4PVDA

Crystal structure of yeast methylglyoxal/isovaleraldehyde reductase gre2 complexed with nadph
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
342
structure length
342
Chain Sequence
MSVFVSGANGFIAQHIVDLLLKEDYKVIGSARSQEKAENLTEAFGNNPKFSMEVVPDISKLDAFDHVFQKHGKDIKIVLHTASPFCFDITDSERDLLIPAVNGVKGILHSIKKYAADSVERVVLTSSYAAVFDMAKENDKSLTFNEESWNPATWESCQSDPVNAYCGSKKFAEKAAWEFLEENRDSVKFELTAVNPVYVFGPQMFDKDVKKHLNTSCELVNSLMHLSPEDKIPELFGGYIDVRDVAKAHLVAFQKRETIGQRLIVSEARFTMQDVLDILNEDFPVLKGNIPVGKPGSGATHNTLGATLDNKKSKKLLGFKFRNLKETIDDTASQILKFEGRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH-dependent methylglyoxal reductase GRE2
publication title Structural insights into the cofactor-assisted substrate recognition of yeast methylglyoxal/isovaleraldehyde reductase Gre2
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 125
structure length 342
sequence length 342
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.265: 3-methylbutanal reductase.
pdb deposition date 2014-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4pvdA00
3WSVA 4RV9A 2C5EA 1LSUA 3FWZA 1AXEA 3OBBA 5ICMA 3NT5A 3PIDA 4BIIA 4DL9A 2ZJ0A 4E31A 1P77A 2ZTVA 1JAXA 4CM8A 2JL1A 3DBRA 3K96A 3LF2A 3ZU2A 5G0SA 4AJJA 1Z7BA 3DZFA 1ZVMA 4QO7A 5B4UA 3I9KA 3E8XA 3EZYA 4B4WA 3S8MA 2VHZA 2ZTMA 1NBOA 4BS9A 1B8PA 4OKNA 1E5QA 1Z75A 2AE2A 1I36A 4QUKA 4LRSB 2GERA 3TF5A 1I24A 4F46A 3S2FA 3F46A 1IULA 4HFMA 4BNYA 1DFGA 4DIBA 1XLTA 2JAPA 2NTJA 3GMDA 3SLGA 2YZ7A 1JWBB 3GQVA 4R51A 3LVFO 3QWBA 3P5SA 3WYEA 2CVQA 5HTOA 1UXHA 2NLOA 4IXWA 5FFFA 1QV6A 2P5YA 4W7HA 5EN4A 4RPKA 2R2GA 2ZYGA 1NAIA 2WYUA 4OIMA 1H6DA 3IL2A 2NVWA 1LSSA 1CRWG 2OP0A 4R16A 4YJHB 3H3JA 1K89A 1J49A 3KHUA 3A06A 3PJGA 4HXYA 2NSDA 3GVCA 1TA4A 2Q2WA 4OQYA 4CLXA 1R66A 2G0TA 4GKBA 3R6DA 1XQ1A 3KRTA 1Y9EA 4WECA 3IJRA 3ZCXA 2PKRA 2DTEA 4CUKA 4Q3NA 4RPGA 3AW9A 3OJLA 4CLRB 5K0ZA 3MJEA 1YKFA 4Z9YA 1R4MB 3Q9UA 4UVHA 5KIAA 5CDTA 2NADA 1DC4A 3H5NA 1N9GA 3L07A 1BRMA 2PK3A 5BT9A 4YRBA 4YEDA 2Q1UA 1ZMTA 4AJIA 2B4QA 2RIRA 2WMDA 2JCVA 3WNQA 1MP0A 3AI3A 3T4XA 4LRTB 1I3LA 1EK6A 4GX1A 4MKRA 3U0BA 2WWRA 3HN2A 4ID9A 5JAQA 4CMKA 4GVLA 2VRBA 4LK3A 3CPSA 4ZA2A 5JO0A 2BH9A 3ON5A 4TRNA 2JD1A 2YQ5A 3EHEA 3W4IA 2R00A 4IQ0A 1Y7TA 5ES3A 1PJCA 3QVWA 3NRCA 3V1TC 2B4TO 3HWRA 3AU9A 2XAAA 3ZHZA 4CUZA 1WPQA 4R5MA 1LC3A 1R37A 3KYBA 5JY6A 5BSEA 5JMPA 1LQUA 2HMSA 3CEAA 2H1SA 4PLFA 3GVHA 3CH6A 4CM1A 3GG2A 2FN7A 1QYDA 1BG6A 2WEKA 5DZSA 5BSHA 3RSHA 4KTVE 3A1NA 1LDGA 1VSUA 3RKRA 4RVDA 1Y8RA 3E48A 3DAGA 5A9TA 4EI2A 5T57A 3GF4A 1NQOA 5GY7A 4HBGA 2VZ0A 3WB9A 4G81A 5L4LA 2GGSA 2YHIB 5DOVA 5I8ZA 1C1XB 2B36A 4CM9D 1I32A 3QV1A 4L76A 5IZ4A 4MKXA 5ITVA 4DBZA 1JKIA 5KVVA 3KEQA 4WNCA 4EJ0A 3CMMA 1LEHA 2E37A 1ONPA 3LT0A 4CM3A 5B1YA 1P0CA 4F45A 2VHYA 4TZTA 3ZWOA 1H2HA 2JFFA 1E6UA 4RVSA 1W73A 3VTZA 1PJ3A 2YUTA 2OFPA 5F21A 3VH2A 4BKRA 1LSOA 1NAHA 1JWAB 1FDWA 4B3JA 1WLYA 1EUDA 4IGFA 1B16A 3EYWA 1ISGA 1X0XA 3JQGB 1E7SA 2EJWA 4ND4A 3WXBA 1LUAA 5CDSA 4E4YA 2VWHA 4NBVA 3PGJA 2GPTA 4BMNA 1XG5A 4FJ2A 2GO1A 1M76A 4P4GA 1PGJA 2NUAA 2VTDA 3ZU3A 1CETA 4S3MA 4AJ1A 5KKCA 4OH1A 4Y6RA 3RQSA 4DQXA 2GUGA 2J5QA 4W99A 1Y5MA 1P45A 3ZU5A 1ZXLA 2DFDA 3GHYA 2JFHA 4NG5A 1NFRA 3HHPA 2J5RA 4GX2A 1LTHR 4K6CA 5HBRA 4WCFB 1N1EA 4I5GA 1E3IA 5EERA 1DIGA 4Y8VA 2Q2QA 2WE7A 5AXCA 1TT7A 2YW9A 4I9NA 3OETA 1U2DA 2D3TA 5A06A 5DCWA 2NVUA 3FR8A 3JV7A 3L6EA 4NBTA 3SJ7A 3ZU4A 4E5NA 5A5FA 4CLOA 5KCZA 4Z0TA 5A1TA 2DTXA 1PZHA 1ZJYA 2FY8A 3QP9A 3QE3A 2V6FA 4HY3A 1E3WA 1EQUA 4WLFA 3JQFA 5T5QA 3FNFA 5DNAA 1EVJA 4OXYA 1DEHA 4IDBA 1X7DA 4H16A 1G6KA 2AG8A 5JCXA 4L9RA 4FIZA 1R4NA 1QLHA 3D0OA 3GC6A 3ENKA 4RF2A 3BYZA 1CWUA 3DL2A 3GR6A 3GY0A 2VNSA 5IF3A 2CDBA 3ZWWA 3IS3A 1NHGA 2QQ5A 2I65A 1DJQA 1X1TA 4QTZA 2HK8A 3P19A 3C3XA 4BGEA 5C7IO 5H81A 4FC7A 4G65A 3WTCA 3WX0A 4WK6A 2PH3A 1PZFA 3BHIA 1CDOA 4EGFA 4FOSA 3SXPA 4BNFA 5DCUA 4IQ8A 3Q11A 4OAQA 1GU7A 3EZLA 2NWQA 5KJEA 4TKMA 4NBWA 3MJVA 4EZBA 4L8VA 1YB1A 3OM9A 4ZQEA 3MWDB 2B0JA 1PJ2A 4WLVA 4D42A 2WYVA 2BGKA 5L3ZA 5MGBA 4KZPA 1B3BA 4IJVA 3RC9A 1BXGA 4IGEA 1UDCA 4L75A 5TX7A 3TZHA 5HS4A 3WIDA 1SAYA 1HDRA 1KVUA 3ZN2A 3VDRA 4QT0A 2HRBA 4OSOA 4R9SA 2AE1A 4CUJA 3ROPA 4CMAA 4MP8A 1E1MA 4EUHA 4DYDA 2Z5LA 3JQAA 4B7UA 2DC1A 2BFAA 1P33A 2OMEA 2RBEA 3GDOA 1PGQA 3JQBA 3DWFA 1N1GA 1NQ5A 4XJSA 3C1TA 1T2EA 1JU9A 1HSZA 4Z0PA 4D3SA 2VUUA 3CZMA 5JDIA 4XYEA 3PRJA 1I2BA 4A26A 3MOIA 4EW6A 1C0KA 3A14A 1PL7A 3EMKA 4JXKA 4N18A 2DUWA 5C7OO 1NM5A 2D1YA 3L4BC 1N5DA 1PS8A 3BMCB 4A5OA 5LDGA 4GLOA 2Y1FA 4A10A 3HDYA 1XQ6A 2WYWA 2EKQA 3OQ6A 4XYGA 3COSA 1EBUA 4XQEA 1P1IA 1R0SA 4BO9A 3CMCO 4RVGA 2B37A 5C5IA 3O4RA 2CF6A 3E6AA 5TS3A 4MVJG 4J1TA 2EP5A 5IDQA 1VL8A 2CDCA 2JAHA 5ILOA 2X1HA 4MVJI 1AUPA 5A05A 5CHEA 2JHGA 1I3KA 3L77A 5CPBA 4GGOA 1ADCA 1PR9A 2Y0CA 2X8LA 5JNLA 4RPHA 2HO5A 4JGBA 3TSCA 1UZMA 4YAEA 4E5KA 1KIFA 3ZNPA 4YJDA 2RAFA 4Q3DA 4CM6A 2XOXA 4DLBA 1ENPA 3MTJA 1WP4A 4IQGA 4CM7A 3ETGA 1P1KA 3WGGA 4CM8B 2J3KA 4CMJA 1H5QA 4Y67A 4IDGA 1SOWA 1JW9B 2YYYA 3ZHYA 4IDEA 4BO8A 5DULA 5IZCC 1BXKA 2UAGA 1DHTA 1PIWA 1Y1PA 3I9LA 2AEJA 4XDYA 1B3RA 1GUFA 2IDZA 3F4BA 4RF3A 1L7DA 4WOJA 1T2CA 5FF9A 