4PVDA

Crystal structure of yeast methylglyoxal/isovaleraldehyde reductase gre2 complexed with nadph
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
342
structure length
342
Chain Sequence
b'MSVFVSGANGFIAQHIVDLLLKEDYKVIGSARSQEKAENLTEAFGNNPKFSMEVVPDISKLDAFDHVFQKHGKDIKIVLHTASPFCFDITDSERDLLIPAVNGVKGILHSIKKYAADSVERVVLTSSYAAVFDMAKENDKSLTFNEESWNPATWESCQSDPVNAYCGSKKFAEKAAWEFLEENRDSVKFELTAVNPVYVFGPQMFDKDVKKHLNTSCELVNSLMHLSPEDKIPELFGGYIDVRDVAKAHLVAFQKRETIGQRLIVSEARFTMQDVLDILNEDFPVLKGNIPVGKPGSGATHNTLGATLDNKKSKKLLGFKFRNLKETIDDTASQILKFEGRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH-dependent methylglyoxal reductase GRE2
publication title Structural insights into the cofactor-assisted substrate recognition of yeast methylglyoxal/isovaleraldehyde reductase Gre2
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 125
structure length 342
sequence length 342
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.265: 3-methylbutanal reductase.
pdb deposition date 2014-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4pvdA00
4XR4A 2H63A 3C1TA 3D4OA 4Z3KA 1PGNA 2QZ9A 4HXYA 1H9AA 1LDMA 2JCVA 3ZCXA 1WMBA 4TRRA 5CEFA 2OZPA 4C4OA 4IZIA 4BKQA 3SVTA 4LW8A 3INRA 1GL3A 3FSRA 1QV6A 2WTBA 5AXDA 1Q1NA 1TI7A 3IKVA 4XR9A 4JP2A 1PQWA 5DP2A 5H83A 1E3JA 2CUKA 3CINA 3UHAA 4KUHA 4XRRA 3AU9A 1HTBA 4YJFB 3TRIA 4N5NA 4QXMA 1NPDA 4B7UA 3TOZA 3L6DA 4FJ2A 1O8CA 1MX3A 1QYVA 1YL7A 3ZZNA 1P1HA 4IGEA 4GBJA 2AA3A 4HFRA 1LJ8A 3VKUA 1SEPA 5BQFA 4P38A 3E5RA 3GVHA 1PJQA 1KOLA 1N92A 4FC6A 3IL2A 3DDNA 2DT5A 3GLQA 3LLSA 2FSSA 5J23A 3COSA 2BLLA 5JO0A 1X1EA 2DKNA 4U5QA 1BVRA 4MJLA 1LQTA 4GGPA 1WPQA 2HAEA 2AE1A 2NSDA 4RVHA 1FK8A 4BNXA 1UXJA 3AOGA 5A02A 3SJ7A 2D4AA 5EPOA 4YJGB 4B3IA 4LRSB 3V1TC 1IL0A 4R54A 4CV3A 3DHEA 1E92A 3GNSA 5CEEA 1YO6A 3C1OA 3KRTA 4R01A 1TA4A 1M66A 3H5RA 2FPGA 4J49A 4B8WA 1BXZA 3UN1A 1DDOA 5EJ2A 1HE3A 4IDGA 5H82A 5A9SB 3MCVA 1O94A 1NAIA 3R0IA 4DL9A 4P4GA 4UVEA 2WD7B 3DBVO 4NHEA 1Y8RA 2OHXA 3OBBA 3TZHA 3QVXA 1DOHA 1VJ0A 2YHUA 1DJNA 5A5EA 2AHRA 5FEUA 1E0DA 1ORRA 3OM9A 4IXWA 2DQ4A 4BNHA 3AM5A 4E12A 1TT5A 3JQBA 5ILGA 3I4CA 1DRUA 5KJ1A 2YQ5A 3IOYA 3WGGA 3OQ1A 1LQUA 2J5QA 3IC5A 4J1TA 3RU9A 4BB5A 4E6PA 1R66A 4WLVA 4R68A 1XHLA 3I9KA 5FI3A 1DRVA 1ZMOA 2CF6A 1T26A 3HJAA 8LDHA 4YEDA 3G1TA 4AJLA 3DWFA 4GL4A 1MG0A 3JYLA 4ZQEA 1UZLA 1R4NB 1E3WB 3RUCA 4YDRA 1E6EA 1A27A 1KBZA 2JAPA 4FJ1A 2BGMA 3NGXA 4A0SA 1H6AA 3PJFA 3IIEA 4YBZA 3HZZA 5DCWA 5ILOA 3KYBA 3B6ZA 4RF4A 1DFIA 1PSDA 5AQ1A 2B4TO 3BA1A 4GWKA 2J3IA 4J0EA 2E37A 4LK3A 5GZ3A 5KVCA 4Y98A 5A3VA 5KWEA 1J4AA 1TXGA 4BOYA 3KEQA 5JO9A 3GEDA 5CPFA 3DOJA 1P1IA 2XPCA 5A06A 5CEJA 4CQMD 4NFHA 1CIVA 3ZHXA 1W4ZA 4BHTA 3MEQA 1I8TA 4CMIB 4CQLA 5THQA 2PKQO 2EG9A 2OO5A 1EZ4A 5I9LA 2EXXA 1ZJZA 4Z9YA 4GGOA 1C1DB 3FPLA 5CDUA 3TN7A 3FTPA 4C7KA 3OIFA 4NJMB 1Q0HA 4JLWA 1L1FA 4CM4B 1Q7CA 4JGBA 1EK5A 2HCTA 4J4TA 4BNJA 2X0IA 1EUZA 3P2YA 3IP3A 1KVTA 3KLPX 3JQAD 2E48A 4PG7A 4IDDA 4K6FA 3I1JA 1S7CA 3Q11A 4W9NA 2VOEA 2C7VA 2J3JA 3RQSA 1ADCA 4DXHA 4FIZA 4CMHA 3RVDA 3M2TA 4U8GA 1PZHA 2ZIZA 3SXPA 3T4XA 4CLXA 2CSUA 2FRDA 3E5MA 1DHRA 4E0BA 3LT1A 4ZJUA 1PL6A 3AY7A 3B1JA 4RO0A 1LSUA 1RYDA 3H3JA 2B0JA 4B7XA 1MB4A 4D7AA 1Z74A 1T4DA 4TKMA 1PJ2A 4GKBA 3MTJA 2Q2VA 2DTXA 4TSKA 1R0KA 5DN9A 5T6BA 2BGLA 5L51A 2Y68A 1LLUA 2EERA 2DUUA 3JQFC 1H2BA 2XAAA 2WD8A 1LXCA 1BW9B 1NPYA 3H9JA 4PZEA 3TQHA 4E5YA 5U1PA 2IE0A 5KKAA 1KEVA 4TRNA 2NUAA 4K26A 1HRDA 1T24A 1NVTA 2Z95A 3ANLA 5CHEA 1XLTA 1NQOA 3WGOA 3X2FA 4BIIA 2YY7A 4M54A 3RBZA 3JQ9A 5A04A 4XD2A 1DFHA 4RPHA 3ZWXA 1FF9A 1EDOA 1PJTA 2IODA 4FS3A 1X0VA 3HUDA 3DZJA 1O95A 5JFOA 4NZ9A 1E7YA 3RBXA 5CG1A 1IUKA 4M86A 1P33A 1PS0A 3S8MA 5IFLA 3GDOA 3ZV4A 2PNFA 3FBTA 2P4QA 4INAA 1M67A 1Q2XA 3RSHA 2P4HX 5JC1A 1A71A 3L6OO 2DC1A 1P1FA 5I7SA 2JHFA 1G0OA 1PJCA 4I5GA 3E1KA 4WLUA 1P0FA 4J3FA 1YB1A 1LSSA 1S6YA 4P4NA 4AJ2A 4EZBA 1HE5A 4BQRA 1LLQA 2FWMX 2PGJA 1GYPA 1R12A 4ZQHA 1HDRA 5T67A 4CLEA 4IJUA 1WP4A 4K1LA 4CM6A 1DAOA 2GN4A 3TSCA 1N5DA 2FHSA 2OORA 3RKRA 3O8QB 1LI4A 1B0AA 1RM4A 2HMTA 4XWYA 3DBRB 4UVIA 3PEFA 2GN6A 4B4WA 4OAQA 4QTZA 3WTBA 4CMBA 3A9WA 2QRJA 3NDIA 5F5NA 5L95A 5L4SA 2VWHA 2O2SA 3VDRA 1T1SA 1DHTA 3LQFA 4IJWA 2PGLA 3RJ5A 3KM0A 4W7HA 2GR9A 1CEQA 3WIEA 2GPTA 3STHA 1GQ2A 3KZVA 4KWIA 1SPXA 4WOJA 4IIUA 1LDGA 4RF2A 4DPMA 3AY6A 3MJEA 1WWKA 2VT2A 1H6DA 1HXHA 3WWYA 1F0YA 1AGNA 3HNPA 4II3A 5C5IA 5B4UA 4XB1A 4XYMA 3JQAB 1EQ2A 4NH4A 7ADHA 3KTDA 3JV7A 3QRWA 3DBHB 5A3JA 5A9TA 2WE8A 4N54A 1PJSA 3U0BA 1U3TA 1ZXBA 1H6BA 3GN2A 3KXDA 4WLNA 3D64A 1X1TA 4ALIA 4Q3NA 4P22A 1MP0A 5CDTA 3QSGA 1XQ1A 4ZRNA 1ZIDA 5IDYA 4MIOA 4NBUA 4HFNA 3D4NA 1OBFO 1F8GA 1GEEA 2V6BA 1IHYA 2QG4A 3DQPA 4QECA 1WZEA 1NVMB 3ANNA 5BNFA 4BKRA 5JPIA 3GG9A 1D8AA 4ZQBA 3K92A 2BI8A 2HKIA 5FF9A 3TF5A 1NHWA 4YJFA 1N8KA 3IUSA 1PU2A 2B4QA 5EERA 1T2CA 5ENVA 1GV1A 1U5CA 3M1AA 2VUSA 3ABIA 4ZRMA 4PG8A 2CDAA 3QQPA 3IS3A 4NBRA 2OL4A 3WLFA 2HDHA 3WG9A 4CLRB 4YJHB 3F6YA 4XQEA 1DLIA 5C7OO 1AHIA 2BKAA 4Q9NA 2X23A 1P1RA 2IXBA 2J8ZA 2PA3A 3BAZA 4L74A 2W4QA 3BMOB 3JQ7B 1RWBA 3LT2A 3C24A 4D44A 1I2CA 4D0RA 5GZ1A 2GYYA 4LN1A 1Q0LA 3B70A 1ZSVA 3FNHA 