3L8DA

Crystal structure of methyltransferase from bacillus thuringiensis
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
202
structure length
202
Chain Sequence
QEMWDSGSRSTIIPFFEQYVKKEAEVLDVGCGDGYGTYKLSRTGYKAVGVDISEVMIQKGKERGEGPDLSFIKGDLSSLPFENEQFEAIMAINSLEWTEEPLRALNEIKRVLKSDGYACIAILGPTAKPRENSYPRLYGKDVVCNTMMPWEFEQLVKEQGFKVVDGIGVYKRGVNEKMLGQLSTDLQQSLTFLWVFMLKRHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Methyltransferase
publication title Crystal structure of methyltransferase from Bacillus Thuringiensis
rcsb
source organism Bacillus thuringiensis
total genus 63
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2009-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3l8dA00
2FYTA 3A7EA 1TW2A 4CKCA 3GWZA 3HVHA 3EVZA 2V74B 3TKYA 2FPOA 5JR3A 2P3QA 3FPEA 5FQOA 2YXLA 3I5UA 1JG4A 2O07A 2IPXA 4UOEA 2OY0A 2P8JA 3GGDA 3NWBA 3TLJA 4YMHA 1M0EA 3SMQA 2XVMA 2AN5A 2OBFA 4X63A 10MHA 2AZTA 4R05A 4K6MA 2YR0A 3LKZA 4E2ZA 3UA3A 2AS0A 4PONA 2G1PA 1AV6A 1XVAA 5DX1A 4HGZA 4KWCA 1QAMA 3PS9A 4EVIA 4QVKA 4DMGA 2ZZMA 3DTNA 2DULA 4EMSA 1HNNA 3FUVA 5DXAA 3FPHA 3ORHA 5KYGA 1D2GA 2O57A 5G02A 3FUXA 2FCAA 1EJ0A 3MCTA 1RI5A 3K0BA 1KR5A 4KVZA 2ZSUA 5DM2A 5DXJA 2GH1A 3SGLA 1VBFA 2C7RA 3QV2A 5HZMA 1X1AA 4QQNA 5CM2Z 4OA5A 1JSZA 3DXYA 5E1DA 5ICFA 2Y1XA 5D1HA 2QYOA 2XYRA 4IKPA 3OCJA 4E2WA 5CVUA 2B25A 4M37A 2PT9A 2A14A 2XYQA 4RV9A 3EVGA 1HMYA 4H0NA 4L7VA 3G7UA 3EVAA 4BP3A 4F85A 3GRVA 4QTUB 3GIWA 5KQSA 3F4KA 3C6MA 4CXMA 3KPYA 4F86A 4KW7A 3LCUA 4GBED 1D2HA 3B3JA 3LDFA 2HTEA 1G38A 1VP3A 2VZ9A 4GF5A 5DPMA 2E5WA 2VDWA 4E70A 3OPNA 3EGEA 4HGYA 4B17A 2XYVA 4FT4A 4KIGA 2AOUA 3R24A 3SSNA 1UWVA 2C7PA 3KQQA 1U2ZA 3PB3A 2JHAA 5DSTA 2JH9A 5HIJA 1NV8A 3T7SA 3TRKA 2UZ4A 1BOOA 1WG8A 3OU2A 1QZZA 5EZSA 3M6UA 1YF3A 1L9KA 4X61A 4E2YA 3SM3A 3DMGA 4KRGA 5KVAA 3DP7A 4RTRA 3UBTA 4BLVA 1UFKA 1P91A 2OPBA 2I9KA 3FUTA 2BZGA 4WVLA 3OFJA 5DTRA 1VIDA 3KR2A 1VLMA 4EKGA 2AOVA 4HG2A 5DT2A 5EIWA 3BWBA 2UYHA 1PRYA 3TQSA 1QANA 3UJBA 3MAGA 5DX0A 2I62A 5FULA 3T7TA 5EOVA 5CIYA 5LQNA 4QQKA 2BH2A 2NXJA 1WY7A 1YZ3A 2AR0A 2NYUA 2PJDA 5EIFA 3UJ8A 5ICGA 3EVFA 4IV8A 5DSXA 5BW5A 4A6EA 4ER3A 3UJ9A 4GOLD 4DCMA 5IKMA 3E05A 1KPGA 3CCFA 3GO4A 3CGGA 1NW5A 3HA3A 3ME5A 1JSXA 3SX0A 3U81A 4RTQA 4PYIA 1JR4A 3UJ6A 4E2XA 4DA4A 2JHCA 1IM8A 1JQDA 3EVDA 5EHIA 3FTFA 1Z3CA 1SQFA 4RVFA 3AXTA 4YUVA 4RX1A 1JTEA 4XUDA 5IH3A 1DL5A 3ELUA 5DM4A 4E32A 4DZRA 3FPGA 3ELDA 5E2BA 1NW6A 4FSXA 4MQ4A 1T43A 2R3SA 4ATNA 5CCXA 3G5LA 3LBYA 1G8SA 4YUXA 5T64A 4PYKA 1R8XA 4V0RA 1NKVA 2G8NA 5EPEA 4FT2A 5E8JA 2BR3A 3KPUA 4RVGA 2YTZA 4OBXA 4QPPA 1L3BA 3KPJA 3DXXA 2PBFA 3DULA 3ELYA 2IBSA 3PX2A 4O29A 1ZGJA 4P7FA 4X60A 2WA1A 3EVCA 5DM0A 2GPYA 3HCBA 5E9WA 5HOQA 1SKMA 3HCDA 3BXOA 3GRYA 2AOWA 1UIRA 3KQOA 3T7RA 2I7CA 2OO3A 2Q41A 3P2IA 1Q0SA 4RYLA 1F3LA 5E1MA 1SVUA 5EEHA 5EZQA 3BUSA 3QOWA 3GJYA 1N7JA 2ZWAA 3MTIA 2UYCA 4LECA 1X1CA 4M38A 1I4WA 2ZW9A 5GIOE 1NE2A 2KW5A 1O9GA 3LCCA 3B3GA 4FP9A 2GAFA 5ICCA 3A25A 4G56A 3GDHA 3FRIA 3GRUA 3ER9A 2P35A 4GUAA 2PXXA 1BC5A 1OR8A 3B5IA 2ZFUA 4YUZA 2IP2A 3E23A 3P9KA 4R6XA 5P8WA 3CJTA 5LQCA 3HEMA 2JG3A 1KPHA 3GXOA 1DUSA 2FK7A 5EC8A 5C0OE 4X41A 2IFTA 2EX4A 3KKZA 3GRRA 1VE3A 1RI1A 3VYWA 3FUUA 4U7TB 1N2XA 5HIIA 5T67A 3MTEA 2Z6AA 3DLCA 4DKJA 4PIMA 3EMBA 3CBGA 5GIPE 4XUCA 2OB1A 4RTOA 2ZIGA 4RTSA 3NMUF 2AOUB 3TPZA 1M6EX 1VQ1A 3NDIA 4OQEA 1BKYA 2YUIA 2GA9A 2PX2A 4HH4A 4C08A 1XDUA 3FZGA 5FHRA 5K0BA 3G2OA 4QDJA 1ZGAA 5EQJB 4YUWA 2YVLA 2HV9A 1ZG3A 2ZWVA 5K0JA 3PLAE 4MTLA 3LL7A 2PXCA 3TR6A 3G8AA 3LGAA 2BR4A 5FHQA 2OXTA 3UJAA 2C7OA 2JH8A 3FRHA 3IEIA 2BR5A 5DRYA 1WS6A 1O54A 1WZNA 1NBHA 4PCLA 3THRA 5CUQA 4P7GA 2QY6A 1AQIA 1R18A 4RTLA 3BGVA 3G2QA 1JQEA 5BXYA 3FPJA 3M6VA 3LDGA 5GOZA 3NTVA 3O7WA 3Q87B 4Y2HA 2C7QA 3C3PA 4P58A 3AJDA 3HP7A 1NW8A 5GWXA 2F8LA 4ER6A 4OQDA 1PJZA 3SXJA 4CTKA 3G89A 3TFWA 2NXEA 2QRVA 4HSGA 2NNWB 2ESRA 3HA5A 4M36A 4QTTB 3B7PA 2P7HA 4EK9A 5U4XA 2Z6QA 2ONZA 1RJGA 3MQ2A 4CKEA 3T0IA 1L3IA 3HCAA 4IV0A 1KP9A 3JWIA 3SSMA 3DOUA 1IXKA 1EQAA 1NT2A 1R00A 3EPPA 3HCFA 1KPIA 3I9FA 3LDUA 3KHKA 3AY0A 4XUEA 4C06A 2PWPA 5LR6A 3O31A 2IIPA 5EKXA 5HIMA 5K0NA 4PINA 2P7IA 2QM3A 2EJTA 3KQYA 3KR0A 4R8RA 2YX1A 3AXSA 3EGIA 3IV6A 4GEKA 4P7KA 5DRTA 3M4XA 3GU3A 5DTQA 4GC9A 3DR5A 3P2EA 5H02A 2EG5A 3MERA 3TMAA 4AZSA 5LQKA 5EGSA 1XJ5A 2YXEA 5K03A 1X1DA 4KIFA 3TM4A 3NWEA 4C4AA 1JG2A 1NW7A 4AX8A 2UYOA 3G2MA 1KYWA 5DWQA 5EMJA 3RW9A 4RTJA 3FYDA 4Z2YA 1Q0TA 3KR9A 2OKCA 5HILA 1VL5A 4PYJA 1JQ3A 3O4FA 1NW3A 2IDJA 2PX4A 2P3LA 2CKDA 3GCZA 4YV2A 4YV0A 4PYOA 1YB2A 1WXWA 9MHTA 3VSEA 3R0QA 1SQGA 1TPYA 1WXXA 1X1BA 4P7JA 3VC1A 3THSA 3FTDA 2B2CA 3NJRA 1I1NA 1FP1D 2HNKA 2PVCA 1D2CA 2ZBPA 3C3YA 2ONYA 4PWYA 4RVDA 1RJDA 4R6WA 4CWAA 1G6Q1 3OE4A 4FR0A 4E31A 2NP6A 3HVKA 1G60A 3UZUA 3E7PA 3G88A 2ZCJA 3KPVA 3PVCA 1B42A 3D2LA 5KQRA 3ID6C 4GOMD 1INLA 1VPTA 2VDVE 1JTFA 3IHTA 3KQSA 1DCTA 2P40A 1FJXA 2IBTA 1M6YA 5K0LA 3A27A 3I64A 4JXJA 4PYLA 2VP3A 2CWWA 3OU7A 3PX3A 1I9GA 2AVDA 5KS2A 3HVIA 5HIKA 4FS8A 3X0DA 2QE6A 3P71T 4PYMA 1ZQ9A 3M70A 5EMKA 2AOTA 3DLIA 2B78A 5FQNA 3I53A 4Y30A 1SG9A 3PT9A 5E1OA 