3ZWBA 5ER6A 2YHUA 4YJHA 1UAYA 2AEFA 5ER9A 3DFUA 3AM5A 1B8VA 1YOVA 3EK2A 3ITDA 4GMFA 3IJPA 3H9JA 4XB2A 1I3MA 4BO4A 1ZSVA 5BQFA 3ULKA 1DFIA 1MXHA 3UUWA 2Y66A 4B8ZA 4J49A 4KUHA 5AXAA 3DZGA 1VKNA 3S55A 4JROA 3A28A 5IN5A 1DBVO 1BW9B 3QWIA 3N58A 2JD0A 4JP2A 1ZSYA 4PZDA 5T8KC 1IPFA 2O3UA 4U0KA 3RC7A 3Q9NA 4BGIA 1ENYA 2JFGA 4M49A 3KM0A 2CVOA 1CEQA 3SC4A 1K0UA 5I9NA 1HEUA 2HMUA 3RJ9A 2CD9A 3PWKA 4ZQGA 3DEYX 3PXXA 5G0TA 5JC8A 2AW5A 3Q3CA 3TQHA 3LF1A 3JSAA 3HNPA 1U8FO 2O23A 3FSRA 5JE8A 2X0JA 3KV3O 3E1KA 1XCBA 4TWRA 2W2LA 3ONFA 1WAMA 5FWNA 2W4QA 3PJEA 1PS0A 3PHIA 2IRWA 2JCXA 4HFJA 2EKLA 3DAPA 5JAIA 2OP1A 2FPIA 1NVTA 2FZEA 3EW7A 4BNXA 4MIYA 3F5SA 7ADHA 1R0KA 3GG9A 3BTOA 2YDXA 3ZWPA 3GN1A 3V2HA 1DIAA 1YXMA 3VOSA 4NZ9A 4J1NA 1JKJA 4Z9FA 1ZJZA 4RPLA 4BNMA 1HT0A 2YHIA 1Y9AA 1HTBA 4CV1A 1C1XA 5EPOA 4TKLA 1CJCA 3FNGA 4XR9A 1AHIA 2VOEA 3FTNA 2YFHA 1NWCA 1Y8RB 1N7HA 4RZHA 3VPSA 4BNJA 3K6JA 3LC1O 1H0KA 1QP8A 3ST7A 2VT3A 1N8KA 3FD8A 1PGNA 1XELA 2X4GA 4NFYA 3RUFA 5T6BA 1ISMA 2GNAA 2W2LD 1WDLA 2W2KB 3WGOA 4A0SA 1PR3A 4G5HA 3GRKA 4AL4A 2DLDA 1C1DB 2QZ9A 2HMWA 3GNTA 2PWZA 2RHRA 3IOYA 3O9ZA 2XPCA 3M2TA 4B4VA 5BNTA 4P4NA 4I5FA 1Q0HA 5HA5A 1ZEMA 4UEKA 3W8DA 3W1VA 1A7AA 3KZVA 4AJOA 1LQTA 3GVXA 5KJ1A 1I3NA 3IKTA 1J4AA 1KS9A 1PZEA 3HN7A 4QECA 3GAZA 4XB1A 1C0PA 1GAEO 2BD0A 3DZIA 4IY1A 5TSDA 4R9RA 5U1PA 2GYYA 1LLUA 3UF0A 3GUCA 4E3ZA 2VZ9A 2HK7A 3WGYA 3TFQA 2QHXA 4R1TA 1P1RA 4WASA 2ZB3A 5ITWA 2PLAA 4I08A 4XGNA 1DXYA 5A3VA 4ALNA 3JYLA 4URFA 1VJ0A 4OQZA 4CMEC 3PP8A 4OOFA 1HRDA 1GYRA 1EBFA 4PLWA 2GZ2A 3AOGA 4IJWA 2HCTA 3KO8A 4ZICA 3ANLA 4ND5A 4Y9DA 1BMDA 2DFVA 3OHSX 4BO2A 3Q0EA 2I99A 1M75A 5KJFA 3C8MA 4YQYA 1Q2XA 4KQXA 3BTUA 4J9UE 4DIFA 4WLOA 3DHEA 4TVBA 1IL0A 5DDIP 3GEGA 2D5CA 3TZQA 4AJKA 3PJFA 1P1HA 1L1FA 4J7XA 3RU7A 1DFHA 1E3WB 3PEFA 1SB9A 4QSMA 5JDCA 1HYEA 4ZU3A 3UH1A 2VWQA 3HQ4O 3M1LA 4CR7A 3ZV5A 1VI2A 2LDXA 3L9WA 3PZBA 2HK9A 2J3JA 1N92A 4O6VA 4YAJA 4Q3CA 1ZK3A 1PL6A 5JXWA 1DRWA 4QFCA 2V65A 3DZBA 4YT2A 1QYXA 5G4KA 3FBTA 1DHRA 1TXGA 1V9LA 4FSHA 4IXTA 4KWHA 2GN9A 3GVPA 3GNSA 5JW6A 1KY5A 2YJZA 1SEVA 4BNVA 1SPXA 3U4IA 1NYTA 3EUWA 1YL5A 1LLCA 3DMYA 3AOEC 3VZRA 2AEMA 2Q2VA 4NNJA 4LCEA 4EYEA 4PVCA 4R3NA 3RFVA 2Y0DA 2V6GA 4XD2A 1UUFA 3K2EA 1NFQA 5L53A 1O8CA 3CUKA 2EW8A 4IPTA 1OI7A 2A92A 4MVJA 5F5LA 1FK8A 4W82A 1AXGA 3U3XA 1V6AA 4XJTA 4EEZA 3BMCA 3JD3A 1U9JA 3WJAA 4BQPA 1ISFA 3UXYA 1W8DA 2PZMA 1KBZA 3VPFA 3DBLA 4PG6A 2DBQA 5CFZA 4M54A 5TNXA 4XR4A 1G0OA 1U8XX 1B7GO 9LDBA 3ABIA 1YL7A 4UVDA 3FTPA 1BDBA 1ZIDA 5DF1A 2ZJ1A 4ALLA 4KUGA 3D4OA 4C7KA 3OJFA 4OM8A 3QA9A 1IZ0A 1T4BA 3QVTA 2Q1TA 4RO0A 1SO8A 2WJPA 3K30A 3PLRA 4AFNA 1XGKA 1Z82A 1JDJA 1EE2A 4HNGA 4A2CA 3GEMA 3E03A 2ZB4A 4AG3A 3OQBA 1YE3A 3DMTC 4WPGA 1XDWA 4EDFA 2DUUA 1YVEI 4L4RA 3BMQA 2PTGA 3NJ4A 4DQUA 1OC2A 4HADA 1MA0A 3H3FA 3HUDA 4FFPA 4PGFA 3LDHA 5JDCC 4MVJD 4TRJA 1TB4A 3CINA 4R1UA 2JHFA 2PV7A 1C3VA 2X9GA 3IUSA 3B1JA 4A27A 2ZK7A 3MJTA 1LLQA 3DHYA 5G4LA 3KLMX 5L4SA 3HDHA 3JCZA 2X58A 2DAPA 2AHRA 1H94A 1T2DA 2C5AA 4GGPA 3WYCA 3WNVA 1U7TA 4M1QA 3ZV6A 2EEZA 5TT1A 4MIOA 3UFXA 1T2AA 4JNKA 2E82A 3PLNA 1E1LA 1N7GA 4MJLA 5KWEA 4CL3A 1YB5A 4JK3A 2I3AA 2JD2A 1UP7A 4J4HA 3WFIA 5COAA 3GLQA 3I4CA 4UREA 2O3RA 2C7VA 3KYCA 4KTTE 4YT5A 2C54A 1BW9A 4PLVA 1BTOA 1YQDA 1KEVA 3R1IA 1EFLA 1HE4A 2FP4A 3PHGA 1CERA 4BL5A 5JYEA 2HJSA 1Q7CA 1YOVB 4AJHA 2PD3A 1HETA 5K6AC 3GH3A 3T7CA 3MJCA 2DQ4A 2P9GA 3I4FA 3AK4A 3RBZA 3B20A 5HWSA 2GN6A 2X5KO 3DBHB 3P2OA 4QQRA 1YQGA 1U2GA 3P2YA 4O5OA 1LBEA 4CMBA 3ONDA 5AYVA 5ENDA 1C0IA 1H6CA 3PTZA 4ND2A 4IUYA 4XWYA 1YDEA 3LZ6A 1ONNA 3CSDA 2Q4BA 3GGOA 4OO3A 4O0LA 2DBZA 5HS6A 1QYVA 4KWIA 3QVSA 4PZEA 1FF9A 3F4LA 3IDSA 4D0RA 5IG2A 3TRIA 3GGGA 4IS2A 4II3A 5TJ9A 4OOEA 3PWSA 3W8EA 4BGVA 5A9RA 3NT4A 2B5WA 4R3WA 1O0SA 2OBNA 4OKIA 1FMCA 4BKUA 3WTBA 3VH1A 1QXSA 4J0FA 1HDYA 1LA2A 2UYYA 4YVFA 3EGOA 3OSUA 4JJFA 3D4PA 3TOXA 4MPDA 3OH8A 3BMOB 3PHHA 2EW2A 1LRKA 3RIHA 4H15A 1R0LA 2CUKA 2X86A 3Q2KA 4E12A 4OYRA 4B7CA 8ADHA 1BVRA 4UUPA 1A4UA 4J90A 1KEPA 4DPKA 4XQGA 5A02A 1RJWA 2GSDA 4BO1A 1RM5A 3FCOA 1ZH8A 1VL6A 3IAHA 5ICSA 4UVIA 3VHRA 3QIVA 3G1TA 2X5OA 5TIIA 1HSOA 3DQPA 9LDTA 1T24A 5EJ2A 4KMSA 2BGLA 4Q3AA 2FR1A 2BLLA 4GWGA 3WLEA 3I5MA 1A9YA 5JO9A 3FNEA 1BHSA 3JD0A 4PLPA 2W2KA 1F8FA 3PFWO 3PYMA 3JQ9C 4BHTA 2A94A 1GEEA 4YTEA 1HLDA 1JVSA 1U28A 4HFNA 1C1DA 4NPCA 3UN1A 4EEXA 4XZ3A 1PGPA 2ZYAA 3FN4A 1A7KA 4J4TA 2AQHA 2EHDA 2I6TA 3RFTA 3Q1LA 2UUPA 2IYOA 1YL6A 3EC7A 2OXIA 4K9DA 4XYBA 4XYMA 4CLEA 2FR0A 3E5MA 4L0QA 1XU7A 4ILKA 1GEGA 4GQAA 4DRYA 2ILTA 1AE1A 4R69A 1E6EA 3ASUA 5JBIA 3GA0A 4E21A 3P7MA 1NPYA 1X7HA 2GASA 3LT1A 1VKOA 1DLJA 3WQRA 3JQ8B 1AN9A 1GPDG 5B12A 4ND3A 3IMFA 4L4XA 3D5QA 2X5JO 4IS3A 2ZCUA 4C4OA 1EEHA 4RJTA 2B83A 4IINA 5LCXA 3GGPA 3K5PA 1GD1O 2PFGA 4FR5A 1R6DA 4E33A 1IUKA 1HE5A 3I52A 1VPDA 2VWPA 4CMCA 5L9AA 3L4BA 3RFXA 5L95A 3OJOA 5EINA 5JYDA 2Z1NA 4J43A 4EUFA 4NJOA 5KVSA 1K5HA 3D5TA 3VAZA 3UVEA 1ZZEA 3ZHBA 3ZHXA 1OC4A 2HMTA 3ASVA 3V2UA 5EESA 4PRKA 3PYLA 1LRLA 2FMUA 3AI1A 4DPMA 1X7GA 2Y99A 1VC2A 4MOWA 4IJKA 1F12A 4J1SA 3AUSA 2Z95A 2EP7A 3UGKA 1LDNA 2E6UX 2H5LA 3QHAA 4LN1A 4ZN6A 2Y1DA 5JLAA 