4TRRA

Crystal structure of a putative putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
261
structure length
256
Chain Sequence
MSNLNGKTAVVTGAASGIGKEIALELAKAGAAVAIADLNQDGANAVADEINKAGGKAIGVAMDVTNEEAVNTGIDKVAEAFGSVDILVSNAGIQIVNPIENYSFADWKKMQAIHVDGAFLTTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGLLGLARVLAKEGAKHNVRSHVVCPGFVRTPLVDKQIPEQISEEEVIKKVMLGNTVDGVFTTVQDVAQTVLFLSAFPSAALTGQSFIVSHGWFMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative D-beta-hydroxybutyrate dehydrogenase
publication title Crystal structure of a putative Putative D-beta-hydroxybutyrate dehydrogenase from Burkholderia cenocepacia J2315
rcsb
source organism Burkholderia cenocepacia
total genus 96
structure length 256
sequence length 261
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4trrA00
4GVLA 5DOVA 5C37A 3PDJA 4JCOA 1T2DA 2AG5A 1Z7BA 1O0SA 1MX3A 3I9JA 3W8EA 4AICA 4FBGA 2VRBA 1IZ0A 3S55A 1UDAA 4C4OA 3FI9A 1P1RA 5U4QA 3IIEA 3H8VA 4DLLA 2UV8A 1Q7CA 4WK6A 2QG4A 4U8GA 2EKLA 1YS4A 2X1HA 3ZU2A 2Q46A 2Q2QA 4OKNA 1Q1NA 1NTOA 4XDYA 1KEUA 5KJ1A 5KVQA 4FS3A 5KJ6A 4U0KA 4LRTB 4WGGA 4XB2A 4RVSA 1L1FA 7MDHA 4WLOA 4YJHA 5ITWA 3H9EO 3U4CA 3OECA 4XB1A 1EMDA 1H6DA 1R0SA 4HV4A 1ZK0A 4P8RA 2BFMA 2B5WA 2HK9A 1ZVMA 2HQ1A 4MVJP 1H5QA 5C7LO 3GDFA 1GV0A 1AN9A 2O2SA 4R54A 4R1TA 4YDRA 4IQ0A 1Z45A 1VSVA 3RFTA 2X86A 2GASA 2P9CA 4CLHA 1OI7A 2ZCUA 4IZIA 3U62A 2IEBA 3FN4A 3Q9NA 2GNAA 1FDUA 4FR5A 1IB6A 2ZTVA 3AOEA 1YDWA 4UEKA 4P22A 2R6JA 3IJPA 1OMOA 3RU9A 2BD0A 2VN8A 1XELA 2VHYA 3Q2IA 2HK7A 4EJ6A 3KBOA 4YEDA 5CPFA 1BXGB 1KVRA 3DONA 1AHIA 4QFDA 3TRIA 2HMWA 1X15A 3WIDA 2NU7A 2DQ4A 3GAFA 1HDCA 3KUXA 3S2IA 4WECA 1T26A 3UH1A 4DPKA 4R3NA 1KY4A 4ZICA 1O9BA 3JQAD 3K30A 2VNSA 2AQIA 1U3VA 1X7GA 3AJRA 2O4CA 2QRJA 4J9VA 1XR3A 5HS6A 3WWYA 3SJUA 1GUFA 2GZ1A 3BYZA 2X4GA 2NVUA 1XSEA 3GGPA 4CJXA 5I8WA 3NDRA 3NT2A 4GKBA 3WNVA 4E5MA 4J4BA 4LVCA 1DC6A 4W6ZA 2I99A 2EW8A 1PIWA 3KEOA 4J2HA 4MKZA 2FWMX 4CMIA 2YYYA 1K6IA 3COSA 5B4TA 4D0RA 1H2HA 1R0LA 4A73A 2VUUA 3GNTA 2OBNA 3PI7A 3KOUA 5JPIA 3BMNB 4R51A 4W9NA 3GVCA 5J23A 1PL8A 5ENVA 1JWBB 1G0OA 2W2LD 2P9GA 5TJ9A 5G0TA 2WE7A 1YO6A 3NKLA 1VL0A 5HTOA 4GLOA 2JFGA 1MB4A 3BHMA 3GA0A 2X5KO 3HDQA 3E9MA 3BTSA 4AVYA 3LF1A 3OA2A 1O95A 3E48A 1XYGA 3Q9UA 3PJEA 5CAEA 4GH5A 2WM3A 3LK7A 4DIBA 2J3KA 4IDDA 3E82A 3HN7A 4B7UA 4Q3DA 3S2FA 2EWMA 4DLBA 2NVWA 1NBOA 4QX6A 1VM6A 4XYMA 2G17A 4OH1A 3RAJA 4CUZA 1B16A 3JQ9A 5ER6A 4FPXA 1P9LA 2CZCA 2JD1A 3E6AA 1ML3A 5FF9A 3DTYA 3IKVA 4YPOA 4WLVA 1KY5A 2CNBA 2X0NA 2Y1EA 3VKVA 2RAFA 3DZBA 4CM5A 3ZHZA 4J7CA 1E3EA 4CM9D 4WNCA 4CLOA 5IN5A 2JCYA 2HDHA 2AQHA 3U4DA 1B15A 4Q3CA 4Q9NA 4QUKA 4DL9A 4BKRA 4HWKA 3DTTA 3VZPA 6ADHA 3I9NA 1GZ3A 3A4VA 3EVNA 5CEFA 1NM5A 5JDCC 4RDHA 3KYDB 4QO8A 1VPDA 5L4SA 3VTFA 3WGTA 5JCJD 1TB4A 3RBVA 3GFGA 1AUPA 2VOEA 2VT2A 3RC2A 4AJJA 1XHLA 3ONEA 3TZCA 3KRTA 3V1TC 3PFFA 1ADCA 2W2KB 2OOSA 3DZIA 4EEZA 4K1LA 4G65A 2EXXA 2YFHA 4MVJF 4Z3DA 3PXXA 4E0BA 4XIJA 4XR4A 2FN7A 4BNHA 4W99A 1UDCA 4BIIA 3JSAA 2WSBA 1E3JA 2FR0A 3D4NA 3LLVA 3HHPA 3AU8A 4DC0A 4XIYA 4E3ZA 2EERA 1MC4A 5DN9A 4NU6A 1TT5B 1RWBA 2J5KA 3PQDA 4PLCA 3LLSA 4YJFB 3QE3A 1MFPA 2O3UA 4H15A 5IAAA 4RO0A 4WLEA 4JROA 3BMOB 4ALNA 3E1KA 5IDXA 3EAGA 1K2WA 2CDAA 2ET6A 3MJTA 2Z1NA 3FPCA 3E9QA 2Q1SA 1J6UA 3E9NA 3I83A 4Y6RA 3WG9A 1U3WA 2J3JA 4YJHB 1CQIA 2P4QA 4WOKA 1EE9A 3JCZA 4NK5A 4R01A 3OIGA 3GG2A 3PHLA 3RUAA 4NK4A 3NDJA 3UW3A 1PJSA 1MP0A 1SEVA 4LRSB 1VL8A 3FHLA 5FWNA 1LLDA 2Y0CA 3E18A 5BSEA 4F6CA 5DF1A 4DPLA 4YAEA 3WLFA 3T7EA 4FFMA 1QYWA 1QMGA 4MIEA 4JXKA 5G4LA 4B4WA 4KWHA 2PH3A 5A06A 2LDBA 1SB8A 3DOJA 3JQFC 1HYGA 2CF5A 2QZ9A 1HLPA 2AA3A 3UCFA 4D3DA 1ZJZA 2FMUA 4HBGA 4DLAA 2V65A 2X8LA 1F17A 1IYZA 3QV1A 4GWKA 4L4XA 1ZKMA 1AE1A 4NPCA 1KYQA 5A05A 4F6LA 2PLAA 5DZSA 1X0VA 4NFHA 2J3IA 1U9JA 2ZQZA 1EBFA 4YRBA 4BNLA 3PLRA 4J16A 4J2OA 4BNNA 4IGFA 3FR8A 4CM4B 3FNFA 4M86A 1HEUA 4FDAA 2ZYAA 3DBLA 4QSMA 3BMCB 4J4TA 1LUAA 1IPFA 4QQRA 2NV6A 4RPKA 4EBFA 1LSJA 3AUAA 2GZ3A 3HUDA 1LLQA 1ISHA 3GH3A 4FFOA 2X9GA 4QO7A 3ZWYA 4F3YA 4BB6A 1J49A 1PSDA 2GO1A 5ICMA 4F45A 4YJDA 1JU9A 1PJ3A 2O7SA 5G0VA 4KWIA 3RUIA 1A9YA 2VHXA 3HWRA 1GDHA 4Y98A 1PZEA 2V6FA 4I9HA 1E5LA 1MXHA 4MVJI 4YQZA 1DSSG 4CMIB 4DBVO 3T7CA 5TS3A 3PWKA 3HJAA 3W6UA 1FMCA 2X0JA 3ZV4A 2HCTA 1LTHR 2FZWA 3AW9A 2OHXA 2GN4A 3JD1A 4R9RA 1NPDA 1RYDA 4PG4A 4PG5A 4XCVA 3S1LA 4CMKA 1WWKA 2PD3A 2DUUA 1B14A 3JYNA 1HRDA 3I9KA 5ILOA 5TT1A 5L4NA 3KB6A 4BO4A 2VTEA 4NDNE 2OORA 2ZB3A 1OC2A 2ZYGA 2DLDA 2CD9A 4NR0A 1VC2A 4KQXA 4RDIA 2EP7A 2H1SA 5JDIA 4IDFA 3SC6A 3TNLA 1WZEA 1CERA 2EKPA 3HNPA 5JYEA 4UEJA 3D64A 5HA5A 3AM4A 1E6EA 4I8XA 1XCBA 2I9PA 1HSZA 1D8AA 2HUNA 4PZDA 2LDXA 3ETEA 1Q0LA 1I24A 2Z95A 4BNZA 4UVGA 3DO5A 3VOSA 4PLGA 4QTZA 4J49A 1I8TA 2QHXA 2A4KA 3A9WA 1CF2O 9LDTA 1CJCA 4WNIA 4CLOB 2B4QA 4RL6A 1C0PA 5TT0A 2Y1DA 1CYDA 1HDGO 4ZVVA 4YAIA 2C5AA 5EIOA 4LN1A 3MWEB 5DCYA 4BNUA 4GWGA 5G2OA 2P5YA 1LQUA 4LISA 1NYTA 1A7AA 3QQPA 2DFVA 1LLUA 3KXDA 4L4RA 2Y05A 3NT5A 3L9XA 4MKRA 3S2GA 1EE2A 4ZD6A 2AEMA 1EUCA 2ZK7A 4JK3A 2VWPA 4D44A 1EVZA 4E2XA 4IS3A 4D0SA 3KLMX 4O6VA 1YE3A 1HE4A 