3LBFA 4ER5A 5F2OA 4E33A 2LD4A 4BLUA 1R74A 4LWOA 5T6BA 4AZVA 3QOXA 1XDSA 2PX8A 4QPNA 5K05A 3UWPA 2V7EA 5FWAA 3TM5A 2AN3A 2H00A 3OZTA 2IH2A 5CVJA 1R6AA 4DQ0A 4HC4A 4RWZA 1G55A 3GNLA 5C1IA 3RODA 5CCBA 2H11A 1RJFA 3BWMA 2ERCA 3M33A 3PFGA 2CL5A 4BP1A 5GINE 2PWYA 1JG1A 5K0EA 4C03A 5K0FA 3V8VA 1ORHA 3I58A 2ORED 2IH4A 3B89A 5EKUA 2ZULA 4AUKA 3BGDA 1ORIA 3PTAA 1YFJA 3ANXA 3B3FA 3DH0A 5GP1A 3FTEA 2OB2A 3OFKA 4ER0A 1EJ6A 3H2BA 5F2NA 2H1RA 3KQMA 2OYRA 3BZBA 4HTFA 4KDRA 4PNEA 4CTJA 3Q7EA 2BM8A 5FTWA 3HVJA 1N7IA 2GB4A 2QRVB 3OZSA 4GC5A 4PYQA 5K0CA 4RSRA 3FUWA 4DF3A 1H1DA 3EEYA 4YMGA 5D1NA 3HCCA 4POOA 2PKWA 4QDKA 4IWNA 3ELWA 3LHDA 3DMHA 4PGGA 3SR4A 2OZVA 3E8SA 4RVHA 2NP7A 3FYCA 1P1CA 1YUBA 3LSTA 3FTCA 3DMFA 3CJRA 1EIZA 4PYNA 2PX5A 3HA7A 1YZHA 3HM2A 1ZKDA 1KIAA 5E2AA 3R6TA 4X1OA 2JJQA 3KQTA 1KXZA 1XDZA 4WXHA 3JWHA 3S68A 3LPMA 4RTKA 3VC2A 3CVOA 3LCVB 5ICEA 4XCXA 4EQZA 2ZLBA 4ZTBA 3HCEA 3TOSA 5LQUA 3CC8A 5FCDA 4OX9Y 3ER8A 2EJUA 3LKDA 8MHTA 2DPMA 5FADA 4DCGA 2FK8A 4AZWA 5LSAA 2BM9A 1BHJA 1RI2A 2B9EA 2YQZA 2Y1WA 3BKXA 3L8DA 1YFLA 2PY6A 2IDKA 5BP7A 1ZHFA 3C6KA 3UJ7A 3KPWA 2O06A 3BKWA 2PSSA 4KDCA 4LWPA 2P41A 5GM2A 2ZIEA 3BGIA 2FRXA 2G71A 3SVZA 2N47A 4OBWA 5K09A 1R8YA 2IH5A 5K0GA 3DUWA 3A4TA 1FPQA 4ISCA 5FA8A 4MIKA 3P9NA 4MHTA 3EEOA 3DXZA 2JHPA 2WK1A 3KQWA 3NW9A 2HR1A 2NXNA 4HRAA 4YUYA 4F84A 5JUWA 3NVKI 3C0KA 2ZBRA 5K01A 1QYRA 1V39A 1MHTA 3KQVA 3UJDA 3ERCA 1O9HA 4BY9E 3GRZA 2P3OA 4FGZA 2ZZKA 4V0QA 5FUBA 4E30A 1P1BA 1EAMA 3RIEA 5DX8A 4U7PB 2R6ZA 4MWZA 5DM1A 4R8SA 2ZTHA 3V97A 1XTPA 5K8VA 1F38A 2VDUE 3WSTA 2PT6A 1Y8CA 2G70A 3BWYA 3BWCA 4OA8A 4PGHA 3UA4A 2P1DA 2AOTB 2G72A 5ERGB 5C9ZA 5EMLA 3KQPA 2PXAA 3EMDA 3M6WA 2PLWA 3KU1A 4FSDA 4LG1A 1P39A 1XCLA 3UJCA 7MHTA 4RTMA 3A26A 5HFJA 1NV9A 3M6XA 3LX6A 3OU6A 3R3HA 3P8ZA 3EGVA 5DLYA 3R9XB 3UFBA 1SUSA 1G8AA 2PV0A 3NDJA 1QAQA 5FWDA 3PFHA 2VS1A 4BLWA 2XVAA 4RTPA 3HTXA 2ZVJA 1IY9A 5CVDA 1X19A 3JWGA 4FZVA 3MB5A 3EVBA 1MJFA 5EG5A 2GLUA 2K4MA 2UYQA 2ZBQA 1KYZA 3P9IA 3TKAA 4YV1A 3IYLW 5E8RA 5E9QA 1L3CA 5CD1A 3OZRA 1AF7A 4GOND 4C07A 5DTMA 3JWJA 5E9JA 3K6RA 1XCJA 3FPFA 2B3TA 2EFJA 2O0LA 3G8BA 1SUIA 4HTFB 4NECA 5EMMA 5GM1A 5HEKA 5MHTA 3P2KA 1RI4A 3OE5A 5CVVA 3BT7A 5M5BA 3G2PA 1NBIA 3G5TA 3P97A 4A6DA 4C04A 2O05A 5LQJA 1TW3A 4RTNA 2I6GA 5F2KA 1AQJA 2WA2A 2HMYB 3NVMB 5LQRA 3A7DA 1JG3A 1XXLA 5E1BA 2IGTA 3MCZA 3CJQA 5CVEA 2GS9A 3MGGA 4EKIA 1FBNA 2HWKA 4AZTA 3HNRA 3KR1A 4DM3A 2XBMA 5LQAA 5EVJA 1RI3A 2AN4A 3AWIA 3MHTA 4ER7A 5EHGA 3CKKA 1VP9A 4PIPA 2CMGA 1QAOA 1EG2A 2CMHA 1RJEA 5B1SA 5FA5A 4GOOD 3EVEA 1KHHA 4QVGA 4PCAA 5BW4A 2ZZNA 2AOXA 4M7RA 3SSOA 2FHPA 5EEGA 3REOA 3P9CA 1L1EA 4GQBA 2AVNA 3LECA 1FP2A 2YXDA 2ADMA 2ZIFA 4C05A 2NXCA 4CKBA 2PGXA 2Z6UA
chains in the Genus database with same CATH superfamily
2R6AA 2QMUA 5FTMA 4MLZA 4DRYA 5KNBA 2GZRA 4RGBA 3HMKA 4Q9IA 1L4KA 1MF7A 2Z3WA 3UCEA 5FV4A 4YUAA 5FQOA 4RDIA 5H5JA 1LDGA 2J1LA 1JG4A 3BPSA 4HYEA 1NF8A 3QU7A 3COPA 2WNSA 4P6VF 1XJ0A 3G3EA 1VECA 3ZXXA 4DHEA 3MLAA 2JATA 1NM5A 1QGAA 1IRIA 2X3YA 2XVMA 4WNAA 4Y9DA 1HL3A 1HYHA 1XSEA 1Z47A 4PSKA 4KC0A 5LLSA 1FA9A 3KUDA 3RV3A 3TFQA 5A71A 4W1SA 4F38A 2J3MA 1T5LA 4KPFC 1QP7A 1QHSA 1K06A 3AHJA 1LSUA 3DHWC 5DX1A 1K3UB 5DNCA 2C2MA 4ZYXA 1LTHR 2Z43A 3GEMA 3AR4A 3HU2A 5AW1A 1C9JA 3DFFA 1SXJE 4HWKA 4KYVA 4X6YA 4ZZ1A 2RE8A 2XWSA 2H4WA 3L49A 2FN7A 1RXWA 2YBDA 3K0BA 1KR5A 2VCYA 3O84A 5DM2A 3SGLA 4AJEA 3C8ZA 4MS1B 5IVDA 4U3JA 3TMYA 5CFPA 2QBYA 1FFBA 1PVVA 5I7RA 2A1TS 3L84A 3IOMA 4Z4QA 1GYRA 2Q3MA 1RFLA 2QVLA 5A0FA 2K2WA 1MTOA 3ACCA 3LFUA 3LWBA 2PSFA 3FGNA 2OGWA 2HPAA 5JTTA 1YBVA 4MDFA 3MVEA 3B3AA 4LZOA 4FWIB 3AF4A 4GSYA 1NXOA 1VE6A 4NG4A 4H9GA 3W4KA 3E5NA 4M89A 3QVSA 2Y1OA 3KCQA 4UMDA 1FTQA 3LCUA 3X1JA 4GS5A 4BMXA 4D4KA 1YV9A 1XJQA 4MULA 2HTEA 4L4XA 1VP3A 2E5WA 4CZ2A 5H82A 3UYKA 4XYBA 3BB3A 3QYAA 3R24A 3WA6A 1XWIA 4L2IB 1Y5LA 3I2IA 1JH8A 2JANA 1DIGA 3KQQA 4U7JA 4ZP1A 3EIOA 3P9ZA 2WY2D 3SYMA 4YCSA 2UUCB 4TWRA 1YF3A 1QZZA 1T25A 1AXGA 3FFBA 1JN0A 1PLLA 5FBHA 3DVSX 3DDSA 4IMJB 4AJ2A 4OAQA 2PTGA 5ER9A 4RTRA 2WYIA 5A2QA 5AP9A 1S2IA 1EVQA 2RAFA 4FYMA 4DCNA 2Z8ZA 4R81A 2O5EA 5DTRA 2DT8A 5EWJA 4HG2A 1Z56C 3ROEA 1YQUA 2VJPA 4HDMA 1LDBA 3QUAA 4YRQA 2G06A 4HVTA 4WAUA 4RXMA 5IW8A 4RSGA 3W3AD 5FULA 2ZIZA 3AFMA 4C3UA 3WRXC 4EY8A 2IX3A 3THXA 1T8PA 3L8EA 4KQCA 3EPLA 1WY7A 1YZ3A 1J39A 5BMOA 3OUTA 3PHGA 1NXTA 1NVAA 1THZA 4GM0A 4BFVA 4N54A 1KJZA 1VKZA 1YACA 2QM8A 2RHWA 5KVQA 2EJBA 1TQHA 1E7QA 2VHVA 1NW5A 3SX0A 1T4CB 3B6KA 3ESQA 4H1VA 5EHQA 5LBUA 3X1XA 3BX1A 1PK7A 3K9GA 3LBNA 5LQSA 4EGJA 4EHAA 1VBKA 2ZUVA 1YHZA 2JHCA 4BYMA 1J00A 4LKRA 1O6GA 4I9GA 5DIFA 2HCRA 3IE1A 4TZTA 4TYYA 1AS0A 1G63A 1N57A 1HYQA 1P2FA 1Q11A 2XIQA 3NASA 1L7XA 4NXNB 3ABSB 2ASEA 4ATNA 3BQ9A 5CA1A 1MNAA 1SQ6A 3KDSE 4I4TB 4TLCA 1ZY2A 5DNEA 3V34A 2QRHA 1UDAA 3L9WA 2HDWA 2OFOA 4R4JA 1H2ZA 4DILA 4UUPA 1C4WA 4QBFA 4GBGA 5FBLB 721PA 1UZUA 3EIQA 4RVGA 4IZHA 2IBSA 3CMCO 4D7AA 4P7FA 1YO6A 2QZ4A 4AZ0B 2RIPA 3L0SA 4K6GA 1IL0A 3MOSA 4JYPA 3FYHA 5GADl 3AZPA 2Q7DA 3KQOA 1Q7GA 4ITUA 5L45A 5A6SB 4ETNA 5KWJA 2BD0A 1TF5A 4KU4A 4KDFA 2JAPA 1ZD3A 2QVCA 