4TRRA

Crystal structure of a putative putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
261
structure length
256
Chain Sequence
b'MSNLNGKTAVVTGAASGIGKEIALELAKAGAAVAIADLNQDGANAVADEINKAGGKAIGVAMDVTNEEAVNTGIDKVAEAFGSVDILVSNAGIQIVNPIENYSFADWKKMQAIHVDGAFLTTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGLLGLARVLAKEGAKHNVRSHVVCPGFVRTPLVDKQIPEQISEEEVIKKVMLGNTVDGVFTTVQDVAQTVLFLSAFPSAALTGQSFIVSHGWFMQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative D-beta-hydroxybutyrate dehydrogenase
molecule tags Oxidoreductase
source organism Burkholderia cenocepacia
publication title Crystal structure of a putative Putative D-beta-hydroxybutyrate dehydrogenase from Burkholderia cenocepacia J2315
rcsb
total genus 96
structure length 256
sequence length 261
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4trrA00
1C1XA 1T24A 1OOEA 1D7OA 2JCXA 2BH9A 3S8MA 3GZ4A 1LRLA 3JQGB 1R0KA 2H6EA 4R1TA 3WJAA 3ZWNA 2EG9A 4U6SA 4CR6A 3L6EA 2GD1O 4CM8A 1U3WA 3K2EA 1E6EA 1IPEA 3LLVA 2G1UA 4CMIB 1KVQA 1SCUA 1QYCA 6LDHA 1NQOA 2QIOA 2Y1OA 2D1YA 4JK3A 4PLFA 1E7WA 4IGFA 4OM8A 3DMTC 3SEFA 4KWHA 5KVSA 3MZ0A 3ZNOA 3QV1A 5DF1A 1HZJA 2Y68A 3CE6A 5JPIA 1A27A 3F5QA 3OP4A 1QSGA 5A06A 3UCEA 1FJHA 2G82A 3JCZA 1P74A 1NAIA 3LZ6A 4E21A 2GSDA 3DMYA 3K6JA 3WDSA 3HWRA 1GL3A 3NT4A 4BNNA 1E5LA 2W8ZA 4DIFA 1X7GA 4GL4A 1ZK2A 1M6HA 2J5QA 1VPDA 3VPHA 3WNQA 3JTMA 3AM5A 1YO6A 3PDUA 3UUWA 3GUCA 4YJHA 4JP2A 4E5MA 4IDGA 3PWZA 1OC4A 1S7CA 1PJBA 3SLGA 3F3SA 4CMCA 3WIEA 2YJZA 3D3EA 1BW9A 1YDEA 4O59O 1R15A 2BGMA 3MJCA 3H9GA 5IXYA 5KJ6A 1ADFA 1EVYA 2QHXA 1HDRA 2SCUA 3FRJA 4JIGA 1SO8A 4CQLB 4DYVA 4GVXA 1KBZA 3WX0A 4TRRA 4ZQHA 2WJPA 3JQCA 5FI3A 1P0CA 4A10A 1LQTA 1NR1A 4CM7A 1LU9A 1YBVA 4BNTA 4BHTA 5KWEA 5B4UA 4EZBA 1U7TA 5JFOA 1HTBA 3BMOA 1DO8A 4QUKA 4GSKA 1GPJA 2ZTMA 1NNUA 3L0DA 3ETGA 4M89A 3KZVA 4L76A 3C1AA 3JD0A 1KEUA 2E82A 3K2BA 1BXGB 4BNVA 3RBXA 4FFOA 3WWZA 2ZB7A 4D44A 1PEDA 3NJ4A 2OUIA 3A28A 3PJEA 3KLMX 4BV8A 4CM4A 5EMHA 4DREA 2HDHA 4TVBA 3RUIA 2GZ2A 1ZK4A 3RC1A 3I83A 3O03A 2NSDA 2Q2QA 1HZZA 2VUSA 2IYPA 3QRWA 2EHDA 2EKLA 4M86A 4CMKA 5A5EA 1PIWA 3EVTA 4BO3A 4B8ZA 2W2KB 3EY4A 5HS4A 5HS6A 1CIVA 4XGNA 3UHAA 1P3DA 4NBWA 1ZK0A 2YUTA 1U8XX 2X4GA 3RKRA 3HFSA 1UXJA 1DLIA 4F3YA 1PZGA 4TSKA 1FK8A 1PL6A 4O0LA 5TT1A 1GPDG 5FYDA 3ZW8A 5JC1A 4P4GA 5COQA 3DBHA 4Q3EA 4RLHA 4ZQBA 1QRRA 4BKQA 1DC6A 1MLDA 1P45A 3ADOA 1LDNA 3SBOA 4CM4B 2Y0DA 1EUZA 4AJIA 3PDJA 3WNVA 3IOYA 4WLFA 2EEZA 1DHTA 2VHZA 1ENOA 2FMUA 2VZ8A 3Q2IA 4RV9A 2Q1WA 1H9AA 3GEDA 2D59A 2EJWA 3AU9A 2H63A 5AXBA 4XIYA 3GK3A 4R54A 4E6PA 4NG5A 3VDQA 5HTOA 5JXWA 1VJ1A 3E9QA 3IDSA 2FR0A 4BNWA 3LF1A 4I9HA 5EQDA 3F4BA 4BO0A 4FC7A 4FOSA 2VHWA 4YRDA 3O38A 3I6QA 2OHXA 1VI2A 2AEJA 2CDBA 3E5RA 2EGGA 4BMVA 4J1NA 4YJDA 3AOEC 4HX5A 4I5GA 2UV8A 5BSHA 4CM9A 4R3NA 1G1AA 2HSDA 3IMFA 1E7SA 5I7EA 2JAPA 2J3HA 2JFHA 4EUFA 4EEXA 4OO3A 3W6UA 4CLRB 3I52A 4XEHA 5U1PA 3LF2A 5I9MA 3H5RA 4IZHA 3QVTA 4BL5A 4BO2A 3GVPA 4J43A 1U28A 1P0FA 2FY8A 1ZXBA 4PVDA 4WCFB 3RIHA 3CIFA 5J23A 3HN7A 2J3IA 1V8BA 3MJVA 4W99A 2AEMA 2NU9A 4UUOA 3VPSA 4W7HA 3WB9A 1YJ8A 1GDHA 3B1FA 2C20A 1IZ0A 1ID1A 3KO8A 1KEPA 3DZGA 1WAMA 3M1AA 1H0KA 3GZNA 4BGEA 3LT4A 3PLRA 1H94A 3NAQA 5F5LA 5KCZA 2X58A 4PIVA 1UP6A 4PG7A 5THKA 5DP1A 3HSKA 3Q6IA 4RPJA 4ND5A 2BI8A 1E92A 4CLEA 2EKQA 1CETA 1HT0A 2HK8A 4H15A 2DBZA 4WKGA 5DOVA 1P1IA 1NQ5A 3JYOA 3ZU4A 3INRA 4DYDA 2PGDA 5L3ZA 1X13A 1GUZA 3LQFA 4YPOA 2PTGA 4P38A 5BT9A 4B7XA 3DOOA 4BS9A 1HE2A 2UVDA 1PGOA 1TT5A 4FS3A 4N18A 2D5CA 3U09A 4QTZA 4YEDA 5ITVA 3SC6A 1PJQA 1GU7A 2DVMA 2NNLD 1B3RA 5G0UA 1PS8A 1YB5A 2OXIA 5L7TA 5BSFA 2WWRA 4W9NC 2VRCA 3ZWWA 3JQ7A 5TF4A 4D46A 1IULA 1QYVA 3DR3A 4HV4A 5L4NA 1DC4A 3ABIA 3GF4A 5G0VA 3U4HA 2CVZA 4YJFA 3ZWAA 1N1EA 4MVJF 4Z9FA 2Q99A 4O1MA 1DOHA 1IL0A 4GMFA 1GYQA 1OAAA 1Y5RA 4TRJA 4WEQA 3FR8A 2IODA 3PVZA 5DZSA 5JY1A 3OECA 1WW8A 2WD8A 1DFIA 1WLYA 1DPGA 1XKQA 3C8MA 3W4IA 4PG5A 4OSPA 5IG2A 2IXBA 3PQFA 3WQSB 1CWUA 4BGVA 1TA4A 1RKXA 1ORRA 1Q2XA 3H9QA 2DT5A 3JD4A 3H65A 1NWHA 3DDNA 2VYNA 2IZ0A 4ND2A 3RASA 1G0NA 5IAAA 4XJSA 3ZU5A 1WXDA 1MA0A 1U5CA 1PJTA 3BMOB 1PGQA 2DBQA 1ULSA 1Y9EA 2FPGA 1HKUA 3AFNA 3QWHA 3RBVA 2WD7A 3H9UA 1DFGA 3X2FA 2VHXA 3NTRA 4UUNA 1EFLA 3OH8A 6ADHA 3OA2A 3NRCA 4FFNA 3KSDO 3GUYA 4I8XA 2B83A 4AJKA 4RL6A 2NQTA 1WP4A 4IBOA 1HDYA 2PH3A 1YONA 2WTBA 3JD3A 3W4KA 4R5MA 3QSGA 1YBMA 4FPXA 4OL9A 3H5NA 3F1KA 4FIZA 1XCBA 3OQ1A 3BTVA 5F1PA 3WYCA 3PYMA 4R51A 1DAPA 3WR5A 5IXSA 3EGOA 4L8VA 2X22A 4BKOA 3MJSA 3PYXA 1BDBA 5CPFA 4UVHA 3CPSA 2BFMA 1NPTO 2QRKA 3MOGA 1AHHA 3FWZA 1DAOA 4GBJA 5JCJD 5G0SA 5ILOA 3HE3A 4FD3A 4A26A 1LLCA 4W7IA 1W8DA 2WD7B 3OEYA 5A04A 1HE3A 2DTEA 1FMCA 3HHPA 4J4HA 3JQAA 4ID9A 2CNBA 3I3OA 1E3WA 2OORA 1J0XO 2WDZA 4BGIA 1QLHA 2RAFA 2WMDA 2Q46A 4D43A 1T1RA 4CMJA 1ZK1A 4UUPA 3PQDA 3UF0A 3IKTA 4FJ0A 4TROA 3F6YA 4JBIA 4CV2A 2GCGA 4L73A 4YJGA 4UVIA 2V6GA 4ALIA 1Y8QA 3ULKA 2BHLA 3KM0A 2AE2A 2FZWA 3GDOA 3JYPA 3LT2A 1YL7A 3HUDA 4LVCA 2EKPA 4QT0A 1TB4A 4B4VA 1PR3A 3IS3A 3GLQA 3OEWA 2WEKA 3AUUA 3QP9A 4J1SA 3LK7A 1PGNA 3PJDA 4FCCA 5GZ3A 2C2XA 1CYDA 4IDDA 4HXYA 1T2DA 