4J91A 4UULA 2NSDA 3QVOA 1VJTA 3KV3O 1YBVA 4CMJA 1P1KA 3EMKA 2XAAA 1GV1A 5FEUA 1Y6JA 2YV3A 3D3WA 1MLDA 1GD1O 1QYVA 3PQEA 2ZB8A 2OP1A 4KMSA 4NZ9A 4PVDA 1X13A 4DGSA 2OMEA 4BKOA 4J0FA 2DT5A 2HSDA 3HDJA 1MG5A 1Z7EA 3FWNA 1GY8A 4E5KA 1LEHA 2OP0A 3FRJA 4NJMA 1T24A 3MEQA 4ZQBA 4CR8A 2NQTA 3PYMA 5BQFA 4UVDA 1VRWA 5TIIA 1N8KA 1LDEA 4ND4A 3TL2A 5B4VA 4E31A 1YL6A 2DBRA 4J1SA 1N9GA 1DIRA 3WR5A 3VC7A 3OMLA 1ENYA 1QYXA 1PGNA 1DHTA 1X7DA 3JQBC 1CWUA 2ZATA 3OBBA 2PGDA 4JBHA 5KVSA 4HFRA 4NBUA 3E5MA 2Y1GA 4BO3A 1V3UA 2O2YA 1LC0A 5T64A 2OXIA 1ENOA 2RH8A 4RV9A 4BNWA 1U3UA 4UEOA 5AXAA 1GZ6A 1N1EA 3FNEA 3GVXA 4NH4A 5JO9A 1A9ZA 4U0JA 4R4JA 3V1UA 4JLWA 5EERA 1UP6A 2V6MA 3TFOA 2UUPA 1EK5A 4BQRA 1B2LA 1DIGA 3D4OA 1B3BA 4L74A 3UFXA 5A02A 2ZYDA 1I32A 4J1NA 4M49A 3JQDA 1B8VA 4DIFA 2GCGA 4R68A 4EDFA 2BRUA 4NI5A 2WDZA 1VE9A 2PGJA 3ITKA 8LDHA 2WD8A 2R00C 1YQGA 5IFLA 4AJIA 3G49A 4Z9XA 1PJLA 4HX5A 3UAGA 5HBRA 3DBLB 1W6UA 3IJRA 1Z82A 2UDPA 3WQQA 3JQCA 4ND1A 1EQUA 1LRLA 5CEEA 3U3XA 4BL5A 5EQFA 3FF4A 1JKJA 3DHYA 5CG1A 3H5AA 1AXGA 1HKUA 3JQAA 3PIDA 4A7PA 3NTQA 1ZO8A 3I1JA 3M2PA 4L75A 4R41A 1ZFNA 1JW9B 4CQMD 4UUNA 3TF5A 4IINA 1FDTA 1R15A 1ARZA 2BI7A 3DOOA 4ND5A 3B6ZA 5IDYA 3WYEA 1BW9A 4A2CA 1RPNA 1ADBA 4OXNA 2Y93A 2E49A 1K0UA 3WGQA 5IDWA 1IUKA 2YFQA 4D41A 4GSKA 2C5EA 3ANLA 1H9BA 1BDMA 1DAPA 1HLDA 1LNQA 3GNSA 5I7SA 2OZPA 3QWIA 1DFGA 2I65A 2P4HX 2X5JO 4HFNA 4DIOA 3ANMA 3DFUA 5L95A 2DTDA 4I5FA 2BF7A 3E5RA 2Q2VA 4PLHA 2CMDA 1GYQA 2FR1A 1YBAA 1QKIA 1DO8A 1YL5A 2D2IA 1TA4A 3JQGA 1GZ4A 3I52A 1Y8RA 3CINA 2YV2A 4XQGA 3U4IA 3JV7A 5EQDA 1O6ZA 4YAKA 3AOEC 3FPLA 2HKIA 1P1JA 5DOZA 5ES3A 1DFHA 4M54A 3OETA 4EYEA 1XKQA 3MOIA 4BV8A 3KTDA 2DPGA 5DDIP 3QA9A 1GCOA 3QWAA 1NNUA 2AXQA 1FK8A 4LCEA 3H9GA 1ZK3A 4TRRA 4FB5A 2X22A 3DXFA 1SCUA 3FNHA 3DZGA 2Y99A 2V6BA 1FDVA 3OICA 4CM9A 1EBUA 2P91A 4JJGA 3PQFA 3H2ZA 5BSFA 3QRWA 1PJQA 5TGDA 1T4BA 3U5TA 4QT0A 4AJNA 2O3SA 2EG9A 1Y5MA 5G0UA 3Q2KA 1KIFA 3UN1A 4BKPA 1Y8QB 3KSDO 3WS7A 1U7TA 3OA0A 4M1QA 4XGNA 4FW8A 2D4AA 4A03A 3GGOA 2GN6A 4ZN6A 1MGOA 1HDXA 4DWVA 5JCJA 5BT9A 1DDOA 4E32A 2VYND 5L45A 2X9VA 3VHRA 3INRA 4JBIA 1R4NA 4UUMA 1JKFA 1PU2A 4BNKA 3O8QA 1J4AA 2W4QA 1CDOA 4HKTA 4ZGWA 3RFXA 2B69A 1DPGA 4LK3A 1R0KA 1RM3A 1P3DA 2O3RA 3ADOA 4O0LA 5F1PA 4WEOA 2HRBA 2VZ0A 1LC3A 3W4KA 1E7WA 1P1HA 1BGVA 1Q7BA 4D3FA 3C1AA 4NJMB 1MUUA 4XD2A 1DHRA 4XRGA 3FR7A 1GAEO 4B7CA 5BNTA 4OL9A 4EI2A 2VZ9A 4ZU3A 3H65A 4BKUA 3FBGA 1GYRA 3W8FA 4BO0A 1LXCA 3DAFA 3IDSA 2W90A 2X9NA 1DJQA 5T8KC 1GL3A 2I3AA 2GUGA 3LSYA 4ALKA 5JW6A 3NAQA 3GR6A 3CZMA 4CL3A 3EVTA 3HG7A 1C14A 1M75A 2CVQA 3K73O 5CDTA 4AJEA 3DL2A 3OM9A 1PR3A 2AE2A 1Q0QA 1J0XO 3ZWPA 5I7VA 3C8MA 3FD8A 2I6TA 3CMCO 3EY4A 3Q6IA 3QVSA 4QXMA 3F47A 1ONPA 3DQPA 2WD7A 1HDOA 1KEWA 2VT3A 3ZH2A 2FR8A 1X1EA 3D1LA 3F5QA 3Q1LA 4YT5A 5L9AA 1MC5A 1B3RA 2GN8A 3AI3A 1YH3A 3RC1A 3WTBA 3GZ4A 1EZ4A 1Y9EA 3I4FA 2AQKA 2NUAA 1QLHA 3GFBA 3PP8A 5DT9A 4J6FA 3TOXA 1EFLA 2IDZA 4FD3A 1EUZA 3VPFA 4INAA 1N92A 4GX0A 4RVDA 4XGKA 4B8ZA 1QG6A 2Y0EA 4KUGA 1FF9A 1E6WA 3LC7O 1Z73A 2FOIA 2YDYA 1DRWA 4WPGA 2QYSA 4IXWA 4IZHA 4C7KA 3FSRA 3UKOA 2PZMA 3GHHA 2Q1WA 3KLPX 4MP8A 3M1AA 1Q2XA 1N5DA 1E3WA 3MJCA 4NHEA 4RF4A 3VPXA 1BVUA 3GZNA 4GX5A 2XXBA 3ROKA 3WJAA 1SNYA 3GDOA 3QWBA 4XRRA 4GVXA 3QJ5A 4GGPA 1UXGA 3RBZA 1H0KA 1NWHA 2W8ZA 4OSPA 3BTVA 5H83A 4D79A 4M87A 1X7HA 1YDEA 2EKQA 1Y81A 1UR5A 2DM6A 3VZQA 2C54A 2PR2A 3WTCA 5JY6A 4N54A 1ISIA 3K2BA 3NX4A 4PZCA 3JQ7B 5A9TA 2Y68A 1AHHA 1EVIA 2GD1O 3JTMA 1YOVA 2EJWA 3N74A 4R1SA 2PZKA 4RPJA 2YY7A 3ZWNA 4I08A 1PZHA 4XDZA 2CUKA 3P19A 1IZ9A 2D59A 1BW9B 2GYYA 3E8XA 3PHHA 1HZJA 5IZ4A 1BG6A 1IY8A 2NLOA 1ZCJA 1NFFA 1R66A 5KWEA 3JYLA 4OXYA 3TZQA 2OGUA 4TRNA 4K26A 3RFVA 4TZTA 4R69A 3O4RA 3VDRA 3KHUA 2YQ5A 1YGYA 3HFSA 2I3GA 2PZJA 4Z9FA 3CZRA 4CMEA 1BVRA 4Q39A 2VHZA 3B70A 1HE3A 1GFSA 4CPDA 2HMUA 3RIHA 1Y8RB 2WWRA 2Q49A 4TMFA 3SC4A 5B37A 1NPTO 2NU6A 3FNGA 1DC4A 2PA3A 3HB5X 1H9AA 1L7DA 3BMQA 4PFJA 3K6JA 3PWZA 3WMXA 1NFRA 4Z6KA 1Q7GA 4IUYA 3PYXA 2P5UA 1NX6A 3DOCA 1OBFO 3ENKA 3I23A 3M6IA 4EJMA 1UP7A 4BGIA 4CLXA 3IAHA 2B4TO 2HJRA 3MOGA 3AK4A 3GAZA 1H93A 1DBVO 4N18A 3WMWA 4N5LA 2YZ7A 3VTZA 4MVJD 4DVJA 3GK3A 1FDSA 2VWHA 1VJ1A 5JS6A 3INTA 4J90A 4RZIA 2E6UX 2Q3EA 3VH3A 2JD0A 2PFGA 1HDYA 1PTJA 5JFOA 3WBBA 3RUCA 1HE2A 2X5OA 3G17A 1SZJG 4HXYA 1EQ2A 2ZJ1A 5ILGA 4CM3A 4YAGA 5IZCC 9LDBA 5KKAA 5ER9A 4J43A 5FYDA 2H5LA 7ADHA 1ISJA 5A03A 2FPGA 2A92A 2HMSA 2VQ3A 5EPOA 3RD5A 3K8ZA 1QXSA 2UAGA 2G0TA 4RPLA 2WMDA 2C59A 5A3VA 2DU8A 4A5OA 2ILTA 2RHCA 1QRRA 1E7RA 1XQ1A 4XQ9A 4E12A 2A9FA 3O8QB 1EVYA 3OQ1A 3OHSX 3PZBA 2JHGA 1NWCA 3ABIA 5COQA 4RVHA 4W4TA 5F21A 3ZW8A 3GN1A 1QV7A 4DYDA 4D42A 4CM7A 1NVTA 1PS0A 1ZNQO 4WLNA 5EINA 4ALJA 3LF2A 5A5FA 4FSHA 3PHIA 5CDYA 3UGKA 4XEHA 1A71A 3PTZA 3PJFA 3PDUA 2D8AA 1ISFA 4CQLA 5C7OO 1GEEA 3ZNOA 3TZKA 3AWDA 4S1VA 5TF4A 1CIVA 2DAPA 3OF2A 4J9UE 2IE0A 4YCAA 3DMTC 1SO8A 4JJFA 1T2FA 1WAMA 4I5DA 2E48A 2AG8A 5T57A 3M2TA 1ZK1A 3CIFA 3UVEA 4R9SA 4KQWA 1I36A 4AJOA 3U49A 4LGVA 4XYBA 4HFMA 2GERA 3JYOA 5ADHA 1ZK4A 2D5CA 4WEQA 4RF5A 4U6SA 3WFJA 4QECA 2YHUA 3P7MA 5EMHA 2VRCD 1LX6A 