4UHHA 3VR1A 1RZRA 2CGEA 2VOJA 1LB1B 3BUSA 2ZYVX 3J81k 2YY6A 4RA9A 1R15A 4LPSA 1ONPA 3F46A 1IUPA 1DCFA 1SUFA 1I4WA 3N7TA 4KYTA 1NSTA 4BCDA 4PG4A 1GPUA 1HLFA 2N9UA 3B9PA 3BCUA 1NI5A 2I3DA 3KDAA 3KFXA 1ZQ1A 2V0GA 2RAUA 2B7BA 3HJGA 5ALFA 3PLRA 2B20A 2VSFA 4P3OA 5FIUA 1DC6A 1XK7A 2VP6A 3GRUA 3QWBA 2PXXA 3UUEA 4YUZA 3K9NA 3IH5A 3LZCA 4YT4A 1B0PA 1M1ZA 4PZEA 3D8HA 3FOAA 3IAAA 2JEZA 4MVJE 1ZKMA 2DC1A 2OLEA 3JD3A 4FNGA 2OO5C 5EXSA 3VYWA 5HIIA 4D3SA 3MTEA 1OI3A 2Q6TA 1VL0A 4LGYA 5SV2A 4DABA 3DTVB 4WECA 4F9FA 1K4MA 4XUCA 3GUYA 3H18A 1BKDR 1BXRA 3O26A 3Q15C 4FSHA 1Q6YA 3C5EA 3UT5B 4P86A 4A91A 1GZUA 1VCIA 2C20A 4WNYA 5CB4A 4ZV9A 5HTKA 1NL3A 1E98A 1Q2XA 2O7VA 4B4VA 1Z2EA 4C08A 5LUAA 1VCMA 4HLQB 4NESA 2J4FA 2O9JA 5K0BA 1RHKA 2A92A 4HN2A 5LOVF 3EPKA 4Q24A 4OLJA 1SCIA 3RWOA 2GZMA 4LSWA 3LL7A 5JAHA 2C7BA 5E4FA 3ZCUA 3LGAA 1OY1A 2UUPA 2C2YA 4MKGA 4C76A 3JR7A 4JLMA 2IPAB 1OE0A 1BW9B 1P61B 1T5HX 2O7RA 3DV2A 3ICCA 4MUAA 4UBOA 1I36A 2R8RA 3FWPA 1R0YA 4N0QA 1NBHA 4RQBA 4K1XA 3ZWMA 3OKAA 2QTNA 2M6SA 3K6JA 4PVCA 3ILXA 1D1SA 3OZ7A 1W5TA 3K8YA 3THYA 1G20E 3RIYA 3EXG2 4ZEXA 1AUXA 4ZYWA 2QX4A 1HQDA 4WN9B 4JQZA 4R2WA 2XT0A 3C98A 1IN7A 1X94A 3T9CA 5TE9A 5H9WA 1FFAA 4JC0A 4NQRA 4OLAA 2C4HA 1U7DA 1YR1A 5BSGA 2VKQA 2OQ2A 4G9BA 1S02A 2WZQA 3G49A 1J7JA 1S8NA 4LRXA 3K0FB 4IX9A 3DZ8A 3FGZA 1EUDA 2ONZA 1M9NA 1PZXA 4IDCA 3AVXA 3M2TA 3REGA 3ZW9A 2V0NA 3CG4A 5HE9A 4KRFA 4XUEA 4AXXA 2I8LA 2C3OA 4OBBA 2F6RA 5JSZA 5EXXA 5F2EA 3UMCA 4P4UA 1X2EA 5CIQA 2WHRA 3QKUA 2CL6X 1XC7A 2TMYA 3PIDA 3ZKAA 4OMUA 2CDBA 3DZJA 4FFRA 4B35A 4K9PA 1EE2A 2E55A 3P2EA 3BAFA 1XROA 3ASYA 3CO0S 1N0HA 2ZSKA 3IAXA 4TL9A 1G21E 1U8YA 4LK3A 4BB0A 3TSAA 5BN3B 1TGVA 3AR5A 1U4NA 2FEAA 5LXTB 2GERA 1FDVA 1P3DA 2X1LA 4H7IA 5AVOA 2ONKA 5CIWA 4J1TA 3DBHA 4AO8A 3QITA 2WKSA 3AW8A 2V6FA 2I2BA 1XVLA 4RY2A 5H0IA 2HSZA 1FNDA 3T3MB 2M2IA 3R0QA 1TPYA 2H4HA 4HEA1 4NBUA 4B7ZA 1VJGA 4WLOA 1E1NA 3GBSA 5BNFA 1FP1D 4DIMA 2CBGA 2HMUA 4BJ3A 1RJDA 2XOEA 1GNTA 3UGQA 2JGAA 1YQQA 4BO3A 3HEAA 1PK8A 5LWQA 1XRPA 5DEOA 4GRIA 5JAUA 2J33A 3IX7A 4ENQA 1NAIA 4CEHB 1E69A 3W4IA 5AFSA 4EJMA 4EPVA 1ZJ6A 1FRNA 2WTMA 1ZJYA 3A9SA 3QENA 4KBGA 3N74A 1N2JA 1UJNA 1DCKA 4M9CA 1UBNA 3RNLA 2XKBA 1GNRA 3CZ4A 4JXXA 1GVNB 1DT5A 5GONF 3UK7A 2Q5FA 3GAFA 2GZDA 2XQIA 4X7RA 5JZBA 3IEKA 3RAEC 5EIBD 3HABA 2DR0A 2QUHA 2R6R1 3OBBA 4LJAA 2VP3A 1E18A 1O9BA 1TF2A 1ZHHA 2R84A 5KS2A 3IGFA 5HIKA 4X65B 1H93A 1KK2A 3LIIA 2Q99A 5JBIA 4GL2A 5AVXA 3MTDA 3NVAA 5K8IA 2ID4A 3U4QB 3HADA 2WHPA 3HWRA 4FYKA 4GM1A 3CSSA 3UUWA 3HPRA 4Q00A 2HDNB 3GPIA 3BIXA 5DNDA 3G0IA 4B84A 5K45A 2Z4RA 1GWNA 3RUCA 2O8BB 3DDCA 5K2OA 3RODA 3H5RA 1TMKA 4MTCA 3ZHQA 5KYXB 1I0ZA 1Q2UA 4O5OA 4E5PA 1IATA 1TAGA 2KMLA 4XWYA 3KETA 2B94A 1RDFA 3D6VA 4L4YA 2VBGA 4I19A 4EF4A 2XCOA 1R3UA 1RYHA 3WL3A 2ZG6A 4F7WA 4X84A 1KKMA 4JHXA 3IEVA 1US8A 1P9OA 1U8ZA 3GLVA 3NGLA 1EJ6A 1QMPA 3ZHCA 2N75A 2WRZA 4JT8A 1P9WA 521PA 2BFNA 2C1EA 1AA6A 3GLIB 4IKEA 3UK1A 3N7AA 4UBJA 4YT2A 2WHEA 1T5IA 5CXQA 2GB4A 1N2IA 1WW3A 1NG9A 3IUEA 4BX3A 1AZLA 4OYRA 2CNKA 1PFVA 2B6NA 3OZFA 2R65A 4W63A 3F3MA 1G8MA 4FC7A 3TLCA 4A2CA 1GL7A 1P2VA 3NT2A 1WSWA 1P0FA 3STWA 4YCLA 2Z8YM 4LHYA 2IV7A 1APBA 3F73A 1OXMA 3BAZA 3QHAA 3S68A 2Y0DA 4DREA 2R62A 4EDHA 4PZUA 1Q0PA 4OYHA 3GLUA 3C1TA 1C80A 4EQZA 1SXJD 5ALMA 1OU0A 3JYNA 2Z1MA 5LQUA 1I5EA 3H5OA 1B0AA 5JJKA 4I1RA 1JZSA 2WLSA 5HK8A 2H1WA 1BRMA 1DTSA 3JU3A 2Z5FA 4AZWA 1E9VA 1K6XA 5I9NA 2J3QA 4YTEA 2IYPA 3IBYA 2A5DA 2B9EA 2Y1WA 3H2JA 4G4SP 4RHTA 4RMJA 1SBTA 1L7MA 3UAVA 2PY6A 4EG8A 2AJLI 4JBHA 1SOMA 1V3UA 3C6KA 3UJ7A 3HU1A 2PSSA 2VJBA 5GM2A 4D9GA 1PCXA 4YGXB 2FPKA 1UQRA 2JJ2A 4R31A 4Z1MA 5ULLA 4QX6A 1P17A 4B43A 3B8EA 4IEIA 1QCCA 3OETA 4JLUA 1SA0B 2XEXA 2VZEA 5KNCD 1VB5A 4TL7A 5AXAA 2BISA 3JQQA 2QMEA 1YQWA 3KJQA 3KKOA 1N9ZA 3KU4A 4OKSA 3DXZA 4I2VA 2HR1A 1QU3A 5KQLA 3D3WB 3NUQA 1E1DA 1GLVA 1F8YA 1QIEA 2NU8A 3FWKA 3OZXA 3S2FA 2J6HA 5H8WA 4O4HA 4BY9E 1V8ZA 4LC0A 5HIAA 2BBSA 4V24A 2ZIWB 3RIEA 1KARA 2JBAB 3L7JA 4XR4A 5DOZA 2INGX 4Z9XA 3UWSA 3QE2A 1GQYA 3B36A 1USUA 3RPEA 1PW7A 3G59A 3Q0IA 3QG1A 4DW8A 1C1XA 2JC3A 1TEHA 1EVIA 3BWYA 3MTJA 4LJ5A 1SIBE 1A9TA 3RU9A 4OQZA 4OK5A 4MW0A 1FNNA 1CB7A 1MO3A 1UDRA 2ACVA 4ZYZA 5AQ1A 3D7NA 5BR1A 1YZVA 4DR4B 3UJCA 5ABPA 4OQFA 7MHTA 3MWEB 3S99A 5DHTA 1EU1A 2OBLA 3R6GA 3UFBA 2CDRA 5GV7A 2QTMA 4BLWA 4BAGA 3H1TA 1F0PA 2G6TA 3N75A 4NU8X 4H3SA 1I32A 3GN2A 2RGCA 4G5XA 3TQIA 5BSEA 2B1QA 1W36D 4YV7A 2AFIE 1LDMA 4C3OB 2XOKA 3RHTA 3ZW7A 1WULS 4Q4HB 1PJ2A 1XZKA 1PZFA 4ZFNA 1DWQA 4KGDA 3KHSA 3RUHA 3WYCA 2JKYA 2JBHA 3U7FB 2JCXA 3P2JA 1GGMA 4OH1A 3JQ6A 1S7GA 2ZCVA 4DJTA 1NM5C 4HX9A 1SC6A 4MV4A 3SJCA 3RSSA 3MYRA 1JAIA 2BJWA 2HMWA 5AIAA 2DKFA 4X8MA 1CG6A 3D0KA 4V3CA 5AJVB 3W2HA 2HA4A 4HXEB 3A1TA 2C77A 2B1GA 1PL6A 4IIYA 4URUR 1DT3A 4CKWB 5HBGA 2MINA 2AN9A 2GZAA 4JJKA 5EP1A 3NVMB 3RHSA 1WWKA 2GYVA 1PVOA 2J6BA 2XMZA 1VHDA 5REQB 5ADHA 2IU6A 2Y0BA 4C6RA 3AL3A 1KMQA 2CFCA 1XJWA 3KR1A 4A0GA 4TV9B 8ADHA 4MW7A 1EFLA 1NJ6A 1V5GA 1Y9ZA 2Y1CA 3AWIA 4TMFA 3GQBA 3MMSA 1SG0A 2WYWA 1TUBA 1QAOA 1JEEA 1TXGA 4PEVA 4L0CA 2I65A 2RG7A 2W2MA 4OLFA 1VJ5A 