1D4FA 3JQ9C 2GDZA 3PPIA 5L45A 4KDEA 5LDHA 4LN1A 3CMCO 3LT1A 4HFMA 2EGHA 1LC3A 2P5YA 1X7HA 1NPYA 5CDSA 3Q2KA 3AY7A 2C29D 1LEHA 4A73A 1WDKA 2VRBA 3EMKA 3AJRA 1HDGO 2EW2A 4O5OA 1SAYA 4WE3A 4W9NA 2GN9A 4HFJA 3TPCA 2JJYA 5TRTA 2CVQA 2JCYA 5C7IO 4CR8A 3N74A 3C1TA 5A5FA 5KNLA 1H9BA 4M55A 2WE7A 3HFGA 3ENKA 3WYBA 5ITWA 1DFHA 4PLCA 1KEWA 2O50A 3U4IA 4IY1A 5A05A 4FSHA 4ZQFA 5KKAA 3DZHA 3OJLA 3TZ6A 3RCBA 4CLOB 4FJ2A 1B0AA 4FJ1A 2J5KA 3K30A 1PWZA 3FWNA 4NMHA 1HE5A 4JGBA 4Z0HO 1JU9A 1FXSA 2G17A 3LU1A 3GN2A 2Q2WA 5F21A 2RHCA 2ZCUA 1OMOA 5TC4A 1GAEO 3N58A 4YCAA 4LSWA 3ITKA 1K89A 1ONOA 1ZSNA 5BR7A 4GKBA 1I3LA 5HBRA 1YL6A 4CQMD 3GGPA 4ZD6A 5H83A 4GKVA 3JYQA 1MC4A 5IZCC 4I1IA 4NR0A 4QQRA 4Q9NA 4IJWA 1B8UA 1FDVA 4XKJA 2QRJA 1K0UA 2R00A 3OIGA 4NIMA 3VH4A 3O4RA 1YS4A 3NJ8A 2O4UX 1R4MB 4EJMA 2NM0A 4R1NA 1NR7A 4CJXA 3BYZA 2HKIA 3GVHA 4HUJA 3TRIA 4YAIA 2XAAA 2YDYA 4IUYA 3VZRA 1ZO8A 3FNGA 1TT7A 4DLAA 3HB4X 4RGBA 1JW9B 5T57A 4W4TA 5DNAA 2CMDA 3HN2A 3AWDA 4J9UE 5FEUA 4U6QA 4FFRA 1A9ZA 2BI7A 2J5RA 1EFKA 3DHNA 5L7WA 2BLLA 3Q9NA 3RFVA 1A5ZA 3O8QB 1P1JA 1AGNA 1LSOA 1H6CA 3UGKA 2OFPA 3NGXA 3OFSA 4D3SA 1G0OA 3TFQA 1CERA 1EZ4A 4WEOA 2B69A 3HJAA 1HLPA 2AG8A 3G79A 1H6DA 4MP6A 5JO9A 5BSEA 3EYWA 3JQFC 2DM6A 1H2BA 1SBYA 1F8GA 3MOIA 3AK4A 3CXRA 4E5NA 3LLSA 3VPFA 3K9QO 1UAGA 1KEVA 3VAZA 2C7VA 1DRWA 1NQTA 3P7MA 3EW7A 4Y8VA 8LDHA 4FGWA 1I5RA 2AW5A 4L4RA 9LDTA 2CDCA 1XG5A 4QFDA 3TFOA 4MVJE 3PWKA 4UVGA 3WTCA 5GY7A 3FSRA 5AQ1A 1N9GB 4EUEA 5A3VA 1V3UA 3EK2A 3D5QA 1NHWA 2UDPA 5I7VA 4L74A 1CRWG 4I5FA 1HXHA 1R66A 5JDIC 2F1KA 3CKYA 4IGEA 4NK5A 3C3XA 3E9NA 2H9IA 1KOLA 5JDIA 5K6AA 4R1UA 1ZUD1 3FNHA 2NVWA 2X5KO 1V9LA 1EVZA 3GMSA 2P9GA 1C1DA 3RUFA 2OP1A 2NWQA 2EP5A 1W73A 2PZMA 4L75A 1LLUA 3LVFO 1F17A 4NBVA 4JN6B 1R16A 3GOHA 3KETA 4HNGA 5CDGA 5LCXA 1DDOA 1LRJA 1UXIA 4FFLA 1QYWA 2EF1A 3PZBA 5TQVA 1PGPA 4PLVA 1WZEA 1J5PA 2NU8A 3DHYA 3C7CB 4DL9A 2A35A 2NVUA 4IDBA 4QXMA 3JSAA 3KYDB 1U3VA 4RQUA 5DULA 1C1XB 4ALLA 2QG4A 3GPDG 4RO0A 3RC2A 2RBEA 2J3JA 4PFJA 2YHIB 2HLPA 3RBZA 9LDBA 1LDGA 3DZKA 4YYZA 3KXDA 5CAEA 2RHRA 1AXGA 3GDFA 4WNCA 1U7HA 4DMMA 5B12A 4A5OA 4R5HA 1IB6A 2V65A 1YGYA 3MJ4A 4IDCA 3QA9A 4DQUA 3I6IA 4XYMA 4KUGA 1BGVA 2ZKLA 1C0PA 4YBZA 3SJUA 4E2WA 2CZCA 5CHEA 5A3JA 3PK0A 2AQIA 2Y05A 4QO7A 4OQYA 4G2NA 2RIRA 4HNHA 4KP7A 4WLNA 2VUTA 4BVAA 4JCOA 3F1LA 1MXFA 1P77A 4MP8A 2JCVA 3G49A 2VZ9A 1V3VA 3A4VA 3OIFA 1QKIA 3F9IA 4INAA 5GZ6A 4GGPA 1U3UA 3AUAA 4R41A 2FSSA 1IPFA 5JMPA 2ZQYA 4PG4A 5AXCA 4MIYA 1NHGA 2NU6A 1O6ZA 3FHLA 3UH1A 1SZJG 5ENDA 4NH4A 3OIDA 1WDMA 3AU8A 4YAKA 3F46A 8ADHA 1UJMA 1X0XA 1JQBA 1N7GA 4GX5A 3UKOA 3AFMA 4BKPA 3QVOA 3QWAA 4IDEA 1LDEA 1R12A 1MX3A 2C2YA 2V7PA 3E1KA 2VZ0A 2AE1A 1T4DA 1U2DA 3NX4A 3M2TA 5AYVA 2VRCD 1IY8A 1BXZA 3HNPA 4PN3A 5B1YA 3S2IA 1VKNA 3RUEA 1BMDA 4Z9YA 3GVCA 3TZKA 3ZWBA 2JD1A 3OICA 4GLLA 4NQZA 1LRKA 4N7RA 2PKQO 3C7DB 3AY3A 3L77A 2JL1A 4AFNA 4FDAA 2Q50A 1AE1A 1XEAA 2O48X 1FDUA 4M87A 4E31A 5T6BA 5C3MA 3E18A 1Z45A 3BMCA 3OJEA 2Q1UA 4NFYA 2D5AA 3IAHA 2OP0A 2B4TO 2CF6A 5DCWA 2R6JA 2NVBA 1I3NA 2Q3EA 5L95A 5K9ZA 4M8SA 2W2LD 2J3KA 4XGKA 2JD0A 3JQ8A 1ZJZA 3TZCA 3PHHA 3VC7A 4Z9XA 4EYEA 4UEJA 4ESOA 3E82A 5C37A 2V6FA 4NBTA 1M6WA 4JXKA 4KUHA 3IJRA 4EBFA 4ZICA 4J7CA 5CDYA 3WGQA 4JLWA 3S55A 4AJOA 4BNMA 1GEEA 4MOWA 2VHVA 4TKLA 5FFFA 1FDSA 5IN5A 3VKUA 3L9XA 1MC5A 5L9AA 3I9MA 1C0KA 1Q0HA 4ZJUA 1DRVA 2YV2A 1A71A 3NT2A 3HDJA 1LQUA 1UZLA 1RYEA 1GZ6A 4ND1A 1HSOA 2BGKA 4P22A 3STHA 1VJTA 3RFTA 3PTZA 2IZ1A 4PZCA 2YQ4A 1MUUA 4GWKA 2YW9A 3H7AA 4B3JA 2I9PA 1SMKA 1HYEA 4U0KA 4P8RA 1HE4A 4E3ZA 1EVJA 2QQ5A 3ROPA 3KEQA 4OYRA 4B3HA 3DAPA 2OGUA 3I9KA 1YWGO 1A4IA 1NAHA 4IIVA 4I08A 1U8FO 4WOKA 1WMBA 1GY8A 4Y6SA 2AQKA 1ZXLA 4BO8A 1B3BA 4CM6A 2Q1TA 4K6FA 4MVJP 1O5IA 1UDCA 1MV8A 2PV7A 3NV9A 3U0BA 2HMWA 5CEJA 4HFNA 1LUAA 2C7GA 1BVRA 1Z73A 4LSMA 5ER9A 3L07A 1I2BA 1Z6ZA 2IYOA 3IUSA 1DIHA 4IJKA 1JN0A 1E7QA 1E7YA 3HQ4O 5G4LA 2VWQA 1LDMA 3PJGA 3B6ZA 4YWJA 4BOYA 1JDJA 1U2GA 5MGBA 4IIUA 1ZEMA 4AJ4A 1D8AA 5KTKA 4BV9A 3U49A 4K26A 3RUDA 1GZ3A 4MDHA 1PTJA 1W0CA 3P5SA 3W6ZA 2I5PO 3V2HA 2VQ3A 1I8TA 1Y8RA 1N8KA 3FTNA 4RVSA 3PXXA 1SB8A 3JQAB 5TNXA 4CMEC 4CV3A 3T4XA 3H4VA 3OETA 4R68A 1UXHA 1UXGA 3GG9A 2HQ1A 3DQPA 1Q7GA 2Z95A 1ZK3A 1E3SA 3I9LA 2I65A 1N92A 3M2PA 3JQBA 2ZIZA 4XYEA 5JS6A 3TWOA 4EDFA 3WG9A 1H6BA 1Y8QB 4YT2A 4KQWA 2DBRA 4WOJA 4ALKA 1I3KA 1BRMA 4RVGA 3RI3A 5LC1A 1A7AA 4OXYA 2ZB3A 4PLGA 3EAGA 4GAEA 1Z82A 4A7PA 5L53A 5G0TA 1JAXA 2GR9A 2PD4A 4DPLA 3JV7A 3PJFA 3BHMA 2AMFA 2GNAA 5L4LA 1AN9A 5TS3A 3W8DA 1R0SA 3PFFA 1EQUA 2GYYA 4WLEA 4BNHA 3Q3CA 4A03A 3MTGA 4XB2A 1XU7A 2XF8A 3PHJA 3B1JA 2O2YA 3BMNB 4CM9D 5BNTA 1CF2O 2E4AA 4IS2A 1U5AA 1VL8A 2C5EA 4BMSA 2NACA 2VNSA 3KYBA 4PZDA 2CUKA 2P4HX 4UEKA 2JKVA 1Y5MA 2C59A 4KTVE 2X0JA 3PGXA 1UP7A 3GMDA 2P9EA 1A9YA 3I9JA 3PWSA 5KVQA 4XQCA 5COBA 1OZAA 3GRKA 4NPCA 3BTSA 4BO5A 5JW6A 1C14A 1FF9A 4C7KA 3BIOA 3KYCA 2PZLA 2G0TA 2OO5A 4WK6A 3H5AA 3ICPA 4CL3A 3M6IA 1QV7A 3U3XA 4D3FA 4RVUA 4YRAA 5DT9A 4BO1A 2VYND 2BKAA 4HFRA 3GVIA 1EE9A 1YH3A 1NFFA 3DB2A 3JQ7B 5DP2A 3UN1A 5K0ZA 1WPQA 1ZH8A 5JDCA 2I3AA 2HCTA 1P1FA 3QW2A 