4PVDA

Crystal structure of yeast methylglyoxal/isovaleraldehyde reductase gre2 complexed with nadph
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
342
structure length
342
Chain Sequence
MSVFVSGANGFIAQHIVDLLLKEDYKVIGSARSQEKAENLTEAFGNNPKFSMEVVPDISKLDAFDHVFQKHGKDIKIVLHTASPFCFDITDSERDLLIPAVNGVKGILHSIKKYAADSVERVVLTSSYAAVFDMAKENDKSLTFNEESWNPATWESCQSDPVNAYCGSKKFAEKAAWEFLEENRDSVKFELTAVNPVYVFGPQMFDKDVKKHLNTSCELVNSLMHLSPEDKIPELFGGYIDVRDVAKAHLVAFQKRETIGQRLIVSEARFTMQDVLDILNEDFPVLKGNIPVGKPGSGATHNTLGATLDNKKSKKLLGFKFRNLKETIDDTASQILKFEGRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADPH-dependent methylglyoxal reductase GRE2
publication title Structural insights into the cofactor-assisted substrate recognition of yeast methylglyoxal/isovaleraldehyde reductase Gre2
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 125
structure length 342
sequence length 342
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.265: 3-methylbutanal reductase.
pdb deposition date 2014-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4pvdA00
4XB2A 2YZ7A 4BNLA 3PQEA 4YAGA 4FGWA 2O3UA 1R0LA 3AOEA 5ES3A 1P1JA 3I9OA 4F45A 1EFKA 4YYZA 2FP4A 3ZV3A 1YBMA 5TSDA 4IGEA 4G2NA 3ZU4A 4DMLA 4CLHA 4IS2A 1FDSA 2GASA 3CSDA 4QSMA 5EINA 5IDQA 1A7KA 3GG9A 4CQMB 4ZHSA 1E6UA 1E7MA 1H6DA 4ALNA 4ALKA 3WGOA 2Z5LA 1HL3A 2EKQA 4JJIA 3KLMX 2V6BA 2DTXA 1LSUA 2VNSA 4DQVA 5KJ6A 2ZCVA 1Q2XA 1L7DA 2SCUA 4HBGA 4JIGA 1M75A 4MJLA 1C1DB 1C14A 3H9QA 1P0FA 1SZJG 1UAYA 1H6AA 1VJTA 2AEJA 2FZWA 3PLRA 4IXTA 1GADO 3A9WA 3B70A 3OA0A 4TROA 5A9SA 1ZK4A 4BQRA 3IL2A 4PZEA 1JKIA 4F46A 1LEHA 1JWBB 1NWCA 2OMEA 4LRSB 4UUPA 4YAEA 5B4TA 1WVGA 2I3GA 2NU9A 3NX4A 4BO6A 5ICSA 3GA0A 1YE3A 5G0SA 1DIRA 2O4UX 1EK5A 2X0RA 3WFJA 4EYEA 3R3SA 2AQ8A 1A4IA 1HEUA 1LBEA 3NGXA 4E5NA 2DUWA 2GF2A 4PLTA 2JFHA 7ADHA 3AUTA 3H2SA 4IUYA 4FCCA 3TOZA 2C29D 3DTYA 4OYRA 1VI2A 3L6EA 1LLCA 3O26A 4FS3A 4WOJA 3RASA 5CP8A 2BMAA 1DB3A 1HDYA 3IQDB 5JDCA 3GHHA 3HDQA 3HJAA 4DPLA 1U2DA 1E7QA 4LGVA 3KXDA 2PH3A 4CLOB 3CIFA 2G0TA 1N1EA 3C24A 3P2YA 5JCJA 4DTIA 1JAYA 3WGYA 4EJ6A 4RF4A 3DBLB 3GN1A 3KZVA 2X0JA 3O03A 4LVUA 3D4PA 2PK3A 2VRCA 4YJGB 4O63O 2NTJA 4WNIA 2A9FA 1WPQA 2VHVA 1UXJA 1GU7A 4W82A 1AXGA 2D0IA 2ZKLA 5DBGA 3UN1A 4OQYA 3FBGA 3ZZNA 1PGPA 1N7GA 4J1NA 1ID1A 3JQGA 2UVDA 4IZHA 2E37A 2X5KO 2C5AA 2PFGA 4GX0A 1YRLA 1DC5A 1YOVB 3I4FA 1A72A 4WASA 3L6DA 5A06A 1E1MA 4GBJA 3BTSA 3ST7A 4PLGA 1GFSA 3U4DA 4MKXA 2IRWA 1HETA 2YYYA 2E82A 3K96A 1NVMB 1PQWA 3WG9A 1ORRA 5EERA 4O5OA 4I5FA 4IGFA 1P45A 4CM5A 1ENYA 3QSGA 3R1IA 2I6TA 3UXYA 4Q3NA 5I8WA 2AHRA 2WWRA 3S1LA 1I3LA 1EQUA 3JQFA 5IZCC 3MOIA 2BLLA 1N9GA 3FPCA 4TRNA 1Q7CA 3RWBA 3H6KA 4NJMB 1KC1A 4RVGA 1YONA 1BVUA 2ZB3A 3KTDA 4RZIA 4U5QA 4R41A 3CMMA 3FNEA 4K26A 1G1AA 3WMWA 2E6UX 1SNYA 4XGNA 5G4KA 1KY5A 2V7PA 2PNFA 3A1NA 3OJOA 1HWYA 2QYTA 4Z0HO 4OIMA 1HYGA 1CETA 1FDWA 1P1IA 1SEVA 4DRYA 4F3YA 4R9SA 1BGVA 2CF6A 4MOWA 1QKIA 4YAKA 4BNXA 3Q2IA 3SJUA 2QIOA 2FRDA 4OXNA 1EUDA 2V65A 3ZWPA 2EW8A 4AJIA 4PG5A 1KVSA 3GMSA 1LQUA 3W8EA 3NV9A 5GY7A 4MIOA 1NPTO 5COAA 2VWHA 4J0EA 1CEQA 4L75A 6ADHA 3TF5A 2AEMA 1WZEA 3BAZA 4CL8A 2BF7A 4FBGA 1K6IA 1U3UA 2BI7A 5JFOA 2E49A 3V1YA 4O0LA 3L4BC 3RUAA 2O3SA 2EERA 5T8KC 4CQMA 1ZVMA 3OJ0A 4GSKA 1IULA 2W98A 5L4NA 1NQTA 1ISMA 4NHEA 1QV6A 3VC7A 3KEOA 2ZB7A 4ALMA 5BSEA 3JQBC 2OO5A 4ZU3A 5JO9A 4DUPA 3ITKA 4D0RA 3PP8A 1ZCJA 4AJ4A 3ICPA 1UR5A 4EI2A 3QWHA 1RKXA 2HMTA 2EGGA 3E9QA 4NBVA 1PR3A 5DF1A 4JGBA 1EQ2A 4YT4A 4RVDA 5ENVA 1V6AA 2Y1GA 3H5AA 3VKVA 3NT5A 1PX0A 4U0KA 3V2UA 3KEQA 5EPOA 3HDYA 3O8QB 1WAMA 3I9MA 2Y0DA 3BMQB 1HE2A 5B12A 2QYSA 4LMPA 3H5NA 3H9JA 5KCZA 1Z82A 1BWSA 4QEDA 9LDTA 2NLOA 4ILKA 1ZXLA 2OGUA 3KSDO 3ZWBA 5HBRA 3OICA 4UVHA 4RF2A 3E1KA 1YXMA 3QE3A 4RPGA 4MKZA 1DJNA 1KEWA 4DQXA 3MJ4A 4J1TA 1KBZA 4QX6A 1E92A 1PJQA 3H9EO 2VWPA 3B20A 2Y1FA 4CLOA 4QECA 1YB1A 1B15A 3OETA 3JYPA 3PK0A 2XPCA 1AHIA 3H3FA 4D41A 1DXYA 3LC1O 4YJGA 3WYCA 1R6DA 3QY9A 3EYWA 5CG1A 1CQJA 4Y8VA 1PIWA 3LYLA 4XJSA 3KSUA 4MINA 3ONEA 1U3VA 1ZJZA 3BMCA 4P4LA 3MCVA 4BNYA 3DZFA 1A9ZA 4WCFB 2IEBA 3RU9A 4D44A 1IPEA 5TC4A 3ZWXA 2VYNA 3ZV4A 3AY6A 3BIOA 4B79A 4WLNA 