3NEAA 5LXTA 3QPDA 3O4RA 2QP4A 1FU8A 2GYWA 2W6OA 5BW4A 1ETHA 4CDRA 4X8LA 1WAMA 4FGLA 1I4OA 1PZEA 3B1XA 4HRVA 4WPGA 1YS2X 3WL8A 4COKA 4DMCA 1FYXA 4TV8F 4YAKA 1M8PA 2AXNA 2JH3A 3H0CA 4MGHA 1WW8A 1OZHA 2VH2A 4QU8A 2FYTA 5FTKA 4F92B 5TMPA 4TS1A 5CH3A 4RW0A 4RNDB 3BG5A 5IH7A 3EIHA 3PQEA 4WCDA 4TXNA 4EL5A 1T5BA 2VT7A 4TRJA 3T3EA 5JS8A 2XQVA 3ZNOA 4GZLA 2H1SA 1GU7A 2KB0A 3BWVA 3TLJA 3FNBA 1HSOA 2YCBA 4U63A 4MVJD 2FX2A 2XGOA 1CWUA 3DDWA 4QEZA 1GUDA 4B79A 3IUYA 1VPWA 5IT4A 2IUFA 4II7A 5CH5A 4TYQA 1JDTA 4F6CA 1AMOA 3P9RA 1XVAA 3R5FA 2IKQA 4LVCA 1QGZA 3FIJA 4BDTA 3UFXA 1D09A 5J2TA 5I7OA 2D54A 2IUTA 1FS4A 1K6EA 1R0BA 5DXAA 4P98A 3BXGA 3FPHA 5KYGA 1RXIA 4DLWA 5JTUA 2QF7A 2PL9A 1MB9A 3GLQA 2QRKA 1EZZA 2JA1A 2RGXA 5CFRA 2BHTA 5JASA 3ZCRA 4KIWA 4NG5A 1DUIA 5HZMA 1P4GA 2XDQA 2Q6LA 3AHGA 4U2BA 1QP8A 4QZVA 3DEHA 4MWDA 1U3WA 4NOJA 4V2IA 4Q4AB 3OSZA 4ZC1A 5KQGA 1FXUA 1Y37A 3ICEA 3NATA 1GT6A 4MVJG 3BD8A 1VL2A 1LC3A 4GLJA 2EFHB 4XGKA 4A36A 3K4QA 5HUHA 2VUSA 2IV2X 1RQXA 2ZJ1A 1DVRA 4MR9A 3F5QA 1JA0A 1HWYA 1ODCA 3PXCX 3Q7QA 3VJLA 3HB4X 5AW7A 3IQIX 1JFLA 4D74A 2GJKA 5EINA 1OJLA 4B4WA 2NYVA 1DKUA 3VNRA 4C4RA 1OI2A 2VZ9A 4GF5A 3VTZA 1ZM4A 1J2EA 2LXNA 1LJ8A 2DPGA 4OUDB 4JI3B 4LV6A 4ARZA 1V16A 1Q84A 4LOIA 2QVGA 2M6LA 1Q14A 5P21A 1U2ZA 2Q5CA 1ZHOA 2JHAA 1UPFA 4XGNA 3OTWA 1ZD5A 1NBAA 4E2YA 1JPUA 1JHYA 3BDIA 2Z0MA 3E2PA 1RRMA 3LUKA 1F6WA 1UPXA 3T5TA 4I8XA 1G5PA 3CLVA 1WCIA 2NUPA 2R5WA 1DBQA 1P44A 3PI7A 1QFZA 1CUGA 1HT3A 2CLLB 4KDEA 4WD3A 1CK4A 1JXMA 1D2RA 1JEOA 3BWBA 3GFVA 1PRYA 5AW5A 3EXEB 1TKCA 2Y1LA 2WEKA 1AQNA 5CIYA 1TAUA 3P94A 2PX0A 3FMPB 4TZ6A 5KTKA 3OY2A 3V9AA 1F2VA 1MAUA 1PYDA 5H16A 1TUIA 2IP4A 2QAJA 2J0UA 4Z3KA 5BR7A 3ZD8A 2FSIA 5FOSA 2P1RA 1N7GA 2VHWA 1QR6A 2Z58A 4Q7MB 2EJVA 2X5OA 4B0PA 3GA5A 4OHFA 1XX6A 2YV3A 5LZ5A 4RFSA 3WRWA 4CQMD 3OLWA 2ZBUA 3PBKA 1T1GA 2VDMB 1G9SA 1MMFB 1MO2A 5DGIA 4E1AA 3MXTA 1UPBA 2BDEA 1FU7A 1ZUNA 3EARA 4KPUA 4ACBA 5LDHA 3W5CA 4RAQA 4NAHA 5IH3A 3I01M 5E6RB 4E5KA 3X1WA 4A3SA 2RI0A 1RHMA 1XRNA 3E18A 1PT9A 4DUGA 2EHJA 4EJSA 1A7KA 3RABA 1Z0SA 2GEDA 2OBMA 2O4CA 5JY6A 4NJEA 3V32A 3EZYA 4M76B 2Q9CA 2A2ZA 4QYMA 5B1HA 1JB1A 1U0OC 3EYWA 1YA4A 1LF0A 4B46A 3D3WA 3LHIA 1IMJA 2ZJ0A 2QN8A 4IPTA 1DRWA 1LV7A 1WLYA 1B76A 2P27A 1GAEO 2XMCA 2EWWA 1X8JA 3IJ5A 5E3JA 4LHEA 3HCDA 3BXOA 2OO3A 3VO8A 2BGRA 5KAMA 3V46A 3AVOA 3N6RA 2QG9A 2XHEA 5HF6A 1YVPA 1QV7A 1SVUA 1QH9A 1W4RA 3WJ7A 4RE6A 2FUEA 3PHJA 2R9VA 4A7PA 3PKIA 4J3NA 4DA9A 4EELA 4G5YA 1YXMA 3R75A 2UYCA 4MZXA 3TDNA 3VRHA 3O2SB 4D5GA 2DB3A 1XMIA 4PQFA 1N6KA 1ZONA 2KW5A 3E61A 4PPGA 4TQ9A 2CDAA 1JEQB 2QYTA 1WMFA 5HA5A 5HF8A 2R0QC 4OI0A 1T5OA 3IQWA 2AFHE 2OZPA 3RK4A 3OM9A 1UODA 3G9TA 3ZDYB 3S2UA 4NICA 5A04A 3ANSA 1Z5OA 1GDDA 4BNGA 4M3NA 2QV0A 1GPKA 1VHWA 2XCTB 1MEEA 1JDPA 1W5AA 3F1KA 4A8PA 4CPDA 2I8CA 1K7CA 2C99A 2CW5A 4QJIA 2ZE6A 3E2MA 3OZAA 3EUWA 2BCJQ 4LZJA 5I48A 1KTIA 1P4HA 1W52X 2UV8A 1LDYA 3OOEA 3NMUF 4NZPA 3CRQA 3KBBA 2P9GA 2XT9A 4HRYA 2DHQA 4L3OA 4B6GA 4MUBA 4X0EA 3VGPA 5BXQC 3N58A 1YR2A 1E9FA 1JU3A 1C30B 4FOSA 3O4JA 3HZOA 4MQEB 3OEWA 4PO9A 3LLVA 2I7DA 3MGKA 3MILA 4B32A 2PQMA 3C43A 1KE2A 3CW8X 3RSQA 1OXSC 4JLNA 3IBCA 4IBOA 4WGGA 5IBQA 3ZVRA 2HDHA 3FVRA 3TRHA 3OJCA 4J1TC 4DM3A 4YAUA 1WL8A 1JIJA 2G0NA 3MUNA 5KYTA 4P7GA 4Y9UA 2QVZX 3N07A 1LD3A 3E9RA 3NBAA 3PQ8A 4GRDA 1QHYA 2A1IA 3ENZA 4PZAA 3L6UA 4TLDA 3T52A 3OQJA 1O95D 3CLRD 2A6PA 3JASB 1U90A 4ZVVA 2HHLA 5FPPA 1SBHA 4P58A 3SFTA 5BMVB 1RBZA 1JHPA 3H6HA 1CE8B 3A11A 4MO2A 1GGFA 1ZN9A 2ZRKA 2BEJA 4BO0A 2FDCA 2VJLA 3N2IA 1RRGA 4DTCA 2FWNA 3T0GA 4QLBA 3NAQA 1HNZB 2FZKA 4Q1AA 4H1TA 1S0UA 2G63A 1EGQA 3HA5A 3LP6A 2CUTA 1Z2NX 4JBNA 4QHSA 4QTTB 4E13A 5JISA 2GPBA 3DWIA 3GRAA 5FWYA 3RFXA 1Q5PA 3LC1O 2VEOA 2D1TA 4EQ6A 1M74A 2QRNA 3KC2A 4NCJA 3W1VA 5LQRA 1KORA 1DIOB 1LSOA 4QT0A 3FWYA 3IHLA 3OPVA 2JAUA 3SJBA 1YU6A 2OWEA 4I66A 4I55A 4ZO8A 4ARUA 3U7GA 3GU3A 1R64A 4HL6A 2C9CA 1N36B 3UG6A 5KAPA 2AK2A 4YREA 3WGLA 4J7CA 1PFUA 2NVUB 4Q4CA 4P3KA 5LQKA 5JCXA 3ZE9A 3B53X 1G1MA 1NLFA 1ODLA 2VF8A 1J1UA 4B7AA 3TLGA 1X7HA 3JVDA 3GEEA 4XVHA 4J8PA 4QXMA 4DSOA 5ELXA 3I8SA 2C4NA 3KR9A 3HNOA 3EOAI 1IXRC 1J09A 2HJHA 5D6OA 2TRSB 1WDMA 2BCEA 4YV0A 5A0VA 3OJEA 1AK1A 1ORDA 4KQ1A 5LM3A 4BP8A 2XTZA 1Y6GA 4YXFA 4BDSA 5LLDA 2CXSA 1KFJB 1BZYA 1P1JA 2DP4E 3HDYA 1DOZA 1A9OA 1KYIA 2J9FA 1LWOA 4Q7JB 3ROZA 2CJWB 2HQBA 2Q3HA 4J7XA 1T3TA 1SURA 2GXQA 2FXVA 1UT8A 2Z2YA 3KOUA 3OE4A 4KV7A 3DOHA 3RQSA 4IJKA 5DHPA 3O74A 4YP6A 2C7GA 1M2FA 2PAFA 1ZH4A 3TMKA 2FN4A 1ZWKA 2X8AA 1DELA 1LLQA 3QELB 4FN4A 3OUUA 4FDLA 4ND6A 5JJ5A 4PHTA 4XIGS 4QYXA 3F97A 5EHZA 1Y42X 1W9MA 2C92A 3BBLA 2ANCA 3PGLA 5IKXA 1SHTX 1X7DA 4MV6A 2CKMA 2FZCA 2BFOA 1YCGA 3K30A 1F8FA 4HDNB 2OP0A 1ZRMA 4NJOA 4E7PA 5AUPB 3P0HA 4XIYA 4DCTA 3ABIA 4L9SA 4N82A 3ZQ4A 3M70A 3EQ6A 1AB5A 3I53A 1H2BA 3QKIA 1HM5A 5COQA 1TVKA 3HJFA 4FOTA 4DDTA 3GJTA 4LBWA 4BFZA 4JIGA 4OK3A 4J49A 4ZDWA 3QOXA 4L28A 2HN9A 4QIHA 4QPNA 4C0BA 4JVOA 2J7PD 2R6HA 1UXOA 1JMKC 3C3DA 1JDNA 4UUQA 4QXPA 4WL0A 2WB2A 3ZWNA 1Z7EA 4GMDA 1SKUA 3LOUA 4KH1A 3O93A 1VSBA 1M6VB 4JJ6A 3G17A 2NU7B 4Q34A 3N39C 1W8IA 4YR7A 