1EUDA 1RM0A 5JCJA 4E2YA 4HFJA 4HY3A 4YJGA 4ONEA 2RH4A 4FPXA 1R6DA 4BB6A 1GZ4A 2PFGA 3I6QA 3PDJA 4BNVA 2IRWA 1K6JA 4FGSA 1ADGA 1E3IA 2GZ1A 5A9SA 1PR9A 4NBWA 4U7WA 1JKIA 2J3HA 4EJ6A 1OC2A 3I6IA 1T25A 4HNGA 4NQZA 1WW8A 2WD7A 4I5EA 4PLGA 4AJIA 4NU6A 4Y6RA 4QT0A 1P9LA 2ZB7A 4J4HA 3PHIA 1ZKMA 3GVCA 3WQRA 3V1UA 4IMRA 4QSMA 4F46A 3ZWVA 3DL2A 4IJVA 3BTSA 4Z9FA 1C0LA 2YV3A 2QIOA 1HEUA 2I3AA 1QG6A 3OFSA 2JFHA 3FRJA 5JS6A 4CM1A 3ZNOA 4D3FA 3DMYA 5TT1A 2FR1A 2GGSA 4R4JA 3ORFA 4E32A 2YQ4A 4LVUA 3QE3A 3E82A 4J9UE 4JK3A 5CFZA 3RU7A 4GI2A 3WTCA 5TJHA 1GR0A 4LCEA 1R4NA 1E3WA 5JBIA 3WNVA 4RCVA 1Y9AA 1VRWA 4BV9A 3GAFA 3BIOA 2X1HA 3I9NA 4NU5A 1D7OA 2O23A 3ENNA 3GFGA 1OZAA 2VHXA 1O6ZA 3EUWA 1H6CA 3MJSA 2PR2A 4W9NC 3L07A 1NASA 1LU9A 5C7IO 1H9BA 3S1LA 3I4FA 1YWGO 4ND4A 3WFJA 1P31A 1P74A 2B83A 3L4SO 4IQ8A 4WJZA 1ZMTA 3Q6IA 4IY1A 1O9BA 4PRLA 2X6TA 3CSDA 4CMIA 1JAXA 2UYYA 1N9GB 2BH9A 1VSUA 5TF4A 2VYVD 2BFOA 3E48A 1C1DA 1EK6A 4HFMA 4E13A 5C3MA 3W8FA 3GGPA 1ZEMA 3LDHA 4NR0A 4BGVA 2WWRA 1JTVA 3ROPA 1K0UA 4NJMA 4X54A 5G4KB 4TVOA 4BKOA 4CM4A 3NUGA 1L7EA 2Y67A 3SBOA 3QWAA 5EIOA 4MVJG 1NWHA 1ZCJA 3P7MA 5CP8A 1XCBA 5JNLA 2HMVA 3PXXA 1QMGA 4ZU3A 3LC7O 1Q7BA 4RORA 2G76A 3DZHA 3QHAA 3NJ4A 4NPCA 3JQGB 4Z9XA 1V3UA 5JLAA 1NWCA 3PJGA 3HQ4O 3HB5X 3U9LA 3D0OA 1EEHA 1Y5MA 5KNLA 5BSFA 3WGIA 2YUTA 1CRWG 3W4KA 3JQ9C 3DAGA 4J43A 3U4IA 5JCXA 1KETA 3U49A 1E3EA 4XGNA 4RQTA 3NT5A 3NRCA 2G1UA 4YCAA 5DCUA 2O3JA 2PK3A 4B3JA 4U0JA 2HMWA 3UICA 3GC6A 4IDEA 1LSJA 5TRTA 4DRYA 1I30A 1I3KA 4FFOA 3NYWA 2D3TA 3PIIA 2J5RA 2HRBA 2DPGA 2GCGA 3G17A 2A92A 3TL2A 1ENPA 4RVUA 3F1KA 2VRBA 4Q39A 4RLHA 3UAGA 1BVUA 1DB3A 1YL6A 2JD1A 3DFUA 3L9XA 4IZHA 4KZPA 4AJOA 3KBOA 4ALKA 1BDBA 3AJRA 1I3NA 2YFHA 3WQSB 1ENOA 1PZGA 1RM3A 3L4BA 1U1IA 3F46A 1BW9A 4TVBA 1JLLA 4LRTB 4PVDA 5DF1A 3Q1LA 3OIGA 1RJWA 2QW8A 3JQ6A 3RAJA 2QZZA 1EFKA 1GPJA 2NNLD 2X4GA 3AI3A 5G0WA 4Z3DA 1DXYA 5HS4A 1BSVA 3FHLA 3QVWA 1HZJA 1VPDA 4IJKA 4OHUA 5T57A 2C54A 3HFSA 2Z1MA 1QR6A 5MGBA 4II2A 4GX0A 3PIDA 4E3ZA 5ENDA 2JFGA 3ZV6A 3B1KA 5G0TA 1BRMA 1B3BA 3ZWWA 1SBYA 3IDSA 3GGGA 4GX2A 3EY4A 3GVPA 4IDAA 5DNAA 2UDPA 2C5EA 5JYDA 4R51A 5CDSA 2NADA 4YWJA 1DC6A 3BZUA 3AU8A 2AXQA 3GZNB 1JDJA 1U7TA 4TRMA 3TFQA 2Z1NA 2ZB3A 3SLKA 1ZFNA 3GF4A 3IUPA 3RD5A 5KKCA 4CMEA 1GZ3A 4BNNA 3DOCA 1EVZA 1GUFA 1G0NA 2EWMA 3VH2A 3ROQA 4BUCA 4DMLA 3IP1A 2UUPA 3U4DA 4CLDA 3WSVA 2X86A 3PWZA 1HDYA 4R16A 1P77A 1A4IA 3F3SA 4PLFA 1QYXA 4YRDA 2IZ1A 1GU7A 2W2LD 4CQMA 2GF2A 3B20A 1JW9B 1XQ6A 3OH8A 4BGIA 2NU7A 2VTDA 2XOXA 2G17A 1ONOA 4J4BA 3PJDA 1PZEA 3BTOA 3HFGA 4DLBA 1MC5A 3NV9A 4YPOA 1UUFA 1NYTA 3ON5A 1FDTA 2GERA 4BNYA 3CZRA 4YAJA 1ZXLA 2UVDA 1W6UA 3DZGA 1B8PA 4J2OA 1IYZA 3AM3A 3CUKA 3JQAA 2G5CA 3RC2A 1LLCA 3IQDB 2W8ZA 1E1MA 4LMPA 4CMCA 4XIYA 2VRCA 3D4PA 3GRKA 2BHLA 3DBHA 2EEZA 5KTKA 4NFSA 1IHXA 1IE3A 2XXJA 2ZTMA 5IZCA 2LDBA 4G81A 4A03A 3I9JA 1P44A 4ALMA 4YT2A 1OC4A 3MJVA 1N2SA 3VPXA 4RPLA 3EVNA 3K6JA 4O5OA 1GQQA 2FSVA 1B16A 1DIGA 4KTTE 4N18A 2DLDA 2EW2A 3PI7A 4CR6A 4AG3A 4D41A 3LVFO 4R5MA 4DIFA 1EFLA 1J6UA 3INGA 1RPNA 3C7CB 5KOIA 3HHPA 5BT9A 1RM5A 1PX0A 2JCXA 3V2HA 4RGBA 4RVDA 2CDCA 4F3YA 4H16A 3ZWAA 5L40A 4ILKA 1YH3A 2GZ3A 3GVXA 4K6CA 1BG6A 1QV7A 3MOIA 5L7YA 3L77A 1V0JA 3VH1A 1X7DA 3AWDA 3VC7A 2EV9A 3ZDFA 4DBVO 4PLPA 3EK2A 4IQGA 5ITVA 5ER9A 5HA5A 1HLPA 2YYYA 2GZ2A 4JBHA 3GPDG 4M55A 4E5NA 3QV1A 4CLRA 4YJHA 1BXGB 1LEHA 1I32A 2PKRA 4EW6A 3BMOA 3JQ7A 4IGFA 1EBFA 3ONDA 5TS3A 3DR3A 4I9HA 4CM7A 4BMSA 4CUZA 3HDQA 2VHVA 1I36A 2C59A 2R00A 3CKYA 2DM6A 5ICMA 1I3LA 3TWOA 3DAPA 3TZCA 3TZ6A 5DOZA 5JY6A 5IG2A 2DFDA 3FNEA 1UXGA 3FR8A 4XYLA 1UJMA 3GN1A 4R9RA 4WECA 4CLHA 5U9CA 3GDFA 4CR8A 5TSDA 1EQUA 4MVJP 5EMHA 5H81A 4RZHA 1N7HA 1NQ5A 4TKLA 4MVJM 3RUDA 1YB5A 2NU9A 4WLEA 3PHJA 1AUPA 1EVIA 4C7JA 3CXRA 2AG8A 4TRJA 4M8SA 4AJHA 5K9ZA 1MUUA 1PS9A 3H3FA 3AUUA 2VT3A 3DBLB 3HB4X 4J7UA 3HG7A 1P45A 1ISJA 1ZUD1 3DHNA 5MDHA 1E7RA 4FFRA 3NEPX 4LSWA 1A9YA 1Y9EA 4L4SA 1ZEJA 4RVSA 1A5ZA 4HX5A 4XQ9A 1NFRA 2CNBA 3V2UA 4EEXA 3BTUA 2GLXA 4Y6PA 6ADHA 3G0OA 2DTDA 4R1SA 4XKJA 8ADHA 5HRUA 4RPKA 5ICSA 1G1AA 4JNKA 1ADFA 3AUAA 2WDZA 4DWVA 2VNAA 3L0DA 4ZN6A 1E7QA 5U4QA 4N7RA 1LRLA 3VZRA 3VOSA 1SAYA 1E1KA 4CR7A 3VKVA 3GOHA 4JJIA 1UXHA 2X5JO 4GAEA 1GFSA 2X9GA 3GPIA 1BWSA 2JHGA 4XYEA 5LDGA 1J49A 3M1LA 2EW8A 2YDYA 3BHMA 1SO8A 4K28A 2TMDA 2H1SA 2O3TA 4XEHA 5JE8A 4GWGA 4UULA 4YJDA 3VPSA 4DYVA 1HDOA 1GZ6A 2VRCD 2YV1A 1P1KA 3HWRA 4KP7A 4U0KA 3WWZA 5JW6A 2E6UX 2Y1GA 4XYGA 4IDBA 4ND2A 4XYBA 4HWKA 3OMLA 2Q46A 3C1AA 3ZNQA 4AJ1A 2X5OA 5LCXA 3JYPA 4YT4A 1B2LA 1DC3A 4Y9DA 1I33A 2VUUA 4OL9A 5G4KA 3M2PA 1T4BA 2JL1A 2PZLA 2WM3A 4O0LA 1ZK3A 3BMCB 4RV9A 4S3MA 2PKQP 3ICCA 3OEYA 4I08A 4YACA 4LISA 4PCVA 3KETA 3GZ4A 3L4BC 2ZCUA 2HK9A 2HO5A 3DZIA 3H2ZA 3HN7A 1T2DA 4H15A 1PZFA 3T7CA 3JQGA 1GUYA 1JWBB 1FMCA 3DZFA 3OIDA 2QYSA 1HE4A 4JCOA 1I24A 4OXYA 2Y05A 3N58A 3NJ8A 4IDFA 3QVTA 3ST7A 1M75A 1EVJA 4WOKA 3WNQA 4PZDA 4ALJA 1ISGA 4XGIA 4L9RA 3WYBA 2X9NA 1UP6A 4YQZA 1P0CA 1MFZA 2VNSA 4CM5A 4E5PA 4FR5A 1DC4A 4PLZA 5C7LO 3F4LA 1E7SA 1E7WA 1B3RA 4FOOA 1QSGA 2YZ7A 3A28A 3PYMA 4J9VA 2HK7A 2QQ5A 3VH4A 3G79A 5JMWA 2GNAA 2B35A 