2C1ZA

Structure and activity of a flavonoid 3-o glucosyltransferase reveals the basis for plant natural product modification
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
450
structure length
439
Chain Sequence
TNPHVAVLAFPFSTHAAPLLAVVRRLAAAAPHAVFSFFSTSQSNASIFHDHTMQCNIKSYDISDGVPEGYVFAGRPQEDIELFTRAAPESFRQGMVMAVAETGRPVSCLVADAFIWFAADMAAEMGVAWLPFWTAGPNSLSTHVYIDEIREKIGVSGIQGREDELLNFIPGMSKVRFRDLQEGIVFGNLNSLFSRMLHRMGQVLPKATAVFINSFEELDDSLTNDLKSKLKTYLNIGPFNLITGCLQWLKERKPTSVVYISFGTVTTPPPAEVVALSEALEASRVPFIWSLRDKARVHLPEGFLEKTRGYGMVVPWAPQAEVLAHEAVGAFVTHCGWNSLWESVAGGVPLICRPFFGDQRLNGRMVEDVLEIGVRIEGGVFTKSGLMSCFDQILSQEKGKKLRENLRALRETADRAVGPKGSSTENFITLVDLVSKPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-GLUCOSE FLAVONOID 3-O GLYCOSYLTRANSFERASE
publication title Structure of a Flavonoid Glucosyltransferase Reveals the Basis for Plant Natural Product Modification.
pubmed doi rcsb
source organism Vitis vinifera
molecule tags Transferase
total genus 157
structure length 439
sequence length 450
ec nomenclature ec 2.4.1.115: Anthocyanidin 3-O-glucosyltransferase.
pdb deposition date 2005-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2c1zA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2c1zA02
1GFZA 5IKPA 3MTAA 1BX3A 3L79A 3S27A 3TAXA 3DZCA 5TMEA 1E1YA 3L7AA 3ZCUA 3QHPA 3CEJA 4N3BA 2ZB2A 1FTWA 2C1ZA 3BD6A 2O6LA 1FTYA 2XCUA 3NP7A 3PE3A 4X7MA 4CDRA 2IYFA 2BGTA 2QN7A 2AZDA 1GZ5A 3DDSA 1UQUA 3CEHA 3ZCVA 2FF5A 3OY2A 4FKZA 2GJ4A 3RT1A 3MS7A 1KTIA 2GM9A 3UYLA 3HBNA 2R60A 2XCIA 2SKCA 1ABBA 1QM5A 2SKEA 3E3LA 4MHSA 3OTHA 2JLBA 3BD7A 3OKAA 2QN2A 2F9FA 4GYYA 3IA7A 3PE4A 2QN8A 3BD8A 3CV3A 1PSWA 1NZFA 3T3HA 1P2GA 2FFRA 4M60A 3L01A 2VCEA 2QN1A 1WW2A 1NVKA 4GYWA 3FROA 2AV6A 1K08A 2VSNA 3MRVA 3VUEA 2R4TA 4F96A 1P4GA 2QNBA 5DU2A 4BFCA 2G9UA 4XI9A 1WV0A 2IV7A 4RIIA 4F97A 2XGOA 3C48A 3NB0A 2YJNA 2ECPA 1QKJA 1XC7A 2OFFA 2R68A 1P2BA 4G2TA 4KQ2A 1NZDA 2ASVA 3NAZA 4CTNA 8GPBA 2C9ZA 1SXQA 1P4JA 2X0FA 1WUYA 4AMBA 1HLFA 1F0KA 2H1FA 3UYKA 2QRMA 4REMA 4RENA 1C8LA 1YA6A 2PYIA 3MT9A 3S0JA 3SYMA 4EKEA 1L5SA 2IEIA 4GZ3A 1E4OA 2IUYA 4YI3A 1NOIA 2SKDA 2QLNA 2C4MA 2C1XA 3OKPA 3T3EA 3OKCA 3WC4A 3AMVA 1J39A 3CUWA 3H4TA 4HWGA 2IV3A 2X6QA 4YI5A 1Z6QA 2XA2A 5GPBA 3MTBA 2QRGA 2X0DA 1M5RA 2H1HA 4M7PA 4QLBA 1O6CA 3MS4A 3D1JA 4RIGA 5C1DA 1C8KA 1Z8DA 4X7PA 3S2UA 2Q6VA 2QLLA 4PQGA 3G2IA 5LQDA 2QRPA 3WADA 4BQEA 2GPNA 2P6PA 1FU8A 2QN3A 1L7XA 3OY7A 2ATIA 2QRQA 3GPBA 5TMBA 4WADA 3HBFA 1FA9A 2ACVA 2XGSA 1JIVA 3L7BA 3T3DA 3S28A 1XL1A 4LEIA 4N3AA 1WV1A 3RSCA 3ZCSA 5DXFA 3T5TA 3CUUA 4EL5A 3MQFA 2GEKA 2G9RA 3CUVA 5JTTA 1JG6A 5TVGA 1LWOA 2QRHA 4RELA 1AXRA 3MRXA 1P4HA 3MTDA 3S29A 2XA9A 4AN4A 3E3OA 3NCHA 3CUYA 1JIUA 1FU7A 4M83A 1LWNA 5D01A 4GZ6A 4CTMA 4KQMA 3BCRA 3HBJA 5JTUA 2QLMA 2PRIA 1L5QA 4N9WA 5IKOA 3E3NA 4XIFA 2XA1A 2IYAA 3ZCTA 3TSAA 4YUAA 3MT8A 2XGMA 2XMPA 3ZCRA 5I45A 1Y8ZA 1GGNA 3C4VA 1C3JA 3MRTA 1L5RA 3GUHA 3T3IA 1FU4A 3G2KA 2F3PA 3BCSA 4MRAA 3EBOA 2FETA 1Z6PA 3H4IA 1IXYA 3QKWA 2JZCA 2VSYA 3ZCPA 2QN9A 2F3UA 2X6RA 3VDNB 3COPA 1UQTA 3IAAA 4AY5A 2VCHA 1WUTA 3NPAA 1GPBA 4NESA 2GPBA 1EM6A 2BGUA 1UZUA 2IEGA 3BDAA 4WACA 3O3CA 3G2LA 6GPBA 1XOIA 4N39A 1SXPA 2PYDA 1XL0A 4MI6A 3RHZA 1IIRA 1FC0A 1FTQA 3VDMA 1VGVA 1RRVA 1RZVA 2F3QA 2GT1A 2JJMA 1V4VA 2ACWA 2IW1A 1NLMA 3DD1A 3T7DA 2G9VA 4W6QA 3CEMA 3BCUA 3MS2A 3WAGA 4BQIA 1GG8A 3OT5A 2KS6A 4CTOA 1P2DA 3NC4A 4NEQA 1Y6GA 1JEJA 1PN3A 3OTIA 4RIHA 4Z5XA 1AHPA 3EBPA 1NOKA 5ENZA 9GPBA 4EJ2A 1XKXA 4AMGA 5DLDA 1K06A 2G9QA 1L5WA 4MHOA 5D00A 4RIEA 3G2HA 3MT7A 3NP9A 4HLNA 2QZSA 4L22A 1Z62A 5BNWA 3TOVA 3Q3IA 3G2NA 3Q3HA 1A8IA 1F6DA 3RSZA 1FS4A 2AMVA 4RIFA 4EKYA 3VUFA 2R4UA 3D0RA 3L7CA 3L7DA 1JIXA 1C50A 4RBNA 4BQFA 2GEJA 2BISA 1NOJA 7GPBA 5TMDA 4MI9A 1B4DA 3MSCA 3CX4A 3T3GA 2VG8A 3OTGA 1GPYA 4GPBA 4N3CA 4KQ1A 4NC9A 1XV5A 3D0QA 2PQ6A 4X7RA 1H5UA 4WHMA 4FZRA 1GPAA 4LDPA 1RZUA 3BEOA 2BFWA 5HXAA 4AY6A 1WW3A 3DDWA 4X6LA 1L5VA 3CUTA 1P29A 4MI3A 4EL0A 1EXVA 1PNVA 4GZ5A 2PRJA 1PYGA 2X0EA 2AW3A 3C4QA 4F9FA 3SYRA 1L6IA 3G2JA 2HY7A 3HBMA 1JG7A 2F3SA 1Y6FA 4MICA 1YGPA 2R66A 3ZCQA 2WTXA 3MBOA 2GPAA 3Q3EA
chains in the Genus database with same CATH superfamily
5G2OA 1WWKA 1X80B 3DZFA 2W9XA 5FWXA 3NVKI 3L7IA 2XWSA 2J6IA 2RKWA 3UJAA 3VVBA 4QNRA 4LBWA 4KR9A 3L0IB 4X1YB 3LHIA 2DERA 3CRZA 4LHWA 3TCXB 4GLJA 4N3BA 1PR2A 3G49A 5B1IA 2CFCA 4KAJA 2Z5LA 3U7IA 3OD5A 3AF0A 4X7MA 3NUQA 3QHQA 3B6IA 3G5LA 3S99A 1QTQA 1A27A 2C5FA 2H5EA 2FWAA 2Z6AA 1TO6A 1GTJ1 1R5JA 4J6EA 2FAXA 5KOJB 5LKRA 1Q7RA 4LJ9A 5B64A 1IUOA 1BVRA 5C1OA 3FUTA 3MPUA 5BR8B 4MX8A 4QXRA 1SXJD 2AOXA 1P1HA 3DXXA 1JAYA 5JSYA 2OOKA 4M8SA 1C1HA 4MARA 3ZZNA 2IZ7A 3I4LA 3KLBA 3KUCA 1K3UB 1W48A 3OOJA 2AVNA 2DCUA 2DYKA 1EVIA 4KH0A 4A8TA 6YASA 2UKDA 2ZT6A 1R37A 3GRVA 3QUCA 3ISVA 4WJKB 4XVQA 3Q8MA 3G2QA 4E21A 2ZITA 1E5LA 1TZKA 1UDCA 2Y1FA 2WICA 2FFHA 1YIOA 3D54D 4OI1A 4E70A 1QM5A 4ILEA 4DJAA 3QELA 2WPNA 1J8VA 2LTAA 3EAGA 1UBUS 1XRSB 2C9OA 2VT7A 1M6VA 4EM6A 3K0HA 2NG1A 3IA7A 3VO1A 3H7AA 1RT9A 1HDOA 1VE7A 2C2WA 2NTVA 2QTZA 1Q3KA 1WPRA 1P0MA 4M21A 4BE7B 4DLXA 5HW0A 2GYUA 1R8JA 4KVAA 4UUMA 4UZEA 5ENVA 4FWTA 