3L8DA

Crystal structure of methyltransferase from bacillus thuringiensis
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
202
structure length
202
Chain Sequence
QEMWDSGSRSTIIPFFEQYVKKEAEVLDVGCGDGYGTYKLSRTGYKAVGVDISEVMIQKGKERGEGPDLSFIKGDLSSLPFENEQFEAIMAINSLEWTEEPLRALNEIKRVLKSDGYACIAILGPTAKPRENSYPRLYGKDVVCNTMMPWEFEQLVKEQGFKVVDGIGVYKRGVNEKMLGQLSTDLQQSLTFLWVFMLKRHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase
publication title Crystal structure of methyltransferase from Bacillus Thuringiensis
rcsb
source organism Bacillus thuringiensis
molecule tags Transferase
total genus 63
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2009-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3l8dA00
1JTFA 1XJ5A 2Y1XA 3DMFA 4QQKA 5ICCA 3CGGA 2DULA 3MQ2A 3G2QA 3SXJA 2XYQA 1OR8A 1M6EX 5CVVA 1WS6A 2GA9A 3GO4A 3FUVA 5DTRA 3TLJA 3UZUA 3T7TA 5KVAA 2HWKA 1G60A 1NV8A 3NVKI 1EG2A 3FTFA 1Z3CA 3LGAA 3H2BA 4BY9E 5E1OA 3G89A 3WSTA 3LL7A 4OQDA 1P39A 4NECA 3UJ6A 2JH9A 5T67A 4U7TB 2AOTA 3E23A 3V97A 3PFHA 1KYZA 3EVAA 3B3JA 4GOOD 5EMKA 3KU1A 1RI5A 1YZHA 2NNWB 3Q87B 5DRTA 5EHIA 5F2KA 4YMHA 4RTMA 2AOUB 4BLWA 4JXJA 1NW3A 2QRVA 2BZGA 3MGGA 2NXCA 3TKAA 1VBFA 1G8SA 4RVFA 2JHPA 3FTEA 4RVHA 5E1MA 2PXXA 5LSAA 3C3YA 3REOA 4E31A 3KQMA 2ZCJA 4LECA 1SQGA 5E8JA 3D2LA 1ZKDA 1ZGJA 3DMHA 3FRIA 1JQEA 1YZ3A 3LKDA 2E5WA 4QQNA 2LD4A 4X60A 5C9ZA 5GINE 2CMGA 3GJYA 2GPYA 1R18A 2Z6QA 1VQ1A 3FUTA 1SVUA 2XYVA 3SSNA 2XVMA 2C7OA 3HP7A 3NMUF 3HA5A 4R6WA 1N7IA 5FCDA 5GOZA 5EMJA 1L9KA 1RI2A 5DM0A 3P8ZA 1RI3A 2O07A 3FUXA 4LWOA 3NVMB 1QYRA 4IV0A 4E33A 5K0NA 1F38A 2QM3A 3P2IA 2WK1A 3F4KA 4P58A 1EJ0A 4F85A 1G38A 3IYLW 3CCFA 2IH4A 3HTXA 1JR4A 1JQDA 4BP1A 3EVCA 3OZTA 1RJGA 2FCAA 4OA5A 1JG1A 4AZVA 2EX4A 2P40A 3DLCA 2NXNA 3P2EA 2EFJA 3PX2A 2YXLA 5E8RA 5GM1A 5JR3A 1JG3A 2AN3A 4OBXA 4BLVA 2I7CA 4FSDA 4DCGA 3DTNA 1RI4A 1X1CA 1EJ6A 5EGSA 5E2AA 4UOEA 2GS9A 1QZZA 1VP3A 3LPMA 3SMQA 3MHTA 1YUBA 3SX0A 4E2XA 2B78A 4P7GA 5LQRA 3PTAA 2UYCA 2G72A 5F2NA 4CXMA 1SQFA 4AZTA 3PVCA 4M7RA 5LR6A 2N47A 2PXCA 4EK9A 2QE6A 3GCZA 5EEHA 3TMAA 4CTKA 3PLAE 3T7SA 4LG1A 4XUCA 3CBGA 4PYNA 4RVDA 1KXZA 4R8RA 1SKMA 2CL5A 3KQPA 10MHA 1BKYA 1WXXA 3K0BA 4E2YA 4F86A 1ZG3A 5D1NA 3DR5A 5ICFA 4ER5A 3KQWA 3EGIA 2O0LA 1Q0TA 1HNNA 4PIPA 1XTPA 3BUSA 5E1BA 4ER7A 5K0EA 5LQAA 3G2PA 3EMDA 1FP1D 1X1BA 3CJTA 5B1SA 2HTEA 4KDCA 4PGHA 3DP7A 4RSRA 4C06A 4DF3A 5HZMA 5T6BA 3ME5A 4C07A 1AQJA 5GP1A 2O06A 3BWCA 5HEKA 1YFJA 5EMMA 3UFBA 5ICGA 5EKXA 1EQAA 1KYWA 3EVBA 3M6VA 3MCTA 5EC8A 5EPEA 3UJ9A 5K8VA 5CCXA 4RTPA 5DXJA 3OZRA 2JG3A 5DT2A 4U7PB 3BT7A 2YVLA 3OCJA 2C7PA 3HCAA 4DMGA 8MHTA 3NW9A 4DZRA 3KR0A 3M33A 3HCFA 3TR6A 1NW8A 3BZBA 2DPMA 5FTWA 3KR9A 2P35A 3I9FA 3VSEA 1PRYA 4E2ZA 2ZVJA 1NE2A 3KPUA 3P9NA 5K03A 3GXOA 4DKJA 2ADMA 2O05A 1JG2A 1XCLA 1P1BA 5FUBA 3SSOA 3SVZA 5ICEA 1VP9A 1BOOA 1JTEA 4AUKA 1DCTA 4EKIA 3R24A 1KHHA 2JH8A 4B17A 5DM4A 1ZHFA 3UA3A 3FUWA 2KW5A 3R9XB 2BM9A 3ELUA 1NBIA 3L8DA 1R6AA 2ZULA 3C0KA 5IH3A 3LDGA 5BXYA 5K09A 4RTRA 3GGDA 2YR0A 2AS0A 2ERCA 5KYGA 5EG5A 3A4TA 2FPOA 3KQSA 3OZSA 2PT9A 2XBMA 4RTKA 3KQTA 4C04A 5BW4A 2AZTA 3EGEA 2G1PA 4OQEA 5EMLA 1AV6A 2PY6A 1WZNA 2JHCA 2VDUE 4ISCA 2PV0A 4MQ4A 2NXEA 2FK8A 1P91A 2AR0A 3FTCA 3OPNA 3PFGA 4FP9A 1L1EA 3OU6A 3MB5A 3C6KA 1X1DA 3U81A 4AZSA 4YMGA 3I64A 5DSTA 3BGVA 2PSSA 5FHQA 1R74A 2IPXA 2QYOA 3LECA 2H00A 3LBYA 1IY9A 4QDJA 3TQSA 2NP6A 3MTIA 3JWHA 2R6ZA 5CIYA 2IBTA 2ZIFA 5HOQA 5EOVA 1EIZA 3G2OA 3CJRA 4GOMD 4RTQA 2ZZNA 1JSZA 2EJTA 3P9KA 5HFJA 1RI1A 3K6RA 5E9JA 1R00A 1YB2A 4HRAA 3ERCA 3GIWA 2HNKA 3HVHA 3B3GA 5E9QA 2WA1A 1XDSA 4O29A 3B7PA 3HCDA 5GIOE 5LQJA 4PONA 1QANA 2PX5A 4PINA 4Y2HA 2OYRA 1Q0SA 4RV9A 3MTEA 3BKWA 4KIFA 4RX1A 4HH4A 1WY7A 3BKXA 5EKUA 5LQKA 3I58A 3BGDA 2PVCA 2ZZKA 2AVDA 5FA8A 4KVZA 4E30A 5HILA 3HM2A 4YUZA 3TFWA 2ZBRA 2JHAA 2ESRA 1I9GA 3C6MA 3MCZA 4KDRA 4GF5A 4QVKA 4QTUB 1V39A 2Q41A 2YQZA 2ZSUA 3E05A 3FPFA 5CVEA 3HEMA 3UBTA 3GRVA 3UJDA 1KPIA 5DSXA 3FYCA 1F3LA 5K0BA 3P71T 4AX8A 2A14A 3A7DA 4GC9A 3UJ8A 4QTTB 1VPTA 5KQRA 5H02A 4GOLD 3GRUA 4KIGA 3UA4A 2OXTA 3TPZA 2IH5A 3OU2A 4YUXA 4Y30A 4FSXA 3NTVA 4XCXA 4YUVA 3HA7A 5K0FA 1TPYA 4WXHA 5HIKA 9MHTA 4PYKA 4HC4A 5ERGB 2IP2A 3I5UA 1VIDA 1ORHA 1MJFA 2IDJA 5GM2A 4POOA 1DL5A 5EIWA 3TOSA 4YUYA 1FJXA 1JQ3A 3LDUA 3GDHA 3NWBA 3ID6C 5CVDA 4A6EA 4M38A 1QAOA 4ER6A 4OA8A 5EQJB 2I9KA 3SM3A 3R3HA 5E2BA 5K0JA 4MHTA 1BHJA 2WA2A 3P2KA 4R8SA 5FULA 1QAQA 3LCUA 4ZTBA 3M4XA 1X19A 4Z2YA 3C3PA 3FPJA 4V0QA 2EJUA 3HCBA 1IXKA 3G5LA 5T64A 4RTNA 3FTDA 2H1RA 1I1NA 2FHPA 4X1OA 4X41A 2FYTA 2HV9A 3AWIA 2JJQA 3DH0A 3CJQA 5CVUA 1XXLA 5DPMA 3M6WA 3RW9A 4BP3A 5CVJA 4ER0A 4RTOA 1R8YA 4FR0A 1XDUA 2V74B 2ZIGA 4HGZA 3NJRA 2B3TA 2FRXA 4X61A 2AN4A 5BW5A 2PLWA 3BWMA 3KQQA 4RWZA 1WG8A 4E2WA 3O4FA 3DOUA 5U4XA 4PYQA 1G55A 4RTLA 5K01A 5EEGA 1D2HA 1R8XA 3JWJA 4P7KA 2OBFA 1JSXA 3T0IA 4IWNA 1WXWA 3TRKA 3LBFA 3HVKA 1VLMA 3KPWA 4R6XA 1FP2A 1NW5A 1L3BA 2ZLBA 3TM5A 4QPPA 3DXZA 5IKMA 5DX0A 4EKGA 3M6UA 4GUAA 4QVGA 4FGZA 4PWYA 3X0DA 3DULA 2GAFA 4HTFB 5K0GA 4PYMA 2PGXA 2VP3A 4FZVA 1EAMA 3R6TA 3B89A 3DXXA 3GU3A 1XVAA 