5DP1A 3ZN2A 4B79A 1ISHA 1KS9A 3BMQB 3LYLA 4OYRA 5TX7A 1G6KA 1GV0A 5FFFA 4UEJA 4BVAA 2GN9A 4ZD6A 4FOSA 2P2SA 1VLLA 4YR9A 1U4OA 2WYUA 3INTA 2C2XA 4IQ0A 2EP7A 4MPDA 4PRKA 4CMEC 4RDIA 4QQRA 3I9MA 1V3TA 4URFA 2B5VA 2I9PA 3LK7A 3I23A 1U9JA 3KYCB 5A5FA 1O89A 1XDWA 4ZA2A 5F1OA 1R37A 5IDWA 4BO5A 4EUFA 3GK3A 4N5MA 1N1EA 1QLJA 4ZQGA 2PZMA 4BNUA 4CPDA 4AICA 4AVYA 1KIFA 3IKTA 3AOEC 1DSSG 4H3VA 1MC4A 3OETA 1FXSA 1OFGA 4IS3A 1U3WA 5B4TA 1JVBA 1YB4A 3LZ6A 5B4VA 4BNLA 3TL3A 4XJSA 3VH3A 3ZHYA 1I2ZA 3F4BA 3MOGA 4Q3BA 3QVOA 3Q2IA 3N74A 1M6WA 4WEQA 1YGYA 2D5AA 3A1NA 5AXBA 4CMAA 3H6KA 3GZNA 1LX6A 3PZRA 4UAGA 1TT7A 4K9DA 3FNGA 1J0XO 3ANMA 3EAGA 5I9MA 1BDMA 2YJZA 4JIGA 5L7WA 1A9ZA 1I3MA 1V8BA 3WGQA 5CDGA 1WXDA 5A4DA 2YW9A 3KYDB 4ND3A 4MVJH 3RC1A 4RZIA 4NNJA 5K6AA 4Q3AA 2AQKA 2Q2WA 2YHIB 2IZ0A 3ETEA 4I5DA 5KVQA 3OJOA 3WGHA 2NVUB 2GDZA 2PTGA 2H9IA 1GYQA 1XA0A 2NV6A 2VHZA 5IZCC 3T4EA 1PL8A 3P2OA 5BSGA 4BO3A 5JXWA 3WJ7A 4CUKA 2JD2A 3WDSA 5JMPA 4KTVE 1PWXA 1IZ0A 1QLHA 3FWZA 5EL0A 1B15A 2NQTA 2YV2A 1O5IA 2WEKA 2PH3A 3PRJA 3NTRA 2X8LA 5IXYA 2VYVA 4Z0PA 4CLOB 3SX2A 2DBVO 5IJZA 1E3SA 1XYGA 2FPIA 1BXKA 3EZYA 5TQVA 3OEWA 2EGHA 2ZCVA 4BL5A 2RBEA 3JYQA 3ZV3A 4BQPA 1SEVA 3S2EA 5F5LA 4DIOA 2IDZA 4PLVA 1VE9A 4FFLA 4M87A 1ZZEA 3LF1A 1GPDG 3WMWA 1ISFA 2W98A 3I9LA 2X0RA 1B8UA 4CUJA 4BO2A 3ITKA 4R69A 1A7KA 3C8MA 4PLYA 2WJPA 2CVOA 5BSHA 1TB4A 4FCCA 2FZEA 1PJBA 4FC7A 4HBGA 1ZSYA 3ETDA 3WIDA 1E1NA 1AXEA 3PGJA 2ET6A 2O3UA 3Q9NA 1ZO8A 4JROA 4WCFB 4WUVA 4MOWA 5GMOA 2Y0EA 3BTVA 5CDYA 1R0SA 3UFXA 3KVOA 1RYEA 1QXSA 2R00C 4Q3DA 1BGVA 3GT0A 4RLSA 3E03A 3QW2A 3E18A 1GYRA 3GVIA 3GHHA 4DQXA 1HZZA 2NTNA 3H5AA 3H2SA 3F5SA 4RF3A 1PIWA 3E9MA 3X2EA 4ZVVA 3ZV5A 4J0FA 3GGOA 4E5MA 2P91A 3OJLA 3K96A 3IMFA 3JCZA 1U8FO 4GKVA 4OM8A 3DC2A 3NDJA 3ZW9A 4DUPA 3CPSA 2OUIA 3RUFA 4OXNA 1E77A 4EUHA 1Y8QB 4JJFA 5ES3A 4E33A 4JX8A 4HV4A 2ZYDA 4OXKA 3D3WB 2X58A 3RBVA 3ZGYA 2VZ8A 4CL3A 5G4LA 1BXGA 3BYZA 2BGKA 3GHYA 4DBZA 5LC1A 3NTQA 3WR5A 4M89A 3M6IA 1JN0A 3SLGA 3K5PA 4KMSA 4AJPA 1U28A 3AM4A 2C07A 4MVJF 2NU8A 1TEHA 1E5QA 4QO8A 2G82A 4BKUA 1O0SA 2GD1O 4L4XA 1B8VA 3RCBA 4AJKA 3PFFA 3ULKA 1DLJA 3E9QA 3KB6A 5JSFA 1NP3A 1NR7A 3H9QA 3K30A 2HJSA 3JD3A 5AXCA 9LDTA 3IJRA 1T2FA 4YAEA 3TDKA 1MFPA 2C20A 3L6EA 1UAYA 3EZLA 2HJRA 5IN5A 4NG5A 1VL0A 1RKXA 4KUEA 2OMEA 5HS6A 1SOVA 1MXFA 3OA2A 1EBUA 4O6VA 1VJTA 4PLCA 3JQCA 2A35A 4NMHA 3A06A 3WFIA 2PD3A 3EGOA 3DBLA 4F6CA 1UDBA 1MV8A 4TQGA 3OJ0A 1WAMA 5BR7A 1LUAA 2BFMA 4ID9A 3K9QO 3D5QA 4JJGA 1CYDA 4HKTA 4MO2A 4BGEA 1EMDA 2Q45A 4ROSA 3ASUA 2W2LA 2C29D 1WZIA 2NVBA 3VDQA 2A4KA 3JD0A 4HNHA 2VQ3A 4E5KA 3GEGA 5EQFA 1I10A 3IJPA 1CF2O 2F00A 3ZU5A 4G2NA 4D3SA 2C82A 1GAEO 3G49A 1FDWA 1W0CA 3PZBA 1E7MA 1KEPA 1YXMA 4DA9A 4EJMA 4DQUA 2IXAA 3GH3A 1K2WA 2GSDA 4YAGA 3U5TA 1K89A 3TPCA 2O48X 5F1KA 3ROKA 1XGKA 2FOIA 4F45A 2POQX 2OBNA 3CH6A 1YKFA 4I8XA 4RVFA 2X7HA 3KHUA 5JAQA 4A7PA 3I3OA 5JYEA 1AE1A 2FY8A 4YVFA 2SCUA 1IPEA 5KVSA 2AQHA 1UZNA 4YTEA 4XIJA 3AW9A 4IUYA 1YRLA 4PG5A 1GQYA 3L9WA 4R3NA 4BMNA 3PLNA 1X7GA 3AUTA 1T2AA 1DAPA 4KQWA 5G0SA 1HWYA 1YVEI 2ZB8A 4D42A 1ZJYA 2EHDA 3BMCA 2VHYA 2EGGA 4E30A 4D46A 4QO7A 5A1TA 1HYEA 1A7AA 4AJEA 1PGPA 5A9RA 2FN7A 2JFFA 4L75A 3PJEA 1PEDA 2HK8A 2H6EA 4D0SA 5CG2A 3ROMA 2PY6A 1NXQA 1FJHA 5DBIA 5JAIA 1JVSA 1D1SA 1PGJA 4Y8VA 2EKQA 4GMGA 4JXKA 4BO8A 4I9UA 5HWSA 1VJ1A 4O59O 1C0PA 4OSOA 2YFQA 2BF7A 4MIEA 2NTJA 4MIYA 2PV7A 4I9NA 3F5QA 3RUHA 2PWZA 1WNTA 3PK0A 4RVGA 1C0IA 2YDXA 3PYXA 4DYDA 3ADPA 1U3VA 1MGOA 2DBRA 1T1RA 4FDAA 1ZH8A 3WGYA 2I5PO 3RUEA 4A73A 1ENZA 1ZBQA 4BO0A 3BMQA 3R6DA 2O4CA 4QFCA 2D59A 3TNLA 1HDZA 1L7DA 1XG5A 3A4VA 2JKVA 4I1IA 4B3HA 4QFDA 4TROA 2XXBA 1F12A 4FFNA 3RFVA 3TZQA 5A05A 3WBBA 1LRKA 4LGVA 3ICPA 5K6AC 1NM5A 4MVJA 1M76A 2E82A 1H93A 2P5YA 3KYCA 4XQGA 3DONA 3FI9A 1ZK1A 3FNFA 3GA0A 3GNTA 2P9CA 3GMDA 1VC2A 2GO1A 1YOVB 2P9GA 4NIMA 1VM6A 5FYDA 1I0ZA 4BNKA 4DLLA 3GNQA 2RAFA 1ONNA 3AK4A 3OA0A 4AJJA 2HSDA 3FWNA 1NAHA 1CWUA 4UUOA 2IZZA 1H0KA 2VWPA 3P5SA 4L8VA 1I2BA 3W6ZA 3WJAA 5COAA 4WKGA 5DBFA 4LMRA 3O8QA 3AFMA 3OJFA 4R5HA 3R1IA 3RASA 2I65A 3DBRA 1YQGA 3BMNB 3QVSA 4CV0A 1F8FA 2XF8A 3RWBA 3RROA 3AUSA 2Y0CA 2AE2A 3GRPA 1C0KA 2PZJA 4DC1A 3SJUA 3O4RA 3AOEA 2ZQZA 4WE3A 3RI3A 3KLMX 4R1UA 3F1LA 2Y0DA 3PHLA 1AN9A 4DLAA 1NQTA 1ULSA 2WE7A 5THKA 2AW5A 2UAGA 3VZSA 3U4HA 3KYDA 4J91A 4RF5A 3LC2O 2YHIA 1MG5A 3HSKA 5AXAA 2NVUA 1HETA 4L76A 2QRKA 1F17A 1WLYA 2GN8A 5DULA 2CF5A 4OKIA 4AFNA 2W90A 4A5OA 4XA8A 1JWAB 4UVDA 2HU2A 3OQBA 1FDVA 3DMTA 3VPGA 3Q9UA 1YS4A 4XJTA 2VZ9A 4FQ8A 4JP3A 4PFJA 2VWGA 2CMDA 1XSEA 3ZNNA 4J1SA 1UH5A 1T2EA 3H5NA 3ENKA 3A14A 2J3KA 1GEGA 4Z6KA 4B7CA 3H9UA 4CLOA 5B12A 2NWQA 2PD4A 4B8ZA 3ZU2A 1GCOA 3K73O 1EDZA 3EDMA 1KC3A 2PD6A 4RDHA 1R4MB 3PFWO 1U3UA 3I9OA 3LT0A 4PG6A 5GZ6A 5HBRA 5AOVA 4NK5A 2QHXA 3GEMA 4ESOA 4MP8A 3HDYA 1LBEA 2VHWA 9LDBA 2Q1SA 2Y99A 1GCUA 4UUMA 3AFNA 4WNCA 1HT0A 2OOSA 1D4FA 1R15A 2V6GA 2X0JA 3JQEA 1KVSA 4GLLA 3VTZA 3RFXA 4A27A 2EKPA 3JQ8B 4WGGA 1YBAA 2HMSA 3GFBA 4J90A 4WCFA 4U6QA 7MDHA 3H65A 4OIMA 3ZHZA 4EDFA 3PGXA 1NX6A 4R3WA 1E3LA 3QJ5A 1LSOA 3WGTA 3ZWCA 4XRGA 3K31A 3QWBA 5T5QA 1Z7EA 1A72A 3MJCA 