1X1TA 1JTVA 2WD7B 4ZQEA 4UAGA 3RASA 1M6HA 3IP1A 3R3SA 3TFQA 3QIVA 2IYPA 2PZLA 3L77A 5B12A 1DRVA 1PL7A 1LSOA 3Q0EA 5F5NA 1LDNA 1XQ6A 3SBOA 5KJFA 1DLJA 1E3LA 3AU9A 2XXJA 3MCVA 5DBIA 2CDCA 2EJVA 3WLEA 3KM0A 1ZMTA 3VKUA 3RI3A 3IKTA 4RJTA 2B37A 3TN7A 1WVGA 1D7OA 1PX0A 2EW2A 2Q4EA 2JCXA 3L0DA 3WOHA 3LT0A 4D3SA 3I5MA 1M67A 3GZNB 5K6AC 3ASVA 3B1KA 3ZHYA 1T2CA 4E4YA 4IQGA 4OM8A 1E3IA 4JNKA 2BELA 2NVUB 4UUOA 2X0IA 4BO7A 5G0SA 3C7DB 4LSMA 4LSWA 4XYEA 3N58A 4LMPA 3D4PA 4YRDA 2A94A 2V6GA 3DAPA 4LW8A 4D43A 3OJ0A 5JAIA 2G5CA 4TRJA 2NVBA 4DRYA 2DKNA 1YOVB 4GSLA 3SX2A 1S7CA 3RROA 2O3QA 3QY9A 4CQMA 2IEDA 3GY0A 3WSWA 1GCUA 4OKIA 3GPDG 4EITA 1EEHA 3U9LA 1PGOA 3H2SA 4J1QA 4A10A 1K3TA 4XYGA 2OO5A 3UF0A 1PEDA 1PL6A 2OUIA 3OJFA 5F1OA 3FBTA 3RJ9A 4Q3BA 2CY0A 4U6QA 4DQXA 2NM0A 4G5HA 4IMPA 4CR6A 4BQPA 4I1IA 2DPHA 4YR9A 4XKJA 4XZ3A 2C07A 4O5OA 4DQUA 1I10A 1NR7A 4WCFA 1TEHA 2CDBA 4E13A 4IBOA 4IDEA 3GQVA 3AUUA 4IMRA 3R3JA 1D3AA 4PG6A 4BOYA 3BMQB 4MP6A 1CQJA 4IDGA 4RPGA 2RCYA 3F1KA 4GMFA 1I3NA 3HADA 1R16A 1E92A 5JAMA 5DP1A 2DFDA 2WYUA 5H82A 2ZKLA 3FTPA 4BB5A 3MJVA 5L7WA 4JQCA 5B4UA 2NTVA 3VAZA 5GZ3A 1UZNA 2NNLD 1YWGO 4EEXA 2VOJA 2JAHA 4DXHA 4OSOA 3ZDFA 4MIOA 2QRKA 3R0IA 1HWYA 1C0LA 1N1GA 5CDGA 4S3MA 1T2AA 3KVOA 3ZWCA 5CEJA 4O1MA 4Q3EA 2B4RO 2VHVA 4J3FA 2HJSA 1UUFA 1IHXA 3IMFA 1BXKA 4I5GA 2P68A 3B1FA 4FOOA 2GPTA 3PHJA 1QYCA 3LQFA 3JQFA 2SCUA 4L4SA 4CODB 3WXBA 1U8FO 4M8SA 3GUCA 4YYZA 2XOXA 1GPDG 5L4LA 4BS9A 1BWSA 4HY3A 3ZU5A 3JQ8A 2UUOA 5TNXA 1HYEA 3RVDA 2A35A 1LDBA 2I67A 3SEFA 3NTOA 1UXKA 2Y1CA 1KEVA 4C7JA 5HWSA 5JY1A 1I3LA 1PJTA 3ROMA 2EEZA 2PD6A 2VYNA 3ZNQA 1E6UA 3A28A 4O63O 4EJ0A 1U28A 4L73A 5GZ1A 2WYWA 1RM0A 4BNMA 4ZQGA 3TWOA 1ONOA 5JYDA 4Y6PA 3AUSA 3Q11A 3AFMA 1CRWG 4B7XA 3GNQA 3ONDA 1BHSA 4WCDA 5A9SA 1LDGA 1GYPA 2FSSA 1NHGA 1DC5A 3PIIA 1F06A 1XWFA 4II2A 5I7FA 1G1AA 4PLYA 4EW6A 3EGOA 4IQ8A 5JLAA 4BGEA 4TWRA 2F00A 3L4BA 5L3ZA 5JCXA 5BSGA 3LYLA 3LC2O 1Y5RA 2FSVA 1IULA 1LLCA 3PJDA 1HF3A 4ZJUA 1I2CA 2J5QA 2YW9A 3IUSA 3CXRA 4NFSA 5G0WA 3UHAA 4BHTA 1LSSA 1PJ4A 4PN3A 5I9LA 4BVAA 2ZCVA 3TOZA 4EZBA 1P45A 2VCYA 3SXPA 4OQZA 2R2GA 3AM5A 2C0CA 4R1UA 3VH2A 1ISGA 4E2ZA 3B20A 4BKQA 3RBXA 1KETA 4BMNA 4A26A 4OGWA 1NR1A 1QP8A 2FPIA 3MJEA 5T67A 3UUWA 3OSUA 3GMSA 1WW8A 1D4FA 1NXQA 3H6KA 2OBYA 4PVCA 4OMUA 4GQAA 1U4SA 3GVIA 3OJOA 3ZV3A 4CV1A 4CM8A 1KC3A 1ORRA 4WE3A 5I7EA 5JC1A 2RH4A 3GMDA 4CV0A 2P9EA 4ITUA 5LDHA 8ADHA 3I9MA 4PGFA 4KTTE 2B35A 1F8FA 2DC1A 1BRMA 3JQ6A 5TC4A 4MDHA 1IPEA 1KVUA 4I5EA 4E5PA 1R37A 1H6BA 1YJQA 3GEGA 1OZAA 1SBYA 5ITVA 3PZRA 1ZIDA 3WSVA 1E1KA 4GGOA 2PK3A 2IZ0A 2G82A 2D5AA 1EDOA 1JAXA 3ONFA 1LU9A 1Q0HA 1SPXA 3BTUA 1B26A 4BNYA 1BXGA 3F4LA 4B4OA 2GN9A 3VPHA 5AXBA 1KEPA 3TZHA 2HMVA 3OQ6A 4M55A 5ICSA 4JGBA 1L7EA 3P2YA 3HDHA 3MJ4A 5C5IA 1GUZA 1BXZA 3DMYA 1PQUA 1UXJA 4MO2A 4I9UA 1SB9A 3QP9A 4DUPA 3TPCA 4YTEA 4WLFA 1W8DA 1XDWA 3O26A 3UOGA 5HS4A 4RQUA 5COAA 2H6EA 4OJNA 1P44A 4OO3A 5JSFA 1E5QA 2QIOA 1JQBA 3EUWA 4YVFA 5AOVA 3QHAA 4AG3A 4CQMB 4Z3KA 3PPIA 1KOLA 1NVMB 3CUKA 4KZPA 1DIAA 3L9WA 3Q3CA 5BSHA 1IOLA 1EUDA 3DAGA 4IJUA 3ROQA 3HB4X 3JYQA 3OJEA 4Y9DA 1DAOA 1C1DA 1I5RA 1ULUA 1V35A 4AJPA 4ZRNA 4TKMA 1YQDA 3V1YA 3AUTA 4YQYA 2HRZA 1PR9A 4YAJA 3JYPA 2Y1OA 4IS2A 3SJ7A 1NQTA 3R6DA 1LRKA 3KETA 1NQ5A 5CDSA 1XEAA 4BO9A 2QX7A 4WCFB 2IXBA 1R6DA 3WGIA 2B0JA 3C3XA 4Q3AA 5BNIA 4RVFA 2VWQA 1CEQA 1GUYA 1WDMA 4BGVA 5KKCA 1C1XA 5K9ZA 4WKGA 1JWAB 1QLJA 1O8CA 3RU7A 3I6IA 1S6YA 1BTOA 4N5MA 4NJOA 1LI4A 3DFZA 5DBGA 3RC9A 2B83A 3OFSA 1VSUA 3OIDA 4KDEA 3V2UA 4RPHA 5KIAA 5ENDA 2B5VA 2O7QA 2Y67A 1C3VA 3L4SO 4OAQA 4XYLA 4PG8A 2JKVA 4CMCA 3K31A 2BGMA 4GMGA 1XU9A 1U5AA 1TT7A 2BHLA 3GN2A 3F9IA 4J4HA 4YBZA 3F46A 2IZZA 4IY1A 4NMHA 2G76A 4MVJA 3U09A 5TJHA 2J8ZA 2XF8A 2C2XA 3C24A 3DHNA 1ZUD1 4NIMA 2NTNA 3O38A 1E7SA 3ICCA 3EK2A 4Y6SA 3P2OA 3NDIA 3WYCA 3D7LA 4Z0TA 4TVOA 1WPQA 3WICA 2VUSA 1BDBA 1Z74A 1J5PA 5GMOA 3GDGA 4OQYA 1NVGA 3L6DA 5IG2A 3ZWOA 3CH6A 2DTEA 3GPIA 1YRLA 4NQZA 1Y1PA 1DB3A 4PLPA 5F1KA 3JQ8B 4KUEA 4FJ2A 4IJWA 1PS8A 1FJHA 4TSKA 3D3WB 3JQEA 1U4OA 4IDCA 1A27A 1BMDA 1W73A 2JCVA 4UVHA 2JJYA 1VJ0A 2Q2WA 4MVJG 4W9NC 5TX7A 1E1NA 4PRKA 2VHWA 3CE6A 3NTRA 2IZ1A 1I3KA 5BR7A 4BNIA 3L6OO 4AJLA 1PGQA 1HSOA 4IJVA 5A9SB 1RKXA 1LBEA 4FJ0A 3G3EA 2CF6A 4D45A 1DXYA 1H6AA 4E30A 4CMBA 1NAIA 4PLZA 3RWBA 4MIYA 3F5SA 4TKLA 3G1UA 4CMEC 5L40A 1NASA 1UXHA 3NV9A 5GZ6A 3DZJA 4GX1A 3ROPA 1TT5A 1N9GB 3QW2A 1AXEA 1VKOA 4YJFA 2HLPA 2ZTMA 3BIOA 4ZHSA 2JFHA 5LC1A 3ZNPA 3NUGA 2EHDA 3BMOA 2YHIA 3R1IA 1U2GA 3JQ9C 3AI2A 3GF4A 2NU8A 1TI7A 1T2EA 1U8XX 4AJ2A 4NBTA 2VYVD 3K9QO 1I0ZA 2NTJA 3I6QA 5LCXA 4EUFA 1DJNA 3EZLA 1ENPA 4OHUA 2HK8A 4L8VA 4UUPA 4W7IA 4XGIA 3MJSA 1TVEA 4LVUA 4Q3NA 3WYBA 2O48X 5IXYA 5C3MA 1YJ8A 5CP8A 2X23A 2AMFA 2BH9A 4GL4A 2VUTA 1JKIA 3ZU3A 5FI3A 1GU7A 3H3JA 4FIZA 4CR7A 4A27A 4XWYA 4CM8B 4E33A 5CFZA 1O5IA 2VRCA 4AJKA 4RGBA 2IODA 1M6WA 3AY3A 2HO5A 1VKNA 3OQBA 3K96A 5TLSA 2ZJ0A 1WZIA 3OP4A 2PGLA 4RQTA 1PZFA 5T5QA 4ALMA 3VZRA 2O3TA 5AYVA 1EK6A 4IDBA 1E0DA 1HDZA 2NQ8A 4UVEA 4E6PA 3ZU4A 4MP3A 2J3HA 4FCCA 4IXTA 3TSCA 4J1TA 1ZXLA 5JXWA 2C20A 4UREA 4GKVA 