3AM4A 3FHLA 3INRA 4GX2A 4ZJUA 1P31A 1YVEI 1YOVA 2RBEA 4OM8A 3E48A 3BMNB 3GPDG 5BQFA 1Z7EA 2VHZA 4OHUA 1E0DA 4NK5A 4YRDA 3RVDA 3PWKA 2PTGA 2JD2A 2JFGA 3UW3A 3INTA 3VH4A 1F8FA 3GUYA 3QVWA 4ZGWA 4BNVA 4CV1A 1I2BA 1TLTA 3WGIA 1QXSA 4WLUA 5B4UA 3TZQA 4XYLA 2H1SA 5JPIA 3O38A 5IJZA 5JAMA 4EUEA 2HSDA 2GYYA 4I9UA 1F14A 2C54A 4NJMA 4CUJA 1E77A 3RBXA 4NQZA 4RVUA 4Z9XA 1PZGA 1GUZA 1LDEA 2D5AA 2AMFA 1LQTA 3JD0A 4A27A 2Q1SA 4AG3A 3OEYA 4B4VA 3VH3A 4RORA 1JQBA 4BVAA 2FHSA 5KTKA 3JD4A 2D8AA 3KV3O 1PL8A 4D3FA 1LDYA 1UXKA 3MEQA 2B4TO 4FFLA 5KNLA 3AOGA 3U09A 4B8ZA 1QYDA 1PU2A 1ZSNA 4E5MA 4FDAA 2NU6A 4O59O 3BHJA 2AG5A 2VUSA 3IKVA 4FD3A 3ANNA 5DN9A 2FSVA 3WNVA 3N7UA 3F1LA 3DZJA 2HMUA 4NR0A 1U28A 1VKOA 4U0JA 1PZEA 1UP7A 3FI9A 5KVCA 5DBIA 1EK6A 2JHFA 2J5KA 5TLSA 4TWRA 3OSUA 1MP0A 1GUYA 4LISA 2H63A 1LNQA 2DBRA 4AJ1A 4DYVA 4BO4A 3E9MA 1RWBA 1X14A 4CM1A 1KYQA 2IEDA 2NNLD 4NNJA 2GRAA 3WYEA 4RV9A 3H3JA 3CUKA 2GDZA 3IMFA 3AUAA 3W4JA 2J3IA 3GNSA 4XWYA 3QWIA 4L9RA 3ZWVA 4J7CA 1IZ0A 2C7VA 2DPHA 2Q45A 3F6YA 4J91A 1EEHA 3HQ4O 4J3FA 2P4HX 1E3EA 5DNAA 4UEOA 3MJVA 1Z45A 4ND4A 4MP3A 1OBFO 2FR8A 1MB4A 2GZ1A 4OKNA 5I9LA 1C1XB 4CR8A 3OJEA 4XIJA 2PZMA 1I3KA 3GLQA 4I8XA 4A7PA 3O8QA 5KIAA 3UOGA 4AJPA 3BMQA 5G0WA 3WXBA 1TVEA 2GZ2A 3S2GA 3VZQA 2PZJA 5TNXA 5CEJA 3GEMA 3DOCA 2CF5A 4KP7A 3RFTA 1Z6ZA 5AQ1A 4XDZA 3I23A 1LXCA 4EJMA 4BNUA 2X9GA 3RCBA 4IINA 1N7HA 3QP9A 3JV7A 3ZWNA 3ONFA 4NZ9A 2WTBA 1LDNA 1PZFA 1SEPA 3D3WB 1TA4A 2Q1WA 4GVLA 3DR3A 3NTOA 1PWZA 2GO1A 3I9LA 3WJ7A 2PZLA 4DBVO 4GWKA 1LDMA 4RQUA 4ZQEA 2X0NA 5COBA 1ML3A 3LK7A 1ZK1A 3LT4A 4OSOA 4GWGA 4Q3BA 2DQ4A 4BS9A 4ZQHA 4Y9DA 5DBFA 3WIEA 2ZTVA 3KRTA 3IDSA 4XB1A 4ZQGA 1I2CA 4XCVA 4DBZA 1BXGB 2PV7A 4DLBA 5KJ1A 1P74A 3GZNB 4WCFA 1F8GA 2V6MA 2E48A 4E4YA 3KYDB 4CM6A 4CMEA 5CDTA 5T5QA 3PPIA 1ZUD1 4KOAA 4RVHA 2O4CA 4ND3A 1JVBA 1VL8A 1SMKA 2H9IA 1C3VA 3ZN2A 1W0CA 4UUNA 3IP3A 2BD0A 2AQKA 4PFJA 4IXWA 1HKUA 4MKRA 1GQYA 3ETDA 4YPOA 3BMNA 3D4OA 3VH2A 1Q7BA 4KDEA 1T1SA 1B3BA 4YJDA 1ZZEA 3W4IA 2D59A 3PVZA 3ZHZA 2FN7A 1WWKA 5JC8A 3CPSA 2NUAA 3IUSA 1LI4A 2DKNA 3WJAA 4JNKA 1L7EA 2C82A 2Y05A 3K30A 3IAHA 1U2GA 3EVNA 1OI7A 3HG7A 3NUGA 2HRBA 3C7CB 3KOUA 4XEHA 1D7OA 1V9LA 2XF8A 3MWEB 3NTQA 4GX5A 1I5RA 3WX0A 4IJUA 4YCAA 5JYEA 4Y6RA 1CRWG 3TRIA 1H94A 1XYGA 1VJ1A 4E2ZA 2Y67A 3B1FA 4N5NA 4N5MA 1HLPA 1VPDA 1YJQA 2P4QA 1UDBA 2EF1A 3NJ8A 4XX0A 4CUKA 1DFGA 3ETEA 3L0DA 4K6FA 5KJFA 1B0AA 2O3JA 2RHRA 3EUWA 1GD1O 1XQ1A 5JDIC 1NBOA 1E3JA 1ADFA 3T7CA 4PLYA 2DPGA 1FDTA 3LT1A 3RROA 3SJ7A 4BGEA 3IUPA 2IYOA 1VC2A 4E2XA 1FJHA 1D8AA 2AE1A 3Q9UA 3RBVA 3NT4A 4R68A 5AYVA 1M6WA 5TIIA 4NBTA 4BO7A 1HXHA 5EN4A 2OORA 5TRTA 4D79A 1JDJA 3WGTA 3JYLA 3ROPA 4XIYA 3RJ9A 2GZ3A 3VPXA 2CVZA 2WE7A 3SC6A 3JQ7B 5FFFA 4YBZA 2J6IA 4YA6A 5F1KA 4YJHB 1A27A 3W1VA 4D7AA 4BB5A 2VWGA 4UREA 3ZV5A 4UVDA 4OQZA 4I5DA 4FIZA 1MX3A 4JLWA 1QORA 1T2DA 1V3UA 1F17A 1YB5A 4OO3A 1NQAO 1XCBA 2EEZA 4PLVA 3Q3CA 2Z1MA 1U7TA 3F3SA 3MOGA 4LMRA 3JSAA 1Z75A 2OBNA 3C7AA 3I5MA 4GLOA 5A1TA 1VE9A 4MVJI 4BO1A 5ER6A 4RGBA 2VOJA 2J3JA 1UUFA 2Q4BA 1NAIA 4YDRA 1JKFA 5DT9A 3PZRA 3NYWA 5JCXA 3VAZA 1IY8A 3DC2A 2W2KB 1V8BA 3PDUA 2X0IA 4JROA 2PWZA 1E3LA 3NTRA 5ITWA 1XIVA 4CLXA 3WSVA 1W6UA 2JAHA 1R4MB 2G1UA 3G1UA 3MJCA 1GYQA 1YL5A 4AJKA 3CXRA 4NFHA 3UH1A 1AXEA 1C1XA 5EL0A 5LC1A 2B35A 2R00C 1Y8RB 3GNQA 3DMYA 2NTNA 3KO8A 3BTVA 4FJ2A 1FDVA 1B14A 2ZQZA 1BVRA 3AWDA 4DLAA 1Y8QA 4FJ1A 4FGSA 4O6VA 4GMFA 1YL7A 3VKUA 2D1YA 5T67A 3CZMA 2DBQA 5TGDA 3G49A 2NTVA 4BOYA 4YACA 4BUCA 2Z95A 3DDNA 3OIFA 4X54A 5G0TA 4AL4A 3ADPA 2G76A 2YQ4A 3A06A 4JQCA 4A03A 1H0KA 2WYWA 4IIUA 5A5FA 1SB8A 1DOHA 5TQVA 4INAA 2AQIA 4BO2A 3PHGA 2ZJ1A 1QR6A 4RPJA 2C0CA 1ADGA 1V35A 2DTDA 2UYYA 4ZVVA 3PWZA 3ZCXA 2X9NA 3E5MA 3L77A 4K6CA 4B3IA 2GSDA 1JLLA 3U4HA 3NRCA 3UCXA 3U4CA 3ZU3A 1SAYA 4PLCA 5I7VA 1UH5A 1I3MA 1G6KA 5I7SA 1BXGA 3LVFO 1P3DA 3RU7A 2OUIA 4BV9A 1YB4A 3PJGA 3KYDA 4RPKA 4QO8A 4YTEA 1P44A 3OEWA 2R6JA 3QHAA 3DAPA 3IP1A 1LRLA 4DL9A 1MG5A 4CM9D 5THQA 3SX2A 1U7HA 2IXAA 1NQ5A 4M89A 4KZPA 3H4VA 4EBFA 4C7KA 5CEEA 1NHWA 3OA2A 1WLYA 4AJNA 4M1QA 4BKQA 4OSPA 4YR9A 3PFWO 3RC2A 3ZW8A 3WNQA 1XA0A 3OFSA 5JNLA 4HX5A 4Z6KA 2ET6A 