3GUCA 4N5LA 5I7EA 2I67A 5TNXA 3ITDA 1I01A 4L0QA 2P9EA 3HE3A 2CVZA 2V6MA 2C0CA 4W99A 4CODB 3JD2A 1SC6A 4PVCA 5L4LA 4Y6SA 3ZWPA 1E1LA 3H9GA 4R1NA 2VTEA 4KOAA 1NHGA 5ER6A 4PZCA 2VN8A 4Y67A 1Y8QA 1E6WA 3KUXA 2X5KO 2Y1OA 5L3ZA 1SCUA 1SB9A 3D3WA 3NX4A 1YJ8A 3EC7A 1VKOA 3KSZO 2NLOA 2V6FA 5TJ9A 3KEOA 1CQJA 2AEMA 3BHJA 3WX0A 1YQDA 2WSBA 4D45A 4MVJD 2C2YA 2OBYA 1PR3A 2ZK7A 1QRRA 3WYEA 3O9ZA 2R2GA 2W2KB 4Q3CA 1Z73A 3WB9A 3MWDB 4XQCA 4EBFA 3LSYA 4YB8A 4J7CA 4KDEA 4LVCA 1KVRA 1C14A 3V5NA 3CZMA 4DPLA 4D3DA 4ND5A 5I7FA 1SOWA 3JD4A 1Y5RA 2A9FA 2BELA 4ZQFA 3RC9A 4JBIA 3FR7A 1NPTO 1U5AA 1VL6A 3I52A 4OKNA 4CMJA 4D79A 2BFPA 2RHCA 3GY0A 3I83A 4L4RA 4TMFA 5KJFA 2I99A 5F21A 4EJ0A 5IAAA 3QWIA 1IOLA 4KDFA 4TWRA 4BNTA 2FPPA 1B7GO 3FCOA 1QP8A 4OOFA 1TLTA 5L53A 3ZWNA 3DO5A 2X0NA 1CQIA 1QYWA 4XB2A 3VHRA 3NT2A 4EGFA 1AXGA 2AMFA 4O1MA 3UCXA 3PTZA 3PHHA 4XX0A 2VCYA 1XEAA 3V2GA 2ZTUA 3O26A 3KOUA 1IY8A 4YQYA 4P4LA 1YDWA 1M2WA 3UVEA 5TT0A 2P5UA 4IM7A 2O7SA 2HUNA 3OSUA 3ZU3A 3E8XA 1HKUA 5KIAA 4IXTA 1UP7A 1LDBA 4EUEA 2Y1CA 5JAMA 2CZCA 3VZPA 3NT4A 1YQXA 1FDUA 2FMUA 1W73A 5L4NA 4GH5A 3H7AA 4OOEA 4CL8A 4PG4A 1PJLA 2I3GA 5HM8A 5BNIA 3UF0A 1ADBA 1YJQA 4ITUA 1DRWA 1QKIA 1WDMA 3SC6A 4RQUA 1HL3A 1N9GA 2IEDA 4XDZA 3UOGA 4DTIA 3GQVA 3TOXA 2FR0A 2UUOA 1XU7A 4R1TA 1ZVMA 3WGZA 3PLRA 1DFGA 4DVJA 1ZK2A 2BFAA 4FSHA 5CPBA 4CM8B 3ASVA 3IAHA 2AQIA 3AI1A 3GMSA 4E2ZA 1X7HA 2DU8A 5COQA 3VTFA 2ZTVA 2UV8A 1I5RA 4BS9A 5C37A 4HADA 2GUGA 3MJTA 1J5PA 1XR3A 5KJCA 2ZYAA 4DQVA 3CMCO 1Y81A 1HF3A 2R6JA 2ZB4A 2NTVA 4FGWA 1LC3A 4XZ3A 3S2IA 4E4YA 1E5LA 5FI5A 2AEJA 3W1VA 4BO9A 2PZKA 2NACA 2PH5A 4FN4A 5EINA 1U7HA 2E4AA 5BSEA 2F1KA 1GUZA 4NI5A 3ZI0A 2Q2QA 3K8ZA 1PJ3A 3LF2A 4IIVA 4YRBA 2OP0A 3OP4A 2AEFA 3GDGA 5JY1A 1LDYA 1LTHR 1X0XA 2Q50A 4FFPA 3G3EA 1PGQA 4QUKA 4WCDA 4BO6A 1UZMA 4UUNA 4A10A 1GY8A 2HRZA 2B5WA 2EIHA 4FFMA 2Y1DA 4P8RA 4PLWA 2CD9A 3UKOA 4DPKA 3U09A 4FBGA 2D5CA 1DO8A 4NJOA 3WICA 4TZTA 2O50A 5KVVA 1EE2A 2IEBA 3S55A 3DAFA 2EJVA 1OOEA 1F14A 3VZQA 2WYVA 1NVGA 1NR1A 2D2IA 2TMGA 3DOOA 3SC4A 1EUCA 4YT5A 4Z0TA 3U3XA 2ZTLA 1YBVA 4M49A 2B69A 1V6AA 3QA9A 2EJWA 1HYHA 4DREA 2J6IA 4AL4A 4BKPA 4MKRA 4BNZA 1WVGA 4BNMA 3DHYA 1GDHA 1C1XB 1BTOA 3HDJA 5T8KA 1H5QA 1U2DA 3O03A 3S2FA 1Z82A 1AHHA 4NFYA 3MWEB 2JAHA 3Q3CA 5AVOA 5KCZA 1X15A 5BNTA 1D1TA 1HDGO 3QLJA 5JDIC 4J1NA 3PQDA 3ZWOA 3QWFA 2AQ8A 1ZK4A 3WSWA 4AJ4A 3JYOA 3C7AA 3PPIA 3QP9A 1ISIA 3FBGA 1LDEA 1NBOA 3HADA 1ML3A 4PLTA 3VAZA 3GG2A 2ZJ1A 3KSDO 5DBGA 5TIIA 4A26A 1UXKA 3NDRA 3R3SA 3KO8A 3EVTA 4GVLA 1GADO 5EESA 1QYCA 1YOVA 4W82A 2IYOA 3DMTC 1VI2A 5I7VA 2PGDA 3ETGA 1LLDA 4S1VA 1K6XA 1KEUA 2DVMA 3RUIA 2VWQA 4R9SA 4XGKA 5F1PA 3W4IA 3FTNA 3PHGA 4OQZA 5DT9A 4GSKA 4MP3A 4WLOA 4F6LA 1Z45A 1ARZA 4GX1A 3WXBA 3ZH2A 4GVXA 1C3VA 3ONEA 1ONPA 2JD0A 5EQDA 3S2GA 3JQDA 3BMNA 3VPFA 5I8WA 2GASA 2Q1TA 3QWHA 4LSMA 2Y66A 2NU6A 5JDCA 1DIRA 3GR6A 5B37A 3F9IA 4CQMB 2DAPA 4UVHA 4GPD1 3WMXA 4OMUA 3HN2A 3JD1A 2HLPA 1YBMA 2DPHA 3LC1O 2DTEA 1HE2A 4GSLA 3Q2KA 3DB2A 2V65A 1GTMA 5I9NA 1IZ9A 2WMDA 4CMKA 1NNUA 5KJEA 5L7TA 2CDBA 2I6TA 1JQBA 1NFQA 1KYQA 5DZSA 1CERA 2Y1EA 4UEKA 5DCYA 2OXIA 3UCEA 3UW3A 1M6HA 5EN4A 5IN4A 4WCFC 4NK4A 3PWKA 3UXYA 1H2HA 1TVEA 2B4RO 2OP1A 4J6FA 4LCJA 3ZNPA 5B1YA 1DJQA 3MTGA 4MKZA 2HMUA 1ULUA 1QYDA 5COBA 3C3XA 3W4JA 3MJ4A 3OECA 1HDXA 1GD1O 3CTMA 4WEOA 2NQ8A 5JAZA 1WDLA 3VVCA 4AJNA 1B14A 1LRJA 4NBVA 4J2HA 1YL5A 2O4UX 2GRAA 4MINA 1R4MA 3DEYX 5G0VA 4JN6B 3PVZA 1PS8A 3FD8A 1IPFA 4E21A 3AY3A 3RFTA 1N1GA 3H8VA 4GQAA 4B4UA 4HUJA 3HDHA 4YA6A 3R3JA 1UP4A 1LC0A 1B26A 3ZHBA 2JCYA 1WMAA 4FD3A 3U4CA 4G5HA 2B37A 1WDKA 1XU9A 2ZQYA 4CV1A 1HLDA 3JQ8A 3RKUA 3PYLA 4GLOA 2FZWA 6LDHA 1FDSA 1Y1PA 1N7GA 2O7QA 2EP5A 1ENYA 4EI2A 3DTYA 4QX6A 2Q4BA 4CJXA 3DZBA 3TFOA 5I8ZA 4I5FA 3JQBC 3C7DB 4IBOA 4ZHSA 3K2BA 3Q0EA 1ISMA 2J5KA 1Q7GA 1XELA 4OSPA 3EHEA 5L45A 3ADOA 2QX7A 3PQEA 1Y8RB 3K2EA 1EVYA 1UXIA 3LT4A 1PL7A 4EEZA 4A2CA 1U4SA 3CE6A 1MLDA 4WNIA 2O3QA 1KERA 3WQQA 4JBGA 4GX5A 4NDNE 3PWSA 4BNWA 1K5HA 2RCYA 4FJ0A 5G2OA 1TT5B 1KY5A 4G65A 3DZKA 2H5LA 4FB5A 4KUGA 4CM9A 3I5MA 3ZWMA 3B1FA 1BMDA 1MA0A 3C85A 4BV8A 1ZK0A 4ZICA 2WYWA 2I66A 5CAEA 3ZWBA 4B4OA 5L9AA 2C7GA 4YAIA 2OFPA 2W2KA 2HQ1A 1VKNA 5IXSA 3UGKA 3CIFA 1SNYA 3AI2A 2NVWA 1U8XX 3W8EA 1LNQA 3V8BA 2OGUA 3VVBA 4IINA 1PWZA 1CJCA 1PGOA 2ILTA 1F06A 1R0LA 4Z0HO 2Q3EA 1XIVA 3JSAA 1R16A 2D0IA 1DC5A 1KVUA 4B4VA 4KQXA 3T7EA 5TGDA 5ITWA 5TLSA 2DUWA 3OQ6A 1NFFA 2O2YA 3PP8A 4O63O 1NTOA 3KSUA 2FP4A 3UH1A 5A03A 5KJ6A 1VSVA 4H7PA 4CMGA 1JA9A 4UEOA 3TZKA 4PGFA 2O3SA 2JJYA 2Q99A 4OH1A 4CQLB 2VZ0A 4YAKA 3E6AA 3OF2A 3NKLA 3WBFA 4DGSA 1EE9A 2ZJ0A 3JYNA 4W6ZA 1UDCA 3DXFA 1JAYA 3EW7A 4BNFA 1UAGA 1DBVO 1JU9A 2CVQA 1UDAA 1KY4A 1KC1A 2DBQA 5IZ4A 4JQCA 5HTOA 4OQYA 4PN3A 1HYGA 1OAAA 3EYWA 3F47A 1HSZA 4GMFA 1OMOA 5TC4A 1HSOA 1PTJA 2EF1A 2G0TA 4ND1A 4RJTA 1VL8A 3E9NA 2BD0A 4PLHA 3RJ9A 4BGUA 3CEAA 3H9EO 3OJEA 3NAQA 4MP6A 4WPGA 2VOJA 4EYEA 4MVJE 4IS2A 3KV3O 2VYNA 1KVQA 2AG5A 4MVJI 4RL6A 2C5AA 2X22A 3GAZA 3LU1A 1PQPA 1U2GA 2I76A 4RPGA 3RIHA 3WYCA 1ZNQO 3H4VA 3WOHA 4MDHA 4Q3EA 4CM8A 1SZJG 1YE3A 5T64A 1A4UA 2CY0A 2D8AA 3PDUA 1V9LA 3UCFA 