 4HD8A 4ZVPA 3PDHA 1BXGA 5HQ3B 4BJ5A 3C6MA 3NUZA 3G5MA 3O4JA 4EIWA 5ILGA 3OJOA 4U7DA 3GF4A 2WSYB 1WHSA 1GSHA 3NIDB 4M3NA 5DXJA 3MIZA 4D9NA 1JEDA 2B20A 2QZJA 5KPJA 3DCIA 3DEJA 4MVJA 4BVKA 4BX9A 1LPOA 3HRKA 4PIVA 3W6OA 5F77A 2ZE7A 5ISMA 1OPRA 3D3EA 4IDOA 3VYSB 3OJLA 3N39C 4U63A 2PN1A 2GD1O 1ADCA 2CLCX 4Q01A 3IO3A 4YNBA 3VZDA 1YZVA 1MB4A 3FDIA 4DCNA 3GZJA 1QG6A 1TYCA 5C1OA 2XD9A 3WHKA 5A3JA 5A0TA 5T8KA 2Q3JA 3L40A 1E9AA 3P2YA 5B4TA 5KYUB 4DRXB 1W75A 4QSMA 3UWMA 4J94A 4HATA 1PK8A 1ZS9A 1UOQA 3NP7A 1E2MA 4LJ6A 4YJ3F 1L7AA 3WJAA 4JNKA 1CE8A 1DQRA 3S8YA 3JTMA 4I4NA 1QYVA 3IP3A 2D06A 1PS9A 2QR2A 4NR0A 2AOTB 4Y2QA 3STHA 5EKDA 3DO5A 2PH7A 4FFBA 4HQFA 4S1NA 5AYVA 3SR0A 4IJ5A 2XUOA 1G1AA 2H07A 1TCUA 3IVCA 1WLYA 3S70A 5IJWA 1QQ5A 1QMPA 4M1SA 4QT4A 4AQ7A 1GEGA 4MXDA 4J43A 5GIPE 2Q9CA 3T7CA 2RBGA 2GOYA 1J8DA 1VKJA 1XNHA 2ONZA 1NNEA 2SNIE 2C8LA 2WDPA 2CMDA 4A6DA 1R4NA 4M1WA 3NWOA 3VPCA 4HVAA 2IYQA 2ONYA 3BK7A 2VKTA 1V48A 2H5LA 1GQRA 4J03A 1M7HA 1N7JA 1MEJA 2ZJYA 4XLTA 1KYVA 2FPGB 1E5TA 3A3YA 1IN4A 4MVJI 2V6GA 3R3UA 4UDOA 3BMCB 2VZ8A 3FR7A 4L08A 3FUVA 1Y9EA 3SE7A 2XGJA 2JRLA 2X41A 2QD3A 3N76A 4NK4A 4PQFA 3WGLA 2YBEA 4AZ0A 1NNSA 3JWGA 5A7FA 3PZBA 3IULA 1V1MB 4OQDA 2WIDA 4GL4A 4MCJA 2FP4A 3D5EA 3WY9A 2Q41A 1DO8A 4M7WA 4DM7A 4BTEA 4MS4A 1GZ6A 5F9MA 3KVNA 4NFLA 3AUAA 2GD6A 1RW4A 4Q4CA 2DHEA 3KWFA 3CY6A 1ZCZA 2ID4A 3UCEA 1HLFA 5KNCH 2R6DA 4ODIA 5J40A 5TE9A 2LCIA 3DE4X 4MUHA 2OHOA 2VAPA 2W22A 3BCRA 1WQ4A 1JHXA 1ZLYA 4PONA 1QP0A 3ZWOA 3UO8B 3QTBA 1GKKA 2CYAA 4FYPA 4OM7A 1IXRC 1OI4A 4DT1B 5MF6A 1PT9A 1FUKA 1ZYUA 4B80A 1Y7IA 4ZT5A 1CJTC 5KI6A 5DIZA 5ECWA 2Z2YA 4P53A 2KS6A 3HABA 1MHPA 3OC6A 3OZRA 5E2AA 2WABA 4A8PA 2HHHB 2ZIEA 1VFPA 1D6JA 2WUGA 5GONA 2QV7A 3O8OA 3PXUA 4DC0A 1Y98A 2HBYA 3MS2A 5A62A 1KYTA 1V5WA 1R0WA 2HU2A 1JDNA 4Z86A 4H27A 3K53A 2ZSUA 5EE9A 4TLMB 3HADA 4YUVA 2DJ5A 4TTQA 4BLVA 1ZGAA 5FTNA 4MLDA 3T7JA 4N0QA 1T34A 1FC0A 1KJQA 1P19A 3JWIA 3N0VA 2IT1A 1SOUA 2R1UA 4CIDA 4DLSA 4BVEA 4O6VA 3CIFA 2EKBA 4L6IA 4FDMA 1IEWA 1U2DC 2EERA 3VPGA 3DFUA 4ASUA 1EWVA 3DA8A 5IC4A 3P9QA 2Z3VA 4FFOA 3O9ZA 1F6WA 3BWDD 3KOUA 3SF0A 3T1QA 3RV3A 2VL7A 3UHAA 4OHKA 1JLSA 2QNBA 2D7CA 3LQQA 3DXXA 5GY7A 2V4ZA 2B8EA 2PAFA 4KAJA 2FPUA 4X3PA 1FBNA 4IQ4A 3L7AA 1ZMXA 1G291 4YT2A 1GXSB 3GC6A 3PUKA 3N6VA 4M54A 1VIDA 4DRZA 1AGPA 4QYTA 4ZQCB 2P0YA 4UD2A 2ZJBA 2AF3C 2HCTA 5AVKA 3OT5A 4ETNA 5LQJA 3JQBC 1GPH1 1FPQA 3W9UA 1UF9A 2X3UA 3EYAA 2NXWA 2RIPA 3HHEA 3LBAA 3K70C 4LKRA 5HIIA 4DB4A 4QASA 4IXDA 5KX5F 4ACAA 3H8WA 4WN9B 3CUVA 3E3OA 3G13A 3U31A 2ADMA 4L5AA 4L9SA 8LDHA 1KI9A 1C29B 2PMDA 3F6SA 3VO1A 3P9YA 1OBVA 3P71T 4GPZA 3KWJA 2WA1A 1O95C 3K6SA 4QREA 3JQBA 1K9SA 1Z47A 4JI4B 2QRPA 2OV8A 1AHHA 3VZRA 2VPQA 3H1FA 3LHKA 5SY6A 1V9CA 3FJOA 3GDOA 4D02A 1MB9A 3Q8XB 3K0CA 2V0NA 1H69A 1GUZA 3OY2A 2RHCA 2BFOA 4UDYX 5G1OA 2R60A 2FPPA 1AV7A 1JKXA 1XE3A 2JFQA 3MS4A 1F3LA 1OTXA 1KAHA 1BFKA 1Y7HA 1RHUA 1YBMA 2XPCA 3EEBA 