4WLVA 2P91A 3NGLA 1UP4A 2B83A 1NPYA 2CUKA 1GV0A 4E21A 3LLVA 4KUEA 4Z9YA 3GT0A 5TX7A 4E2YA 5BSHA 1HTBA 3AOEC 5IFLA 2Y0EA 5G4LA 3H8VA 3JYOA 4XR9A 4B4UA 1O6ZA 2J3KA 3HDHA 2VZ9A 2PD3A 1LX6A 4YVFA 3LC2O 3WMXA 3KB6A 3FNHA 4XGIA 1YDWA 3Q6IA 3U0BA 1H6BA 4E5YA 1YKFA 1N2SA 2OP1A 5IAAA 1U9JA 4OMUA 3LQFA 3G0OA 4ITUA 4HFMA 1ZK2A 4I08A 1DEHA 2JCXA 3DBVO 4JBIA 3T7EA 4WE3A 4HP8A 1HE5A 4MP6A 3GFGA 3V5NA 4IDBA 2EGHA 1KC3A 2PR2A 3WWYA 3WB9A 2QZ9A 1IZ9A 1DPGA 3U5TA 3ZU5A 2PD6A 1MGOA 3C1TA 3PGJA 5L4LA 3ITDA 2HK9A 1K5HA 4IZIA 2GR9A 3OJFA 4XJTA 5F3RA 1QSGA 2VCYA 5JY6A 3AI3A 4YJHA 4M54A 1ISGA 2FZEA 3FD8A 1Y81A 4UVIA 1YWGO 3A14A 5DCUA 3I9NA 4CLEA 2NQ8A 4LVCA 1GPJA 1YO6A 5U1PA 1NFQA 4MVJG 1P1HA 4XQEA 4WLEA 4NBUA 5TT0A 2Y1EA 1XLTA 4CMGA 1ENPA 4TVOA 1N92A 5A02A 4YXFA 3GAZA 1PJ4A 5JDCC 4DWVA 2AQHA 1P9LA 3JQ9A 4PG7A 4BGVA 4Q3DA 1XU9A 3RKRA 2NACA 4PG4A 3O4RA 4L4RA 3WYBA 3EY4A 4IY1A 3COSA 1UZNA 4Q39A 1XELA 4AICA 4CPDA 4PIVA 3QWFA 1IYZA 3N58A 5I9NA 1E7SA 2NVUB 2W2KA 4ID9A 3D4NA 1UXIA 4R69A 5L7YA 4BV8A 4GAEA 1PTJA 3VPFA 4Y98A 1R4MA 1QYXA 3QRWA 1X13A 2GN8A 1R4NA 5GZ3A 5A3VA 2HMSA 1I0ZA 5L51A 3JYNA 3R0IA 4J9UE 1LSOA 1KEUA 2BFPA 2VYVA 1ISFA 1ZEJA 4UVEA 1Y8RA 4E12A 1BG6A 1JU9A 4OH1A 1Y5MA 4QUKA 1MV8A 3QLJA 4M55A 1FF9A 1E6WA 4FQ8A 4PVDA 4RVFA 3U9LA 4C7JA 4KMSA 4NU6A 4DLLA 1RM5A 1X1TA 1GY8A 2J8ZA 3SLGA 2HUNA 2H5LA 2PH5A 2ZATA 3GZ4A 4OOFA 3CE6A 5CDYA 3NT2A 1PJTA 1RM3A 1RM4A 1XGKA 5FI5A 3WQSB 3QIVA 3B1JA 3S2EA 2TMGA 2AE2A 1ISHA 4AVYA 3C1OA 2GUGA 2PGDA 1D4FA 2CSUA 1Y5RA 3HZZA 1ONPA 4CQLB 3B1KA 4ZA2A 1WDKA 1SB9A 1ONOA 4U6SA 4WOKA 5I9MA 1PJBA 3ZW9A 3GAFA 4B4OA 2UDPA 3JQFC 2O50A 3HB4X 1A7AA 5COQA 4A26A 3GVPA 1V0JA 2VNAA 4LCEA 1DO8A 3MWDB 4QO7A 3RJ5A 4MO2A 3WICA 5HS4A 3A4VA 4K1LA 4YB8A 5KKCA 4IDAA 4PLHA 4PZCA 1C1DA 1JWAB 2I3AA 2ZQYA 1ISJA 3UHAA 1M66A 4GLLA 4RDIA 3ORFA 1M2WA 3HFGA 4W99A 4BNKA 4TQGA 1V3TA 2P2SA 2YFQA 4E30A 3DHNA 4RO0A 1D3AA 3VPHA 2NWQA 1LDGA 1J5PA 3KYBA 2GN6A 4CM8B 1BRMA 4XD2A 2HAEA 2YV3A 5DOVA 1KVQA 1NM5A 2ZTLA 3KSZO 4H15A 2HJSA 3RC7A 2BHLA 5J23A 4WLFA 3QJ5A 3JQ6A 4ND2A 1PJSA 1JKJA 4AJEA 1P77A 1CERA 1NX6A 4HKTA 4DVJA 1CYDA 4OXYA 3HHPA 3NEPX 3LU1A 5TJ9A 3IJRA 2VRCD 2X58A 4AJLA 3EZLA 1YS4A 3JD3A 3GGOA 1ZW1A 4PGFA 1H5QA 3RQSA 2BGKA 4PLFA 1UJMA 3PHHA 2HKIA 1AGNA 3BA1A 4DGSA 2J3HA 1PGOA 4C4OA 5IDWA 2DFDA 1DDOA 3RUHA 4BMVA 3DBLA 4FN4A 3UGKA 5JO0A 3ZHBA 2O7SA 4R3NA 1LRKA 3HNPA 3PWSA 5FEUA 5CPFA 1W8DA 1UDAA 3WLFA 1SPXA 4BNGA 2VZ0A 3KLPX 2QX7A 4IQGA 1X0XA 3I9KA 1QLHA 1R66A 1WDLA 4Z0TA 2EG9A 3DQPA 5AXAA 1OFGA 4HADA 1KERA 3O9ZA 2EP7A 1NR1A 5CPBA 4BGUA 5KWEA 3PQFA 4QTZA 3HN2A 1Y1PA 1ZKMA 1U5AA 1L1FA 5C7OO 4FFMA 1ULUA 3GGPA 1U4OA 3ZI0A 2GCGA 2EKLA 3CH6A 3GPIA 1PS0A 3PHIA 4S1VA 1DFHA 4XKJA 2WDZA 3TL3A 4DPKA 5JS6A 1HDZA 3ASVA 3UCFA 1F06A 3SVTA 1ZXBA 4YT8A 4DPMA 2BFMA 3GVHA 3LLSA 1ZIDA 4CODB 3LSYA 5KVVA 4BO8A 1B2LA 2ZB8A 5L45A 5JYDA 4J49A 3WGHA 3GDFA 1ZEMA 2DU8A 1BXZA 3GHYA 5CDGA 5KJCA 2O3TA 2QRLA 2B36A 4JN6B 1T1RA 3C8MA 3ZHYA 5C3MA 4YRAA 4OXKA 1SOWA 3ULKA 1DAOA 1LLQA 4P8RA 1DIBA 4D0SA 4YQZA 4AFNA 2J5RA 3ABIA 4TSKA 4YJFB 3FF4A 2V6FA 5DP2A 3CMCO 1ARZA 3M2PA 4IMPA 4MVJM 4R5HA 3TNLA 1NNUA 3FNFA 4JP2A 1U8XX 4XYBA 3DB2A 2HO5A 1PQPA 1HRDA 2PLAA 2Q2VA 4II2A 4NIMA 1ADCA 4W9NA 3EDMA 2YUTA 3U49A 5BNIA 2Y1CA 3D5QA 1DLJA 2VHXA 3EVTA 2ZYDA 3QQPA 3IKTA 3E82A 3B6ZA 2VT2A 4Z3KA 1GL3A 3LZ6A 4OL9A 2QQ5A 1J0XO 3M1LA 4NI5A 5AXDA 4N5LA 1XU7A 4J4HA 2BI8A 3RBZA 1I3NA 3PZBA 5C7LO 4TRMA 2W4QA 1AE1A 4MVJH 2X8LA 1LA2A 2IZZA 2FR0A 4L4XA 1T24A 3EC7A 4OAQA 1EUZA 2CNBA 1GV1A 1PSDA 1HDGO 4L4SA 2DT5A 1ZMTA 4OGWA 1YL6A 1UAGA 3D3EA 2EJVA 4HFJA 4J90A 5A3JA 1UP6A 2NU8A 1GQQA 2DAPA 5L53A 3QVSA 3PXXA 3VDRA 1YJ8A 3AI2A 4CV0A 1DC6A 5F21A 3ASUA 5CAEA 5DOZA 1ZK0A 1H93A 3K5PA 4RPHA 5B4VA 3RUIA 4NFSA 1HSOA 4PLZA 4A5OA 5HTOA 4BHTA 3GK3A 3ZNNA 4QQRA 1YQDA 4KTTE 4CLDA 1P1KA 2Z1NA 5JAIA 1NPDA 1PGJA 1ZSYA 3PYMA 4UEKA 2LDBA 3EZYA 2J5QA 1N8KA 3WWZA 4HFNA 2F00A 2P9EA 4FSHA 1NTOA 4HXYA 3OBBA 2X6TA 4FPXA 3HUDA 2IZ1A 4CMHA 4CM8A 3ETGA 5LDHA 2E4AA 3DAFA 2P5YA 5DCYA 1HZJA 1B26A 1EFLA 1X7HA 2V6GA 4RPLA 5KKAA 3E6AA 3F46A 4LK3A 1N1GA 4WKGA 1HT0A 2YFHA 3HE3A 2FSSA 3H5RA 4NU5A 1LTHR 4O1MA 