1DIHA 1T1SA 5L7YA 2HAEA 3HN2A 2Q4BA 3NRCA 4NNJA 4DA9A 1JN0A 4EUEA 2NU9A 2WEKA 5KTKA 4IIUA 5JE8A 1M76A 4PIVA 1E1MA 1I2BA 1H94A 3W4IA 4XJTA 1W4ZA 3JQAB 4G2NA 3EW7A 3ITDA 3C7AA 2IRWA 5JMPA 4CM4A 1ADGA 2YJZA 3C85A 4WOJA 3BMCA 3GEDA 3H5NA 3KZVA 4P4LA 4ZQHA 4ESOA 1KS9A 1WNTA 5U1PA 4L0QA 3STHA 2PKQO 4P4NA 4AFNA 4PLVA 3KO8A 3TDKA 1KC1A 2ZIZA 3NT4A 2X58A 1RM5A 1RM4A 1VLLA 4FFLA 5JAZA 4KTVE 4RORA 1U1IA 4WJZA 2JHFA 1KBZA 4YRAA 1SEPA 3QLJA 4CL8A 5K0ZA 1SOWA 2ZTLA 3AI1A 1B7GO 4BNFA 1XGKA 1C1DB 3WGYA 5AVOA 2YQ4A 3WWZA 2BI8A 4FGSA 2WJPA 4K28A 2IYOA 1KERA 4CV3A 3NJ8A 1HT0A 3ZV5A 2H9IA 3JQGB 2Q45A 3EC7A 2J5RA 3LT4A 1DRUA 3WBFA 2Q1TA 4WASA 3CTMA 4CM6A 2CVOA 3F1LA 4N5NA 5A5EA 1KVQA 1ID1A 1MA0A 1PWZA 1RJWA 1UZLA 2FZEA 3OJLA 2ZB4A 1PZGA 4W82A 2Z5LA 4XQEA 1C1XB 2RIRA 3CSDA 2EP5A 1P0FA 2WYVA 4E2YA 3QSGA 1SOVA 1NQAO 4MJLA 4YA6A 5AXDA 2D1YA 3NGLA 4P4GA 1N2SA 1JVBA 5T8KA 2AW5A 2E82A 2O50A 3PJGA 5JO0A 5DULA 1Y7TA 1V3VA 1E7QA 3S8MA 2YDXA 4Z9YA 4MPDA 3UCXA 1X0XA 3GEMA 1JLLA 1WMBA 3ETGA 2Y66A 1HL3A 2X0RA 1GQYA 1H6CA 3H3FA 1ZBQA 4XX0A 5L51A 3HQ4O 3HZZA 3ZWAA 1HE5A 4FGWA 4NBWA 1UAYA 1WLYA 1UXIA 1DC3A 2POQX 1P77A 1VL6A 3TJRA 1ZMOA 3T4XA 1NQOA 1ZEJA 1I01A 2X6TA 1GEGA 3G0OA 3OH8A 4NBRA 4BMSA 3HSKA 2I66A 1ULSA 4JIGA 3TQHA 1K89A 4YT2A 4BO1A 4YB8A 3VH1A 3GHYA 2VNAA 1I3MA 4R1NA 5IF3A 3NGXA 2DBVO 3DB2A 4CLDA 3GC6A 3RKRA 3PYLA 2FRDA 2O3JA 1R4NB 1QV6A 2QW8A 1BSVA 2VWGA 2GR9A 3BAZA 3DZKA 5FI5A 5KJCA 4XR9A 4B3HA 4BO5A 1NHWA 1TLTA 1M66A 3IOYA 2VTDA 5G4KA 2EIHA 3C1OA 5KVCA 4FFNA 4RF2A 1Z75A 1EDZA 3V8BA 4TRMA 3RKUA 3BHJA 3MTGA 1F12A 3H4VA 1E77A 4MOWA 1DEHA 3O03A 4Z0HO 4JP3A 4U7WA 3GLQA 4PLTA 4YJGA 3QVXA 2JL1A 1XIVA 1QORA 4Y67A 2BKAA 3KSUA 4ID9A 3W8DA 1YONA 2TMGA 1H2BA 3VZSA 5JDIC 4BO6A 4WCFC 1Z6ZA 2CVZA 4ALLA 4DYVA 2E37A 3E03A 1LJ8A 2BLLA 4WUVA 5A04A 3H7AA 3WQSB 2BMAA 3PVZA 2YHIB 1OC4A 3GRPA 2DVMA 2QRLA 3DBHA 3ZWMA 5A9RA 3ZCXA 2EGGA 3LT1A 3WDSA 4MVJH 1KVTA 5B1YA 3INGA 1P0CA 4RZHA 1V0JA 3DBVO 5L53A 2PKRA 3ETDA 4OIMA 5MDHA 3KYCA 4EGFA 5COBA 5TSDA 1W0CA 4BNVA 2QZZA 3ZWBA 2EGHA 2EF1A 1OAAA 3WNQA 3JD0A 1E7MA 4FJ1A 1B8PA 5DNAA 3IP3A 3HE3A 4PLWA 4YT4A 1YXMA 1GADO 1R4MA 3D5QA 3MTJA 1ENZA 3BA1A 3GT0A 5F5LA 3GVHA 3ZI0A 5IJZA 2DUWA 2C82A 4BNTA 4B79A 2O4UX 2WE8A 3AFNA 3VVCA 5KNLA 3WQRA 3ADPA 3PK0A 2Y1FA 3WGZA 1WMAA 2Q99A 3CMMA 4KP7A 1E3WB 4HNGA 4CLRA 3K5PA 1ZK2A 5IXSA 1YBMA 3AM3A 1V6AA 5TQVA 3WB9A 2BGKA 2RBEA 5TRTA 1SMKA 3IC5A 4URFA 2GDZA 3WGHA 1A7KA 1YKFA 4TROA 1PQPA 4FFRA 4FC6A 4BO8A 2RHRA 5EN4A 2AEJA 3WJ7A 1PJBA 4ZQFA 5EL0A 2DTXA 4BGUA 3GVPA 5JDCA 4GPD1 1UH5A 1O89A 3RJ5A 1C0IA 1V8BA 5IZCA 5CPBA 3ST7A 5LDGA 2QYTA 3H9JA 3A06A 3RUHA 3KEQA 4OYRA 1ZH8A 3NYWA 4R3WA 1LSUA 3F6YA 3L4BC 4HFJA 2ZQYA 3C1TA 4DQVA 4H7PA 1GR0A 1T25A 2H63A 4Y8VA 1ZZEA 2Z1MA 1WDLA 4DTIA 2BFAA 4RF3A 2OFPA 3WGGA 4HUJA 3DBRA 1KVSA 2V7PA 4P38A 1CETA 4NU5A 1JDJA 5KVVA 4DREA 4TQGA 1D1TA 1PGJA 2E4AA 3ZW9A 4B3IA 4E2WA 4GI2A 1ZSNA 3IUPA 1YQXA 2B36A 3G79A 4A0SA 3JD4A 1LRJA 4IM7A 2JAPA 1SAYA 4J7XA 4K6CA 1RYEA 1LA2A 4MVJM 1I2ZA 4JBGA 4XQCA 4JN6B 4BV9A 5JBIA 1HZZA 1IL0A 1K5HA 3PFWO 2PY6A 3DMTA 5BNFA 4G81A 1P31A 3LDHA 4AJ4A 1YL7A 5T6BA 3OEYA 3P5SA 5GY7A 4L76A 2W98A 4MKXA 4DPMA 1WDKA 2FHSA 5IN4A 3KSZO 3D3EA 4GBJA 3X2FA 1E3SA 4WLUA 2ZTUA 4OXKA 4BNJA 4EUHA 3ZGYA 4DMMA 1E1LA 3W4JA 2C29D 3LC1O 3BTOA 2P2SA 2WTBA 4TZKA 3SLGA 3NEPX 1QSGA 4IGEA 1F8GA 3C7CB 5H81A 1OFGA 5CDUA 5KCZA 2YUTA 1DLIA 2O23A 2JD2A 3DR3A 5HRUA 2DBZA 1O94A 1U7HA 2C7GA 3L07A 2AQ8A 3LT2A 3RC7A 4PLFA 3M1LA 5EESA 1B0AA 3CEAA 4ROSA 2PTGA 3ZWWA 1NPYA 3GUYA 3OIFA 3UCEA 1Y8QA 3SVTA 1A5ZA 4UVIA 5A4DA 4E5NA 3BXXA 1LQTA 3K92A 4PRLA 3ICPA 4YACA 4R16A 5JMWA 3EHEA 4KDFA 4XA8A 3EDMA 4RLHA 1UP4A 3PHGA 5G4KB 1ZXBA 3H9UA 1MV8A 5A1TA 5K6AA 1ISMA 3QVWA 3CKYA 4JP2A 4X54A 2QQ5A 4K9DA 4KOAA 2BFOA 3ZHXA 3ON5A 3HFGA 3LU1A 1OOEA 1P1FA 3MZ0A 4D7AA 1I33A 4B4VA 4XJSA 5KJEA 4CLEA 4YT8A 4DMLA 4E21A 4CQLB 2BGLA 3AY7A 4CMHA 4YJGB 1A4IA 2NADA 3V2GA 5DCWA 3VPGA 4FOSA 1AGNA 3WGOA 5I9NA 6LDHA 3PGJA 1UZMA 1U5CA 5F3RA 5THKA 3VPSA 1MG0A 2D3TA 1F0YA 4O59O 5IDQA 1X14A 3CPSA 4CUJA 4RVGA 1E7YA 1A4UA 3PLNA 3V2HA 3I9OA 4NG5A 1P33A 1PWXA 3DBHB 2GZ2A 4QFCA 1HXHA 2AEFA 4DC1A 3ZNNA 4CMAA 1WXDA 2I5PO 3N7UA 2VYVA 2FPPA 1YB5A 3QWFA 4H3VA 3HDYA 4IJKA 3UXYA 4J0EA 3MWDB 1NAHA 3BZUA 3DDNA 3KYCB 1C0KA 2G1UA 4PG7A 3ASUA 3VDQA 2F1KA 3ZHBA 4AL4A 5A3JA 3S2EA 1T1RA 4GX2A 4II3A 3D5TA 3TZ6A 3PEFA 1HDRA 4HP8A 1R4MB 1ZSYA 3ENNA 5FFFA 3UICA 4R5HA 4BMVA 1QR6A 2NWQA 3DC2A 3I4CA 2D0IA 4LCJA 5DBFA 4ND3A 4MVJE 4ZRMA 3I9LA 2GLXA 4F46A 5JAQA 3VH4A 1HYHA 1JVSA 4CLRB 5AXCA 3DZFA 2HMTA 2TMDA 3B1JA 1MFZA 5I9MA 1QYDA 5L7TA 3DEYX 2ZB7A 3OEWA 1YB1A 3PRJA 4CMGA 3LVFO 1M2WA 4GLLA 1EFKA 1V3TA 5MGBA 3GG9A 1A72A 3G1TA 2GGSA 1PJCA 3L6EA 4BO2A 4ONEA 5HM8A 1P74A 3EZYA 3RUFA 1YVEI 2JFFA 4RCVA 4CM1A 4FFPA 2PD4A 3W6ZA 1F14A 3ZZNA 1WP4A 3FWZA 4BUCA 3ANNA 1G6KA 4OOFA 1MXFA 1XU7A 3JD3A 3DWFA 3GRKA 1GQQA 2EV9A 3U0BA 1NFQA 1XLTA 4ZA2A 1GTMA 4J7UA 1ZW1A 3JQ7A 4HADA 1LDYA 2AE1A 2PNFA 4N7RA 3D0OA 4PCVA 4ALIA 4RVUA 1PJ2A 1UAGA 2IXAA 4YWJA 3RCBA 1PQWA 3V5NA 5THQA 3IQDB 3F4BA 5C7IO 3FCOA 3BMNA 3TL3A 