1RWOA 2NXEA 3A1TA 5I7WA 5EKTA 1GZ3A 1ZK4A 3BGOS 1OCEA 1UKVY 2Z8YM 4B31A 4P3PA 1N7GA 3E8XA 1H2HA 3KZNA 1IG3A 2H00A 3O2JA 4OHRA 4Q7EA 1O9HA 3B38A 3WNDA 3LY5A 1JX6A 1U8FO 4M9ZA 1GT91 4H9GA 4MR9B 2FDCA 2J3JA 1E2QA 3GNQA 4RY2A 4Y0AA 1Q0PA 5KTKA 4L5YA 1N4AA 4C4XA 4AZ3B 4UNIA 4LY3A 3GPCA 4BNUA 5C35A 3KQUA 3KXLA 4GUAA 1WQ3A 2FGKA 3TD2A 3Q85A 1UBCA 4KDRA 4RL6A 3AM5A 3OFNA 4EHBA 1UK6A 4XI9A 2BEUB 2R1TB 2X8LA 5TV2A 4BS9A 5IVPA 4KR0A 1XYVA 4CNBA 4XPIB 1TD9A 2E6KA 3NLLA 4GE0A 4NOMA 1C0KA 5HGXA 1KI9A 2YV2A 1Z4MA 2XOKD 2OLKA 1E1QA 4RV5A 2EKPA 3GY0A 4YCDA 2WVGA 1MABA 1M1ZA 4HPJB 3PB3A 4HGNA 3UGKA 3JAMA 2XB9A 1PJZA 1JB9A 2ACEA 3QYAA 3AIOA 3T34A 2ZPAA 3RKSA 1XDZA 2QUJA 4HO1X 4BAUA 4YRMA 5C2JB 5A3SA 3OZWA 2V3CC 2X3FA 5JVDF 1UPCA 4MCJA 3ADKA 3LDGA 1NMZA 1WCWA 4D43A 1OASA 3I64A 3IT0A 2QL9A 3D4IA 5LWQA 1WDWB 2Y1OA 3HCOA 3IR7A 1YE5A 4AO6A 1BA3A 3A36A 2R8ZA 3PRKE 3SNHA 1H6AA 1WUKS 5FUYA 2EW2A 4DLYA 2ANBA 4JLJA 1EFUA 4Q21A 1N2JA 1N33B 2C7GA 1U2SA 3FCCA 3PI6A 3ONWA 2BM0A 5H81A 3WIUA 3INRA 2X9GA 3S5UA 4J0QA 5CNMA 1GAEO 1WD5A 4OLHA 4GUDA 3EAQA 4LUCA 4PG4A 2XMSA 5ERXA 1LSJA 5CT8A 2G40A 2IF0A 1T9AA 3OQHA 5C7LO 1IBLB 2ZYIA 2V6FA 4I0WB 1JYEA 1LVHA 2Q5OA 1FTGA 1G8PA 2XGGA 2FLWA 2J3DA 4CR8A 3FNQA 4LWQA 1EINA 3WGYA 4DSZA 3GGDA 1EQ2A 1PK7A 2AKAB 3DPIA 1EJ6A 4YRJA 3NONA 5KCMA 4AQ7A 3GMDA 2YR0A 1L4MA 2GRJA 3BE8A 3OKCA 5D1NA 5DTEA 2X1MA 2B0CA 3KQPA 4WESA 3KYCB 2X0KA 5GJWC 4KXXA 2A67A 1JF8A 4ZVRA 2AI1A 2DLDA 3HM9A 4P7KA 3CUWA 3TLGA 3TX6A 1AA6A 1TNDA 4NG5A 3IQDB 2C29D 2HSWA 4NEHB 4UE3S 2C3YA 5TRTA 2ZSIA 4I5IA 1JNYA 2X6QA 4Q7JB 2EKBA 4UXIA 5T3UA 1CZKA 2YICA 1UBLS 4GM0A 2X0DA 4KRGA 1X7ZB 1JMKC 2ZI5A 5IJAA 3TDKA 3GLFA 1WSDA 3T3OA 2DLNA 2VK2A 3IL2A 4ND1A 1FYWA 1OW3B 1ZSVA 4RVSA 4PZAA 2TMDA 3D6VA 2DR0A 4TKUB 2Q1YA 2CCKA 2I87A 2Y1EA 1FRFS 2GF9A 2JEZA 3E35A 4RFVA 1U94A 3WLFA 3RG8A 4RVUA 1F20A 1EAMA 4ALJA 2D62A 3E5RA 3IXMA 4XWTA 3OIDA 4IUCS 5SYMA 2AW5A 2KW5A 3SP1A 4B4WA 4E2ZA 5BWCA 4DILA 4GBGA 5AVUA 1JQLB 4DC9A 2G7MC 2JANA 2AZTA 1DTEA 1BWQA 1ECGA 2FPXA 1I1OA 1A98A 1HDGO 2AJCA 3RARA 2PUBA 2EQBA 3A1SA 4I9FA 1IB0A 4DIOA 2QN6A 4H4EA 3ZWVA 1JYFA 4BPRA 1IBMB 2R6ZA 4S1TA 1PZHA 2BAGA 1T9GR 1L4BA 4RQTA 4YV7A 4NH4A 1OFUA 2FCAA 2PX3A 1EUCA 1VMAA 3FHLA 2BW0A 2QLBA 4RGBA 4X0EA 1GPMA 1N1DA 4R2WA 1NM5A 3RRZA 4ZV4A 1UFQA 4OHVA 3OCUA 3LBAA 3T7EA 2H1IA 3K9QO 2PKCA 2XVAA 5KVQA 4RTMA 4RDHA 2WBLC 3EGOA 1NVEA 4XX1A 4ZARA 1YDHA 5GONF 5U4XA 4IHKA 1YJCA 1DAHA 4NV3A 2VPZA 4CODB 1SCIA 2OFXA 3V2UA 2BEVA 4QFMA 1YCGA 5E4JA 3C97A 3GU3A 3SIXA 4N40A 3LQ1A 3H16A 1IBRA 1KO8A 3PXUA 4TLEA 5HVNA 3CJRA 2X2PA 1DPFA 3HUTA 2WKSA 1DCFA 4HN2A 2AVDA 4WKNA 4LMBA 4XD7D 4CG1A 4EEKA 1JJFA 3AUYA 1AF4A 4LV6A 3UJHA 3FPEA 4P86A 5D6OA 3G7SA 3HGTA 1QC5A 3K05A 2VOJA 4KC0A 5AJXA 1EB8A 4ZU1X 4KXWA 2ANCA 1R1DA 1OH8A 1KBOA 3CB2A 5DM1A 2INGX 2CV2A 2VDLB 2G8NA 2F4VB 1V8FA 1SCAA 1W5AA 3VZRA 4TS4A 2CZGA 3MCAA 1HRKA 1IM2A 3WOVA 2JDID 1F2UB 2QLMA 3FDIA 4IIHA 1U8AA 2VOEA 4PPQA 2ZJBA 1P72A 4HI0E 2XYVA 1A7UA 1BDJA 3MM4A 4TYMA 5ALUA 3O3OB 5EYPA 4ZDJA 2EKLA 1TIPA 3EFEA 4ZO8A 4J0HA 4MDFA 4XZ3A 4G5SA 5A1TA 3KU4A 4KE8A 4BNHA 1SXJA 4CM4B 4UBLA 3MT8A 1BFDA 3C8MA 4PYRA 4NMXB 1TB4A 2ZBGA 2C8KA 3DBOB 3B8EA 3IAUA 4G9EA 5EJMA 1R4NB 3W4IA 5HM6A 4F9EA 2ZRAA 1DX6A 2XB6A 4PAWA 1R10A 1JFLA 5IPFA 4AKGA 2J9FA 1Z2DA 3LKBA 5ILGA 3CPEA 4EMBA 1JN0A 1NULA 3HXOA 3JU3A 3M1AA 2X7JA 2FEAA 4ZOCA 1E3WA 1Z0UA 3B9RA 3PQEA 3PLAE 4BZXA 2I71A 1TMOA 5ADWA 4ALLA 1K8RA 1NIJA 1NONA 1NVGA 2FN9A 2X3YA 4IEFB 2QUIA 4HPWA 4JLOA 3REGA 2A1TR 3H5WA 1FJ2A 4JVSB 3E8SA 4Y6PA 1DOAA 1HT0A 1U1GA 4JK3A 3BFVA 3GLHE 3COPA 5ALOA 5CYFA 4BEBA 3ABQB 3IVMA 5NULA 3VQTA 4PFSA 4CI9A 5D51S 1ZL0A 3HS3A 4F8YA 1ZXXA 3TL6A 1MZPA 2GBGA 3MLBA 4MLDA 3V8PA 2VCHA 1VRWA 1WUTA 4YLGA 2JH8A 4OFXA 3E3MA 4Q6BA 4TV9F 1DRWA 3B82A 4KHZA 2RGDA 3TW8A 2CHFA 1FXWA 4RF4A 1ELOA 2ZTMA 2D7JA 3EZNA 3HCPA 2NX2A 3K35A 4G5OA 4GECA 4XIJA 2IHKA 3TIIA 5L4NA 3KT6A 1EM6A 3OPNA 4EENA 5CIQA 3VVCA 3AG5A 3HZZA 5BV2P 4HFMA 5I5GA 4RM2A 4B48A 1Z5PA 3KAJA 2BGWA 4B6EA 2AJLI 3EUAA 5TQ0B 2BI8A 5EJ9A 1RQ7A 4NQRA 4R7ZA 4FE4A 2O3SA 5JO9A 1K8YB 1KVTA 1NQAO 1W8IA 4P3KA 4ZZ0A 4DTIA 1L4LA 2F8SA 1IE3A 3UMMA 3Q72A 3FOEC 3UV6A 4OJTA 3KEGA 3BG5A 3OESA 3UN1A 1IXRC 1Z33A 3GAAA 3KDSE 4KXLA 4MVJM 4CQMD 2XOKA 4FYYA 5COQA 2ZRMA 3KZKA 4WCDA 1XWIA 1Y9EA 2HB6A 3BMOB 4HWRA 1PHPA 4E03A 1TM3E 2JJMA 3Q40A 4CLXA 3FUWA 2X5XA 2ACWA 2WM2A 5KYNA 1MJFA 5HKBA 3GFVA 5K6RA 2FZ4A 4NCJA 3RTBA 1IB6A 5D85A 4FDMA 3D8NA 3T5CA 5HQTA 2AH5A 3AHDA 1RXIA 2O20A 4RZ2A 5G3ZA 4F5YA 4F4UA 4GS5A 4JDUA 1YC2A 1RQXA 1XZ8A 3OQBA 4Z7NB 5LMUB 4PHTA 3RYFB 1GG8A 1RQLA 4X63A 5DWDA 3OT5A 4JYZA 3MHPA 1ZP6A 3QUBA 1LQUA 2Q27A 5F98A 1Y8QB 4P82A 2Q7DA 2WLTA 3IRVA 3JVVA 1P9OA 5L3RA 4G23A 1GRNA 2VHJA 1C7JA 3EEYA 2HX1A 1P19A 5ETJA 2GHIA 3WJAA 2LP4Y 5UKDA 2P0EA 4KXYA 4MWOA 5ENZA 1ZK3A 2ZATA 3QLUC 4AUMA 2OCYC 3RANA 3U1VA 3A4YA 5A9TA 3ZE6A 2FSHA 1KK0A 2GBLA 1EVZA 4R31A 3HI4A 2PUCA 3MFYA 5CFOA 1G21E 3U7FB 1AZTA 2QJFA 5JD5A 3BQ9A 3ORFA 5JWOA 1FP7A 4ND6A 4BBAA 5G1PA 3QW2A 5IF9A 1XTQA 1PV1A 4RIEA 5BPFA 3DVQX 4US2R 4YCLA 3MIIA 2CXHA 3HFSA 4GX0A 3R0QA 4KAFA 2E0IA 2K2WA 2HSJA 4H27A 5DM2A 3ERCA 1DO8A 3QKUA 1DJOA 