1MLDA 2GD1O 4GGPA 1ONNA 1UZLA 1DHRA 1B3RA 1GDHA 4ZRMA 3TOXA 4CM4B 1ZSVA 3AI1A 1SOVA 4BQPA 3IS3A 3P7MA 5I7FA 1NHGA 2DVMA 1P1FA 1PQUA 4BO9A 2GN4A 4JCOA 4K28A 4BKRA 3IIEA 3DZIA 1Y9EA 3OQ1A 4IPTA 1TEHA 5TT1A 1I10A 3FTPA 3F9IA 1VLLA 3GDGA 4BKUA 4NH4A 4CMCA 3RKUA 4WPGA 3AK4A 4I1IA 4CLRB 3EAGA 1PL6A 1W4ZA 2RH4A 4ZN6A 2DTEA 4RLHA 2ZJ0A 3X2EA 5ENDA 4RDHA 1R15A 5MGBA 4GL4A 4ZICA 1AHHA 1T25A 1FMCA 4TRJA 4LSMA 3Q11A 1BHSA 1J4AA 4ALLA 1U5CA 3G79A 3PJFA 1E5LA 1PR9A 3C1AA 3DZKA 2EKPA 2ZCUA 3ZU2A 1E1KA 3AY7A 4IDGA 2VHYA 3GH3A 3E18A 4HV4A 4E31A 3GC6A 3W6ZA 5T57A 5F5LA 3A28A 3ZH2A 4GQAA 4P4GA 4XZ3A 1MFPA 4PZDA 2O2YA 4HNHA 1E3SA 4BNZA 1C0LA 3JD2A 1EVZA 4IS3A 2R2GA 1PWXA 4U7WA 4KWIA 4MP8A 5H83A 1EE9A 3I3OA 2GNAA 5JC1A 4IMRA 4IBOA 2XXJA 4FB5A 2OOSA 3VZRA 5A9SB 1QRRA 1XDWA 1ENOA 1JVSA 2JFFA 4ONEA 4XGKA 1EZ4A 4YJFA 4MPDA 1JN0A 4F6LA 3L6OO 4NMHA 4UUOA 4IDFA 3ZWCA 4UAGA 2EWMA 3OM9A 1G0NA 3BHMA 4BIIA 3GGGA 1R16A 1FXSA 3AY3A 3UICA 4EUHA 5IXSA 3ZNPA 4CM9A 4JP3A 1C0PA 3BXXA 4ND1A 4E33A 3DOJA 3GUCA 5JE8A 2F1KA 1TI7A 1X7DA 1MFZA 1R12A 3KYCB 4R1SA 5GZ6A 2TMDA 3HN7A 2BGMA 2O3QA 4WCFC 3FRJA 4LW8A 1LC3A 2RHCA 1HSZA 4CMEC 2Q1UA 5H81A 5C5IA 2G17A 4R54A 3L4SO 1LDBA 4U6QA 3UCEA 3BYZA 3TFQA 3RSHA 3V1UA 2X22A 3DMTA 3GRPA 4LCJA 4R1NA 4BNIA 4AJHA 4Z3DA 2DM6A 3LT0A 2RH8A 1D1TA 1GEEA 1Q0HA 3JQ8B 3HFSA 1J6UA 3WQQA 4XYEA 5L7TA 2A4KA 4FW8A 3ROMA 5L4SA 1CWUA 4EZBA 3PLNA 1ADBA 1X15A 4OJNA 3OMLA 4WGGA 3UKOA 4TMFA 3E8XA 4DC1A 1WMAA 2AXQA 2CDBA 3ENNA 3PYXA 4L0QA 3W8DA 4IQ8A 4EEZA 2B4RO 5K6AA 1ZNQO 4XA8A 4B4WA 4J7XA 1Y7TA 2FPIA 2Q50A 3EHEA 3MTGA 4RLSA 2IODA 1X0VA 4CR6A 3FR7A 1GZ4A 1OAAA 3PEFA 1U3TA 4QFDA 3X2FA 3GG2A 1LRJA 2P9GA 5F1OA 1LLDA 4H7PA 3H9GA 5ILGA 2ZIZA 3ONDA 4JBGA 3DBHB 3RUDA 5JXWA 4E0BA 4KUGA 3FWZA 4IDEA 2P9CA 2BRUA 1SCUA 1Z74A 5IN5A 4EUFA 5FWNA 1KEPA 3WFIA 5BT9A 4CV2A 4TKMA 4WEQA 3RFVA 4A10A 3FPLA 3F4BA 1A4UA 3PHJA 4P38A 3ROKA 1Q0QA 1WW8A 4YQYA 3K31A 3ZWOA 2C2XA 1U3WA 1T2EA 4NFYA 5IDXA 3NDJA 3R3JA 1HE3A 4AJJA 1YQGA 2DUUA 4Z0PA 3TZHA 2QZZA 5DP1A 1WMBA 1UXHA 1T26A 4F6CA 4CM4A 1ENZA 2XOXA 2WD8A 4MVJD 3TDKA 1K6JA 4HWKA 1VM6A 2YJZA 2ZYAA 2X23A 1AUPA 3OIGA 4R4JA 3Q0EA 3ZDFA 5A9TA 1DSSG 2X7HA 1VRWA 1WNTA 3CZRA 3D3WA 3RFXA 2I76A 1IHXA 4YT2A 2WSBA 2D5CA 1Q0LA 1M6HA 2Q2WA 2Q99A 4DIBA 2OZPA 1LLUA 3L9WA 5U9CA 3ZWYA 4ROSA 4AJ2A 4D46A 2C20A 3D5TA 4CLRA 5JAZA 3I83A 4NBWA 2BGLA 3ZWMA 4K9DA 1GCUA 2WD7B 3AU9A 4E5KA 2I65A 4CMKA 2Y99A 3ZNOA 4JBHA 7MDHA 2HK7A 4H16A 3DZGA 1ZMOA 3JQAD 3MJTA 1DAPA 1DBVO 4UUMA 4AJOA 4RJTA 5L40A 1O89A 3GZNA 4J1SA 4BKPA 4HUJA 3VZPA 4RL6A 1WP4A 2G5CA 3TSCA 1DC4A 2XXBA 3VPGA 4DA9A 2FMUA 5L7WA 2JHGA 4XQCA 2RCYA 3BMOB 4E6PA 5EJ2A 5JLAA 1EMDA 1E3IA 4E2WA 1Z73A 4W7HA 5KJEA 4GI2A 3W4KA 3V2GA 1HF3A 1DIHA 1IL0A 3F5QA 4XQGA 2CFCA 1H9BA 4YAIA 5A04A 4PG6A 2PGJA 3DEYX 1VJ0A 5EMHA 1XHLA 1KETA 4FC7A 1GTMA 4RF5A 3WR5A 3WTCA 1A5ZA 3OH8A 3FTNA 1HZZA 1PS9A 1GQ2A 3AJRA 3NAQA 3ZHXA 2NSDA 1VKNA 2FPPA 2I9PA 4J6FA 5JAQA 1YH3A 2C7GA 3K92A 2DC1A 3VPSA 5ICMA 1YBVA 2CDAA 3PRJA 5A9RA 3C3XA 3AUSA 3ROQA 1MXFA 3UF0A 2EP5A 3KYCA 2QHXA 4YAJA 1DRUA 1P0CA 4J0FA 1NWHA 1O0SA 2PKQO 3LDHA 4YWJA 5GMOA 2HU2A 3WBBA 1SO8A 3VVBA 1RYDA 5IZCA 2W2LD 3TJRA 4B3JA 1DJQA 4M49A 3JQEA 4HFRA 4JJFA 2NU7A 5A4DA 4FFNA 4D43A 4E32A 3JQ8A 3U62A 4ZD6A 2UV8A 3UUWA 3JTMA 2QRJA 3ZGYA 2GN9A 2HCTA 3CINA 3V8BA 2AA3A 1PJCA 2JAPA 1RJWA 2VTEA 3JQ7A 1IOLA 3ON5A 3C7DB 5IXYA 3SBOA 4II3A 4CMIB 1ISIA 2Q2QA 4J16A 4BKOA 4CMJA 3EW7A 1BMDA 2B37A 5MDHA 1H6CA 2UAGA 2YHUA 3BMCB 1K6XA 2H6EA 4ZQFA 3G1TA 3OP4A 1SBYA 3S2IA 1ZK3A 2AW5A 3F1KA 4WLOA 1E7RA 4ZQBA 5LDGA 1O8CA 2OFPA 3LF2A 3FR8A 4KQWA 5H82A 2A35A 3H7AA 1I01A 4GKBA 5ILOA 2AEFA 1PL7A 5FI3A 1B8UA 3VDQA 1WZIA 5JBIA 2OHXA 1I32A 5B37A 3PQDA 3QWAA 4DIFA 1Z7BA 1VSUA 2ZTUA 3AFMA 3QA9A 4PCVA 3S55A 5CEFA 5TF4A 2Q4EA 1GPDG 2VQ3A 3DBHA 4RVSA 4DYDA 3INGA 3JD1A 4G81A 5IDYA 2HDHA 4M87A 3GNTA 4G65A 4NBRA 4B7XA 2IYPA 1ZO8A 2IE0A 4YRBA 2EXXA 3VZSA 5HWSA 3NKLA 2B69A 3JQDA 3IC5A 1MC4A 3VTFA 2C07A 1LU9A 2HK8A 4EGFA 3L4BA 5GZ1A 1PJLA 4WEOA 5T8KA 3AU8A 1OC4A 1GYRA 1MA0A 2NVWA 2WM3A 3GVCA 3ICCA 3I6IA 3K6JA 4MIEA 3BZUA 5JY1A 4W7IA 2YY7A 1E3WB 2GPTA 4HNGA 3HB5X 1HDXA 