3ELWA 3A7EA 3EPPA 3LX6A 3LCVB 5GWXA 4C08A 2Z6AA 1FPQA 3KPVA 3S68A 3MERA 2VDVE 5BP7A 1HMYA 4GBED 3UJ7A 3CC8A 3O31A 3A27A 1N2XA 2P7IA 3PS9A 1VE3A 4EMSA 3GRZA 3O7WA 1SG9A 3EVEA 3FPEA 1T43A 2B9EA 2ZWVA 4GEKA 4XUDA 1INLA 1B42A 1L3IA 2PX8A 3AXTA 1O54A 3B3FA 2AVNA 2P3LA 5F2OA 5C0OE 1YFLA 2G70A 2IFTA 2P41A 4KWCA 2ZZMA 3I53A 3UWPA 1ZGAA 4FT4A 4CWAA 1Y8CA 1H1DA 1SUSA 2UYHA 5DTMA 1UWVA 4PCAA 2IDKA 3VC1A 2UZ4A 2G8NA 4C4AA 5K0LA 1AQIA 1NW7A 2CWWA 2Y1WA 3KKZA 3MAGA 2AOTB 4K6MA 5DWQA 2B25A 5DLYA 4KRGA 1M0EA 3ER8A 3KQYA 1MHTA 1KPHA 4KW7A 3KR1A 2QRVB 4QDKA 3THRA 1NT2A 5EVJA 4A6DA 2CKDA 3IEIA 4PNEA 3QOXA 4PYIA 5K05A 2ZTHA 2YTZA 3EVDA 2ZFUA 2C7RA 1I4WA 3DLIA 3HVJA 3Q7EA 2B2CA 3PT9A 2Z6UA 3ANXA 5DM2A 1G8AA 4YUWA 3A26A 5G02A 5C1IA 2PWPA 4HSGA 5FWDA 2H11A 4HGYA 3TM4A 1RJEA 1O9HA 5EZSA 3UJBA 3IV6A 2PT6A 3NDJA 4E32A 5MHTA 1JG4A 3KQOA 2P3OA 5DXAA 5EZQA 2BR3A 2ZIEA 1QAMA 1SUIA 3FPHA 1UFKA 3DUWA 4X63A 1NV9A 4YV1A 3G2MA 3HVIA 2PJDA 4ATNA 4BLUA 2OY0A 3LKZA 5M5BA 1D2GA 4RVGA 2YX1A 4RTJA 3AJDA 4MIKA 4GC5A 2AOUA 2VS1A 2P7HA 3IHTA 1TW3A 4E70A 3V8VA 4F84A 4OX9Y 3DXYA 2EG5A 4FT2A 3KPYA 1KPGA 2P1DA 2V7EA 3EEOA 3E8SA 2AOWA 2F8LA 1VL5A 3ELYA 3P9IA 1FBNA 3RODA 5FQOA 5HIIA 5E1DA 3FPGA 1KIAA 3EVZA 4FS8A 4CTJA 3AXSA 3LHDA 5KQSA 2BR4A 3JWGA 2IGTA 3G7UA 3OFKA 2PBFA 3QV2A 2UYQA 1KR5A 5HIJA 1G6Q1 2VZ9A 2ONZA 3NWEA 5CD1A 2IH2A 4G56A 3HCCA 4GOND 3UJCA 4H0NA 3FZGA 3QOWA 1UIRA 3M70A 3M6XA 4PIMA 4PCLA 4DA4A 2I6GA 7MHTA 1NBHA 1KP9A 4C03A 1O9GA 1RJDA 3EMBA 4PGGA 2AOVA 1NW6A 2ZBPA 2ZBQA 4PYOA 5EIFA 3JWIA 3T7RA 5DM1A 2IBSA 4AZWA 3EVGA 1AF7A 4PYLA 4DM3A 2ORED 3LDFA 3BXOA 2NYUA 4GQBA 5EHGA 5CCBA 4IV8A 1DUSA 3KPJA 3EEYA 3OU7A 3FUUA 4WVLA 1NKVA 2GLUA 2AOXA 4P7JA 3B5IA 4CKEA 2I62A 2OB2A 4P7FA 2GH1A 2BR5A 2HR1A 2BH2A 3OE4A 3VYWA 2R3SA 5LQUA 3HNRA 5FWAA 4YV2A 1IM8A 5LQCA 3DMGA 1RJFA 3FYDA 2BM8A 4L7VA 3PB3A 3SR4A 1YF3A 3GRRA 2XVAA 2OO3A 3G8BA 3KR2A 2PKWA 2G71A 2OKCA 2VDWA 2PXAA 2K4MA 3EGVA 2P8JA 4IKPA 2FK7A 4ER3A 5FHRA 3RIEA 4DCMA 5FQNA 5HIMA 1ZQ9A 3LSTA 4YV0A 2GB4A 1BC5A 3CVOA 5GIPE 4PYJA 4RYLA 3P9CA 2NP7A 5DX1A 2YXDA 3BWYA 2C7QA 3P97A 3HCEA 1U2ZA 4V0RA 3CKKA 2P3QA 4EQZA 4RTSA 4C05A 1XCJA 3THSA 5K0CA 5KS2A 3SGLA 3KHKA 4LWPA 3OE5A 2IIPA 1ORIA 2ONYA 5E9WA 2YUIA 2CMHA 2ZWAA 4CKCA 2OZVA 5FA5A 2QY6A 5DTQA 3ELDA 5LQNA 3AY0A 2UYOA 4OBWA 4M37A 2AN5A 2OB1A 3BGIA 5P8WA 4QPNA 3SSMA 3G5TA 4EVIA 3G88A 2NXJA 1M6YA 2PX4A 3LCCA 5D1HA 5FADA 3NDIA 3KQVA 4HTFA 4MWZA 4R05A 4XUEA 3R0QA 3PX3A 3A25A 3GRYA 4MTLA 3BWBA 2ZW9A 3E7PA 3VC2A 5CUQA 3ER9A 3FRHA 5JUWA 1XDZA 5CM2Z 2PWYA 4CKBA 2HMYB 2YXEA 5DX8A 1P1CA 3TKYA 3EVFA 2XYRA 3ORHA 3GWZA 4DQ0A 3UJAA 3OFJA 2OPBA 4M36A 3G8AA 1X1AA 3GNLA 1TW2A 3HA3A 1D2CA 1PJZA 4HG2A 1L3CA 2PX2A 5DRYA 1N7JA 2O57A
chains in the Genus database with same CATH superfamily
3KO8A 4FE7A 1KEUA 3RNOA 4ZYYA 4D02A 3T52A 1DCFA 3ETEA 1RACA 5CFNA 2HN9A 3TLJA 3USCS 5IT0A 4LNUB 3J81k 2C95A 4KO2S 1C3OA 5IW8A 3OTWA 5BVGA 4QAJA 5FBWB 3DBOB 3O1JC 3PPVA 3TBHA 4D9JA 1DBQA 2A4KA 2Q0QA 3U3XA 2MYUA 3EZGA 3KJHA 3LGAA 2V3WA 3CURA 3TTUA 4XSVA 5JG7A 2I2FA 3HYCA 3KP1A 1KYZA 1P2UA 4PY2A 4BCBA 3ROKA 3EZ6A 1XMVA 1RI5A 1YZHA 2BTQB 4YRGA 1XRMA 1P6QA 4RPHA 2IW3A 4XX0A 2WJAA 3WBJA 1KBZA 2J87A 3UMYA 2D74A 1NW3A 2XDWA 3HA2A 1HT1E 1W4AA 2NT4A 3PXBA 4XGRA 2I2AA 3KQHA 3VGJA 1G5PA 4G4SO 5FBHA 4YP9A 1DLIA 5LDGA 1I80A 2DY0A 3ROFA 1NLYA 3D6MA 4X64B 4D46A 3F74A 4OHVA 1UXKA 3D2LA 4X0EA 3PICA 3BL6A 1QPBA 2OLJA 5GINE 3UCXA 2CJYA 4EMUA 2JD1A 2OHOA 3D31A 4KRFA 1XA0A 1U04A 4IX1A 3RSGA 4BGUA 1V35A 1UIMA 2EKPA 1DBWA 2VQSA 3FKSD 5KQGA 4GNKA 1HA3A 3NC0C 1T35A 1E4VA 4RS3A 1IM2A 3QBDA 3ZCRA 1CB7A 4X7PA 4L4SA 2Z43A 1QYRA 1GARA 1IVYA 2ZI6A 1JNYA 1UFQA 5JASA 1TZKA 3F4KA 1FDVA 4PCUA 4IDDA 5LYJA 1BKDR 3AQ4A 1GRRA 3GJRA 3RC9A 4YXWD 2W6IA 1HDRA 1KJ9A 2EL7A 2EWWA 4J90A 1FLAA 4Z1OA 5HJ5A 2XAAA 1RJGA 3GYGA 1ULHA 2OP1A 4FQ8A 4IIVA 4Q4JB 5CXSA 1ZCAA 4R1QA 4XFKA 4EJSB 4NAHA 3ASZA 2GT1A 2JZOA 3CONA 1MBZA 5CR9A 4B43A 4DCGA 2Q5JA 4H31A 2O3RA 1BWQA 1EX6A 2P2SA 3W5VA 4XE5A 3A3YA 3DJFA 4AYXA 3WGHA 1U0GA 3KT3A 2YXNA 4H7KA 3QRWA 3JD0A 2C5EA 1MB0A 2UDPA 1QVAA 2ZE7A 4HVCA 4XM1A 3V2GA 2DPLA 3EBLA 1Z6PA 2D3WA 1Z7BA 3DBHA 3MRTA 4QGHA 5IJAA 4YWHA 4N47A 3WAKA 3F47A 3TF5A 4IDBA 2HHHB 2Q1SA 1WP4A 1L4NA 1ZR4A 1SKMA 1ZGCA 1OHHA 2PR2A 1NRXA 1YT5A 4RPJA 4ESHA 3VU9B 1WXXA 3KQKA 2DHCA 1HKHA 3BCRA 2QTRA 3RWOA 2G1AA 3TTTA 3QFCA 3V1NA 4WESA 5FAXA 5DHFA 3CGWA 4JI2B 5K3EA 3CWZA 3ZCPA 3BF8A 3LX8A 4RIHA 1UMCA 3DMNA 2UUOA 4GXRA 4NDZA 3WS7A 3NKLA 5B55A 5C7YA 7YASA 4EYGA 4NFYA 5AJTA 1UT6A 1VG1A 2OL4A 3FPKA 4NCHA 5IM4A 5SY6A 5EMMA 3V33A 4IOKA 3UMSA 1U5CA 5EKXA 2VPTA 4TN5A 5LB4A 5EC8A 3DR3A 5IVDA 2V54A 1PT8A 1EP3B 4HUTA 3OCJA 2MSLA 3KWFA 4JI0B 2J0SA 1CRQA 3KR0A 1WL8A 1QP7A 1EH5A 2Q5FA 4MV6A 4KO1S 1Z25A 2QR3A 1IWOA 4W8GA 5I4CA 2OCPA 1ADYA 4IZHA 2NZYA 5T8KC 1EXDA 1KMCA 4L50A 5ALIA 4GPAA 5B7PA 5IG2A 1IC6A 1VPDA 3ZHBA 2GPJA 4W1QA 3D8TA 3N75A 4XIJA 2MYTA 4HO1X 4EITA 1BVHA 2NSHA 3GLHE 3NEYA 4AKIA 1VHQA 3BTSA 3D8NA 5COBA 2XSZA 4TS9A 5BN3A 4LF4B 5EIOA 1OPRA 3AKDA 4FKBA 1EVZA 4XGQA 2JH8A 1YTLA 2C92A 1NFFA 2OPHA 3LVFO 1RFGE 