4GGOA 2RH8A 3ZZNA 2JHFA 3AI1A 4CQLA 2UUPA 3D5TA 1E5QA 1GEGA 3LC7O 1E6UA 1E1KA 3ZWOA 4MPDA 4M1QA 3ZH2A 4BKRA 4R9RA 4DLBA 2Y99A 1ZSVA 3E9MA 4MVJM 5I7FA 1E1MA 1DC3A 1QP8A 4K6CA 1PJ4A 2TMDA 3ETEA 3VH1A 4IQGA 3BHJA 4H7PA 1X7DA 3TZQA 1N1GA 4B79A 2ZYGA 3VPGA 5CPBA 1HYHA 4Y67A 1KVRA 1MG5A 3KYCB 3RC9A 3E03A 1RM0A 4RZHA 3DOCA 2P9CA 4S1VA 3L4SO 1LNQA 3IC5A 4RF4A 1E7MA 5B4TA 2CY0A 4DC1A 2O23A 5CEEA 1BXGA 1VC2A 1CDOA 4IXTA 5CFZA 3COSA 1EEHA 4GMGA 3PRJA 3ANMA 3GHHA 3H9EO 3AM4A 2Q45A 1R4NB 1JA9A 4MO2A 1OFGA 3DWFA 4QFCA 1T1SA 2H5LA 4GWGA 1LTHR 1C3VA 3C24A 4Z3KA 4YT4A 3QWIA 2OBYA 3WSWA 4XCVA 2X1HA 4KTTE 4PCVA 2I6TA 1T2FA 2QYTA 4PZEA 3WFJA 3PIDA 1PGJA 1ZMOA 1YBAA 3FPCA 1SB9A 1GCOA 4IDFA 4I9NA 1KVTA 2X7HA 2Y93A 3BZUA 1PX0A 3GFGA 1Y9AA 2A94A 3WWYA 1NVTA 2PD3A 1V35A 4IQ0A 4AICA 1NVGA 4CODB 1MB4A 1XHLA 1QLJA 2FWMX 4ND3A 4NNJA 4R01A 4CPDA 1N7HA 3ZNQA 5ADHA 4BO6A 1B16A 2VUUA 4MVJH 1KC3A 2GRAA 3TN7A 3AI3A 4CMEA 2PWZA 4J1TA 2EW8A 2H1SA 1NP3A 4AG3A 5A9RA 5KJFA 1KS9A 4QSMA 1DRUA 3LC2O 2QZ9A 1RM4A 1WMAA 3ZWCA 3ZWVA 3RSHA 3RROA 1HDZA 2HUNA 3HDQA 5TJHA 3W4JA 1MXHA 4XRRA 1YXMA 1LXCA 3FTPA 3EUWA 4YVFA 1P33A 1H6AA 3ORFA 5LDGA 4JROA 4MJLA 3IUPA 3B1KA 3PFWO 4KMSA 2GZ3A 4NDNE 4P4LA 5JAIA 2NLOA 2PKRA 3RC7A 3FPLA 3SX2A 4IZIA 4CM8B 4JP3A 3RFXA 3JQGA 4WLUA 3TL2A 3EHEA 3V1TC 2GF2A 4HWKA 1J6UA 1GADO 4WCFA 2W2LA 1H93A 3NUGA 1WNTA 2PGLA 1LA2A 1LSJA 1QV6A 1T25A 2LDXA 1T26A 1S6YA 3H2ZA 1E3EA 4NJOA 3ROKA 4H16A 2A92A 3ROQA 3ITDA 4WCDA 2D2IA 4DWVA 1QYXA 2VYVD 3O26A 1RPNA 4FOOA 1LDYA 2V6MA 3BHIA 1HETA 3Q11A 4JNKA 1ENPA 1E77A 1VSVA 4AJ1A 1ENYA 2PFGA 3GH3A 1JVSA 2AXQA 1F8FA 3QY9A 5KOIA 2VWGA 3WIDA 1UZNA 4RLSA 2YY7A 2JAHA 1DXYA 1EQ2A 1VKOA 2GERA 2NTVA 1ONPA 2V6BA 3GDGA 3ZU3A 4FBGA 5IDXA 5MDHA 4E30A 3O9ZA 3FD8A 2X9GA 1JLLA 3HADA 1EUDA 1E0DA 5JYDA 3PGJA 1Q1NA 1GR0A 4LW8A 1LC0A 3GGOA 1OI7A 4O63O 3P19A 1NFRA 3DC2A 1VRWA 5DN9A 3SVTA 1ISMA 2YV1A 2GUGA 5TT0A 2J6IA 3JQ9A 3Q1LA 3DTTA 5TIIA 4XQ9A 1OBFO 4BNKA 3DAFA 1J4AA 2BD0A 3EDMA 4S3MA 2D0IA 5F5NA 1ADCA 1B7GO 4RCVA 1U1IA 3NGLA 3RU7A 2EP7A 4CLXA 2YFQA 2CDAA 1IE3A 1V6AA 4YJFB 2I67A 2X9NA 3TZHA 1PR9A 2AA3A 4O6VA 5ES3A 1MFPA 1OC2A 4XD2A 2GASA 1R6DA 2O4CA 2PNFA 1AHIA 3GG2A 4RZIA 5JAZA 3DOJA 3ZWXA 4OH1A 5HA5A 3WBBA 3NKLA 3D1LA 1ZEJA 1ADBA 2IDZA 1L1FA 4HY3A 2W98A 2X5OA 3JQ6A 4MVJD 1P44A 1HDCA 4XWYA 1TLTA 3CZMA 3SXPA 3PHGA 5TSDA 1UZMA 2XXJA 2VHYA 4XDYA 3TOXA 2DC1A 4J7UA 2ZK7A 5I8ZA 3KLPX 3ZWPA 1R4MA 4OJNA 4D42A 1C0IA 3PEFA 1PL7A 4EI2A 5EERA 2P91A 1A72A 1NX6A 4E13A 1ZW1A 4TRMA 1IHYA 4BB6A 2GGSA 4D45A 3F5SA 4RVFA 3JYNA 4YAJA 3BA1A 4ZN6A 3QLJA 4W6ZA 4U8GA 3D0OA 1TVEA 1KIFA 2BMAA 1K6IA 4XB1A 5CG2A 2VTEA 1ENZA 5T8KA 2I66A 2O7QA 3FNFA 1LLQA 2O3SA 4J4BA 2O3UA 1DB3A 4GX1A 3S2GA 1KY5A 5U4QA 4DLLA 3WGIA 1UH5A 4XX0A 5KKCA 2G76A 2X0IA 1NXQA 4X54A 2YHUA 3KRTA 4B4UA 2C0CA 2Z1NA 1ZNQO 3FCOA 4XYGA 1PS0A 2GZ1A 3WFIA 3JQBC 1XYGA 1PJ2A 5GZ1A 4RPKA 1NVMB 2GN4A 4LMPA 2B4RO 2WE8A 2ZB4A 1VL6A 1DC5A 4RDIA 3WGYA 2OMEA 1ZVMA 2HJRA 1Z74A 4B3IA 2HMUA 3VVCA 2Q4EA 4NJMA 5IJZA 2GLXA 4ZQGA 3MTJA 4E4YA 4EUHA 4IQ8A 1JTVA 3KB6A 2HJSA 2PGJA 2YYYA 5BNIA 1IOLA 1RM3A 5F1OA 3R1IA 2PZKA 3DBRA 3OQ6A 4BQRA 3MJTA 1IUKA 4YRBA 3ENNA 3OM9A 4XR9A 4B4OA 3OA0A 3DBLB 3OQBA 1E3WB 3ETDA 3DMTA 2YZ7A 5AVOA 5BNFA 4XQGA 1PQPA 3KV3O 3ZDFA 3CEAA 1WWKA 5K6AC 1E3LA 2GPTA 5H82A 4D79A 4CQMB 5IF3A 4CLRA 3ZCXA 2G5CA 4KZPA 2ILTA 4CMHA 3ADPA 5DDIP 1XU9A 3EC7A 1B2LA 3VTZA 3QWFA 3KYDA 4YJGB 3DONA 2PY6A 4KUEA 5CG1A 4XJTA 4XZ3A 5KVCA 1JAYA 4CUZA 2XOXA 4J7XA 3N7UA 2PH5A 4B7UA 3BXXA 4CV1A 4J49A 1JWAB 1DJNA 3T4EA 1T2AA 1Z7EA 3UCXA 4ND4A 1I0ZA 4J90A 1EUCA 1E1LA 1JKFA 2CD9A 3AOGA 4K28A 4L4SA 4TZKA 4EJ0A 4DPMA 1VSUA 4QEDA 1EE2A 2VOJA 1KYQA 2Y1GA 2CFCA 2PA3A 1Q0QA 4CM1A 1U4SA 5EIOA 4E33A 3RUCA 1Z7BA 1YE3A 1HYGA 4PLPA 5I8WA 2Y1CA 1W6UA 1CJCA 3OF2A 5L4SA 1GUFA 1DIBA 4KOAA 4CLDA 3WGHA 5IZ4A 3PI7A 2AG5A 4NK4A 5T8KC 4YR9A 5IDWA 4Q3NA 3E48A 4CUKA 1YOVB 3ONFA 5L40A 3JQAD 5EJ2A 1PZHA 1QG6A 3AUTA 4CLOA 2DQ4A 3FF4A 3ZHZA 1ONNA 1V3TA 4OGWA 4D0RA 3GGGA 4DA9A 1EBFA 1IHXA 3ZN2A 1Y81A 2Y0CA 5I9NA 5JCJA 3H3JA 4CM5A 3U5TA 3JQDA 4AVYA 3OHSX 1EVIA 1GYRA 2O2SA 3S2FA 3CINA 1T2CA 2DFDA 3WLEA 2I76A 1D1SA 4MIOA 4WECA 4NU5A 4JBHA 2VOEA 3NYWA 2Y66A 4DTIA 1BTOA 2WYUA 2PD6A 5JSFA 2AHRA 2DTXA 2B4QA 4PLHA 2VNAA 3E5MA 2JFGA 3UFXA 2BFAA 4J4TA 4FC6A 2HRZA 1O9BA 4LCJA 4PG6A 4ALNA 1N2SA 3IL2A 1DIRA 3KUXA 1YOVA 3RUAA 1GCUA 1SC6A 4JJFA 3L4BC 2PLAA 3KSZO 3JD2A 3VVBA 3I4FA 3TF5A 4OMUA 1P1KA 3R6DA 2FPIA 4WPGA 2XXBA 3C7AA 4AJLA 2Q1SA 3B20A 3ON5A 1I2CA 3F4LA 2HRBA 4GSLA 1U4OA 3H8VA 2Q2VA 3OMLA 3DZIA 1DHRA 1O8CA 3CMMA 1EDOA 4TWRA 1B26A 4PRKA 4D3DA 1I3MA 3A14A 4BQPA 3O8QA 5TX7A 3RD5A 5KJ1A 3FI9A 2EIHA 3DAGA 3DZFA 2X5JO 1XIVA 1KVUA 3ROMA 2BELA 4ZVVA 5THQA 4J16A 1DJQA 3NTQA 2HK9A 2Y0EA 3ZHXA 3FNEA 2X0NA 5IDYA 5TLSA 5EPOA 1T2EA 4GVLA 3LT0A 3SJ7A 4MIEA 4Z0PA 1LSSA 5DCUA 3WQRA 1C0LA 1O94A 4D7AA 4C7JA 3QVXA 1Q7CA 1K5HA 1MFZA 1HSZA 4FB5A 4DQXA 1QYDA 3F47A 5T5QA 3DBVO 3GFBA 4U7WA 4U0JA 1LDBA 3KTDA 1K3TA 1ZKMA 4N5MA 1AUPA 3G3EA 2ZYAA 4J3FA 2PK3A 1E3JA 4BGUA 1RYDA 3I4CA 4IS3A 1KC1A 1NYTA 2NADA 3HZZA 4BNGA 4E5YA 