1XG5A 3WFIA 2NACA 3AY6A 4B4UA 3DBRB 1PS9A 2AHRA 1R12A 4E5YA 1GPJA 5CHEA 1HETA 3GGGA 3IL2A 1Y9AA 3PGXA 4PZEA 3K2EA 4AJ1A 3T4EA 5DCUA 3A1NA 1JAYA 3QWHA 1IE3A 4H16A 2J6IA 3SLKA 1N7GA 1IHYA 4CUKA 3ZWXA 5DP2A 5KOIA 5JNLA 2X7HA 1N7HA 4FC7A 4IDAA 4D46A 5JC8A 2W2LA 4LMRA 4AJHA 4B8WA 1ONNA 4NBVA 4BNGA 3NJ4A 4JX8A 3IS3A 3AOGA 3JQBA 1ZEMA 1B8UA 2CFCA 1JA9A 1SC6A 1TXGA 2FP4A 2UVDA 3F3SA 3O9ZA 4K6FA 4NFYA 4YXFA 1ADFA 2OL4A 3U4HA 3W1VA 4TVBA 1U3TA 2PKQP 4GAEA 4R5MA 2FY8A 3ZN2A 5U9CA 2VZ8A 4OOEA 3ZV6A 2BFPA 2Q50A 3GOHA 3I3OA 3ORFA 5EJ2A 2C2YA 4RLSA 4DBZA 3BHIA 3RUDA 1DFIA 1K6JA 2GSDA 4W7HA 2DBQA 4FN4A 3H9QA 1T4DA 4BNXA 4IIVA 4U5QA 3EYWA 4IPTA 1DOHA 3RSHA 2GF2A 1GQ2A 3JD2A 4MINA 1I30A 3DHEA 3FTNA 2I76A 4L9RA 4HNHA 1DIBA 1FDWA 4KUHA 1K6XA 2PV7A 3WIEA 3X2EA 2Y0DA 1G0NA 3ULKA 1UJMA 2UYYA 1V9LA 3RQSA 1LDMA 3KYDA 1D1SA 1PGPA 1YB4A 1VI2A 2HU2A 1P1IA 3A14A 3ZWVA 2XPCA 4CV2A 2PH5A 4ND2A 4JJIA 3QVTA 4QEDA 4FQ8A 4Z0PA 2R00A 3VVBA 3WX0A 2C7VA 4I9NA 1HTBA 5AQ1A 4ILKA 1NP3A 1ZJYA 2CSUA 2GRAA 5CG2A 3LZ6A 3RUEA 1FXSA 1XA0A 2Q1UA 3H5RA 4B3JA 1U2DA 2W2KA 3KYBA 1EVJA 1ZSVA 2YV1A 3PWSA 3DZHA 4M89A 1UDBA 2PWZA 5I8ZA
chains in the Genus database with same CATH superfamily
5GONB 4KIWA 4DLXA 1A9TA 1KBOA 1UC5B 3EGWA 1T2NA 2W43A 1XUOA 5DGDA 4QODA 1ADJA 3TDNA 1MDBA 1QZTA 4MRRA 1U0BB 1B23P 1TW3A 4TM8A 3L84A 3S55A 1DIOB 4MGIR 4C4OA 1YGPA 2ZAMA 5I3CA 1RZUA 1DKUA 2IKQA 4G6ZA 2BEWA 3N8DA 4QWMA 4GMDA 4ASUD 3WGNA 1QHFA 3LUFA 3ECCA 2FUEA 3GOQA 3R6GA 1Q7RA 4MWZA 1JI0A 1N2ZA 1PN3A 1U81A 2AUTA 3AUYA 3ZY3A 2RH5A 3H5OA 3U3KA 4RIHA 3N3AC 5DGHA 4WXHA 3ZU2A 2GEVA 2GA9A 3PENA 3A36A 1WOYA 4GRIA 4AT1A 2Q2QA 1VGQA 2H1RA 1E1DA 1Q1NA 5BO5A 4Q93A 1N0UA 3RVLA 3VR2D 5E6UA 3R9KA 1ZGGA 4WGGA 5KJ6A 4GUAA 1Z7WA 4MO9A 4RVSA 1GN8A 1L1FA 1MAUA 4S12A 2GEJA 2PUJA 1H85A 2HC9A 4YJHA 3LRXA 4X6YA 3U4CA 1YC2A 3FYUC 1P18A 1QRTA 1H6DA 1R0SA 4TQAA 4HV4A 4FZ3A 1ZK0A 4LZOA 1U7DA 2VJBA 1RJFA 1T3LA 5A1JA 2OCIA 2J9XB 3HB7A 3CJTA 3CVJA 4F0JA 1EZZA 3GDFA 1WR8A 3QVKA 4AY5A 2XWBF 1M2GA 4WADA 3O0TA 1TQ2A 3N75A 1CUAA 4R1TA 3GBPA 4KOEC 4CTOA 5L3SB 1K97A 3O91A 4OJKA 3D2BA 3RFTA 2VAWA 3RYHA 1GZVA 1OI7A 4OI1A 4U2FA 1TAUA 3U62A 2IEBA 1IAQA 3FN4A 3EUEA 3U7IA 3WRYA 4F04A 1FDUA 4FR5A 2BCEA 2YRFA 4KQ9A 1FW8A 1H9CA 3T3OA 1BRTA 4IH1A 3FJ1A 4P22A 2M32A 5AVVA 1CLUA 4E7PA 3IJPA 4EPYA 4X24A 2V4MA 1NXTA 4JVMA 4U2GA 5B3KA 1P5HA 2VHYA 2YIMA 2C2GA 1P2SA 4ZT3A 4NG4A 5AVQA 3AESA 4ZOLF 1QIIA 5CCEA 1T5OA 4H60A 4CIBA 1KVRA 2RI1A 1AHIA 4Q21A 5JFGA 3NYIA 2Q8QA 3FWYA 3QEOA 4KIFA 3WIDA 4CXMA 3ANTA 3KUXA 3AVVA 3TQRA 1RPJA 3BWXA 3QXJA 4F1KA 2C2KA 2F3UA 4LHWA 3UH1A 5AJZA 1YKGA 3TO5A 2E6KA 5IS2A 1NMQA 4LWQA 3HLYA 3MGKA 1IK4A 2AQIA 3AJRA 1J2TA 1YASA 2X5XA 3G5LA 4MV8A 2QRJA 3CISA 2ENUA 2GZAA 4IVNA 2EJUA 3EPRA 1BKYA 1U8TA 2PRKA 4KK4A 2OQIA 1FJXA 4L9AA 2NVUA 4MUAA 4RZ3A 1GITA 3RSQA 2AC4A 4EHNA 3KKEA 4OQLA 1TJ4A 3OESA 1GKLA 1G2QA 1R3UA 2Z5VA 2C8JA 3NDRA 4HRVA 3ZEAA 4E5MA 2GZRA 4EJSC 2A59A 4J4BA 1BFDA 4LVCA 1HO3A 4EUKA 2F17A 3VJKA 2FEXA 3KEOA 3QGMA 4CMIA 1TRHA 4I6GA 3COSA 3T5TA 4BQIA 1R0LA 4RTKA 2FPXA 2VUUA 3GNTA 1IY1A 2OBNA 5SZHB 2NSHA 2WAXA 2Z09A 3M6AA 3U3MA 3AGPA 3E7PA 4KH0A 4X63A 2CHQA 3E2PA 1JMYA 2EFCB 4AY4A 4W9NA 3GVCA 2G67A 3TNFA 3JZDA 2UVQA 5D85A 2B1RA 3BFXA 3PGA1 1G0OA 1Z4LA 1TU0A 2HQBA 1QFYA 3EZ2A 4E07A 5F76A 2WWHA 4YCBA 2WE7A 2TS1A 1M54A 4CEJB 2WM2A 2NUPB 4F3CA 1VL0A 4B75A 1TUIA 4GLOA 4HC4A 4Q5IA 2JZNA 1Z34A 4V0ME 3LF1A 4PAOA 1RQPA 3OSZA 4YIKA 1XWIA 5AJTA 1ZM9A 3H4MA 2XLCA 1JSCA 5SZIA 1NF2A 3R3ZA 3N5KA 4G8CA 4I99A 3IAM6 4Q3DA 4DLBA 4MI3A 2ST1A 1FNBA 4P0TA 4QX6A 1CHNA 1E61A 4Q9DA 3EARA 2C9ZA 1PG5A 4KI7A 2IUUA 1V1MA 3SY8A 2FX3A 1AO0A 5EEGA 2W8BB 5CT4A 5FF9A 4OHMA 3DTYA 3M6LA 3WHKA 4K9NA 4NOJA 4ZMRA 2CNBA 2X0NA 4V0LA 5EMNA 1BDJA 2QN6A 2NSYA 4X1IA 1Q15A 1RP7A 5FWYB 2Y8EA 3ZHZA 2QPTA 3RSFA 2Z6UA 4J7CA 3V4LA 1QCZA 1RW4A 3E84A 1V16A 4WNCA 4CLOA 5HP4A 2XUPA 2JCYA 1HG1A 2HDHA 2PCJA 3DM9B 1B15A 2QZJA 3GJ5A 3C0KA 4Q9NA 1UM8A 4QUKA 2P27A 2JHCA 2HSWA 3G8YA 3I9NA 1E1RA 4ZO6A 3A4VA 2I1QA 1YOBA 1R0ZA 2P3SA 4RDHA 3CW9A 3IQWA 4ZHQF 3R6LA 2WJYA 3VTFA 2V59A 2I8LA 3H17A 3GCDA 4K9KA 3ZBTA 4BFTA 4F1JA 5JCJD 5ELXA 4QE3A 4JB8A 3AWIA 2GBFA 4P35A 4YJ2F 4RTNA 1V26A 2AL7A 4YHHB 2PUCA 1JJVA 2BJVA 5GJWC 1NRXA 2FXIA 4LGYA 3DF9A 5AJXA 4ND8B 1OROA 4JQYA 2BFWA 2G7ZA 3MTQA 3FRHA 1ZHOA 5K0TA 1EP9A 3IMGA 3IURA 4LPSA 1VMDA 3PXXA 3WQHA 4IHJA 4B71A 4XR4A 5IVHA 4ZI5A 2FN7A 3WJ1A 4BNHA 2JVJA 3H18A 4YUWA 2FR0A 3A1WA 2V74B 4FYIA 4PZLA 3HHPA 4QPZA 3AHJA 1CF4A 3E22A 1JG4A 3HJBA 5GWXA 1TT5B 4PLCA 1OFHA 4AW9A 4U3JB 1LPAB 3QE3A 1ML4A 1UF9A 3BXEA 4JOQA 3OZTA 1CY7A 4NDZA 4DT1B 3QOYA 3WIOA 4H15A 2ZM6B 3HKCB 5DSZA 5K0CA 2Q3MA 3AHFA 4ZDJA 2QTGA 4NZOA 5KAMA 2FQWA 1QO0D 1YU6A 4LNUA 3VSBA 1HK7A 2XVXA 2OHFA 2MYNA 4JR0A 2HEIA 3MJTA 3I83A 5ITWA 1T1EA 1Y7PA 2J3JA 4N4AA 1S8FA 2I2XB 2P4QA 1GT6A 5BN1A 4QDOA 1T0UA 4PINA 3ZBPA 5IF9A 3LX8A 2VP2A 1YIDA 2PYDA 1OJLA 4HLDA 2PMEA 3WV4A 1XKTA 4HX9A 2C03A 1VL8A 2OLEA 1U1EA 1QB8A 2Y0CA 2CNNA 2HSGA 3CZ9A 3E18A 3OTQA 1F4PA 3CONA 1U8UA 1EDBA 3KHKA 1UZUA 4H4CA 4I1OA 4UHJA 3H04A 3WLFA 3ZYCA 1W5FA 4BO5A 4MIEA 