4W6QA 3FWHA 4U39A 2R48A 4QVKA 1C3OB 4IXMA 5GONB 4EKGA 3T0GA 2EKLA 4JJ7A 1L5FA 3GNLA 3RAGA 3V46A 5DOZA 4Y9UA 1VPEA 2NTNA 3TOZA 3OF3A 4F86A 2PZKA 4BO9A 4X71A 4I5EA 5JHGB 3T3NA 1QRRA 4P58A 1IZYA 5CFQA 3TWOA 2KB0A 1U8YA 2I6XA 4RDCA 1R0LA 3A6ZA 2GM9A 3OECA 4WXPA 4RE6A 1TU0A 1W94A 3NORA 4DCOA 4RKQA 3E2IA 3ELDA 1JG7A 4O25A 4RL6A 2GLUA 4NU6A 1DX6A 4NJMB 1JLKA 1MKYA 2VNSA 4R2HA 4XFJA 5KTTA 2NU9A 2W6ID 2FTKE 1LF0A 2ZYHA 2YQ4A 1PR5A 2XWQA 3O2QB 1RHQA 4LC1A 4Q9KA 1BMFA 3BORA 3FLAA 4JCOA 4YP1A 3QHAA 4GUAA 5ERXA 1T4CB 1JBKA 3CVJA 4QVGA 2CLIB 2E1RA 3HKBB 1DEOA 2ASEA 2WPDD 1R4AA 1RR6A 3O84A 1C80A 3SNKA 3ETNA 5D84A 4IRMA 2DEUA 4A8TA 3W2GA 1M0TA 2VP5A 2YC2C 1JGTA 1XNRB 4B3GA 1V4BA 4I8XA 3VVLA 1YQDA 4LX8A 2EP8A 5FPQA 2IU3A 5C5DA 3AUFA 1T3TA 1QHHB 4NHEA 5EWLB 1N5DA 1NMEA 3NVDA 2FPGA 5E0KB 1NVXQ 1P62B 2ISQA 3BXXA 4F7DA 4DLZA 1UBRS 1HKUA 4WZZA 4BLQA 4WOPA 3VU0A 3TIGA 2ZS9A 4XE5A 1L3BA 1AKTA 3BE4A 1XLVA 4D0GA 7GPBA 2IY9A 4JEMA 3RRYA 1J24A 1ESDA 3VHRA 2WSIA 4ENSA 2IEIA 2OEPA 2FMKA 3DPIA 1BQ4A 2QVXX 1B74A 4X3CA 1TC2A 2M6KA 2QB5A 3HGMA 1GZDA 4PZYA 4Z53A 3ZE8A 2GVNA 2R9VA 2IC5A 3KJXA 3CXUA 5GIOE 1DIGA 3IA2A 4RD3A 5G0VA 2VDKB 5I9IA 2VJPA 1NJ8A 2Z2IA 3OE1A 3PU6A 3TZBA 5C8YF 3K9HA 3B38A 4U2DA 1U9ZA 4UHCA 4N0EA 1G8KA 2OLJA 3FBGA 4RA6B 3ZK8A 2E49A 4BO6A 4EQ6A 1ORVA 4LDZA 2FDXA 4N3BA 4B3FX 2FJPA 1BYUA 1I3LA 1CY6A 3V42A 3O95A 1A4IA 5KKAA 3DR5A 3ZWBA 3IBCA 5BWBA 1KEKA 1NF3A 2I29A 3SJZA 1TO6A 2A84A 2F2TA 2WYWA 1HTTA 3IIEA 1ZA1A 4KVAA 3LLSA 1CZRA 4GX0A 4LBVA 4KQIA 3L7OA 4U6QA 5LDGA 1ECFA 1JHZA 1JHAA 1UBKS 1EJ2A 4WKCA 3KYCA 4ZGWA 2D5BA 3AOEA 4G9GA 4KI0A 2QJRA 5T7BA 2ZLBA 3TLJA 4I55A 1D1PA 1UK7A 1EAYA 1RKBA 2QU7A 3CLHA 4C0AC 3O3CA 1G4HA 4DTIA 2CXNA 4XVUA 3QBDA 1UFRA 3IS3A 4CQMA 1JPVA 1JTEA 2Z56A 4HGPA 2BMWA 4AD8A 1H0HA 1GTG1 3IT3A 1XQYA 1QGUA 4JSYA 3BL5A 2GDZA 1KI6A 2QZ9A 5TQJA 4AN4A 1NUQA 1U7UA 2QAGA 4L0MA 5J5AA 1X7ZA 1RAIA 4FDTA 4KXNA 2X5JO 4MZXA 1N5IA 3IV7A 1L1EA 5AM5A 1RWNA 2IPXA 3UFXB 4R1QA 1J20A 2QPTA 4UAGA 1LKZA 2FAXA 3GD7A 3HYSA 1EDDA 2C5FA 2AKYA 3KEQA 1TT5A 3CXRA 3GEHA 3LG2A 4YI5A 4AJ9A 2UYHA 5CNJA 5H1YA 2O0KA 4XB1A 2C2KA 3D4LA 1KVTA 4TROA 3TPFA 4IR7A 5J59A 4GM4A 3ABOB 2HADA 1D0IA 1J6UA 1PZMA 3JWPA 1E6UA 3KCQA 3KC2A 1W36D 1NURA 1R6VA 4ZU1X 1MO6A 4J3NA 1SOWA 2ZT6A 4PLGA 4G4JA 1DNPA 1FDUA 1U2PA 1P1RA 2IXGA 3AF4A 4E11A 5JCOC 2V9ZA 1DBQA 2G9ZA 1L7RA 3RIMA 3ZXIA 3KSZO 3UB2A 3ZUPA 4FHFA 1TDJA 1P2GA 3UICA 1MX3A 3MTIA 2CHFA 2VCHA 3O75A 3GA5A 4ND4A 3L84A 4BLPA 1NN0A 1M3SA 2WB2A 1PDWA 3L6UA 5TARA 5L7WA 1WVMA 4J0HA 5JAIA 3WLQA 1EK6A 1Z26A 2JVJA 5CD9A 4UM7A 2PX4A 3PFNA 4FYJA 2O0JA 1IOZA 5DW3A 1BKSB 3IQFA 2ZM5A 5JAPA 2LE0A 1BMDA 1SQFA 5AJUA 5DU2A 4U0JA 2J07A 3FI0A 2ZRGA 5DN9A 2G9RA 1GTL1 2RGRA 1A7AA 1E9VA 1YRWA 1N1DA 2VSOA 4RKYA 3RHSA 1M5RA 4EHNA 1NPYA 4TWJA 1GAEO 1V5FA 2WG0A 3AFGA 3BMQB 4I9FA 4X1YA 2ANCA 3WZMA 5LIPA 4IVNA 4NCKA 4A1OA 4ZDJA 2N47A 3AI2A 3V33A 3G5AA 3BDIA 3PGLA 3SX0A 1EJBA 1YQWA 