4ENWA 3R9XB 2BM9A 3BDVA 4E07A 1VXRA 1C29B 2WTMA 3GRAA 3LDGA 3QUCA 4N6OA 4UATA 4DE5A 4URUR 3COZA 1P5JA 3A3OA 3I05A 2AS0A 3FSEA 1EWTA 3F7OA 3LWZA 1M1ZA 4MRSA 4OSEA 2XHZA 1OB2A 4KNYA 2X3YA 1WPXA 1DCKA 2A30A 3GFOA 2ZJAA 5IAKA 1N75A 3VRHA 2FA9A 3S44A 1JZQA 4G67A 2OUIA 4KXXA 3SLKA 5FWYA 1DWOA 3ZWKA 4KACA 3H3XA 4O3MA 2ZSDA 4B4WA 4BVKA 1GYRA 2H29A 1HYHA 3O3OB 4K46A 2XGJA 3EY9A 1BE6A 1B8NA 3WK5A 4YMGA 4A92A 3HXMA 5K20A 1RU3A 3UK1A 5CX4A 3Q98A 4R7GA 2GCNA 3K0AB 4L22A 2AR7A 1MC1A 4XGKA 1L7MA 3MB8A 1NVXQ 1IY0A 2F1IA 2HZ7A 3E61A 4L5CA 3PRKE 3VYUB 4A5SA 3ICQB 1W6UA 3L7KA 1FX0A 2KPOA 5CW1A 4ZVRA 5BYKA 1OGYA 5C8XA 5ALFA 5IZCC 1ZUIA 2WINI 4YUAA 3CW8X 4BPBA 3WMEA 1NF9A 4TLBA 3F7NA 2J8ZA 2V7VA 4BATA 3PQDA 4AQDA 1PIWA 1B0PA 2ZRLA 1D2EA 3AUTA 3EXFA 1ZICA 4LISA 3G7SA 4PZPA 1AZSC 1CR0A 1SKQA 3TTYA 1RMYA 3AU9A 5HFAA 1IBLB 3P9PA 5G1OA 4H2DA 1PFQA 1Z0JA 2VDLB 3MUNA 2E5LB 2FPLA 5A2QA 4ZO8A 3H8SA 4IRUB 5JS6A 4KMOA 1FTQA 2VJLA 4OTZA 3T1VA 1QC5A 4R5HA 4TS4A 1GPMA 4OAOA 4INOA 3WJ1A 3U4MA 2HF9A 1QCYA 1WUTA 2XUKA 3PSAA 2CMKA 4FU0A 4AU1A 4PG8A 1VPTA 4I5GA 4TQ9A 1QV6A 1YCGA 1VRCA 4JOSA 3GRUA 4MP8A 5EXTA 4HMOA 2P9BA 3A0RB 1PHRA 1FNBA 2EFCB 1HDGO 1QX4A 2GBGA 3OJXA 3LUGA 4FGJA 2CFIA 2V6FA 3N2IA 5G40A 3NWJA 2IDJA 2M1XA 3QHPA 1YC5A 3KJZA 1U3GA 3TOSA 2A9JA 2HSZA 2SCUB 3LNTA 1NZJA 1CZKA 3KVYA 4G9GA 1RQLA 4BNDA 2DJ5A 2ZI3A 3KJFA 4IEIA 4JYBA 2I67A 3LYUA 2DQYA 3RAFC 3QA3E 1KMHB 3P9ZA 4R8VA 5E4TA 5FI0B 3V9AA 3QTTA 3SFTA 2G4LA 3DFZA 3R3YA 4WLUA 5CYPA 2OXIA 4UNNA 1TF5A 4B6JA 3QBEA 4BX9A 4Z51A 1P0FA 1Q0UA 4YASA 4QFBA 1GNSA 4MUNA 5DU2A 3GBPA 5IRCD 2WUGA 3N8IA 1CY4A 2NWQA 3Q15C 4I1OA 2FYTA 4LCBA 4X41A 3RG2A 4IHJF 4DANA 5B2FA 3ORSA 3PWSA 2WB4A 1J39A 3PRYA 1V1JA 4HGZA 1AS2A 1Y3AA 1P5ZB 3JCZA 5IBCA 3BL8A 3P2YA 4I5FA 1NKSA 2ZK7A 4HVLA 3LOQA 5KVQA 3JSXA 4RHTA 3WYDA 1A3CA 2GEFA 2XZTA 1N2CA 2HCTA 3BGWA 1DJPA 3GJXC 3TNFA 1XPUA 1JR2A 1QU3A 4NC9A 2E85A 2YQ4A 4IJ5A 4OP2A 3C3DA 2XKBA 4TL6A 1VA5A 3V55A 3CH6A 3CVJA 2CF6A 2HYDA 2IYFA 4XAQA 4DNFA 4LYAA 3RC7A 4QPPA 4BKQA 2QDXA 2WU0A 1V7QA 4FGZA 4PWYA 2GN9A 3HB0A 3FPSA 2W8BA 5EJMA 1SUBA 2VUUA 5JZBA 4ZZIA 2KLBA 4G4IA 1ZH2A 5IDVA 1HSZA 3G9ZA 2IDZA 3IKMB 4MYDA 5BP7A 2NV6A 5BQPA 5AVTA 2IHJA 4UEOA 3RJ9A 4BMZA 2OQVA 1J2EA 1Y3FE 4A16A 4C5CA 4HHEA 4XWYA 3Q5GA 1F06A 4RLFA 4NZMA 1T1SA 3BHMA 2QS9A 2ZDQA 3Q88A 5HJ7A 1UR5A 2XMDA 1V41E 2G09A 3AXTA 4ENSA 4LMBA 1DHRA 5C0OE 3Q3IA 2WWWA 2HEGA 3VNUA 5A9TA 4GBJA 5TGZA 3F3MA 2YHBA 4QOSA 3K1ZA 3ICWA 5DTMA 3IDFA 4GM1A 1U8UA 3RGGA 3UWOA 3UMGA 3TB4A 1TPZA 1U8TA 4JP8A 3IAM1 1E7SA 4Z7JA 5JNSA 3AM1A 4ND7A 1AQIA 4HB4A 4QARA 1Y1KE 1JH9A 2Y1WA 1T25A 5F1OA 2BMFA 4P4LA 2BV3A 1S1CA 2HPAA 3DE7X 5JROA 1T36B 2QNBA 2ZDHA 2E0IA 2RMKA 1U8CB 1T1JA 2X5KO 1NT2A 2GXSA 2HIHA 5E4FA 2QUIA 4RPCA 1LWOA 4ZIRA 3FCYA 1DRUA 1GRVA 2YTZA 4R8LA 4YRNA 2KHZA 3OOEA 3O1IC 1XAIA 1C7FA 1Z6TA 1FS6A 2CK3A 3ZGYA 3I45A 4FOPA 5AOAA 5IJ9B 2NUTB 2ZSKA 4PHHA 3U7IA 2XY4A 3RRYA 1K89A 1XF9A 5DISB 2I3DA 1M34B 3AJEA 5KBYA 5AP9A 1KRHA 3CLUC 3U4HA 2PT6A 3EYWA 3B1JA 4M8NE 3ZVLA 2P3OA 3W8EA 2P5YA 4G26A 1NPDA 3NATA 3LY9A 4CHTA 2D6FA 4ZI7B 4I6JA 1GGHA 2JJ2A 1ZKMA 4U9HS 4O2AB 3AFNA 3O2QB 3D6VA 1RIIA 2YZNA 5JCJA 1RE1A 3QVLA 4D6XA 3KG2A 1N6LA 1R16A 3ER6A 3MWFA 5DTIA 3PTLA 3SP1A 3TTXA 1XLUA 3LLMA 5ITSA 3CF4G 3BIXA 3F6YA 4WOJA 5K6TA 2Y68A 4H15A 1ZJ4A 2H7VA 2ODBA 3C3XA 2R60A 3H11B 3IBSA 2HLDA 2IPLA 1NF3A 2ZKIA 1M83A 4OK3A 1CVLA 1I2AA 1K0UA 3PPYA 3MJCA 1A95A 4OQZA 5JRJA 4D9NA 3AOEA 4LY6A 1KL7A 4UNQA 4CTJA 2E1RA 3A1CA 1W5FA 5KQSA 1GNVA 3QOFA 1EHYA 1W9MA 1T3HA 3QV2A 3A2LA 5FV4A 2VP5A 4GGPA 4RZ2A 1GCIA 2R48A 5AI5A 4ETMA 1Q50A 4AF8A 1QG6A 4H7PA 4BMDA 3M70A 3R4VA 4XYLA 1A2BA 1EMDA 3KAQA 3IKVA 1L5VA 1CP3A 1XV5A 1CDDA 3LCMA 4NZNA 1FJ2A 4JT9A 4TLCA 2FQQA 3U3OA 1CR1A 2ZI7A 3ZR4B 3EEQA 1V6AA 3AJ9A 4NH0A 2J07A 5B58T 2RGCA 2J08A 1OV6A 1W46A 4YVFA 1MU0A 4TLEA 2VSQA 4UFOA 2H2FA 1UKZA 1EUDB 4ZQHA 1IQ0A 1DFGA 2QL5A 2OAEA 1A8HA 3T1HB 1TGYA 2HD4A 3HR8A 4CKEA 2QRHA 3AK4A 4C0KA 4Q7EA 2AD5A 2QW8A 1CJTC 4F5WA 3AUFA 1PLJA 1UBCA 3R0VA 3WNBA 3VJMA 5LQUA 4GPTA 3CLVA 4H6VA 2RD2A 2JCYA 4MGHA 3RUCA 3HH8A 4DAEA 3EDCA 1JVBA 1SHJA 2SKDA 1XO1A 1ZEMA 1XZMA 3SR4A 5IFLA 3EGXA 2EBWA 4YJHA 2B8JA 3KWJA 3YASA 1HZJA 4W7SA 5L7TA 4PIVA 1P3JA 3NHKA 3IT0A 5JJBA 2Q0HA 3A9SA 3IPLA 4OH7A 4U4AA 2P62A 5BNZA 2O7NA 2NU8B 1T9ZA 2IEZA 1D6SA 4DJFC 1T6XA 3H13A 3SHQA 4RK0A 4BKPA 2HKIA 2D5AA 3ZV7A 5JSYA 3OX3A 3STHA 3H18A 4EVQA 2IP1A 1Y8QA 3SHFA 5GIPE 3L6CA 1WMDA 1MEEA 1OZFA 2W0SA 3AJ8A 2FE1A 3BIOA 5A7FA 4V1CI 4RSHA 2D4AA 5D3ZA 1Y5LA 5LKAA 5KS2A 1TTPB 5CGQB 3VXKA 4ODIA 1K6EA 4D26A 2FN4A 4PZAA 4BBAA 3FWHA 1NMXA 1YHZA 1A5BB 1Q1ZA 2INGX 1MAWA 2XB6A 4MW4A 5E7QA 1P74A 4F71A 1ABEA 4IRMA 2B99A 1JEJA 4JLPA 4C0XA 5EMHA 2GILA 2QMUA 5F52A 5P8WA 4EVIA 2PLNA 1PV4A 4LXIA 2OLKA 5D1HA 5FADA 2ZOSA 2ERXA 4UARA 2XDAA 1H69A 4QPDA 1ZJWA 4MQBA 4EL0A 1E3JA 4JVMA 2OMKA 3I9LA 5AOVA 2ZE6A 3E7PA 4TTAA 1J1IA 4OCZA 5EWJB 6ABPA 2WOJA 2LR0A 2CL0X 5CM2Z 1RKBA 2X8JB 2HMYB 3PQ8A 4P3NA 4DRXA 4PHFA 4CN9A 3CLUD 1GSHA 2MT9A 2VAMA 3AFMA 3EJWA 3RS2A 5A6SB 1UFOA 3EPHA 2Z2JA 2PAAA 4QREA 2QTGA 4CKWA 4HGRA 