2ZYGA 4BMVA 1LDNA 2RIRA 4FW8A 1JKFA 4CV2A 4UUPA 1PQUA 5DDIP 4MKXA 4EITA 4J1QA 4U6SA 4W7IA 3RC7A 1X13A 2Q1WA 5G0UA 1NQAO 3D3EA 3FF4A 4E2WA 4TZKA 1BHSA 1W8DA 4CM3A 2FR8A 4YYZA 4J7XA 1KEWA 2ZATA 4KWHA 5T8KC 1Y7TA 5K0ZA 2P68A 2O3RA 4E2XA 1YDEA 5GY7A 2BRUA 4W4TA 4DIBA 2BI7A 3NGLA 4DC0A 2V7PA 1Z7BA 3TJRA 3SEFA 1E6UA 5IDXA 1DPGA 4UVGA 3DTTA 3GUYA 2DBZA 4BNIA 5JCJD 1H94A 3QY9A 4IMPA 4RPJA 2B36A 2IYPA 4L73A 4OO3A 3WS7A 2VUTA 1V3VA 1DIBA 3MZ0A 2Q1UA 4ALNA 4D43A 3D7LA 3EMKA 1CETA 1K3TA 3WLEA 4CM9D 1IULA 3CMMA 1DIHA 2LDXA 3V1YA 4WK6A 1OI7A 4BNGA 1PJ4A 3W8DA 5AYVA 4PIVA 1DIAA 1P1JA 1C1XA 1ZW1A 3JQFA 5JDCC 4HP8A 2Q49A 4DMMA 4YT8A 1YONA 1DEHA 3ZW8A 3JTMA 3FN4A 1LA2A 3U62A 2Y1FA 4R41A 2Y93A 4YRAA 3RUAA 2X9VA 4XCVA 1SMKA 3FPCA 3OICA 3UUWA 1V35A 4WLFA 1Z6ZA 4BO7A 5F3RA 3BHIA 1CDOA 2RH8A 4ZGWA 2Q4EA 4OGWA 1XWFA 3DFZA 4NBTA 5DOVA 2EKLA 1QORA 3O38A 3VPHA 1HDCA 2D1YA 1Q0QA 2CFCA 1UR5A 1ZSNA 3D5TA 4WASA 5JDIA 1Z75A 4YXFA 5JC8A 1Y6JA 2BMAA 2QYTA 3N7UA 4J16A 3LLVA 4UREA 2RHRA 1MXHA 3OHSX 5ADHA 5LDHA 4M1QA 4QEDA 3ONFA 3ZWYA 4IDCA 1X14A 1P3DA 3PQFA 5IDQA 1ID1A 1JKJA 2Z5LA 3BXXA 2NM0A 2QRLA 1D3AA 1XKQA 1K6IA 4BO1A 2A94A 3ZU4A 1IB6A 4BO4A 4E31A 1SB8A 2PLAA 4OJNA 4IPTA 3W6UA 3G1UA 2DFVA 4ALLA 3NTOA 3QIVA 2E49A 3D1LA 3P19A 2VYND 2ZKLA 5FWNA 4XDYA 5IF3A
chains in the Genus database with same CATH superfamily
4YK7A 2HEGA 1JFVA 4AO7A 3K70D 3EHDA 4TRRA 4W9MC 2C42A 4FT2A 2HR1A 3OFNA 2OZPA 4C4OA 4BKQA 4EY6A 1UM9B 2E4WA 1L4NA 3FSRA 3OFVA 5AXDA 4DA8A 1EUYA 2CCGA 3IKVA 4JP2A 3IMKA 1E3JA 1N6KA 2D54A 2OAP1 3MBKA 2HQBA 3L8ZA 4D0GA 4KUHA 3BN3A 5KU1A 2XH8A 4MYSA 3AU9A 3FPHA 4QDOA 4TV8A 5SZJA 2HLNA 2JCSA 4V3CA 4N5NA 3TOZA 1G6Q1 4FJ2A 1O8CA 1QYVA 1YL7A 1KYTA 2IA5A 3I64A 4EY3A 1L7VC 3CG4A 4IGEA 4NCIA 4QD3A 3SKVA 4HFRA 3VKUA 3GPLA 1QHIA 4EGQA 2QEQA 5CTAA 1FQWA 1PJQA 2C8LA 2VXCA 3LXUX 4Z86A 1KOLA 1N92A 2GA8A 3BCUA 2X4DA 2E4XA 3WLOA 5DXJA 1T8WA 3BF7A 1W1IA 3NHRA 4MHOA 2FSSA 4WN3A 2O8FB 1TF2A 2WNIA 2HX1A 1IQPA 4AIIA 2O54A 2GM4A 4QYXA 4U5QA 3K0SA 3LYUA 4QYIB 2IF2A 3TO5A 5GINE 1OXBB 2XMCA 3MCUA 4GGPA 1K4KA 3O8CA 5AW6A 2O2CA 2AE1A 3QFHA 4HGPA 5DBOA 4BNXA 2UXCB 2J0QA 3IUBA 2RGDA 4ZFNA 5LP1A 2H2DA 4BMOB 1H2WA 2GXUA 1JEQA 1N3YA 2D4AA 2LCIA 1OLSA 3L7BA 4W8HA 1L8XA 1LS6A 4CV3A 5DWVA 3DHEA 3Q7TA 1JHAA 2DP4E 2WJHA 3C5EA 1TA4A 1YR1A 1M66A 2GB4A 2J3LA 2WHQA 4OQDA 3SIXA 4A0HA 3UN1A 5JWHA 1QIKA 3CR7A 1DDOA 2FKAA 3VO2A 4J3JA 1HE3A 5A9SB 5KX5F 4GICA 1O94A 4GG1A 3B82A 3V4SA 4DL9A 3D3KA 3R4CA 4F8EA 3GZTB 1YI1A 3SK0A 5JVDB 5IXYA 4GUDA 4U7PB 2OHXA 3E3AA 1RRMA 2XA1A 4GSYA 2IQ5A 2QMOA 2XIQA 3EIOA 4RQAA 4DEXA 5A5EA 5JD4A 1KGDA 1PE0A 4Q48A 3WI7A 5ERYA 3UK1A 3GAAA 2ZUDA 3IEXA 2R6R1 3OM9A 2NU8B 3LCCA 4HAOA 3TTVA 2LW7A 4B2IA 1CUWA 3C7TA 1LJLA 1Z7WA 2ZLBA 3I4CA 2QU7A 2R6AA 3OTHA 1IN6A 1OREA 2RI0A 3KT3A 3S1AA 3ICQB 4UEWA 3RU9A 5I3ZA 2B20A 4R68A 1NBHA 4Q3LA 3ZDXB 1DO0A 3LUJA 4ODIA 4Q1BA 2OVFA 3CLSC 5DNYB 5A71A 4FW9A 2LNDA 3TE7A 1JEYB 2J4CA 1D2NA 1C7JA 1EFCA 2GDJA 2F55A 3JYLA 1JDUA 3E5HA 5FL7D 1UZLA 3PQ8A 2R2AA 1Q74A 1E3WB 2R87A 3A8TA 3CEPB 4YDRA 1NJ6A 2HO4A 5J63A 1PTJC 4FJ1A 3ZE7A 2BGMA 3GGJA 1Y3DE 2C2ZA 1KR5A 1TJPB 3HZZA 4REQB 3NBYC 3I76A 3B6ZA 3KYBA 1GPYA 2QJOA 4RF4A 4KFCA 1QQBA 2E37A 3K0AB 1RP7A 2IOFA 2R6HA 3KB2A 1YB7A 5GZ3A 1HTWA 1VCIA 2P6NA 1IB0A 4Y98A 5KWEA 4ZV4A 4U7DA 1IWOA 3LECA 1I4TD 4FQ5A 3A4TA 1AB6A 3NWEA 1Z0SA 1FVFA 5AI4A 2DSNA 4EB0A 3F8SA 4Z2YA 1UC8A 4ZVTA 3QKTA 5CPFA 2XPCA 4MV8A 4NTZA 4R2IA 5KPDA 1J9EA 1UBKS 1CIVA 4JU9A 1I8TA 1ZPDA 2Q4DA 2QAJA 1JZSA 1RJ9B 3BS4A 5THQA 4PCUA 2PO7A 4E15A 3K8YA 2OO5A 4E1VA 1EZ4A 4WACA 5I9LA 1VMKA 3BSSA 4JUDX 3L46A 4NOLA 4TMYA 1QM5A 1SKYB 2GEKA 1AIPA 1E2FA 3OJWA 4Z9YA 1IEXA 3FPLA 3UAOA 1VP9A 1SVUA 2IIPA 3RAPR 1KO4A 1OWMA 1O9HA 4QJBA 4XJXA 5GJWC 3L93A 5J5CA 4KPUB 4C7KA 1JH8A 7MHTA 4CM4B 3R7WB 2OENG 2I6SA 4JGBA 1WUTA 1JDBC 2QTNA 4WDRA 3AF5A 5JFTA 1AX9A 3PDIA 1E1DA 5I6DA 2ZFUA 4H0FA 1WMDA 4N6GA 3QFFA 4L9AA 4PG7A 4IDDA 5G1PA 1G38A 3I1JA 3GFQA 1XKXA 3AEKB 2C7VA 3U26A 3SSNA 5K3CA 1ODLA 3IJEB 1JHDA 1C3OA 2JIMA 1PSZA 2ZQ5A 4FIZA 5E7JA 2QDXA 1W5EA 3DW1X 3FGOA 1A1VA 5JS1A 3M2TA 1QDUA 2NO4A 3SXPA 5IHXA 2ZS8A 2W2VA 3GUHA 3LXMA 3NM4A 4QPNA 3NHSA 2FRDA 3HC7A 4HEJA 3GLKA 3ONWA 4LPSA 1TCBA 5FR2A 1VMDA 3BB4A 1BHO1 1HH4A 1YE8A 1ZA2A 2R44A 3ZDRA 1YUMA 3ZEIA 5GQSA 1M1NB 1RYDA 3B60A 4B7XA 1Z29A 3FBWA 2OOKA 4UHBA 2C9BA 4H4EA 4QODA 3E7PA 1GPH1 5A6VA 1HV8A 4P80A 4GKBA 2WUFA 2VT6A 4O33A 2BJHA 4TSKA 2AFRA 3EB9A 4HMQA 3W1WA 1FRVA 1ZD9A 4EL5A 5LJLA 3HVRA 4NV3A 3U3MA 2WMYA 1FRFS 1WXHA 2VCEA 2IZ5A 2NOAA 1RHRA 2AUTA 2K4MA 3DDWA 2FPLA 5KSYA 3CS3A 2DUUA 1N5OX 3NIBA 1P61B 3HCPA 3LVBA 4B5LA 2XAAA 2ZR7A 3EMBA 1NXVA 1LXCA 2PUTA 1ODTC 1JLLB 1XEXB 4KQIA 1G7TA 1XXHA 5JNUA 1DG3A 2NUAA 5CT6A 1NVTA 2PQ6A 3GO4A 5AUOB 1XLTA 4S1TA 4S2UA 3ZE0B 2RGAA 3UATA 4I19A 3I8OA 5DNUA 3A6JA 4DJ5X 2AJ8A 3LRTA 1YZQA 3OUUA 4WQMA 3C3EA 4YMUA 2YW2A 4TLEA 1PJTA 2FVYA 4GM1A 1BS1A 5JFOA 5G1OA 1YQWA 1PR4A 4NZ9A 2O0HA 4UXIA 1GUAA 3CUVA 3FPFA 3LYAA 1G8HA 2CZQA 1GGJA 1VSTA 5JVDF 3LL4A 1ZESA 7YASA 1WX1A 3ZV4A 3REGA 4ENVA 1YA6A 4PR3A 2NO0A 1Q2XA 3SYRA 4GE0A 3UV7A 1IMJA 1CUHA 3PKJA 3VR3D 1T1IA 2XNCA 