3IAS1 1RRVA 1O58A 1R0RE 4E32A 4MH0R 3BFKA 5LQUA 2J3DA 2C2WA 5D1NA 4LSWA 1IN7A 1IZ8A 1ZAKA 2HNKA 4Q9HA 3AUTA 4EUHA 3ONVA 2POCA 3K9FC 1WPQA 4R05A 3IBYA 3RYHB 1EVQA 4I6JA 5D3MA 5EMHA 3RFUA 1JIXA 4ZHQB 1CHDA 4D44A 1QX4A 3PYXA 2XCRB 3CJRA 4Z9XA 3AHIA 3C8DA 1C7FA 1S2LA 3CRVA 3ZE0B 4NATA 4TM8A 4V3CA 1AS0A 2I7XA 4OYHA 1Z0JA 2DUMA 2A2ZA 1P0FA 2PMCA 4U5XA 4M0PA 5DN6A 1E9CA 2D2IA 3Q7SA 1AMOA 2FEPA 2WM9B 4O4LA 2O2IA 3LP5A 4LRUA 1CIJA 1SC6A 2OY0A 3ETJA 4IP0A 2QTLA 4RORA 1VIAA 4AIIA 4DYVA 2VAWA 4IJWA 2K5UA 1NJ2A 1CJMA 2DQ4A 4W8OA 2ZRCA 1KQOA 2CLHB 3K32A 4DMLA 3OAAA 5AKYA 3TLBA 5L53A 2WVGA 1VRVA 2ZPUA 3SHOA 2I2FA 1LD3A 4CYMA 3ENQA 1E1CA 3AKDA 4R1LA 5AHKA 4FDAA 3HCWA 4Q4JB 3PSHA 2WHPB 2Z1MA 2GZ2A 5CW2A 1KO8A 1N6OA 2Y92A 4IHAA 1IC6A 2DHDA 4IAOA 1TQ4A 3GRVA 4ME6A 2VSNA 2WJVA 1LC3A 4NPAA 5TXGA 3TRIA 1Z15A 4IDGA 3HXOA 2J5RA 4R9SA 2ZI7A 1G7RA 1YOBA 5GMOA 1W35A 4ZCLA 1MOQA 3VSBA 3T61A 2C77A 2FK8A 2NP7A 1M2EA 2H8KA 3AINA 3LOUA 4KLCA 2VUIB 4MLPA 3SFZA 2C7OA 1MZVA 1QH8B 4GOLD 4C7MA 2PX6A 1M0SA 1BDMA 3EMKA 3KZXA 1PTJA 4NBWA 5DNYB 3AY3A 1ODKA 4MRMB 4Z8XA 3EUFA 3DJYA 3W2FA 5E4FA 1H9AA 4Q7EA 4KMOA 3GMIA 4J1NA 5AI4A 4IMPA 1F2TB 4JLVA 1Q1GA 5FBHA 2FWAA 1NVVQ 4YV1A 4ZVTA 2R84A 2OYRA 5AH0A 2VDUE 1J42A 2R7KA 1PR1A 3C4JA 3LKVA 3ND8A 4P5PA 4C0KA 4XWOA 5C1BA 3NDJA 2Z8YA 3LHFA 1Y8QA 2O50A 1CEQA 3NEAA 5CXSA 4BU0A 2G70A 1SJ9A 2FMXA 3Q72A 4G0YA 1EB8A 3OKAA 4B4OA 4EYSA 2GVZC 4AZTA 3RYIA 3PXXA 5DGTA 1UC4B 2OFWA 3LDAA 5KTSA 3H5NA 1U9IC 1I33A 3CZAA 5DPMA 2C83A 3N6XA 4LHSA 3MPUA 2Q29A 2YDYA 4MITA 4R9UC 1W4ZA 3LPDA 4PGMA 5DCYA 3IKLA 4D6XA 7REQA 4P3PA 2VAMA 3RVLA 2VHYA 1T4BA 1HLDA 2ON6A 3QVXA 1NBHA 4OYLA 2FEOA 4ENVA 2IHYA 1JA1A 3PT5A 5KYXB 2BFDB 2CBZA 4MVJG 1HV8A 3QE4A 1GPJA 4WCFA 1FDRA 2G9VA 5K99A 3RVRA 1PUJA 3IUEA 4AY3A 5B55A 4INZA 5SYAA 1W1UA 2IXAA 6ADHA 4FYXA 1RPTA 1YB1A 2JI4A 4NAVA 2TECE 1AKVA 3ZHYA 3FDXA 4U00A 4F12A 4B73A 3LY8A 2OXRA 1WX1A 1N25A 1L7OA 3BS4A 4G0QA 2OENG 3PUYA 2B34A 3N70A 1TPYA 3DDSA 3D3WB 3FFBA 4RHFA 4TL7A 4BIIA 1KQNA 1E5VA 4A0FA 5BR4A 2ZR7A 4F38A 5BP7A 2FXVA 2RGCA 3B13B 4N49A 4LOKA 3PEYA 3QF4B 2G88A 4UM8B 4E1VA 4IMRA 1YR1A 4Y1GA 4CM1A 4YRNA 3N0XA 4YCCA 1QQ6A 3ND9A 5I8PA 3QNMA 4OK6A 1KE2A 1H2HA 2ZI6A 1CW2B 1SVLA 3GGDA 4RM3A 1CY7A 1IVYA 1U2EA 5JCZA 3M3PA 3GMDA 4F72A 1Z0FA 3FNRA 2FFAA 3L8FA 4R8KA 2CFIA 1OU0A 1B3BA 1BA2A 3RWOA 1T2DA 2VQSA 5CAEA 4WBNA 2GTIA 4HFJA 4X00A 3SP1A 3UAXA 1PJSA 3ER8A 2Z5VA 2Q2WA 3UAYA 3PEEA 2YZNA 2BDUA 2VHTA 5CP8A 1ESNA 3R0VA 2XA2A 5EXEA 3AOGA 4UFOA 5HXAA 1VQ1A 1Y8RA 2IOFK 3H4IA 4JP3A 4BPRA 2IFTA 2FW9A 4OSOA 5ERYA 3RSHA 3E8SA 4FEGA 4OD0A 3REFA 4J29A 4BKRA 3AUJB 4CLRB 2YTZA 4CMGA 1T9BA 2EFEB 5HZGA 1MOPA 1UWCA 4GMDA 1DKQA 2R2GA 2YASA 5M5BA 3WGTA 2DHRA 3I1FA 1IN1A 2GXQA 3BMXA 2WWVD 2V59A 3CRW1 2V3WA 2GN2A 2H7XA 2X22A 3BGOS 4JB8A 2GT1A 2C2OA 3EMBA 4LJYA 1NRXA 4K9DA 1EIWA 1N6RA 2O1SA 5AJYA 5JI3E 2B1QA 3S2ZA 2I6FA 3TQSA 2VHJA 3QPDA 4YN3A 2AOWA 3TJMA 3U9SA 1Z4MA 