1FDUA 3X2EA 5CPFA 3K2BA 3C85A 5JCJA 2VQ3A 5IXSA 3CZRA 1XEAA 4HP8A 1MUUA 3VTFA 5T67A 3GZ4A 4M86A 5C37A 3ZWMA 3F1LA 4TRRA 4JCOA 1Y81A 1G1AA 4D46A 5B4VA 4WOKA 2AG5A 2IE0A 4W4TA 3S2EA 3OJ0A 4EITA 1XYGA 2Y1OA 3GZNA 3VH3A 2BF7A 4BO0A 4XQ9A 3RCBA 1YB4A 2PNFA 1LRJA 3W6UA 5JMWA 1NWHA 2I5PO 3ZW9A 4LW8A 4FB5A 5IZCA 1FJHA 3KYDA 2NACA 3OIFA 3GHHA 1NHWA 1H9AA 3TPCA 2ZATA 2X6TA 1PEDA 2GN4A 4TROA 1W0CA 3PJDA 5G4KB 3PK0A 4UVEA 1P1FA 4FW8A 4J2OA 5T64A 4HFRA 1KEWA 3TDKA 4PLYA 4MKZA 4RQTA 1VSVA 2AMFA 1VLLA 4XX0A 4BGUA 2DPHA 2CZCA 3DXFA 3PHJA 3C7DB 3V5NA 1I2ZA 2OO5A 3I1JA 3DOCA 3OA2A 3TZKA 3BXXA 3U9LA 4XGIA 4BNIA 2Y05A 1XKQA 3RWBA 2WDZA 1O6ZA 3FR7A 3OQ1A 4EUEA 1U3UA 2G76A 1F8GA 1GDHA 1QMGA 5TC4A 4XEHA 4FFLA 1HF3A 1KVSA 2OL4A 3LC2O 3L6OO 4GX0A 3T7EA 1WZEA 4A73A 4PZCA 3NYWA 1YJ8A 2H6EA 4NIMA 4NBRA 1J6UA 3C1OA 3PDUA 1O89A 5T8KA 4CQMB 2PKQO 3WMXA 1DRUA 4JQCA 1DDOA 3ZNOA 3U4CA 3IC5A 3RUCA 1ADGA 4J9VA 2P9EA 4PRLA 5KNLA 1TLTA 2IEDA 4DLAA 3GRPA 4OGWA 4TSKA 3JYNA 2VYNA 1TEHA 1LLDA 2AQKA 1QYCA 4MVJP 1MGOA 3D4NA 3DBLB 1D1TA 5I7SA 2GDZA 3NGXA 4K28A 1HE3A 2NU7A 3K31A 4OXNA 4WEOA 4U7WA 2GLXA 3L6DA 3CTMA 3L0DA 1Y6JA 2AXQA 4PLHA 1ZFNA 3BTVA 3AY3A 3IIEA 3TL3A 3Q6IA 3ROKA 4D7AA 3JTMA 3MOGA 1ZKMA 1F0YA 2FOIA 4IMRA 3V1UA 1DIRA 2O4CA 4ALKA 2IXAA 3BZUA 1FDTA 2NU6A 3ZDFA 3JQAD 1B14A 2QRKA 4MVJH 4YDRA 4I8XA 3O8QA 1DOHA 1LJ8A 1OZAA 2W8ZA 1V3UA 1KVTA 1VL0A 1YBAA 3AFNA 4IMPA 3BMQB 2QG4A 4PG7A 1PS9A 3EVNA 3V8BA 1RM0A 5DT9A 1K6IA 1SEPA 4BNKA 2O2YA 1DLIA 3VKVA 4YACA 4DQVA 5CG2A 3BTSA 3JQDA 4E2ZA 3WGTA 4CV3A 1MB4A 1Z6ZA 4WGGA 1QORA 3KTDA 1D8AA 1ZK0A 3ROQA 2VYVA 4MIEA 4JX8A 3RBVA 4TVOA 1A9ZA 2B5VA 2NV6A 3ZWCA 3G79A 3VPHA 4Z6KA 4FCCA 1Z7EA 4RL6A 1O94A 1QLJA 2J6IA 3PYXA 4MINA 3UKOA 3D7LA 2O3SA 3OIDA 4BMVA 1X1EA 4AJNA 3ONEA 1N2SA 5GZ1A 1UDAA 1YO6A 2CMDA 3NDJA 4FN4A 4RCVA 4IBOA 4DGSA 1U7HA 1PQPA 1ADFA 2FSVA 2VCYA 3ANMA 1ONOA 2X9NA 3DBHA 4J16A 3WBBA 4BO5A 4BNGA 2Z1MA 1NFFA 4XYLA 3W4JA 5KVCA 3KYCB 4NJMA 3NTOA 4RF4A 2HRZA 1PGOA 3HE3A 3L9XA 3KSDO 2FRDA 1NX6A 2AQIA 1E3LA 3UAGA 1LDMA 3I9JA 5L7TA 1EDZA 1K6XA 4JBHA 5GMOA 2CY0A 4F6LA 3NV9A 4XRGA 3RD5A 1PJQA 1RM3A 1P3DA 1V0JA 3ZNNA 5U9CA 3B1KA 4CMEA 2BFPA 4E13A 4MVJM 3JQEA 3HFGA 5AVOA 2D5AA 2ZQYA 3GMSA 2VYVD 4NFSA 2O7SA 1KEUA 3TNLA 5AQ1A 1SOVA 3AFMA 4JIGA 4PG4A 4ZVVA 1I33A 4AICA 1ZBQA 4P38A 1M6WA 3DR3A 4JBGA 1F17A 3BMOA 4LVCA 4OHUA 1YS4A 4DC1A 3AUUA 4MVJE 1DRVA 4YRAA 1UAGA 1NVGA 1ZSNA 2ET6A 3RBXA 3QW2A 2Y1GA 4M55A 5EL0A 1S7CA 3E82A 4BKQA 1GUZA 3OMLA 3TL2A 1PJ4A 3RC1A 1ARZA 1QV7A 3INGA 1QG6A 4QEDA 3FBGA 2ZTLA 5IDWA 3RU9A 2E49A 4FFOA 4RVUA 1MFZA 2QW8A 4ZQFA 4N5LA 4BV8A 5DBFA 2CNBA 5L4NA 2CFCA 2B4RO 2IXBA 1I5RA 1MC5A 3ZWYA 3U09A 2P68A 3EY4A 5ENVA 3V1YA 3GT0A 4CM5A 1P9LA 2BKAA 2Q49A 2BGMA 1LXCA 4J91A 4E6PA 4AJLA 3CXRA 1E3JA 1H9BA 2VNAA 3NKLA 3T4EA 3LLSA 3ZV4A 1DO8A 1LC0A 3KSZO 4BKOA 1NPTO 3GOHA 3WQSB 3AOEA 4J2HA 3JQ8A 1KVQA 2VHVA 4OJNA 1DAPA 3H5AA 3JYOA 1X15A 4NI5A 3LLVA 3JQ6A 2Q4EA 1VJTA 5JSFA 4WJZA 2QRJA 3TOZA 4YCAA 1ZXBA 2YV2A 4AJ4A 2JCYA 4BNWA 2EXXA 1HKUA 4GKVA 4ESOA 1MXFA 5G0UA 4CR8A 5A9SA 1HYHA 2F00A 4BUCA 3DHNA 1VE9A 3KEOA 3OIGA 4DUPA 4GBJA 3GNQA 5TT0A 3STHA 4DYVA 4IDCA 1E6WA 3B70A 2ZIZA 4BMSA 2PD4A 1VM6A 3BHMA 5JAZA 5ADHA 1A4IA 1OAAA 4Q3BA 3ANNA 2PGLA 3AUTA 3RROA 4D41A 3IUPA 2GR9A 3UCXA 4RORA 1BSVA 4E2XA 2PR2A 3ZH2A 5MDHA 3O26A 3F1KA 2X0RA 1GFSA 1I30A 2WTBA 4CV0A 3KLPX 3NGLA 4D3DA 4J6FA 4EJMA 3ENNA 4WEQA 3NTQA 4GSLA 4RVHA 2AA3A 2NQ8A 5G2OA 3QRWA 4DMLA 6ADHA 3JYQA 8LDHA 1PSDA 3AWDA 4CM4A 1NTOA 3PQDA 4S1VA 4HUJA 3S2GA 4PG8A 1NR7A 3DMTA 4XKJA 1LDBA 3K8ZA 3E5RA 4ZQHA 1MX3A 1K2WA 1CYDA 4YJGB 4PCVA 5CEEA 3UW3A 2EG9A 1EVYA 1EUCA 2NNLD 1YRLA 3B6ZA 4NMHA 4BO6A 5FEUA 1K6JA 2IZ1A 2NTVA 2Q46A 4E2WA 2C82A 3C24A 3SJUA 1H2BA 3JD1A 2BMAA 3H65A 2O3TA 3X2FA 2Q1SA 3A9WA 1R15A 3NAQA 1JN0A 1I8TA 1DJNA 3TJRA 2PKQP 4CPDA 3OEWA 3D3EA 2VZ8A 4R4JA 2I66A 3EAGA 4N7RA 3GZNB 1HDOA 1BGVA 4R54A 2WD8A 3PI7A 1IYZA 4KDFA 1JLLA 3VPXA 4GPD1 2HLPA 3KYDB 4O63O 5F3RA 1PL8A 2RHCA 3NTRA 4ND1A 5TRTA 2RH8A 4AVYA 1HZJA 4B3IA 3D64A 3GUYA 3D1LA 3NEPX 1ADBA 4CV2A 4LMPA 3S1LA 2GD1O 4PIVA 4I9HA 4CMIA 4LSMA 1R12A 2P2SA 4CQMA 1XHLA 4LVUA 5K6AA 3UCFA 2WM3A 1GTMA 3K92A 3SBOA 4GLLA 3TZ6A 2H63A 4A03A 4BO3A 2HMVA 3PPIA 3FNHA 4R68A 3O38A 3AY7A 1UXGA 1ZK1A 1A5ZA 5BSFA 3QWFA 5C3MA 4PLTA 1OFGA 3M1AA 4IJUA 4HX5A 2D8AA 5CDYA 3RUDA 4J7UA 2FZWA 4WNIA 1RKXA 3PFFA 1TI7A 1DC6A 1EFKA 2J5KA 3E9QA 3LT2A 3MTGA 4OMUA 4D79A 2CF5A 3GK3A 3K73O 7MDHA 1GUYA 1PU2A 3ICCA 3DZJA 1T1SA 3OP4A 5AXDA 2WSBA 4ZJUA 1CF2O 2PZJA 4DVJA 4CJXA 2G82A 4WCFC 1XR3A 1MFPA 3GEDA 4TZKA 1B2LA 1V3VA 4JJGA 2G17A 1EDOA 4YB8A 2DT5A 4IIVA 4PLZA 2GZ1A 4BNLA 4CQMD 3FHLA 5IJZA 1LU9A 1VRWA 4D43A 4JP3A 2DM6A 4KQWA 5A3JA 1SZJG 3B1FA 4DA9A 4CLHA 1PJBA 2CSUA 2W90A 5IDYA 3VZQA 3H5RA 2UDPA 3DTTA 1U4OA 1JQBA 2OUIA 3ETDA 1GPJA 1RM4A 3O8QB 4G2NA 4J7CA 2X7HA 2Y1CA 2J3HA 1LX6A 1NQTA 1D3AA 1L7EA 4OXKA 3MCVA 2H9IA 4NK5A 5KKAA 2TMDA 5F1OA 3M6IA 4XRRA 5A04A 3MZ0A 3K9QO 4JLWA 4RGBA 4RPJA 3NT2A 4YA6A 4RZIA 4XA8A 3VZSA 2A9FA 3INRA 1SB8A 1UJMA 2VHXA 3JQ9A 3NX4A 1F06A 1HZZA 5JFOA 1D1SA 3HB4X 3F9IA 4W9NA 3WR5A 1T1RA 1B15A 4II2A 