2MYPA 3JPWA 1E8MA 4IF6A 3GLIE 3TVTA 2J4CA 1PQPA 3KX2A 2QTVA 4WXHA 3OICA 3NTUA 2ZWVA 1GPNA 2IP2A 3D0RA 2QVCA 1HDZA 2OQ2A 4JU9A 1R0XA 3PENA 4G65A 1RHRA 4D6YA 1NY5A 4JJ6A 5LP6C 3QVSA 4U5QA 2YHBA 3ECCA 4LMRA 4JLAA 5ELMA 2GEJA 2GKSA 3A6JA 3F9CA 1NTRA 4BVGA 4C0JA 3U3ZA 2H9YA 4FZJA 3RYCB 2B1JA 4YP7A 2B37A 2AFVA 2CVOA 1GFIA 3NORA 4MRRA 5DHSA 3VPGA 1TUIA 3NYRA 4Z9XA 1EVEA 4X1KA 4H7IA 1Z5NA 2X1HA 1TQHA 3BH7A 3KTDA 3MFQA 5AMXA 2VEDA 3FVTA 1ADYA 1PEKE 4DHWA 5M29A 1PW7A 4O29A 1T1RA 3UW3A 5IS2A 3DW3X 1CS0A 1A04A 2YN4A 3EUFA 2A78A 2NV0A 2Z3ZA 4F38A 3STTA 2YV3A 4BOYA 4NBTA 1J8FA 1T5LA 1V4BA 1VLQA 1C2YA 3V1YA 4W6ZA 1JT9A 1H2FA 2BUBA 2QM0A 1GGVA 1VPEA 1KU6A 4HYEA 4K9SA 1NW6A 4MV5A 4W9NC 1QOQB 1PEDA 4C88A 1RZUA 4PRKA 2A5DA 5IYZF 3LPCA 3UKOA 1N6HA 1UM9B 3EQ6A 2FHSA 2H54A 2IYYA 2G17A 2QPAA 2IUUA 4I55F 3VYTB 4PRLA 1II9A 1CK4A 3CUTA 4LTNA 3TIVA 5HIJA 3I3OA 1IRIA 4L4UA 1X8LA 4CLOA 3SVLA 1Z63A 4IAOA 4PSVA 3VU8A 1KI7A 4I4IA 4XD7A 4W5WA 4FTWA 3U3XA 4ZYLA 3BJMA 1XLUA 1LS1A 2C04A 3IB6A 1V45E 1XRNA 1SVNA 3A9WA 4YDRA 1HZZA 4OXXA 1FFXA 2DWCA 4Q19A 1QHXA 1AU9A 3IOCA 4LRWA 1JG7A 3LLMA 4U2BA 1V39A 2JZOA 3KQWA 2DSNA 3ZZMA 2GK7A 5F1PA 1Q3HA 2DTDA 2C2OA 2C59A 4M1KA 2JK0A 3O47A 1ORTA 2FPIB 2WTXA 4QWMA 1Z5OA 3A1FA 1MO2A 3JWEA 4S1NA 4A1OA 2JDIA 2QW1A 4XM1A 4LV5B 2ENWA 2PV0A 4LHXA 1UZNA 3Q9SA 2G1UA 3GAZA 2SCUB 1T2FA 3CN7A 4AECA 1T43A 3UJ3X 1DX9A 1LX7A 5JHGB 3RAGA 1RM5A 3QI2A 2WYWA 4YJKA 5DBFA 3L40A 4Z3KA 1J5EB 3DMGA 2J9GA 3G23A 2DQZA 1ZAYA 2C0QA 1NMSA 3KOUA 5LDHA 1CY2A 1OZGA 4RK1A 2H18A 3FCYA 3FBWA 4J3NA 1B41A 3Q41A 1N0IA 1ENPA 5HDQA 3LWBA 1CDZA 1JNXX 1M1YB 1YQ9A 1L5ZA 4BQOA 3PWTA 4I1SA 1FQOA 5GOTA 5JPCA 4ENTA 3O8LA 4QEDA 3FW1A 1HYBA 5DN6D 5BP7A 5KNCH 3HGMA 2VF8A 3ORSA 4N0PA 1F06A 4D9FA 1W8DA 2C88A 3M1YA 4OQQA 1VKOA 1XU7A 2HO4A 1BZYA 2WMNB 4YP1A 4WQMA 1ZHFA 2QTGA 3E9ZA 2R8YA 2ZT7A 3OQ6A 4I4LA 2ZYGA 1ZW1A 2P9ZA 5AW3A 4Y2XA 4LZAA 3CEHA 3GVPA 4OUDB 3R7DA 3T1OA 5KWVA 5FYQA 4LNUB 5BV1A 2FEWB 3PDWA 4B76A 2Q49A 3NBXX 4CKBA 5LIRA 2JCVA 1ADBA 3WLKX 2QTFA 1SD1A 2ZRLA 4D3YA 4DR6B 4CKEA 4I3FA 3GLTA 6CHYA 1V9LA 1QNLA 2RB5A 1QF9A 3FLBA 3IURA 1QG6A 3ZDYB 3CLHA 2OB2A 4HG2A 4JGBA 4AY3A 5A6SA 3SR4A 4Q39A 2R5NA 1OX5A 3GB9A 3O82A 4PWZA 4Y6SA 1GUBA 4E08A 3LL7A 3ETEA 4IFBA 4JLBA 3TBFA 1LW7A 1OZHA 1UFKA 3HNRA 4GOLD 3B9BA 2EJUA 2XB8A 2YHAA 3L0SA 4PSUA 4DMMA 4JLKA 1KAEA 3CV3A 4DYDA 2YJTD 1VHDA 3RU3A 4O63O 1JZSA 1U28C 2FB9A 2H9AA 1XXHB 3BUSA 4A92A 3TLJA 2W2KA 4CIXA 5AVVA 3E61A 5E9WA 1RE1A 1G5TA 2BTQA 3ZNNA 3QFSA 4C2BA 1BEZA 1AIPA 4KWTA 4LDQA 1IZ0A 1WBJB 2HA4A 4KXMA 2MINA 5DJ5A 4NCIA 5DLEA 4QUAA 1XMOB 3SFTA 1V4NA 2CXNA 3FROA 1A7KA 4INPA 5AJHA 2D5AA 4CQMA 3KUUA 4DGQA 1JHYA 1IQPA 2XBUA 3MF4A 5K0LA 1M6YA 1XRRA 3K1AB 4P0QB 3B8HA 1BCRB 4ZPXA 4YY3B 1YONA 3DOCA 4B79A 3F4BA 1D2EA 1QJ4A 1RI1A 1Z2PX 2PTHA 5FIUA 2A1IA 4ZVLA 1EBUA 4FOSA 4YWHA 4HX2A 1CVRA 5A9SA 5BN3A 3OTWA 4DM3A 4R84A 1BVUA 3GGOA 3EFOB 5CURA 4HDSB 4C4PA 3DE6X 4KE9A 4CMCA 4YAKA 1R16A 2EV9A 3ZLJA 4LI3X 3A6ZA 1YOBA 2XVYA 3CRQA 4PHGA 1KZYC 3EQ7A 4KIUA 4EYGA 1DIHA 3JZDA 4FFPA 4F6LA 2P6OA 1JHMA 4UU0A 4NFLA 1HX7A 8MHTA 1M5UA 2FG7C 3SVZA 1RYHA 5JCXA 3CLUC 5AWFC 1YXMA 1Y4ZA 3JWHA 3WLEA 4BAGA 3KB1A 1KSFX 4EBFA 2O5CA 4ZEOA 1AF7A 3LUKA 1CF4A 3Q12A 3GNTA 3GZTB 1KFCB 3H18A 2IYQA 3G9XA 4BN4A 3R09A 2M6LA 3RC1A 2N0SA 1IHUA 1RMQA 3WLNA 5DW3A 1XPUA 1TIBA 2J5QA 2Q1UA 2ZAYA 3G0OA 3GA0A 3CVYA 3I1JA 3T3PB 2GFQA 3B1YA 2DHRA 3G88A 2VJLA 3KVOA 1J09A 2V1XA 3BAFA 1ECBA 1G98A 2RGEA 4J1TA 3VSAA 4YR9A 1IMOA 2XY4A 5H3LA 1U2RA 1XHLA 2CYBA 4GXRA 3U31A 2AQ8A 2I8AA 3HDVA 2Z83A 5KYVA 1T8RA 2A6PA 3KOOA 1BGVA 3KYIB 4FOPA 4GP6A 4K9LA 3RIXA 2QNRA 3SXUB 4M9QA 3X3HA 2PGNA 4R2MA 3F7OA 2UDPA 4P33A 1E6EA 2SKDA 4LJRA 1SBYA 3PHGA 5IH7A 1ECPA 1ZISA 5K0BA 1UOQA 5CBPB 4TTTS 1AKQA 1ZZEA 4AQDA 2J1LA 2WWGA 1BE1A 1LX6A 5KJCA 5HK8A 2HPZA 3CCFA 1I4WA 4TOIA 1J06A 3M6WA 4E3ZA 2R9VA 2WF5A 4KQFA 3BIFA 3STWA 2WFLA 4KDFA 4PLGA 2BBOA 1ZR2A 4BFLA 4EVIA 4QHYA 4GVLA 3TF5A 4P80A 2Q0XA 5CU7A 1IVNA 1S8OA 3TRHA 4PLTA 4TL6A 3HU1A 3SLRA 1CJCA 4UQLA 5ITSA 4KDEA 3WK4A 2OC4A 5HZMA 3PCXA 3KJXA 3M70A 2CE7A 3OJEA 1MVNA 5FBZA 5FHQA 1BQEA 4C21A 3E27A 3MTBA 2QRGA 1R6TA 1PFQA 4FOOA 2XDAA 3DO6A 3SEFA 1U1EA 4B6RA 1H85A 2HRQA 2XMDA 5LU8A 1UEXC 1N6OA 3QFCA 3THXB 4BO1A 3REQA 2BLNA 3CRNA 4KO3S 3RK1A 1PFKA 1PI3A 4KGDA 3WYDA 1RLTA 3PF8A 3QYJA 1XHFA 1T26A 3H5TA 4KTVE 5GZ6A 3S2UA 3AF3A 4X3PA 3EPRA 1P7PA 5F64A 2P91A 4BWVA 3G68A 4B46A 1Y9JA 4BQNA 1L7OA 3F4LA 2R7AA 3BWXA 4N01A 4UNRA 1KSGA 1VSUA 1LSUA 3D2AA 2PO5A 4EY4A 4DKJA 1WZNA 1KETA 1MTZA 5BUZA 5EQFA 1Q17A 4D79A 1IXZA 4OQ4A 4BB0A 4QXOA 2QRQA 1EK5A 4P5DA 2IPNA 5LYYA 2P0YA 1OYYA 3P5SA 1YDGA 4H7JA 2I67A 1QF7A 2XUZA 4UBMA 4HFJA 3E84A 1FA9A 1C1YA 3CY6A 2JCYA 3TLEA 3B2QA 4FGSA 1T1SA 3WLQA 4LYGA 3QX9A 3WGVA 5JZMA 1NE7A 5KQPA 1E9FA 1NR1A 5IJXA 3ADOA 3EVFA 4XUCA 5AQ1A 2AHRA 3HDTA 5TSDA 4NBRA 3OE4A 2IPMA 2YWXA 2MYNA 2AN3A 4YRBA 1MIOB 1XEXB 1ZJ6A 3PVSA 4DSAA 4IJMA 1NQ5A 2P9JA 4F21A 2ZU6A 1QANA 2GEKA 2ODNA 1RWNA 1TF5A 4B6FA 2NPOA 2OV2A 3TJMA 1LLUA 4Q4LA 3ANMA 5TVGA 3KKOA 3X1MA 3AL3A 2QRHA 2SBTA 4H6XA 3UFBA 4ZOBA 4OQDA 4BQPA 3R6GA 3BXFA 3ROMA 1LLCA 3I4CA 2IXEA 3DCIA 3O1JC 