2APJA 3RVSA 5AW1A 4KGZA 4OMUA 4H60A 1YTUA 2HAEA 3QJ5A 3PTAA 4FUQA 3PXDA 1K06A 4YMTA 1GSOA 1I2MA 2R2AA 2RONA 1OC4A 4U4AA 1P3Y1 4YJ3A 4A4DA 4QBIA 5AOAA 3N2GB 2NTVA 1KY2A 3HVHA 3MAJA 3ABSB 3K31A 1N0WA 3OESA 4G1MB 2PHZA 4JYBA 5I9SA 4J1TA 1AQUA 3EY4A 1XWFA 3QNWA 3CN7A 2HUPA 4P34A 5NLLA 4WERA 2R87A 3D81A 3RREA 4MVJM 4MSUA 1W9HA 1F4PA 3MCWA 3OZIA 4DMMA 5B7PA 1E3IA 3RFCA 3OLXA 3MWDB 4BGEA 3U2QA 1W0KD 3C3BA 5F3DA 5FB3A 1WO8A 4DMKA 3QG1A 3NR2A 2FLWA 5ALHA 3AUSA 1IOLA 4Q34A 1I94B 3RBAA 1O08A 3CIOA 2OCKA 4TTVA 4D6YA 3Q8MA 4U2FA 4JVSB 1KSHA 4CLEA 2YJZA 5BUZA 1I01A 2H31A 4X66B 1PYDA 4OQYA 1RJFA 4EDFA 4LDQA 2YWGA 3RG8A 3KPUA 4CQLA 4U2KA 2O5EA 3FYCA 1E1YA 2EFYA 1FNMA 4JR0A 2JGRA 1NNI1 4UBMA 4A27A 4YMVA 4K1LA 5FBVB 4BTVA 1EWYA 1MVNA 1H4VB 1V8ZA 1OLXA 2EEPA 3B5IA 1O89A 3M81A 1E9EA 3DBHB 4HWGA 5E9JA 4RF3A 4HX2A 1N2IA 4TLCA 3JSAA 5H3HA 1XEAA 1QVWA 5IXJA 3HDHA 2CNOA 4KN6A 3P9SA 4L5IA 4NFSA 4GGOA 4KPFC 1PT6A 5I7UA 4NYJQ 1EFAA 4JMLA 4LHWA 2A1TS 4DV7B 1QRUA 3HUUA 3DWEX 4PICA 2X2EA 4NVRA 3WK9A 2XZOA 2AOXA 1ATZA 2GRJA 4QGBA 4IMIB 3WMRA 3UXHA 4OY3A 1E94E 3F5SA 4CM7A 4D9GA 1J25A 2ZUVA 3GFSA 2IDZA 4WZBE 1G3MA 1DTWB 3KD2A 5H16A 3WGNA 4XZ3A 3U62A 2B0CA 4ZYLA 2OFXA 2D2FA 3L7DA 1XD8A 2OAGA 1LSOA 5AMXA 5KQMA 2ZSKA 3INGA 1ZU4A 2H5IA 3DL4A 4ZJYA 1TECE 3BZBA 1GZUA 3FE2A 4LJLA 5HK8A 1RPZA 4RZQA 1ZOIA 3P2KA 1T3SA 1ZNZA 3L1HA 3KSDO 3GA7A 2E37A 4OHMA 4DGSA 3ESYA 5JD4A 4WACA 3T4XA 5I9NA 5JZVA 1KO5A 3WMXA 1IY2A 2A0UA 2VJDA 4II3A 5BYAA 3ZX5A 2HSDA 3DG9A 2JLCA 1AUXA 3V1TC 1SO8A 3BSSA 3H5RA 4BP3A 1VLLA 3PDUA 3ZWDA 2HMWA 5ALLA 2Q8NA 2OV1A 3WHLA 4OHPA 3QW4B 3GLGE 2QZ4A 1VKHA 3KL4A 2DY0A 4H1HA 5JRDS 2XTMA 4PO3X 3USCS 3CX8A 4CF4A 4NK5A 3HU5A 3NBUA 4V38A 3CTPA 3FTCA 2AC2A 4R81A 4QDUA 1EUZA 1GGHA 2DUWA 1C3XA 1E77A 4BMVA 2R68A 1SBYA 2BONA 3D8HA 3L7CA 2LZ0A 3CH4B 4ESVA 4IFBA 1XF1A 3R3VA 5EQJB 3NEJA 2Z6VA 3LRXA 1OZGA 4TZKA 4IRXA 1NY5A 2XCLA 3PQ7A 4NCIA 4ZGBA 5ITSA 3B1JA 3IPXA 1M1NA 2WWFA 1GDTA 4PX3A 2OQRA 5FUVA 3QGMA 3TCNA 7YASA 3HXLA 1OXUA 1A8IA 2AMFA 1A8QA 4PYKA 3GHHA 5ALTA 3LPLA 5ITVA 2R5FA 4UBNA 3OIFA 2R8BA 2HREA 2IXDA 3ZE6A 1Z74A 4JJIA 1GD1O 1YA6A 1D0VA 1S5PA 2VBGA 2JAXA 3RKRA 3M1IA 1YQQA 2WOOA 1D2GA 1KSFX 1RYZA 3LKDA 1CUYA 1GQYA 2J9GA 3HMQA 4G37A 4EB0A 4F4CA 3KPWA 3MCVA 4UHFA 4B75A 2XT0A 4CMIB 4PG6A 2VF4X 4YRSA 1J22A 3E6AA 2MSNA 2OD2A 2E87A 3QVGA 4CN9A 1NLFA 2DR2A 3E23A 4DDHA 1YK0A 3GAFA 1JEYA 1CJCA 1QM5A 3LL4A 3AJEA 2QSUA 1LV7A 4LNAA 4CIAA 2B5OA 1HZZC 4H0CA 4X41A 1YB4A 3RAEC 5T4BA 2QTHA 1GIAA 1BA3A 5TGZA 3ZYCA 4BCDA 4EJ0A 1YQTA 5B6JA 2FY8A 4QPDA 4C88A 5IWAB 3OP1A 4IV8A 1QC5A 2BEJA 4M1MA 3RUIA 2Q4TA 1RQ2A 1ZRMA 1J21A 5JLJA 4W5OA 1B76A 2IEZA 3D6UA 2UZ0A 2EFJA 3PFFA 3QXHA 4KBFA 2XQVA 5T6MA 4E22A 1WSAA 3BD9A 3ILYA 5JYCA 4S2UA 1FRNA 3N2KA 1MXHA 5CH8A 4MR8B 1TCVA 1RXCA 4V1CB 3VAYA 3KLOA 3PL1A 2BSXA 5EUMA 5KTPA 2WY2D 2Y77A 1KMHB 4QODA 4QQ8A 2XWJI 2P5UA 4DPLA 3PX7A 1VGVA 4GPTA 1DS6A 4CDRA 3NWJA 2FPRA 