2YV1A 2HU2A 1WDKA 1AGNA 1PWZA 3QQPA 4J1QA 4YT4A 5B4TA 1ZW1A 5KJ6A 2ZYDA 4DC0A 1TT5A 1UZLA 3LU1A 1DPGA 5BR7A 1Z74A 3UHAA 4XGKA 4YQZA 1DC5A 3H9EO 4B3HA 4D0SA 1T26A 3DZHA 5J23A 1C0LA 5LC1A 1GCUA 4R5HA 1T4DA 3LQFA 3KB6A 5DCYA 5DN9A 3FI9A 1RYDA 3QY9A 4ROSA 2Q45A 1AHHA 1QKIA 3V2GA 4E5PA 5L45A 4NJMB 2IYPA 1GZ6A 1KC3A 1BDMA 4NFHA 1HWYA 3WDSA 5B37A 3AUAA 1E7MA 4UEOA 3QWHA 1PQUA 1HLPA 1P31A 4ZHSA 4QXMA 3WS7A 1YGYA 4F3YA 2X0NA 1FXSA 5L7YA 2IEBA 4LCJA 3VZPA 3ZZNA 4KP7A 4YT8A 3DZKA 3WGZA 1DSSG 3OA0A 1B0AA 3RUIA 1ULUA 1W4ZA 2UUOA 4CMGA 4ZRNA 1WW8A 2ZCVA 1F14A 2CVZA 4AJPA 5IXYA 1ISIA 1V3TA 3A4VA 1SBYA 3JD4A 1LDYA 4CM9A 5I8WA 4ALMA 3MWEB 5THQA 3IKVA 4WCDA 5L51A 1Q7GA 1E3EA 3F3SA 2Q50A 3WQQA 4B8WA 5AOVA 4RQUA 5JC1A 2O7QA 1ZNQO 4HV4A 2O2SA 1YH3A 4NHEA 1HE2A 1GZ3A 1IHYA 4E32A 4LSWA 1DC3A 2HSDA 1ML3A 1PX0A 1ULSA 1XA0A 4FFRA 5G0WA 1QR6A 1EZ4A 5I9MA 2D2IA 2C07A 1V8BA 2EWMA 5F1PA 1PQWA 3HADA 4BNTA 5I7EA 3LSYA 2P4QA 3DO5A 3I9MA 4INAA 2FPGA 3WGHA 1JVBA 4W9NC 3WWZA 2GRAA 3PZRA 3WMWA 1DIBA 3FRJA 4YRDA 3RI3A 2GF2A 2BRUA 3W6ZA 2D59A 1EE9A 1IB6A 4NK4A 1YONA 3HB5X 3U5TA 4CQLB 2BELA 4GVXA 1CQJA 2DU8A 1GL3A 3F47A 4WLEA 1W6UA 2E48A 3PWZA 4PLGA 2EJVA 4GH5A 1WZIA 4Z3KA 5JPIA 4UEJA 2HJRA 4UUNA 3AY6A 5A5EA 5IAAA 1DB3A 3GPIA 2VTEA 2ZTUA 4N54A 1EQ2A 2P5UA 5CDGA 1GADO 3I6QA 1JKFA 2C7GA 3FWNA 5A9SB 4H3VA 5F5NA 3C1AA 1ENZA 1UH5A 4FBGA 1T2FA 3H9QA 4IIUA 4ZRMA 4EJ6A 3PHLA 2PH5A 3D3WB 4NDNE 5DP2A 4UULA 2GN8A 1E77A 1E92A 1Y8QA 4YJFA 4K26A 2OBYA 4BNUA 4A7PA 4MO2A 1HDZA 2E4AA 5BSGA 4TQGA 1CQIA 1LSJA 2A35A 1O9BA 5KTKA 3DDNA 4YJGA 4MP3A 1M2WA 3WYBA 1RYEA 4K6FA 3BMNA 3H2SA 1Q0QA 4FOOA 4FFMA 1JAYA 3WG9A 2NU9A 4CM4B 2X0IA 2R00C 3LT4A 2O4UX 4IDFA 4KDEA 3G0OA 1EUZA 1TVEA 3GAFA 2Y93A 4PN3A 1I01A 3KUXA 3H8VA 1E5LA 1IE3A 1KVRA 4I5DA 1ENOA 2HAEA 3PVZA 4DIOA 1J0XO 1EMDA 5EQFA 4Q39A 3SVTA 1I10A 3QSGA 4E2YA 2JJYA 1BWSA 5I7VA 4FDAA 2PGDA 4O59O 2VOJA 2G5CA 2DPGA 1YBVA 4QX6A 1WMBA 4GSKA 4BVAA 2FHSA 1SCUA 3RUEA 1NP3A 3CIFA 4OL9A 3U4HA 5GZ3A 1XSEA 1C14A 5TQVA 2IODA 3IP1A 3SC6A 2PA3A 1UP4A 5TF4A 3C7AA 1A71A 1U3WA 4ALIA 5C7LO 2X9VA 2VWGA 3I9NA 5L7WA 2OGUA 5CP8A 1B26A 3DFZA 5COBA 3RVDA 4N5MA 2Y68A 3SLKA 2QX7A 1XIVA 5EMHA 4MP6A 4R1SA 3VDQA 4FGWA 5JCJD 1PWXA 3H7AA 4PLCA 1HDCA 1X0VA 4DPLA 3IP3A 4M87A 3ITKA 4E5YA 1I0ZA 2YV3A 4FFNA 1H6AA 4CMIB 1D7OA 1DIHA 3GPDG 3OICA 4BKPA 1NR1A 4UVGA 3DBVO 2C59A 2HQ1A 3E9NA 4FJ0A 3JQ7A 3HDQA 4L73A 4ONEA 4X54A 1M6HA 4CLDA 1E0DA 3H2ZA 3I9OA 2B69A 1RWBA 2WE8A 3ROMA 2D0IA 4J0EA 5JS6A 1WXDA 3LYLA 1JTVA 3I23A 3H9GA 4FD3A 3UICA 2IZ0A 3OJEA 3DTYA 2YY7A 2RH4A 3DOOA 2X22A 2XXBA 4GWKA 4NU5A 1UXJA 4ITUA 3AJRA 3TFOA 1UXKA 1P1JA 1GQYA 1KC1A 1WNTA 2ZB8A 2EERA 5CEJA 3KSUA 3OF2A 4FC6A 1K3TA 1SC6A 4DREA 2SCUA 3WIEA 3BIOA 2PZLA 3QWAA 5FYDA 3TZCA 2P4HX 1G0NA 6LDHA 3VC7A 3R3SA 1IOLA 1KYQA 3WOHA 3I3OA 3WWYA 5CDUA 4ALJA 4B7XA 1JA9A 2O48X 1MG5A 1PJTA 2Y67A 4FQ8A 5DOZA 2Q1WA 2YDYA 4J4BA 1CIVA 4LISA 2HUNA 4F6CA 5DBGA 4RF5A 2WD7B 1OMOA 3JQFC 4Y6PA 3WFJA 3WJ7A 5G0VA 3VH4A 3AM3A 4XDZA 2BHLA 3DAFA 2DVMA 1S6YA 2I76A 3O03A 4R41A 2VYND 2PZKA 3CE6A 3FPCA 3JYPA 3U49A 4KOAA 3TN7A 4YBZA 4EBFA 1U3TA 4B4OA 1QSGA 2VN8A 5AXBA 3CKYA 2PD6A 5DP1A 4MVJF 2HDHA 2NVBA 1E7YA 3GN2A 4PVDA 3VVBA 1O5IA 1V35A 1YQXA 1GY8A 1GR0A 1MV8A 1A72A 1Z73A 3DBRB 2VRCA 4FGSA 1Q7BA 1XWFA 2C2XA 4IZHA 3C7CB 3LC7O 4DXHA 4E30A 4IM7A 4WLUA 1GYPA 1QRRA 5CG1A 3SX2A 4KUEA 2VHWA 5BNIA 2OORA 3OFSA 4AJ2A 2IZZA 1E7QA 4RLSA 4M8SA 2BI8A 2QYSA 1TT5B 2P9CA 2O50A 4YYZA 5L40A 1ISJA 4CL8A 3GDFA 1U1IA 1HDXA 3U62A 3NJ8A 1GCOA 1ZO8A 2A4KA 3RJ5A 1A27A 4NQZA 4P4LA 4ZD6A 1KY4A 2OOSA 3INTA 2BFMA 2J8ZA 2C29D 5TGDA 1HXHA 1WDMA 1T25A 3FF4A 5EQDA 4CLRA 2RCYA 1I2CA 1IPEA 1P44A 1R4MA 4B4UA 1BVUA 4GL4A 3UOGA 4YAIA 5TLSA 3RUAA 1Y5RA 3ADOA 2D4AA 3JQCA 2Y1EA 1NASA 2I3GA 1YBMA 4FS3A 4U0JA 2NQTA 1H6BA 4L4SA 3JQBC 3I83A 1LNQA 3JD2A 2V7PA 3HDJA 3ZV3A 2VRCD 2R6JA 4FJ1A 4XCVA 5JDIC 4BNHA 1YWGO 3NDRA 3F6YA 2W98A 4YWJA 5JAMA 5HRUA 2Q3EA 4BB5A 1N9GB 3WBFA 2ZQZA 4U8GA 3HJAA 3N74A 3PIIA 2X23A 1KERA 4WLNA 2EF1A 4CODB 4ZQBA 1X13A 2P91A 2DTDA 4RDIA 4FPXA 1SNYA 3ZNQA 3GVIA 5U4QA 2LDBA 4I9UA 1H93A 4YPOA 3KETA 1KETA 3N7UA 2QRLA 1GZ4A 4N5NA 3RKUA 4GX5A 3GFGA 2EGGA 1IY8A 1WWKA 5KOIA 4JJIA 1E3SA 2XXJA 4IZIA 3GDGA 4D44A 4OSPA 3R3JA 4JN6B 3U4DA 4IDAA 3OECA 4H7PA 2C20A 4YR9A 1EVIA 1ZEJA 2PGJA 1SMKA 4XIYA 1D4FA 3R0IA 1GQ2A 1ZMOA 2YQ4A 3BAZA 5H83A 4CQLA 4P22A 2OZPA 4Z9XA 2QIOA 3G1UA 3QVXA 4I1IA 3DOJA 1GV0A 1MC4A 4NH4A 2OHXA 3S2IA 4DLLA 4DBVO 1Q0LA 1O95A 1ZCJA 1QYWA 3HG7A 2V6BA 4RVFA 3OEYA 3QJ5A 4C7JA 3ORFA 1WVGA 2BI7A 4Y98A 3NDIA 2O3QA 5HM8A 1GV1A 1UR5A 1Z45A 3WLFA 4UUMA 1MG0A 2Q99A 2QYTA 3MEQA 3E18A 1EVZA 4U6QA 5FI5A 3JQGA 3KXDA 5H82A 1ZK2A 1LDEA 2EV9A 3DB2A 3D3WA 3H9UA 2NM0A 2AQ8A 4GMGA 4Q9NA 1U3VA 3W8FA 3G17A 5IFLA 4PG5A 2C0CA 1UDBA 4R01A 5TJHA 5A4DA 3WGIA 4NR0A 3BHJA 4L74A 5KVQA 1ZK4A 4Z0HO 5ILGA 4GI2A 1YDWA 3ZI0A 3FPLA 5COQA 1NPDA 4R1NA 2NTNA 1ORRA 3ADPA 4WCFA 3PDJA 4D45A 1XU9A 1DAOA 4Y6SA 5F1KA 3SEFA 1Y8QB 1YJQA 3G3EA 4YJFB 1PZGA 3VPGA 2VUSA 4LMRA 3E9MA 4TMFA 2FWMX 1P0FA 1PTJA 2TMGA 4XQCA 2PY6A 4NU6A 2EGHA 1IZ9A 1U4SA 4WE3A 3TWOA 3EVTA 4QFDA 3KBOA 