2IPLA 4YXWD 3HU3A 4BNMA 1WKVA 3LS2A 5FLYA 3A2KA 4WLNA 1SB8A 1W85A 4BFUA 2HU7A 5FRDA 2FWMX 3TIXB 1RZVA 1TC2A 4JOSA 3A1VA 5AKIA 4RJIA 3JRNA 2WMOB 5IPFA 1XPRA 2X8JB 4PYQA 4GYYA 1W6UA 3IKMB 4RVCA 2XZDA 3DL7A 1MX9A 2HSWA 1FSZA 4TLEA 3EEYA 5J5CA 4YMGA 2J4DA 2YN4A 3OI7A 3PPYA 5D1NA 2PMEA 3DT9A 4F91B 3RJZA 3WG9A 4PGGA 2PZBA 2ADOA 5HKKD 1GLGA 2W8ZA 3SR4A 2E5FA 5EQDA 4WEQA 3G9UA 3FYCA 3SU8A 3GPCA 4N49A 4G2NA 4L22A 2P2GA 4DLYA 3HA7A 1YZHA 5E4YA 4DSUA 2O8EB 3EDQA 3IV9A 3CN7A 1VI6A 3JARB 2Q62A 4H7JA 4D8TA 4KO3S 1GTG1 4MVXA 3E84A 5BO5A 3HCNA 1MT3A 4OHWA 4V0NA 5H4HA 3SEAA 4Z9AA 2N42A 4C87A 1A69A 3S0JA 4UOZA 2B8TA 3KUCA 3JAWA 4OX9Y 4IZOA 4C3VA 1KRXA 2PUDA 5ALPA 4NKRA 1ZL2A 5AD1A 4RHYA 2EKDA 1KI7A 1PD0A 2BKXA 4C1NA 3C48A 4TOIA 5C4IA 4MV8A 3CTMA 2CD7A 3NANA 3ISVA 5AM1A 5M3BA 2FG7C 1KZ9A 2P9EA 3AM5A 2CVPA 3X1YA 2ZTLA 2A9FA 3ZOKA 2W2XA 5FPKA 3ZS9A 2B7CA 2WU8A 4ABTA 3SPXA 3SYLA 4BCCA 2WIBA 3FKQA 4S35A 1U4SA 4HJRA 1IN6A 1SKBA 1UJBA 1XZ8A 3DUWA 1OSNA 2VJMA 2YWEA 3MQ4A 2BZ0A 4PCUA 5K3EA 3G13A 5L7WA 1OYYA 1PZMA 3H0EA 1JNXX 1ODSA 3E03A 1RSZA 2R8ZA 1M8GA 2ZP1A 1DX6A 5KQSA 4Y8VA 5TY0A 1SXQA 1U7UA 1X9HA 2PUEA 2G4VA 1N3IA 4OL9A 3JSXA 2C9OA 1OBCA 1L7VC 1TQDA 3C70A 5KINB 1QONA 3G0CA 2PVPA 1TCVA 2NIPA 2I9KA 4RZSA 2CXTA 2QG6A 1RCTE 4OY3A 1BVUA 4M83A 3I73A 2QN2A 4FTWA 3PDIA 1A2KC 4LQCA 1Z7BA 2RGNA 3UAOA 5C4MA 2PXHA 2QTCA 2PXAA 3PU6A 4M1OA 1J42A 1DBPA 1XD9A 4FSDA 4MA0A 1KY4A 4PQEA 5DBHX 5AOBA 5I51A 3FNQA 4N48A 4TQGA 4J0GA 1XCLA 5JLJA 2W6JA 1KYYA 1N5KA 3IT0A 2NAFA 5AJZA 2NADA 3Q1KA 1XMSA 5IZCA 5AKHA 1Y1QA 2ZRAA 4L85A 1GG9A 2R7NA 2N3ZA 4HNRA 5FA6A 1YE8A 3KG2A 2IV3A 4F72A 5BUQA 3SFVA 3IMGA 4D9NA 3V1YA 1T1IA 1V11A 2C5FA 3JWGA 4ND8A 3O5AA 4ESOA 1JPJA 2JD0A 2ZBQA 5KWVA 2I4OA 3PNSA 4NOLA 3PUHA 1FX0A 1L3CA 3LNTA 3PF9A 1YUMA 1BMDA 5E6SB 1QPZA 3KV1A 1EM8B 3P4XA 4Z7QB 3L4EA 2JA2A 1BU5A 3GJZA 1XCJA 3KRTA 3MPUA 5GM1A 2DX7A 3GEPA 1PE0A 4YRIA 3R0ZA 4BMDA 4NC9A 3KJNA 5HZGA 2XAAA 2OPHA 2GAJA 2POCA 4N47A 3ZJUA 5B36A 4MWSA 1P4RA 4R2KA 3M4NA 1CKEA 1FS5A 1PJBA 4JYMA 4ZHQB 1Y0BA 3HWSA 1W59A 5GVSA 2CMDA 1NQAO 1HDCA 3BTOA 3CEMA 4JJ4A 2Q3LA 3LBIA 4WWHA 2QIOA 2WJJA 3ETCA 4J43A 4V0MA 4AZTA 5ECDA 1GKKA 1NZJA 3DWGA 5FTJA 3HN7A 1I3KA 3HHPA 3OICA 4QXAA 4CR6A 2H52A 3AI3A 2HY7A 3WDMA 2PYZA 3LO5A 1OLSB 3RH0A 3QWIA 1WHSB 3OQIB 5DGDA 2AQKA 2DUWA 4CIAA 4N5LA 3FYUB 3PEUA 3WHLA 3AEUB 3DE3X 4JQOA 2CT8A 3B1VA 3PENA 3VYUB 4IVQA 3BL6A 3Q7RA 4GOOD 1JKIA 1BHSA 3CNEA 2Q5OA 3LMKA 5HMMA 5E3IA 3V7YA 3DLBA 2O2YA 2VJNA 2FHPA 3O3OB 1F5SA 1L1EA 2BZSA 1DFIA 5GV8A 4DEXA 5CJPA 5IHXA 5JU6A 2XZTA 1KEUA 1B00A 1V3TA 4TVBA 4BJ5A 3WHIA 5AKYA 1YJ5A 4WXEA 3DO8A 5HJ2A 2OCKA 4CKCA 1GPJA 1NMSA 1OI7A 1RP7A 3AKCA 3N5CA 1JAXA 4L5JA 1R5OA 3KFLA 3UMFA 2YZGA 4WZAA 1Y1PA 3FWZA 1YULA 3RFCA 4R71A 1TRKA 2Q0XA 3BA1A 4MSUA 2BFEA 2BEVB 2GT1A 2BGWA 5F1KA 3ZHXA 2BM1A 3A32A 1H4SA 1UBCA 4FFNA 1AUOA 1E7YA 2ACWA 1KERA 1D4OA 2R5FA 1A5TA 2AZTA 4H3KB 3JPYA 4KBYA 2DPLA 4LS3A 2IOFA 3ZQ6A 4XIIA 4ER5A 4AMBA 1A5ZA 3IMEA 3O3NB 3ADDA 4G3XA 3N70A 2CLDX 5D7NA 4AKEA 3M9XA 1AURA 2QMOA 1ICIA 4J2TA 3UTDA 4GI2A 3TPCA 4OIMA 1D2GA 1Z08A 1E9EA 1JFVA 2G83A 4A8TA 5JJBA 5IAAA 2WPNA 4P35A 1RIIA 3ZD6A 4FD3A 1R1DA 1XOIA 5FPTA 4F4FA 4RD4A 1U2DA 3GJ3A 2IHZA 4RORA 4ZVSA 2WQ6A 1Z63A 4OMFG 3CUUA 4IKOA 4I5GA 1UCFA 4EGSA 4HNAB 2HWXA 2O8CA 3ZNNA 1AUVA 1HRDA 1XEAA 3M81A 2I7TA 4M37A 4RMNA 5COBA 4GWKA 2DU8A 4XR9A 2R1VA 3LQ1A 2X0IA 4WXMA 2WP8J 4F85A 3JQCA 3GRVA 4G6ZA 3WDKA 1ORTA 5BORA 4OB6A 4X7BA 4CT4B 5KMGA 1UKZA 1F14A 2BFWA 2W83A 4AY5A 5LOVA 2EKPA 4O1IA 2OD2A 1LS6A 4K9SA 1Q1ZA 3UGTA 4CU5A 3E3OA 3Q8LA 1X8XA 2JI4A 4HDRA 4Z4HA 2QI9C 4EJSC 2QVYX 2AOUA 1DSSG 1GXSB 2CZQA 4X8HA 3S1LA 3H75A 3SBEA 3GPBA 2DKOA 4RQAA 4EABA 2ZYSA 3D3EA 4AX4A 1PQ4A 5B57C 4BPBA 1XQWA 4GW3A 2NPFA 3J80A 4GLLA 1DDOA 1OCEA 1VLZA 2OHOA 5BSHA 4UJ5A 1CJKC 3P9SA 1KTVA 3B60A 4ZDIA 4OHMA 4LFBB 3O6VA 3IUNA 1G4HA 3ZWKA 3M9WA 4DCSA 4D8YA 1F20A 1N5OX 2VSXA 4K40A 2A8YA 2ANBA 2VP0A 1JQKA 2WJYA 2AEEA 2PKQP 4I50F 4O2LA 5K2MA 1SVLA 4BO6A 3TS1A 2FWBA 4OMDA 3UJBA 3UTCA 1WLSA 2C4MA 1ID1A 2JCGA 2QQGA 1GTJ1 4HDKA 5EOVA 1IVYA 4Q1VA 2ZUEA 4JV5B 3QF4B 4IOLA 3UMJA 2PU7A 3ZI7A 2VAPA 3IIIA 3N7UA 4RKWA 2ZT5A 3PXXA 1ZOIA 3KDPA 1E1CA 4XDYA 3UJ8A 3ZDXB 2O59A 4B80A 4XYEA 4GOLD 3A1NA 5C53B 2XRMA 2NZXA 4MVJM 1GRCA 3AKEA 2BMAA 4LDAA 4CR8A 7YASA 2R44A 4JB2A 3FVWA 4HUQA 5HVNA 4RTQA 2B8JA 3AB7A 3AF2A 3HZHA 1L5OA 3M2PA 5CXXA 4B6FA 4DA4A 3EBPA 1NR1A 2I6UA 1W88A 2F00A 4TKZA 3ZU6A 4FMDB 2QRPA 3W8FA 3JD2A 3A36A 1DG3A 3IURA 4RK7A 1LNQA 3ELUA 2CFSA 1FJHA 4QJ4A 4ARVA 3ELDA 5J4KA 4FSXA 5JXHA 3ZC3A 2VWHA 5ICSA 2MJLA 3LBYA 4NEQA 1N0WA 2QAGA 2WUFA 1AHPA 3IMFA 1ZRNA 1VPVA 2J9XB 2ZJOA 1LF5A 3H4MA 3OMLA 3QOFA 4Y2QA 1X8LA 5FUXA 1WHTB 3HXLA 2GEUA 1P19A 1EGAA 3ASUA 4HHEA 4NL4H 3GZNB 3LUDA 5JH7B 4TKMA 4KTTE 3WL6A 1EBBA 4ZD6A 4EBBA 1KP2A 4A27A 1UKCA 2M1XA 4CBVA 3BHNA 3JX9A 3T7RA 1V6AA 4ENSA 2MDTA 3ZDCA 3JQAA 3ROMA 2FR1A 3HGTA 1RQPA 2LIVA 3P2IA 4JA2A 2DTDA 4YC7A 3L1HA 2CC2A 5EZQA 5AICA 1WUKS 4F46A 1XRMA 2FOXA 2V3WA 4FU0A 4JK3A 1V5WA 4MEJA 1KFBB 3CIFA 1KDOA 5HKBA 3KYCA 2OA0A 4EO9A 3HZRA 2NO1A 5HQ3A 