3THOA 4HG2A 4DWVA 5AT1A 1Y37A 5ICCA 1C7ZA 3EW9A 1G5HA 3MZ0A 4H4DA 4XEHA 5JALA 2OHGA 2VK4A 5IDWA 1Z7YA 2WJ4A 3A6ZA 3JZMA 4W5OA 2YVAA 3UAYA 4JI8B 1Z68A 2FB9A 3P94A 4Y18A 4OLFA 2G0TA 3ECSA 1CUHA 2FDXA 4BN0A 2ZJ2A 1VFNA 1AN0A 1X8KA 4Y2RA 2PWBA 3NGMA 1IHYA 4MS4A 1EFVA 3JASB 1YI1A 1RZRD 5MDHA 1NG9A 2PUHA 5ETJA 3F5DA 2VXBA 1E69A 3IAEA 4FWTA 2GCIA 2ILTA 4GSKA 4DN6A 4DA7A 3LZDA 5KAPA 1Z47A 1GZ5A 3AEUA 3C8HA 5A5VA 4ZZ3A 2H1IA 4MDEA 4LXXA 1AGPA 5EHIA 2WHEA 4X90A 4DTCA 3M6IA 1TAGA 1T4DA 2V5UA 2EVWX 1NHWA 3IXLA 4OHCA 4Q1BA 4ZJPA 3P0HA 4LHVA 3DVQX 5EWLA 4MYCA 4ZVLA 5FFNA 4ZU6X 1K8ZB 2G1JA 4EY7A 1ECLA 1G8GA 1SQGA 2NACA 2OQIA 2GEDA 3NV9A 1NR7A 3DQZA 5JYBA 3A4VA 3ZI7A 4YQFA 2R8XA 4X24A 3FCOA 3L1UA 4A3SA 5JSKA 3FVTA 3WA6A 3EJ6A 5FPPA 4MUMA 3ESCA 3MSXA 3NIWA 4XLLA 5AK3A 8ATCA 4K7JA 1YQWA 5AK6A 3CVVA 3O82A 1QYIA 1O6ZA 4UNIA 4A1FA 2A92A 4RZSA 3PXGA 2F48A 1X6VA 3EPLA 5DT9A 2D3TA 3DV0B 3KB2A 4YIKA 3ZW9A 4E33A 4F85A 1NVBA 2QM3A 2WK1A 3EF3A 1P1HA 1Y3DE 4HRYA 1EK5A 1CYDA 4GQIA 5L3RA 3T1QA 3U7QB 5AM2A 4JNKA 1HETA 3GZJA 4BP1A 1XCBA 3ZLUA 1RSZA 1G7CA 4OA5A 3OZWA 4QOFA 2Q1TA 4MHOA 1CQJA 4WINA 5JJCA 2WAMA 5SYNA 3PX2A 1TCAA 3GPBA 3HMQA 2SNIE 2GK4A 3M2TA 5F4BA 5A9SB 3IEKA 1RWWA 1VCHA 1G63A 1E2LA 2DX7A 1IY2A 1ICIA 2QG9A 1IB6A 2C2HA 3I83A 4ME6A 3OQBA 5E2AA 1AK9A 5SY4A 4BQIA 4UEJA 1A1VA 5LQRA 3TZKA 4RV4A 1ADJA 2HQSA 4N01A 4YCBA 5LR6A 3A11A 1WMBA 1Q91A 1ZRMA 5EEHA 1I3CA 1ZDMA 5L7WA 4KSYA 2B1RA 4RIIA 3VBEA 5IKOA 3CBGA 4BFYA 5EJEA 1ESNA 3BRWA 1AOXA 4YJFA 2PRZA 5DCUA 4HZGA 1H8ED 1KYTA 2IX9A 1XZKA 5L7YA 4F86A 2W6ID 5JCOA 1LU9A 2XHEA 3RTCA 1KC3A 1P3Y1 4YMLA 1W4ZA 4JEUA 3ABIA 4UQLA 5LQAA 3M3DA 5LDDC 2J7PA 2WSLA 3C43A 1DAPA 1R6BX 1X1BA 2ORIA 1DO0A 4J94A 4BO7A 3BXFA 4UNRA 3LYLA 1PR5A 3FDFA 4M6WA 2YJTD 3V1UA 4B9AA 3SC4A 2BGLA 1NRIA 1P1FA 1A4XA 3GCXA 4GX0A 5KO2A 4UXHA 3ZWNA 1UP6A 4C3ZA 1N0UA 2HJWA 1CCWA 3WNQA 1U0EA 4D80A 1OX4B 2P6PA 4JL5A 2QLJA 4QD3A 3SLRA 4FCCA 1AQNA 4L8FA 4YV7A 4G89A 2VATA 1CRZA 1PZEA 2QEQA 1ISFA 3IPRA 1K75A 4N12A 4UAVA 3B1FA 4FNOA 1UAAA 2ZYAA 3KR9A 4HNQA 2V6JA 2J9RA 3G9TA 4OQ4A 1LNQA 2IZ5A 4MLPA 3QTBA 1IZ9A 5JT1A 2VHYA 3IMGA 1XCLA 3O2JA 4QBIA 3ZDCA 3ZX4A 1BTOA 3H97A 4E5YA 2R97A 1P0IA 4BP9A 3L7LA 2HRZA 3PHJA 1R7RA 3DHWC 2WEKA 3GUZA 1J0DA 4M99A 2FMIA 3LK6A 4JBYA 1WV1A 5DBIA 3RVDA 1I3MA 1J22A 2H54A 3L8DA 4X20B 3U1BA 2CJXA 4KVFA 3HMKA 1UXHA 3WYFA 2JFPA 1UADA 4YMIA 1FSZA 3AL3A 3ANNA 5AI8A 5DI3A 2IYSA 2Y1DA 3E2PA 2Z6VA 4AQ7A 1VDZA 2DBRA 2H1HA 3HN6A 1W2HA 1GZUA 3EMKA 3I01A 2A1UA 3AZPA 1EPUA 2YWDA 3KQTA 4FVTA 4YS6A 1U6IA 4EGQA 2HGZA 2AYZA 4IH4A 1C3OB 4YDSA 5LB2A 1ZH6A 3VO8A 4I2NA 5JH7A 1XDBA 2X1HA 3QLUA 2VDUE 3H0EA 5AW0A 4MQFA 1BA3A 2HK6A 1Z73A 4FP9A 5SY9A 1PWHA 3C6KA 5K99A 2XSZD 3U81A 3DBIA 1VLLA 2W6ZA 3UHPA 3MLEA 4KR3A 1CDEA 2OM2A 4IDAA 4D2IA 4Q15A 4EA6A 1V2HE 1XT6A 4I1YA 5DCLA 2H1VA 2IE8A 3IV7A 5DE3A 5EOVA 3T6KA 1FJGB 3P9KA 1FA9A 2WAAA 3ZHUA 5IKEA 5KX5B 3GV0A 3VMMA 3RTDA 4K6GA 4FNGA 4TRNA 4WLNA 5T3UA 4L4UA 2Y3IA 3SYMA 3UW1A 3CR7A 4YRRA 3QNMA 3QU2A 4CDMA 4EI8A 5J63A 3V7YA 2F55A 1W5BA 4HH4A 1S2LA 4W5QA 1GAJA 2HU7A 1R9JA 2ISCA 3KT8A 4ICIA 1UK7A 4BQPA 3SWWA 1IEXA 1ZWLA 2DWOA 3ZE9A 5CHYA 1JDZA 1UFRA 2PIDA 4KV7A 4BNXA 5BSHA 3E05A 2Q41A 1DAGA 4HWPA 5ALUA 5LYJB 4BLRA 1FBTA 1W0JA 4FBGA 3I76A 1PR9A 3UC5A 3UJDA 1JHDA 3Q1KA 4B82A 1GPAA 1IL0A 4JDUA 5DHTA 1IFXA 1UK9A 1QMGA 2RGAA 2PPVA 3DHYA 2VYQA 1C1DB 5AHWA 1YV9A 3OU2A 5EE9A 2SECE 1Z6QA 2RHMA 1FSSA 4N48A 1SY7A 3EIWA 4H7EA 1TLLA 1F3OA 1ZMRA 3RQSA 1FYXA 4IIUA 2WWGA 3SJUA 3TQFA 3VR4H 4Y9RA 3FVRA 1I1HA 1DFHA 1Q7BA 2ZJ8A 4EX7A 1GDDA 2O5CA 3RUFA 1RQXA 4LW8A 1S7GA 2HSJA 3BJMA 1J6UA 3E27A 3HO8A 2F3QA 2XNSA 5FH9A 3OM0A 3QXHA 4G9EA 5CA0A 3Q7QA 4E12A 5JMWA 5ARCA 2HMTA 4ZTBA 1WKVA 2EJUA 3B38A 4M9CA 4WESB 3KJEA 2GZ3A 1OWPA 2GF9A 4AICA 5FORA 5ALVA 4QJBA 1RC8A 2HV9A 3K1TA 1Z2DA 1CF2O 4IMPA 2X9LA 2RIPA 1UMCB 2H4YA 3HC7A 5CLQA 2H57A 5E1BA 1XDUA 3NNNA 3URMA 4DMRA 1YS1X 4BX8A 3BMCB 3CUKA 1KZ1A 1WABA 2DBYA 3HJHA 4JHLA 5BW5A 4FE3A 3WWDA 4E2WA 1XLWA 2CDBA 1JFFA 3DOUA 3MJFA 4D7AA 2EKQA 4DLNA 1EFAA 4G1FA 1TUBA 3ZJUA 3E0XA 5ILQA 5EWMB 5SYAA 1TZCA 4ZJZA 1IK6A 1QNLA 3U7EB 3MCAA 1Z17A 3E6AA 4J0QA 1DAKA 1IIRA 2ZE5A 2PMDA 3DT6A 5DNVA 1NW5A 1CY8A 2ZLBA 4GR5A 3HXOA 3WGQA 4IXNA 3RK0A 2TRSB 2QTWB 3DZIA 2HNAA 3G13A 4LMAA 3VMFA 2PQ6A 3AOEC 2FNAA 3KB6A 5BN3B 3SC3A 3GU3A 1XVAA 3S2IA 3QSYA 2NPIA 4DEXA 5B3JA 4DG8A 2BCJQ 1FPQA 1J00A 1SBTA 1UQTA 3OTQA 4FKMA 1LF0A 3KL4A 4B44A 2WJVA 1OLUA 2VTBA 2W4IA 3INYA 4Z3DA 1X7DA 4UM7A 1PUIA 1S2GA 5B4UA 1GD1O 1SG9A 2WZDA 3SDBA 1C7QA 5IAOA 1JNXX 2HF7A 2MIIA 3MIIA 1YQDA 2RK4A 5BURA 1U0HC 5FNVF 2P3LA 2PSJA 3L0SA 2VH2A 3E8XA 1TQ8A 5GONA 4CCSA 3IELA 2VUTA 5FWYB 3GBSA 4JHXA 3I1YA 4QYXA 3WGTA 1Y8CA 2M98A 3LF2A 5ALKA 1YZGA 2JI6A 1XTUA 2JCBA 3R6DA 2CCGA 2X4IA 4BLTA 4F46A 2UYHA 2QJTA 4N5IX 2BOVA 1KJWA 1SR8A 4KYVA 4JLSA 5IK2A 5A3RA 3AVTA 4JL8A 2P5SA 2XQIA 4BN4A 3SQNA 5CG1A 2CWWA 4JI4B 2AF4C 3FNRA 2C9YA 4L57A 3L43A 1ULTA 4REMA 1ZIPA 3BHJA 4TSKA 3OCVA 4KRGA 4EFMA 1ZXBA 5AH0A 2P5UA 1MFPA 1J06A 1GUZA 1Q7RA 1FX0B 4LRQA 2X3UA 2RGGA 2EKZA 1PX2A 2O3TA 1I4EB 4FEAA 1TQ2A 4L8VA 