4JXKA 3OPMA 3LZCA 3P9QA 4TTAA 3ADDA 3NI2A 5EZYA 2P6OA 3DOJA 4Q4HA 2IYNA 4AKSA 3RTDA 2AOXA 3OLZA 4DV7B 1HLPA 2AMJA 2AA3A 2YIVX 3DW1X 3U0VA 5ARBA 1FMJA 1W94A 4HAWA 4DLAA 3ANXA 4ENUA 3E7FA 1NT2A 4HGQA 3OLQA 2J31A 1AKYA 1YZ3A 3GRVA 4GWKA 4NPCA 1KYQA 3ROZA 1L7QA 5DZSA 4TTVA 1YB2A 4UEWA 5BSRA 2CUTA 2JIMA 1HE8B 2WMOB 2ZUCA 3BWCA 3C70A 3QMMA 4NMLA 1LNZA 5FP0A 3PLRA 4RAQA 3VISA 2QTFA 1QH8B 4M6WA 4LFAB 4C7XA 2YXLA 3FR8A 1PWEA 2QK4A 1MIHA 3AY0A 3FNFA 4CM4B 1HEUA 3VFDA 1G8SA 2FV8A 5IAGA 4LYDA 1KXZA 3DBLA 4QSMA 5BV8A 2GYVA 1Z8HA 3BMCB 3OY7A 1SXPA 4HGYA 3ZQ6A 4FCVA 5KSWB 1X86B 3KZKA 1E96A 3JASB 2YWRA 3BXZA 3B5JA 4WT7A 1D2CA 3G85A 4OK3A 1QNLA 1IN8A 4GC9A 2QSUA 4QHTA 3T3EA 2X9GA 4Q4LA 1T2VA 4FT4A 3EIXA 3RKSA 1PSDA 3MINA 5ICMA 1GGNA 2NTEA 3PPVA 3HEMA 2ODAA 1UFQA 4YJDA 1P19A 3X3HA 2ZYTX 3O83A 3RUIA 4OLHA 3UFBA 4FR2A 1W25A 3K6RA 1O7JA 3DVAB 5IT0A 3HBJA 1L6IA 5LBIA 1ZGJA 2FLWA 2QZPA 3H8SA 3KJIA 4YQZA 1DSSG 3VSCA 4L9WA 1X7XB 1LK7A 3UV3A 3UMMA 1Y4DE 3STUA 4TMWA 2Y0BA 3W6UA 1I6KA 1FMCA 5CITA 4M1KA 1C4XA 4RE6A 1NQVA 1LTHR 3WGJA 2PKXA 1PR6A 1CUVA 2BKLA 3JD1A 2GI4A 4MLZA 4PM4A 4R9RA 1CJUC 2HF2A 2BN4A 1NN1A 1CJBA 1Y82A 1JDTA 4PG5A 4PIMA 4YNBA 3U7JA 2BLNA 3SC2B 2KSQA 2PD3A 2CFRA 3IJ5A 3PEVA 1U8AA 3CFYA 4PC1A 1WP9A 5DISB 4HNUA 2C1ZA 3FI0A 2EG5A 4L7QA 1XB2A 5T4HA 2OCDA 4EPWA 5IJAA 5TT1A 3BB3A 4GI1A 4BATA 3ZGNA 5JD4A 2YNMD 2RHWA 4NDNE 2VJQA 2YYAA 4V03A 2DLDA 4NR0A 1VC2A 2FF7A 2MYTA 4FE4A 4K6OA 3GRAA 4L8WB 1NBEA 3I2JA 2P9BA 3IP6A 5AW8A 4M36A 1B00A 5HCUA 2B8NA 4E6EA 1USVA 4HTAA 4JENA 2C57A 2EKPA 1CERA 3HNPA 4P7JA 1V2GA 2HV9A 4AZTA 1XDDA 1R2QA 3ENQA 1GSHA 1F0PA 2ADMA 1AO3A 3MYRA 4I8XA 4RHFA 5BSVA 1WQ4A 3A1SA 3F6EX 5JJKA 3EQ9A 1C9NA 1Y6QA 1PTKA 5D3ZA 4AF6A 1K4KA 2WMYA 3KYIB 1I24A 1HLGA 2XTZA 3FRIA 1D2GA 2Z95A 1XRLA 3MB8A 4BNZA 4RK1A 2I1WA 5JH7A 4PLGA 4JMPA 4F2GA 1NIJA 4OH7A 4TLCA 3I05A 3A9WA 1CF2O 2IITA 2JH3A 2XGMA 2XWSA 1XFAA 4WNIA 5FBHA 1FFSA 1FNDA 3N28A 4GMHA 4WI1A 2JAWA 3R7FA 3VZDA 1JJAA 3GU3A 3L8YA 3SVZA 4ENRA 5FBZA 4ZVVA 1FNMA 3DMNA 2JLYA 1ESDA 2A33A 1TMOA 4QU9A 3LG2A 4FT2A 2IOFK 1ZJ5A 5L3RA 1A1VA 4GWGA 4M88A 4KNVA 2FRXA 1QFMA 1NYTA 3FSEA 4DWJA 3QQPA 2R6FA 3A1TA 1ZW6A 2WSIA 2CNWD 2JJ2D 4ZWNA 2Y05A 3ZD9A 2QJRA 4AKHA 2R3SA 4ZI2A 3E9EA 1IUNA 1AQUA 4LZJA 3IHKA 2QTVB 2EFHB 3C6ZA 1KEEA 1P6UA 5FOTA 3QEAZ 3QBJA 3TVYA 4GPIB 4JK3A 4TT3D 3EEOA 4D44A 1C29B 4YREA 3KLMX 1XLTC 3PF9A 4M9UA 1RE1A 2CHEA 2JCSA 3V1NA 4MRMB 2OYRA 4IR7A 4N7MA 2BTOA 2APJA 1VJTA 2NSDA 3DBOB 3MPUA 1WSBA 1YBVA 3ENWA 1O6FA 1P1KA 2XVYA 3D8BA 3EMKA 3IUJA 1YE5A 3KZNA 4F9GA 2IZ6A 3LGAA 3OQOA 1DKOA 4RKQA 1I5OA 2I8AA 3LWDA 1L9KA 1X13A 2ACWA 2OMEA 4HZGA 4BKOA 1DQNA 4GOJA 1MOPA 5GINE 4FGKA 1ZH2A 2WK1A 1U9YA 5EA2A 3T7SA 2PFKA 5BSWA 4C3OB 1LEHA 2OP0A 4X5OA 3D3JA 5I9TA 3V34A 2G6TA 2HQRA 2K4MA 2NQTA 1UPCA 2OV1A 1GTZA 2DRIA 2ZIXB 4CU5A 5E8JA 4CN8A 1J2YA 2HLDA 4FVTA 5IVPA 1SK8A 1D0SA 1B76A 3R9XB 2W83A 4F3TA 2OBLA 4V0SA 1K86A 3TLAA 4JQSA 1F4VA 3EGDB 5CJ2A 1FUEA 2QLMA 4J1SA 4BLVA 4IDNA 2BONA 1EFRA 3EGXB 3V48A 3WR5A 2H9YA 3R5TA 2IF0A 3OMLA 4KX3A 4G5XA 2GJ9A 5KUTA 1TFRA 4AZ0B 1ECGA 4W5QA 2PGDA 3V42A 2YXDA 5AJUA 3VR5D 1M34B 2ECFA 4HFRA 4RCYA 5KVSA 4BO3A 2IS4A 2BIFA 2O2YA 1SZDA 2ARKA 2G8LA 2OXIA 3N6RA 1DBPA 1RAHA 1U3UA 5FHRA 5I8ZA 5HZMA 1GDTA 1HR0B 4P92A 4DQDA 1RAIA 4M2LA 2EF0A 2DZDA 5JO9A 2N47A 3KUDA 4QYWA 1XPOA 1G16A 3QEKA 5MF6A 2PXHA 1THGA 3W2GA 1TJYA 2DF8A 2E89A 4IOKA 4R4JA 3DVLA 3DYBA 3TFOA 2ISQA 2JFXA 3EFOB 2UUPA 3KSMA 2W93A 1L4FA 5CX4A 1SXGA 1J2RA 2H59A 3O2QB 2YMLA 1XXHE 3IP8A 4XB6B 1Q91A 3FGNA 5DYTA 4CIWA 2FWIA 4M0CA 5E9QA 3C3AA 4M49A 3WWEA 4YMIA 4A2WA 4LYYA 4I8DA 7AT1A 4DIFA 4TV9B 2QTNA 3SDBA 1X9IA 2GCGA 1CF9A 2Q4TA 2FNAA 4R68A 3FFWA 3REFA 2XYHA 3RJMA 3W6PA 2BRUA 3ENVA 3KTFA 3T7AA 1ABFA 2ETXA 2WDZA 1GPUA 3OE4A 2XBLA 3TRHA 3VO8A 1RJGA 3D59A 5DGCA 4BEVA 8LDHA 3U60B 4QBFA 2AYYA 3IBFA 1Q20A 1O08A 5AVTA 5JZSA 1JWLA 4Z9XA 3VC2A 3MBOA 5H02A 1K7FB 2B9VA 1P5RA 2AH5A 3IJRA 1I3CA 2ONKA 4GWLA 5B3JC 2H16A 3V8RA 3IBYA 5JV5A 2V58A 3RG8A 2O8FA 1LRLA 3PUYA 3K9HA 3U3XA 2HA3A 3CPHA 5EQFA 4AQDA 1L5HB 1JKJA 3D9QX 3IVCA 3TQIA 4ECEA 1MT0A 2XH8A 5G3ZA 3JQAA 4A7PA 1XTRA 2N3ZA 4BXOB 4L27A 2E4VA 4V1CI 3MRVA 4R41A 5DJ5A 4LG1A 3OM1A 4KVGA 2YVKA 4N65A 2HCBA 3VR3A 3ETJA 4UUNA 1II8B 3KTAB 4HK4A 4IQ4A 3CX7A 4IINA 5G3YA 4EGSA 2CK3D 2OLKA 2QLFA 1Y34E 2Y4NA 3AUXA 3I30X 3DOOA 3TZBA 2WIFA 4DDTA 3HUTA 3B6ZA 2A9KA 1NSTA 2B4YA 4X61A 5IDYA 2MHCA 3AEQA 3HXTA 5LYJA 1RPNA 2OK7A 2PX8A 1ZITA 2E49A 1DCMA 1K0UA 1L5WA 3P4YA 3WGQA 3JAKA 2VJLA 1IUKA 4LHYA 5J59A 3OWHA 4HD8A 2YFQA 1EAMA 1M2EA 3QNWA 4FOPA 2CJPA 4TN5A 3VI4B 1MZPA 2H1IA 2VJYA 5LQCA 3E2IA 1DAPA 5E7JA 2HWUA 3DLCA 3DDUA 5AW3A 3QWIA 1G4HA 3B48A 3EFBA 4EGQA 2C5LA 2G9RA 4GNRA 3DFUA 3WZ2A 4BFUA 4YXWA 2CXNA 3IAFA 1MHPA 2QVCA 2ZWAA 4I5FA 3E5RA 3GLHE 2R66A 2FR1A 4LY0A 2I62A 4AECA 1YBAA 4EB0A 2MSLA 4CCYB 1YL5A 2D2IA 1DAGA 2NNWB 4XJVA 2I91A 3LL7A 1L5YA 4ACAA 1W36C 1Y8RA 1ORDA 4HVLA 5EZSA 1QAMA 5CM2Z 4RK5A 5JQGF 1WB9A 3ETLA 1ZGCA 4GR4A 3I5YA 3ND8A 1WD7A 5AUNB 2XB6A 3W78A 1D9ZA 4EABA 1EAYA 1WW2A 4J0GA 2VP9A 5M04A 3FPLA 5DOZA 1J23A 2HGSA 3T5CA 1SURA 