3WLEA 3P5SA 1HYHA 3PJDA 3JQBA 4KTVE 2O23A 1QMGA 4N7RA 3KUXA 5HS6A 2VWQA 3HWRA 4NJOA 3WIDA 1HDRA 4W6ZA 2AG8A 4PRLA 1BXKA 2VN8A 5EQDA 3DO5A 3K2EA 2CY0A 2EJWA 3CTMA 3W8FA 1CQIA 2FWMX 1EVYA 2PY6A 2Y68A 1YGYA 4XRGA 4MVJE 3JQ9C 3OECA 1G0OA 2JD0A 3R6DA 4R3WA 4WNCA 4DQUA 2WD7A 1T4BA 2EV9A 4GX1A 5BSFA 3L07A 3TL2A 5KVQA 3RAJA 4BGIA 5FF9A 1EE2A 2B4QA 1KEVA 3RUEA 2W90A 2B5VA 3MJEA 5CFZA 4CMBA 5FYDA 3M6IA 4P22A 3HADA 3TZKA 1R0SA 2CDCA 2DFVA 1I33A 3Q1LA 4XYGA 1VL0A 5IN4A 2CZCA 3HSKA 3WSWA 4XDYA 3K8ZA 4FC6A 4FFPA 4DXHA 2BFAA 3VTZA 4J1QA 4LRTB 3F47A 4UULA 3PDJA 2P5UA 3D64A 1EDOA 4JXKA 3H2ZA 3BMOA 3UVEA 3EK2A 3MJSA 1O94A 4J9VA 4Q3AA 4I9HA 4QXMA 4U8GA 4PLWA 4CM7A 4EITA 5TS3A 1PEDA 8ADHA 2EIHA 4H3VA 4ZRNA 1A71A 3ENKA 1EDZA 1H2BA 3GQVA 3SLKA 5A5EA 4CL3A 5BNFA 3WGQA 3PHLA 1GCOA 2DBZA 2O7QA 1O9BA 2PA3A 5JCJD 3SXPA 3S2FA 1XQ6A 2I66A 3DWFA 5CDUA 3H65A 1E7WA 3WTBA 3LT2A 3M2TA 2YQ5A 1NFRA 2JD1A 3RUCA 3K73O 4FFOA 3VHRA 1PJ2A 1T4DA 1KVRA 3PIDA 2POQX 2YHIB 2ZYGA 3JCZA 3U4IA 3IOYA 3N74A 4I5EA 2C2YA 2NVBA 4BNWA 4R16A 3CKYA 3AM3A 1NXQA 5K0ZA 2HMVA 2DLDA 1IHYA 5A05A 3QWBA 3KVOA 5AOVA 3DBRB 3VOSA 2Q3EA 1Y9AA 1GR0A 1DRVA 2IDZA 2WMDA 2ILTA 4BO0A 4E13A 2PKQP 2X5JO 5G2OA 1AN9A 4FJ0A 4W4TA 2WYVA 4EEXA 3TWOA 3RC9A 3FN4A 1XWFA 4Y6SA 2GLXA 1CJCA 5IG2A 1PGNA 1MG0A 1I2ZA 2X9VA 3DZBA 1LUAA 4S3MA 3TQHA 3M1AA 3KETA 2CVOA 4I9NA 1IUKA 2QG4A 4EDFA 5F5NA 2Y1DA 1GEGA 1DLIA 1OZAA 4PLPA 3MTJA 1B16A 1GAEO 1LSJA 1U1IA 1JA9A 2DBVO 3F5SA 1I36A 5F1PA 4CMIA 3VVCA 2WEKA 4Q3CA 2EHDA 3E9NA 1LC0A 4L8VA 5G0UA 1HE4A 3T4XA 4KQXA 4D3SA 2HRZA 3DONA 4BB6A 5G0VA 1KVUA 1YQXA 3TZCA 1C0KA 6LDHA 3GY0A 4R5MA 2D3TA 5IZ4A 3PTZA 1T2AA 1QYWA 3JQAB 3P2OA 1DIAA 1FDUA 4URFA 2VYVD 4IDCA 2HQ1A 4XR4A 3D1LA 3EGOA 3QVTA 3RIHA 5T64A 1WDMA 2WYUA 5IF3A 1NVGA 2NVUA 3RD5A 3I4CA 3EMKA 2YDXA 3KBOA 3OIDA 3QW2A 1KVTA 2RIRA 1DFIA 4QT0A 2XAAA 3ZWWA 3DFUA 2FOIA 4MVJP 2VRBA 1PS8A 1U8FO 2X4GA 5BR7A 4JJGA 3AW9A 2NV6A 4IJVA 1SC6A 3DFZA 3OJLA 1I30A 5BSGA 4WUVA 1J49A 4TRRA 2ZK7A 1GZ6A 3GF4A 1E3WA 3WOHA 1H9AA 1EBUA 1BW9B 1Y6JA 4BNHA 1KIFA 4J2OA 1GUFA 2I67A 5CG2A 1HLDA 4J7UA 1UZMA 1XR3A 3WGGA 2O3RA 3P19A 1X1EA 1R37A 4EW6A 4BL5A 3KM0A 4L74A 1XG5A 1LJ8A 4MVJF 4CQMD 4CJXA 4BO3A 4R1UA 5TJHA 1E5QA 5C7IO 2A92A 5ADHA 5K9ZA 4GVXA 4UEJA 1ZFNA 1BDBA 4FOOA 4CQLA 1EVJA 3GOHA 1E1LA 2B5WA 4NG5A 2O2SA 4Z9FA 3QV1A 4JX8A 4IIVA 2Y1OA 5T6BA 3RI3A 3TN7A 1UDCA 1U4SA 3Q2KA 1HDOA 3ADOA 4A0SA 3Q9NA 3FNGA 4WK6A 3UAGA 3AFNA 2JCYA 3FBTA 1VSVA 1TT7A 4W9NC 5HA5A 4B7UA 1T2CA 4ND5A 2O48X 4J2HA 5BNTA 5A03A 3OHSX 1IPFA 1HDCA 1RPNA 4R01A 1NAHA 3L9XA 1JW9B 3SEFA 4OOEA 5KOIA 5JMWA 3D0OA 4R9RA 2Y66A 2HMWA 3DHYA 3GMDA 3RC1A 2VTDA 1IB6A 4XQ9A 4WJZA 3GFBA 4RZHA 3QVXA 1UXGA 3T4EA 1K3TA 1QP8A 1RYEA 1BTOA 4TKLA 2FR1A 3G3EA 2BKAA 1NYTA 3I9JA 2Y0CA 4IM7A 4MIYA 4R51A 1GZ3A 3OQ6A 1N5DA 1ZBQA 4BNNA 4J43A 1O95A 2GERA 4J4TA 1YDEA 3JYQA 3OF2A 5EQFA 8LDHA 3GRKA 3IJPA 2YHIA 1TT5B 4CMAA 2JCVA 1KY4A 3E03A 1NASA 4WCDA 1LSSA 5DCWA 4RCVA 2WJPA 5L3ZA 3NJ4A 1I8TA 1TXGA 1KOLA 3ZNQA 1M76A 1Y8QB 1B8PA 1EUCA 3DBRA 2VHWA 3E5RA 3AM5A 2QRKA 4IJKA 2VYND 1S7CA 4L76A 4UVGA 5C37A 3DHEA 1IE3A 2JJYA 1NFFA 2HLPA 2A94A 3DXFA 1DRWA 3WBFA 4BNJA 4M8SA 4EJ0A 1O5IA 4IQ0A 1OC2A 3BHIA 3SC4A 5LCXA 3FWNA 2FPGA 4GMGA 1E7YA 2X86A 4RF3A 4MVJA 3OQBA 5CHEA 3WQRA 4Q9NA 2NM0A 1QLJA 5AVOA 5KVSA 4XRRA 1VL6A 5I7EA 1P1RA 3BTOA 3GR6A 3GEGA 4QFCA 2UUPA 2X5OA 5AXCA 5JDIA 4FFRA 1F12A 4TZKA 1ULSA 3PFFA 1CIVA 1NP3A 2PZKA 3I1JA 4GSLA 3V2HA 4ESOA 1H2HA 3GN2A 4TZTA 4N18A 1E6EA 1NQOA 3FSRA 4E5PA 4PRKA 1DHTA 2PD4A 2YV2A 2CVQA 1A9YA 2LDXA 1X7GA 1KS9A 3MZ0A 1ZJYA 4DMMA 4BNTA 3GVIA 4GKVA 4CM3A 3STHA 4Y67A 1QYCA 2B0JA 3PYLA 1Q1NA 4GPD1 3JQAA 1CF2O 4B7CA 1NVTA 2VUUA 2OP0A 2ZB4A 3GVXA 1DC3A 3HDJA 2I5PO 4I5GA 2BH9A 3LF1A 2FY8A 1MUUA 1C0IA 4GH5A 2OXIA 3DL2A 3K9QO 5EIOA 3ANLA 9LDBA 3WGZA 3QVOA 1YBAA 1QG6A 1JAXA 2GGSA 5DZSA 2W8ZA 1QYVA 1MC5A 4D3DA 1BSVA 1EBFA 2C59A 1F0YA 3JQCA 4KDFA 4RQTA 3NDIA 3TPCA 2PGLA 1P33A 1BW9A 1HYEA 1PJ3A 2HJRA 3PJEA 1CDOA 3G17A 4HY3A 2ZTMA 4GGOA 3NDRA 3I52A 4CR7A 4DIOA 1NR7A 4D45A 5JSFA 1I24A 4BMNA 5L9AA 1XSEA 4LN1A 4PN3A 3WDSA 1D1SA 3DAGA 4BO5A 4WECA 3ZWAA 1RM0A 2BFOA 1TB4A 