2DWUA 3UZUA 3AHJA 3JZIA 5C5DA 1RQ2A 2VHWA 3FCUB 1AHHA 1LBQA 3QK7A 2RHHA 1SKAA 3DLIA 3LBIA 2NW6A 2ZBPA 3O83A 3NCHA 1Z8HA 3QXGA 4PPYA 1Z47A 2WAAA 2ZQZA 3AUXA 3OP1A 5G0TA 1KKLA 4UU7A 3HBJA 5TARA 4BLOA 1S3GA 3QSGA 2FPRA 4PC2A 1V2GA 3LYLA 5IKEA 4J1QA 2NTNA 5CVEA 3SPXA 5I7VA 1R8YA 1EXNA 4LHZA 5F35A 5DN6A 2VJQA 1XXLA 2NZWA 3KV1A 4O3FA 4P4SA 4Z0TA 5IMBA 1ZVVA 1Y5RA 3PC2A 5KX5A 2NOAA 1ML3A 1E1CA 4BLTA 1WSBA 1A50B 1TADA 4ABTA 1T8YA 2I4RA 2ZJ5A 3L7NA 3OZEA 2WT4A 4JLMA 2NUPB 4P4TA 5ALFA 3TTVA 1EXDA 2QRNA 1CUIA 2GN8A 4E13A 1SUIA 1QYWA 5JNVA 1W88A 5KSYA 5EZSA 1T10A 4W7HA 1TQ4A 1ZO8A 4M54A 1U2GA 2NZ8A 1RLIA 3CT4A 4L3WA 1JYSA 1KDRA 3G85A 5EQDA 4ZVKA 4B8WA 1ZM9A 2F3PA 3WICA 1U04A 5AKYA 3DLTA 4ZT3A 3B5EA 4MV1A 4YRTA 1QZ3A 3PLRA 1JU3A 1P2VA 1YGYA 2YZMA 3I52A 4GLOA 5AHRA 5EVJA 5FNVF 2BCEA 1HYGA 4GBED 2BZSA 3GC6A 4JJEA 2ZRFA 3SR0A 3DL0A 1R74A 2IP4A 2QN9A 4JOSA 1A4UA 1OIVA 1DNPA 4D74A 5JVDB 3ZDCA 1EZ4A 3C7KA 4RESA 1ZBQA 1KEVA 1L1EA 3AKZA 5DCWA 2F3TA 9ATCA 1G20B 2H0AA 13PKA 3C43A 1PJSA 1Y7HA 2O1EA 5EXSA 1VXRA 2I6FA 1QU2A 3OQPA 2IS6A 5JDCC 1AH2A 3WZMA 2Q2VA 4L02A 2R96A 4CJXA 1YJ5A 1L4NA 2VTDA 3BXHA 2E5WA 2Q0HA 1K6XA 5B7NA 4YK7A 3O91A 3NYWA 1I32A 2VRNA 3RFFA 1CCWA 4F71A 3KWJA 3MILA 2V65A 3CPSA 2ALJA 1AB5A 4WACA 1XELA 1ULBA 3ZD6A 1DOHA 2OFPA 4RDCA 5ALSA 4CMIB 6GPBA 3QRWA 2FWNA 2YY6A 5JYDA 2RFLA 5H02A 5JSZB 1EFPB 1PL8A 5SY9A 2O0JA 4EPRA 1MIHA 1E2MA 1IIRA 1OMOA 1W4AA 1KH1A 1Z22A 2HV8A 2ODAA 4WT7A 5FTKA 4N6GA 3OF3A 4PV7A 4TTPA 1OVMA 1GG2A 3UCFA 1PZGA 3TBKA 6ADHA 1M8KA 2OPHA 3HV0A 1S3FA 2RJ3A 3GPIA 4JU8A 4DWJA 4PLPA 1DE0A 4JT2A 5HS6A 3LLUA 4LOLA 3R5HA 2H3HA 5F5NA 3EDQA 4LCEA 4MK4A 4TLBA 2EFHB 3L8CA 6NULA 1M34B 4X95A 3OCYA 2IUEA 4LHSA 1U2DC 1YL6A 2HFJA 3RUEA 3JATB 1FVHA 1TT5B 1X7ZA 2WV9A 3UHAA 3CX7A 5JWRA 1XCPA 3GPDG 2OOSA 3UJ8A 4BLPA 3BXEA 4TKUA 4EX6A 4G6ZA 5E7JA 1I5EA 4QNMA 4FN4A 1UANA 7REQA 1B74A 2AG6A 2KS6A 2V54A 1F4PA 4KO2S 3VM6A 1YZFA 5HCNA 4CTOA 2REQB 4B34A 3ETCA 1R64A 3HRKA 3TUJC 3Q1LA 2VNIA 3OJCA 2GM5A 2IZZA 2YYSA 3FCEA 4AT1A 1BMTA 1IIBA 1KZ4A 3KTFA 1OYOA 2IYLD 4Q3EA 2BTOA 3OZGA 4O4LB 1RRMA 4LI0A 5F78A 3CFYA 4KR3A 1MC5A 1Q7TA 3FWYA 4FYXA 4QDKA 4X44A 3KC2A 2AFRA 3BXZA 3UICA 2VK4A 5BOSA 4LFAB 2H7XA 3MAGA 1E59A 4WFIA 1R6AA 2OGWA 4JSRA 4EAQA 3RUCA 4EHLA 1KDTA 1VG9B 1RRFA 1G8SA 4HEA1 3S44A 1AKTA 2WINI 1P18A 2ZJ4A 3DGFC 1RWBA 3Q8XB 1P1CA 1E2HA 4Y7CA 1PHRA 1MB0A 2F90A 1NLYA 1RHKA 1T5SA 3OZAA 2VZ8A 3H97A 3UK7A 1J7JA 4M1QA 4WV3A 3OUTA 5F4BA 5LUBA 2Q4EA 4J43A 2JFGA 3NWOA 2B4AA 3Q3IA 3VJKA 1XZCA 3ZTWA 4CIYA 1FBTA 2YMLA 1JZQA 1N2CA 2ZS9A 1O0BA 3V7YA 5GONB 1E6CA 2FSVA 1R7RA 4DRXA 3T15A 5L7TA 4PLFA 4UPDA 2FOIA 1EYZA 4Q3AA 1CEYA 3FYUB 4EKYA 1XDSA 4R7GA 2JF0A 3LUPA 1FDOA 3CR7A 1QX3A 3VUFA 5JHHB 3CUSA 1M76A 3PC8A 1Z4KA 4JCOA 4MJXA 1PG2A 3PIIA 1LBHA 2XCLA 2PGJA 2CUTA 1W49A 2J8ZA 4E7PA 3CKYA 4XLZA 1YDWA 2GBFA 2HU8A 3LDFA 2W48A 1Z5VA 4Y30A 2IVZA 1S2GA 3E48A 3UNXA 3WJ2A 3O03A 3FTDA 2G72A 1NOJA 3RGWS 5THQA 4KSBA 2WTAA 4TMWA 3CGWA 3TR0A 1ZUHA 1PJ4A 1CY1A 1DTWA 1F2UA 1HA3A 2I22A 2C98A 3AY6A 2PX0A 4G37A 3IAM6 1Q3TA 3DV0B 5AXCA 3G1UA 3T5GA 3KKKA 4CYMA 5LWHA 4IIYA 1N2HA 2PG3A 4FJ1A 3UB4A 2QHXA 4P1ZA 1GOTA 3A14A 4HATA 2BGGA 1ZKMA 2YFYA 3HTXA 3N2KA 1DQYA 1UBRS 4F6RA 1TGVA 1LPAB 2YC2C 5T67A 2SHKA 4CM4A 3OJ0A 1KMIY 2PM8A 2W2VA 2AQIA 2XH8A 4FZRA 1UEIA 3HRIA 4JC5A 4IV0A 1ZAKA 4MPJA 4TVKA 5HIMA 2JIOA 1NFRA 5YASA 4U6NA 2AE2A 4E1BA 2WYUA 1NUPA 4QGFA 4JBXA 1CDOA 3PC7A 3TDNA 1NKTA 4X6LA 3PQ8A 1GZ4A 3QIVA 3ACBA 4ZWNA 1TOAA 5CFMA 1SMKA 4KAXA 5ALEA 4KQJA 3STVA 1ZHOA 2Z2JA 4F4JA 3AJDA 1MP0A 3VZQA 5DNWA 1JAZA 1XKLA 4MS1B 3BGWA 4NE7A 1Z2AA 5ER6A 1Q0LA 1QK5A 4NI5A 3UHOA 5J2UF 1DT5A 1XB2A 4FCCA 3G59A 5G1NA 2HBZA 1GL9B 1DHRA 4RULA 1P5ZB 2R66A 3VI3B 1O2DA 3UJCA 1OUMA 5ADHA 3HEBA 3RVQA 3DMHA 2JLWA 5FJIA 2QSJA 1AKUA 2PFGA 3BF8A 4FDTA 3WK7A 5IK2D 4G5RA 2HI0A 2QXTA 4BP1A 1VHWA 1VE6A 3MMXA 3PGA1 1V0JA 4E51A 2V7VA 1ULUA 1XEWY 3S55A 3K0EA 1I7QB 3KHTA 4CEIB 1U3CA 5HUJA 1QIJA 1WS6A 4QRIA 3S27A 1P1IA 3PKZA 3IO5A 3TAXA 5JIBA 1T3GA 3CNNA 4KQEA 4C4ZA 2X40A 5HF6A 1M6WA 1E1YA 1YH3A 4HB4A 4FDLA 3UK6A 2P2GA 2OBFA 2W37A 4NS1A 5TQ0A 5IZCC 3N0VA 1CUGA 4KMOA 3OWXA 2NXJA 1OWNA 4EEZA 3IO3A 5LXTB 3MERA 4D45A 2OGZA 2CNNA 2XCUA 3IJRA 1ZWKA 4R98A 3LYUA 4IR7A 5AOAA 4HLCA 5IRCD 5EPUA 2FFQA 4E22A 2X77A 1Z0JA 5CCBA 5FOXA 3BWDD 2J0UB 3KQNA 5K9ZA 1OV6A 4MS4B 3KUDA 2BGTA 2Q4RA 2AZDA 1N3IA 2V7WA 3P9SA 3M0EA 1MHPA 2QRKA 1WMFA 2BH2A 4BEWA 1ZOLA 4HLUC 4YDSA 4YUYA 5BT8A 4X6YA 2Q3FA 4BLWA 4KG7A 2ONCA 2I33A 4YV1A 3QLVC 4IMRA 3HJBA 1F9EA 4Q7MB 3W5JA 4YJGB 1A5AB 5HTKA 2W2TA 2ZPTX 1EG2A 4XJXA 3RW9A 5ALRA 4L8FA 3B1XA 4BO7A 3UQZA 4E46A 4EQ6B 4FLEA 2CNWD 4ATNA 4BVBA 4U7DA 3FFXA 1EVKA 2RHTA 3QBDA 1M9NA 4FOLA 1X92A 3LO5A 4KIJA 4XR4A 3RYFA 4HDCA 4G84A 1K63A 1MO5A 3UVEA 2Y1GA 1TA4A 4UTOA 1EFVB 4AG3A 3E5NA 3KQSA 1Y8QA 4BNFA 1LPNA 1INLA 1O96A 2E37A 2B4RO 4I14A 2CLKB 1W4RA 2P5TB 4OA8A 1P5JA 1EK0A 3IODA 4FPXA 4XIIA 3G8AA 1YRLA 3ORRA 3OIUA 4YRPA 3DL2A 4ZGWA 4CQNA 2F9FA 2X8BA 3DR5A 4QTXA 3NOQA 4A0HA 2ZB3A 4TVSA 3RAPR 1VZ2A 2W6PA 1AMNA 4EGCB 1K4MA 1N9ZA 3SY8A 1O94C 4Q1AA 5D7BA 5EJAA 3PTLA 3SLGA 2C9MA 1E79A 3HGQA 1W94A 2Y4NA 2DXIA 1WW2A 