4F6CA 2X23A 4A27A 1NBOA 4AJPA 5TJ9A 1XWFA 4ONEA 2D8AA 3D7LA 4J0EA 1XELA 3GNTA 3ZNNA 4NI5A 1XDWA 1B8VA 1F14A 2F00A 4OKNA 3FN4A 1I2ZA 3WXBA 3DFZA 1DBVO 1Y8RB 3VDRA 1VJ0A 2FR1A 1G6KA 3H9JA 3JYLA 3QE3A 1DIGA 1ISHA 1X1TA 4J0FA 4NBUA 2Y1FA 4EITA 3K73O 1GV0A 2LDBA 1CQJA 3DBRB 3IJPA 5JDCC 1I36A 4NU6A 3DBLA 2O3QA 3X2EA 3ASUA 1QMGA 4DGSA 3WMWA 4Y6RA 4RPLA 2DTDA 2HMVA 4TQGA 1YDWA 4Y6PA 4DC0A 4CR7A 4PLZA 2E37A 4YACA 5JC8A 2BF7A 2DAPA 3ASVA 3GT0A 4J91A 5DCYA 3RJ9A 4RVDA 4E2YA 2EXXA 5JY6A 2FSVA 3PP8A 2XPCA 2R2GA 3DHEA 4Y98A 4JX8A 3ZV3A 2A4KA 3QQPA 4LGVA 3KSUA 4GI2A 4II3A 3VZPA 1RJWA 3PZRA 2EERA 5KVVA 3GNQA 1HLDA 1ZBQA 1YQGA 3WJ7A 4E5KA 5BSGA 1VLLA 2DPGA 3I1JA 4OQZA 3HDHA 3INGA 4OIMA 1GUYA 4LVUA 2VCYA 2B5WA 3DL2A 1P9LA 3DZBA 5EN4A 1DIAA 4XYBA 4GX0A 3EZYA 1SOWA 2R00C 3RAJA 5A1TA 3ZI0A 4BO7A 4N5NA 4HKTA 1CQIA 4YA6A 4RPHA 1M76A 2P5UA 3MCVA 3CSDA 1A7KA 3FR7A 4PLWA 1IYZA 3GAFA 3PIIA 2RH4A 4L4XA 2O3TA 3VKVA 1EK6A 1I30A 3QVWA 5EINA 5AXAA 4F46A 2BGLA 4DRYA 3GEGA 4UAGA 3GRPA 2B36A 3A9WA 3IKVA 5IZCA 5ENVA 4IMRA 3A1NA 3RVDA 4ALMA 3NDIA 1GQYA 1PL8A 5A9SA 2UYYA 2DPHA 2FHSA 3I9NA 3I9OA 2ZTVA 2I99A 4R69A 3AW9A 3VH3A 1ML3A 4Z3DA 2FR8A 2CVOA 1LI4A 5AOVA 1YJQA 2VWPA 1BWSA 1F0YA 3R3SA 1AXEA 4YTEA 4AJNA 4ZGWA 4JJGA 1H2HA 4IPTA 5CEFA 4LRSB 4DIOA 1FDTA 4DIBA 1D1TA 2AQHA 3KEOA 4M54A 4QO8A 3GQVA 2J8ZA 3QHAA 3WSVA 4B8WA 3WOHA 4LK3A 5JNLA 1ARZA 4B7CA 3T7EA 3TDKA 5HRUA 2EWMA 2W2KA 4UUMA 5JAMA 3TSCA 2GN8A 2VN8A 3IP1A 4D41A 4GLOA 1CEQA 4N5LA 2NQ8A 4E0BA 4PG8A 1X15A 3V1YA 3SLKA 2Y1DA 5L51A 1E1NA 2P68A 2X8LA 1KVSA 1PU2A 2O3RA 2W4QA 1ZCJA 1E3IA 1UR5A 4J9VA 4OOEA 3IIEA 5IN4A 4BNFA 4ZQEA 4MVJG 2I3GA 1PZEA 4Z6KA 4JBGA 1L7EA 1KERA 3HB5X 4R3WA 1WZIA 4GQAA 1MGOA 3TJRA 4R16A 1QR6A 2DBVO 4XR4A 2X6TA 1W4ZA 4TVOA 2C5AA 4M49A 3NDRA 1A4UA 1PJLA 1LLDA 2IRWA 4C4OA 4RORA 3MWEB 3FBGA 2PKQP 3WTBA 1EMDA 3L9WA 3D64A 3QVSA 4G65A 2HK7A 3QJ5A 2HMTA 4XDZA 2OL4A 4EGFA 1C1DB 4AJJA 3GNSA 1LX6A 1PJCA 1D3AA 4OAQA 1QORA 5COAA 5JCXA 3K92A 4DMLA 1MP0A 1YQXA 4E2XA 4CMAA 5G4KB 1F06A 1HWYA 1M66A 1XR3A 1O95A 3OJ0A 4I5EA 3CH6A 1Y1PA 1JWBB 4FR5A 4IINA 1ZFNA 4UREA 4URFA 4G5HA 4B4WA 5HM8A 4BNJA 3WGOA 3ONDA 1BVUA 3LC1O 1I32A 3K31A 1TXGA 2C82A 4E2ZA 5A02A 4EJ6A 2Y67A 2B35A 7MDHA 1UUFA 1GFSA 5CP8A 4BNYA 4QECA 3LDHA 1NFQA 1K6JA 2AEFA 1R37A 1F12A 3P2OA 3V2GA 4ITUA 3ST7A 5B4VA 4UVDA 1UP4A 2WYVA 4GH5A 3GHYA 4OXNA 2X0RA 3GPIA 4Y9DA 3C85A 2CSUA 4AL4A 3RKUA 2EJVA 4E5PA 4OKIA 4ZRMA 4DVJA 5HWSA 2FN7A 2VYVA 1GZ4A 1ZZEA 3VZSA 3B70A 4YAGA 3QWBA 4IDAA 5ICMA 1PSDA 5JMWA 4PLYA 1H5QA 1PJ3A 3T7CA 3LSYA 3NT5A 1TT5B 1PWXA 4PVCA 1ISFA 3DTYA 4HBGA 4BMNA 4YJHB 5KIAA 5L7YA 1NTOA 2NU7A 3WGGA 4DPKA 1BG6A 4DUPA 4TRNA 5ER6A 2BFPA 4LMRA 4AJHA 3WMXA 4R9SA 3BMNA 4IJUA 3ANLA 2W90A 3WICA 3H3FA 5JE8A 1YVEI 4YT8A 3GY0A 4FW8A 3KBOA 4CM3A 3U9LA 1XSEA 2YV3A 3WYEA 3VPXA 4BNZA 4EW6A 5I9LA 4RF2A 1YRLA 1K6XA 1GYPA 1I01A 3QIVA 4IMPA 4WCFC 3VTFA 4L9RA 5JBIA 2VT3A 1ISGA 3G17A 4OXKA 2X86A 1LJ8A 1DSSG 1HEUA 1YKFA 4RF3A 4WLVA 4ZU3A 5JAQA 2ET6A 4LCEA 3G1UA 4BB5A 2VWHA 3UOGA 4UEOA 2ZB8A 3MWDB 1PZFA 2P4QA 4G81A 5A03A 1P1RA 2Q49A 1YB4A 4NBRA 1RWBA 4R4JA 3UAGA 4D0SA 5C7LO 5B37A 1HDOA 3KVOA 1NQAO 2Y1EA 2OOSA 3K96A 2ZTLA 3JD1A 3ANNA 4PLTA 1VE9A 2B0JA 3U4DA 4DBVO 4ZHSA 3PHLA 4KDFA 3GEMA 2DUWA 5A9TA 5DBFA 1PQUA 3JQFA 4WNIA 1HRDA 7ADHA 1LBEA 5GMOA 5ICSA 1SPXA 1JKJA 3JQ8B 1I24A 1DLJA 4JJIA 4R1SA 4II2A 4WGGA 4BUCA 2O3JA 2VT2A 4J2HA 4E32A 2X9VA 3TOZA 2JHGA 4GX2A 3ZV6A 2DLDA 3I5MA 4OHUA 3PHIA 2FOIA 4BIIA 1XLTA 3V8BA 5DBGA 1NM5A 4J6FA 4TKMA 3UVEA 1GTMA 4Q3CA 3A06A 4OSOA 1LSUA 1U3TA 5BQFA 3DZJA 3SC4A 1UDBA 2DU8A 3ZW9A 4MVJA 3WLFA 5F1KA 5DBIA 4ZA2A 4AJ2A 4MKZA 4WUVA 2IXAA 1M75A 3BAZA 2GO1A 3D3WA 4XA8A 1WVGA 3CTMA 3D4OA 2WYWA 1ZSYA 3FBTA 4RJTA 1EBUA 1X0VA 3NEPX 1T4BA 4RVHA 3TL3A 2ZJ1A 5U9CA 1ULUA 1N9GA 1JVBA 2NTNA 4JQCA 4P4NA 4BNLA 3OJFA 3KHUA 2P2SA 1YQDA 2OZPA 3AUSA 3W1VA 3WGTA 4MVJI 1MG0A 2A9FA 2NUAA 3ZNPA 3ZHYA 2HMSA 4Q3BA 3AOEA 1K2WA 3VOSA 2RCYA 1O89A 1R0LA 3DFUA 4H3VA 1UXKA 2AQ8A 3WS7A 4FQ8A 5H81A 3BTOA 3G0OA 3Q9UA 4GPD1 2E6UX 2QX7A 4NHEA 4XRGA 2GN6A 4NJMB 3GR6A 4J2OA 1P1HA 2POQX 2QZZA 1VL0A 4FFMA 3U62A 3IQDB 3P2YA 4CMIA 1EDZA 3ZV4A 1FDWA 3GC6A 3BMQB 1B14A 3PLNA 3M1LA 4LRTB 1SOVA 3V5NA 4E12A 2YQ5A 5IFLA 2NVUB 2QW8A 3GAZA 1GQQA 3OSUA 4UULA 3UICA 5KJCA 3CUKA 2YHIA 4PRLA 1O0SA 1P31A 2FP4A 4MKRA 4MP3A 4NFHA 3HDYA 4FFPA 1Q7BA 1X14A 4K9DA 3E8XA 4FGSA 4U5QA 5G0WA 3DXFA 3L6DA 2UAGA 4QX6A 4TZTA 1PJSA 5G4KA 3RU9A 1HF3A 3DO5A 1PS9A 5JYEA 5AXDA 4CQMA 1TEHA 2PR2A 3PYLA 1BSVA 4CV0A 1RM5A 2FZEA 3V2UA 1JKIA 5EQFA 3VH2A 3CZRA 1Y7TA 2Q4BA 4A0SA 4HADA 4NZ9A 2PZJA 5JLAA 3BMQA 1M67A 1NASA 1BHSA 3MJEA 2HO5A 4A2CA 2D4AA 3D4NA 3WGZA 1BW9B 3H2SA 4TMFA 1ISIA 1V0JA 3L4BA 3HG7A 1L7DA 4CUJA 4RQTA 5I7SA 1Z75A 3C1OA 5FWNA 1YB1A 5A4DA 3K5PA 1GV1A 2YFHA 3WQQA 4CL8A 3ZHBA 4XGIA 3Q0EA 4RPGA 4WLOA 2FPPA 3RQSA 1UDAA 4ILKA 3RWBA 2C54A 3S1LA 2ZATA 3R3JA 5C5IA 2CF5A 4YQZA 4DXHA 3RUHA 4BNXA 1HL3A 1ZIDA 3MEQA 4Q3DA 2Z1MA 2OBNA 3JQEA 4BNUA 4YQYA 1ADGA 2FRDA 4WJZA 2B37A 4DBZA 1M2WA 5EL0A 4BKUA 1XQ1A 5CDUA 3BMCB 3AY6A 5T67A 2DFVA 3TNLA 1GD1O 3UXYA 3GVXA 3ZU2A 