3RSHA 2P4HX 1I6LA 3WLMA 4PSCA 3TZEA 2PS0A 2VF4X 2DC1A 5CFRA 1SIBE 2ZVQX 2C94A 1XV5A 3E1KA 1YB1A 2GILA 2GLUA 4AJ2A 1UC5B 2DFKB 3I2IA 4ATNA 1HE5A 2Z3WA 5JS6A 2NW6A 3ZLJA 1BCRB 2PGJA 1Q15A 2ZUSA 3NXKA 1RPJA 3EEBA 1GXSB 1Q95A 3N2NA 4IJUA 2H16A 4YP5A 4CM6A 4C3ZA 2DQZA 2GN4A 3EVCA 3BPSA 1H3EA 2W7TA 4I6GA 4JLMA 3ZHCA 2OORA 2VJAA 4D6PA 4I4IA 3PG5A 4M88A 3CLTD 4BMYA 1RM4A 4CNBA 3DBRB 4UVIA 1R2QA 2FE1A 5LYJB 5HM6A 3TSWA 1T29A 4PQEA 2C5GA 3WTBA 2ZJ8A 4XVQA 5LZ4A 1K7SN 3MINA 3JATA 3QPDA 2OPHA 5L4SA 2VWHA 2O2SA 1HC7A 3DFKA 1DHTA 1XJWA 1ZNYA 2C03A 3LQFA 2PRJA 5FCDA 4KE7A 4P9NA 2NZVG 4PY2A 5IC6A 3G0CA 4UDXX 1XDUA 3W5JA 3F90A 3RVSA 4W7HA 3ISTA 4QBGB 3WIEA 5FTMA 4QHTA 2C78A 2GAJA 4C3VA 4QVKA 4EJSC 2GPTA 3D6TB 1GQ2A 3R41A 2OLKA 4NCXA 4Q4JA 2Y71A 3CUTA 4KN9S 1DWPA 5EIBD 4FKZA 3NTVA 4B40A 4WOJA 3ZIAA 5AI9A 1SVOA 1GNVA 1OGJA 2R68A 1SHJA 4ITRC 4AD8A 5KWVA 1NC3A 3AY6A 1U0SY 1QZZA 4ZOLA 1WWKA 4IRUB 4NKRA 4WFKA 2VT2A 1H6DA 3EZGA 4GD3Q 2H4XA 2INGX 3R0JA 3U0VA 4EELA 1IBSA 5JZVA 3FLEA 3TVYA 3UG6A 5B4UA 4XB1A 4CU2A 1P75A 3CRRA 4JQZA 3JQAB 1GCIA 2PUGA 3RF6A 3RC8A 4L0CA 4NH4A 3OSZA 2PKWA 1NJFA 1HFKA 3L02A 1ZUNA 3A7EA 3DT8A 3A1EA 3ZIUA 1PJSA 1IM5A 3IAFA 1MO6A 2UKDA 2WYOA 4Q7KA 4CI0B 2WJ6A 2F1IA 3ESAA 3GN2A 2I6XA 4FD2A 4FYMA 1YU6A 3A37A 1YVUA 3JWHA 5B3JC 4P22A 2K7ZA 4BFYA 4FWIB 2IC5A 5BV8A 3JW8A 1LFAA 3J81A 2QY6A 2GYVA 4H4DA 1ZIDA 2D0PB 2H59A 4YCJA 4NBUA 5DK6A 4HEA6 2ID4A 1VJCA 2ZUFA 2F3PA 1MW9X 1EP2B 1GEEA 1OBFO 2QZJA 1YA8A 2R1TA 3AINA 5BR4A 2QG4A 1DKPA 4NU0A 3SX0A 4L76A 1CW2B 2WA2A 3UK6A 3H84A 4E7PA 3RT9A 3B12A 4DA4A 3GG9A 1D8AA 4KI0A 3DTVA 4BQEA 3ASYA 3K92A 1YHNA 2PUEA 3IO5A 2OAGA 2VPYA 4YJFA 4ZI3A 3GJTA 1N8KA 4ZZ1A 4PAQA 2IEZA 1RYFA 4K3UA 3M1AA 2C2WA 3MAAC 4ZRMA 1A8PA 3G6WA 2CDAA 4I3GA 2X3UA 5JQGB 2NAFA 4NBRA 3CTPA 1SXGA 2OL4A 3WG9A 4D9NA 4D5GA 4MCHA 3SJCA 3F6YA 4F0JA 3FHTA 1AHIA 2R8BA 4FMDF 4NBLA 1ZG3A 4CFSA 3NVMB 2IXBA 3IODA 2CB9A 2PA3A 1BOFA 3BAZA 2AZMA 2AC4A 2HRDA 3BMOB 3JQ7B 2EATA 3AESA 3EG5A 3PENA 3QKRB 4PC6A 1RWBA 1UC9A 5DNVA 5EVCA 3B85A 4D44A 2QAGB 2GYYA 1RPZA 4URVR 4P3NA 4CT0A 5T41A 3KU1A 3I5UA 1ZSVA 5JCJA 2W70A 5FUXA 1WCYA 3AF2A 4HFJA 4HY3A 3PFGA 2R66A 4YJGA 1QIDA 1S0UA 4MMXB 2RH4A 4BB6A 1R6DA 1VG8A 1UMCB 1KSHA 3COVA 3K15A 3OPMA 4MUFA 4N65A 5C8YF 3BVPA 3I6QA 2P0EA 4BNVA 1KY2A 2IRWA 1K6JA 2VQEB 1YHZA 2F2TA 2PMBA 1BVYF 3B5JA 2GZ1A 1E3IA 3JQRA 1PR9A 1FE8A 1DQYA 3BWBA 4EJ6A 2AD1A 1T25A 4HNGA 4C5BA 2VK8A 2ZYUX 3G2PA 2RC6A 3O93A 4JFAA 4Y6RA 5HYVA 2AR7A 2V96A 1FQKA 3QMPA 4QT0A 2GFHA 2YYSA 5D87A 3WHLA 2RGCA 2GEFA 1OBOA 1ZKMA 2EJCA 2PFKA 2O5RA 1FNNA 1K7EB 1ZU4A 3FF1A 3GVCA 4MI6A 4QSMA 4S2EA 2QR2A 3WL8A 5HUHA 4XWWA 1E9RA 2GAFA 3BWVA 3HR7A 2ZULA 1C0LA 1NV9A 3FRJA 1LWNA 1X8JA 3L4KA 3Q12A 3B6KA 4U7HA 5WRFA 5LOVA 4CM1A 1AT1A 3ORHA 5CCEA 4LHXA 5AVTA 1UOEA 1JHYA 2WQZA 2P9JA 1QJ4A 4ZPXA 1VJDA 1TO2E 1W5FA 2QRGA 3O7MA 3CLUD 4R4JA 1ZOOA 4DJFC 2V03A 3E82A 5FNVB 4QOIA 3MTAA 5JIBA 2J3DA 3BHNA 2HWKA 1FVOA 2AXEA 1VRWA 1MEJA 1XL1A 1U0TA 2ZRAA 2VP6A 3KOXA 4RU1A 5HDQA 1XYVA 2JJ2A 3I9NA 3OWOA 4P35A 3C87A 5LYJF 3K9FC 2EHJA 1OZAA 1TO6A 5CNIA 1O6ZA 2Z2KA 3EUWA 5E0OA 1V37A 6GPBA 1GLVA 1AKQA 1G7SA 2JIDA 4Y1EA 3EEFA 1I51A 1DL5A 4D4GA 1ZBDA 1Y4UA 3AJ9A 3I2HA 2W6ZA 1ZM3A 4N40A 2PRKA 3I4FA 1KEEA 1YWGO 3MERA 4ZMBA 4KFSA 1H1TA 4PZAA 4QWWA 1P31A 4FBMA 4Q9IA 2O1WA 3R7FA 2B30A 3VDNB 2XQFA 1WZNA 1EHIA 2XMRA 4MX8A 4UFNA 1QE0A 1WMFA 2FZKA 2H3EA 2X6TA 3CSDA 3ICVA 3SU8A 1CJVC 4ZYXA 1JAXA 1U1FA 1N9GB 1T3ZA 1U7UA 3NU1A 1XQXA 4ZARA 3S0JA 3CVUA 1NW6A 1T4CA 1UDXA 2AFHE 2GHTA 4PCLA 5MN4A 3EXAA 1E20A 3WBKA 1F2TA 2UYQA 4QGAA 4HFMA 1S5PA 4E13A 5C3MA 3VMMA 5CA0B 2BKLA 1ZEMA 4NR0A 5E2AA 1QRUA 1K0UA 2HMAA 4MS3B 4NJMA 4U5XA 1QDEA 5G4KB 4BDTA 2A78A 2J67A 5CVVA 4EY4A 1L7EA 4BGDA 1NW8A 2AG0A 3GJXC 1GRNA 2QPAA 3VPBA 3QWAA 1JE0A 1GZUA 2BE7A 5EIOA 3EVDA 4DDVA 3GLFB 4CN8A 4MWEA 1QNLA 2HMVA 2OHOA 3M9WA 1I1QB 3PXXA 3TX6A 4A6XA 5HVNA 1DAMA 5TGTA 3NJ4A 3JQGB 4HAUA 4Z9XA 1M8GA 1B8NA 2CN1A 2CHQA 1CR1A 3HQ4O 4ZVQA 3HB5X 4O2AA 1DS6A 5AIBA 2M2IA 2VP2A 5BSFA 1X8KA 1CRWG 5ALNA 2VJCA 3U4IA 5JCXA 1KETA 1PVVA 4HAYA 5E1BA 4RQTA 1P5HA 2G1UA 3NRCA 3BRSA 3S99A 1BEUB 4B3JA 1N2EA 4B3SB 1K7XB 3A25A 3GEEA 4P83A 1JL3A 4U0JA 4KNVA 1CZHA 4R7TA 1LSJA 5TRTA 3T5GA 2Q8PA 1QF6A 2D3TA 3K35A 2DPLA 3GW8A 1IVNA 4FYVA 3DOHA 1CFZA 4H17A 2JA1A 1EK1A 5BQ3A 3FFAA 4LYYA 5JQGF 2A92A 3QXJA 4B44A 2VUHB 1WF6A 3D8HA 4Q39A 2CJWA 4RLHA 4AWAA 3ZHOA 2JD1A 2P1DA 1V5FA 3F5FA 3GLRA 1X7ZB 3HZHA 4I9GA 1PVOA 3KKLA 4DY4A 5EUQB 2Z08A 1BDBA 3BWEA 3AJRA 4KH0A 1IN7A 3WQSB 3CRW1 2HJHA 3K1ZA 1NBAA 2FSIA 2R7AA 4WH0A 3V9PA 1QTNA 3RHSA 3F46A 3HI6A 4ZAYA 4QUAA 4PEVA 3SD7A 4DF3A 3LW8A 3OUTA 4B0PA 3GQBB 3OIGA 3GWGA 4B3RB 2NG1A 1GA1A 3INYA 2C4MA 4ZXPA 4GMDA 3RAJA 3TB6A 4CDRA 4OTZA 1GPJA 4Z3DA 3PD0A 1DVRA 1XAGA 1HZJA 3AUKA 1U7PA 3FHLA 3QVWA 2JGLA 3OWHA 4OG2A 5I7HA 4HMPA 1PDOA 2C54A 1OV4A 2Z1MA 2CMHA 4C20A 3FUTA 1Q77A 1QR6A 4GYKA 3IMGA 2ERCA 5C7YA 2ZBVA 3K16A 3A6DA 4X94A 3ZV6A 4FT4A 3SYMA 2HFKA 3KWLA 1Q7TA 1YJAA 3B1KA 1SZDA 4M9RA 4AKHA 3M4NA 5GV7A 4DW8A 3H2JA 3IDSA 2Z56A 1S3IA 2XYHA 3TTTA 3GVPA 2P6UA 1UODA 2FZ5A 3HA3A 2VPXA 4X85A 3RB8A 5JYDA 