1OGYA 4H31A 3I2HA 2FOIA 3L7MA 1O9GA 1HDEA 1PR4A 2MHCA 3LCCA 2YOFA 3JRWA 3MAJA 3MWLA 1ISSA 1JVNA 3NFRA 4MJ7A 4TM7A 1RC0A 3A9CA 3E9MA 1BS2A 3QJYA 3T1VA 3PWSA 2QJFA 4GUAA 5EYPA 3GGGA 1HGXA 3C7KA 3IP1A 1OR8A 2VWPA 8AT1A 4ARIA 4GU5A 4R0VA 3WSVA 1O58A 2BEKA 3JALA 4LBZA 3CRVA 1QRRA 3V2IA 2V6GA 4ND5A 2WV9A 3ZH2A 1NQXA 3BSYA 3OPYB 2D7DA 1Z33A 1E1RA 4NYJR 1T3GA 2KSQA 5JSHA 3VR2A 4KNVA 4OFBA 4LMRA 4XFKA 4D6YA 4TQAA 4HNVA 2G0AA 3K9BA 3VDNB 1JZTA 5B1DA 1YZTA 1REQB 2PCJA 3ZV4A 5T8KA 1ZGCA 3SJAA 3TVDA 3NYIA 1QQTA 2VJOA 3CEHA 3M1IA 3OZBA 4KVGA 4OHRA 5A4IS 1ZGAA 2I71A 1C0PA 5AJUA 3AILA 3D59A 4LOAA 4H17A 4C22A 5EP2A 4MTLA 4QULA 3A2NA 3MK31 3VBCA 4L4RA 4YAWA 4W9RA 2WAOA 5IJ0B 1YE3A 1ZW1A 2HGZA 4J1SA 3ZOZA 3TI9A 4IH1A 2CBZA 5I5GA 2IHBA 2YJ4A 1UMDB 4RIHA 1B15A 4XPZA 1WBJB 1V6CA 2WG0A 3DB2A 4LQDA 3F5MA 5H1YA 1NYQA 4LRWA 5HJEA 4EVRA 1M1YB 1Q91A 4FCTA 4OGGA 1MIOA 1Q22A 4Y1FA 4EHLA 4NH4A 3HZZA 1J9ZA 2EIXA 3B1ZA 3E53A 4LA4A 4UARA 3ZQUA 4AFNA 5JT1A 3NTXA 2XGJA 3OCZA 1AU9A 4R8LA 2P4UA 1R7RA 3R5TA 5KNCH 3RC3A 1C8BA 1NYLA 2P7HA 4EK9A 1EVLA 4L78A 4OB7A 2K5UA 4ECEA 1YE5A 3QIVA 1DBIA 1R00A 3QNWA 4KEAA 4MKFA 4X7PA 4B6QA 6REQB 1W5FA 3GDWA 2PWPA 4KK3A 1L5VA 2F9LA 4IJQA 2VHQA 5IVKA 2I2DA 1NN5A 1YDWA 2NV2B 3QPAA 3AXSA 1G9XA 3IV6A 4HH3C 5JD3A 4O2AF 821PA 2WHQA 4M0FA 2PH1A 3TLEA 1LPAB 2WWVD 5CDFE 1A8PA 1QKJA 2CFRA 4HZUB 5I8ZA 4LI3X 1BJTA 4ZAFA 3CLSC 1QIIA 1TTPB 1VC2A 5KTOA 1M0TA 2XYGA 4I5DA 5BRNA 1B26A 3DP9A 4RTJA 3K09A 4KWEA 1FL9A 3IC5A 3TDKA 1FSGA 2HUNA 4BNDB 4R7ZA 4B3XA 2VSOA 1DAMA 3G82C 2RB5A 4OHXA 2P3LA 2CKDA 2GRAA 5TPWB 1T36B 1CR0A 1EFRA 2YZ2A 4HNAA 4LXYA 3QYJA 4WK6A 3VJMA 1IBSA 5D86A 4BKPA 1E2UA 3LX8A 1ADGA 5HF9A 3H83A 1TADA 4PWYA 2P65A 4RVDA 5KTSA 2DSNA 5ETJA 3U1VA 3O38A 2AX3A 2AQHA 2OCGA 1OAAA 2YWDA 4S0ZA 4A0QA 3DR3A 3GRCA 3NP9A 5L7YA 5HTOA 1U2SA 2DLNA 4X1KA 5EL0A 4AK9A 3KPVA 4YPOA 3PVCA 1E7MA 2R47A 3ESAA 3JQFA 4UAJA 4C14A 4LZNA 1N5LA 4V0LA 4NE7A 3K0AB 4PTLA 2Y66A 2IXDA 1R6TA 3NIWA 4U7DA 1NOIA 4BJHB 1QJ4A 2M6KA 2GZ3A 1IY2A 5IDQA 1MP0A 2J8ZA 2Q5EA 2YJNA 4Y2RA 2RGWA 4Q9JA 3TZKA 2QRQA 3BL8A 2YINC 3UXEA 3UJPA 1LDEA 2O0JA 3IOBA 2A4KA 2WOOA 2AVDA 4CQLA 3AUAA 4BVBA 3DZGA 2AMFA 1VZ3A 4ZJYA 3RR2A 1L4GA 1LS1A 1OV4A 4WERA 1ZL0A 3Q5EA 4UNSA 5EWLB 4HVAA 5FL3A 2PAAA 4O02B 2IH2A 1FOEB 4P8RA 5JCOC 1V6SA 5C1IA 5AT1A 3MOGA 1Z7GA 3GJSA 1LGYA 3ZHYA 4RD0A 3D0OA 1JR3A 1VGVA 2G9UA 2C8LA 2Y2UA 3Q7SA 3TCNA 2ZE8A 3UVEA 2FHSA 1YRAA 3IPXA 4EM6A 1VE7A 2PMCA 1UT5A 2ZYTX 4ZPJA 3UKJA 3UWKA 4A5OA 4D46A 2NUTB 5IVPA 1BTOA 3K73O 2UZAA 4O2BF 3NHJA 4M86A 2ZATA 1UWCA 5FWXA 4G2TA 1L6IA 5FFNA 3FTEA 1B93A 1W2GA 2QMHA 3H97A 2I0FA 3T4EA 1A1VA 4LYYA 1NUSA 1T9AA 3VHQA 3L8GA 1SBZA 4RSRA 4UTOA 4YCDA 2E0IA 2B0CA 4B73A 5B4TA 4IMRA 3VHRA 4IS2A 3P9XA 5TPZD 2GZHA 4CKEB 1N0UA 2GPAA 1OI4A 3QWHA 4O4LB 4FM9A 2I9PA 3IVCA 2WAAA 2C5GA 2H3EA 2XA9A 3CNBA 4K2AA 4EA9A 1SCDA 3WWDA 1PTJA 3PPWA 5BN1A 3T1TA 4DLAA 1I2CA 2P9CA 2YIDA 1KIAA 4QARA 3RYCA 4TV8A 1BMQA 1E9BA 5D6NA 1T9HA 2RGNC 3JWHA 2OCIA 4MUIA 3L7IA 3P0FA 2E7ZA 4I1OA 1Z22A 1E5XA 3CVOA 1LBHA 4AYWA 5I7UA 3N8HA 4MGYR 3GLFA 2BUBA 3CLTD 4UTPA 2HXGA 4MKIA 4ZEMA 3WKAA 4NV3A 3PSHA 4B76A 4QUBA 3VI3B 3U16A 5IZCC 1Q3KA 1JQLB 5JRJA 2GAAA 3R9KA 3C87A 3RLIA 5B30A 4M98A 5AYVA 1E8NA 4MP3A 3C7DB 3W9SA 3ZY4A 3L8DA 1YFLA 2AMLA 4FEYA 1Z0JA 4DM7A 4EI9A 2AIRA 3WS7A 1O87A 1MX3A 2IHUA 3VU9A 2OOSA 3B1WA 2X4IA 2AJBA 1FS6A 1PG0A 3L79A 2ZBFA 4OGLA 4I1UA 1PX0A 4R8KA 4EI2A 1G7TA 4EAAA 1M75A 4DSZA 3GWGA 3PTLA 5G41A 5KNLA 5HHTA 2I4IA 2EFEB 4YUYA 1XHFA 1H8HA 3QPWA 3C0KA 3SHVA 2X5NA 1MTZA 4S04A 4ZK2A 3O8LA 4JJIA 3KQVA 3LT2A 2YZKA 3RTCA 1P7ZA 2HSGA 3QG5A 3ZYZA 4MPTA 2QGFA 3H2YA 3L7LA 1R4MB 4JEMA 2GLTA 1LVHA 4Y6LA 3U7IA 1IEQA 3IT1A 4LUCA 4D57A 4EG5A 3WGHA 3CRRA 3UHJA 2PL5A 5EP3A 3BSFA 3N2KB 4OA8A 5DM60 2JJYA 5FBQB 1Y8RA 1J9GA 2BWJA 2Q7OE 4TTQA 3FPLA 2O3SA 5HUQA 3C3KA 4HLUA 4M8LA 2KPOA 2MT9A 3B48A 3LHFA 4F3YA 1IBLB 1TA9A 1YFKA 1SPBS 1NLZA 3A26A 3HWX1 4CLEA 3S1AB 3HS3A 5HFJA 1R8QA 3R6DA 5BY2A 1U1EA 3HDHA 2W8BB 1L8QA 2XUPA 4QDTA 3AYZB 1KMCA 1MB4A 5E38A 2D5LA 3FY4A 3EDCA 4Q3NA 1MDFA 1N1GA 3A4YA 4BX2A 2HWWA 3AB3A 1W2WB 1IXSB 2ZRJA 4HB3A 1QC5B 3EQ2A 1MJFA 3OECA 4IILA 3VR6D 3HO1A 4BRUA 5E8RA 4EY7A 4XKJA 5DNVA 5F3RA 4TKUA 4DGQA 5SY4A 3O2JA 5IKEA 4HD8A 3FPFA 3IO5A 3C6QA 2FETA 1ULAA 3OEEA 3KT3A 4CF6A 3U4MA 3ZKWB 3P0IA 4BVJA 5FAXA 2I66A 4W7SA 1PJSA 5AH0A 4C30A 2OGUA 3BXZA 1X7ZB 1J25A 1WB5A 4AL4A 1QPBA 2X9GA 3ZK9A 4DCPA 3GLGA 1TU0A 1AQLA 1H2WA 1IIRA 1RYEA 2BFBA 1D7OA 1WM1A 2L19A 2WUVA 1VLQA 2WU4A 3CJQA 2PKXA 3EAGA 3JCZA 4HPJB 1QZTA 2YMMA 3ICWA 5G40A 2AN4A 1I5RA 4OU5A 1ZH6A 3KIPA 4IGKA 2NNLD 4G1BA 3WWCA 3PITA 1U2DC 2EBWA 2OXRA 3TLKA 1OXBB 2ID8A 3B9QA 3TL3A 3TLXA 3HB7A 3CV3A 2CMHA 5CTAA 2HREA 4KFUA 1U7XA 4TPKA 2Z56A 1JPVA 5BQ3A 4JBGA 4RDXA 5JVDF 2QW8A 1KO8A 4I1SA 4FHEA 2IYZA 3KZOA 3CS3A 1C2YA 4UCQA 4GQBA 1NN0A 4P54A 3UKDA 3U48A 3C85A 2Y92A 4UEWA 4JWTA 5I4CA 4KX3A 2P9BA 3MJVA 3GWZA 5EHNA 1AMUA 4Q82A 1D8AA 4RJLA 4G4GA 4QXOA 3A3PA 5GPBA 5FOUA 5M29A 3D1JA 4Q1FA 3M8KA 2P3QA 4INZA 4ICIA 1KEZA 5CXUA 1K1EA 2O07A 2BJHA 3MFYA 2AV6A 4Z0PA 2BJVA 4YCNA 