4PNHA 5BV7A 1CR4A 4B8YA 1ISIA 1X7YB 1RW4A 3DEAA 3GJXC 3MYYA 4R51A 1N8TA 4LDNA 5GINE 3L2OB 3ZV6A 2V74B 1AOXA 3K9NA 3W90A 1Z16A 1M3SA 2EXXA 3IA2A 4Q9KA 3U1BA 4XWGA 1I0IA 4BFVA 1NG9A 1YUMA 2FP4B 4AUEA 5L9AA 2QNBA 3IMCA 2BMEA 3KQKA 4LSMA 2W6NA 2ZUUA 4N0DA 1GWNA 3PC6A 2JHGA 2WB4A 2PKQO 5HMMA 2A9OA 7MDHA 4RVNA 4MVWA 3TE7A 1U0FA 2OV4A 1S5PA 3E2IA 3I37X 4Q93A 1D3AA 2DT8A 1X6VA 2X5JO 3GFOA 4F6CA 4JKIA 1RRGA 3KL4A 3CLRC 1CDDA 3GX1A 3K96A 4RTRA 4DPMA 4Y2JA 3NDPA 5DTJA 4BATA 3NIFB 5JG7A 4QTTB 3RV3A 4EW6A 4ZYUA 1XZPA 3AXTA 3P19A 2HJVA 3WLOA 3L1IA 4B3XA 2VNHA 3ELWA 1IOWA 1TVKA 3RYCA 1T6NA 4BTVA 1Y5NA 3BWYA 4URZR 2HMSA 2GN1A 3UJDA 2QROA 2Q5IA 2YBDA 3ZD7A 1A0OA 5IASA 3ZV3A 1KIFA 1SUPA 1BXRB 2BGRA 2O59A 1KYIA 2HGSA 2HGZA 1QLWA 4W99A 4BVFA 1GUYA 4QWWA 3KSBC 121PA 2QAJA 4L08A 1KI3A 3H2YA 4OH7A 4D6XA 1PAUA 3QUQA 2PHZA 3F6SA 5AK3A 1GXSB 3S8MA 3SE0A 1DAIA 2XHEA 4E7OA 1DARA 1VCNA 2FW0A 5AW8A 4J49A 3LX6A 1K9SA 4ITRC 3OF5A 3HABA 3ND5A 1RQNA 3LC2O 4DUZB 4WOCA 1HE2A 4NKRA 1L5SA 4KBFA 4XIYA 2IEIA 1V9SA 1XHEA 5K4GA 1OWPA 5AKZA 8ATCA 2QJOA 4RCVA 1NOIA 4ENWA 1SC1A 1DQRA 1T4BA 3DBHB 5A6VA 5BQXA 1Y8RB 1HETA 2ZJZA 2X22A 2HJ9A 1C81A 5JPDA 3ENWA 3N2GA 4KMSA 5AOVA 1JDVA 4BTEA 1F0PA 1PK9A 3D3NA 3DLCA 3T54A 3VR6D 1GFWA 2FUKA 1RFLA 4RD3A 3UM9A 3V8QA 1IY2A 2EJTA 2OBBA 2PMWB 2B94A 2JGFA 3HN7A 1L3CA 1Q0UA 3I5UA 3LIPA 2BMDA 3DB2A 3PNVA 2QUAA 1C7FA 1GTG1 1ABEA 1TKCA 4HBGA 4WTOA 1PF7E 4I66A 3ICVA 2O7VA 1IQ0A 5GJVC 4D56A 4UDNA 4QUIA 4YPFA 5KDOA 1OI2A 3R4VA 4QSMA 5DM4A 2BTEA 1O87A 2V7EA 1NXSA 3AEKB 1GEGA 4L9WA 1A8UA 2VHQA 4OP3A 4YLYA 4QLBA 2H8GA 3NGXA 4BC0A 4CG0A 4DQLA 2J87A 2EIHA 3ENVA 1ESDA 4KP7A 3VKGA 4TV8B 3NBKA 1K88A 4FYHA 4GGPA 3RAEC 2MOKA 1WXWA 2HCFA 5DGHA 3SJUA 3EGCA 1CUWA 3A1EA 1I7SB 2P9BA 2QRPA 3DMTC 3UYLA 3V8BA 3MGAA 1R0BA 3GN2A 1FFCA 1IZ7A 2X9VA 3MNFA 2WFAA 4CCAA 2HF7A 2Z30A 5CA1B 5DNVA 5AXDA 2Q3JA 3BIXA 2JA1A 5E2IA 1XNRB 3AR8A 2NZ2A 2Q5CA 4HQ0A 4JVOA 1RYBA 4RHCA 4ZC8A 2PUJA 4NATA 5HJEA 3KOXA 3L6CA 3PEUA 5FPPA 3RNOA 3TZHA 5J4YA 2F59A 1CQWA 3AWIA 3E3AA 5K2MA 5T6BA 3UMGA 4GICA 1U98A 3G9QA 2C7BA 2I3DA 4P32A 3S28A 3OLWA 1SA0B 3LRTA 1LTKA 3UB2A 1PR3A 4OUDA 2AQHA 4PO3X 3WA6A 1MV8A 4NCXA 4IMIB 2Q1WA 4L9SA 4LNUA 4C7XA 1DGQA 2VT3A 2OM6A 5I51A 2FPOA 2QYTA 3EXIB 1CFZA 2ZRQA 1KO1A 3L8GA 2ZCVA 4TVOA 5CGZA 4FJ0A 4QRDA 3U40A 2E89A 3FJYA 4HZUA 4LF5B 2BFEB 1UKAA 4L50A 4L8LA 4DLKA 4DV6B 5C31A 2Q6IA 3KQVA 5IK2A 3KYDA 1SG0A 2DC1A 2PBZA 2JCBA 5AXAA 1CQIA 1P4HA 3DBLA 3V1KA 3K2QA 4MLPA 3KSRA 2O2GA 1EQUA 2W90A 2YJ3A 2Z8ZA 3FMPB 3LXXA 5AM2A 1IN4A 3OT1B 3LECA 1VCIA 4M3NA 3QV2A 1WLSA 2CDNA 2D0DA 2QT1A 2ZYTX 3AV3A 3JALB 5I7SA 1XXHA 4HTAA 4R83A 4ZV9A 2Q1TA 3K70C 3TRJA 3W9UA 2XT0A 4HFNA 4PYKA 4RS3A 4MYDA 5JAOA 2R1ZA 1SUWA 3GJ7A 4UTZA 4K9NA 3EZ7A 3CHYA 3GELA 5IUKC 3Q8KA 2R6HA 3QPWA 1KA9H 2TS1A 3BAZA 3DAPA 4J0FA 1VYVA 3THOA 1TU3A 4HMQA 2EJWA 1KOJA 2ZGVA 3J7AC 3VPSA 3RYIA 2ZI9A 5B7QA 3TSAA 4YUAA 1O54A 3GCGA 3NV9A 3GLHA 1F51E 4B7CA 2M32A 1SHKA 2G9ZA 5C8VA 3ICPA 1G3IA 3VA7A 4QOEA 5C5EA 1HT1E 3EFOA 3QVKA 3PKIA 1S1MA 3BWMA 2WIFA 3ZHYA 4Q4JB 2CNWA 1N77A 3DHEA 5F9FA 1NYQA 1UEJA 4RK7A 3KPVA 3FRJA 4DCCA 1N6RA 2AOVA 2WG1A 3KWMA 4OL0A 5DRTA 5K0GA 4RJJA 3USZA 3JQ8B 2P2LA 3KR9A 5IBRA 2FW1A 4HDKB 3LKVA 1IUPA 3VGJA 2PWBA 5ALDA 4ZQHA 4PCLA 1OTYA 2VPWA 2IYVA 3OU7A 5KQLA 1KZGB 3HFRA 4TRMA 1J9EA 1DPGA 1XMSA 2QVZX 4WXMA 4G9BA 1JIQA 1E7WA 3BFPA 5JYBA 1BWRA 3UMBA 5HEKA 2KX7A 4AXXA 1D07A 1B42A 2L0XA 2VZ0A 2X23A 3EXG1 3I92A 2DKFA 2HHCA 3B70A 2YRWA 2ADOA 1GPUA 5FLEX 2H2WA 2G25A 1TPYA 2C3MA 3QF4B 1BXKA 2QYSA 3K0CC 3ZBPA 4D8VA 3ANLA 4NZPA 3WGMA 3MJCA 4F3KA 1ZIXA 1PVVA 2ZUEA 2UVPA 2QVXX 5MFZA 4TYPA 3OZRA 2WMDA 4FI3F 1ZGCA 1WQ4A 3EIHA 3SXUA 1MAUA 3U7EB 5HWSA 3LP5A 3O3CA 3G2LA 5ALJA 1VCHA 1TZJA 2I2CA 1DC3A 3QY9A 4UNNA 4WZZA 5CBPA 3TZCA 4D98A 4MV6A 1G6KA 3WGLA 3WNQA 4AG6A 3DP7A 1THMA 4H0FA 1VP9A 2V6JA 1E98A 4EW2A 4RH0A 4LY0A 3H9EO 3D31A 3PXBA 2PUHA 5KYYB 5D3ZA 2PLRA 5AW0A 1KORA 2AD5A 5BSKA 3BMCB 3MTEA 3Q2KA 2VQEB 4WXRA 5AICA 4QBIA 1JXQA 4R2JA 3FDXA 4HGZA 3OSUA 1V5WA 2WHPB 2WAYA 5CNJA 3VBCA 1PYDA 3DDZX 3F5MA 5HHTA 3AIMA 1JHXA 3L6RA 3LRPA 1T2CA 4QDZA 2IW3A 3CZ9A 2G9VA 3W5HA 2RI1A 2F8MA 5A5GA 4TWAA 5D5HA 4LYJA 1T6YA 3ZHXA 1MVLA 3THYB 3GZNB 1C4XA 5KYKA 3H87A 3O8BA 1EVYA 1UP7A 5GAJA 4YRDA 3THXA 4GW3A 4TXHA 1OROA 1RRPA 3AC0A 1QHYA 5E8RA 1UKBA 2H31A 2J9RA 2Q4BA 3DLPX 5H4HA 4IFTA 2ZBEA 1G21A 4MWGA 4RAOA 5HR5A 2GK6A 3F3SA 3AESA 2R2GA 5EC8A 5JQGF 1QB7A 4XDYA 1VL0A 3PPVA 2PX6A 3D7NA 3H2BA 1DADA 4U9IS 1RBZA 1E3SA 1X9HA 3A3KA 5JMOA 4RD1A 5LQUA 2ZTUA 2DQYA 1FMJA 3DWIA 4LJSA 1SVUA 4PZZA 3CEPB 3ILVA 3ZWBA 1LC3A 4NYMR 5CHEA 2P3LA 1SHLA 5JC8A 1C1DA 3EMKA 3M4XA 1WBDA 1GIAA 3ANXA 3BREA 4LIPD 4J2TA 4UHKA 5AH0A 4YONB 2ZCJA 2KLHA 4AMGA 3DYIA 3GLIA 2JLUA 3COYA 1EMDA 4MGZR 4R5HA 1A77A 2E18A 2CZCA 3BRQA 4LXQA 1N2EA 3MWYW 4C4SA 4RNCA 1ICIA 4YJHA 3H6HA 2BDUA 1OB2A 1Y48E 2DSTA 4L07A 1Q6YA 1IRXA 1YR3A 2QYOA 3E1SA 3WMXA 4EG0A 3KBOA 2IS1A 1MQAA 2RB4A 5FB3A 3G13A 5JYEA 5KNDD 1JXMA 5SICE 3EHEA 1P39A 3U7QB 5LZ4A 1VSQA 1S9HA 2R8BA 1TJ4A 4QQ8A 1XEXA 3O8OA 1SEPA 3UXEA 3ZHZA 4EFMA 3ZOZA 2IZOA 4ZC1A 4CVNA 3G8YA 1FEZA 1YSCA 1WNTA 3FLMA 3A11A 