5CHYA 3TD9A 4D56A 2J85A 1OA1A 2PMKA 3MWEB 5JT1A 1Y1KE 1GVHA 2QGNA 2BCGY 3PI6A 3O8OB 1XVTA 2QGFA 1D2CA 3FFWA 4PNZA 2YHIA 4DAEA 4CEJB 4D82A 3RSCA 4BX2A 2G6TA 1E5LA 5JEEA 1E5DA 3IOBA 4C7KA 1XTUA 3LC1O 3MSCA 2IYUA 4NBUA 4GXQA 2OWDA 3Q1KA 2A0XA 1I2ZA 1V6AA 3A4TA 1JEAA 5FUBA 1MO3A 3TAXA 4BB9A 5CAEB 1TYZA 3SQLA 5CVEA 4M7PA 2D0DA 3VYTB 4MTCA 4HNUA 1TZMA 3N2LA 3CLRC 4FOPA 1FFBA 1IONA 2ERCA 1FW8A 3MWLA 4RGBA 4ZEXA 1RJ9A 2GO7A 4F9GA 2J3HA 3GNTA 4GDMA 2OG1A 5DISB 2A9RA 3TLGB 4AICA 2DF8A 2FQYA 2F8MA 3HI6A 4N6OA 4QHSA 3UT6A 3B53X 1GV1A 3WSWA 1XCBA 2XV1A 3NTXA 3CJTA 1MJNA 2ZAIA 5CYFA 1D2NA 1O7JA 2PGAA 3K0BA 3NC0C 4TVBA 3LT2A 1NRJB 3LJKA 2NGRA 2VJMB 3ONWA 4MWBA 3O2NA 5D7NA 4B8ZA 4AUKA 2RAVA 3N58A 5IUJC 4I50A 1DGQA 3IPAA 1A9SA 2OXFA 3HBNA 5DO9A 2XBMA 2SKDA 4ZVVA 5ILQA 4KCGA 2G17A 1G3UA 2HWWA 2R47A 5HFJA 1HYGA 4TV8A 4FB5A 3WNDA 5AVYA 1FJGB 4HB3A 5FI3A 2J3JA 4I1RA 4UNSA 4UFPA 3T7RA 1VPLA 1NA5A 2F3TA 2MSLA 2XUPA 4MX8A 1PFQA 1T2UA 2F1HA 3W3AH 1VRWA 4WESB 1IXYA 1JG2A 1BKDR 2BRUA 3WR5A 2WUDA 1QFSA 1V7QA 1FDVA 1Y63A 2QP4A 1CR0A 3N8KA 4HG2A 1Q0HA 2VTBA 2JLQA 3LUDA 3SQNA 1AX9A 1WWKA 2FUNB 1I36A 2QPAA 1K6IA 1PZHA 3BHNA 2Q50A 4J07A 4MPPA 1KEEB 4O29A 3RYIB 2GGSA 2OORC 3WQRA 4EG4A 1IJEA 1GUFA 5KYYA 4MGKR 4V03A 2H48A 5LA6F 5KSZA 2PLAA 1FU8A 1VOTA 2HSWA 4D4LA 2B6HA 3GJ4A 1W1IA 3IDOA 2CL7X 4TYPA 1ODCA 4E46A 2NSLA 2A88A 1SR8A 1RAAA 2GPYA 2M1ZA 3DUFA 3PQ6A 2OUIA 2V5AA 2JASA 2V7VA 3C16C 3ND7A 3ZH2A 1UR5A 2PFSA 4WESA 3EQ7A 1KO7A 1HL7A 4XD2A 5F73A 5JD3A 4RADA 3THWB 4O02B 2Q3CA 3BRWD 2CJXA 1AMNA 3HLYA 4F2GA 3S7TA 2IHKA 4YJFA 3U3ZA 1XZPA 2KBFA 2JFFA 2ODBA 1HOXA 1YS9A 3WGMA 4LZWA 3K9WA 2XNJA 4WPGA 2YHBA 2D62A 4QYIA 1L5MA 2FE1A 4YCJA 1K5GA 3IQWA 3RYFA 4YO8A 3JQEA 1E9DA 4FYVA 5EWMA 2BFMA 4IZHA 1HH4A 4CL8A 3JD0A 1QTNA 4OBXA 2X7JA 1N7IA 4G4IA 5IJXA 2IPOA 1Z8FA 4MI3A 2WI8A 3UAWA 1GM5A 1KTVA 2E4WA 4CKWA 1FLDA 1L4LA 2JJ2D 3OFND 2IS2A 1YWGO 3UPDA 1G3RA 4OAOA 3F1LA 5JCXA 4CQNA 2IXTA 2JJYA 3F5DA 1ND6A 2J7PD 2X2FA 3AVVA 1KOGA 3LCJA 2ORED 1Z16A 2V6MA 4S1WA 1I0ZA 4JP8A 3T7TA 1X9IA 2R7NA 5FFFA 4Z7QB 1O8CA 1JEQB 4I9NA 4RZHA 5LDDC 1IY1A 8AT1A 4URZR 4HJXA 1C7RA 1W0CA 3Q41A 2EW2A 2PGNA 1XD2A 3PDIB 5AKEA 4EJ6A 1DBVO 2ZIUB 1MB0A 2CBGA 5FBKA 3RIEA 1BCRB 3TLAA 3H1TA 1XQVA 3NJRA 2IKQA 3T9BA 3TTXA 4EQ6B 4Y2HA 5IKEA 4N48A 3RHFA 2ZVQX 2ZREA 1N2GA 3JARB 1NV9A 2QT9A 1PNOA 4AP5A 2AI3A 2H9YA 2ZU0C 3AR8A 4E09A 3C6ZA 4Q3DA 5ALDA 4EFKA 5C8DA 4LCJA 3KXKA 2UZAA 3DYIA 2ESRA 3H6KA 3KFXA 3U0VA 4HSEA 4GXRA 3TLEA 4CETA 4LZPA 2JI6A 3CNHA 1DXOA 4LY6A 3E48A 3LQYA 4L5YA 3P19A 1FFXA 3TL2A 3WL3A 5HW0A 2P2CA 4M38A 1UBLS 5AXDA 4PLWA 3UMCA 4I5IA 1IWBB 4GOOD 3MCZA 2DTDA 3R5FA 4REQA 2JHCA 3CZ4A 4ZDIA 1KMQA 2EBHX 2ZIXA 1WW8A 1FVFA 2M6LA 1WMDA 3SZGA 1L4BA 3D9QX 4J1SA 2FPIB 3GOQA 4URFA 3FBTA 3OY7A 2IHUA 2XLCA 3K2EA 1JQ3A 4P2GA 3LDGA 3RYFB 1USVA 3BEDA 3U40A 4JI7B 1WF3A 3TFOA 1M1YB 2GBGA 1MOZA 3FWYA 4J2HA 4MVCA 1DWUA 4OLAA 3HJCA 5EXXA 4LFBB 2C5EA 