2P68A 3BTUA 4LSWA 4TVBA 3ZV6A 4YEDA 5JW6A 2VUTA 2R00A 3RUFA 4CUZA 4XYMA 3W6UA 1OMOA 1K0UA 2YW9A 4J4BA 5THKA 4N54A 3TZ6A 4BNFA 4BMSA 3JQGB 3AUUA 1PZHA 2X1HA 2IXBA 4IJWA 4NK4A 4L73A 1WXDA 2OBYA 1E1NA 4NDNE 2VZ8A 2D2IA 5HRUA 4M86A 2QW8A 2UUOA 5U4QA 4D42A 3ANMA 2D4AA 2C5EA 2EW2A 1EVIA 2W2LA 2NADA 1W73A 1K89A 1JTVA 1B7GO 2Q1TA 4FOSA 4PG8A 3GDOA 4KUHA 4R1TA 4JK3A 5HM8A 5JMPA 2WE8A 3F4LA 4ALIA 1B8VA 5AXBA 1ZH8A 3S8MA 4MDHA 4B3HA 1PGQA 3PGXA 4KWHA 3C85A 3D7LA 2PKRA 2VT3A 4Y6PA 4A73A 4ALJA 1M67A 3DOOA 2G82A 5EESA 2NQTA 4BNMA 1Q7GA 4G5HA 3K2BA 5ITVA 2Q46A 1XEAA 1N9GB 3VH1A 3DMTC 3WS7A 3I6QA 3CEAA 2VOEA 2YDYA 5DULA 3U3XA 3FCOA 1K2WA 3V1TC 5CDSA 1DIGA 4OKIA 4P4NA 3KHUA 1R4NB 1XKQA 2Y93A 1GYPA 4DREA 5G4KB 4B8WA 2YV1A 1BDMA 4YT5A 4PVCA 2Q49A 3TFOA 1TT5A 3DZHA 4FR5A 1R0KA 3GEDA 5I8ZA 2JL1A 5K6AC 1S6YA 3LC7O 5L95A 1T2FA 3UFXA 1MXHA 2OL4A 3DTTA 4A2CA 4DC0A 5ER9A 4E3ZA 3H9UA 4IDDA 3PIIA 2CD9A 4Q3EA 2I99A 2IZ0A 4NPCA 1FK8A 1V3VA 1QV7A 2RAFA 5B1YA 5DDIP 2BELA 1OOEA 2CMDA 2JKVA 3PI7A 4CV3A
chains in the Genus database with same CATH superfamily
5IAEA 1V16B 4YAGA 1JSCA 1IHPA 1LB1B 2DF8A 3GXBA 5HFJA 4I1UA 4ETWA 1CLUA 2JBAB 4F45A 3AEKB 2WHXA 1Z38A 3L8EA 5AD1A 2ECKA 2DHDA 5FWDA 4P7GA 3C6ZA 2O2GA 3J80A 5D86A 5BYAA 1J7JA 3J81A 1TEZA 3CBGA 4CLHA 3CSDA 3FYHA 3PR1A 2BFWA 1G2OA 2YVAA 1A7KA 2VUIB 1VPTA 3ZS8A 4CQMB 1E7MA 2II6A 2CEKA 2NX2A 4NBLA 4ALNA 4I5IA 2YWEA 3GL9A 3NH9A 2Z58A 4FZVA 4JJIA 5AJUA 4DQVA 3W9SA 1J0DA 3FF1A 2SCUA 3RHFA 4M76B 4OBBA 1W46A 2PMDA 4XH9B 3WGKA 2IU6A 3K0EA 3CLSD 1LBHA 1N2CE 1C14A 1GPAA 4FINA 3H9QA 3SZMA 2RG1A 1H6AA 1ZS9A 1ZM4A 2FZWA 3N6XA 2DLNA 2VDOB 2VBIA 1ZK4A 2M1XA 2P2ZA 2X9LA 3IMGA 3LH5A 3N8NA 4J0HA 1UMBA 1IG0A 4F46A 1LEHA 1JWBB 1UBUS 1GSHA 3GFFA 2OMEA 4LRSB 4UUPA 3HU5A 3SGLA 5LFAA 5I7OA 5B4TA 3LQQA 3KNZA 3OAAD 4RM2A 5AICA 3SBEA 3UV6A 4Y0NA 1WVGA 3U7EB 3NX4A 4BO6A 1TJ4A 1SD2A 5ICSA 4HZGA 5G0SA 1DIRA 1Z7GA 2O4UX 4KIFA 1H0RA 2CLKB 1JRLA 3SCZA 5LOVA 1DAFA 1ZPDA 4D02A 1Y37A 1VG1A 3RYTC 3N7TA 5CCEA 4GNRA 1A4IA 1HEUA 5BNWA 2LKDA 2GF2A 9MHTA 7ADHA 3AR8A 3EA4A 3H05A 3H2SA 5HUQA 2OGWA 1PCXA 2XCRB 1KK1A 1TPZA 5J43A 3TOZA 4OYRA 1KWKA 3CRRA 4QBHA 3RASA 4FS3A 5K6RA 5CP8A 2GN1A 3REQA 2BMAA 4P33A 5JCOC 1I7DA 4MEAA 1TU4A 1XEWY 3GMTA 1SG0A 5FA8A 3GHHA 4CG0A 4KE8A 3JY6A 5AM1A 2ID8A 1CVRA 2EJTA 3SD7A 4RXMA 2O0KA 3HYTA 4KWEA 5D7BA 1E7QA 3PPXA 5DHRA 5JSKA 3ZQ6A 5KQRA 3EW9A 1YRQA 3I5YA 2PH3A 1JDBB 1Y4DE 1FTWA 2AW3A 1LPMA 1USKA 2V96A 3CIFA 3LXMA 3P2YA 3R2JA 4PHCA 5JCJA 4ZYZA 2HHLA 4PSCA 3WGYA 3Q8LA 1RQXA 1ZIOA 2VQDA 1NLYA 1QV9A 2PBRA 3HSSA 4MW4A 5DW3A 3HZRA 4G4GA 5C8VA 2DE0X 5KHOC 5LXTA 4H7HA 5FJIA 2X0JA 4MPTA 1YHZA 4NV0A 3SC2A 3FOEC 5AUNB 1WV1A 4O63O 5ICEA 4C0AC 3MWLA 1E1CA 1MQAA 4HWSA 3VHXA 3H5IA 5DH9A 4E46A 5JANA 2VHVA 1UXJA 3R3VA 1J9ZA 3HJBA 3PFKA 4CVNA 3RU2A 3TPZA 2HSGA 4IR7A 1ZRMA 1GG5A 3GX1A 3DV2A 2AR9A 2CSXA 1L7VC 1XK7A 1S89A 4OQYA 3FBGA 1YMUA 4BVEA 4H6PA 3JQGA 3OF5A 1XDUA 3UK6A 5J2TB 2IDKA 4P3XA 2X5KO 5DSZA 2WKPA 3QKWA 4YCNA 2QR2A 4ZVRA 1YOVB 3L4EA 2JFZA 1HZZC 3T1TA 2WF8A 3CIOA 4J0JA 4KWCA 1JQLB 3WHLA 2W2PA 1P7VA 2CL0X 1UXOA 1YR8A 1SHKA 5AHKA 4TYMA 4D4HA 2CV0A 2B7BA 4JKOA 2PZEA 3VDMA 4TOIA 5I9TA 1Q0SA 4PFKA 3ST7A 4MVXA 5C4MA 2R8ZA 4PLGA 3E5HA 5AJHA 3EDOA 3R6WA 3U4DA 3PE4A 3TW4A 3V8VA 4D4KA 3AL0C 3ABRB 1NBIA 4GPZA 1I1HA 3T35A 3KR9A 2CUNA 1H8HA 4G67A 1FDRA 3G0GA 3Q9SA 4Q00A 2R4TA 1ORRA 2R66A 2XNDA 4Q4AB 5AJZA 3GA5A 2V74B 3UANA 2W0SA 2NGRA 1UKEA 1ENYA 3EA0A 3QSGA 2WJAA 3URMA 4DFDA 1ZR2A 2I91A 5GJBA 3CUEF 3FFWA 4Q3NA 5I8WA 2AHRA 2WWRA 4RTSA 1TMGE 3MLBA 3T3EA 1L5HB 3DOUA 4TMZA 3HM2A 4U3JB 4LJRA 4M0LA 4BX2A 2BMFA 3SMVA 4KN6A 3DLAA 1QBGA 1VJGA 3H6KA 5KNCA 5KWVA 2BSAA 4L72A 4AKGA 1KC1A 1NBMA 3MCAA 4Z9AA 3S8YA 4NCJA 1TX4B 3P0IA 3PGLA 1LF5A 2L82A 4D25A 3ZC3A 4U5QA 2V54A 4K26A 1G1AA 1F8UA 5LA6F 4QTTB 5KOJA 1SNYA 5G4KA 1TADA 3WMEA 2JANA 2V7PA 4HNTA 2QGFA 3OJOA 1HT1E 4GDMA 2BMVA 5FO0A 4IVPA 4OIMA 4AN0A 2RKOA 4JJAA 1P1IA 2IGBA 4R9SA 4NXNB 2C57A 4I2NA 1XTTA 3A9CA 5CLIA 1QKIA 4MUNA 4A8JB 1WCWA 4R8MA 4QREA 5IVHA 1ESMA 5IFKA 2QUJA 1E2DA 2O05A 1R0YA 1C8KA 2Z6QA 3IOBA 4OXNA 3C39A 3E8MA 4D6YA 2INGX 3SR0A 4AJIA 4DNQA 