2G1UA 3H4VA 4BB6A 1P74A 1M66A 1U5AA 2POQX 3BMNB 3PGXA 2EKPA 2VT2A 4RLHA 4UUOA 1HDGO 1HL3A 3PQFA 3BA1A 3ZW8A 1NXQA 1NQAO 3VVCA 3ZWAA 4BV9A 5I7FA 1NNUA 3HFSA 4JBIA 3AI2A 3W4KA 5IN4A 3WICA 1FDVA 3ZWNA 4DTIA 4WUVA 5THKA 1U5CA 4P8RA 2NVUB 4CLOB 2UV8A 1UP6A 5LDHA 1ID1A 2FPPA 5K9ZA 5CAEA 2JKVA 4E5MA 4ZGWA 2ZB7A 4W6ZA 4U5QA 2Y0EA 4J3FA 1FDSA 1PJLA 2EIHA 4RDHA 2DKNA 4D3FA 1X14A 1M67A 4MDHA 2GZ3A 1E7WA 1GYQA 2CDAA 1GQQA 1R4NB 5GZ6A 3GFBA 1HYGA 4U6SA 3HZZA 5JY1A 5DBIA 3DC2A 1ISHA 1OOEA 3RASA 3I6IA 5EIOA 1BXZA 1UXIA 5A03A 4HWKA 3L4SO 2I9PA 3WSWA 5KJCA 2DBRA 3ZGYA 1IHXA 4WKGA 1E1NA 4AJEA 4DMMA 4UAGA 4YAKA 4CMHA 4DWVA 5IDXA 4QO8A 4Z3DA 2FSSA 5FI3A 1NVMB 1R16A 1RPNA 2O3JA 3DONA 3MJ4A 3WGQA 4BQRA 4CR6A 3H6KA 4M89A 3ZWXA 3ZWVA 2QZZA 2XF8A 1E1KA 2NU8A 2I67A 1LI4A 3VKUA 1KOLA 3UCEA 4NBUA 3ICPA 4BNNA 1EK5A 3PQEA 1BXGB 1PJSA 3AU8A 4XIJA 4BNZA 5CEFA 5I9LA 4Q3EA 4W7IA 3IQDB 3JQ7B 4PFJA 1VJ1A 4B79A 4E0BA 4YAGA 4HKTA 3LK7A 1E7RA 2DBVO 4IDDA 4HNHA 2C2YA 3JQAB 2VUTA 4K1LA 3KOUA 3QLJA 2ZKLA 4GAEA 4BO7A 3EDMA 2BFOA 1UZNA 2YFQA 2V6MA 3QVOA 4I5EA 3MJSA 3NUGA 1J5PA 3RUHA 1B8UA 2HKIA 3G49A 5BNFA 1OBFO 3HSKA 3ETEA 1ZUD1 2F1KA 3Q2IA 1WMAA 2FR8A 2UVDA 2WD7A 2J3IA 3AM4A 4YXFA 3F5QA 1Q1NA 4O1MA 3RC2A 2B35A 1MLDA 4LGVA 2GCGA 3KVOA 3RAJA 4BOYA 3M2PA 4TRMA
chains in the Genus database with same CATH superfamily
4RV9A 2D2XA 1D5CA 1SVLA 3E53A 2R8ZA 3FWZA 1AXEA 3OBBA 4FE3A 3UYKA 4QNRA 2IPAB 2IUSA 1CK4A 4F38A 2BEKA 2ZTVA 1JAXA 3H6GA 4YK7A 5EFOA 3DBRA 3K0KA 3L7NA 1GWNA 4PV7A 2CLIB 4X6LA 1Z7BA 3ND6A 1GNSA 2ZJBA 1B8OA 3G5AA 2VYFA 4RZ3A 3Q5GA 2FGJA 3LKDA 3S8MA 3ANSA 5E9WA 2F43B 2DETA 3TKLA 4S05A 1E5QA 1Z75A 2JJ2A 4P5PA 3UV6A 4N3BA 5ALEA 3STXA 2VSQA 5E2AA 3KT3A 1NBEA 4TUYA 5KSOA 4OQ4A 1W47A 3IAS1 1IZYA 1AQ6A 2GA8A 4RD1A 3GMDA 3P9KA 2P75A 4H0FA 4QQKA 3SLGA 4YXWA 4AKEA 3LVFO 3MRXA 1RC8A 4OG2A 3P5SA 5MHTA 3FH0A 5HTOA 1UXHA 2NLOA 3SM3A 2OHJA 3ICEA 1SXJC 2IUUA 3HDVA 3VGJA 2P5YA 3WVNA 2C5SA 5EN4A 3D6HA 4KXQA 4Z4FA 1FJGB 2IPMA 2JG3A 2ZIAA 5EMMA 4URZR 2OR3A 2R6HA 1H6DA 4ZAFA 5I51A 3IL2A 3AUYA 2UZ0A 4JBWA 3TTVA 5LFAA 3MUEA 1U90A 1HQKA 4F84A 5E1BA 3PQ8A 4C22A 1W44A 3FIJA 5TVKA 1M1ZA 1SKBA 1L7MA 3D4IA 1R66A 1JG7A 2Q1YA 1XQ1A 4BWFB 1ZHHA 4WECA 4WFKA 1RHJA 4CLRB 4RPGA 3OJLA 4CU2A 5K0ZA 1RVDA 1V1JA 1YKFA 1R4MB 2H8KA 3IVRA 3H87A 3CH4B 3KSRA 3H1AA 2LXNA 1DC4A 2NADA 1DS6A 1N9GA 2OCBA 1BRMA 2CXQA 2PK3A 3D7RA 1I0IA 1SKAA 3L07A 3O73A 1FUYB 2Q1UA 3G8AA 3ZTTA 4D9HA 1KMHA 2ZVDA 4LRUA 4F2HA 1DCTA 4X41A 2VF8A 3TH5A 2WMDA 1X7XB 5LB2A 5FPPA 4FS8A 4HDSA 4M1SA 4BN0A 4J0DA 3MMNA 4GX1A 3V32A 3HLYA 1JLSA 4YXWD 1MIHA 1UBUS 1Y1RA 2HPZA 2PM8A 4XFKA 4GM1A 4EGJA 5CA1F 1A9PA 1UKEA 4G25A 3D1JA 4XLZA 3LY9A 4TRNA 2JD1A 4Y1EA 4TQUS 4HATA 3WNCA 1U1EA 3AR2A 3DQQA 4BFSA 2FJUA 5EHZA 4KH1A 5ES3A 4EYSA 1NV9A 1PJCA 2XCOA 4N65A 1NXTA 2QPTA 1H2FA 1KJYA 5FFMA 3L7KA 5LP6F 3AU9A 2XAAA 5JG7A 4KAJA 4B6PA 3A1DA 1WPQA 4R5MA 5DX8A 1R37A 3GLHA 1NBAA 4N3CA 1HNZB 3ZOKA 3T95A 5KYWA 4KQFA 4TXNA 3CEAA 3BM5A 1DX4A 1L8OA 5CCEA 4MRMB 4DXDA 1YI8A 3SFZA 4YRMA 1VJRA 3AYXB 3CH6A 1J33A 1RP7A 2AF3C 2YMLA 5DFAA 1PN3A 1MN6A 2POCA 4HRYA 5E6SA 1BEUB 3NM6B 3I32A 5DZSA 3ZE0B 4EJSA 4Q7QA 2FAXA 3EZNA 3RSHA 3ZH9B 5JRZA 2Q5JA 4PAOA 1VMEA 4RVDA 4C2UA 1CV2A 3GRAA 4YUAA 5E9AA 3WJ2A 1VGVA 4B1FA 5D85A 2O8FB 1KP3A 1D2CA 4G1FA 7YASA 5BOSB 3BH0A 3MRVA 5L4LA 4MK4A 5DOVA 2R86A 2FK8A 1C1XB 4ASUD 4DDVA 3E9DA 4GOJA 2RHMA 4MKXA 5ITVA 5EZQA 4CIBA 2B3DA 4FMDF 3UAZA 2WHRA 5TQ2B 4RQBA 1U0LA 1YFKA 2NG1A 1HUQA 3B8HA 3LT0A 3M49A 4L6CA 4TWBA 5JD3A 4TZTA 3ZWOA 3KFVA 2K2QB 3EQ7A 3JASB 4ZYXA 1D2HA 1NDUA 1B8NA 4RVSA 5HQJA 4DS3A 1W73A 4JI4B 1QAMA 5KYTA 1F1JA 2P62A 3DLCA 2B8WA 1M33A 1Y80A 2J46A 2B1QA 2OFPA 3A4YA 3SJZA 1JWAB 1FDWA 4IGFA 1XZCA 4LE1A 1V16B 5IM4F 1ISGA 4MJ7A 4QYIB 3PC7A 4EY7A 3TDNA 1W1WA 1WV0A 2P11A 5T3YA 1LUAA 3IQGX 2QGFA 4ZOBA 4OEHA 3EGXA 1XTUA 4NBVA 2RMKA 3C8ZA 3RFFA 4E4YA 1E6LA 5KQPA 5IS2A 1C8BA 4P4GA 3J81A 1M76A 4F21A 2NUAA 3WOVA 1J2EA 5LXTA 1GILA 1KSGA 5KKCA 3VJRA 4Y6RA 1N36B 2I33A 3RVBA 1AB5A 3HABA 3NHMA 1YT5A 1XP8A 5JXIA 3OPNA 3OIUA 1H85A 1PG0A 2C2ZA 2IV3A 3M6XA 1NFRA 4B31A 3HHPA 16PKA 3MQ2A 3U17A 3KLBA 2JGJA 4WAUA 2C4HA 4BP9A 2DR3A 5IC5A 3LWNA 5JNVA 2OXEA 4AX8A 2VDPB 1E3IA 5KINB 2M9MA 5CFMA 4UNQA 2DBYA 5AXCA 2X4LA 2IL1A 2D3TA 3QE2A 1LBIA 4NBTA 4MICA 1KJ8A 1QPGA 1RBYA 5J63A 1I5OA 2OA0A 2FUNB 2OD9A 4JI5B 2R8YA 4PZZA 4X62B 3SJCA 4ESEA 1PZHA 3RRNA 2CKMA 3P52A 4KBFA 2O52A 5IJ9B 2A4MA 4HY3A 2FFHA 1E3WA 2X3UA 4QPPA 1WKCA 5T5QA 4AN4A 3LP5A 1NUUA 4DCTA 5KO2A 1T8UA 3Q10A 1Y37A 2BTOA 1X1DA 4OXYA 2OV3A 4IDBA 1AUVA 4G67A 1I14A 2PBRA 4FYXA 4HJXA 4O1HA 5IAKA 2VQDA 2C2HA 3D0OA 3GL9A 3GC6A 3I04M 4LVOA 3LZCA 3S5UA 4KXFB 3ZHOA 1L2TA 3DMHA 4GMKA 5GPBA 4LYJA 1EFVB 4O4HF 4LSGA 1OVMA 4IJ6A 3SE7A 4F5YA 5KQGA 3IS3A 2QQ5A 2I65A 2AD5A 2H9AA 1X1TA 4QTZA 3P19A 5TPWA 1BYUA 3FYUA 5JTTA 2Q4DA 5H81A 4FC7A 2HDOA 4FZ5A 1JFLA 3BHIA 2II6A 4EGFA 2R48A 3LTNC 2P9BA 2QY6A 3BWBA 3CGWA 3MWYW 4JOCA 3ZHQA 1EVLA 2BMWA 3OURA 3LCMA 1VMDA 4XE5A 2NWQA 3EXIA 4P7JA 4NBWA 1UODA 9ATCA 1AU9A 1EA5A 3ZQJA 1JF8A 2CVHA 3TLMA 1U7WA 4ZQEA 4AF7A 1AX9A 4QUAA 4IH1A 4B47A 5JSZA 3GQBA 