1DJQA 2P4EA 3WQHA 4V02A 5THQA 4KQGA 5KX5B 3LZDA 1PQ4A 2AFHE 1TMYA 3DLHA 1BDHA 4LOIA 2PBZA 4UKDA 4CR7A 3THWA 3ORFA 2QRMA 1N2HA 1PNQA 1U1GA 3R76A 1VIMA 2JS7A 1UCFA 4TL8A 2I2XB 2QRNA 2XTNA 1XRMA 2CK3D 3IDAA 4L4SA 4R2IA 4EB8A 1C0KA 1DJOA 3HKCB 3K71B 4YJGB 4KJZA 5ELLA 1GPBA 1IZ0A 3GLFB 3H2KA 1Y34E 2DU8A 4XUCA 2BI4A 3M6LA 2G25A 2C2XA 2QUZA 5TDHA 4E13A 3QKIA 2UUOA 2BR5A 2NXCA 1NMQA 2HQBA 2HMSA 2QTNA 1UT8A 4CMIA 1KEEA 4RTJA 2F8SA 1XCJA 1JTFA 3V9AA 4Y9DA 2RGNA 3W77A 2OC9A 3M4ZA 3Q9UA 3V2GA 1DJMA 2AJLI 3PUXA 4BEWA 4YP5A 1OWLA 4M0FA 1MVLA 1LI5A 5IM5A 2E6KA 4YJ2F 2FFBA 3VNQA 3WNZA 1KWKA 3IMKA 1FYEA 3E9EA 4HI0E 4NICA 3RANA 3TX2A 2HBRA 1EDEA 1O9GA 3JQ7A 4I5GA 4OMFG 3WNCA 4DCSA 5CYGA 2FX2A 1FCJA 3G2HA 1O5IA 4XM2A 3H2GA 1P4GA 4NJEB 2QL6A 4DE5A 4HB4A 2AG5A 3DC7A 4YACA 5A4AA 5COBA 1SHZA 4HMOA 3HM9A 2CXHA 2V6FA 4N5NA 3S81A 2V6JA 1X7XB 2IITA 5CDHA 4JL5A 5IJ9A 3L7LA 4KPYA 3O82A 4FLMA 4QXMA 2O8BB 3CF6R 5K0CA 3B2NA 3PYLA 3HYRA 2QM0A 2NLOA 1XX6A 2W5UA 1PSDA 4RVSA 4KSBA 5DN6D 3DOUA 1MDFA 1BXKA 1NJFA 1TRKA 1XU7A 1GZHB 4HHEA 2VYFA 2A30A 3NJ8A 4MYRA 3AWDA 4RNDB 4WW0A 3RIHA 3TLKA 1RJ9B 3BJZA 3UUGA 4H7FA 3EGCA 1CQJB 3GO4A 1J56A 4UHHA 1FB5A 1GGMA 4DZTA 1NX9A 1O0BA 2P79A 1AH2A 3OFSA 4U7HA 1UMCA 3NYWA 2NV6A 4GMFA 4KXWA 5LQAA 3AEUB 5KKNB 1K6EA 1KFBB 4L0DA 3WYDA 2ZJ8A 1O6CA 4C21A 1Z39A 2C9OA 2GTPA 2PZLA 2O2HA 3PHGA 4LMAA 3B3JA 5ARCA 4Q1DA 4F91B 1HWYA 2O0HA 4UXJA 1RC8A 4M1ZA 3V8RA 2R1ZA 4BFUA 4U9IS 1HTBA 5EG5A 3M3HA 3CVOA 3M2PA 3PNKA 2GLTA 3BSWA 2E6UX 3B1FA 2MCFA 1U1DA 2P41A 1YVPA 2BFBA 4M46A 2AEMA 1TVMA 5E7IA 5EE3A 3TSWA 4PNPA 2Q4RA 4X6UA 3UT5B 1PW7A 3AF3A 1UQRA 3HEAA 3LXRA 3FFAA 2F9FA 2VF8A 4QJIA 3QEBZ 1ST3A 4IGEA 1VLVA 3ZE9A 2ADFA 4L9WA 4M0CA 4I66A 1DAPA 5AW2A 3H3FA 1EMDA 4LV6A 4UM9D 1QOPB 3TSAA 2PUHA 3KUDA 3INNA 1C30B 4CMKA 4JJ4A 5JCPA 1TKBA 2DFLA 2GJAA 1NKSA 3D43A 3OQIA 2Q1UA 2GJSA 3EK2A 4K28A 3C3JA 3WWZA 7ADHA 1KJWA 2DUNA 1RBYA 4Q9JA 5IK2A 4MICA 5FRDA 1VE3A 2J3EA 2EG5A 4HDKA 3ZY5A 3IQXA 4RV9A 1GZ4A 4XOUA 2XW6A 4BZZA 3T4UA 1OHHA 1VE1A 3DNFA 4N5MA 5JXJA 4JYAB 1B8VA 5IN5A 1JLLB 5D1HA 2IYRA 2G5CA 2MIIA 4ZOLF 1JEYB 3II6X 3FHOA 5KSPA 1RCFA 1UM9A 4AZ3A 1UJBA 1G6KA 2FH5B 2JFYA 5AKIA 5EJ6A 1ZR2A 1EXWA 3Q7TA 1TTTA 4YRRA 1NU6A 2GCOB 2X9LA 1S9HA 3HY6A 1HQYE 5TSDA 4FE4A 1SY7A 2XE7A 3NWPA 4DT1A 2FN7A 2A3RA 1DPFA 1XJ0A 4UREA 1XMXA 3KQVA 4RIHA 2AK3A 5DWDA 2PPVA 2R1VA 1RCUA 3WB9A 1T9GS 5JCJA 5FOSA 3V97A 1EVEA 4X62B 1PFWA 4HN9A 1LGYA 2XOXA 4C3VA 1JNXX 2Q3BA 1NFQA 1PLJA 2O2EA 3A1WA 5ITZA 2WC1A 4IWXA 4A92A 3L4KA 2XNCA 1QGYA 3WA6A 5CT9A 4E5VA 3KAKA 2WMYA 3WNVA 1KIAA 2QXTA 3H5VA 3C5HA 4FWIB 1RU3A 1FUUA 1UJ6A 2D74A 5FNVB 4EELA 1W1WA 3SXJA 1G64A 3KJZA 4OGGA 4HZIA 1KAMA 1RXYA 3SQMA 4JQCA 4C3UA 2B82A 2ZTSA 3OJCA 2XCTB 2P0EA 3EZ9A 5C5IA 5JWOA 3IEKA 1KH3A 2PBFA 1K27A 5JLAA 5AVSA 5A0FA 2I4RA 2PUDA 1W88A 4IJKA 3L04A 1QVVA 1G98A 4GMHA 3CLRD 3PPXA 3PD7A 4D8WA 3R5JA 4LDRA 1FSZA 1G38A 4NZZA 1PJ3A 1T3ZA 4QUDA 2ZTHA 