5TGZA 4QDZA 5H68A 1C7FA 2GD0A 1I0IA 2XR1A 4A15A 3JRNA 3ORYA 3W2TA 2P69A 2WK1A 5HDBB 3AEUB 1YD7A 1Z3CA 2GFQA 2HH9A 2C2MA 4LIPD 3TDNA 5JCZA 1L5VA 3CT6A 1JQJC 1KI9A 2BJWA 2BZSA 4K9LA 1R9NA 2Z1NA 2EU8A 2ZB3A 4O4LA 3KKPA 1XF1A 3GF4A 2XKAA 2CL0X 3QU5A 5DHQA 4MCAA 3UT6A 2PS1A 3QF4A 3L8DA 1HMYA 2G40A 4AUEA 4BNNA 5FNVF 1YJ5A 5DYYA 2R7KA 1G0NA 3AFGA 4WZAB 1JYFA 3ET4A 4X44A 2GA9A 1CS0A 1U63A 4CLDA 2X86A 2PJDA 1HDYA 3AHJA 4XH9B 3G6KA 4QE3A 4EO9A 1IVSA 1P77A 2QTMA 4QU0A 3F3SA 2KI5A 1R0BA 4TQAA 4BVHA 3CW8X 4CNQA 4F4UA 1DWQA 1EYZA 2CDRA 2GF2A 2EKBA 2Q5QA 4F3CA 2M6LA 4P4SB 4JQSA 3TQRA 3BCRA 3GLGA 3O47A 5AHXA 1K7YA 2EZ4A 1AK9A 3GJZA 3PVSA 5E9WA 5IXJA 2DUNA 2JEZA 4XPZA 4DCGA 2XOXA 3EDQA 3BDAA 4FGUA 4N4AA 1MAWA 4U2FA 1VG9B 1Y1RA 1ZCAA 2CNKA 2COEA 4NBNA 1P8AA 2I2DA 3I9V1 4NYIQ 5C8DA 5K0CA 2HNKA 4TLDA 4OATA 3BRCA 4HSEA 1NRWA 2IS4A 3NV9A 1G8PA 1KP2A 1IK6A 1NYTA 1UBNA 2VF8A 4RXMA 4WOBA 5EUMA 5TVGA 1ML4A 4G89A 3CZRA 4D3YA 3KAQA 2GJAA 4URZR 1WBBA 4C2AA 5JNRA 1IYZA 3CUKA 3D1VA 4EA9A 5AUQA 2OFFA 1LLCA 3WDLA 1NQUA 3AVYA 1E1MA 1Y80A 3FDXA 4LMPA 3OE7D 4XIYA 5HF9A 1FFEA 3HSYA 1EFVA 3T3MB 3WP1B 1V6CA 3RRNA 1XMJA 1FEZA 3FIJA 3AGQA 2LDBA 4G81A 4PS0A 1P4GA 3I9JA 4ALMA 1WXXA 3P9IA 3NANA 1E1CA 3OPYA 1O54A 4RPLA 1C5KA 1ZXXA 5JXHA 5FI0B 1Z6YA 3Q9LA 1NI5A 1R5JA 2JJ1D 5EE1A 3VNAA 2VP4A 4DOMA 3WRYC 1E66A 1V43A 4RJKA 1VYHA 3CRVA 2DLDA 3D6HA 1U0RA 1ZD8A 2AWNA 2EBHX 2EW2A 2HSZA 3NOVA 3RSQA 3GRUA 4HR7A 4R0NA 3LVFO 4FEEA 1OLXA 4FN5A 3OF5A 1II8A 1KMHA 4LGCA 3LBAA 5D84A 4EAQA 3UJNA 2A9VA 3C7CB 2RMKA 3LFUA 4OCZA 2AC7A 4ZVNA 4HYEA 2ILVA 4F4JA 1DQSA 1OPRA 2CDCA 1DT3A 1MF7A 3L41A 3P9NA 3GNLA 3ZWAA 3Q7PA 3LM8A 5L40A 5KSPA 2X2OA 5JT1A 4HPWA 2K7FA 1C29B 3VR5H 1JIUA 4HDNA 5BV7A 3OD1A 2C8JA 3VH1A 1K86A 2HSJA 3E7WA 5AM0A 3VJLA 2HU8A 1UPXA 3EK2A 4RW0A 1FYDA 3MRVA 5ER9A 4B6EA 5ITVA 3UY4A 3KXKA 1P60A 2PJZA 2B1IA 4EFLA 1ESZA 2WDPA 4CLRA 3X1KA 3M6LA 3PCRB 4K03A 3THOA 3UWKA 5JPDA 1FFXB 4K88A 5CBKA 3RIXA 4AMYA 1BMQA 4C04A 4CRWB 5IS2A 2JJMA 2J7PD 3KUKA 4IGFA 5TS3A 3W5AA 4PAGA 1BA3A 2GPBA 1H0SA 5AQEA 5KNCD 2OCDA 3HDQA 5JTTA 1V9SA 2JIZA 4YASA 4TMTA 5B57C 1I36A 4E2FA 3CKYA 2Z57A 2C1ZA 3ZJVA 4NHOA 4K9OA 5DRYA 1JSZA 5FUYA 3ZHUA 5IG2A 4JBXA 4L22A 3GJ0A 2FK7A 3LX4A 5MFZA 2AKEA 4XYLA 4I55B 2DEUA 2F6RA 1N0IA 4LGYA 4C5AA 2ACEA 3SXJA 3U16A 1AM4D 1BCSA 1PDVA 1QJCA 3GDFA 1IIRA 1CVIA 1DWOA 2FMKA 1KH2A 1M7GA 1TJ5A 5CYPA 2BKVA 4JEIA 1N8TA 1QFJA 5TSDA 4JQOA 3PXGA 3AF0A 3K9NA 3PI6A 4MVXA 4CR8A 4D9BA 5FADA 5KNDA 3BB3A 1TAQA 3LHSA 3VBCA 4OBXA 5LZ9A 1N7HA 2C4VA 4JV5B 2RARA 2VR1A 3AR3A 4OQ4A 3RUDA 4FFVA 1YNSA 2CVPA 5INTA 2BDUA 3VSDA 621PA 1EVIA 5SZIA 3CW2A 3K20A 1FQOA 2ISCA 3NRJA 2C5SA 4IIJA 5CFOA 4TRJA 4AJHA 2O59A 2QUHA 3IGFA 1Y0BA 1CY0A 5LQRA 3WB0A 1PS9A 4BWFB 5KTRA 1F4PA 4TV9B 2VT3A 4RPIA 1ZH4A 3R8XA 2GBLC 4I66A 4G1UC 4J7UA 1KZ1A 4N01A 3P1JA 4ENQA 1IC6A 3L49A 1GARA 5FAXA 2YXEA 3L92A 4EKDA 3SP1A 1CF4A 1QRDA 1W36C 1RHJA 3P32A 3QPVA 3IULA 2XTMA 4BP9A 3KBBA 1Y9EA 1QGUB 2PYIA 3KG2A 4L4SA 3E9RA 1ZEJA 3R44A 1A5ZA 1JE1A 2QUKA 4WKOA 3IFSA 4XTCS 3IHLA 2REQB 3OIYA 4V39A 1USWA 3QBVA 3WZLA 4AS3A 3BTUA 5F23A 3WISA 3QYJA 2P67A 4D1YA 2SHKA 3CCCA 3FZYA 4XKJA 4LXGA 3T1QA 2LBPA 4RPKA 4CEIA 3B36A 4JNKA 2R4UA 1LX7A 1Y6GA 1FNMA 2JZOA 2QWXA 2VNAA 3PCTA 2CJYA 1NJGA 1Z2OX 5ALQA 3V80A 5BYKA 4DB2A 2C84A 3FUXA 2QX8A 3T52A 3R5TA 1NW5A 1FPMA 4KXLA 3VKVA 4YMGA 5IF9A 4LFAB 2ZJBA 3JZAA 2H1IA 5HJ7A 5BQPA 3GWZA 4GAEA 1D0VA 1BWSA 2IZ7A 4ZVKA 7AT1A 3PGLA 4W1PA 2SCUB 2BGIA 1PP4A 4MKFA 3ZDDA 2OMKA 1E2NA 3A4MA 4GWGA 5CIYA 4AUKA 4ZEVA 1VA5A 4DYVA 1D6SA 2YV1A 4G5FA 1WMEA 5C2JB 1XQVA 3MM4A 5JW6A 4RH1A 3K5IA 5K3FB 4IDBA 1D4AA 4Y2UA 4ND2A 2K2QB 3HUEA 1Z0IA 2Q4RA 3AP2A 4XYBA 2BFEB 2H07A 4P3XA 3JYPA 4F2WA 5BPHA 1DC3A 4DV2B 3H05A 4C7MA 1HOTA 4QYMA 2Y1LA 4A6PA 5BMVB 1KXJA 1OA0A 3RKSA 2ZAMA 2PYDA 2WM3A 1AKNA 4MWCA 1QHHB 4YRGA 3OEYA 1WV1A 2J3MA 4I08A 3ZVNA 4EG3A 1M2FA 3P96A 3ELBA 1ZMBA 3L4BC 3HN7A 1AQLA 3K5HA 3EFOA 2NXWA 1MOZA 1PZFA 3JS5A 4X3CA 2G6BA 2ZROA 4UCWA 4R2KA 3BORA 4QOFA 2GNOA 4P33A 4RACA 3DZFA 2LIPA 4U4AA 2YZ2A 5L3RA 5M7EA 3M34A 3OE1A 3F4KA 4PYMA 3ZGNA 4R9VA 1WCWA 4QBTA 1EX1A 2RSLA 5BW6B 3ST7A 2ZYVX 4Y2VA 2QJWA 2OHHA 1W46A 1ZLXA 3LGSA 4ALJA 3BBLA 5TMDA 1BDHA 1H1LA 4Z4FA 1YF3A 5ED4A 4YQZA 2B7BA 1MFZA 2Z2JA 2ZI3A 1Z4OA 3G0IA 3I92A 5C7LO 2VK1A 2WUEA 5K4GA 3U39A 3CHYA 4PX2A 1X7XA 4IWNA 3LWNA 4ZANA 1RT9A 3MSCA 1O5TA 4Q66C 1NX9A 2OQIA 3A28A 3PYMA 3M4YA 4JUAA 2PXCA 2QQ5A 3VH4A 2V98A 1U5BA 1ADJA 5F7OA 4N7BA 1EWKA 3BJZA 3N0VA 1YRAA 5DEOA 2V7GA 1ISHA 1KS9A 2JEOA 1BE8A 1ZOLA 3BMQB 5FFFA 4BVAA 1Z4PX 2VHUA 4KE6A 3K6SA 1WQ1R 2C5FA 2LKDA 4HUTA 3G1WA 5ALWA 3LDAA 4YGXB 2GQ0A 2EP7A 3HR4A 4G2TA 1NJ5A 3OZVA 4PRKA 2FUG1 3U3ZA 2JW5A 4RDIA 2PHZA 2WNHA 3I9MA 5EHXA 5HKKD 4URFA 1NNI1 2B5VA 3QZUA 4ZV9A 2I9PA 3Q15C 4KBGA 3VNVA 3C43A 1E98A 1NSFA 3V8RA 4F06A 5C1BA 3KYCB 5A5FA 1O89A 2E5LB 1XDWA 4ZA2A 1ODCA 3AHHA 4I55F 4CQNA 3HVKA 2EQAA 1FUEA 3DVSX 4N5MA 2Q5FA 1II9A 2QRNA 1Z8NA 3WMRA 5CH5A 4CPDA 1NP6A 1XX6A 3IPRA 4JASB 2MSWA 1FFCA 4H3VA 4HDMA 3ETHA 4H9GA 3UGTA 1KRHA 4I36A 3OETA 2FWIA 4IFTA 4WJLA 3LT5A 2A1UA 2Z9BA 3P9YA 4YRQA 3BFXA 3CE9A 4C4RA 