3IP3A 2UUOA 3OBBA 5EESA 2HU2A 4KQXA 2ZJ0A 1PQWA 1GQ2A 3W8FA 4Q39A 2NTJA 5JO0A 3UCFA 1XGKA 2B5VA 4ROSA 1IZ9A 3D4PA 4L0QA 4LISA 5KJEA 1HDXA 4PGFA 3VZQA 5F3RA 3EZLA 2VTDA 1I10A 4XQEA 1XA0A 3ZWYA 4F6LA 3L6OO 4Q3AA 1UAYA 5A9SB 1B15A 2BRUA 5TGDA 1WDLA 3DBHB 3U4CA 4UVEA 1SEVA 3ZV5A 2DKNA 1DEHA 1SNYA 3NTOA 2ZYDA 4YAEA 3S2EA 2YDXA 1Q0LA 4NFSA 3AM3A 1B8PA 4K1LA 4BNIA 4XYLA 2QRLA 2WM3A 2D3TA 4FN4A 1BXKA 2IEDA 2ZQZA 3PQEA 2JD2A 2E48A 3I23A 2O7SA 1R4NA 3OJOA 3GN1A 4YXFA 1SEPA 5G2OA 3R0IA 4I9UA 2DUUA 4BO9A 5CDTA 5DOZA 2HAEA 4BO4A 3ICCA 5FF9A 4J1QA 4CMGA 2ZCVA 4RF5A 1VM6A 4IXWA 2IEBA 1BDMA 4IM7A 4EEZA 1KY4A 2QYSA 2ZTUA 3ZGYA 2EV9A 3LYLA 2IZZA 2E49A 2C07A 3WBFA 4I5DA 3W8EA 3G1TA 4KWIA 1ISJA 1Y6JA 1NWCA 3K8ZA 3EVNA 1KETA 3KOUA 2NV6A 3GA0A 1XQ6A 5T64A 4YT5A 2IE0A 1U9JA 3ONEA 4ZRNA 4IJVA 3RJ5A 1I33A 4DQVA 1N5DA 2Z5LA 4W82A 3ZWMA 1ZJYA 4HP8A 1J49A 2WSBA 3AI2A 4N54A 1QXSA 3D3WB 3INTA 1EK5A 5C7OO 3UW3A 1YL5A 3NDJA 3V1UA 4YB8A 4AJEA 4Z0TA 4CMBA 1E6WA 4ALJA 3BTUA 1E7RA 1TI7A 4WASA 3VHRA 4F45A 4YDRA 3TQHA 2BFOA 3H6KA 4MINA 1ZMTA 4XIJA 5ILGA 2JFFA 4OOFA 4CLHA 1NPDA 3GZNB 5FI5A 3E6AA 2TMGA 4RDHA 1X1EA 5IDQA 4MKXA 3DEYX
chains in the Genus database with same CATH superfamily
1H1LB 4EPYA 4IZ6A 3GZ4A 1LRLA 3S8MA 1RXIA 1UMCA 2IDJA 2ZXFA 3JQGB 1Z6AA 4N82A 5JCOA 4DJ5X 4REMA 4YRJA 3R74A 1P9OA 3DOUA 5KAPA 3NIFB 1H22A 2BBSA 3H1BA 2GD1O 4CL2A 1U3WA 3K2EA 1IPEA 1FU4A 3LLVA 4IG9A 1P75A 4LA4A 4F2WA 2PUBA 1E98A 4HJXA 3DXZA 4IAOA 2YICA 1QYCA 4IX9A 2C5SA 4L0CA 2QIOA 4X85A 1EXNA 3HZOA 4PLFA 5A3QA 2WT4A 2E18A 4TYNA 1DU4A 1OSNA 1V7ZA 4MVXA 1OGJA 3TR5A 5AH0A 4AD8A 4ZANA 5KVSA 3I09A 1THTA 1FUUA 2FZGA 3EXHC 3MZ0A 2R4QA 1CQZA 1H5UA 4P5PA 1A5AB 1PKEA 3FI0A 2ZRJA 1KQGA 2J0EA 2M6RA 4KX5A 4AURA 3SFTA 4I4NA 4RHCA 4YX9A 5J4LA 5JASA 1BEUB 1O8BA 1XQVA 3ADKA 3N76A 3UJAA 3ACCA 4O2AF 5AVJA 2ZUFA 4RTJA 1MIHA 2PNJA 2WI8A 1TU0A 2DWPA 1QTRA 3NLLA 3OP4A 3UAWA 2DHRA 3JASB 4AMBA 1U81A 4YJ2A 4BPBA 2HRCA 4UQOA 1DJPA 2OBMA 5IARA 1JIXA 4UHJA 1UT5A 3M5DA 1P74A 4K9OA 3O6VA 3J81k 4QICA 3K6JA 4RENA 3HWRA 2NU6B 4JI3B 4QGHA 4XSHA 3TZEA 4HLQB 1KZ6A 3CCBA 4ZVPA 4C4RA 2WJVA 5K3BA 3A1WA 2P9JA 4B45A 3F6RA 3D0KA 1VPDA 5F2KA 4LHZA 3JTMA 4Q82A 1V7PC 3FJ1A 3UUWA 2BMFA 3GUCA 3QA3E 2NZ8A 4ARAA 2AFHB 4LF4B 1XVUA 3MCWA 4IDGA 3PWZA 1SA0A 3NYIA 2R751 2Y0BA 3KOZA 3L8CA 5KNDD 1S7CA 2PZFA 2WIBA 3SLGA 3O31A 3UV7A 3U4QB 2KHZA 3A4LA 4JLNA 3S81A 3RBAA 1LF0A 3TBFA 2IUYA 2BEWB 1LCIA 3UYLA 3WLSA 5CLJA 4QDXA 3EQ2A 1ADFA 3WO0A 4OHYA 3IAM1 1VHQA 4XEUA 3WK7A 5JWHA 1U5BA 5JSYA 3ZS9A 2QRUA 3NUZA 3P4XA 4QWMA 2P1ZA 1N33B 1UKAA 1JR3A 2F3TA 3IEPA 4NV0A 3WX0A 4AP5A 1MENA 3W3AH 5FI3A 5D5HA 2Q0SA 2VA8A 5FNVB 4C6RA 1NR1A 2P6OA 2ZXEA 3S28A 4CM7A 3IEKA 4F96A 2BF4A 4RHEA 3VYWA 4BNTA 4BHTA 3T95A 4G3XA 1GSHA 2QUZA 2Z5GA 5TQJA 2IW3A 4XVUA 2QTGA 4QUKA 2YOHA 4JODA 3ZDAA 3LVQE 2ZUTA 4J76A 5EIEA 1NNUA 2HSEA 3CUWA 3U4GA 1QAQA 2JAQA 3LK6A 4B87A 2EL7A 4NATA 2UZ0A 3K2BA 1UBFA 1U0BB 4YUYA 4BNVA 3AUYA 1V1JA 1TC1A 5JATA 3AYXB 8GPBA 2OO7A 1PEDA 2E5LB 2IBTA 4A8PA 2X9LA 1XK7A 1QFMA 1Z63A 3A28A 3BWBA 3E7WA 2C78A 3PJEA 4MGHA 1MV5A 1S8AA 4CM4A 2XV1A 4FDUA 4D9FA 4FX2A 2FW9A 3OEHD 4L3WA 4DA6A 3U7EB 4N3CA 3QX7A 4NE2A 2NYUA 1S2OA 1VJRA 2G72A 4ZVTA 1RZRD 3ORRA 3WRYA 1FFSA 3O03A 3CR7A 4WI1A 1M0WA 5AM3A 1X39A 4TTSA 1HZZA 1A8SA 4PSAA 3UJCA 3DW1X 1A3CA 1T6NA 2WUEA 3QTBA 2JNWA 2VSNA 4M86A 4CMKA 3EVTA 4JLVA 3HY6A 4P80A 5LJIA 3ERCA 1R8YA 1V2HE 2W2KB 1AB6A 3DW3X 4MUIA 5K3DA 3EDYA 1DO2A 2W5UA 3ETNA 1K7EB 1M2NA 3C3MA 1P3DA 2NTYC 2REXB 2D7JA 2GFQA 2YUTA 1R0CA 4NBWA 5LBTA 3L5OA 3RK1A 5LQKA 4QUIA 3X1DA 1K98A 4OB6A 4EAQA 2FUCA 1W49A 4I81A 5HYVA 4BX3A 4PX9A 5TT1A 5FYDA 5C2JB 2V1UA 4JAVC 5EIHA 5JC1A 1VMIA 1QRRA 1SXJA 1MLDA 1P45A 1W2HA 5B1HA 4TX1A 1KIMA 3RS3A 2CE2X 2FQQA 2BJWA 2JJMA 2XA1A 1TQ8A 3ICOA 4IDPA 4OQQA 4P3XA 4KNVA 5D00A 4AJIA 4KQ2A 4DIEA 2HL6A 4OUDB 3K0HA 4ASUA 3CVXA 1CF9A 1NDUA 5CLLA 3ZVMA 2XEXA 3DO6A 3RSOA 4OJMX 3GEDA 1WXGA 4FINA 1II8B 2YHBA 3AU9A 3AH8A 3DBIA 1NW3A 1F2DA 1YVRA 5CIWA 1AKTA 2WU3A 3C3YA 1H2XA 4HPXB 2IU0A 5TEWA 1JR3E 3T3OA 3EEFA 2XUFA 1IBSA 1Z2DA 3L1JA 4FC7A 4I9HA 1P29A 2ZANA 2XLBA 4FOSA 5EQDA 3HMQA 2A5YB 1NOIA 3FAKA 5FTMA 1B0UA 3O38A 3I6QA 3V34A 1VI2A 5KSYA 4PHCA 2AYXA 2PYZA 2AEJA 5FA8A 3KKLA 1YZYA 3A6FA 3PXEA 2EGGA 2QT1A 4Q16A 5HF8A 3UENA 5K6RA 2VP5A 4IX1A 5SYNA 3HR4A 1M0TA 3EPPA 1OKKA 2JGDB 2ZJZA 1X7ZA 5ALVA 1KTIA 5BSHA 3HA7A 2GNOA 3EQ9A 4R3NA 3T99A 4DLNA 1ZLXA 1F7VA 2QL6A 1UJCA 1N4AA 5I7EA 3IEVA 3OWXA 3L4EA 3KAKA 4EUFA 3B2QA 2E4YA 3ZQJA 1G4UR 3VR4D 3I52A 2O8CB 1FFHA 1KY3A 2AJCA 4XEHA 3VNAA 1GJRA 1PR0A 5I9MA 4LJ7A 4E11A 2R5WA 1OZ0A 2O1XA 3H5RA 4G63A 3VRHA 2VDRB 1XDDA 1U28A 1P0FA 1J8QA 2PVSA 2WKWA 3FTQA 4LTNA 4RSRA 4WCFB 1K97A 4ZALA 1D0VA 2Y1KA 1C4XA 3CIFA 1E3QA 3D9QX 3P9QA 4EQ6B 1S2DA 1VPWA 2J3IA 1V8BA 1SHLA 3GFVA 3MJVA 3SMVA 2QROA 2G36A 2P3LA 3MNFA 3V42A 4PGAA 2NU9A 3Q1KA 1F1JA 5DGIA 2D5IA 3DYIA 4W7HA 1GLNA 5FCDA 1DTSA 3E2IA 3E7FA 4IIGA 4BLQA 4HLNA 3L06A 3N2KB 1P1BA 3AKYA 1C9DB 2FMXA 3HCFA 4R84A 2JCSA 1X7WA 1MABB 4GOND 3LT4A 3COZA 4DWWA 1E4VA 1X6VA 1EHYA 1H94A 2PKEA 1RP1A 3NM6B 1JHMA 4X1YB 