2QR3A 4EW3A 1NE2A 3QITA 4TKUA 1U0NA 3IAS6 1L5WA 4QICA 3BQ9A 5EZYF 2IU6A 4AMZA 4FS3A 4WLOA 2A57A 4HYYA 4X1KB 3GW8A 4D5GA 1HE8B 3DS8A 4K1XA 4K8OA 4N47A 3BD7A 2XMQA 3FLBA 3HKDA 1SCIA 3R6TA 4DIFA 4AURA 3PV0A 4G01B 1ODIA 3VYRB 2ZRAA 1KFJB 1I1QB 4FDLA 1OAKA 1U11A 3DGFC 3NIWA 1DC4A 1VKNA 3DHYA 1D4FA 5EQDA 2IIPA 5DNCA 4IJUA 2EBUA 1YR8A 3DYVA 1KY5A 5TEWA 1L5KA 5H8WA 1B0PA 5EP4A 4MKGA 1NC1A 3O93A 4PAWA 2HKIA 1I2AA 2IRWA 1ZD4A 4LGCA 1N9GA 4DUPA 2G4VA 1CZNA 3FDFA 1YRBA 4X1IA 2OQVA 3SIWA 3NEYA 1DRUA 2AFHA 4N1AA 1E4OA 5FD8A 2Z5LA 3FVVA 4MPJA 4QFDA 4M9XA 4FJ0A 1AUVA 1Q21A 4RD1A 1G8FA 4NHOA 3S8EA 2QTCA 5K4HA 3BN3A 4RCYA 3HYLA 3FGZA 4ZHQF 3PFCA 4IUCS 3H19A 3QMPA 2CWDA 1Y3AA 1IM2A 2D7DA 4ZFNA 2VHQA 3L8HA 2O7NA 1YS7A 4M9UA 2XB9A 1JW9B 1QYCA 1C9KA 2P3SA 3RWMB 1LWOA 2QVBA 3QOFA 3RC8A 4RL4A 4UHBA 1GNPA 3QVOA 4H18A 1RAEA 3HCFA 4JZKA 1Q20A 4NSNA 5EQFA 3DVSX 1C3JA 4CNQA 1OLXB 1EP3B 1EM8A 1YMVA 3NH9A 4JLPA 2D1TA 1HEUA 1Q1AA 1QH1B 1VJ5A 1WPXA 3BIFA 5TPWB 3FOAA 1BS2A 3CQ9A 3EGXA 1RQRA 5BSEA 1V8DA 3G0BA 1CG6A 3ZHOA 3DMDA 4FZ5A 1VA5A 5EJIA 2HN9A 2Z1DA 4S12A 3ZCSA 4AB1A 4YAWA 3L82B 1MRZA 3O73A 1SQGA 1ZH8A 4G67A 2QJTA 3AG6A 4AUMA 3U4IA 4HFRA 4ZC1A 4A91A 1QFJA 1QZXA 1YZ3A 4ZIRB 2GVDC 4QOGA 1QF9A 4ZODA 1H4QA 3DB1A 3GUHA 2O8VA 1G4UR 3ZE7A 4HGQA 5THXA 4KB5A 1VECA 2YZGA 3C3KA 3KAPA 1HE2A 2YIDA 3BCSA 2H65A 3KVRA 4BX0A 3B89A 4M1TA 1I9CA 3ORHA 4JLAA 2Y99A 1J9GA 2Q45A 1Q17A 2V7GA 2R6GA 3FVTA 4KQ6A 3RGGA 3I62A 4TMYA 1ND5A 3VMMA 4EEZA 1I7PA 2ZIVB 2CYBA 3DKKA 4JI2B 3UMSA 3MJEA 5CNMA 3WZ2A 4DYDA 3FAKA 3EW7A 2JIMA 3DKVA 1RWWA 1V45E 3ET4A 1S8FA 4QBGB 3F7NA 1OFVA 1Q6YA 4CKWB 7ABPA 4KFTA 5GTDA 1M34B 1QZ3A 3IE2A 3GR6A 3EEQA 3ETEA 1C4WA 3RWBA 5HKBA 2RGEA 1XZIA 3OCYA 1OCEA 3R0QA 3KV3O 4M9SA 4BB5A 5IK2D 2HMYB 3DVQX 5CHEA 3F3SA 1QO7A 2O14A 3NDRA 3ETCA 3C6XA 5A7GA 521PA 3PE4A 1INLA 4N8DA 3SBDA 2JFHA 1MB3A 5AKJA 3R7BA 4EVRA 2DGDA 2ORYA 3BF7A 1UEIA 1LNQA 5FF9A 3T5AA 2ZP1A 1Z88A 3T5PA 3HDQA 5G4KB 1RD4A 1UPUA 3AVOA 5LP6A 1P3DA 1D4ZA 1ZW6A 3W2IA 4PX2A 3I4CA 3ZDAA 1JR3E 2JFWA 1NMYA 3CZCA 2G1KA 4LEIA 1VE9A 3KP1A 5AVJA 5ULLA 4BN0A 4WBNB 3RK1A 5CA1F 2FGKA 2KLHA 2GFQA 4RX1A 4K9NA 5A6VA 1WXIA 2XIQA 3NAZA 1E4VA 4QUJA 1C1XB 1X0XA 4Q9IA 5EZYB 5JAUA 5A0VA 3GPIA 1A5AB 3SF8A 2YWRA 4RZIA 3SCZA 2QI9F 2XF2A 4FFBB 3DTVA 3AYXB 2CXPA 2J9FA 1GG2A 2YXPX 3QW2A 2J31A 4FNMA 4OUDB 1ZVQA 4E08A 1Y9DA 1QCZA 1FMCA 3V4LA 4ZQIA 1O54A 4GE0A 4DIKA 4ESOA 3N2EA 3KSAC 5L3ZA 1WEHA 2J33A 1X0VA 1ZVKA 2O2YA 4IOMA 3KU1A 2XGSA 1YOVB 4B9EA 4PYJA 4UASA 4TXJA 1N4AA 3IAHA 3UWSA 3MFQA 4M36A 3CW9A 4CG1A 4D9KA 4ALMA 2ACVA 2B2CA 4PAOA 4TV8B 2HQSA 2WFAA 1FYDA 4HVCA 4KXVA 4W5TA 2ZTUA 3BMQA 2XQIA 4BEVA 1KJ8A 4QM7A 2C4HA 3H05A 4I50B 4CMCA 2NUAA 3V7FA 1VHTA 1ACJA 3H7AA 3K9CA 5FTLA 2IZ7A 1AMUA 2WJAA 4GR9A 1B2LA 4Z0TA 5CFLA 3OC0A 4UE3S 3J80A 1IBCA 5C32A 4I4TB 4C14A 2CMFA 3HU3A 5HJ7A 2IBTA 1VB3A 2G9UA 2ASVA 2HUNA 2R5NA 3DV9A 1L7DA 2XUAA 4MIEA 3SZLA 2JLXA 1T1RA 