1XEFA 2NU6B 4PG5A 5EUMA 4A16A 1LQUA 3MWJA 3ZGOA 2PS3A 3B7PA 1FTGA 3M8KA 4KIGA 5GY7A 1ATIA 3CGWA 4MIOA 5DVZA 3WKEA 2BMEA 1X80B 5COAA 3KVVA 3TL6A 1ZNXA 4A8TA 2SBTA 3BAZA 1UKAA 5K3FA 4IQ4A 1JV2B 3U56A 4LRYA 3VNQA 1ZVKA 3QX8A 1K6IA 1U3UA 3LFUA 5BW8A 3BWDD 5EP1A 5C34B 4PC6A 4BLPA 1UJ2A 2E49A 2MR6A 3V1YA 4C0XA 3BQMB 1EHYA 2PH7A 3L4BC 2CL7X 4DBLC 1GCGA 1JSXA 2D62A 4IIDA 4LRUA 2EERA 5D5QA 2RHOA 1YK1A 1ZVMA 2ZWIA 1L8OA 5HCNA 4Y1GA 2W98A 1IUOA 2QL6A 2PWYA 4KXLA 4Z1MA 2V3WA 4QQNA 4F21A 5L4NA 1QV6A 1I4OA 2BGJA 5K8CA 2ZB7A 4D81A 3FUWA 2QQGA 1HNZB 3QQ5A 4ZJYA 3ITKA 2C03A 1E69A 2QP4A 3PP8A 1OTHA 2GRUA 5TQ2B 4DM4A 4WVLA 4KO8A 5FA5A 5K3SA 1IOZA 3MA0A 1QB8A 3FG9A 1CDZA 5DF1A 3QI2A 5BUZA 1XTJA 2F1JA 4YT4A 4RVDA 1N75A 1NVWQ 3OIWA 2XMBA 2Y1GA 2OE2A 1GLVA 3NT5A 4FLEA 3V2UA 3L7IA 3L06A 5EPOA 1JFRA 4KK3A 3O8QB 4K9PA 1P80A 4TLDA 5K2MA 4LMPA 3TAXA 3H3XA 2DY0A 1I5OA 3HDVA 1Z82A 3L46A 1M6VB 5CM8B 5FBKA 3QFSA 2W2NA 4Y2SA 3ZWBA 2VP5A 2NPOA 1E1RA 3E1KA 4C4SA 4DZRA 4ENUA 3L40A 1G5TA 3DCYA 3ESBA 1M33A 3QE3A 5TQ0B 4CIAA 4MKZA 3TGLA 2PUFA 3QFFA 3MJ4A 1IEXA 4AKSA 1KBZA 4B9EA 3EGIA 2ROQA 3H9EO 4C88A 1YR7A 3KLNA 3X3HA 1RRFA 2JGDB 4ZI2A 2I8CA 3RW9A 3ZBUA 4PZAA 3QHPA 5LSAA 2GYVA 3OETA 4TVKA 3IAFA 4EGQA 4QUGA 1MO3A 1GKKA 1NRXA 4DQLA 4J0CA 2XUHA 3MWFA 1DKUA 5B6PA 4KYIB 4RTOA 1B76A 1MEEA 4YJGA 3TNYA 2QL5A 3AUKA 4BLTA 1ISRA 1TF2A 3UBTA 3C8ZA 1PIWA 2JI6A 3NALA 3DDSA 4Y8VA 4DABA 2PX0A 1SXJA 3ONEA 1Y6FA 4DCCA 3UENA 1C9YA 3PNYA 5LB2A 5E95A 1Q12A 4BNYA 1A9ZA 4WCFB 2G63A 2IEBA 2VJOA 2Z8YM 1IPEA 5C35A 1JH9A 5MGNA 2PL3A 4GG1A 2P2DA 5LU8A 4WLNA 5LZ8A 1RAAA 3WL8A 2V3CC 2HX1A 3L1KA 2O8FA 3FETA 2NXNA 1S2LA 2AG0A 3QEJA 4B75A 3QPBA 4OM8A 1U3FA 5FI1B 3O8DA 1SPBS 4M8IA 3GROA 2XTZA 4WBSA 1E4VA 4MGIR 2Z4TA 3QLVC 4UHFA 5LBUA 1NONA 1M0TA 4ZGBA 1V96A 2PTGA 1K88A 4KXQA 2IYEA 4D57A 4P4UA 3FUCA 3INTA 2HIMA 1G5FA 4N9QA 4C21A 2TS1A 3GUYA 2NUAB 2Y1XA 2DMRA 5JXIA 4CV1A 3WGIA 1NW7A 6PFKA 4JY7A 1UQUA 4Q1FA 4F8JA 3RC3A 2FB9A 4WLUA 3HCCA 4X85A 2X7XA 2WG0A 1MIOB 4GRDA 3QX7A 2H1SA 4V0ME 3EQ6A 1VXRA 3K72B 5AKEA 5JPIA 2G3YA 5JAMA 5JNWA 5K3EA 3S3TA 4EUEA 4WINA 1JJAA 4U7FA 2FK7A 5KTSA 1GJRA 1F4PA 2GYYA 4EMSA 4LE0A 4O25A 5K0CA 4L5AA 5E9JA 4JUDX 4NABA 3EIEA 3ILSA 2C0QA 1HKHA 3EG9B 1IN1A 3DL0A 4NQZA 4QNNA 4RVUA 3IUJA 3BBPA 1M0EA 4C22A 4U9UA 2ORVA 3S8EA 1ZRHA 1Y3HA 4YS6A 2Q1SA 3DXXA 4A27A 1AUQA 4B4VA 4MQ4A 4ES6A 2HCJB 5DU2A 3I58A 2P7IA 3QU2A 3U4QA 3D2CA 4DR7B 1K8YB 3E53A 5B3JA 1L5FA 3JD4A 5EXXA 2AF3C 2D8AA 1Z88A 1R3UA 2I3ZA 4AKEA 4BLQA 1KTVA 5DK4A 5LUBA 2B4TO 1DT5A 2HWYA 2YBEA 4KXXA 1R8YA 4B8ZA 3UJ6A 3NM6B 1EDDA 5AVJA 2OVBA 1AK1A 4LDRA 4A23A 1DJMA 3BHJA 1HQYE 2VUSA 1RXCA 3TI9A 1SUSA 4ARZB 1Q92A 3FPAA 3HR8A 4P7KA 3C5HA 5E8RA 3GLGA 5ED4A 1DMSA 3DZJA 1U28A 1VKOA 4U0JA 3TTSA 3CN7A 3HB0A 5IT4A 3U5ZB 1QQBA 3IGFA 4XLLA 5JH7F 1P1BA 3H13A 3O0TA 2JHFA 1R6UA 1T8TA 4PAMA 2E4VA 4TWRA 4N3GA 3UGTA 2C5HA 3IEKA 3R0JA 4MS4B 2H63A 5F2NA 3U1BA 3A2KA 3L1UA 2BZ1A 4B09A 2XH8A 2C3PA 2OC4A 4OU5A 2F90A 3E9MA 3D2LA 3DGFC 4HDMB 1SWVA 3EFOB 4NNJA 4PNZA 3O6VA 4HDKB 1ONSA 1R9JA 3KK0A 3SP1A 1WD7A 3OQVA 3R7WA 3TTYA 3D3JA 3IMFA 4GOJA 4WY2A 1UPFA 4KFTA 3TB4A 3ZI7A 3NRBA 3BN3A 3QWIA 2ZIFA 3ZWVA 5ITSA 2J07A 3H1FA 4J91A 4UDOA 1O77A 4LOHA 1E3EA 3HA7A 4LOAA 5DNAA 5FWYB 4ZCLA 4DNPA 4EG5A 4UEOA 1QUEA 2Q5JA 2V7XA 1P6UA 4MP3A 3O1IC 2FZKA 4LJ7A 4ND6A 5LKRA 2BFFA 3HP1A 3AJAA 3QV2A 3PNVA 1WUHS 4OQQA 1EFDN 4I3FA 5BN4B 3K6SA 1MMFB 1KJQA 3JAKA 5EOVA 3KYJB 1AUVA 3DAOA 4J76A 4XLTA 4BMXA 4XFKA 1NVFA 2PZMA 2XQVA 3KKNA 3R4CA 4RFVA 4PYRA 5HUHA 1Y9JA 3EVZA 3T54A 3UOGA 3BMQA 2OG2A 1AQ6A 1EWVA 1AMUA 1KO4A 1TVEA 4Q7JB 3U7JA 2GZ2A 1WBBA 2PZJA 2F43B 5AM0A 1XZJA 3GEMA 1NG9A 3CLUC 2C9MA 1U1DA 1A88A 4IFIA 3MWGA 1PZNA 5DFAA 3DLIA 1UBSB 2G77B 3L3BA 4DA7A 5C9ZA 1XMXA 5K7SA 1R6AA 1LXCA 3UATA 3IBGA 4EDHA 1G9TA 1LX7A 3QJGA 3IV7A 3QP9A 3BE5A 3AERA 2PMEA 2OCIA 4RK0A 2C58A 2SKCA 1D4OA 1NJGA 3ONFA 3ZWNA 2HN9A 2ACEA 1DKRA 4QOGA 4ZO6A 1WCIA 2W2XA 1MJHA 3D3WB 5BPFA 1YQUA 2DPXA 3DR3A 3SJAA 5K8LA 4US2R 2BMWA 2GO1A 3I9LA 4WSOA 3WJ7A 4EJSC 4GWKA 1LDMA 4MDFA 1MJNA 1VPLA 2YCLA 2X0NA 5COBA 5CT9A 1ML3A 2B2XA 4ZQEA 3R9KA 3ORHA 5JV5A 3KWJA 5JI3E 1SK9A 