4CF5A 3NBAA 4DSNA 5KCZA 4NX2A 1XKLA 4L5AA 5KSPA 1R8JA 2JEZA 2XGGA 4CTNA 3W2GA 4PSUA 3HSKA 5AM2A 2Q5IA 2CSXA 3KJEA 3D0RA 1KJNA 1E92A 2BI8A 3DOEA 4ND5A 5GQSA 4CLEA 1ZH4A 1P2SA 2HK8A 4H15A 3AJEA 1PJRA 4GLJA 3JAMA 3C3KA 3OTWA 4N5HX 4PO1A 1NQ5A 4YFYA 5BYBA 5T41A 1ZGBA 3INRA 1UBJS 4FNGA 3DZ8A 5KYNA 1ZQ1A 5IKOA 2B5OA 2AOTB 3GDHA 2OCYC 1K8YB 1TLFA 3A6LA 3LG2A 4B7XA 3DKIA 2VC2B 2GQ0A 1WHTB 1HE2A 5J5CA 4BEVA 2FW1A 3CLRC 1DCTA 5HKAA 4MUKA 2V7QD 1QG0A 4AY5A 5ITVA 4U1RA 3SKVA 4NEQA 4INPA 1JLSA 3DNMA 4RKEA 1HTTA 4M0KA 3EZXA 1B3RA 5G0UA 4DNOA 1L4MA 5JFTA 4PYOA 5MFPA 5H68A 3N2KA 1U7XA 2CK3D 2WWRA 4EG0A 3ZWWA 4RHFA 3TI7A 4DLZA 3DR3A 4LNAA 1FJ2A 4QGBA 5F23A 5IYZB 4JS0A 2VI5A 1YU9A 4B35A 3NEYA 3RSZA 4JLSA 1Y6QA 4YROA 2HA6A 1UEXC 1JRLA 3OFND 5G0VA 2VO1A 1JE0A 4TL9A 3ZWAA 1N1EA 4MVJF 3T0FA 1GDTA 2I1LA 3OLYA 4ZVQA 1KZ9A 2FPGB 1KQNA 4HAVA 1G1MA 1IL0A 1KS2A 1ZVJA 4BLPA 5CBPB 2GWHA 3VAYA 3VDNB 1KI3A 4TRJA 4Z51A 1ZAYA 2ZJ6A 4KQ6A 3EEYA 2WLTA 3FUXA 3N2NA 2HY7A 3B5EA 3WYGA 4OG2A 1GCGA 3PVZA 5BWBA 5DZSA 4DWJA 5K45A 1IEXA 1KR2A 4P36A 3TR6A 4LQDA 4IIDA 5HK9A 1B1CA 1DFIA 2WD8A 3C8MA 2D0PB 1CEYA 2CHQA 4HWGA 5HUHA 2Q7XA 3A36A 2IXBA 3JWJA 1KYTA 4A15A 1L7BA 1CE8A 2DJ5A 5SICE 3WQSB 2ZJOA 1F8YA 1TA4A 4PXYA 1RKXA 5CFNA 1ORRA 2ZXUA 2WTUA 3LUAA 4HVTA 2FPIB 2I7TA 1HH4A 3PEVA 5B5SA 1Y6RA 2VJPA 2H1RA 4QLAA 1U8ZA 4EQZA 2CEAA 2HJVA 3FJOA 2OXTA 1XRJA 1W88B 3NJRA 4IKOA 2GH1A 2DSNA 2P6NA 4Q4HA 1EFVB 1KEEB 3RASA 4XJSA 3WDMA 3ZU5A 3ZQ6A 1EP1B 1YE5A 1WQ4A 4IWXA 4Q4CA 1YV9A 1GQOA 3FUVA 2XTAA 4F3RA 4XIGS 3GP5A 1Y9EA 2CLSA 3NFRA 3GGCA 4GLBA 3H9UA 4NH0A 2ZTSA 2X5XA 3AEYA 3KQOA 1DMSA 1CVRA 1TD9A 4Z4CA 2GEFA 5KSWB 2CZQA 3VR2D 1ST3A 1QFXA 2RGGA 1BEEA 3LQKA 3U1BA 5CGQB 1N5RA 3YASA 4LOLA 1XVVA 1KMIY 3O74A 4M0UA 3RC8A 3VNUA 3B8HA 3EIEA 5EJGA 5JVDA 1U7UA 1M2VB 4MWSA 4NZYA 1JMYA 1U0EA 6AT1A 4U8HA 2OTCA 4C4ZA 4G0YA 2N0SA 2VBFA 4Y2SA 4FEAA 4YWHA 3C6QA 1XCBA 1XTKA 2D2FA 2NPFA 1BGXT 1YZUA 3QNUA 4JJEA 3PYMA 4QNNA 4RSGA 3T54A 2OGWA 1DAPA 1WCYA 4BQFA 5JTTA 2XXAA 2BHSA 1KSGA 1TZJA 4HB2A 8ABPA 2X22A 4U63A 4UUAA 1XXHE 1XNHA 1D0IA 3DLCA 2JGLA 3VISA 1CC1S 1QFZA 1MEEA 2DFLA 2PQMA 3KR2A 4Q66C 5CPFA 4G07A 4TKUB 1YJ5A 3FWZA 1DAOA 4H1WA 2QU8A 1BROA 3HE3A 3BWYA 5D3ZA 1J90A 4HXEB 5BW4A 7REQB 3LQRA 4WESA 2L17A 3PR1A 4HDRB 4Q0MA 1HE3A 4GKAA 3SLRA 4Y9UA 1X1SA 1C29B 2GVDC 1ZOIA 2CNBA 2G09A 2FWJA 2I8CA 2W2TA 4B84A 2JFYA 2O57A 2OORA 4IF6A 4JB2A 5C53B 1RZRA 1L6RA 1NBMD 2JA2A 2WMDA 4D43A 5AHOA 3LP6A 4CMJA 4FOTA 4DLXA 1OYOA 1UQUA 1ZK1A 3BEOA 4FYXA 4QXOA 1T3TA 1U0RA 4ZO4A 4YQEA 3ZKWA 1KYYA 1U8TA 1W9MA 2PMBA 2ZRLA 2Z04A 4F8YA 2CVHA 3CKKA 3F6YA 4L5IA 2OM6A 2H5IA 4TGLA 4YJGA 4YP0A 4BVFA 2V6GA 1KK3A 2XCIA 3IQFA 4DRXA 3ULKA 4DCPA 2BHLA 4V0SA 1E9BA 4TV8A 3OQPA 5EJMA 3GDOA 3JYPA 4LVCA 2WB2A 1VPEA 3TDNA 1M7HA 2IHNA 2G3YA 2IUSA 2X19A 4JC4A 4B4VA 4RGQA 2XDYA 2PT6A 3OEWA 2PX6A 1YZGA 2J3EA 4NSNA 1K2VN 1CTQA 2MYPA 2P4EA 2XGMA 4RANA 2FX5A 1RXCA 1N2GA 3T5GA 2YKGA 1CYDA 4QU5A 4GGMX 4IDDA 4HXYA 2PZAA 4MW4A 5L45A 3NTUA 2D1RA 4RIGA 3W9YA 3PUVA 1EGMB 3LT1A 4JXJA 4D8TA 2HJ9A 2X4IA 4MR8B 3SYRA 1NPYA 5SZKB 3C3AA 2C29D 1AOXA 3ZIDA 1LEHA 1CW2B 1HDGO 1P6XA 4QATA 2GETA 4W9NA 5AWFC 1FLVA 1S89A 2DPXA 1S8OA 2PSEA 4A8JA 1AQUA 2JJYA 2UZ3A 3GEIA 5TRTA 4DA0A 3BN3A 3PX3A 5LKAA 4OATA 5C7IO 3WRVA 1Z15A 4L08A 2OO3A 3C1TA 3ZLBA 3AVYA 1JGTA 1HY3A 1QUEA 2WE7A 3ENKA 3CT4A 3JALA 3M4NA 1DFHA 4PLCA 2X1VA 3CUYA 3FY4A 3KB1A 4IRXA 4S24A 3O9MA 1PDWA 4CEIB 4WAUA 3JAKB 4FSHA 3VPDA 2B7LA 5FBWB 3GARA 4ZQFA 1G8JA 2CBXA 5KKAA 3TZ6A 1M8GA 5KYWB 2JHCA 4FJ2A 5BY2A 1VIYA 2KX7A 3L0IB 5LP6C 5DYTA 1N32B 1ECLA 4W8OA 4FFSA 4PGGA 1ZITA 2ZIWB 4FHGA 1CNEA 1RZVA 1JU9A 4H4EA 4NDZA 4ZOCA 2Q8NA 3FSGD 2G17A 1Z34A 1LK0A 2NAFA 2VRWA 5F21A 3H0KA 4HS4A 2RC5A 3WMGA 5IWAB 2OCLA 2K5UA 2QV7A 4C20A 4L5YA 3N58A 1RABA 4YCAA 2I4MA 3ITKA 1U2RA 3B1VA 5I5EA 2PXXA 1WZ2A 2OQVA 5IVIA 4AO7A 4HPWA 1XVIA 2QVCA 3EOBI 3I6YA 5BR7A 1MGPA 4DHEA 4RK6A 4KR7A 4HWOA 1M1YB 4GPTA 1Y5NA 3GLVA 3QBEA 5H83A 4DVGA 5J3JA 1MC4A 5BSRA 1XT6A 5AJVB 5TE9A 2HGSA 3OF3A 3NWOA 4I1IA 4OP3A 4QQRA 4ZODA 4YMGA 1QTNA 3F3MA 2G5PA 4IJWA 1L4LA 4YO7A 2M98A 2ZT8A 4M83A 4NIMA 2FPUA 2J7KA 2NUTB 1SQ6A 2ZBDA 4RJKA 2FU5C 3INYA 1YBFA 3IUMA 4WV3A 3W2FA 4RTPA 5JSUA 5I7OA 3LO8A 4MDYA 5LOVF 3SYLA 2QVYX 3BYZA 3CNHA 3CX6A 1YHYA 5DSXA 4AT1A 4S05A 1J8VA 3MA0A 1PT8A 4M53A 2NOAA 1EAYA 3TE6A 2QGFA 4QASA 4HT3B 2BZSA 3D5EA 1JW9B 3HB4X 4C5CA 4RIIA 5DNAA 3FHTA 1CIJA 1XQWA 2CDRA 3KELA 2ERXA 1KARA 2XADA 2GK6A 1GPBA 3KZOA 1XZLA 3QBVA 2QLFA 1ZESA 4Z8XA 3KZNA 1ZIYA 1XDZA 2J5RA 1EFKA 3OIVA 2FVYA 3LXXA 2BGRA 3DHNA 3D8NA 2FRDC 5L7WA 2AB0A 4F60A 1AGNA 4TTIA 1HBJA 3B6IA 4RW0A 2UUCB 4CIXA 1J56A 4JYPA 4B6GA 4UM9D 3TFQA 3REGA 4L95C 1CERA 1EZ4A 3M9XA 4BEJA 5CX1A 4UTVA 5BW8A 2ZZMA 2IHTA 2H4ZA 3HV2A 4OA5A 4HB3A 1G7CA 2AG8A 2EGUA 3G79A 2DQSA 1KP3A 4MP6A 2O14A 3THYA 1VLVA 2YBEA 2RIPA 1OT3A 2XY4A 2DM6A 3JW8A 1U2PA 4JQOA 4WY2A 5CJPA 1F8GA 3MOIA 4YH1A 3JARB 2FEOA 2VHUA 3CG0A 4E22A 1VKZA 3RIHA 3LLSA 2VK4A 3K9QO 3VPFA 4CEJA 4Q1EA 5J58A 4FR2A 1WSBA 4YP1A 4KV9A 1BOFA 5JCPA 1R8QA 1RJFA 4PSCA 1JEQA 2ZI3A 5E4YA 5KX5B 2LNDA 2PU5A 1RI4A 