3I8OA 4UHDA 3C6ZA 2XMSA 2FLVA 1ULUA 1VJDA 3OC6A 4AXBA 4E88A 3DOOA 5BV8A 1AO0A 2DGDA 3FJ1A 1U0RA 3MWDB 1HE3A 2Q28A 2F2TA 4XI9A 5J9FA 1CR4A 4MWEA 3NAGA 2AD1A 1FPMA 4KWCA 3SQWA 2B98A 4RABA 2W4MA 4L4SA 1U3FA 3CLUC 1OGJA 3KOOA 4Z3OA 2O5CA 1U98A 4X00A 1MG0A 1WE2A 5AI0A 4KVZA 3REFA 2CXQA 3MEQA 3TW4A 3V1MA 5EWLA 1VL6A 1QORA 5C1BA 1NBEA 1NTOA 1WO8A 1X1AA 2VF5X 2VJAA 1UM8A 3A6JA 2P78A 2ZSBA 1R8JA 2HWUA 1ZOSA 3D7SA 5E1DA 3JXEA 4YT5A 1OLXB 4ZCPA 3WKBA 3C97A 2HCBA 3QLJA 4IKPA 4WZBA 1Y9AA 3M89A 3RAJA 4K3VA 1Q3HA 2H2FA 1WU8A 3KYJB 4N5HX 1XG5A 3L18A 4EBFA 1Z0FA 2OO7A 1P3JA 1OZ0A 1P2BA 4KO2S 3SZUA 4CXMA 1I4DD 1KI6B 1QVVA 1MZVA 3IJRA 1VRCA 1UMBB 2G04A 3LDFA 4W7IA 1G38A 3S1SA 1XHLA 1QCDA 4BPRA 1C0EA 4EYSA 4K8RB 3E9EA 1OXTA 2X1MA 4XTRA 4LDRA 3ROQA 4B17A 4C7MA 4FT4A 4G5FA 5I5EA 4W5JA 2PPLA 3W79A 2QAGC 2X3UA 5H68A 2B1JA 2IXFA 3C7AA 4LV8B 4JU9A 4FDAA 2R1UA 2XMGA 1IJEA 1J99A 1BOOA 1GCGA 1LJUA 2ZE7A 2VHJA 2JLRA 3D3NA 2B8EA 3H11B 3M6UA 5HKOA 2C31A 4OI2A 4F3KA 1RS0A 2IYOA 4R2JA 3LPDA 3SM3A 3CNQS 4BZQA 3VPGA 1KMHA 2FGKA 2PZJA 3PGA1 4Q16A 4ZMSA 4R8VA 1DQYA 3O90A 1BYUA 2W4QA 1BXGA 4M1WA 4S3MA 4GKJB 3AU9A 3K0CA 4D2IA 4FIDA 1PS8A 1WNFA 4U7GA 4D6XA 5FBVB 3HI4A 4BBPA 1AKTA 1R8SA 3IAUA 3ZWOA 4R98A 1CP3A 1L7RA 1H2AS 4RD2A 4Q39A 2QGNA 2DJIA 3QUCA 3R7WB 5CB8A 1X6VA 5EXPA 4NIMA 4QUHA 4DEYA 1L5YA 1V9CA 3DS8A 3KFVA 3PQ6A 1H2YA 2WI8A 4C7OB 3S7TA 2GFIA 3OFNA 1QK3A 4M0DA 4ASUD 3U3OA 4R2LA 2BI8A 1JQDA 2AHRA 3N59A 3OIWA 3TOZA 4EJ6A 3FTFA 3W78A 2Y05A 4WOCA 4ALNA 2BIFA 1ZMRA 4AYXA 1YQGA 3AHEA 1E3IA 2IXAA 5HDQA 4AIRA 1QGYA 2C4KA 3BRSA 3CU5A 1N34B 1ZC4A 2DPHA 2H8KA 3RRZA 5A02A 2VHEA 4JP5A 1WZEA 3ZVMA 4G8BA 4B85A 2O8FB 4BKMA 3B1JA 3N8GA 5BSVA 5T8KC 1RMTA 4X7MA 2Q29A 4E5SA 3EDOA 1GZHB 5KDLA 4CMJA 1WEKA 4DIKA 4O29A 3UUGA 5K3OA 3GEHA 1NU8A 3MMNA 5B58T 1XE3A 1A71A 4EUSA 3DM9B 4JB3A 3L4JA 1A4XA 1DS6A 1W76A 2BUCA 3BK2A 3VVLA 4OEHA 4LECA 2WKWA 3W6NA 3Q3VA 2QTTA 2XPCA 1JE0A 3CUKA 4HWOA 2AKEA 5LZ7A 1K27A 2OM2A 1N8NA 3E22B 3D6AA 2J3EA 4LX0A 4U1RA 2FX3A 3C3XA 1MH1A 2WU1A 4LMBA 4RE5A 4PLHA 4G56A 2D2IA 4LI0A 3RS3A 3GDHA 3ZU5A 4GXTA 3VR4D 2G07A 4J1NA 1DAKA 3GW8A 3ZHTA 1M34B 4HGQA 3SQNA 3OIDA 3ELBA 4W4TA 3ZE6A 1SOWA 4QA9A 1I2AA 3NRJA 5K3BA 1F2UB 1E61A 2B6HA 3DCJA 3GFRA 4G65A 4I4CA 4PZCA 4ZOLB 5CAEA 4I2NA 1K88A 1GN9A 3KQNA 3IVXA 3GRRA 3MS2A 2FN9A 4U7TB 3R8CA 1V1JA 2ACKA 4TWZA 3DLCA 3QEMA 4UVHA 1EUCA 3KB1A 1ECLA 2OB1A 2RONA 2P9FA 4YNBA 2QL7A 4RHUA 1GU1A 2DPYA 1VL1A 1S7CA 1K6MA 1YBAA 3HN2A 1LCIA 1MPTA 2KX7A 3DBOB 4D97A 5JAQA 1NN1A 5ED0A 7ABPA 5EKTA 2B69A 4KQXA 2Y67A 5DZSA 4ZAWA 4YRMA 5B55A 3NNNA 5AVYA 1PR0A 1RIFA 5EE5B 1PQYA 3L4BA 2JLCA 3N8DA 2I7VA 1P2GA 3I9JA 1E2MA 3K09C 2VNJA 1SXJB 3OX3A 4H0CA 2GX6A 4MR7B 4PXYA 5TNXA 5A1JA 5IM4F 5DYIA 1N6NA 3LPAA 3N9IA 4X85A 2ZIVB 5JPDA 2WMYA 4I6EA 2OZLB 1GSIA 1UT6A 1QBKC 1WUYA 4ZO6A 3WFZA 2DXIA 3K2BA 1GAWA 3R6LA 4Q05A 5A4MS 1QYWA 2AFVA 3M6VA 2ZRNA 1JSCA 5BYBA 1XA4A 2FSPA 4LWZA 3VMMA 4D3FA 4DRZA 5LU9A 2JFNA 4EPTA 4YWJA 3A9WA 3KZMA 4LY6A 3STHA 4PG8A 2MWMA 5ECWA 1XCPA 1DC8A 1U28C 1JFFA 1TJNA 4K28A 4K7JA 4U2FA 3TI7A 5KHOC 5TS3A 4R2HA 4QOEA 5F78A 5FBZA 1WQ1R 1MGOA 4XB6B 1E4VA 3WDLA 2OUIA 4QFDA 1KZHA 2BLNA 3MQ2A 4QM6A 5KOHB 3TKLA 4B6RA 4IO0A 2IP1A 3D43A 1VIYA 1G3QA 4LVNA 1F7UA 4BC1A 2G28A 1Y8QA 1C8VB 4R8RA 5ADVA 1IK4A 4ZCTA 3OCXA 2ZUTA 3RF7A 5JECA 2UZ3A 4L73A 4DC1A 3I39X 4F0JA 5AHWA 4GP7A 5EGSA 1JT2A 4P9NA 4CL8A 5IKPA 1XD2B 2WE8A 4ONEA 4B3RB 1JG2A 1EKXA 5IYZB 4R9SA 2W0MA 2B2NA 1XWFA 4BQNA 5DCUA 1UUFA 4Z7OB 2OKCA 2HYIC 1KQOA 4A5SA 4M6WB 1I01A 3GCZA 2EVWX 4DV6B 1VLLA 3C5WP 4U5QA 2C2HA 1FZQA 1G66A 1WXQA 1PUIA 1SQGA 3LUJA 3UH1A 4B8ZA 3CURA 1DJQA 3VC1A 4KNWA 4EL0A 5HCUA 3RC1A 3GP8A 2OCBA 3QPVA 1VBNA 2E21A 3OX1A 5ALZA 4IDQA 4PHHA 2FUG1 4YCMA 4U2CA 1G6Q1 1TOAA 3F6YA 3BE8A 3NT5A 4NEGA 4KQFA 3MJHA 1JG7A 3JZDA 3QEBZ 1YB5A 3AC0A 4QBIA 2O3JA 1K2WA 4C6HA 1K8QA 4BEVA 3DE7X 2C84A 3IBSA 3SYKA 2HQOA 1W4ZA 4QECA 4ZOQI 5CHEA 2EGUA 5K51A 2XTJA 2G9QA 2C3PA 4MWGA 5KNBD 2DLCX 3I1YA 3V55A 2ZROA 4JAVC 4ZVPA 5K0TA 3FYTA 4UOQA 5ALWA 3F7TA 1G19A 1P81A 1ONNA 3KXIA 1PTJC 1ARZA 3AIMA 1KRHA 2XMRA 1C0LA 2G5CA 3PX3A 3SXUB 5L6MB 4P0QB 3F8SA 4Z3DA 1V3VA 3PE3A 2MCFA 2R6GA 3ZVLA 2GXUA 4Z4CA 4PYMA 3U44A 2YC4C 3HBFA 2QD5A 3U7EB 8OHMA 1V8FA 1W87A 2AC2A 4LHXA 4MW9A 3LWDA 4X20B 3QKTA 4ARBA 3KTFA 1OC2A 3H3FA 1Q21A 3V8MA 3KSBC 2H00A 1JQ5A 3P1JA 5AI4A 1ULBA 2FUKA 1IVNA 1I7NA 5BQ5A 4X3CA 2J59A 4YRBA 1G18A 2O0HA 5JAZA 2OZKA 1PN3A 1RE1A 2FPRA 2A58A 1Z5GA 4R0MA 1XK6A 2XT6A 2Z98A 5FB3A 4ML3A 3H5IA 2VDQB 4IIEA 1O5OA 1N33B 2OBNA 3AJRA 4RCVA 3KQMA 4R5MA 4HTFA 3DGFC 2MSEB 1FFGA 3ND9A 1U8AA 4IGEA 3B9RA 4JVNA 2Z9DA 2N0SA 3FUWA 3F5DA 4BAZA 3FD8A 5A4JA 4P34A 3DBRB 3VZDA 2JAXA 3CISA 2I1WA 4IWNA 1KE1A 3BULA 1AQUA 2C1ZA 3LTNC 4XOIA 3OLYA 1DDGA 2QLFA 2PRKA 3GCGA 3UXMA 1F0NA 5CG2A 3ZG6A 1EQUA 1ZKDA 5F51A 1E64A 4A8HA 1XF1A 2B2XA 2GD6A 2PUVA 3NDPA 1XDZA 3NHUA 4RWEA 4NCBA 4KMMA 1QHHB 1O6ZA 4YA6A 3PHHA 3RG2A 1ILWA 1BD3A 1SC1A 4GXRA 3VDMA 4HLUC 3AB8A 5JRDS 2PSJA 1GFSA 2OSVA 4QWWA 4MAMA 4KQ6A 2PS1A 4BO5A 1UC8A 4QREA 1L8AA 5KCMA 3P9PA 1FUYB 3D6JA 4TMVA 3RAFC 