5AKJA 4O4JA 2FQWA 2EZ4A 1UKCA 3U6BA 3O92A 5LKRA 1A5ZA 3PEEA 1MOZA 3COSA 3G5MA 4RE6A 3Q8LA 2DFKB 3ZE7A 3N2LA 4FIDA 3EXFB 3PGKA 1B93A 1H4QA 1O9HA 4ZC8A 2I4NA 9LDTA 3HFGA 1UBRS 3RJ5A 3FAZA 4ZMBA 2XWSA 1PX0A 3QLEA 1QC5B 3O26A 4YT4A 3SZ3A 1TEZA 3G7NA 5ENZA 1PJ3A 3NJ4A 3NOVA 3KOXA 3PUJA 1N1EA 5EE5B 4A36A 3WO1A 5K2MA 3FDZB 1YAJA 1LPAB 1T8YA 2GJ4A 1XZJA 2XODA 4G09A 3UENA 4Q47A 2XZOA 3VR5A 4Z9AA 5HF6A 4P82A 3VV3A 5AJZA 2CK3D 3UANA 3N0VA 2IHBA 3ZNPA 2C4NA 2X13A 3DKPA 2OHXA 4LMRA 3W06A 3AHHA 1P8AA 1XNGA 3A6JA 3H1FA 4IAOA 3BFPA 1RYMA 3LKVA 5AKZA 3R75A 3GEIA 1EZ4A 3FTNA 3HCPA 1PZNA 3AOGA 4HXEB 4BECA 4ALJA 2WMDA 3ZV6A 3O0DA 4BNDB 1FFAA 2VAPA 2JJ2D 2AA3A 2NSYA 2Q2WA 2WVHA 4Q7LA 2VNIA 3WP0A 2YJZA 4R9NA 2G3YA 1X8XA 1YB5A 3GN1A 2C5LA 2QRKA 2VNKA 4G1CA 5JCJD 3QP9A 2PS0A 2OC9A 5EFOA 2JFQA 2ACKA 1N8KA 1EBFA 4ZEXA 2VNSA 3GLGA 4NBTA 5JI3E 3IJ5A 2KE5A 3X1ZA 4DCJA 4H1VA 3RS5A 3WK4A 4QG7A 4WY5A 2HLDD 3Q85A 4KE6A 1EHCA 3QEOA 2HA2A 4RWEA 2R7AA 5GQSA 5EP3A 1PR4A 4P7FA 2GH1A 1Z3IX 3H6GA 4CTOA 2UXBB 2IXTA 4LXQA 4WZAA 3VYWA 4JJZA 2P68A 5DKFA 5FTKA 1CNMA 2ZRAA 3ET5A 5FWNA 3FOCA 1N2CB 5LMNB 2YOFA 1U9CA 1YIDA 1D1TA 3WLNA 2FW0A 2G7ZA 2QN8A 4Y9DA 4CU2A 5ITZA 2BCGY 2OO7A 4FBLA 5KTSA 4UVDA 2G71A 1OIXA 3RBVA 1RLJA 2GZMA 4HDCA 1T6BY 1ECPA 2V7BA 3EA0A 3NKFA 5FHRA 4S1WA 3N6VA 3IMKA 2WJ6A 3IQXA 5JZVA 1V6SA 3OBBA 3GJQA 4P36A 4TZTA 1QGUA 3REGA 5BSKA 1H5UA 8OHMA 5BOVA 4D9IA 1FL9A 3JXEA 4AUNA 2I55A 1PL8A 3L8YA 4ZCRA 1KWGA 3MMXA 2HEIA 4IDHA 4LTNA 4X84A 1KE2A 3MD0A 1E8DA 1PR0A 3CXRA 2YFQA 3TVDA 4I4IA 2JJMA 2JJYA 4EPXA 1GTVA 2YY6A 3ONDA 1IRXA 1S3IA 1UZMA 4U0KA 3OWOA 3AUYA 3QITA 2FAXA 2QTHA 4NATA 4TV8A 5HM6A 1DXHA 1GUAA 3BA6A 3SHTA 1NOJA 1U3DA 2OB1A 5FI3A 1N2JA 3B3QA 3HEBA 4G1UC 5ALEA 3ZWAA 4BJHB 1KQ3A 2HGSA 3JS5A 4LYJA 3WLFA 3PITA 4IIJF 4FQ7A 3CZQA 3OTOB 4DC9A 2X9VA 2O3JA 2A94A 4FYWA 3ZLTA 1ST2A 1U2GA 3WLRA 2GX6A 2OFXA 3GAAA 2REXB 1NOKA 5CH5A 2E5FA 1EFCA 1Y48E 1T2EA 2V9PA 5AVYA 3EVFA 5ELLA 5A0FA 4J0IA 2EKBA 3P9SA 1GKUB 2J3EA 1J07A 4JC8A 2QUZA 4B3JA 3T1TA 4ZALA 4XX1A 2Q2NA 1XJ5A 1ZRHA 4RJ2A 3FX2A 2NO7A 4TM7A 4YP0A 5LJLA 2RC5A 4BMXA 2H3EA 5JCOC 4H0CA 2VP9A 4P5PA 3H9GA 3LCJA 3RS8A 3PQ5A 1M6EX 3W3AA 1H22A 3DM5A 5ED0A 1GAWA 4FCVA 3TAUA 3ICEA 1X8JA 1QTQA 4C5BA 3QW4B 4LGVA 4RBNA 1SOAA 1JXQA 4FDAA 2RAFA 4RDIA 4DR6B 2EDCA 3LD9A 1PFVA 1TA0A 1DBSA 1N5LA 4R2WA 3WL7A 1RMQA 3DOJA 3LL7A 1UJ4A 1NLMA 5FO1A 2AOTA 3JTMA 5JJ5A 1T2DA 3KU1A 5L3VA 3H2YA 1KQGA 1RAHA 1AXRA 2FMXA 1V95A 3FFAA 2IPAB 4RPLA 1TIBA 3BL5A 3IA7A 3ZCQA 1ZR2A 3FTEA 1Q5PA 3R7NA 2UYYA 4LECA 1B0UA 1E2PA 1VSVA 3FRIA 3FDIA 4LX8A 4QQNA 2P9HA 1FDIA 3WG9A 3FA2A 4GW3A 3HYLA 3TLAA 5L51A 2PSFA 2CFCA 5AJXA 3ADPA 3VDRA 1G2OA 5SICE 3ADOA 3NMUF 3ZWBA 2OM6A 5GY7A 2HRDA 5J59A 3BJEA 3LT5A 1MC8A 2ZB3A 1JE0A 1S96A 2ZWIA 1RI3A 4PZYA 2GM4A 2OCIA 1FRNA 5CT8A 5JD4A 2PA0A 2ZIWB 1G38A 2JGDA 1YR3A 3DZGA 3DZHA 4IIYA 4DBZA 4QGFA 1YR6A 1VJGA 3OZTA 3GUVA 2A0YA 5IWAB 4TTJA 221PA 3QLUC 5ECYA 4G85A 3AB3A 1VB3A 3MBOA 3OAAA 5CEEA 4CKEB 5A0VA 3K1AB 3MTJA 4N3NA 2JARA 1UPAA 1XAJA 4M0CA 3IT1A 1I5EA 2V7UA 4EAQA 2ZT8A 1AVTA 1DTWB 2GS9A 1IE3A 5HCIA 4U7WA 3MHTA 4JB3A 3BWDD 1J23A 1POWA 1L5QA 3JATB 4JLWA 2A9KA 1LI5A 4IEEA 3JQPA 5CLJA 1DAEA 1ZRNA 1J42A 1MDBA 3EGXB 3PGVA 4K9OA 4YJHB 2VQ6A 3PLAE 1CEQA 3C7CB 1IUKA 2AG8A 2C8JA 3DHNA 4R1PA 2AW3A 4DOMA 2OLEA 5B1HA 4S35A 3PDIA 10MHA 3ORRA 2Q5HA 1HLGA 3M6AA 4WDRA 5CYGA 3UGJA 3FZQA 1QPZA 3TB6A 3H4IA 4P32A 3BXEA 1Y8QB 3HNPA 3EGIA 1A1SA 4GWGA 4TUYA 1T13A 4RW0A 1FFHA 2D5LA 5FOSA 4ZEWA 1E1RA 4CLEA 5JLJA 3FKJA 4BVFA 5HKOA 1EWVA 2VHVA 2G80A 2H63A 5EIAA 4ETWA 3EG9A 1SCDA 4TKVB 4GKAA 1Z2PX 2P9YA 4NU8X 2XB4A 3ZXXA 2WQ7A 1AQJA 4YBZA 3H75A 4Q1DA 3BWCA 3C6ZA 1JX6A 1WULS 3BXPA 4JWKA 4UC0A 1LGYA 5I6DA 1SOWA 3SBDA 5K8VA 2JG3A 2F1RA 5AKEA 4Q3NA 5CM8B 1OFUX 4MR9B 3RWMB 2BEKA 3BT7A 3L0ZA 4F5EA 2LKDA 1KEVA 1QHFA 2JFXA 1DVRA 1Y9ZA 1HGXA 3BRWD 3HXTA 4HDSA 3WMXA 4B6QA 1O3YA 3R41A 1WQ4A 4Q9AA 5ELMA 4L9WA 4A82A 1NW8A 1ODKA 3OUZA 3BZBA 4E2ZA 5TT1A 1V16A 3M5DA 5ALZA 3ZD9A 3ZBQA 4DARA 1R12A 1EINA 2J7PD 3FAKA 4DKJA 1N7GA 3DEYX 2GEBA 4MDYA 4CMHA 4F2GA 1NJGA 1M33A 2WRZA 7ADHA 3D3JA 4UZSA 3GK3A 1XRLA 3FCAA 1O8BA 1MXFA 2WYUA 1MV8A 5JSHA 4P33A 3L92A 1FDRA 3E81A 4K0RA 5IMSA 2CXQA 4PPFA 1VI5A 4B3CA 2ZITA 5EFZA 5EKSA 3PE4A 1K3FA 5HCNA 5TXGA 3N1UA 2CF5A 1UPCA 4GMGA 3R3JA 4EG6A 2DKOA 3ROGA 3I32A 4A0SA 3UT0A 1MDFA 1JMKC 4PLVA 1JLKA 3WBBA 4BPRA 4NX2A 3U2QA 5LZ5A 6PFKA 4OQEA 4B6PA 1PL6A 4IJWA 2PY6A 2IW1A 2JATA 4IXTA 2YFHA 4NU0A 4X6YA 4MWBA 3WKCA 3ZWDA 4GWLA 2YXBA 4DZZA 3DBVO 4IJ6A 3ROQA 4L15A 4MS4B 2B98A 4RH0A 4AROA 2CT8A 3EQ9A 1TGVA 5AW2A 1X7XA 4KN5A 4EHNA 4G1EB 4RLSA 5EE1A 1TZJA 1Z13A 2WYVA 3CEMA 3AEUB 5FHQA 3CHYA 3SK0A 1QYDA 3FM9A 4HMPA 4KBGA 3V4FA 1RZRA 2ZTLA 2VSXA 4GI5A 4HPWA 1NBWB 1NSFA 1RCFA 1ZAKA 1ZIXA 2JFNA 3PQ7A 3ABSB 1UJ2A 2QN7A 5EWLB 3OZIA 1MJHA 4A26A 3A06A 2OO5A 3RLIA 4GPD1 5NULA 1X1EA 4QG3A 1EGHA 1PFWA 1L5LA 3LX5A 4AJJA 5CCDA 3IHKA 2BJWA 3OIGA 4ZVOA 3RIMA 1MKYA 1NMYA 1IHDA 1ULZA 2RAVA 4LOLA 4RV9A 5B3JC 1NYLA 4TKZA 4TYYA 4A23A 1DRVA 1UBGA 3AJRA 3DYBA 4XCQA 3ZU2A 4BFZA 4CDGA 1JIUA 5FA8A 