2P2YA 4RA6B 4Y8VA 3V00A 4RU1A 3O3CA 9LDTA 1AKUA 1G6HA 2PJUA 2RGUA 3QFSA 2CDCA 4QFDA 1OA1A 3TFOA 3PWKA 4UVGA 4Q6WA 4IH9A 1NJ1A 3TMKA 4CWAA 4O4IB 3FSRA 3CUSA 5AQ1A 1N9GB 2GHIA 3E3NA 3O82A 5A3VA 1SUCA 2YIJA 4GP9A 4G23A 1JHZA 3G2KA 4I5FA 4UMDA 1VL1A 4DCJA 3KFXA 4G1BA 1XTVA 1UIMA 1QNFA 4KO2S 3GEBA 4IGEA 4QOEA 5EPUA 5BW5A 3WK6A 2H9IA 5K6AA 4IFIA 4R1UA 3ET5A 5ALTA 5INTA 1GRQA 2AGVA 3RWOA 1PG2A 3QELA 4OHBA 4QPCA 1QZTA 3RUFA 4ABYA 2BDTA 4X44A 1HI9A 1W73A 3PNPA 3AR8A 4D0LB 4RLFA 2C1XA 1QYIA 4HNGA 2Z2XA 3L7BA 1DDOA 5LCXA 1TJ5A 2YWDA 5JU6A 4H6XA 2TMYA 1RIIA 2VJNA 4PLVA 2RHBA 1WZEA 1AUQA 1Z22A 1FDOA 1R5BA 2OG1A 4ZTZB 1KDRA 2ZBPA 3U9TA 4UHDA 1CEXA 4DL9A 2VAPA 2IIVA 4ZK2A 2A35A 3QVLA 4H7DA 5TMDA 4QXMA 4DLTA 5HKBA 1GNPA 1U3VA 1WDWB 1ML4A 1DC8A 1C1XB 4DMUB 5IUJC 1FFCA 4V0OA 3S5JA 1L5RA 3OLZA 4RO0A 4OI4A 4I19A 2FEXA 4P7FA 2OCIA 2QGNA 3RC2A 2J3JA 3RBZA 1S3FA 2J09A 1LDGA 2NNWB 3DOIA 2JGMA 4I1OA 3MINA 5AI6A 4WNCA 3EBOA 1U7HA 3S7TA 5CAEA 2QM8A 3UGQA 5IAKA 1W0KD 4JT2A 4KREA 3VSCA 1RI1A 4MQ4A 1IB6A 4K9PA 1V25A 2BZGA 1U8AA 1X8XA 5GAJA 4IDCA 2XKBA 4TN1A 5T7BA 4ZCQA 1NSTA 2FGJA 2PL3A 2ZRAA 4JZYA 4QHYA 5CDHA 1SKBA 4KUGA 2OCAA 3WZLA 2R6R1 1X1QA 3NB0A 3PK0A 3VZBA 5A3JA 2F9LA 5FTWA 4OQYA 1XZQA 2RIRA 4HNHA 4KP7A 1DBSA 5HR5A 2P6RA 2P9ZA 2PMEA 4PZLA 2LPMA 3BXHA 3LBHA 1Z4JA 3BGOS 1XMQB 3BHNA 3A2LA 3K3PA 3DWIA 1SUAA 5HFNA 2VZ9A 3W2EA 1K4YA 3ZZTA 2B9EA 4DAEA 3U4MA 1Z0SA 3CRW1 3UKDA 1FUEA 2HK6A 4ZARA 2I3BA 1XDBA 2VL7A 3BFKA 3AUAA 1DO0A 1SUIA 3DT9A 3EFBA 3FWYA 4GGPA 4NYJR 5JMPA 4G0QA 3SS7X 1QRUA 4IUBS 1Z6PA 4RY2A 5AXCA 1Q17A 2H2GA 1J9ZA 2VHEA 5ENDA 1GCAA 3OIDA 1JZSA 1G6Q1 1WDMA 3AU8A 3KSBC 5U4XA 1UJMA 2I2BA 1JQBA 4LHYA 4D9NA 1FNNA 1R0RE 3WLQA 5K0TA 2KPOA 4G0XA 3QVOA 1U3FA 4BKPA 3DE4X 2P41A 1OGYA 3ZGLA 1XTIA 1R5NA 2YMMA 4TYWA 3E1KA 2VZ0A 4KLZA 1C1YA 1U2DA 3NX4A 5AYVA 5HUQA 5FUQA 2FB9A 1BXZA 3HNPA 4IJMA 5B1YA 2QN8A 1VKNA 3RUEA 4DG9A 3GVCA 4H2DA 3Q3HA 2JD1A 1JIVA 4NQZA 4MS3A 3KPVA 3TNYA 4KFTA 3MLBA 3L7DA 5KTPA 3HO6A 2IPOA 4JQSA 4R6XA 1KO4A 1A2OA 2VA9A 3MYRA 3OHPA 4IIFA 1YRBA 4TLMB 5A7HA 4EX7A 2ZVJA 3AONB 1QHFA 1U98A 1AE1A 2B0CA 3CGWA 1UPUA 3N39C 4FDAA 5T6BA 4M38A 5C3MA 4UQPA 3PT5A 3BMCA 4OBEA 2J9FB 3PDIB 3PC7A 2Q1UA 1X1DA 2EC5A 4PNZA 1II9A 3HV0A 2B4TO 2CF6A 4FSDA 1CJUC 3W05A 1P2GA 4K2AA 2R6JA 1J39A 1I3NA 3UMJA 2GZHA 4WK2B 2ZWMA 4M8SA 3LA8A 3WIOA 4X1OA 5IKPA 2LCQA 3DO8A 2XMQA 2ZRDA 2X2PA 4XGKA 3QKRA 3NZEA 2JD0A 4MRMB 5HRAA 4L7QA 1YQQA 2C7BA 4A8JC 4RKQA 5K8IA 1JG4A 1DTWB 3KWFA 1KK1A 1YT5A 1DAMA 1YB2A 4U7JA 5M2QA 3R9WA 5LD2C 1Z2CA 3MHPA 1P5RA 4TTPA 1A9QA 4REQA 4JXKA 3EIUA 4PSKA 3IJRA 4MQ5A 4C76A 5THXA 5CDYA 2Y0PA 2UU9B 3WGQA 2G07A 3CRNA 4JLWA 3RJMA 3JATB 2H1OA 2C4HA 2GWRA 5FFFA 4G0PA 1V16A 1DJMA 4KXFB 2OHFA 4BJHB 1C0KA 1HL7A 1Q0HA 2XMCA 3JAWA 5SY6A 3D6UA 1TTQB 2BE9A 4ZJUA 5CB8A 4YQFA 4EF4A 4A92A 4HNAB 1UZLA 3GJ3A 1GZ6A 1NW7A 2BGKA 2IA5A 3KKMA 1VLHA 3MCZA 4K03A 1VJTA 2I7XA 4P22A 4ZZ2A 1K8QA 1IY1A 3RFTA 2IZ1A 1ILEA 4F97A 2XAUA 2NO4A 4H1TA 4PZCA 5A4KA 1MUUA 1YR2A 4B3JA 1J2UA 1KI6A 2ST1A 1HYEA 2AC2A 1FRZA 1HE4A 2PFSA 2V7VA 3CLUD 4P84A 2PA0A 3SXJA 3L01A 5JD6A 1XCMA 2VSXA 4KODA 3I9KA 3DZDA 5IMBA 4BLOA 3TTVA 5A71A 3T35A 2JJ1D 3ZEIA 1PJZA 3MQ2A 4IIVA 4W1SA 4I08A 2J30A 4Q4AB 4WOKA 1IDOA 2JGAA 3P4YA 1GY8A 4TL7A 4EKGA 1UK9A 1BQEA 4DJJA 3DV2A 4FYKA 5K0EA 4ZEMA 5JANA 4CM6A 1SQGA 2BFWA 2WMOB 4ZKEA 3D31A 4B71A 4K6FA 3V48A 2IXGA 4CI9A 3SKYA 3NV9A 2JGJA 4LI0A 2HMWA 1Y4DE 3BIFA 1GQSA 2C7GA 1DMRA 1MQ8B 5ER9A 2QTCA 3SZRA 2XUHA 1SC9A 3ZV7A 1O5OA 3HUUA 5DHFA 3IUSA 1FVFA 1P9WA 1DIHA 4KAJA 1OZHA 1U02A 2QN2A 4IJKA 4F0JA 4WZAB 3HQ4O 5G4LA 2IDKA 1W5AA 1LDMA 3BK7A 3RH0A 4MPJA 3GEEA 4BOYA 2I2AA 4N39A 1D8AA 1V4VA 3LBFA 4BV9A 2H3EA 3U49A 4K26A 2QD2A 2PUDA 1GZ3A 1IJKA 2GX6A 3M6VA 2MINA 1NJGA 4Z1MA 1HQYE 1C2TA 4C0LA 2GUWA 4CG2A 4YUXA 5I45A 2Z3VA 3OY7A 4S2EA 1E59A 1IN4A 3EFEA 1DG9A 1XEWX 1N8KA 4LRUA 1JH8A 5TNXA 3JQAB 3TLEA 1ABEA 2OQIA 2QN7A 3T4XA 3K1JA 3WSTA 2Q2NA 1UDXA 1C9NA 4ARVA 4DG8A 2OCKA 3VQTA 2HQ1A 2WQ7A 5AKEA 2OLEA 2J87A 3BRCA 2X0EA 1VRCA 4X7RA 4JEUA 3SQNA 2Q5OA 5BT8A 3AZPA 5SY9A 3RF6A 4MB6A 4QBKA 3OPYB 4U2GA 3V4SA 3DTNA 1SWVA 3L0CA 5BV1A 3M70A 3ZXYA 2HPAA 1F6WA 3WG9A 1H6BA 2QAGC 3SE7A 1F8XA 4KQWA 1AS3A 4HRYA 2QKYA 1KO7A 1V5GA 3V9AA 5KNBA 2XYHA 3KUDA 4BJ1A 4ZEOA 3AHEA 2WZCA 3Q5EA 4PLGA 2HCFA 1OB2A 4IDNA 4GAEA 3R7WA 3FLMA 1P1CA 1ZGCA 3R7FA 4R7GA 4O4LB 1MTOA 2BJHA 3A04A 4TMKA 1AF7A 2W8BA 1HMYA 3IH5A 3CPJB 1Q7EA 3PU6A 2ZIVB 4ZEXA 2FWPA 2R86A 5AW3A 3S2UA 4WLEA 1ZA2A 2ZE8A 4BNHA 3PITA 1UPCA 2BFEA 3F7OA 4TLDA 1KFKB 1RC1A 1KBQA 2XF8A 4ODIA 2O2YA 3IPRA 4BP3A 2FRVA 4ZFNA 5BNTA 2ECKA 2V98A 1X80B 1G8MA 1IBLB 1TX4B 3S5UA 1IH8A 1O4VA 2X7XA 3DE7X 1JQJC 3UPDA 1EG2A 2NACA 3GEHA 1SC4A 4R8RA 3RIEA 1QP4A 4PZDA 2CUKA 4HDSB 3S1SA 1Q0TA 4CF6A 3CGGA 3AGPA 2A88A 1E32A 2F43B 4D9IA 1A9YA 5EE9A 3GRKA 1IJBA 2W2PA 3VMFA 2ORED 3LKVA 1J06A 3A1FA 3P0IA 1UC9A 4M9QA 5GJBA 2PZLA 4G5FA 2ZRQA 4P58A 3IJ5A 3MJHA 3HZRA 5BVGA 3I2HA 2IOYA 1M6VA 1YC2A 3CEPB 3ICPA 4WY8A 4JZKA 4RVUA 3U3XA 3U60B 5DT9A 1HA3A 3HN6A 4RTNA 1YK0A 4JQYA 4BEBA 1EE9A 4G5YA 1NFFA 1H2AS 3AY0A 4Q3OA 3O2QB 