2PL3A 2QY9A 3IAXA 3NWEA 1SB8A 3QVJA 4AX8A 1TJNA 4HXYA 4IDDA 5HIKA 3MHTA 1HDXA 3RR2A 4XLTA 1CKEA 3M33A 2PWAA 4M4SA 4NDZA 4QHTA 1DELA 3L02A 5AI5A 3SLKA 4EF4A 1RWPA 2GLUA 1KDPA 1QVRA 4QT4A 4WOKA 4DLPA 4D0GA 1HMYA 2XE8A 5JS7A 3LUAA 4DVGA 1SD5A 1U8EA 1SVKA 2B30A 3H8JA 4QTZA 4AMUA 2ID7A 2ODPA 3GQBA 5IJZA 2DFDA 3IE2A 1Y7PA 4XX0A 4ZEWA 1OA1A 1TKRA 2VT6A 1X8JA 1RPAA 2GEUA 3R7NA 3H11B 3HU2A 2MMGA 2FX3A 1DKUA 1MOQA 3CX4A 2Z9DA 5IT0A 1KH3A 2BRUA 4GOXA 1NVFA 3K7EA 1KPGA 2BFNA 4G0UA 3A6EA 2HQRA 2W4IA 4R1QA 4B9EA 1YQEA 2R6JA 4WZAB 2AUTA 2AFHB 1US8A 2VIIA 5E2AA 4G63A 3UXHA 4X7RA 4WBSA 1VIYA 1YZQA 5ECYA 4C7KA 1F38A 1LLQA 3G8DA 3F90A 2NUPA 2PD6A 4X1IA 1OC2A 1R3UA 2A9JA 5JAZA 3AW8A 1E1LA 1PDWA 3KSMA 1E2DA 2O8BA 2I78A 2FX2A 1X77A 4IIXA 4AY6A 3QEAZ 2H0QA 1A7AA 4QULA 4PAQA 2VHEA 5KNBD 2GEVA 4RZSA 1GRQA 1JL3A 3N76A 3QG1A 3ZY6A 2Q9AA 2X0RA 3PX3A 2LBPA 1HFJA 4LF7B 3L05A 1L5HA 4MGKR 4RKWA 5FNVB 4GWLA 1FYFA 3OECA 4B44A 1XZGA 3OPMA 3FZQA 3U3DA 3WLHA 5H4GA 5DMHA 2BR4A 3MN1A 2F3SA 4KSYA 1PKEA 1EFRD 2BM1A 6REQA 4PINA 2J0EA 1UFRA 4R54A 4BJ6A 4RADA 3CH7A 4AJPA 5IULC 4IDAA 4PQFA 4RGVA 3TBHA 5B1DA 4EFDA 5JJ5A 4DJDC 2GZ1A 3EXAA 1YQQA 1FDIA 1ZH4A 2ZP1A 4ZAFA 2F8LA 5JI3E 3MTAA 5KYWB 4D8UA 1P9RA 2X5OA 1SVLA 3HXTA 1TAQA 5CFQA 4GPEA 3F7MA 5B6JA 1WZEA 4IMJB 4Q37A 5FWYB 2DHEA 1ZD4A 2H29A 4ZOAA 1NDQA 4NQZA 1T2DA 4IICA 3M5DA 3TZBA 3N1UA 4OHPA 5G0VA 1SO8A 3DZIA 3E18A 4FHGA 2C9DA 1XQ6A 1G59A 1FTYA 2HU5A 4HB2A 4IGKA 2OG2A 5JSZA 3E5HA 4CDRA 3PI7A 4ICIA 3ZE0B 4FJ2A 1HQCA 1KE1A 4E11A 2CMFA 2BFFA 1Z2OX 2B78A 1FX0A 2ZIFA 3BDIA 3CLUD 3GGJA 3PJEA 4DSOA 1FJHA 3PSAA 2WJ3A 3LUHA 4PANA 2DJIA 4KE7A 4WLEA 3TKLA 4ZTZB 5E9QA 3IQIX 2J5KA 1HG0A 2PZMA 4IHQA 3GGSA 1WR8A 2QYHA 3GVXA 3P2EA 3EYWA 3OY2A 3QLUA 5FTNA 3VU1A 3TLKA 4R41A 3MS7A 4ZZ1A 1DP4A 5JRDS 1UAYA 3ZWPA 1E5TA 1CIPA 3LGAA 3N39C 4LJ4A 4JI0B 1GPLA 1QH8B 4PNEA 1YV9A 1Z5WA 2E1PA 2KMLA 3I4FA 3KLPX 3DLAA 1JAIA 2JEYA 3TIFA 4ECEA 2QW8A 1ZVMA 2FRXA 4TWIA 2Y27A 3JVDA 1EG7A 2VSFA 1JJAA 3LCCA 4DMFA 3WK8A 2TMGA 4MV9A 5JY1A 3T1TA 3RK0A 1V3VA 1KI6A 4KFTA 5F21A 1NNEA 3AK4A 5K0ZA 1LTHR 2CLHB 2G0AA 3ZHSA 4DY4A 4XTCS 1M7GA 1L8LA 2BGMA 2C31A 2P9EA 3HCCA 4DN6A 1NPTO 1QIKA 4K9QA 3DH0A 3JAWB 4O4LA 1OI7A 1D4OA 1RHUA 2A14A 2O8VA 4GHWA 4MUGA 2B7LA 2F9MA 2NU6B 2ZS7A 3NNNA 3ZD8A 3I9MA 5CLJA 3ZJYA 5LKAA 4I8DA 2IS4A 2IUFA 2YVKA 3L01A 3IDZA 3R7LA 2I34A 3LFTA 1MAWA 3UMCA 2XQFA 5KUTA 1N1EA 2O2JA 1NVKA 2YMQA 2ST1A 3EH1A 5LP6A 1DEOA 1ODLA 2I03A 4M1TA 5DX1A 3TEMA 2WQ7A 1MC1A 4W1QA 3HDGA 3FHTA 5DF1A 1CU1A 2E4XA 1SHUX 4B4KA 2A1UA 4QYTA 4IQFA 4Q3LA 3PQDA 1ANKA 1ESCA 2CB9A 2RGXA 3AONB 1YF3A 2EDCA 3WJ1A 5FOSA 3WRXC 2UYGA 1WV0A 3E1GA 2D3TA 4IZHA 1X7GA 5BQOA 5CEJA 1EM8B 2CJWA 2VN8A 4ER6A 4EI9A 2NNWB 4GMKA 1AGXA 1EWVA 3ONFA 4KJXA 4DCOA 2C2GA 2YIMA 3KSZO 4GVXA 2Z6UA 1MG0A 2GF0A 2IPOA 4XW2A 3ZW8A 2H5JA 4F3RA 4LJLA 1KRXA 5H83A 4G0PA 1BW9A 1Z6AA 3E9YA 4HNSA 1HY3A 4GI1A 5GWXA 5JFGA 2QENA 3AILA 4NBSA 4Q3OA 6PFKA 4M49A 3LWZA 1ZRHA 5J40A 2B2NA 3Q8WA 3C3KA 3ESAA 3A4IA 2C9ZA 3C6ZA 2QXYA 3PICA 4UC0A 2PBLA 3Q9LA 3Q0EA 3ZHTA 7MHTA 3PC3A 1UK7A 4KFUA 3U49A 2HWKA 2IXAA 3AB8A 3MVEA 5DI9A 2REOA 1SBQA 3IR6A 3RRNA 1Z13A 4J4BA 3NHPA 4RKEA 3TUZC 3LTNC 5AI9A 1V1JA 4M0CA 3H8VA 4EO7A 1EX1A 2NO1A 2EGUA 4F93B 4AULA 3K0AB 3EVAA 2IHZA 3GEGA 1SELA 3UJ6A 5LBIA 4RTKA 2PKQP 1U8YA 1V1RB 4JJZA 3F6EX 4UUOA 3UGTA 5H9WA 2CNDA 4R16A 2K7FA 4GZ3A 4KV9A 4CEHA 1E4OA 1KPHA 4HUQB 3V4PB 1IY9A 4FBGA 4YI3A 1J8MF 1F17A 2ZBDA 5KNDA 2IUSA 4RZQA 3SHVA 2MSDB 1UK8A 4PLCA 5EUMA 1JKIA 1NFQA 1CJMA 3TRIA 1PCXA 1O97C 3QWBA 3F6BX 3Q4GA 4OQLA 1T5IA 5KTRA 1FYVA 1XWFA 2OYSA 5FULA 1GZSA 1ZOIA 4B71A 3PD7A 3KYJB 5A4IS 4FHFA 2C57A 3PGMA 2OLEA 4Z8XA 5BWLA 5EJEA 2NN3C 2VF5X 2Z3WA 2HPAA 1Y3IA 5DOZA 2IV3A 3QKRA 4O4HF 4JI3B 4PG6A 2FK8A 1T9HA 1ECJA 2GNPA 2OG1A 2PCLA 2I54A 4ZALA 3HR7A 5J2UB 3S70A 4N48A 4LE0A 1T13A 3OPXA 5F2NA 1NRJB 1VDMA 4BMSA 2GAAA 3UEOA 1Z39A 4V38A 1SCQA 3EGXA 4IHAA 1YBAA 4BRWA 3EJWA 1DWQA 1UDRA 10MHA 5EE1A 2XTJA 3AVOA 1PVDA 1Z8DA 3G2OA 3VTKA 2QR3A 4TMZA 3FUXA 2CLMB 1XZBA 5FTMA 2B4TO 2HIGA 3ZQ4A 5M04A 1RXUA 4JELA 4U1RA 2WHYA 3IXQA 1QUFA 4OP2A 1Q77A 5D6NA 5B37A 2JCXA 1K27A 4B0PA 4Z9BA 1RSZA 2ZJ2A 2GESA 3DSRA 5J5VA 1D8TA 1Z2CA 2FLVA 3P2OA 2I80A 5CFRA 5LXTA 1I30A 2NYAA 3CRMA 3OY7A 1NMEA 1G60A 2ATIA 4ZO6A 2JHAA 2IHBA 5I6DA 3D4LA 5AHKA 2H17A 1JTVA 1JFFB 1Q0QA 3HCDA 4IXDA 1ZNZA 4F06A 3B9QA 1FX1A 4ETIA 1CR0A 5KNBA 4IIGA 1Q50A 2MSKA 4HWOA 2X41A 1DAMA 4JLVA 2A9FA 1G9TA 4MS4A 4N5DA 5TJ9A 4U3JA 3LC1O 1GQQA 1YL5A 5D2CA 3WXBA 1R0ZA 1X7DA 3FNFA 3L4BC 4I08A 4DARA 1BCSA 1SG6A 3QKSB 1U28A 2O2HA 3IAHA 3OMXA 5F3DA 3VTZA 1QMGA 3N2LA 4YJGA 1WV1A 3PUWA 1GZVA 2D8AA 5DN9A 2QP4A 1TLFA 1X15A 2NO6A 2XF8A 4MMXB 1CUFA 3HPQA 3KJNA 3FGOA 3S2GA 3QXSA 1KP3A 4LZPA 4HDMB 4EQ6A 1EFRA 4ENSA 3T5TA 5C1PA 3UGJA 2HWXA 1PVOA 1KYZA 1QE0A 5HQJA 2M6SA 2PPLA 4YREA 2RBKA 1VMEA 4NNJA 2YUTA 3P8ZA 4LRYA 1C9YA 3I5XA 4XGQA 5I4BA 1U81A 2CJPA 1EFVA 2NNLD 3QIAA 1OJ7A 2XMCA 3ZWCA 4M86A 4YBRA 4CKWA 3Q0TA 1WUHS 5AK0A 2IDMA 3L0PA 3HI6A 4FHCA 5L3ZA 1U6KA 3E3OA 4US0R 2BHTA 3VKUA 2PTGA 4QDJA 3VNSA 4GF5A 1Y1KE 2AZXA 4JH0A 2FZWA 3UGQA 3KS9A 5TEWA 2YQ5A 5B1EA 5IAKA 3TD9A 