3OPVA 4IDCA 3HM2A 4IQFA 1AY0A 2P2GA 4JLJA 3IB6A 4QYMA 1QWOA 4QBKA 2FLWA 4O4IB 1WXIA 2CVQA 5C7IO 1EX7A 3HUFA 4UUQA 1U0JA 3VVCA 4IDQA 4OIMA 4WNCA 4MK4A 1HFWA 5M3BA 2IRWA 1O6BA 1Z0ZA 2P2YA 1W8IA 2V4MA 4IVNA 3V2UA 4DDMA 1G2QA 4GC9A 1Z37A 2OV6A 4IIFA 3T3GA 4AJLA 1YGYA 2R44A 4QDZA 3LO8A 3K9FC 5ADUS 3PEVA 3NDBB 3AETB 3H4VA 4Q4AB 1GILA 1TX4B 1UPUA 2P4HX 1ZJ5A 3HWSA 4LMPA 3TTSA 4DFDA 4EVSA 1H05A 1M3SA 2QN2A 2JI7A 3IT2A 2Q6TA 3NBUA 5IYZA 3HN2A 4X97A 4CLOA 2AG0A 3ZJVA 3O4GA 4YRCA 2IEDA 3LDUA 4G86A 2C4KA 2PGNA 1ETHA 4P38A 1N0IA 1QAOA 3HU3A 2I6SA 1T0HB 5HR5A 5LP6A 2EP8A 2R8OA 4H1TA 5C1DA 4CW7A 1JDTA 2WA2A 2BWJA 3A05A 1POXA 1W0JD 5CFMA 1I6MA 1YI0A 3CW2A 4MA4A 1GPYA 4NFSA 4WD3A 2CW5A 2IVFA 4N7BA 2ODNA 4PO1A 2VXCA 1T10A 1WRBA 3G5LA 2W90A 3EA5A 2FQYA 3BMXA 4EI9A 4F3KA 3PL1A 2XLCA 4F6CA 4W5JA 3D54D 4L75A 3UTDA 4QDOA 1RQNA 1OXXK 4TWZA 3D7KA 3H0CA 3DA8A 4HDAA 4UVGA 4CL0A 5JXWA 4K6CA 4MX8A 4M6WB 1LD3A 1C50A 4UM5A 2AJLI 4FWBA 4ZCTA 3ITKA 4K26A 1A4IA 4YB8A 4C29A 1W1UA 2IYWA 2PCLA 4RORA 1XPRA 4B46A 1S4QA 3EOZA 5U4XA 2F8MA 1C4OA 5C5IA 1I7QB 3NHRA 2J3KA 3U5TA 1NUTA 4UDOA 3T5GA 4DAOA 2OBFA 3K3PA 1WUJS 3ZWVA 1YB1A 4BN5A 2CLCX 1NJSA 3D3KA 4ADSG 1N8SA 3NH6A 1WA5A 3V2IA 3HXLA 1PEKE 4LJKA 5JQWA 5FDFA 1MRNA 1HT3A 3SEZA 1HNXB 3NBFA 4HDKA 3KZNA 4N03A 3FNEA 1WDTA 4AURA 4F4DA 5E7IA 1YI8A 3LUKA 4DLXA 3G1TA 1KYYA 3GQVA 1L5WA 3O1LA 4OB6A 1FVFA 1S9DA 2E3JA 3IKTA 1YJQA 3MERA 1R4NA 2R5FA 3VZPA 2MHCA 1XRSB 1HMYA 2BFFB 2YMQA 3Q4GA 4KIJA 3WGYA 3Q8WA 1UMDB 4IMJB 2RHJA 1G18A 1CS0B 3PR2B 5LOVF 3HJNA 4M86A 5IMBA 1ENZA 3R7FA 5IC5A 3PBKA 2GYUA 3I1IA 1MG0A 3F7MA 5DI3B 3F78A 2ZWVA 5JMTA 4UCWA 3CX4A 2ZVDA 4MR7B 3RU9A 3ZGVA 5JVDA 2A1UB 2Q3BA 1RXIA 5K8TA 5M2QA 2GPSA 2I54A 3V8QA 4MWGA 5AI6A 2GD1O 4MQFB 3NUZA 3R9IA 3TFQA 4TWIA 3AZOA 3KSZO 2GYYA 3JQRA 4TLMB 5E6UA 5C18A 4XVCA 4DMUB 1T3SA 4BO1A 3W3ZB 3MJDA 1Y1QA 4X1YB 1QH0A 2QGFA 3IOEA 3CISA 4V02A 3JYHA 5LMZA 3EXEA 3TSCA 3WWPA 1LPPA 3KUDA 1P81A 4WKOA 1DRWA 5TB5A 3RJZA 3T7KA 4D96A 1J0XO 2HU8A 3KUUA 1ZVJA 3AUSA 4MW0A 4P3OA 4CQMA 3KR1A 4TRJA 3LPAA 2I80A 4WNYA 2ZTHA 4EYQA 5DN9A 3L4JA 1P4AA 3IC5A 1XVIA 1KH3A 1TXGA 4QUIA 3O90A 3Q7EA 2EP5A 3DYIA 2H4WA 4YJ3F 4UPVA 5DM2A 3W5BA 2I1QA 2Z6UA 2GO1A 3I4CA 2WJ3A 2XXJA 4M46A 3MXOA 4KLRA 4LC9A 3G2HA 1BA2A 4D9FA 2JLVA 1CP2A 1PV2A 2WD7A 3UJBA 4XLZA 5JZOA 4YFYA 2OEPA 5EZQA 1KMNA 5LL6P 1UFKA 1MB9A 2HQBA 1ICEA 2AJBA 2PJDA 2IEGA 2WMOB 1ETUA 4U7GA 2CHEA 3QU4A 5DN6D 3MHPA 1JR6A 2AOUA 3FSGA 1OFTA 2Z95A 1P5FA 4QHYA 4TYMA 1SXJA 2GWHA 2P1DA 4OLHA 3SF8B 4XIYA 3JQEA 1N34B 1P2BA 4DMMA 1O97C 3W7BA 4DV7B 3IDOA 3KD2A 3RIGA 3K72B 5FQOA 3MPOA 1P9NA 2DUUA 3WMGA 1DPGA 4JOCA 1JBKA 1U2GC 3AXSA 3C4VA 2Q1YA 3ZOZA 1WDKA 1S8AA 3QPWA 1J24A 3ANTA 1NJ6A 1DX9A 2ZUVA 3BORA 4RFSB 3GZ4A 1VPVA 1E9FA 4RM3A 5ALGA 4AN4A 4BV2A 2FY8A 4UHCA 5DBEX 1U0BB 4KVAA 3RTBA 4FILA 3TINA 5CA0B 3W8NA 2B1GA 3U3JA 5KNDA 4QPZA 1PK9A 1H2WA 1ZL0A 2AOVA 2ZBPA 5LXTF 5TT0A 2WY2D 3QWHA 1W47A 1OAKA 4E08A 1XP5A 4KWEA 3EVGA 2YKGA 1WCV1 2GDJA 1QWSA 4KUEA 2ZGVA 4YY3B 3GMTA 2J9XB 3IDSA 2WV7A 4JI3B 4IL5A 1PG0A 2ST1A 2B92A 9ABPA 3R5KA 2OVBA 3HU5A 3T4EA 1NNSA 3ZQKA 1I2ZA 2BR5A 2GFIA 4YJDA 3ZZTA 1VPLA 2NQTA 5FL3A 1JFFB 1VPWA 3I9V1 2Q5CA 4DQDA 2G06A 1TUBB 3ZHXA 1Q1NA 3N9IA 3UIEA 3A9RA 4NESA 1QVVA 1TE2A 3FYDA 3PHBE 3TRFA 1NY5A 4L8GA 5IN4A 1OIWA 2W4MA 1QDUA 1JDUA 2OKGA 5L3SA 4WKPA 1GNLA 3PQEA 1S9HA 3I6YA 3Q2KA 1Z0UA 2ZPTX 1QVRA 5FQNA 2EIXA 4NSNA 2PGIA 2ZJYA 2QJFA 4IV5A 4MVJF 4EUNA 4MB0A 1TYAE 1R8JA 1CDOA 1CWUA 2OGTA 4NI5A 4CIWA 1G42A 2BMEA 3HCEA 2ZRMA 3VYRB 1OLUB 2ECKA 3BD9A 4G2TA 4V0RA 2VTBB 3TZBA 2CD9A 1GUDA 1Z8NA 4BVGA 3IS3A 4D3SA 4EVRA 2WHYA 3F7TA 4LQ4A 3EQ2A 5CXQA 1RPTA 5C7LO 2E21A 4TL7A 3LMKA 5GONB 4G65A 2VCYA 5CHEA 4BV9A 1IU9A 4EQ6A 2V45A 2IELA 4WCVA 4DV3B 2GHTA 1BDMA 2PAFA 2WSBA 2DERA 1EEXB 1UBNA 2O0JA 1D4OA 3H9QA 1OFHA 1XZNA 2LRHA 2PX4A 1WW8A 1U1DA 2ZE8A 3WV4A 3TG8A 2BDUA 3ER9A 4MDFA 4TKUA 1GA6A 3RUAA 3PJFA 1SKYE 4C0QC 2YYAA 5ALLA 3DZJA 1UXGA 3RK4A 5IBQA 3I62A 2Z56A 1X7WA 2P4EA 2XYRA 3R1IA 3EXAA 3ROEA 3UJAA 4EP1A 1ADFA 1U28A 1SVWA 3CZCA 4M0FA 4W63A 2A88A 2FF5A 5HP4A 1UPFA 1VKZA 2HA4A 3RYCA 2E6UX 2VO1A 1Z2EA 7ABPA 3L07A 1E4YA 3D7MA 4Q4HA 4MCAA 4MPRA 1M1NA 1LF5A 4QHTA 3C85A 5FI5A 1MJNA 4CR7A 2MSCB 3O0TA 3N7UA 1AGYA 4FEGA 4GXTA 3WK8A 4YAGA 3C48A 3ZWPA 2J4DA 4LAFA 2B35A 1J8YF 3BPSA 1NTOA 4ZAXA 1G60A 1O97D 1Y3HA 2H51A 2DPHA 4C4XA 5BRJA 3ZIAA 2ENUA 3H2BA 1T9BA 1JA1A 1KJ8A 4ALMA 5IJXA 1WHTA 1BVYF 1MZPA 5BQ5A 3TQHA 1N2BA 1IULA 1U7WA 1XAHA 1BFUA 1BO6A 1KSHA 3DCNA 3HQ4O 4P0PB 1WXQA 1AKVA 1E92A 2OOSA 4G5QA 4JXJA 3O03A 2QRVA 2RJOA 1BQEA 2AJTA 5EJ7A 3CX8A 2R6HA 4GKVA 5CTAA 1T1GA 1MAUA 1IHXA 1RADA 1EQUA 4R71A 1UK8A 2PXXA 4ZXPA 3W2HA 2ZCJA 1Z2CA 3KXKA 1QHXA 1Y7PA 1WVGA 5MGBA 1K3TA 2X0JA 1GPWB 2IY7A 1G1AA 3BE5A 5BSUA 5KDOA 3PR1A 4WOCA 4AC9A 2X19A 1SVUA 2AYXA 4PSAA 4MVXA 3N8HA 1LLCA 5JCXA 3IP3A 1GTRA 2DR3A 4WFJA 4TRRA 2Q3JA 1R4MB 2WDZA 3CINA 5K05A 1OKKA 3GL9A 1M54A 2VLBA 3LU1A 2R47A 4IHAA 4TSRA 1RHJA 1USIA 3MPUA 4JLNA 4P58A 3WDLA 4A5OA 3PF9A 4NE9A 4QGSA 1P6XA 1NVEA 5I7OA 3RAEC 4NAVA 5JJKA 5CH8A 1MTZA 5EP4A 1LRKA 