4D9FA 2H16A 4KZPA 2XHEA 3OKAA 1U2SA 2YRFA 4IJVA 1BXGA 3HKCA 3RC9A 3ZE9A 3CVUA 3GD7A 4BX9A 1Y48E 1UDCA 5KAMA 2IWRA 2PL5A 4LTNA 4UNSA 3TZHA 2H5EA 4RPIA 5D3ZA 1SXJB 2IYSA 2NT3A 3RTEA 4C4XA 3E7FA 4YCBA 2Q5LA 2ASVA 1JAZA 3DVAA 5TQ0A 5B6IA 3WLNA 3DDCA 1R0YA 4CUJA 3VDRA 4QT0A 2HRBA 3E70C 4KN6A 4NOLA 4DDKA 4N5HX 4KCGA 1C2YA 5LZ7A 3HCEA 5FORA 4B48A 5JBQA 3T1YB 4YRFA 3ZDYB 2NIPA 2ABWA 4G8BA 2QT1A 4B7UA 3MGAA 2IZ5A 2VSOA 4WKNA 3WIUA 1P33A 2OMEA 4S1TA 4US1R 4DDWA 5JADA 4IIGA 1QH1B 5HPYB 1XD2B 3OTGA 1G17A 2WNHA 1YZFA 1JU9A 5EP2A 3VQTA 4WBNA 5GIPE 1RE1A 1UIRA 1TK2A 3HKEB 1YNSA 3T7JA 1UPBA 4D92A 5JDIA 3GCXA 5JISA 1E2BA 3E35A 3PRJA 1I2BA 2BGUA 3ZE7A 3E1GA 1Y3DE 4LGMA 3EMKA 3FX2A 4W9MC 3V9PA 1QRDA 4EBBA 4B74A 1N5DA 1PS8A 5LDGA 4GLOA 2Y1FA 3GA5A 3H2BA 5K3FB 3R75A 2JFBA 1XQ6A 4FI3F 4LJ5A 4G5SA 2WYWA 1NSYA 3OQ6A 3COSA 1EBUA 3NHWA 4CDNA 4ZALA 1ZVKA 2O2HA 5KZMB 2XGMA 4PX3A 1JSXA 2DECA 5KTYA 4UUBA 2H4YA 3WAKA 3VDMA 1DI0A 1B93A 3RIEA 1EUQA 3DEKA 1GKKA 4U8HA 2EP5A 3GMIA 2BEVB 3S3TA 5ILOA 5AUQA 3PFIA 1NI5A 2CNOA 4R6XA 1U8CB 2WZBA 2YWHA 3L77A 4KI0A 2HU8A 5HBGA 1ADCA 5LMCA 2QTTA 4PYMA 1TO2E 3AEKA 2HO5A 4MUMA 1HFKA 4RPHA 5DHAA 2PMCA 2OMKA 2WWVD 4R1QA 1WSAA 4E5KA 3B7WA 1M2OB 1Y3IA 3T0GA 3CNEA 4DLBA 1TYCA 1J00A 1S2LA 3CW2A 5HOEA 1ENPA 2NQ2C 3QUCA 4DDHA 1C4WA 1MCZA 5CA0B 3ICQB 1XDZA 4CM7A 3ET4A 2J3KA 4JJZA 1WV1A 4GMDA 1SOWA 1JW9B 4IDEA 4S04A 2BZ1A 2DQZA 5DULA 4X1YA 2Q6OA 1DHTA 3NIWA 5IZCC 1IEWA 3LDFA 2AEJA 2G1JA 3AP1A 3CNHA 3GRCA 3FPFA 1OA0A 2XVYA 1C30A 3F4BA 4JL5A 4Q12A 4GNKA 3UM9A 4C76A 2UYQA 1RZVA 4WOJA 1N34B 1QX4A 2VH5R 4CGZA 2AOTA 2Q3LA 3GT3A 4Q3LA 5FF9A 4C2AA 2QV0A 3P0FA 2AEFA 3N2GB 4ZOAA 5DK6A 1SG6A 3VC2A 1BEZA 2WF5A 4NJEA 4OQPA 4YRNA 5LMZA 1AHPA 3DTVD 3CKMA 4ZPJA 1Y7IA 4BQSA 1FSSA 1B8VA 1QDLB 3DE1X 2XLBA 4XB2A 4B2PA 1VBFA 1I3MA 1Z07A 2CBXA 4PR3A 3P9YA 4B6OA 4BO4A 4ECEA 3ULKA 2VJPA 5AHRA 4F4HA 5HQ3A 1YIDA 2YRXA 2Y66A 3QYJA 4MR7B 1HTWA 4IFEA 3PUWA 1AA6A 1RKVA 3A28A 3D6MA 3DT8A 3EASA 3WRYC 4AKIA 4ZI2A 1RBQA 2ENUA 3QWIA 3HXLA 3FB4A 3N58A 3BFKA 4JP2A 4NV1A 4PZAA 5IBQA 4KGXA 4PZDA 1IPFA 4U0KA 2L17A 3O91A 2EU8A 4ICIA 2YIJA 1PUXA 4BGIA 1ENYA 1FNBA 1W4RA 1V5WA 2JFGA 5CH8A 2OO3A 3HKBB 2O2CA 3BD7A 3FVRA 2YXBA 2CVOA 3H42B 5EP4A 3VAAA 1K0UA 2WUVA 1N2BA 1L5YA 4ZDIA 2E3JA 2WFLB 5C8YB 2EL7A 2A1IA 4LQDA 2VIIA 2HMUA 4TVKA 4ZQGA 3I12A 2VPZA 3GJXC 5CGZA 4EHJA 3WWCA 2OEPA 5HGXA 3UK0A 1IHPA 2V03A 1GGKA 4U5XA 2X0JA 3UT6A 1GUAA 5B7PA 3KSMA 5D5PA 4HQLA 5KHLB 5F9HA 5DGXA 2CNKA 1I4OA 3MM4A 4F3TA 3HB9A 4XLLA 1GT91 2A5GA 1PS0A 1HBJA 3PHIA 2JCXA 2EKLA 2FPUA 2FKNA 5WRFA 1GRRA 2P40A 2FPIA 4KQEA 1KE1A 4TZ6A 3R7NA 1XMIA 5C4IA 5F33A 1IN4A 3A04A 3M4YA 3T8YA 1WBJB 3HVRA 2YDXA 3G2JA 3CUSA 1YRBA 3QH4A 4YJKA 1YXMA 5GIOE 1CNFA 3D5EA 5EZSA 1ZJZA 3AQ4A 1CUUA 4RPLA 3SPXA 4BNMA 5JNTA 3R9WA 4JFAA 2PYZA 4DLTA 4EI7A 4OHOA 1R6VA 1HT0A 1YR9A 1Y9AA 4C0JA 4DT1A 5ADVA 4CG0A 4TKLA 1WZUA 2VDMB 3W2TA 4TVSA 1J22A 2Q3CA 1Y5NA 4L6AA 2VTBB 4FFBA 4X3OA 4O0MA 3WLSA 1SR8A 2GPNA 4KH0A 5DYTA 2A9PA 3FTNA 2YFHA 4RZHA 1ZGGA 1VPWA 1IJKA 1BZYA 1WUKS 2ID7A 1GTZA 1N6LA 3LC1O 4QAQA 5YASA 1H0KA 3A7EA 3GNLA 4DMFA 3QJYA 1DJMA 4F96A 4OFBA 3Q3VA 4EPWA 3A6EA 3FD8A 1JJIA 1W0JA 1XELA 1GAQA 1Y3CE 5K3OA 2R6DA 4KDRA 3NVMB 4TXLA 3RUFA 4DW8A 1Z4KA 1E4OA 3WGOA 5JJKA 3F78A 4UHCA 4LYHA 1PR3A 1YCDA 4AL4A 3CEPB 1B00A 1IONA 1XMXA 1ZKDA 5ICGA 1MB2A 2HMWA 4B4VA 5JNSA 2HF8A 2RHRA 2RH9B 2XPCA 2XUHA 3B1ZA 3M2TA 2PU7A 5BNTA 3VU1A 3AY0A 4QFBA 5HA5A 3L1VA 1ZEMA 3A70A 4UEKA 1A7AA 4J16C 5TGTA 2Y77A 4TKUA 4UBKA 4W63A 2H17A 3IDAA 4X6YA 3EEQA 3BBPA 4QECA 4XB1A 1XZGA 3R6LA 4WXMA 1GAEO 3ITNA 3Q12A 4C7OA 1CLUA 3EZ2A 2GYYA 4LSZA 4M53A 4B3TB 2AN4A 4U4AA 1A2OA 2AN9A 5HUQA 2VZ9A 3IPYA 3PE6A 3TD2A 3GUHA 1MB9A 3QK7A 3SVZA 3TFQA 2QHXA 1VFNA 3IXQA 5ITWA 3HCAA 2PLAA 5A3VA 1DXYA 1OXBB 1VPVA 2YOHA 4KE7A 1G8SA 3DCJA 4Q9AA 5DBHX 5EKXA 4QUIA 2HIAA 2ZULA 2AMLA 2AHOA 4QHSA 2P6MA 4K2AA 3H6HA 3TIIA 2I1QA 2JGIA 3A27A 2H2GA 4XJVA 2GZ2A 4F92B 4IJWA 4K8RB 3KO8A 4LHEA 3P9ZA 4G86A 4LRWA 4RXUA 1NR5A 1A8HA 2W2OA 4EF5A 1W0JD 3ANLA 4DN6A 4CEJB 4ZGGA 1N8TA 4Q4DA 1KR2A 2EFGA 4Y9DA 3OHSX 4RXTA 1CEXA 3Q0EA 3GEBA 4JSRA 1M75A 4YQYA 2GCOA 3L7DA 4D2IA 4KQXA 3RS3A 1JEYA 4AO6A 1T10A 1B2RA 1PLJA 2WV7A 3A6JA 4RJ2A 2VQFB 4OM7A 4M1KA 3PQ6A 3OVMA 2O8CB 1D4OA 2Z57A 3C6KA 3GEGA 3VBEA 2NXWA 2F3UA 1K08A 1ODIA 4AJKA 5KQLA 3FCYA 3PJFA 3BK1A 3H5TA 3BKWA 4DLYA 2ECQA 4M37A 1RU3A 3DDSA 1C4XA 2EBUA 2O5RA 3RU7A 4EHIA 4M0KA 1SB9A 3K1AB 1KDZA 3J7AC 4PR0A 2BEWB 3BL8A 4ZU3A 1X8XA 4E09A 3PNVA 1B76A 4JLUA 4MWGA 3ZV5A 1G38A 1VI2A 1TGYA 3PZBA 1QRUA 4PHFA 1IN6A 2FFQA 3CRNA 1N92A 5DI3B 3LK6A 4WOBA 1DTSA 1Z12A 1NYQA 1ZK3A 3OM1A 4D8YA 1JLMA 4V0KA 4QFCA 7ABPA 4F6RA 1O6GA 1QYXA 5DHFA 5I6DA 1L4LA 2QSZA 3MWDA 2ZVQX 5FULA 3WADA 4ARZB 1A2QA 4U2GA 4WERA 3TVYA 2IGTA 5IU6A 3WHPA 1LTKA 3EIOA 1V9LA 4TV8B 2HJVA 4FSHA 4IXTA 4NBKA 1WVIA 2Z56A 4WSOA 13PKA 3QU7A 1EE1A 3QVGA 3CF6R 2YJZA 4BNVA 1BA3A 1SPXA 1T5BA 2BMDA 2J31A 4RSGA 5E2BA 5EFZA 4G0MA 3QHQA 3EUWA 1UC4B 1C9KA 3CW9A 3V8PA 4PM4A 2XYPA 5DNYB 4NNJA 3WK5A 4EYEA 3CO0S 4L9WA 4O4JF 4TYPA 3ICWA 4R3NA 4K7JA 2A59A 4KIJA 4MV9A 4U9UA 4XCXA 5BMOA 1GTG1 