1GN8A 4NIMA 1WZ2A 2P90A 4FB4A 4DQDA 5I4CA 1VRVA 1XQYA 3R7WB 4B75A 5K20A 3DB1A 1U7OA 2BKUA 2OBNA 1GKIA 2QRJA 4IEEA 1WVMA 4ZTBA 3RVLA 1KNXA 3ZWAA 3JZFA 3LPNA 5BV0A 4RM3A 3ZPXA 1RPJA 4RF2A 2H63A 2FP4A 1Z5ZA 4L4SA 4XGKA 4Y2HA 1BVYF 2IKSA 2YHSA 2P4EA 2PS3A 4NMMA 1J70A 4U02A 3WBJA 4D9KA 2VBGA 5JATA 1XPOA 3QKTA 1ZM4A 4YYZA 3DL7A 2XVZA 2Z9BA 1OLUA 3D7MA 4JT4A 2PUGA 1R0LA 2PZBA 1FU4A 1ZY2A 4FS3A 4QA9A 3AR2A 3PQ3A 5BVHB 4R1LA 1XLWA 4Q03A 2G71A 3KP1A 4TT8A 1COWD 1ZGHA 3EBOA 3MJEA 3HY6A 4I6JA 2CLEB 1E4EA 1PR4A 1X1QA 3ZNOA 4XSGA 3RS5A 3TSZA 4MQ5A 5LFAA 3ZN2A 3ZCPA 1G3QA 1UC4B 2XXAB 4GD3Q 3MLEA 1DAEA 1ZSNA 2F3UA 1GADO 4ZK2A 2ZVPX 2RGAA 2BMWA 1M1NB 1Z56C 1QH1B 4LJ6A 1M67A 1Q74A 3ZU5A 1E62A 4L4YA 3VU9A 4N9QA 4MPRA 2M6KA 1PJBA 2C00A 3AEYA 4TYWA 3ETJA 1G41A 3M3PA 2IEBA 3DFFA 1IM5A 2R86A 3UJBA 2NSJA 2PU5A 3RYHA 4BP9A 1JA1A 2ZRCA 4HP8A 4US1R 3KSAC 3FB4A 1T9DA 5LA6A 2AZMA 2BGUA 1PSZA 1UZUA 3B51X 3F8WA 3BDAA 5CW2A 3WGTA 1G0OA 4FSHA 4YT8A 2JFFA 2JJ8A 3SBXA 3ZWWA 3HO8A 4C14A 2B25A 1AQ6A 3COWA 1BN6A 4CIVA 1GGKA 1GZDA 2HNAA 2P41A 4CV2A 5JFTA 1KAQA 2PX8A 1XD2A 1JHRA 4JZYA 2IYUA 1G64A 1T6XA 3CJTA 4HMPA 4BNWA 2BHNA 1ZS9A 4PGFA 5INTA 2XRFA 5ILQA 3H3JA 2O8DA 4E07A 3U6BA 4FS8A 1X94A 3V2HA 1Y1LA 4HLQB 1WNFA 2YZGA 1U65A 1R27A 4JJ4A 3TSYA 1TK3A 3EPLA 4DV4B 3FIJA 4OYLA 4JT9A 1U3TA 4RQBA 3ZIAD 3IUMA 3L92A 3DNMA 4AF7A 3HB9A 4BBZA 1XVTA 1DRVA 3CEMA 4Y7DA 4DUYB 3ISJA 1VLHA 3R44A 1IMJA 2EEPA 4MVJP 3OG9A 4ZXPA 1IY8A 1QDLB 2JFNA 4Z7QB 3DAOA 3UKDA 3W8DA 4BNIA 5ARDA 5LL6P 2H85A 1SCKA 2V7QD 3SYTA 1TUGA 1GRCA 2HN9A 4WCVA 3BL6A 2QQ0A 3ENZA 4TV8A 4DA6A 4B6QA 2IHNA 4X20B 3HVRA 1VMIA 4LQLA 3DG9A 1Z8NA 2ZT8A 3EY9A 2MR5A 4WLFA 1E8DA 2E82A 3CZ4A 2A86A 4U2GA 4Z5XA 1FZQA 1RJ9A 1I01A 1KVQA 3C8HA 3EBPA 3I6IA 3OFJA 3D7RA 2WM3A 3OU6A 4MIOA 5CA1A 2NZJA 4Q3CA 1I6WA 1S89A 4XQEA 5B12A 9GPBA 1JFTA 1J8DA 2JI7A 4CWAA 5J2TB 3U3JA 4LHYA 3LV8A 2A5FA 2WIGA 3UPUA 3VSCA 2I4OA 1Q1GA 2EWWA 2VRBA 2AQKA 3KBBA 5FYDA 3NBMA 4KN5A 4ALIA 2G4VA 4Q3NA 5BUCA 2AK3A 3ICWA 3UV3A 2YH2A 3MXTA 2OPBA 2WKWA 4JMPA 5L6MB 4H7FA 3BT7A 2FW7A 1K1EA 3MMSA 4KXFB 4DZZA 1LQ2A 2X4DA 1QQTA 3RLFA 2X4GA 1GZ6A 4HLNA 5F7XA 5EIFA 1X7HA 1P7YA 1XKTA 3DUFB 4L22A 2GHQA 5HOQA 1ZG3A 2NQ2C 3C1OA 3LCUA 3PUXA 1CSEE 3GLQA 4F5WA 3PG5A 2O8FB 3ABOB 4HYQA 1NTOA 3EXIA 2D5BA 1TF7A 5AKXA 1SQ6A 1OXUA 2H4FA 5C8YF 4WJZA 1YRAA 4JI7B 3AF4A 3PXDA 1NWCA 3MUNA 4WKBA 1ZNQO 4HS4A 2IP1A 1MF7A 2XMZA 1L4EA 3ST7A 1Q2UA 2OAEA 2F1JA 5IT5A 5JALA 2HR1A 5I4IA 1OXTA 4Q02A 3CSSA 1TEHA 1KE2A 4UMEA 2G0TA 2I3ZA 5ALKA 5TGDA 3V6MA 4V03A 1AQIA 3V32A 1A1SA 4ZCLA 5K0EA 1CZNA 5KTSA 1X2BA 4KBYA 4I5FA 2ZIWB 3NBZC 4C0WA 4KYTA 5JISA 1OFHA 4XYGA 1OLOA 5A5FA 1TFUA 3VC3A 4R2IA 4UQPA 3EXFB 4LOKA 1GILA 3V2IA 4MYCA 4AO8A 4HNGA 4PWYA 2W6MA 1U6IA 1VBMA 3M6FA 1PDVA 1HV8A 2HMYB 1VIVA 1ZUNA 2EZ9A 1WSAA 5JMPA 4IOKA 1R5BA 2H16A 2Z08A 5LLSA 1XFAA 1M6NA 1JWLA 4JEUA 1YBMA 4MV8A 4GKBA 2GJ8A 4Q1FA 4GR5A 1MB2A 2HQ1A 3KKPA 2WY2D 2WILA 3OJLA 4RHXA 4XCQA 2JGLA 3WGIA 3RBVA 1VLMA 1ADCA 4OHFA 5JDCA 1TO2E 1RHJA 4NEGA 2FJUA 1ISJA 2ZKLA 3I9LA 2QAGB 3PUVA 3A0UA 3OC0A 1DBIA 1LBEA 4L6AA 3PDHA 1AGPA 2JVIA 3JQ8A 4JVNA 3C5EA 1IWOA 1G2QA 3D6TB 4R7TA 5AVRA 4O8ZA 3VOAA 3IQFA 1LUAA 3PYLA 4CR7A 2G4CA 3P4YA 1XCMA 4OQFA 4P7FA 1O94D 1U7DA 2B1QA 1W7AA 2VP4A 1A2KC 2RI6A 3IESA 4M55A 4DCJA 4IUBS 3U4CA 4ML3A 1HNXB 2VNKA 4V0NA 1J6UA 5JAQA 2ZXEA 2A84A 3HXPA 2IXBA 1HKHA 3P45A 4DIUA 4QJIA 3D8SA 5J4KA 4CMGA 2F4NA 3BA1A 4RU1A 2OZLB 2JARA 1RLOA 2C8VA 4CL2A 4RKYA 3F67A 2GHTA 2Q5LA 3HV2A 3MWKA 3BHIA 4MVJH 2CVQA 5THXA 1WXGA 1YFJA 2JI6A 2ZSBA 2QK4A 3IXLA 3GP8A 1Q0RA 2EJVA 2QL5A 4GPTA 5BMVB 3DCYA 3IS3A 1WB9A 1U2DA 3AHHA 2R8RA 1L7QA 4OLFA 1XDDA 4MRSA 4R9RA 2WFMA 3H0KA 4XEUA 1Q12A 3MBKA 4J0EA 4JOBA 4PNPA 3GFBA 2B6NA 3GH1A 2QD3A 1E2GA 3CLRD 3HEMA 4ZAXA 2ZROA 3T52A 4ZI7B 2NIPA 3JVEA 1BN7A 1VA5A 4KJZA 4RKFA 5KYYA 1J5PA 1L1RA 1E3MA 4DLNA 1QIEA 1B0PA 1TAUA 3BMCA 4AP9A 2VP6A 3TIGA 2CVFA 2QZ9A 1COWA 4UATA 5LMZA 2WJAA 4H7HA 4LZNA 5EUCA 4DA8A 1TJ5A 1AK2A 3MOSA 1NSYA 2A4KA 1DKQA 3I6QA 3R0XA 4XVUA 1IQUA 3GVCA 4G1MB 4G0WA 2ORWA 3AY7A 2LGJA 3G0IA 1LBSA 1QP4A 3GZNA 2J48A 4FNMA 1KTIA 1LDYA 3D6AA 1DINA 4PY2A 1S7GA 4QQRA 3JS5A 1S1CA 1X70A 1PJTA 5EZYA 4R05A 1QHHB 3C8ZA 2OXCA 3RO7A 3ZY2A 3AGPA 4OF4A 1YS4A 2XQGA 3E0QA 1VL6A 3HDYA 2Q5EA 1OZFA 2ZR8A 1HE1C 1HLPA 5G41A 3OTHA 4TKMA 1LK0A 1XTRA 4OXQA 4B80A 5HQ3B 2JLBA 2X42A 1HE4A 5CX1A 5DI3A 5K0NA 2Y4OA 1SQSA 2JC3A 3EJ6A 4RK0A 4ZCSA 1QLJA 4JROA 2IELA 4J9VA 5DMXA 1L3IA 3QUAA 1NZFA 4BY9E 1NBOA 4IWNA 1EXWA 4D9NA 2GCGA 3QM1A 5TQ2B 3M5WA 2O8DB 1YO6A 1BEEA 4LG1A 3ZVRA 4YJ3A 2ZXFA 2AR7A 1W85A 1YA8A 2DTEA 3N28A 1U0OC 4GYWA 3ZXXA 3KKLA 2ZDGA 2A5LA 2H48A 1NT2A 4NJOA 5CTAA 2DULA 3DS8A 3RE1A 1QRTA 1UPFA 3NTQA 3OPYA 4LX0A 4DDWA 4HNRA 1P4GA 4H1TA 4R1NA 2GYYA 3OD1A 2O3JA 1UJBA 2XTMA 1XZEA 2CZQA 4WGFA 3NBFA 3ROZA 3UMVA 1RLMA 4XSVA 4XQ9A 4OMUA 2GN9A 2NT3A 1KYXA 4QVIA 4WMLA 3W5VA 5JEEA 3OM0A 3B1WA 4CT5A 3A3PA 2GOYA 2Q6KA 2V7QA 3NB0A 1HI9A 1PNTA 4FW9A 1AHNA 3UF0A 1QO7A 3FNHA 3FZYA 4RPKA 3B3AA 4B2LA 1H9AA 2IPLA 4BLQA 5D3MA 1QGED 3R6LA 3WOHA 3A3OA 4F2PA 2VSQA 5EESA 1X1EA 1DQPA 8GPBA 1S4MA 1P4JA 1A9SA 4DCGA 3PFCA 3AUUA 3GLGB 