4QXAA 7REQB 4YALA 1P0PA 4CBVA 2GCEA 3E27A 4FE7A 4CM4A 1ZOPA 3ZIUA 1OC2A 2Y2VA 4NX2A 1QR2A 4DL9A 3KEFA 3PUZA 4J0DA 3ZDYB 1G8HA 3MELA 4GPBA 5DX0A 5EWJB 4UU0A 2VJAA 1KQGA 4IVRA 2Z9BA 5CCDA 1UQTA 5LXTB 2XSZD 2C20A 1Q5PA 1WCXA 2RB5A 2WPDA 2A1IA 3C1TA 4B33A 5CEJA 3EOZA 1JQKA 2EF1A 1OBCA 4P08A 4W9NC 2ES4A 1Z33A 2EX4A 2Y8EA 5JSYA 4MV0A 4MI6A 1Z22A 5B58T 4DR4B 1RAGA 3I0ZA 3R4VA 1XEXA 2REBA 4E21A 1TLTA 2LVBA 1QORA 4ZO7A 3ZOKA 3VA7A 1HZZA 3I1IA 1EBUA 3L0PA 4MRVA 4PGAA 4QBHA 1CIVA 1R0SA 1NLYA 4MIYA 1GN9A 2W8BB 3QFTA 4FHDA 4OGFA 1T5SA 2PNFA 3CZ9A 5F52A 5JTTA 3GG2A 4IWNA 5KSWB 3SX2A 1G60A 1EXVA 1FDSA 1DDOA 5CB4B 3EXAA 2NUTA 4BFZA 1EBBA 1NUUA 3WV5A 1O5OA 5CXQA 1CY1A 2W70A 1T35A 1FFSA 5HMMA 2CT8A 2XF8A 2UVPB 3E22B 4CL2A 1X13A 3Q5EA 2R66A 4XYMA 3WAJA 3QXSA 2OO7A 1YQ9A 3HC7A 3QU4A 2VP0A 1EVLA 1X19A 3WBFA 5JMOA 5F35A 2XQJA 3CB4A 3EUEA 3KK0A 5AXBA 2JGDA 3E8MA 5KJCA 4MV6A 1DIAA 1KZ7B 3ABIA 1XYGA 1ZGHA 3OMWA 4LWOA 1EFPA 3MQFA 3L1IA 4FMCB 4L8VA 5JQGB 4HLUC 1YKFA 4PO8A 1BX3A 1JMYA 2UVDA 2Y1LA 3KEOA 4EECA 2IQ5A 4MB0A 1PEKE 3NKFA 2P8SA 2IQIA 2NSJA 1IBLB 1KBQA 3K9QO 4OI4A 2XZLA 1JR6A 5T4HA 1I6KA 4H4CA 4DOMA 4BRWA 4BO3A 1FFCA 3K1ZA 4FNAA 4RESA 2EQ5A 1KIFA 3BXFA 5LQSA 1L5QA 1L9XA 1U7WA 2ZOSA 1MF7A 4GI7A 4Q39A 2IVZA 1BDJA 3HYCA 4PCLA 4RHEA 3RUAA 5JO0A 5BO5A 1QF6A 1CT9A 5KAPA 5LWHA 4UUMA 4DBLC 1VSUA 3BA1A 3N28A 2DBRA 1M6NA 1RJWA 4KMRA 3F9IA 1I30A 3LC7O 4DA8A 5AUPB 1ZM9A 4EPXA 3P0JA 2ECFA 2MSDB 1D8TA 2PSEA 3BB1A 1SHLA 3BXOA 4MUKA 4LQLA 3PFIA 4YRTA 3V3TA 3V48A 2WTUA 4ZMRA 1W36C 3NGLA 1PV1A 1WUIS 1K7FB 2VJBA 3EZ6A 3AGPA 3LECA 2PKEA 1NOIA 1U9CA 3V2HA 2GR9A 1E0AA 4J0QA 5IG2A 3WYFA 2X77A 3TVDA 4EYOA 2EJCA 4LHXA 4OFBA 2Q5JA 3HEMA 1UFQA 1LRJA 1T43A 3PQ8A 4XQ0A 5KX5A 1XYVA 1YI0A 1N5OX 1TKAA 3A32A 3BXEA 4M88A 3A6FA 1SVMA 4UDNA 4HUQA 1KJNA 5EYPB 4M1YA 1VI5A 2GZDA 2YC4C 3AESA 3NHYA 4HXFB 1FDOA 3GFGA 1KPGA 1XRPA 1Z34A 2Q5HA 2W6NA 3TLMA 1XXHA 1WSWA 1GUAA 2F3UA 2L19A 2MHCA 4IUBS 4JLSA 4R2JA 2L0XA 4DPKA 2HHJA 2ROQA 2EQAA 3HP4A 3NLLA 3OJWA 2J7PA 2PUTA 1KSGA 3ZJ5A 3C43A 3LKBA 4ZHSA 5KYWB 2VJOA 2DX7A 1W5FA 3R7DA 3TEMA 2B7CA 2YMPA 2R7AA 2JGMA 2VI5A 4M0LA 1EJ0A 2L42A 1OTHA 3HZRA 4L95C 4I4TF 3PUWA 3H4MA 3IUMA 2A1UA 1TO2E 2C8JA 4R8VA 5JSHA 4GWLA 5T6BA 1GGFA 4DLWA 1I6WA 3S3TA 5B2ZA 1C9NA 3T7AA 3VNUA 5DGDA 2BGJA 3F67A 3M6FA 3QWAA 1EUYA 3WKBA 3B2QA 3BRWA 1I3KA 4WVLA 3WOHA 3JD1A 1B0AA 5BT8A 1QQAA 2XI4A 1HX7A 2X4GA 2WJPA 1COWD 5CIQA 3MBKA 4P0TA 3SG0A 1AC5A 5C7OO 2PUCA 1EFUA 3AIKA 3O03A 5IEJA 1II9A 3OEEA 7MDHA 2FJUA 2ALJA 4HUJA 1CS4C 1QOQB 4LX0A 3TTWA 2YICA 2ZT5A 3SSMA 1XZLA 4BFYA 4EW2A 5DCUA 5B3KA 3RRNA 2RI1A 4L0CA 3ZWVA 4FJ1A 3ICOA 3I04M 3EGVA 4MUGA 5TPWA 2J09A 4UM9B 1PGJA 1FX0A 3KHTA 2ZB2A 3R3YA 3T3HA 2VH5R 5LZ5A 3E9MA 1G21B 1LCIA 4OQNA 2YXBA 3IP5A 3LGAA 2NU8A 3I01M 2G5PA 2UYCA 5IYZB 4CEIB 3QVTA 2YNMC 1V37A 2ZWVA 4MS3A 1NKVA 1JG4A 1ODSA 1UBUS 2WV7A 3BCHA 1FOEB 1Z8DA 3C3MA 1Z25A 2MSKA 2NU8B 1ID8A 4TT3D 5IFLA