4EENA 4JY7A 1PLLA 3B6EA 4H1UA 2OFWA 4BNLA 1BGXT 1ZWKA 1XKLA 2WB4A 4RKFA 1A69A 3EQZA 4HB0A 3KJHA 3F4BA 3M4XA 4Q3BA 3ZGXA 4F5DA 4NXNB 1NXSA 5LQJA 5EXXA 4H3SA 3C98A 4JGIA 1YGYA 3A1NA 1GRVA 2YXLA 2R5FA 3BWCA 3DR5A 3ETJA 3GZNA 1LX6A 3H6KA 3HU2A 3PZRA 3QX8A 4UAGA 1PEYA 4I4CA 3GIDA 5I9MA 1EA5A 1BDMA 1H42A 2BTQA 2EFDB 2BM0A 2ZI6A 4JIGA 4ARAA 1A9ZA 1V8BA 4WZBA 4DSZA 1WXDA 1XN1A 2MDTA 2Q5IA 3ZKWB 5A2GA 3UAYA 3KYDB 3RC1A 4AZWA 4RZIA 5FBZA 4NNJA 1WCXA 4DDUA 2Z6QA 2Q2WA 5DHSA 3IELA 1KZ4A 4I5DA 5KVQA 3OLYA 1XMIA 3OJOA 2HMYB 4JUBA 4LTNA 4WAUA 5LUBA 1RLJA 1ZYUA 2H9IA 1ECBA 1ETHA 1GYQA 1E6CA 2CDNA 2VHZA 4PICA 3DGEC 4ASUD 1EHYA 1XCPA 4P3YA 1QHSA 2DCUA 2I1QA 2AK2A 3T4EA 4AZ0B 4BMXA 2IHVA 4RD2A 1NVDA 1L0BA 5EPEA 3WDSA 1STOA 5IYZA 3BT7A 1E2HA 1JQDA 1PWXA 4C2BA 4DBLC 1E62A 5EL0A 1K9SA 3ILSA 3KKZA 1XZCA 5F7XA 2NQTA 2UZ1B 1K5PA 2HTFA 3KJIA 2H54A 2QYHA 2WEKA 3PRJA 1QCDA 4ZHQA 3NTRA 4F21A 3I0MA 3FVWA 1C8LA 5REQA 3ZH9B 4JI4B 1B0UA 2OD7A 2VZLA 2DBVO 3B7WA 3CJTA 3WIBA 5EP4A 4B3TB 1BXKA 1DJMA 1C4WA 4KQ9A 5TQVA 2RH5A 4BL5A 2WWXA 1FNBA 1QQ7A 2HNBA 3JYQA 3S2EA 4BQPA 3EVFA 2C7RA 5F5LA 4BP1A 2IDZA 3KQOA 4FFLA 2B1QA 1NZJA 1TW3A 3EIEA 2CLDX 4CEHA 2R1VA 2C0QA 1YI0A 1RYNA 4EUKA 3A04A 3LBIA 1YK1A 3L8EA 3F7OA 3H7IA 3LX5A 6REQA 1KFCB 4LJ6A 1B8UA 1RADA 4I2VA 3ZVRA 2YVUA 3GD5A 2AYXA 3ITKA 1ESNA 1SK9A 2WMOB 3KYIB 4R69A 1IBLB 2FNAA 1TZMA 2QL7A 3BE6A 3T95A 3EPJA 1Q91A 1JIVA 1USIA 1TJYA 2XMBA 3W90A 1ESDA 2EYUA 5BMVF 4FC7A 2O1EA 4B3GA 4M1TA 3UJ3X 5GV8A 3WIDA 1Z7YA 2D62A 1Q1AA 2GVZC 9ATCA 1AXEA 2GZRA 2ET6A 2RGUA 3QEBZ 4MGYR 4Z4HA 3C3MA 2ZWMA 5GMOA 2Y0EA 3C6XA 4DLTA 5JWOA 4RM2A 4I81A 4RLSA 1GPAA 1VG1A 1N2BA 2R00C 3GT0A 3STTA 1VLZA 2W43A 5LQSA 1GYRA 2AZ4A 3GHHA 4WV3A 3SWWA 5BN5B 2FW6A 3EE6A 3MJDA 3ZIDA 3NHBA 3W5BA 2ZM5A 4A8TA 3E9MA 3ZZ0A 1QR2A 2RHDA 2VJMB 4L95C 4E5MA 3E15A 2B1GA 3FHOA 3IMFA 3JCZA 1CV2A 1U8FO 2MR6A 3N2YA 1OILA 4GKVA 4UMEA 2FG7C 3T7IA 3ZGLA 4EB3A 2KJQA 5K2OA 4UD6A 3BEDA 3PV0A 5ALVA 4OXNA 1R9MA 3EG9B 5LQDA 4QVIA 3CVXA 1ZH2A 2ZRFA 3BWMA 3HDGA 3FPEA 4L7QA 4MR8A 1J9GA 3O8BA 3OT1A 4RY8A 4E33A 1HE1C 3ODPA 2B4YA 1UJBA 4JB0A 1TAGA 3LOPA 2X58A 4M1OA 3DEIA 4OXKA 2XQJA 2VZ8A 4ACBA 1W4CA 1PR5A 5G4LA 4MV4A 2PX6A 1Z38A 3N6XA 1SXJB 1RZRA 2CD7A 1ESEA 4N82A 1HT3A 2Q5LA 3E3NA 5DASA 4C4YA 4ZCIA 4CEJA 3PNSA 3F5MA 1Y1SA 2BGKA 2KW5A 1WD5A 4RTLA 1IK4A 1PW5A 3SNKA 3C3WA 3VZCA 5AVUA 4MV3A 2YRWA 1R6XA 3OLQA 1X86B 5IUKC 3N39C 4X7PA 4MVYA 2RDMA 4MVJF 2C07A 4D56A 3RWOA 1IUPA 1HFWA 5TS2A 3KQKA 2CGEA 4M7PA 1NBMD 2HJWA 3A3OA 4L4XA 4KSBA 3ZCVA 1DBIA 2PYZA 1VKHA 1K8RA 3OM1A 3BWDD 1R9JA 5A4AA 1LW7A 4GHWA 3MT9A 4ZIRB 3GLVA 5B7PA 1QVVA 2OC9A 1NP3A 2Q8NA 3MCWA 2FPOA 1G16A 4UJ5A 4YLEA 2FPPB 3M3DA 4GPZA 1XZNA 1JYSA 1Q16A 1Y4AE 1YNOA 2QYOA 4S12A 4NFLA 4HGYA 2IIQA 4O4JB 5CW1A 2XGJA 2HJRA 1K7FB 4MUIA 2IH5A 1CHDA 1NSTA 1VL0A 2CMKA 4KUEA 5B5SA 4POOA 1SOVA 1V6SA 1MXFA 1BX3A 3OA2A 1EBUA 1U9IC 3QLUC 4HGZA 3AJ8A 4O6VA 4D0LB 3DL7A 3A06A 2XRMA 1ZONA 3A32A 2VYCA 3KJGA 4MKIA 3DBLA 5JUWA 3RWMB 2WM8A 4YJ3B 1UDBA 3OT4A 3ZDBA 1R8YA 2RHOA 3HKDA 3SJZA 4GZMA 2XLBA 4QREA 2QR3A 3K9QO 4ID9A 3EC1A 5FUBA 1OHHD 1YQUA 3MMXA 4BVKA 1K1EA 3FNRA 1EMDA 4MJXA 2Q45A 5H9WA 4Q6BA 5B64A 2XECA 2W2LA 3GT3A 3HRIA 5E6RA 5EHGA 2NVBA 1E1RA 1WZIA 2ZDQA 3ZY6A 4ZYLA 2A4KA 2P6MA 4W1RA 1WHTB 1DEOA 1MH1A 1CUBA 2IUSA 1A2KC 2GN0A 2NPIA 3GEGA 3NUZA 3P5BA 2GARA 3QNMA 5EE0A 5J59A 3ZU5A 1Y6RA 2JBHA 3LBFA 5I4BA 2C82A 3BE5A 5AUNB 3G49A 5FA8A 1FDWA 1W0CA 2GBLA 1DX6A 1E7MA 4KMOA 4N8EA 5GONB 4BVLA 4DA9A 1GL7A 4DQUA 2IXGA 2PRSA 1XQ9A 4WK0B 2IXAA 3FWYA 3GH3A 2B4KA 4BFUA 5AKKA 4YAGA 2QZ4A 3U5TA 3B1WA 1W5AA 1L4MA 5F1KA 4AWXA 2I87A 3RHTA 4IMJB 3LY9A 3KJNA 2WMNB 4RKYA 4YROA 4F45A 1YS7A 1H85A 4KSYA 1IBRA 1KAGA 3CH6A 4G5RA 4OGLA 5EKTA 3KHUA 1MJGM 3IESA 4HEQA 3I3OA 4N47A 3SAJA 1WP9A 1BXRB 1B2RA 2FY8A 1PDWA 3O8LA 1RLUA 4YVFA 5H5JA 3W3ZB 4B5KA 1S8AA 1WETA 2PT7A 2GX6A 1RHQA 3MJRA 4AP6A 3U17A 1NDHA 1YR8A 3AW9A 1DNPA 5DI3B 4CT4B 4HS9A 1CJMA 2I80A 1UK9A 4O29A 2XUOA 5IX8A 4X91A 3S29A 1CY7A 5LB2A 3KSBC 5GVSA 1FOEB 1XTTA 2G63A 3B1VA 3VNBA 3AUTA 3ESDA 4MKHA 5EWJA 1PWEA 3QW4B 4RZ2A 1SIOA 2C9OA 3BXPA 2BZ1A 2OGSA 4UHCA 5CRIA 2I54A 4F60A 5BUCA 2MU1A 4F9FA 4ZEWA 1KI2A 3W2EA 4D42A 2GSWA 4TV8F 1RIFA 1JFRA 1KF0A 5CNKA 4GMHA 1TVCA 4P2BA 1JLKA 5TMBA 2VHYA 2VJBA 3AR6A 3PB3A 4UTRA 3U1TA 3GGDA 1AGRA 1RZUA 4AJEA 1CG6A 1RKBA 2ZJ7A 2JFFA 1UPTA 4IO0A 3FWPA 1OCEA 3PJEA 2VDMB 1L5KA 2H6EA 3RVJA 5CG2A 3T4PA 3ROMA 1BWQA 4AUNA 1JVSA 3EUFA 5JZBA 4JEHA 4Q16A 4Y8VA 5FL3A 1V5EA 1CPYA 4I9UA 1VJ1A 3FFWA 4MQEA 3W5HA 5KOHA 4FYYA 5DLYA 4FZVA 3TQQA 2ODNA 4YCNA 1NE7A 2C2GA 2YVQA 4MIEA 3NNDA 2DZDA 3KAKA 1A5TA 1HGXA 1M6VA 1DX9A 1P39A 1CB7A 4BATA 1AMOA 3F5QA 3T1OA 1ZS9A 2IKQA 2QTCA 1L4UA 3FYUA 5HILA 3HABA 4PTLA 5HFAA 2GBCA 1VBNA 1D6NA 2D4HA 4US1R 4JQYA 1VCHA 3EH1A 5C4GB 3DLCA 1Z25A 4OX9B 2RK6A 3MUFA 1M34A 5H59A 2OV1A 2BV3A 2RCNA 2W58A 2XTNA 3MMPA 3MS2A 2P2YA 3ZYCA 1J20A 3H1TA 1BMTA 2AFIB 2QVYX 3UK2A 3GRAA 4A73A 3G59A 2QMEA 3VPCA 3IAUA 3QG1A 3R6DA 4QFCA 3KOZA 5ALOA 3SJBA 1DMRA 3T41A 1DC7A 1BS9A 2AN9A 2I1VB 4H6WA 3A4VA 2PM8A 4I1IA 4JC4A 4MB0A 1OWOA 4QFDA 3JYHA 4TROA 4B3HA 1C9DB