1W1IA 1F48A 1AD2A 1M1UA 3DBLA 3IR6A 4W8HA 1VBNA 4R2MA 4H3VA 1XZQA 2YMLA 3GLUA 3VPAA 4FKZA 4WZAB 1OVGA 1CULC 2HK9A 2X8BA 4Q21A 4R31A 5CP8A 1YQTA 4AG5A 4JB0A 3CRZA 3KOUA 5FNZA 1KYQA 4AULA 5F2NA 1CU1A 2YBEA 4GSLA 5LUBA 2PXCA 4LQDA 4O1MA 2BMJA 2NAPA 5HQJA 4CTKA 2BIFA 2O6HA 4PC3A 4UREA 3A58B 3JWEA 2AN9A 1XPOA 4LHEA 2O20A 2IP4A 3FNQA 3KB8A 3PYMA 2OO5C 4L07A 4QX6A 1AHNA 4B83A 5ARBA 3UFXB 3SVLA 2CXUA 3R74A 4ER5A 2Y1LA 1FFXB 3AC0A 1QGUB 1EXNA 1YJ5A 4V1CA 3OAAD 3C8UA 1FVXA 1MX1A 4JUAA 3WGLA 4XM0A 5MF6A 4QM7A 1EP2B 3S7TA 3E4DA 1FJXA 4LF5B 3EFOA 4L0DA 3CN9A 3DP7A 1KI1A 1MH1A 1LRJA 1ZH4A 2JFUA 3I3OA 3TW4A 3RR2A 4A8JA 2SKCA 1T91A 1Y80A 1KY4A 3QIAA 3MYYA 4JLDA 4LQLA 4QYIB 4RD0A 4V3CA 3U26A 2NT3A 1YS2X 2ID4A 1C7EA 4MGZR 4G0UA 2XI4A 3KJNA 2DBZA 3MMNA 3OFNA 4NZPA 3GJZA 2OBBA 3RU2A 1DQPA 4RTPA 2HMVA 4TV8B 2FETA 1RWNA 3GFPA 5ARDA 1QLWA 3ON5A 3RO7A 5L40A 1DO8A 3WB0A 4EJ6A 2WZBA 3ITNA 4OGGA 3TAHA 5IEBA 1KQOA 3NASA 4F60A 3JYQA 4KPUA 1NZFA 3O7MA 5DW3A 3WKBA 3HB9A 4AJPA 4URFA 1MLDA 2VDJA 5HTKA 4HNTA 2GXUA 1HTBA 2J9FA 2FJUA 3DD5A 1SXHA 3HO6A 3NTXA 2X6RA 5D5PA 4AG6A 5AVQA 3IURA 2WUDA 1J70A 1QIHA 3P9NA 1OA1A 2XB9A 5ICEA 3SVZA 4OU4A 3SZUA 4EBBA 3OE7A 3KXIA 3K9QO 2ZYDA 4PV7A 1G5QA 4ZYTA 2B5VA 3AR4A 1BN7A 5L4SA 3MM4A 5LP6C 1EUCA 1U7ZA 2YCBA 4ALKA 2Y99A 1Z4MA 4II3A 1QV7A 4KMRA 1KH2A 2BEVB 2X9QA 3F9IA 4RGYA 2VT6A 2ZI9A 1T0BA 2DLDA 2J3DA 2UZ0A 4D41A 4DL9A 2QUAA 3A4TA 2FPOA 4MMYB 3JY6A 2XBMA 4RTKA 3H83A 3RSFA 4HQKA 4DABA 2V55B 2AZTA 5IT4A 5E6RB 2CE7A 4EFLA 1WHSA 2BDTA 1ELOA 1O89A 1FYVA 3U80A 1ILWA 3EWAA 1M72A 2A78A 3SQMA 3V4PB 3S8EA 3GLFA 4DJEC 5ALJA 1BWPA 2C0QA 2H2AA 1L1EA 3L8HA 1CJKC 4TZ0A 3PFNA 1X1DA 4WBXC 1YMQA 2QGNA 1YBAA 4B3GA 1U1IA 2V7XA 3W5IA 2PL5A 1IY9A 4DLYA 3ZTTA 3PYXA 1ZSYA 2ZIFA 1EFRA 1IZ0A 1L5OA 4JLMA 5HFJA 2NOAA 3RYIA 1IBCA 3FXAA 3GOQA 4AP5A 4B0PA 2OWEA 3UCEA 1E0JA 1W73A 1PR1A 2CVZA 1LBTA 2O2GA 3D43A 3FCEA 3HVHA 5D8DA 4IWYA 2N1BA 1AN9A 4EHHA 3HP1A 5KOYA 4O29A 4R83A 1M2EA 2F67A 4RPKA 5UKDA 4P5DA 1YKFA 3IQFA 4OHOA 3CNQS 4MJ3A 1KK1A 3KFLA 2XYGA 3ETNA 1DXOA 3K6KA 1L7RA 1PZMA 4OF4A 5HOEA 1P8JA 4DV5B 4NH4A 2IOFA 3PDWA 1KEWA 5I7AA 5MFPA 2JI8A 2Y05A 3HPQA 5B6PA 4NL4H 2W93A 2JHAA 4BLUA 5F1KA 1SG0A 2YQZA 2BFEA 2GDZA 3DTVA 3H8VA 4HAXA 4YHBA 3D7NA 4Z9YA 3UBTA 1I7DA 5H4HA 3ZKWA 2P2DA 3KV3O 3BQNB 4WCFA 4E5MA 2ZUCA 1XA4A 4MV8A 4DSNA 3Q0IA 2RI0A 4GOLD 1FB5A 4R2KA 3R3VA 1N36B 4YWJA 4EH1A 1X38A 4XDYA 1YFKA 1ZVMA 4PXAA 3Q9UA 4RK6A 1GGEA 3QVSA 4AS1A 3GQBB 5G4KA 2PQ0A 2YV1A 3OJ0A 3PDUA 2VWHA 1YRLA 3L04A 3QKRA 1MX9A 1N5RA 2P67A 2Q2OA 5CA1B 5J2TF 2QX9A 5DIZA 5CVDA 4OM8A 2NVWA 3D2BA 2RKWA 4C3OB 2FV8A 3AHEA 2ZCVA 4C76A 2QR2A 3UWSA 4LYFA 1E3EA 2BFOA 5FULA 8ABPA 3FTFA 2XBLA 3LCUA 3TEMA 3DL0A 2OG2A 1MVLA 3T3HA 4YACA 5JISA 4QDXA 3DFFA 2O5EA 3G1WA 3AB7A 5K0TA 4ZZ2A 5KVVA 2X22A 3ISTA 2OR3A 3HABA 3UXMA 5J5VA 1TVMA 3EG9B 4WA7A 5CCXA 4ZDKA 4RTOA 1PKEA 4AMYA 3K4QA 2ZB4A 1I6WA 2WYHA 2P6OA 4IMIB 3RB8A 4IZIA 1Q74A 1HL3A 3NAQA 2FUCA 3QYPA 4IHJA 4TQGA 3OUTA 3OWHA 4DIUA 1M2VB 1TT5A 3T0IA 4EUSA 1GPUA 3VAYA 4C9BA 1K5PA 2C84A 2VRCA 3DB2A 4HDSB 3W4JA 5IF9A 3JWPA 2TS1A 1HX7A 5C7OO 4HYYA 5DI9A 4F97A 1Q83A 1SXJC 2D06A 4WFIA 4QIHA 4QUEA 4GUAA 4QVGA 4KXMA 2GJKA 3ZI0A 4PYMA 1X39A 3RLFA 1HDXA 1WXHA 1GDHA 1CD5A 1NJ2A 2GTHA 2VC2B 1S8NA 2VHEA 3M0EA 3WRWA 4G4SP 4Z2AA 3UQYS 5JC8A 3AUAA 4EGCB 2Q1UA 4GKKB 1JYFA 3NS7A 5ADHA 4Q1CA 2EQ5A 1L5MA 1O9BA 5J4KA 3W90A 5BV8A 4ILKA 2XCUA 4MVJI 1XKLA 4F1WA 2RJNA 1ONPA 3QH4A 4YJ2F 1N2SA 4FEEA 1T43A 1CJMA 4FMCF 2PNFA 4NZ9A 2I6TA 5BMVA 2G9UA 1JF8A 5K3OA 4R8MA 4ML3A 2C4MA 3HXPA 4BRSA 4ZHQA 5A04A 3UWPA 1PL7A 3MWKA 4CWAA 4II7A 3GAZA 3HYSA 4AJNA 3WZLA 3DG9A 4EENA 2W2LA 1X7XB 1CQXA 2ASEA 1TI7A 3UT5A 3C3AA 3TLYA 1Q3KA 2B4TO 1R3DA 3JQ7A 2X0FA 3WFZA 4F45A 2BKAA 4INZA 4QTZA 4PSDA 1IHOA 5FR2A 2EW2A 1WEHA 2HDNB 4AY6A 3IGFA 4E5DA 1OAOA 2NO5A 1LA2A 1V1RA 1WEKA 5FTNA 1L9XA 3V9PA 3UMMA 3A4IA 3ASUA 1RBMA 3IPCA 1EWKA 1R15A 5L95A 1H3FA 1FFSA 4LYGA 4D9GA 1NVKA 3QKTA 3WDKA 3BB1A 5LM3A 3HJAA 3MF4A 1YACA 4GD3Q 5CDGA 5JXGA 1HH4A 4FYXA 4G24A 1BNCA 3NTLA 5LU8A 2V1UA 1VB5A 2VFAA 1CRPA 2R6FA 4JI6B 5BWBA 3HM9A 1FMJA 1K4KA 1ZC4A 4W4TA 1K8YB 2B9VA 1XR3A 1K6XA 1PU2A 1HL7A 1NI5A 3CX6A 4I4TB 3CYFA 1B8UA 1VYVA 4M0MA 2DPGA 1LPMA 2WT4A 1ZOLA 4R4JA 4R40A 4Y1GA 5CW2A 4D4GA 4DBVO 1BQ4A 4P0TA 5LC1A 4URWR 3SE7A 4HQ6A 4MVCA 2PZBA 5BYJA 1MO2A 1JHPA 5C8YF 3RVSA 3TLXA 4QEDA 4HOYA 3RFTA 5L45A 2ZXFA 1N6HA 4IW3B 5F5NA 1E3DA 2WUVA 4GXQA 4QE3A 1KNXA 1C41A 1TKCA 1SCNE 5LJIA 2BEWA 5EJ8A 2Y0CA 4C20A 4P34A 1JQJC 3NLLA 4KGVA 4REQA 4Y7CA 4GH5A 2XT0A 2ZSIA 1JW9B 4N6GA 4E70A 3UPTA 1CE8A 1TL7C 1OFIA 4LF8B 3WO0A 5BQ3A 4DV0B 1M1YB 2HSGA 4DJTA 4OX9B 2F90A 2JIMA 3AVPA 4XYMA 1CUVA 1I13A 1H1TA 3NTOA 3VPHA 3VZCA 5IYZB 2I2BA 4KYUA 4NAUA 4OJYA 3T4PA 3WNZA 3UB4A 1JEQB 2EWMA 1X14A 2B34A 1U3VA 2F17A 2JCVA 2B2NA 4TMYA 4U39A 4JH0A 4WFQA 3PC8A 2UYQA 3A1DA 4XOUA 1U28C 3UXHA 1BIFA 5KEIA 1AO0A 4YQEA 3I04M 1NXTA 3QYJA 5LP6B 4G56A 2GXQA 3KSMA 4I9HA 3ZHYA 1TD9A 3EC7A 4ZAFA 2GK7A 5CAEA 3ZG6A 1H0KA 1THTA 3LPNA 2NVBA 4H6PA 4QBFA 3DCYA 2I8AA 3CRVA 1VKHA 4AJOA 2YZKA 3T7RA 3VZBA 4EMBA 