4HN4B 3AF2A 1DQYA 3ESQA 2FCAA 3OETA 5ILQA 5B2FA 4DLUA 4EYEA 4ID3A 4MAFA 1XKQA 2YXEA 3MOIA 4MJXA 3NZEA 1OWPA 1YJCA 2CV0A 4AS3A 2AT1A 2DPGA 3AERB 3IR6A 2ZE6A 1NVVR 1YC5A 3QA9A 2PL9A 3QFSA 2AXQA 2PEZA 2WB2A 2EU8A 4I3HA 1DWUA 1LW6E 2IYTA 4JMLA 4LCEA 5DM4A 4EATA 1AY0A 1F5SA 1ZK3A 2J32A 3CLSD 1II9A 3S1SA 4MYTA 2X22A 2YOHA 3NHPA 1OH7A 1G98A 4RBNA 4JLVA 5J2TA 1KMHB 1ZN2A 4GVPA 3L1KA 2V6BA 5FPSA 4KRXA 4CM9A 2P91A 2A3NA 2RI6A 1ECCA 3PQFA 4BN4A 3HKDB 1XTTA 3VKVA 3ICVA 3Q8KA 5BSFA 1COWA 3FIJA 3NAZA 3ZE7A 3QRWA 4RIFA 1T4BA 4GZMA 2XRYA 5LA6A 1TK2A 4UE3S 3JPWA 1Y5MA 5CX1B 3UN1A 1VGVA 3NBYC 4X8HA 5JWRA 1Y8QB 1TQHA 2HX1A 3GELA 5DTQA 2XE8A 4XGNA 3I8OA 5AM0A 3SBEA 2PU5A 3FUUA 4C4AA 2QTTA 3HP1A 1QJ4A 1MGOA 2NZ8A 1HDXA 3HV2A 3AR4A 2G83A 1XQ9A 1DT3A 4FMCB 4Q1FA 3VTKA 1IY0A 4LXYA 5L45A 1YR9A 3E58A 3INRA 4E5UA 1H2XA 4OBBA 5GV7A 1YRWA 4CL2A 2IQIA 4BNKA 4U5XA 1XRNA 1SKBA 4HKTA 4OGGA 1N75A 1ISRA 3QTBA 2FPRA 2GCOB 4JXJA 4UDOA 2UVPB 4DRXB 4ZGWA 1R0KA 1P3DA 3Q7SA 5ESRA 3KJEA 2DH5A 3TCXB 1F9AA 2IHTA 2HRBA 5ESDA 3QYPA 4R2HA 3ROXA 1LC3A 2QW0X 2QX8A 3W4KA 4LYGA 1NVDA 4GECA 5KREA 1GZ7A 1RKBA 2WWIA 2V45A 1SC9A 1P1HA 3SIXA 5KX5B 5FO1A 1FYDA 4NJMB 16PKA 4B48A 2PGOA 3X1ZA 4MWBA 5ALEA 2OT3B 4ZO4A 3I32A 4R1LA 1SIOA 1Q44A 3HO8A 4C6RA 2W4MA 4R9NA 4A0FA 4BO0A 1JDUA 1NL3A 1E59A 1TC1A 1VMKA 2D7JA 1ZL0A 2W90A 2X9NA 4AIRA 3VO9A 3I73A 1G3MA 1GL3A 3P4UA 4OF4A 4PPYA 1HLFA 5A4IS 5JW6A 1MJGM 1S4QA 1WB4A 2BEUB 4YECA 3CZMA 3L8DA 2FPPB 2OVFA 5KI6A 4CL3A 3WHLA 1M75A 1UBHS 1KZ4A 2H4HA 1XZCA 3SM9A 3ZQKA 4QBTA 2A9QA 3QVUA 5KOHA 1UJNA 3HA7A 1SKUA 5CYOA 2BZGA 1ABEA 3EVAA 5E95A 1WA5A 2NP7A 3ABRB 3EY4A 3G2LA 3E7DA 1N0VC 3F47A 1DOAA 4Z51A 3F78A 4IKEA 1KEWA 1KEZA 5KYXB 4ON9A 2X7JA 3F5QA 3LPAA 3Q1LA 1PK8A 2OQRA 3W6NA 3LP6A 2QLNA 4BRSA 2IHVA 3LBIA 1XTIA 3BZWA 1U2QA 4HNVA 2VTVA 3AR8A 2WG2A 1KARA 2NUAA 1QLHA 3CGGA 3GFBA 3PP8A 1D0VA 1RPAA 1JKMA 1ZIOA 5IVIA 3BCUA 1EFLA 4B35A 5C1BA 3IDOA 3KCNA 4REQA 4KR6A 1D6MA 3VPFA 4INAA 3RADC 4BECA 3M6FA 1VHDA 4NMMA 4QUDA 5E9WA 4B8ZA 1U65A 5FH9A 1QG6A 2O07A 2Y0EA 4KUGA 3U3OA 3ZS9A 4MW4A 1FRZA 1E6WA 3LC7O 3R7BA 5I5EA 5AW7A 2FOIA 4D5GA 2CW5A 1Y1TA 1DRWA 1YR1A 3MF4A 4IZHA 4GOKA 3FSRA 3VAAA 3SQWA 3NWEA 1WHTA 2ZRHA 4N3GA 2ORWA 2Q1WA 3F9RA 2BHSA 1Q2XA 3M1AA 1N5DA 3OTGA 4MP8A 4DEXA 2YOGA 3DVSX 1BVUA 1KI4A 4N3CA 5F7OA 1BD3A 3HCRA 1K4YA 3FVVA 3K5IA 2HQOA 3HXOA 4XRRA 4GVXA 4G8DA 4LJLA 4GGPA 2BP7B 1UXGA 1E9CA 1KJZA 1Q95A 3BH6A 3BUSA 3CR8A 4AROA 1UT5A 1DAFA 3FKSD 2EKQA 4QYIB 4NZYA 3G82C 3ND7A 2GPJA 2QUIA 3VZQA 2I7XA 5LUBA 4MVYA 5JY6A 2KHZA 1R50A 1RYNA 4PZCA 4YPFA 3GGCA 2AN5A 3JQ7B 3NX4A 3G9ZA 2NSLA 3TS1A 1PDWA 3IO5A 3EISA 3QE4A 1JMVA 1CNFA 1YOVA 3DWGA 2EFEB 2YY7A 4RPJA 1V3QE 3NC4A 2DQYA 3ZIAD 1PZHA 1K75A 4RL4A 2G9QA 2PV0A 1TM5E 4BCCA 2PUEA 4NZNA 1F5NA 2IXDA 4TMVA 4JGIA 2W6ZA 5SZKB 1M0SA 3T3IA 1P73A 3E61A 3Q7PA 1SCQA 2XNKA 2HPZA 3C14C 5CA0A 1CDZA 1H2FA 1ZCJA 4O02B 1XZ8A 4CKYA 2DPYA 3H9CA 4HRAA 4EENA 3JYLA 3R3UA 3PL5A 2RC5A 4X7RA 3RFVA 4K26A 6PFKA 1UMCA 1YHYA 1BCRA 3R5FA 4EYSA 1CUHA 1IMJA 4NCNA 2ECOA 2Y4OA 1GTVA 3HLTA 4NP6A 2J30A 1XD2A 1S5PA 1U7ZA 2YQ5A 1W6RA 3FCUB 1KA9H 3KAJA 3L0CA 3LQYA 3QE2A 1SBZA 4AMBA 2J3QA 2PSFA 4HAIA 1GFWA 3QLUC 5ULLA 1HE3A 5DYYA 1GFSA 1T8UA 3F6SA 1J99A 3IMEA 5JS8A 1E64A 1QPZA 1Q19A 3RIHA 3HI6A 1HQYE 3SC4A 1FU8A 1MEEA 5IAJA 3JW8A 3WYDA 4CDNA 2DHEA 4G67A 1DRJA 2XYPA 3FNGA 4JVLA 1DC4A 5BVGA 5EJEA 3PWZA 4KIGA 2QDXA 1FVHA 3DOCA 1J0AA 1V43A 2LV8A 3F6CA 1SGWA 2QAGB 3HABA 3OT1B 3PNBA 4INJA 3ZKWA 4JLAA 4YBRA 2VK4A 2ORED 4BGIA 1ZS9A 1E0AA 2VDMB 2HJRA 1NTRA 3MOGA 3BBLA 3W8RA 4FZVA 1DBVO 1B6GA 1YE8A 4N5LA 5EE1A 1K27A 1T6XA 3DVQX 3WMWA 3DTVA 4C1BA 4MVJD 3ZXSA 1TO6A 2XUKA 3SLRA 2QYOA 1O9GA 5D01A 4TLEA 2ZXFA 1VJ1A 5EZ6B 5JS6A 2D1FA 3G5AA 2B6NA 1SJ9A 2E6UX 3MQFA 4J90A 4J16C 5CXSA 3BULA 3ZDDA 1DTWB 2JGRA 5HK8A 3IIMA 1EESA 5BV7A 4URYR 2EIXA 2W11A 1X6VA 1KRWA 1FDIA 1RHQA 4PQFA 4X8LA 1EQ2A 1KK2A 4GE0A 3ICQB 5IBPA 2ZJ1A 4M3NA 2EX4A 5GY7A 4DRZA 3PUWA 4JI6B 5IZCC 1W5TA 2FX2A 4OQ4A 3RT7A 5IT4A 1J9GA 1FSZA 2WT9A 5ER9A 1WU8A 4UBJA 5TPZA 7ADHA 3Q72A 1ISJA 1E79D 1Z0JA 1FRNA 3CX8A 2HREA 4JR1A 2ORIA 3O8OB 1GKYA 5CH3A 3PXGA 3RIMA 4F4DA 4EAAA 1V5EA 4FKZA 2PSDA 1Z5UA 2HMSA 3HSYA 4UJ5A 2V6JA 1T9AA 2JAUA 3DZDA 3PICA 4MWCA 3FYDA 4OUKX 5EPOA 3RD5A 3Q0TA 4O3MA 1JF8A 1ILWA 1FNSA 3R6TA 2J9YB 3SK0A 2DU8A 4Z4QA 2JGAA 2NO5A 2RHCA 1W4LA 3A3OA 1QRRA 1E7RA 2VP6A 5K3SA 3TAXA 1WBBA 1UL1X 2BEJA 1JR6A 1L4KA 3NXSA 1GQRA 3VHXA 1OAKA 4TM7A 2FFBA 4KE8A 3AG5A 3OQ1A 5BYBA 5C8XA 3PZBA 4IXNA 2VTBB 1NWCA 1W0JD 1QK5A 4RVHA 4H77A 4X6LA 2ZRCA 4NOLA 4MAMA 2Z2JA 4A6EA 2HR1A 1Z33A 1W85A 3AR2A 3ZW8A 2Z6AA 2P5TB 2ONYA 4DYDA 1D8TA 3AB8A 3QEMA 1PVDA 4D42A 5DM60 1UODA 3P2EA 4BX8A 3QF4A 2CFOA 4WLNA 3F2IA 4Q9LA 3FMOB 3TXYA 2CFIA 1ZD8A 5A5FA 1HM5A 2JIPA 1X2EA 2VK8A 5HZHA 4JWKA 3PTZA 3CS3A 1IG0A 4GPEA 2D8AA 2G4VA 2GBLC 2OORC 4MUGA 4QHYA 1GEEA 4U9HS 2M6KA 4QKQA 3TZKA 5CVCA 3AWDA 2ODPA 3LHFA 2DAPA 3KU4A 4HGNA 4ILEA 1OF1A 4PYRA 4XIFA 3DKKA 3DMTC 3KJZA 2D6FA 3SU8A 4RTPA 1VI6A 3CVWA 4F9FA 5KYNA 3MN1A 4WACA 3IAUA 4Q1DA 3CIFA 3UVEA 5B7PA 2MR6A 3PBKA 5A4FS 2A1UA 