1HFJA 3UN1A 2XT0A 1UOPA 4Y2JA 5JDCA 3U1TA 4V0NA 1MQSA 1G5TA 2H59A 2X40A 4Z54A 1L7VC 2R7LA 1P1FA 2GHTA 2RH8A 3U3RA 4BN4A 3JVUA 3EC2A 3AI1A 2UUPA 3D5TA 2A78A 1EJ0A 5G02A 1E1KA 1W4RA 2R1UA 4M1QA 3DG9A 4ZOBA 1G5IA 3S7ZA 4DLBA 3OTIA 2Y99A 2GKOA 3SR0A 1G59A 4KQ1A 1FRFS 4QOJA 5I7FA 2LP4Y 5ARBA 2X76A 4H6WA 3HBFA 2F9FA 1DC3A 5EG5A 4N48A 1PJ4A 3W04A 3K8QA 1O94D 2KM1A 3ETEA 3BF7A 3BC1A 3HXMA 1N1GA 2R1TA 3X43A 1LK5A 2NO1A 2W0SA 5CPBA 3KTFA 5YASA 4Y67A 2ATVA 4EFDA 1G66A 1MG5A 1YNOA 3RC9A 3T15A 4XWOA 5I9LA 3HM9A 1OTYA 3EEQA 2VDPB 3K15A 1CUVA 1Y4AE 5EQJB 5MN6A 1XMXA 1NDQA 1YJAA 2IZOA 3O8LA 3GRCA 3PNBA 4ID3A 3JXEA 5LZ5A 4Z2AA 4DC1A 4XUCA 5PNTA 5CEEA 1BXGA 4IXTA 4WBNB 5FBQB 4XASA 2RH9B 3ANMA 4M1WA 4WZAE 4INJA 4HZUA 5FLKA 3KJIA 3G5MA 1T5LA 1JA9A 4NU0A 1DKQA 5K1ZA 2FR8C 3W34A 1P0PA 4Z3OA 1P4GA 1MO4A 2D7CA 3QUSA 1N9ZA 3M5WA 3PIRA 4JDUA 1T1JA 5CCDA 4LJ4A 1LTHR 5J43A 3GBPA 3ZZ1A 1C3VA 4V1CA 3T41A 3PG5A 3ESCA 3EJ6A 4QPDA 3GQBA 4C7VA 3MC1A 5BNWA 4TV8F 3TTUA 2F1HA 3WSWA 4PQFA 4M1KA 3G9QA 3A6PC 3W2IA 4XVHA 1XZDA 2F1IA 3U0VA 1SKAA 1QH1B 3NNSA 1SKUA 2HNBA 2X14A 1GCOA 4DMCA 3OVMA 4DSZA 1GT6A 2Q6VA 3A2MA 1KVTA 1YFZA 2X7HA 3BZUA 2VQDA 4QU0A 4G9GA 3TQSA 1UINA 4S35A 3AF4A 3IUNA 2VKQA 4M9XA 5CITA 3HACA 3H84A 5AOCA 1YAHA 1MQAA 1PAUA 3WWYA 2OILA 4YP5A 1DE0A 3VU1A 2XZLA 1L5FA 2LBPA 5HTKA 3BIWA 4Z9AA 1TYBE 1NVGA 3W2TA 1MB4A 3RRXA 4KKVA 3UMGA 1VYHA 4MQLA 2FWMX 1I4EB 1T13A 2FNAA 3FUCA 4MQEA 4O2BB 2OFXA 4D82A 3GLFB 3P2MA 2P5TB 5FWYA 2JIOA 2OYRA 2PWZA 5I3CA 1IMJA 4HQ6A 2H65A 5GVSA 1NP3A 4AP6A 4X97A 3EB9A 2C3UA 1KS9A 3EXFB 3QHQA 3KPUA 3LC2O 5CURA 4A4DA 1VCMA 5C4IA 2JB9A 1NU8A 2QZ9A 3ZWCA 5GGXA 3A1VA 3MGKA 4FGUA 4RIEA 2LTAA 4OI1A 4TKUA 4CG3A 1B23P 4LYFA 4NBNA 5J47A 1WD5A 2HUNA 3HDQA 2QXUA 1SIBE 3DJYA 1E0SA 4RD2A 3L1VA 4IDQA 1R0YA 1UKBA 1HYQA 3TXYA 4AF6A 4UPEA 4IMJB 1YACA 3HRHA 4GM4A 1LXCA 3HCBA 2KJQA 4YVFA 1P33A 3MTAA 121PA 1I4OA 1KZ4A 3IUPA 2DR2A 1QB7A 5LQDA 4NENB 3E61A 1RHUA 5JIBA 2RAUA 4P4LA 2X8BA 3EGEA 3MRTA 2FUG6 4IXNA 2XYGA 3FPLA 3JRWA 4IZIA 4Q05A 5KNBD 3Q0IA 3RFXA 3ZKWB 1NUQA 1XRMA 1ORDA 1J7KA 1CJMA 5IT0A 2HSWA 3EHEA 2E1RA 3NTLA 1N7JA 5FYQA 5C0OE 4DIMA 4YUZA 4Q02A 3T9EA 4AJ9A 2WOJA 3I58A 5BYAA 2ESRA 4BAGA 3KQNA 1PV2A 1U3GA 1QV6A 3B3FA 2LDXA 2PG3A 1T26A 1S6YA 1E3EA 1FTQA 4EVQA 3M49A 1MX1A 3P9SA 3C3CA 2HT1A 1D2EA 1AURA 2AC4A 2Z09A 3B9QA 4GI7A 5KTRA 2VP0A 1RAIA 4Z99A 3ZE0B 4MMYB 3SEAA 4DWVA 4C2UA 4FOOA 4HUQB 2XE6A 1LDYA 5IKXA 4G4IA 3PNVA 1W93A 3LWBA 4AJ1A 1DWQA 2CLLB 2PQ6A 3IO3A 3IRVA 3WKAA 2HN9A 2ZSEA 4L27A 1JVSA 2WT8A 2AXQA 2ZSUA 4P0TA 1SBQA 3IVAA 1IRXA 2FMFA 3QY9A 3TQIA 5KOIA 1TZKA 3JRNA 1QH8A 4M4SA 1UC5B 4ZDIA 1DXYA 2GERA 3UHOA 3R3HA 4B3CA 2FSUA 2V6BA 4C0XA 2V7EA 4I6EA 3ZU3A 4DZZA 4L07A 2IPLA 5FO1A 3O9ZA 3HI6A 3FD8A 5B58C 2X9GA 4Z4FA 1AV7A 4KXWA 3PGJA 4R83A 1DEKA 1LC0A 3B36A 3V8PA 1Z4MA 1SXPA 1POWA 3DC2A 1T5HX 3F2IA 3WAKA 3SSNA 2R7KA 1VRWA 4P81A 4U00A 5DN9A 4FR0A 2J7PA 2ZP1A 4F11A 2YV1A 5ILQA 4DSTA 1QHYA 4DCGA 3I5XA 2J6IA 4GR5A 3HKEA 4FTWA 4FYIA 2QUBA 2IYNA 4DLVA 5TIIA 1WABA 1WSAA 3PQCA 4QD3A 1P62B 4XQ9A 3DAFA 1J4AA 4OAOA 5F5NA 4FWIB 1ADCA 3WNCA 1U1IA 3DMPA 1HZZC 2H1FA 3NGLA 3Q8MA 1VZ3A 2BGTA 2Q8PA 2YFQA 4AKHA 2CDAA 5F76A 1N2EA 1V6AA 1XZFA 5DV9A 2COKA 1Q77A 1DAGA 2A84A 4P5EA 3I2KA 4RMHA 4B32A 5JNUA 1VCIA 3AL3A 3TZHA 5KU7A 4LK2A 4O6VA 4C0HA 1MFPA 2GASA 4N4AA 5AKIA 4KR3A 2G9VA 5JAZA 3DOJA 5C8YB 3WBBA 3NKLA 2AW3A 1IDN1 1ADBA 2IDZA 3ISJA 1L1FA 4HY3A 1RQNA 3FWPA 3HVJA 3JQ6A 1MCZA 5E9WA 3CZMA 4ZOLA 2BMVA 3TVDA 1S1CA 2B61A 1VPVA 4OVKA 2VHYA 4XDYA 5IYZF 1UFRA 4RK4A 3B12A 1JPVA 3ZWPA 4E51A 1E0AA 4FDMA 1UKCA 1J97A 3ELBA 3L04A 4D42A 2QBYA 1W48A 3UMMA 2NSLA 2BMEA 4EI2A 1OAKA 3HPQA 5EERA 2C00A 1G17A 3I53A 2P91A 5HKLA 4DNPA 4JY7A 3HPRA 3LIPA 2RHDA 4HG2A 2X4LA 2YVQA 2G80A 1H1TA 1GXSA 3TRHA 3UA3A 4WADA 3R3WA 4D45A 4X20A 2QW1A 4RVFA 3JYNA 3JVDA 3KHKA 4YAJA 4EG6A 3O3NB 3QLJA 4W6ZA 1RXEA 2FPOA 1WCV1 3QE0A 1AKNA 1Z5NA 5AJYA 3UWSA 3NC1C 5CG2A 2I9KA 1NJFA 1BXRA 1XLWA 2O7QA 5T8KA 2O8NA 1CUZA 4R1MA 1NW9B 1QE0A 1DB3A 3LBYA 3LW7A 4GX1A 5U4QA 3E7XA 3TPFA 2QTVA 3WGIA 3NOQA 1QM5A 4Y9TA 4CKEB 1FS5A 3CUTA 3R6GA 4MDFA 2QTRA 1WJGA 2RK4A 2IY9A 1YMUA 2Q3JA 1P4SA 1RKVA 3E1SA 5DVZA 5F1YA 2EJCA 2ODQA 2Z1NA 1PS0A 2C5BA 2VLBA 3MIIA 2ZIFA 1XMPA 5HBGA 4RPKA 3HP7A 4P7JA 3KEMA 2HHCA 1SCNE 1U2SA 1KPHA 1JR4A 3RARA 3M6WA 2W2MA 1EWYA 4RDIA 1BJTA 1ZVMA 1WMSA 2HJRA 2Z3ZA 4B3IA 4TLCA 3U1VA 4DV3B 3A26A 5T3YA 3M6UA 3VVCA 3W5HA 3BH0A 3PD0A 4KFCA 4QUDA 1P18A 2R8EA 1LLFA 2VF7A 3X1WA 3IQGX 4MJ7A 3RM3A 4IQ8A 1ZDMA 2C8JA 3QV2A 2R4TA 1XLTC 1NSFA 4Y9RA 1GTRA 4MV0A 2PGJA 1R4AA 1FVOA 1FBNA 3QXHA 3U3KA 5BNIA 1IOLA 4MS4A 1E3DA 3AEXA 3OQ6A 4BQRA 4YRBA 1IUKA 3ENNA 4WZ6A 3OQIA 4LF7B 4KYUA 5BQ5A 3OQBA 1J2JA 5BNFA 3V4PB 3RHSA 4UBJA 3TAHA 3NHUA 2O20A 3UAYA 2YJ4A 3EQ7A 5ITZB 2AYYA 3ZDFA 4HX9A 3LGAA 4F2HA 4CKBA 4QTUB 4W5HA 4AS3A 3LBAA 1E3LA 4OJYA 5H82A 2OKGA 4IHAA 4BMOB 1HFKA 1NLUA 2R96A 4K8OA 1E1YA 3ZCXA 2G5CA 1C3JA 2AFVA 1VE1A 3CNOA 4E5DA 1PUXA 3T7JA 1H8ED 4CIYA 2VJMA 3V1MA 1DXHA 1XU9A 1SHKA 3EC7A 3OZGA 2GPWA 2IVZA 2Z5VA 4CCSA 2WMYA 4ETMA 1DCFA 1VE6A 3D6NB 1SBIA 2XKAA