3L1KA 4QDUA 4QD3A 1HE5A 2JFVA 1JJBA 1NSFA 1OX4A 2GARA 3OPYI 4KVAA 2E5LB 1R37A 1HOXA 4X6UA 5C32A 2JLZA 3R74A 2QLJA 2X9LA 3QE0A 3FTQA 5ALQA 4QYIB 1FP4A 4LRTB 1HG0A 3MXOA 3MCVA 3MJ4A 3AY3A 2YY7A 4B8YA 1G20B 3E3MA 3HYTA 4JJ7A 1XNRB 1A88A 1JKJA 2H48A 2VNKA 5FT9A 1KQNA 1AT1A 3FCUB 2CYAA 4ZQFA 4A23A 1Z4QA 4TKVA 2GO7A 2QE7A 4MOWA 4AJKA 2Q3EA 4CMCA 4BECA 1OFGA 4F56A 2PRJA 3H2KA 3AM4A 1VJRA 2CLFB 4KQEA 1J8QA 1RXVA 3VTFA 3D7RA 2XE7A 2DCMA 3IAS6 3CWZA 2DWQA 3KWJA 3LWNA 3B51X 4MIKA 1ZNWA 1IDN1 2FUCA 1XZLA 3KP1A 3NQ41 3WO0A 2WK1A 3BIJA 3EEOA 4RACA 3UANA 1T29A 1E2QA 4F84A 5B37A 3LC2O 2I3AA 4JNCA 5T57A 3TJZA 4Q37A 4REQA 1A7UA 1T8TA 4M99A 5LIRA 3PUJA 5ITSA 4AY6A 1O94D 4NMLA 3JWPA 1DEOA 1DG1G 3CFYA 4K3UA 1P1BA 1PYOA 5CYGA 5C8XA 1OH8A 1FW8A 5AKGA 2XCRB 4RUKA 1NE7A 4TLAA 4U39A 4OFXA 3U6BA 2HT1A 4HFRA 4N8DA 1I94B 1OFUA 2AT1A 3PEWA 3NH9A 4KGZA 4MW1A 2OV1A 1JF8A 1OTHA 2C3MA 4OHUA 4BX0A 3S4YA 2VPXA 4DDMA 1E4EB 1Y34E 3G0DA 4QUDA 4F4CA 4ZZ2A 3DT6A 4LSZA 5KEIA 3JATB 5DHUA 2VTKA 2WV7A 1V41E 4TS9A 4RY9A 4J4BA 2OSBA 4ZO4A 5CT8A 1HLGA 1LW6E 3AUYA 3L04A 4H2DA 4ZALA 3GJ7A 3R9XB 1QF6A 2RD2A 1SUSA 1HRKA 4H6WA 3B3QA 3PFHA 5CFQA 3HTXA 2EF1A 1DXYA 3PIIA 3TIIA 1BE8A 5DSZA 4JBYA 4ERXA 4GDFA 4QGFA 1UL1X 5A9SB 3CA8A 4P4SB 4I50A 5EIHA 5EJAA 4NAUA 4AP9A 4HYTA 1R0XA 4IRMA 1JJ7A 2Q1TA 3ZZ1A 2SBTA 3AI1A 1QRDA 3LX5A 2BVNA 2HCFA 4ZVUA 4E09A 4FMCB 1QGDA 2PSEA 4B82A 3ZBUA 3OHMA 2PE5A 9ATCA 3RTGA 4LF8B 1XHEA 2WTEA 3ZHSA 4CG0A 3CF4A 4RTNA 2I6GA 4DWJA 5BRJA 1AOXA 1TQ2A 4JMLA 2I8AA 1JHVA 1JMVA 2HPHA 3GEGA 3ZZUA 1XXLA 3MCZA 1UMKA 4JA0A 3W5SA 1M2WA 3FNRA 1EGMB 2OHXA 3I9OA 1K75A 4L76A 5JZ9A 1Y5IA 3IR6A 1A2BA 3ANLA 5F7OA 3KALA 3X2SA 3MT0A 3MPOA 3T3NA 2WZBA 4NCAA 3ED5A 5IYZA 3OT1B 1FSPA 5AOCA 2GJ8A 1LPBB 3MT8A 1RJEA 2E87A 1YH3A 1YK1A 3GHHA 2FW6A 4JITA 4NPHA 5CLJA 2HD4A 4FFSA 2DFPA 1FP2A 4HFMA 2I7XA 2IUUA 1X1EA 3O7MA 4IDPA 4CF5A 7ADHA 1J06A 3A7EA 4FX5A 4PPYA 3H86A 2JI6A 2WT9A 2RIRA 3RVOA 4AMYA 4O08A 5DN6A 5BPHA 2XR1A 5HKLA 2YW2A 1N77A 4FKZA 3BFVA 4S0XA 2VATA 4TYWA 3PHCA 3BCSA 1B1CA 4HI0E 3LLMA 1V1MB 3K9FC 1U7PA 2MYPA 3SMQA 4K6KA 2IHVA 4C2BA 2OBFA 2NTEA 1GA6A 4LEIA 3CXUA 3DAOA 3G8CA 4G97A 1U4OA 4RA6B 5DLQC 3EW9A 3F96A 3OEHA 4KV9A 5AM2A 3J7AC 1NDQA 1Z4PX 2OHGA 3PNLA 1QIKA 1R4NB 2J3IA 2ZKIA 3LY7A 2QTFA 2ZVDA 3K0CC 2P0EA 4FGUA 4MYHA 1ADCA 4RKEA 5J2UB 3G1WA 4R7GA 4BASA 3FOFC 4ZZ3A 3DMYA 1F51E 1FTYA 4JZKA 4ZVKA 4MMXB 3OBIA 2B34A 5AVKA 2ZM5A 4IQ0A 3RIXA 2Q27A 3PRHA 3H2GA 3OCJA 4E2WA 5K20A 3RIGA 4P08A 5NLLA 2UZ1A 3LXUX 3PLNA 5CX1A 4C0LA 5JNVA 5EESA 5LMCA 4J7AA 2O2IA 1NX6A 2WD7A 1ZK1A 2PWZA 2FPGA 1TK2A 5KYNA 1TKAA 3I45A 4PU0A 4Z8XA 4AUMA 4AJ1A 3NZEA 1U2QA 4WXPA 3ZY5A 3W0LB 4KN8A 2WDZA 2WYVA 2XRFA 3W5DA 1MLDA 1HSZA 4L50A 5DWDA 2VSNA 1BEZA 1MOZA 4MR8B 4D4MA 2Q46A 3KWMA 7AT1A 5JADA 3VTKA 1X1SA 3EUEA 5K6TA 1NATA 4XW2A 2SNIE 2QVBA 1OYVA 1XZEA 3EZXA 1GL3A 4P36A 2EV9A 1HDXA 2ENUA 3FPCA 3TPFA 2M32A 2PBRA 1EWYA 2GVDC 1N5JA 2FPPB 1A9XB 1KI8A 2V9CA 3M5WA 2CYBA 2J3KA 4XLZA 3MT7A 5BVGB 5EJEA 3TRJA 3DBLB 4ZC8A 1JIQA 1TJYA 1EFVA 3THOA 4BLVA 4M21A 1CRLA 1V8PA 2QPAA 2QPLA 2E4AA 4Z99A 4E2FA 3ITEA 4PNHA 4EUEA 1WMBA 2WWWA 1E2EA 5DBOA 3DXFA 2A86A 1Q7BA 4FYVA 5LB4A 4LF9B 2PGDA 3DD1A 1RBYA 4HT3B 2ZITA 3GD5A 3LT5A 3DE2X 1O97D 2NU6A 1II0A 1H0SA 3GBPA 3SLGA 3EVFA 3GVIA 5HQJA 3OQOA 1E5LA 1C8LA 2V7GA 4Q03A 3UJ9A 3EXHA 3ZIAA 5IKMA 4XWGA 2BTQB 1O8CA 4WDQA 2ECFA 5H3HA 3NHWA 4LZLA 2BV3A 5MN4A 1JSXA 4FZJA 5AHRA 3FI9A 4O2AA 1L4MA 3JZMA 4HR7A 4CNQA 3IPCA 3GT7A 1ZI6A 1H94A 4URZR 3FB1A 4RSHA 2XCUA 3DZCA 2P6UA 2ZOSA 5BYKA 2JVKA 2BGKA 5LL6P 4OHPA 3OZEA 4XD7A 4I0WB 4CKBB 3E1SA 1NJSA 2AFIB 2OFWA 2VRWA 3C6YA 1GAXA 1MVOA 5JMPA 4HMQA 4B74A 1SHJA 1OAKA 4DR6B 1Y6ZA 3LBAA 5D3QA 3OZCA 2O2XA 3BMOB 4PN3A 2WSBA 2HHAA 4XRGA 4GP9A 5CNKA 3WMEA 1X74A 1NXXA 3MINA 3DULA 2TS1A 1ZGJA 4JYZA 1VYTA 2GNPA 2GPYA 3TAHA 5JD5A 1SKMA 3I52A 4LC1A 3L4BC 4GWGA 2OYSA 2FF7A 4X95A 1UIRA 5DCYA 3ZUPA 1A9RA 4JN6B 2JHGA 1DMRA 2VDOB 3GYBA 3GAZA 4N6OA 4M9ZA 4PO8A 5LC1A 3V7UA 1C4OA 1AZSC 1YZLA 2YFHA 3K9HA 4E6PA 4UVEA 4MV0A 3MIZA 2WB4A 4R2MA 3GJYA 1CQPA 3H2ZA 4BB5A 3REQB 3UH0A 4CYMA 1X1CA 1QFXA 4M38A 1QS0B 2HQSA 1WXEA 1P4AA 2BM0A 3TGLA 4CEIA 4UJ3A 5CB4F 3ZZMA 2V9ZA 5K8CA 3QXJA 2B1RA 2X9VA 5HP4A 5EZYB 5WRFA 3NG1A 3ZCSA 4FONA 4ZV7A 2IP2A 3E23A 4MITA 4XA8A 3Q8XB 4LRUA 3K9WA 1MQ9A 2IU4A 2E9SA 4DPMA 4RANA 4QU9A 4L8LA 3WNCA 4J0FA 2C9YA 1XNQB 2X7JA 3AL2A 3T3HA 3FBTA 4Z1MD 2JJ2D 5A3VA 3BICA 4PIMA 4Q1CA 3UAXA 3KT0A 4G23A 1VQ1A 1IIBA 1ZSYA 2FXIA 4BWFB 1OWMA 4OLBA 4IXTA 2FMFA 3PHIA 3BMXA 4KWHA 3KHTA 4I1YA 3R7BA 3TQRA 2UXDB 3DTVD 4OG2A 1E1QA 2J0EA 2ERYA 3WYNA 1U1CA 1Y6QA 4QDJA 2X86A 3LUFA 2E49A 1IHYA 1PWXA 1PLJA 1PLKA 3LU1A 4O2BA 4RYDA 1M1NA 4PFKA 3DEKA 1NWHA 2RKBA 1VXOA 4NCKA 3G8AA 5FTNA 2ECKA 3WLMA 3PX7A 3UJAA 4O63O 4F8JA 3FRHA 3PXDA 4LYEA 4XB2A 5B7NA 1O54A 4NLLA 4ID9A 4II3A 1NFQA 1QO7A 1N0IA 3QBJA 4G09A 1N2GA 3H87A 4AWXA 4XVRA 3VA7A 2JI8A 1ML3A 1NR7A 3N86A 4DPLA 4EHBA 2YVQA 4EENA 3ZTTA 3LHSA 2XNDD 2QYHA 2IHTA 2Q3BA 4K87A 4D4HA 2CV0A 2CNWD 3QK7A 3CX6A 2GPJA 3UK2A 5DI3B 2Z6VA 1E7WA 3MIIA 1BDBA 3VX3A 2Q7XA 2Z2JA