4G4IA 2OD9A 2GSWA 1NF8A 6YASA 3ZY2A 2F4NA 4WXYB 4DM4A 3VNAA 4DMHA 2WD7B 4ARAA 2NV0A 3RASA 2GXUA 2UZ4A 1E89A 1WDTA 3UWOA 1XE3A 1W36D 1PLKA 1A8SA 2FETA 4A6PA 4BUJA 3UGTA 1OJ7A 3DE1X 1TZKA 1JHAA 4J0KA 1HYQA 4XUDA 1EFPB 121PA 2JA2A 3P9YA 1GKKA 4ZXFA 3R5XA 1T6BY 2CNDA 3I2YX 4NV1A 1DRVA 1CIPA 1PL7A 4JEUA 2H7XA 3LLCA 1XHFA 4JC4A 1VL1A 5AHWA 1DLJA 4CEHA 3HTXA 4IDOA 2W0MA 4PQGA 2XUQA 3O82A 5DBIA 2CXPA 1KYTA 1L7PA 3M0EA 5CVVA 3GQBA 3WLEA 3CUSA 4V39A 1RHKA 4QUGA 4RJTA 4RNCA 1T8SA 1IEQA 4L72A 4MUFA 3TN7A 4WZBA 2ID8A 5I7WA 2J3LA 2KM1A 3QUCA 1Z47A 5F51A 1G7CA 2JCXA 1IDOA 1GTSA 3FOAA 1PVOA 1V8DA 1VP9A 5EVJA 3CH5A 1CUCA 2YN2A 4KE7A 3OE1A 1QQ5A 2GXSA 3E5HA 4JHLA 4WA8A 3B1KA 5K6AC 4U8HA 1BA2A 1HGXA 3OFVA 2EX1A 3RGGA 3A9RA 1E3IA 1RQRA 5LP6B 3QHQA 2F64A 3F2VA 4IW3B 4MR9A 4P53A 1YS9A 2WRZA 4Q01A 3T06B 1L4MA 4ZT5A 5TE9A 2HU5A 2OYSA 3U2QA 4UUOA 4N49A 1T0PA 1ZJ6A 1PV2A 3OKFA 4WGFA 5ICFA 1S0UA 4LSWA 3QMVA 3BICA 1SBHA 4MEJA 1BHJA 2OBFA 4LOLA 4XSGA 3D4PA 3RFUA 2A94A 4LW8A 3DAPA 4D43A 2J3DA 3NUZA 4PY2A 2NVBA 1G41A 4DRYA 1XVVA 2P9QA 5IEJA 3U7GA 1NOJA 4GSLA 1CQXA 1KPIA 3DXYA 4A1OA 1D4AA 1YCGA 3UBTA 3RROA 3VPCA 5IFKA 1DCTA 3EZGA 3AX6A 1T15A 2P62A 3GY0A 2O8BA 5KYUB 2H57A 4G9BA 2I6SA 4HQ0A 1GRRA 2OD2A 4OBXA 4RHCA 3U9LA 4DMRA 2R11A 5HG0A 2HCRA 4AF7A 1AMOA 3UNXA 3HBFA 3ZHTA 2P0EA 1W4CA 4NCIA 2JKYA 4LJ8A 4UPVA 4YCDA 1EXMA 4YRFA 3SMVA 3WMRA 3OJFA 4MGEA 5F1OA 1ZZGA 3FBTA 3KB1A 1SY7A 4Q3BA 4JI3B 1C3OB 1KJJA 2CY0A 2FEKA 3A0RB 1M8KA 1T5IA 5FTMA 2AX3A 4IMPA 5HMMA 3UZUA 3ZIUA 2C1EA 1MU0A 3N0VA 1E60A 4YR9A 5FNVA 1Q83A 3ZD8A 4UTXA 1WF6A 3CZAA 1DAHA 1G8FA 4JS0A 4CF3A 4WBNA 3EOZA 2C07A 4Z49A 5JZBA 2PSEA 3I8SA 1WSDA 2IZ5A 5HKOA 3O9VA 1UMBA 4TPKA 1CZNA 3WLNA 1TEXA 1IY2A 5JJCA 1E9VA 1QH9A 2WWWA 3A1EA 3GA7A 2AJBA 2Q41A 4RPGA 1J90A 1E6CA 1AKTA 3NAGA 5DTRA 2V6IA 4PX3A 1OKKA 1G8PA 4KQ6A 3KFVA 3OI7A 4H17A 4MYSA 2ZKLA 3FTPA 2ONJA 4WMLA 3THRA 4MNTA 4BB5A 3OCVA 3ORHA 5TMBA 2OHGA 4JQCA 5HUHA 2JLVA 1JFTA 3VDNB 3OQPA 3EDQA 3VAZA 1RD4A 3VUEA 3WK5A 2NPOA 2QR5A 1VPEA 1YWGO 3DF7A 1KH1A 4TTQA 1LBIA 3HY6A 4OSOA 4L4YA 4KITB 1N5KA 3K6SA 2JIBA 1YB7A 2ZRBA 4IJMA 4OAPA 5F9FA 4AG6A 2D1RA 1R6XA 5CDGA 3FF1A 2ATCA 2XUAA 1L2TA 4PSVA 2GBIA 5IABA 5EUCA 3BWVA 2VHVA 4MRVA 2XMQA 3ZPXA 4K3UA 2HJSA 1SQ6A 4ATNA 5B5SA 4GRAA 4UFNA 1H3EA 4ZEVA 4WFQA 4HNAB 1MKYA 3A6HA 1GPBA 3QOWA 2XUZA 1E69A 1FLVA 2GPTA 4NDAA 1G2PA 2YCBA 3CVXA 3LQFA 4CODB 4Q4JB 4ZCLA 3QBVA 1EFCA 1U8FO 3OCYA 3WXBA 4M8SA 3SQLA 3L7AA 4BFZA 2XOXA 4YLGA 5AJYA 5H59A 1K98A 2H06A 1HQKA 3LYUA 4KYVA 4NRDA 3AJ8A 4KE9A 3U9SA 5J2UF 5DIFA 1XO1A 3RVDA 2A35A 3BG5A 1A50B 3K1AB 3PITA 4HI0E 4WSOA 3SSMA 3SWWA 3ANYB 3CEHA 1SKQA 2KPOA 4C7JA 3EC1A 5HWSA 1I3LA 1PJTA 2J6BA 1B1AA 4EBBA 2FKNA 3KPJA 3R0ZA 3TIIA 3QMPA 5IWCA 1S2NA 3ZY6A 5GZ1A 1RM0A 3SYNA 3TWOA 4HLQB 5TS2A 4P2GA 3QLVC 2VEDA 3DUWA 1ZMXA 3COPA 3Q11A 4WBXC 1CRWG 3I9V6 4B7XA 2JLQA 3G6WA 4CEIB 4PSCA 3TAUA 1KZYC 2ZBRA 3FOFC 4FDMA 4P3NA 1HFKA 5GONA 5ALGA 4OIFA 1F06A 1XWFA 3GJXC 4U7DA 1SIWA 1NVVQ 4PLYA 3LWBA 4EW6A 2C2WA 3I28A 2GS9A 4TLMB 5JLAA 2F00A 3TVTA 2ZT7A 4TYMA 1O97D 3NDPA 3USCS 4C0HA 4I4NA 1E8DA 4MS1B 2G77B 1RI1A 1W88A 4X1YA 1Y5RA 1KO5A 2FSVA 2P41A 3OT5A 5HE8A 5SY4A 3W9SA 3IOMA 3PJDA 1HF3A 5B6PA 4DR3B 2N0SA 1YRAA 2J5QA 2NUTB 1OILA 2RFLA 2CHUA 2YW9A 3IUSA 4HDAA 4ZALA 3P9XA 1EFHA 1Z7YA 5G0WA 4BHTA 5JHHB 2RCNA 5CURA 1XF9A 2QP9X 3U26A 2QXYA 5AVSA 5I9LA 4X0EA 1Q6YA 1OV4A 2ZCVA 2XITA 3ZR4B 1AV6A 2VCYA 3LBHA 4OQZA 3AM5A 1N0HA 5DWDA 1E2LA 3I4LA 4IRXA 1F0KA 1PFVA 5IRCD 4OQDA 4BKQA 2HHLA 2BZ0A 2A30A 3C5CA 3Q9LA 3AB7A 4HLUA 3D4BA 2EBHX 5EJAA 3RBXA 4A26A 3DUFB 4DMKA 1QP8A 1AB6A 2ZJ5A 3FPEA 3OSUA 1XZHA 1WW8A 3W7VA 1D4FA 1Q1ZA 3DAYA 3GJQA 3H6KA 3VRHA 1GRCA 1AU9A 4UUBA 5F3WB 5JC1A 3ELDA 4CV0A 1KHHA 2HRCA 4ITUA 4OX9Y 1U1GA 1ZYUA 4XASA 3CC8A 2B35A 2D4HA 2O2IA 2SHKA 2Z9BA 5TC4A 3WQBA 2W6JD 4ZZ3A 4MDHA 3PT5A 4FYWA 1IBCA 3RGWS 4I5EA 1KVUA 1Y1KE 3PFNA 4E5PA 1YJQA 2ECKA 3X1YA 2A6PA 5KYTA 1RE0A 3H2GA 4WFKA 1O87A 4FFBB 4RZ2A 3PZRA 3U3RA 2ZIAA 3R8FA 2XSZA 1T6NA 2P9HA 4GGOA 3WGMA 2PLFA 2GBCA 4RZSA 4KFCA 1CEYA 1JAXA 3DMGA 3ONFA 3H3XA 2GFQA 4KAJA 1N2IA 5G1NA 3BE8A 1D2MA 2BKXA 5KOYA 1EH5A 1EFVB 2CXRA 3BTUA 1BFUA 3I62A 3F4LA 1KHTA 3BSYA 3QBEA 4EG0A 1WS6A 5GOTA 4KREA 3RSCA 1RYYA 5AUOB 3B53X 1NBAA 3OJCA 2POCA 4WZ6A 2QD1A 1B42A 4M55A 2YW2A 3G8CA 1E8MA 4W63A 2VR1A 4JGBA 5EJIA 2D2VA 3S7ZA 5C8DA 3PEWA 3MJ4A 3KJHA 1CRPA 3KAPA 1N5MA 5DI9A 4M0FA 4EMSA 3EWAA 4BIMA 4Z99A 4MO2A 2CJYA 1LF5A 2GILA 3QP9A 3TSOA 4BNDB 1SVUA 4DUPA 4P9NA 4LBVA 1A2QA 3UV6A 4I81A 2C4KA 1T10A 5JS7A 1R9NA 4FI3F 1UFKA 4OJNA 1SG6A 4OO3A 1BGWA 3RH0A 5CK5A 1QDUA 1KOLA 1NVMB 2VT6A 3CUKA 1DIAA 2C9CA 2IOYA 5FI0B 1M2JA 5BN5B 5FTNA 5BSHA 2ZUDA 1EUDA 3DAGA 1DUSA 4NEHB 4RHEA 5K0LA 1C4OA 1AG9A 3ROQA 3VZBA 4RW0A 2IL1A 3JYQA 4TL7A 1CIJA 4D8TA 1C1DA 4S1WA 5E6SA 4DDHA 4EI9A 4LFBB 3Q6NA 4EG5A 2ZAIA 3FZYA 4Z9BA 3FPKA 5EIHA 1PR9A 4YAJA 4P7BA 4A4DA 1N3IA 2ZWIA 3N2LA 2XLBA 2Y1OA 4IS2A 2XB4A 2W6CX 2O59A 1P1BA 3N53A 1TVMA 3B1WA 5KYYB 1YV9A 1KF0A 2IX3A 4X7MA 5CDSA 4BO9A 1DBIA 2OC9A 3DSRA 3PFBA 1R6DA 2I2CA 5C1PA 3OPQA 2O8EB 5EIEA 3RPEA 4KSBA