3E5NA 1KRHA 2HF9A 5EMLA 5IC6A 3T3MB 5JZSA 3STYA 3NBAA 1N0IA 1O8CA 2WPDD 1JECA 3REOA 2A92A 2NMVA 1J9GA 3JZIA 4D9JA 1XZJA 4AZ3A 3NOVA 3K35A 4Y2VA 1N6IA 1V6AA 2CLMB 1VKZA 2HU7A 4R8SA 1C3OB 1AXRA 2H2HA 1NMXA 3ZJ4A 4EEZA 2O59A 2NZXA 4KQHA 3WJAA 2PUBA 4K6GA 5BV2P 2GLTA 3UXYA 3OPYB 1CUZA 1E63A 2WHEA 3DBLA 1YCGA 2G0NA 2VJMB 2DBQA 1GNRA 4L9SA 5TNXA 2SICE 3TUZC 2PGOA 1ZGAA 1LPSA 2JKZA 5F73A 5LPNA 4PZPA 5I4KA 5KREA 3C4JA 4RANA 5CTAA 3L7LA 1Z37A 4UTOA 5AJTA 4R2KA 1VG9B 2JGDB 4WH0A 4ZOEA 2ZJ1A 2VBGA 3PNSA 4HUTA 1OGIA 3LQ2A 2OC9A 3EQ6A 4GPEA 4H3HB 2JZNA 1TEVA 1UBTS 3JALA 3D4OA 1RYYA 4HQNA 2C9YA 2Z8XA 4KUGA 4OM8A 5C1DA 4NENA 3THXB 4B81A 3CM0A 3R0VA 2GK6A 2VZEA 3K30A 5FWDA 4AFNA 1H0SA 3N53A 5DNWA 5DNDA 4TV9A 3ZC3A 3GEMA 4KFRA 3B3GA 1KZYC 5HP4A 1N2OA 4DUYB 1Z7GA 4WZAA 4L4RA 2PVCA 3BMQA 3T3NA 1M73E 1BS9A 1OC2A 1ZNYA 4HADA 4PHTA 5KDLA 3HGQA 2YWRA 1MO3A 4BIMA 3PE3A 3EMVA 2X2PA 2JHFA 4M0CA 4ZDJA 4LV6A 3HA7A 1G3UA 2JJ1D 2A30A 1GRQA 2PV7A 2MYTA 4JELA 3D8RA 3EQ8A 2DFKB 2ZK7A 4I81A 5KS2A 2O0LA 5G4LA 5HS4A 4I55B 2O0HA 3QEMA 1OPRA 6AT1A 1ECFA 3PVCA 4WX2B 1ANKA 1ZLYA 2I8AA 1PEAA 3GFFA 4Y1RB 2O1XA 2WD9A 2DAPA 5HF5A 2ZCJA 1H94A 2C5AA 2XGJA 1BCSA 3AIIA 4JR2A 3ZV6A 1FB5A 4Z1MA 1YZYA 3GJSA 2UVQA 1N8SA 3SC2A 4MYHA 4DEXA 4OHKA 3T7SA 1O96B 1WBDA 1DKOA 5DNVA 3IEXA 1YB5A 1HMYA 3P26A 3AKEA 4I50B 4GVPA 4X20B 5EHGA 2JD2A 3SDZA 4LJ9A 5IW8A 1W49A 4EPRA 2O3RA 4G0XA 5KYKA 3TCNA 4IVRA 4LDQA 5EQJB 2PR7A 1BE8A 1SIOA 5LLTA 3C41J 4KTTE 3KQMA 3LM8A 4XLTA 3HN6A 4HH1A 1BW9A 1JYFA 1R18A 4U3JB 4DAOA 3ORRA 2FP4A 3N3AC 4BL5A 1VTKA 3IUJA 4HDRB 4PPFA 5HIAA 1KJZA 4EY6A 4F5EA 1JXQA 4AJHA 2GPYA 3GH3A 3T7CA 3MJCA 4Y1GA 2WAMA 5HHTA 1MAHA 1EP9A 2P9GA 3O4GA 3RBZA 1ZJ5A 3KEMA 1VB3A 3TQOA 1PT9A 3WL6A 3H04A 2IUTA 1F9EA 3W5CA 3N39C 1HNNA 2X5KO 4C7BA 5C1OA 1E2GA 2QU8A 2WT9A 1VMKA 1YQGA 1VXOA 2Z83A 1EX1A 1U2GA 1LBSA 4JBNA 4O08A 2X4DA 4CMBA 1SOUA 3LY7A 3QU9A 2WP0A 3HZOA 1WMSA 2ZU0C 3NJRA 3QVVA 1QF7A 1C0IA 1H6CA 4ND2A 2I4MA 2WUDA 5FWYB 1YDEA 1FX0B 3GGOA 2G1PA 1V26A 3KIPA 1QHSA 1VLMA 4G24A 5HS6A 1RXVA 3QVSA 3E3OA 3IDSA 3WQHA 5IG2A 3GJ5A 4HB2A 4HH4A 5K0NA 1G60A 2OKCA 4Q1DA 4YJ2B 4G89A 1SQSA 4INOA 1YB7A 2HLHA 3DGEC 4OOEA 3W8EA 2NAFA 3IX7A 4YO7A 2XUPA 4YP9A 5BQXA 3D7NA 1FMCA 1K1EA 1QXSA 3TRJA 2UYYA 1P72A 3TOXA 1NG9A 1W5BA 4C6TB 3RANA 2EW2A 1LRKA 2PX6A 2CFSA 2CUKA 4MV5A 1AVTA 3Q2KA 1FRNA 4OYRA 4TTVA 4B7CA 2CXRA 5LZ2A 3KR0A 2BKEA 2AL7A 1HOTA 1YAJA 4XD7A 4XSHA 4XQGA 4BATA 2MWMA 5EWMB 4DPKA 5A02A 1M8GA 1L5ZA 2G25A 2MSEB 1YDMA 3HJTA 3DCNA 1H69A 1RP1A 1OU4A 2G9ZA 2X5OA 2PZAA 2PRSA 2YXPX 4D0LB 5K7SA 1JKJB 1YDHA 2QD1A 4L8LA 2C5FA 2INGX 2BLLA 3Q98A 3N6RA 4RFLA 2IBSA 1P3JA 3JATA 3TIGA 3WLEA 3PICA 4K9MA 5CVJA 5JO9A 5AT1A 1K6MA 4ND7A 4HDKB 1L6IA 3O6VA 4PLPA 2W2KA 1K5PA 3B9QA 3G7SA 3NM5A 3EXAA 1W48A 2EX4A 4M0MA 1WA5A 4KHPB 4BHTA 1GEEA 1MKYA 3VX3A 1OFUX 1U28A 1HZZC 3JRNA 4HFNA 4U7JA 4YLGA 3UN1A 3R5FA 4EEXA 1G5FA 4LKOA 1OAOC 1PGPA 3TW8A 3CH5A 4C4YA 1AV6A 5IAEA 1NN0A 1XL1A 2VJLA 2QE7D 1CS0B 5AKIA 5DIFA 2UUPA 2GI4A 2IYOA 2WAOA 4AZ0B 1A77A 5AD1A 1QB8A 2CSXA 1YZLA 1DQRA 2EARA 2JK0A 4K9DA 4KO1S 4AP5A 1DAHA 1OXVA 5FTLA 1ZD2P 2FR0A 1YVPA 4JT9A 4QGGA 1H9CA 3RYIA 2YJ3A 4ILKA 1GEGA 4WN9B 4DRYA 1N32B 3LY8A 4R69A 3QXJA 5EPUA 5AH0A 1P9OA 2O57A 4B3GA 4LI3X 3P7MA 1E2DA 2NV2B 3N76A 5K2MA 4CF4A 1NPYA 1G20B 2V58A 3FYHA 3LT1A 4X7BA 1I4TD 1FLDA 4JXJA 4QUDA 5EHNA 4AIIA 2QTRA 2AKEA 1D5WA 1KZ7B 3L46A 3D5QA 3SAJA 4KJZA 1OBCA 3TVTA 1KDOA 2VATA 1ZU5A 3IDZA 3GGPA 4NMWA 1GA4A 2IYXA 4JQZA 2PFGA 3KZNA 3GLFA 3QKSB 2ZIXB 1R6DA 5DYYA 2P5TB 3PXDA 3X1MA 3E9EA 4QG3A 2VWPA 4ZOLF 2Z2JA 5ESWA 4ZC8A 4B0PA 5BUSA 5L9AA 3V4VB 3RFXA 1TO6A 3LWZA 3A2LA 2HUPA 2VPYA 3OJOA 5JYDA 1M10A 4GQBA 2YWDA 3OKCA 1P7CA 1NNLA 1TDJA 3VAZA 3KE9A 2SKEA 2ZS7A 4IW3B 2N46A 5C4GB 1D2RA 2CFOA 2Q2OA 1U81A 3EEFA 1WD7A 2BV3A 5KSZA 1LRLA 2FMUA 4TS4A 3RAEC 1EH5A 2IYWA 1X7GA 3FI0A 4D97A 3SQOA 1F12A 1XL0A 2XYHA 3AIKA 3K15A 1D9XA 1EFUA 2H5LA 3QHAA 5LQAA 3NNSA 4XIFA 3EW9A 2NSYA 1BXRB 1MC8A 2C8JA 4TWZA 1ZRSA 1Q3KA 1VCHA 2PQ6A 3ZE8A 4PC6A 2AEEA 4FILA 5JCJA 4J75A 3OE7D 1XEAA 4ND8B 4RA9A 2Y0BA 4W1SA 4JP8A 3K9NA 5AVWA 3F7MA 1X1AA 4NCKA 3HJNA 1IJBA 3EN0A 3VYSB 4R84A 1WHTB 2F8MA 1RQNA 1N2CE 4D46A 3EB9A 2OHIA 5EMJA 2AG5A 3QF7A 3OJ0A 1R50A 1RYFA 2Y1OA 2WHPB 3VH3A 4R71A 1GN8A 5F2EA 2IH4A 1XDUA 1V41E 2WF7A 2CD7A 1GG8A 1NWHA 3PTLA 4MV7A 4QJ5A 4D6YA 5FPSA 4X8OA 2CXTA 1C50A 4I4TB 3CVXA 1MC1A 4H27A 4UM9D 4UNIA 4LGCA 2A5DA 2MU1A 1H9AA 2HY7A 3LA6A 2ZE5A 3SS8A 5I5EA 4PNHA 2YN0A 4QZVA 5IKMA 3R3ZA 1FP4B 1NYLA 2LTAA 2IU0A 1ID8A 3PK0A 5KU7A 1K68A 4ZEOA 3G9UA 4FHCA 1XTRA 4HFRA 1EIZA 4PLYA 4MKZA 4XX0A 1VLLA 3PI6A 3UATA 5JH7F 3MF4A 3VKWA 5M3BA 2RGWA 2W9XA 3DXFA 3PHJA 2GEBA 1FFEA 1I2ZA 3I1JA 3C15C 1P29A 1KQPA 3DOCA 3OA2A 5BN5B 2IV2X 4B6GA 2IHTA 3D7KA 4DANA 2D2FA 4Q9KA 5DW3A 2FPMA 1G5QA 4BNIA 3SHTA 4AAYA 1XEWX 2WDZA 1DADA 3WLQA 2Q5QA 4RDXA 4BBAA 3AEYA 1HGXA 3AEZA 1F8GA 5DT2A 4ENTA 3U0VA 4BX8A 4ZEXA 3ZDXB 1HF3A 3WQBA 3T7EA 2CZGA 4NF2A 4PZCA 1LJLA 1Z68A 5LYYA 4DRXA 3RLIA 5ALDA 4ZVOA 1J6UA 1K3FA 1Z38A 4LQ4A 2RAUA 4CQMB 1XEXA 4D25A 3BK7A 1DRUA 1P0QA 1XZPA 3MAJA 1IUPA 3NYRA 3R23A 4Z8YA 