4IJVA 3NIGB 4KNWA 3WKBA 4NDNE 3AI3A 1F14A 3H9GA 3L0BA 4AJ1A 4ZDKA 1VYUA 1T91A 1RKBA 3TKYA 2PVSA 4BE9A 1GU0A 5DIFA 4DMGA 4S1OA 1NVDA 2ZVQX 1GCGA 2JI9A 1KEKA 2RH8A 1EXMA 2Y67A 4HTFB 3V4ZA 3GOQA 4G24A 2XNSA 2AFHA 3DKPA 4ABYA 4G8JA 2GCOB 3GRKA 3I2KA 4ZRNA 1T4CB 4BNMA 1P2UA 2VH1A 3ANTA 4N8DA 5I8WA 3DVLA 4WBNF 1E1DA 2D2IA 1E0SA 3DV9A 3HY4A 3P20A 5CDHA 5H80A 2I8LA 4DT1B 3HG7A 2G7ZA 4K6CA 4AURA 5T7BA 2FPGB 2RAUA 4FZVA 2IOFA 2COKA 5TF4A 4HKTA 2W11A 2Q99A 4KPGA 2CY0A 4BNVA 4Q1CA 1P60A 2DPYA 1QDUA 5DGCA 4N5IX 3B1VA 1X3SA 4KR2A 3QLTA 3IDAA 3D4BA 1SBTA 4HHEA 2YWGA 3PPIA 4FDVA 3FIUA 1WTAA 3SHWA 3GDOA 1FZTA 2G06A 3UAVA 3WC4A 2QTRA 1YDFA 2D2VA 4TZ6A 3KXDA 3L9XA 1W5TA 4IUYA 2UXCB 4KIWA 4ZZIA 4C5CA 5HK9A 5IZCA 2A94A 2QRVA 3R1IA 4N65A 4QSHA 5K8UA 3K70D 3NM6B 4KBGA 3AEXA 2ZM5A 5DNYB 1NLUA 3PNPA 3W8FA 3FCSB 3MQ2A 1U0EA 4PZLA 2HZBA 3F9RA 1Z6TA 4P5EA 3WLSA 1APBA 1NDHA 5HUHA 1FMCA 5SY6A 4IGEA 2GZ3A 3HYRA 1G0NA 1LLFA 1VJDA 3SZGA 4LYEA 2Q9UA 5IVIA 3OFVA 4HLUA 1EE1A 4WFKA 5KYWA 2PBRA 4HRYA 5BQ5A 1TI7A 3QXHA 3I8XA 3QLVA 5FWYA 2JCSA 2VF7A 3TNJA 1Y98A 4K9OA 3DD5A 2I7DA 4CTJA 2OP0A 3SYLA 2QMOA 2ZYUX 4Q1BA 3WVNA 4LJYA 2PA3A 1Y9ZA 2D0IA 2HJSA 4RZHA 3WGZA 4C6RA 2G1AA 4LJKA 1FYXA 1FU8A 4AC9A 1A2OA 4YX9A 1D2GA 2FW9A 2JFVA 5F3RA 2YFKA 4X90A 3PSHA 1PD0A 1I4EB 4UFNA 3V1MA 3O38A 2JRCA 1AV6A 1VLVA 5BT9A 1XYYA 3D3QA 3EZ2A 1XF9A 2O14A 3UHJA 2BEWB 1PNOA 1CZHA 1WEHA 2GEDA 2ZANA 3HPRA 2XT9A 4ZVNA 5A3QA 1A9PA 1XL1A 4JMLA 3GMSA 1Y5MA 2IH5A 4M7OA 1UBKS 2O2SA 1O94A 1JSXA 3MB5A 3O3NB 4KFRA 4WFJA 5EHIA 1NQTA 1QH8A 3MQFA 2GZ2A 1JJVA 2WUEA 3CUVA 1DVRA 1GVHA 1MN6A 4PZUA 1Z7GA 4QX6A 1S8NA 1M74A 1XP5A 1AXRA 3EQZA 2DPMA 3N2YA 1C80A 3PA6A 5I3ZA 1WZCA 1RI3A 2Y0DA 4L28A 3NW9A 5L3SA 3NJ4A 4C1BA 4UTRA 1SQ5A 4UARA 4IL5A 4EATA 1PBNA 3R6TA 3C3AA 1G8FA 4RV9A 3LW8A 4H18A 4V2IA 1AQJA 3QU7A 4ZQCB 4IIJA 4XGRA 4HZIA 3N2NA 3FWKA 1W2GA 4R8VA 3S81A 3KUXA 3VAZA 2LNDA 5LIPA 4KCGA 1T29A 2HADA 3PFHA 3O31A 2XTNA 3R9WA 1OX4A 4PLYA 1BS1A 2G6TA 2Q5HA 2H2HA 5LMCA 2JRLA 2NYVA 1H0RA 3GVIA 3IQXA 4NCNA 1DWOA 3TQCA 1RKQA 3FX2A 4NV1A 1U9IC 5MN6A 5EPOA 3EEFA 3BXXA 5DWVA 2N3ZA 2QG4A 4WK2B 5H1YA 5EKDA 5BSEA 3I62A 4LFBB 3G3EA 1QO0D 2WG0A 2QGFA 4ZO9A 3OTOB 5LZ7A 1MX1A 2BGNA 4BNJA 4JL5A 3VYRB 3QG5A 1VSBA 4PO1A 4EFLA 1IHYA 4QTYA 1A8SA 1E2EA 2UZAA 1XJ0A 1EM8A 2QB5A 3CNHA 2ODEA 2ZQYA 3DKIA 1SKBA 1WHSA 2O0HA 3GEMA 4WZBE 5REQB 3T5AA 2AN1A 4G0YA 3C7TA 3WGKA 1YCFA 1XD8A 2H2IA 4JNCA 1ADGA 1OQAA 2IHVA 2QP3A 4CQLA 1JBQA 4TVBA 4DCVA 4WJLA 5CB4A 1IXYA 1E1KA 3C5CA 4OGFA 2Z43A 1U5AA 2M6RA 2AEJA 5FX2A 1QO9A 3M6XA 4W5JA 5T4BA 4A10A 2Y05A 1BNCA 3CC8A 3M4ZA 4M9RA 4MUKA 4TPKA 5FBKA 5KQRA 2QZJA 5GZ1A 1ZZGA 1GUDA 2V58A 4C4RA 5KAMA 3D2CA 2I7TA 2J6CA 3AH8A 1P2SA 4TWJA 5DHTA 5JMTA 1YTLA 3ROKA 3QBEA 1IJBA 4Y2SA 3RUHA 1YQXA 4CF7A 2HH9A 1ZI8A 4AXBA 4URVR 1TECE 4MNTA 5TLSA 3OPVA 1HE8B 4B73A 4F2DA 2OV8A 4Z4QA 1BVHA 4WKOA 2LWIA 4R3WA 3K0AA 2GVZC 1KQOA 3BRSA 3JD3A 1Y3BE 2AN9A 1LF0A 2Z58A 4HXGA 3TB4A 1DB3A 5LM3A 3CS3A 1U3GA 3HSKA 4O4JB 4EGAA 2XCTB 4M0PA 1TEZA 1Z38A 3BZBA 1UWVA 1YFKA 3GAFA 4HCJA 1CYDA 5BORA 1RBYA 1V3UA 2I2DA 2G8LA 2R8OA 3K6KA 5B1YA 5B58C 6LDHA 1UBFA 1TYDE 2B4QA 5CFZA 2Y2UA 3RVOA 1ISFA 2OHVA 2GFIA 4MV0A 1QS0A 1R88A 2IE0A 1I4OA 1VGVA 3WNZA 1T8SA 2QQGA 2FWJA 3WLJA 4BPBA 1YASA 3G9ZA 2XYPA 3M1IA 2AB0A 3QE3A 1Z0ZA 4NFSA 4RUKA 4M87A 5IVDA 4JYBA 5IDYA 3SHOA 3FCOA 1IOZA 4PXYA 2ZSDA 2GJKA 3DMTA 4JGIA 3TSWA 4BWYA 2C5GA 3FTPA 4FYJA 1G3MA 2CL7X 3DD1A 3I8OA 5DX8A 2OEPA 3R5FA 1A9QA 1GPDG 3AY0A 5THKA 3DOJA 1KFBB 2E3JA 2H4JA 4PFQA 4DSUA 5BR1A 4CKZA 1KGDA 1WHTB 5TEVA 2F7SA 4MJ7A 2GZSA 4O1MA 3JVUA 3LIIA 4RQUA 5K4AA 1R5OA 1KO7A 3W04A 221PA 3VNVA 1KK2A 4ENQA 2AJBA 3HXMA 3C3DA 1VL1A 3C7DB 3P1JA 1G9SA 4DUPA 1JQDA 1L8OA 1F2DA 2HDHA 1NVXQ 2PT5A 2PXCA 4XVRA 5C32A 4RJKA 3WL5A 1EESA 1KJYA 1M2GA 2C84A 2FUEA 3GL9A 1TCVA 3OHMA 1AN9A 4UTVA 1PN3A 3HY3A 4MWBA 3DQQA 4BKRA 4EZIA 1B0UA 4J1SA 3W0LB 1AHPA 1YMVA 3KOYA 4OFWA 3I6ZA 1USUA 3LOPA 1X7WB 5AXBA 5DH9A 3F74A 4F0JA 1JRLA 2WA2A 4B3HA 4F9TA 4BFXA 2IHYA 3TX2A 4DC1A 3U37A 1ODCA 1X3LA 1BH6A 2I9PA 1Z4PX 3OQVA 5EMNA 1H2BA 4LBZA 4F2WA 4OX9B 1EIZA 4UZSA 4CMEC 4CLRB 2IDKA 1K06A 2JLXA 1PU2A 3AP2A 1E2KA 3VJLA 4NAHA 1TW3A 1WP9A 5D00A 3TH5A 3WV4A 3ZWMA 3RFVA 4B4UA 1IUNA 1P1RA 1YIAA 3LA8A 4PAMA 3JQCA 4PZDA 4OI2A 3ROPA 2EW1A 1L1FA 3AJAA 3AVWA 4LTMA 4BO5A 1WPQA 1PR0A 3P0FA 1Z0FA 2QBYB 3O4HA 1TUBA 1CEXA 2DF8A 5TF0A 2NV2B 3LXUX 1AQUA 1XCLA 2R6GA 4D8XA 3OCJA 1HYEA 2P35A 4EIWA 1G7SA 4CRWB 3GFSA 1B26A 5I7FA 1ULTA 3PQ7A 4OKNA 2B6HA 3A2MA 5AM5A 1D1SA 2X8JB 4Y1FA 5J5AA 4MROA 1CPYA 2YVLA 3REOA 3QPUA 2XD9A 4KXNA 4IEIA 4DEVA 1CIJA 1MRNA 1OPRA 5JNSA 3TECE 1YKGA 4GDFA 2P5SA 2VLIA 2ADMA 1CRWG 3IAM1 4LDRA 4Q4HB 2ZXUA 4I1YA 1V25A 4MUMA 3GRPA 2V98A 1PWYE 4HQLA 3ZE2B 3OFSA 4GMFA 2XLBA 1WE2A 2HU7A 3R3VA 2HRDA 2YXBA 1D4AA 2ID8A 4JL6A 5DULA 4WY2A 4EHAA 1E9CA 2X2OA 3WIBA 2IIBA 4M9CA 1F60A 4DLSA 3EX7C 3ZV7A 2QSUA 1F8FA 1B0ZA 1MJGA 3Q10A 3I9NA 1NN1A 4G3XA 3E9MA 4YASA 1LFDB 5AJTA 3D0QA 4H1UA 3TOSA 4ZICA 4YCSA 3RKRA 4DB2A 4V1CB 3O1HB 4ARBA 3G17A 5GVSA 2JI8A 1RIFA 4B3CA 2D5IA 1T2EA 4EELA 5C37A 4KZKA 1ZM2A 1MLDA 2X5NA 1G38A 1MAAA 3U9SA 4M76B </