1J9EA 2XA1A 3FSGD 4E14A 4DM3A 2ZU6A 1SXJD 4QYSA 2JEZA 8GPBA 2W9XA 5E3HA 2WF6A 4CRWB 2XAUA 3EGDA 5REQA 4ZYUA 3ZNNA 1XQ9A 2JFOA 1F0YA 2QZ9A 1HBJA 5A5GA 1USWA 4URHA 2O7VA 1YJCA 3D7RA 3P2OA 4DWOA 3EMVA 2W71A 3HNRA 4NOLA 4IGKA 2IWHA 4UBMA 3TSYA 1PJRA 2HBQA 4RZ3A 2D0IA 5F77A 2BBOA 2ZYWX 3DMGA 3I73A 4PWZA 3UKJA 4RZQA 4UAGA 3VI4B 5CDFE 1XD2A 4UBKA 4DS3A 2ATIA 4E5SA 1D1SA 2WIKA 1Z2OX 3E82A 1F51E 1DC8A 3S6JA 3T3MB 2VZ0A 3EPRA 5KNDD 1RKXA 2OKCA 2EERA 5FUWA 3DO6A 2QAJA 4NBUA 4MICA 2Z8XA 2ZS8A 2RGDA 4HDKB 4XR4A 4Y1FA 3RIEA 3SC6A 3C6XA 5K0SA 4JYZA 4WZBE 3LSTA 4YV0A 1MD9A 3ICCA 1C1YA 3WWZA 4FUTA 1E2JA 3I23A 4L4ZA 1WD7A 4D43A 4EYEA 1R50A 4L5AA 3SQLA 2FN3A 1QLJA 2GYWA 3H5VA 1O96B 1Q19A 3QK7A 4GM4A 4K40A 1LTHR 3L1IA 2QYHA 1E6EA 4JOQA 4XKJA 1ZK4A 2YS7A 3S27A 1NHGA 3FDXA 5DIFA 1WM1A 2PYDA 1AQLA 1KI9A 1E9DA 1LUAA 4F8EA 3ABRB 2IIPA 1WUIS 3O94A 5AUPB 2WTAA 4UTXA 2ZJ3A 3ELDA 3NRBA 4NULA 4LWQA 5IBPA 4DPLA 4JGGA 3X44A 2XKAA 2AN5A 4ZCMA 1U0OC 3GN2A 3SSMA 1ECGA 3G88A 1VL6A 1C8BA 2VZLA 5K4HA 2WLTA 3NHZA 2XV1A 2GAIA 5HFNA 1R5BA 2BELA 3QA9A 3IP9A 2VJAA 2O7SA 2XJ4A 2RB4A 1R4ZA 5JUWA 3WWOA 2PWYA 4RLHA 1CQZA 1U11A 1R88A 1VC2A 2AJCA 2J9GA 3EGOA 4CMCA 1P1CA 4DMCA 2MINB 4CEIB 3IPAA 3GWZA 1BRTA 2J6CA 5DOVA 4GLLA 3RUPA 5CDSA 1RMTA 4CQNA 4LBYA 3WSVA 5L8VA 1WNTA 3A1WA 1D5CA 3MMPA 2PU7A 1PJZA 3RV3A 3MJEA 4A8PA 1LI4A 1R0KA 2O57A 3WSWA 1QGYA 1TD1A 1YC2A 5EYPA 4D8VA 1XEFA 1YBFA 4O08A 2V97A 5SZHB 5CVVA 1HRDA 4V24A 3S2EA 4RSMA 1NN5A 2ZUTA 1M2NA 3BJIC 1RW4A 5B12A 3C5WP 5EJ4A 5D01A 5FBKA 3DONA 2WD7B 4LZPA 2Y0EA 3MWYW 3P5BA 1H2BA 1Z4JA 3BIFA 3PUKA 4ZVKA 4P4UA 4A8JC 5KVCA 4WEQA 1Q2UA 3ORQA 4I7EA 1L8AA 4EA7A 1D3AA 1UJNA 2X9GA 4FFLA 3ZEAA 3TNYA 1EFTA 1Q15A 5CEJA 3EVAA 5AVJA 5KTRA 4RVCA 3HLYA 4AMBA 2WR8A 1J8FA 3N3BC 2AOUB 1R3UA 2NO0A 4BLWA 1P7VA 1W0KA 2HY7A 3NC1C 3S1SA 1A96A 4G0NA 4I66A 1VBFA 4X94A 1G8SA 4RVFA 3F6CA 2E18A 3M9LA 1E77A 4PC6A 4FWIB 1GTZA 3KQMA 3DAOA 2TMGA 4EM6A 3HRIA 2JIQA 2W7TA 1U2PA 2VHJA 3NT5A 3PGA1 4I1VA 1GTJ1 4O5AA 2AUMA 2RARA 1A2QA 5FWXA 2LD4A 1IQRA 3WIOA 2YIVX 3UGKA 1PK8A 2QT0A 3BK2A 1R18A 1YUMA 3CF6R 4J9VA 2GPTA 2ZRQA 3FUTA 1KE1A 2NUPA 2C7VA 3HP7A 5F33A 4LE2A 3ZIAD 4DR1B 2GBPA 4R6WA 1B0ZA 1T1IA 2Z98A 2XMBA 1I7LA 1N4DA 3ZZNA 2C94A 1VJDA 4KQ2A 5CB0A 3DO8A 3BFXA 1JPUA 3L0OA 2JEYA 3COPA 4U2GA 4WXYB 1XCOA 1N1GA 3KOWA 1R5JA 3QFRA 4ZEMA 2Q2QA 5PNTA 3RASA 4CMGA 2WNIA 2OAGA 3QLVA 2R66A 4HPJB 2VUSA 3S40A 1YR1A 2BFAA 2C3MA 2R1ZA 1GKYA 2YHIB 1DC6A 2IY9A 4GMKA 3T15A 1HE8B 4OI1A 5EGSA 1AUXA 3VTKA 5JY6A 3NU1A 4PM4A 2WLSA 1QZZA 1Z36A 4MJLA 4BQNA 2I4RA 1YA4A 4L0CA 3QHAA 4E2XA 2ZSHA 1LPNA 2EOAA 4UU0A 2VZEA 3S70A 1H6AA 1BD3A 2PSHA 4JB8A 1BE8A 1T8UA 3E3MA 4PNPA 4X8LA 4ZAGA 4DILA 2F4VB 1D0SA 2AXEA 2CHFA 2O0KA 1Z15A 2YH2A 3C74A 2ALJA 2HXYA 1IDN1 5J4VA 1OKKD 1I4LD 1RWKA 4PYNA 3OECA 1N1DA 1H2YA 1OXBB 1QG0A 3BFJA 3KQPA 4TLDA 4B85A 1AA6A 1ZAYA 2O8CB 1JFSA 2DT8A 4W9MC 2W2OA 5D1NA 1KI6A 1JQLB 4PQFA 2HWWA 2IHUA 2IE0A 1HNNA 1Z0FA 4PIPA 1SIWA 1NAHA 2G08A 2CGEA 2PEYA 3BUSA 3KZXA 2RGYA 4JBWA 4OEHA 4R81A 1B2RA 1P2DA 3RT7A 1LPOA 1VCMA 3T7DA 2G67A 3EMDA 4ZOBA 5CEFA 2H31A 3KVOA 1W25A 1BYIA 1VJCA 3TGWA 2AXQA 2PGOA 1D5WA 1SK8A 3L7NA 4ZOEA 4YAIA 2OXRA 1ISPA 1N8NA 1FNMA 2QJOA 2ZR9A 3MT7A 4O4LF 4DT1A 2IUSA 4HNUA 1ZI8A 5IHXA 4RMNA 3EVBA 2MSWA 2GZRA 3CH7A 5F76A 3WIDA 4EZEA 3GB9A 3OZCA 3PZRA 1J21A 2ODWA 3P0JA 4FOLA 4DJ5X 1P7PA 4RZXA 3T3NA 2C7PA 4WCFC 2X77A 2QTLA 4I5DA 2ZQYA 4CIDA 1PD1A 3QG5A 3OSUA 4DMGA 4YAWA 4EQ6B 4DV2B 2LUOA 1TO6A 3ZGOA 2WJIA 2ROQA 4M0DA 3HUTA 3EZFA 4B2LA 2CHQA 2GCOA 2ZR7A 1QBGA 4KE7A 4KH0A 5FTWA 4UD2A 3T7AA 4CG2A 1JWBB 2AFHB 1DOHA 1HE5A 1QHYA 1QHIA 3WYNA 4RK5A 4BDSA 4KK4A 1XYGA 1SZJG 4UTRA 1UKVY 4AIIA 4B35A 2P77A 3FNBA 3LXMA 3PHCA 1NYRA 1X7WB 4TTSA 2VWQA 1BD4A 2C2WA 1IBRA 3MWDA 4YROA 4F4JA 1I3LA 3C45A 3FPBA 1AC5A 1UJ6A 3HDVA 1O6CA 2LGJA 3JPWA 1KO1A 1TYBE 3KHSA 3PFIA 3Q72A 4KCGA 4AAYA 2W83A 3OFND 3SEAA 1KZ6A 2J9ZB 4Q4HB 1BQ3A 1FF9A 2QQGA 3QXXA 4DBLE 2ERCA 2VQFB 4MLZA 2YVUA 3G82C 1QG4A 4KX3A 1UXOA 3K0SA 4S2UA 3T5DA 1Z6ZA 3NAMA 4KXNA 5KTYA 1L5RA 1M74A 1AV6A 3H7IA 1Y3BE 5TVKA 3LRTA 3EODA 2GJ9A 1GN8A 2AR0A 4WKNA 4INJA 1WPGA 1ES9A 3VUFA 3VYSB 5I7HA 1CHNA 2A0UA 4EUKA 1HT0A 2VP0A 1RHMA 3OE7D 3E9QA 3BCSA 3I39X 3RC1A 3RRBA 1QP8A 3QMWA 3TQSA 1O08A 2BW0A 5BN1A 3MTIA 2NTVA 3W8RA 3IULA 3WLIA 4KAAA 1SVKA 1YONA 3QPBA 1A8UA 1E9BA 4MQ5A 1JEEA 2BSXA 4NRDA 3SYLA 5E9JA 2ZYSA 3GIWA 1G7TA 4O25A 1KNQA 4EG4A 4ZZ0A 2E55A 2WNSA 3TUZC 3HBJA 4Z4QA 1RRVA 4MGYR 4J3NA 2EJCA 2CYCA 3PEUA 3E9EA 3N0TA 1ESDA 1OOEA 1NP3A 5FYDA 3DOHA 3MJSA 1BJRE 3N76A 2CLFB 1MA3A 1Z4KA 4RQBA 3REQA 3LHIA 4EWLA 1XMIA 3EASA 2OCYC 1DBIA 5H4GA 5KTOA 5BSFA 2IU6A 1LK5A 3HGTA 3MWJA 3ZQ6A 1I51A 5I4IA 4XQCA 1GG5A 4JITA 5H68A 3TD6A 3EXG2 5DBFA 3ZQJA 2C9CA 1OREA 1TB4A 2O2DA 2XD9A 3G2NA 3JR3A 3QKSA 1GQSA 2HRRA 2IUTA 1DT5A 1EFRD 4YO8A 4DEVA 4WOKA 4YCJA 1P73A 4KXQA 4PZLA 2OGSA 3S5UA 4D79A 2COKA 2EHJA 3LA8A 3W1EA 2XGMA 2JBAA 4HYQA 4ZDWA 3MCUA 1Q7GA 4HDQB 4LK3A 1BDJA 1X1QA 1YGPA 3EY4A 5LYYA 4I1PA 2OQRA 3TPZA 2CNKA 3NTVA 4KR9A 1GDTA 3LBNA 4AKSA 4PYKA 2JFGA 4HC4A 2VK1A 2XCSB 4JS0A