2ISQA 1QF6A 1WKVA 3O92A 1ADGA 1LVUA 1ZX1A 2P9HA 1LPBB 3EFBA 1TLTA 3JTEA 4ZEWA 1NOIA 4H0NA 4MQEB 3ZX4A 4CI0B 4HNQA 2HQRA 3JYNA 3AVOA 5KMGB 4G9EA 1TEHA 2Z4RA 1E8DA 1MOPA 3U39A 2XCRB 3ETNA 4XXHA 4HGYA 3IHWA 5K0CA 1KH2A 4I2NA 2WIAA 2R7MA 3AG6A 1SUCA 4L2IA 1I3CA 3EXHA 2NU7A 4GMHA 4HAOA 1AQIA 4NEQA 4YMWA 4BVFA 1U94A 2GLXA 4DV2B 5EZYA 1D2EA 3BXPA 3NWEA 3IIEA 4GM0A 3TL3A 3ROKA 4JFRA 3T4UA 2B3TA 2XEDA 1F0YA 2FOIA 3HSYA 4R05A 1E1CA 1W52X 3NIFB 3V1UA 3AM1A 1DIRA 3CUVA 4QUBA 4YV0A 4ALKA 2OXFA 1DWOA 1KI2A 4G5QA 1KKMA 1Q14A 4JYBA 1B14A 1IXRC 4UHBA 5B1EA 4YDRA 3O8QA 1RRVA 4ER3A 3ZTWA 1LBQA 1WCWA 4KLRA 4PEVA 4EHNA 3L84A 4FUTA 4NARA 1KVTA 1XYYA 3EA4A 4MGYR 1J23A 1YBAA 3EXG2 4BLVA 4EY3A 4TLEA 4PG7A 4HN4B 2ANBA 2FFAA 4XWAA 3OT1A 5CHYA 5DT9A 5G3YA 5CMLA 1B6RA 1DQSA 2DWOA 2O2YA 3BSWA 3MCTA 5TQJA 3TBHA 3PEYA 2GJ9A 4KIFA 1L5RA 4HGQA 3CPJB 3FFAA 2X0DA 3JQDA 4A0FA 5FQNA 4DQVA 4CV3A 4K87A 5KNCD 4WGGA 2EW1A 2R7NA 3PWTA 1P5RA 4OP2A 3K7EA 5CB8A 1ZLXA 1VKJA 2G0AA 2I8LA 2VYVA 1JKMA 4L4UA 4MIEA 4KXLA 1O6CA 2Z2YA 3TZEA 3UENA 3R7SA 1NXXA 1O03A 3OT5A 2B5VA 2NV6A 221PA 3KDSE 4BDSA 3G79A 1Z28A 4Z6KA 3SZ3A 2VTVA 3EEBA 1Z7EA 1VDZA 4LJ8A 3SKYA 2WP8J 3M6LA 2K7FA 3CLSC 5DLYA 1ST3A 3UKOA 3DPSA 5CVDA 4FUQA 3O1LA 4Y2QA 3WZLA 1J70A 2GFHA 2X7JA 1X1EA 2BZGA 2JZCA 1JSRA 3L0ZA 4OLHA 1M1YB 1N2SA 3VPAA 1NXVA 3VSDA 4AJNA 5T4HA 1T6BY 2SKCA 5DE3A 2OPHA 1MQSA 2VCYA 3DBHA 1PFGA 3ANMA 1CUWA 4GDFA 1XLUA 4BO5A 4F2WA 3ZZ1A 4GS5A 5KYVA 1W1IA 1J42A 4UUQA 1NFFA 1XZIA 3B1XA 1THMA 2ZRIA 3M5PA 3KPUA 4WY8A 3FHOA 1V6SA 3IUMA 2FLWA 4S0XA 1PGOA 2WV9A 4ZZ1A 3I73A 1FJXA 3KSDO 3QKUA 2AQIA 1XRSB 2ZS9A 3BRQA 1ORWA 1BJTA 4WFJA 3ZLBA 2CY0A 3ODPA 3RD5A 1RQ2A 2X3FA 1TZMA 3IT2A 3KOZA 3ZNNA 3KCQA 5JNUA 3CN7A 5U9CA 5G41A 3AF0A 3BB4A 2BFPA 3JQEA 2D5AA 5EJ9A 2PU5A 1WF3A 4RJJA 1BEEA 2VYVD 2R6R1 5AQ1A 1WHSA 5ABPA 2J33A 1SOVA 4Q15A 4PG4A 4L22A 1I33A 1K0FA 5A7GA 1ZBQA 4P38A 3DR3A 1EGVB 2I6GA 4LBWA 2AYYA 3BWMA 1F17A 5EG5A 2V7XA 4K6OA 3ZDBA 3ITEA 1HDEA 4IQFA 1YS4A 1GARA 2OCDA 1GNPA 4QU5A 4B40A 1ZJ6A 3QXHA 4D6PA 4C7MA 3WV4A 2CB0A 4IVPA 2AS0A 4RELA 5AWFC 1J90A 1CY1A 1DRVA 2LE0A 3KJXA 5FYQA 3BRSA 2SKDA 5HG0A 4RFSA 2V8BA 3QW2A 1R0CA 1P18A 1GGJA 1CQZA 2ILVA 5D8DA 3TB6A 3W7VA 2RHDA 3EVZA 4QYXA 3E22A 3DS8A 3ROXA 1GUZA 4ME6A 3AR4A 5JUWA 1XMOB 4RS4A 5FTKA 3W34A 1ARZA 1ODKA 3KKEA 5J2TF 3IVAA 2ZTLA 3QPWA 4TZ0A 3HP7A 3BN3A 3LVRE 1P4AA 1RJFA 2PSJA 3R41A 5D6OA 3MBKA 3RU9A 3WBJA 1TKBA 4L5CA 5D7BA 1L9KA 4KV9A 4IVQA 2QW8A 2NAPA 4MUAA 1CB7A 1NZDA 4H08A 4YFVA 2HWKA 1SKUA 4MR9A 4W9RA 4KRFA 1TNDA 3N9IA 2B4RO 3QKRA 4Q18A 3ZXSA 1AGXA 4N3GA 1UMBA 2YZGA 1E5XA 3EY4A 4RBNA 1G42A 4ETMA 2FI1A 3LDGA 2IE8A 1SFRA 3ZY2A 3KJIA 5TMPA 1SWVA 2ZDGA 3AC0A 3EVFA 4CKYA 4LDZA 4MEJA 4P86A 1Z08A 3EXEB 5KB3A 2WLTA 3CXRA 4B32A 3IAAA 1TTQB 1ZNWA 2QR3A 1K4YA 3LLSA 4D3XA 1G8GA 1NRIA 4X7RA 6Q21A 2P9ZA 3ZV4A 4EO9A 1UPCA 1Y1SA 4HDCA 4RA6B 3LOPA 2X0FA 4BKOA 3WQSB 1S3SA 3AOEA 4GWLA 4J2HA 4M0LA 4CKCA 3IKMB 4G36A 3KALA 1RJ9B 2VHVA 3S0JA 2AFRA 1DAPA 2DJIA 2PKYX 3BWEA 1C29B 2J9RA 4MCIA 3QEAZ 4QJIA 4NI5A 3BT7A 4TLAA 4E7PA 1JE0A 1JUDA 2WYHA 4BP1A 3GH1A 4LTMA 4YCNA 3FNIA 4IYRA 5LVAA 4MRNA 3SOPA 4BNWA 1XEFA 4L95C 4YI3A 2EXXA 2XQIA 4NPAA 1D4ZA 1KRXA 3ZK9A 1MQ8B 2DJ5A 4PXYA 2HWUA 4BLRA 1VE9A 3KEOA 1FYXA 5D5QA 3FMOB 4GBJA 3GNQA 2A9RA 1GRNA 4XH9B 5TT0A 2LCFA 1W2WB 1M1YE 1L5WA 4UM7A 4A0HA 5SZJA 5JVDB 3IKJA 3EIUA 4BMSA 1JFFB 1S3GA 1G64A 3BD9A 4ZT7A 3PUZA 3OQMA 1IJEA 1AKWA 1A4IA 2GXSA 3O3MB 5KHAA 4Q3BA 4HMOA 3ANNA 3WSTA 4EPTA 4CXMA 1I94B 3A3OA 3NBYC 4PGHA 4C3ZA 4RORA 1SZPA 4A82A 3I62A 4DSUA 3N0XA 2FW7A 2PR2A 3MAGA 1FL9A 1CJKC 1DWQA 1T6ZA 3F1KA 1Q3TA 3HJBA 1GFSA 3BEOA 3PT5A 2H0QA 3TLGA 1WB6A 2GBIA 2H8GA 1BC5A 3ESRA 4L7QA 3W9SA 3WGNA 4ARAA 4D3DA 3E4DA 1QP0A 3NTQA 1UAAA 3FPHA 5DWDA 5FX2A 3D8NA 1YZQA 2NQ8A 4RVHA 3QRWA 4BECA 2WC1A 4W5TA 4Y2SA 4YMVA 5E95A 2RK6A 4UCWA 3QPDA 4LZPA 4Q37A 4UTRA 1E3MA 4U7PB 3GZJA 3WLMA 2ZYWX 1YZGA 1MAAA 2PH1A 1E2IA 4D3ZA 3E5RA 4ZQHA 1Z4PX 1CYDA 2E87A 3QMWA 4PCVA 4RL4A 4Q4AB 4R8KA 4YJGB 2Q29A 5F7XA 7AT1A 1EDDA 2HJWA 2VDWB 2OCYC 1EUCA 4I36A 4C07A 3B6ZA 1IWBB 4AN0A 2BM1A 4NMHA 1DKPA 3ORYA 1X7WA 1KP2A 2G4VA 3D54D 2Q46A 4LUCA 5K0TA 3OY2A 4X94A 5GTDA 3HH8A 3PU6A 3QYPA 3JD1A 3C14C 3SJUA 1DOZA 2O3TA 2NU9B 1RAGA 2Q1SA 3T7AA 4O2AF 1SUFA 3X2FA 2C04A 3GFRA 1QM5A 3O1HB 3NAQA 1VRCA 1V11B 1X7ZA 4DJAA 1D0SA 4MEAA 3WGUA 4D4KA 4Q4CA 1Q95A 1U1GA 2QX8A 1NKSA 4PYRA 4MS1B 1NVBA 2HOQA 3D3EA 3VOAA 2VZ8A 2P2CA 1QTIA 4QUHA 2MT9A 4N7RA 4CIXA 3BS4A 3E8MA 1AK9A 1YSCA 3T3PB 3BICA 1XAIA 2AN5A 3MTAA 4K86A 5CXXA 3JRXA 3PI7A 4BBZA 4KDFA 1Q0UA 3VPXA 5DWVA 2EZTA 4O63O 5F3RA 4H18A 1PL8A 4Z54A 2RHCA 3NTRA 4R7TA 1YS6A 4XUEA 2HA2A 4ILEA 4GO1A 5JOQA 3KG2A 4P9NA 4WNAA 2LVBA 5EE0A 2Z4TA 2DR0A 2CJWA 4YUZA 2AC2A 2WQZA 2GD1O 5BY2A 2LV8A 4PIVA 5LL6P 4I9HA 1JHMA 3A0UA 4QIHA 4Q66C 2IBMA 3UKJA 1U9YA 4LSMA 1R12A 1W1UA 3N2KA 1SJ9A 3CUTA 3HVHA 4QPDA 5FWXA 4UDYX 2DULA 3BWDD 3HA2A 5EY5B 3W7BA 5JS1A 2GD0A 3UCFA 2WM3A 4FR0A 2OXRA 4AY3A 1QIDA 2HMVA 3KHKA 1T3ZA 1M1NB 3QSYA 3O38A 2BGGA 3S8EA 4QC2A 2GVDC 5EC8A 1A5ZA 2J7PA 3GCWA 4KAXA 5BRNA 2HFKA 3QX8A 1DOAA 1D2NA 1N6KA 2PN1A 3QOFA