1ZZGA 3VI3B 1ZK1A 3LT4A 4INJA 2AUTA 2DQ4A 3E1GA 3FCSB 2ZS7A 4BECA 3LIPA 1KA9H 1GRCA 2A84A 2P2NA 3NKVA 5DBFA 3TOVA 3ZXUB 2WWHA 3G9UA 3IAM1 1I2CA 4RL4A 4DBZA 1BXGB 4DLBA 3E3NA 2QX8A 2YBDA 1P74A 5HDQA 2V6MA 5DHPA 1LBIA 1BMFD 2IS6A 2QTTA 5CDTA 5T5QA 2OG1A 4L8YA 3W77A 3I9V1 2O4CA 3IEXA 1GP2A 1IG3A 1GPKA 3DKIA 1CUVA 4IZOA 4X5OA 1UBGA 4DCNA 1C3VA 3S7ZA 4PC7A 1H2AS 3GRCA 2APJA 1IMOA 2BD0A 3E0XA 4A3SA 4V0KA 1HORA 3HDTA 3OCJA 1GQYA 3R76A 1ZOOA 4G37A 5AUPB 4IIFA 2IYFA 1B3BA 1D9ZA 4MRPA 4YJDA 4BU1A 2HQOA 1ZGJA 1EHIA 4TT8A 1XTUA 2KPOA 1PBTA 2BEVB 2CBGA 2OESA 5C32A 3IUSA 4F86A 3VGPA 1AKQA 3SIXA 1Y98A 2PWAA 4NZYA 4OHZA 4AUNA 3IAHA 1N6KA 4UHCA 4W5NA 1QK4A 4O2AB 2COKA 3C7CB 1C8VB 1G1MA 4LF9B 1H4SA 2ZBVA 2XF8A 3MWEB 6REQA 1HE1C 3NTQA 4TYNA 1I5RA 4YCAA 3EF3A 4MYHA 5L8VA 2GCOA 1JT2A 3KB2A 2DUJA 2GA9A 4JJ8A 4URYR 1D2CA 3K09C 3IERA 1NXSA 1M8PA 1XKLA 3OI7A 3B1FA 5ERGB 2Q2OA 4N5MA 1JZQA 1XTSA 2QLJA 1P72A 2MSWA 2WU1A 5MN4A 1B0AA 1ESNA 2RHRA 3MGGA 2LW7A 1XQ1A 2JKYA 4XWTA 1J7KA 4YMHA 5JDIC 1E3JA 3HY4A 4H1VA 4WOPA 4KOEC 4DR3B 3SQNA 2JB9A 2FPWA 4RKWA 4S12A 5FOTA 3RROA 2J6HA 1VC2A 5EIWA 1UBJS 1SXIA 1FJHA 2CJWA 2ENUA 4UTOA 2H0AA 3OT4A 2PR7A 3K53A 3NHZA 3NT4A 4TQUS 5AYVA 5IT0A 1KDZA 2MSDB 1C4XA 1RKVA 1K6EA 2NZ8A 3BRWD 5TRTA 1DT3A 2QVGA 5JJCA 3JYLA 2WTXA 4J0GA 3ROPA 5JXHA 4Q3KA 1XAIA 3CH4B 4W9RA 2H3EA 4XIYA 2QEQA 1KE2A 3RJ9A 4E6EA 1Z15A 4URXR 2GZ3A 2G36A 1U2SA 4GI7A 1ABEA 3HKCB 4KFUA 2RI1A 4NYMQ 3LE8A 3QMWA 4CCAA 5FUBA 5KQPA 1XE3A 1XRLA 2FMHA 4TWIA 2G0AA 4YA6A 4F3NA 3FXAA 3FKSD 3DPIA 4D7AA 3SEQA 4ZVTA 2YN2A 2XVYA 4UVDA 3PLAE 1FOEB 2WUVA 5BQPA 1FFCA 1QH8B 4B9AA 1T2DA 4KI0A 5DHFA 4ZU1X 2OCBA 3QH4A 3SFVA 2C1XA 4N0MA 3SWWA 3L7AA 3F3SA 3O7WA 5BURA 4JP8A 3JSAA 2PA0A 3C7AA 3U1TA 3RFCA 3AR2A 4BVLA 8ABPA 2DP4E 1UIMA 1NAIA 1BX0A 3TTWA 1JYFA 1FP7A 2PXCA 2QYHA 1TCAA 2VF5X 1T1GA 3PZRA 2K87A 4TL9A 1RT9A 2PBLA 1U9CA 4DIUA 2PSJA 2H31A 4GM4A 3U31A 3PDUA 1FRQA 4LF7B 1AT1A 3N39C 1GZVA 2ZS9A 1TC1A 4LXUA 2N75A 2IIPA 2O8EB 4V0SA 3W04A 2C5SA 2BFDB 1GYQA 3T5TA 1X7ZB 5JD6A 1VYVA 3O47A 3PUYA 4PPYA 3BGOS 3PQ6A 3LDFA 2AKYA 3LL7A 1QHFA 4QGGA 1RLMA 2B35A 3STTA 2R00C 3W9UA 4PQFA 3ZZ1A 1KFJB 2F4VB 3MCZA 4ZCPA 3STUA 1A9PA 1XTQA 5DXJA 4N5IX 4UZEA 3K9FC 4IKEA 3AWDA 4JLNA 1YBHA 4LRWA 5JMTA 4MYSA 1ZUHA 4GMFA 4O6VA 4HDCA 4HDAA 5D51S 5CCDA 4JEUA 1Z8NA 3SHTA 3BWMA 1ZD2P 1M7GA 2E4ZA 5TGDA 3G49A 4F2HA 3F7OA 1NUSA 2PGNA 3H6HA 5KTPA 2Z95A 3HCDA 3OIFA 4X54A 3CX8A 1N9ZA 2ZJYA 1IN7A 4IF6A 3T3PB 3ADPA 3ZQUA 2IEGA 3AIMA 5B2EA 1PEYA 5HOEA 4TTJA 5JXJA 1DOHA 1E62A 1KGDA 1JLKA 1JNYA 5K51A 4G0YA 2RHDA 2ZIGA 4BO2A 2C0CA 3HYNA 2VP2A 5FOSA 5BQOA 5A1JA 4ZVVA 1FMTA 1K1EA 3SNKA 3GLVA 4FCVA 3IV9A 4YP1A 2ZIWB 3ZCXA 1GKUB 3C6KA 3DPSA 2RBGA 4LNHA 1OLXB 1JLLA 4C30A 5B55A 1H9CA 4YUAA 4O2BF 5JVDB 1Z0DA 4UTZA 1N5IA 2Q41A 1NP7A 3MSCA 4H17A 4UCFA 5ANRB 4EPRA 5I7VA 1G6KA 3FDIA 4XIIA 5H80A 1P3DA 3RYIA 2FUG1 3BMXA 3DZDA 3JAMA 4QLAA 2C8JA 3KYDA 4RPKA 3KKLA 4PGAA 1SU7A 2PKEA 6Q21A 1YFJA 3P9NA 3QUBA 3NV7A 3CX6A 5CT8A 3QHAA 4EY6A 4WDQA 3WLKX 3K9LA 3MJDA 2AVDA 5FPTA 2KM1A 3IP1A 1LRLA 2IUSA 4DL9A 1MG5A 4PTZA 2LTAA 1VHTA 3W5JA 3RT1A 1S3GA 1DKMA 3KUDA 5KPDA 2WVAA 4MUXA 3VJMA 4BJHB 1WLYA 2AXNA 3BE8A 2EHJA 3BL5A 4LOIA 4D96A 4DV2B 4K8RB 1B73A 3VTKA 2WT4A 1AXRA 2MSKA 1WEKA 2ZWOA 4M1QA 3WNQA 3D8BA 4RM3A 1XTZA 2L18A 3O31A 5JNLA 4KREA 1RAHA 1W48A 4WLVA 1RMQA 3NGLA 1Y8AA 3DWGA 2LCIA 4ERXA 2EFYA 3O2SB 3O3MB 1S8AA 2B83A 1NPYA 3C2QA 3FPKA 1CZHA 1GV0A 2ZYHA 4EWLA 1IJKA 4ENRA 3IIMA 4QD3A 2YRWA 3V6MA 4E2YA 3GT0A 5TX7A 5BV1A 4YRNA 5BSHA 4BMYA 1WCYA 1VGRA 3UWKA 5G4LA 3WNDA 2JLXA 1IBCA 3H8VA 3Q7EA 4MH0R 3PRHA 2JFVA 3LJKA 4XR9A 1ODSA 4WERA 5CMLA 1O6ZA 2HHAA 5DKFA 3LUKA 4B4UA 2VZ9A 4QYMA 3LRPA 1S0UA 4LJ6A 3GRUA 4W8OA 2E9SA 3H2GA 2VXCA 2XMQA 4MS3A 4Y9SA 4YVFA 1H8EA 1KFCB 4XE5A 5T4FA 2H7YA 1KQNA 4CKYA 4L2IB 1H6BA 1Z68A 3L1VA 4G24A 5EHXA 1IU9A 1N2SA 2RK6A 3JASA 3SYTA 2JGJA 5CBPA 5KTYA 4UNSA 3LQFA 3B5JA 4QGHA 2VCEA 3G0OA 1XPJA 4BPBA 4QSHA 3HJTA 3DV0A 3O95A 2JCXA 1U8CB 3DBVO 2RI6A 1F20A 4UPVA 1LPOA 1J9EA 1HE5A 1MVOA 1MV5A 2B8TA 4HZUA 4W1PA 3WLTA 4EQ6A 4JWKA 3K4QA 5EE5B 5JSZA 1OWMA 4JOCA 3OQIB 3BFKA 2WU8A 4QFMA 3F8WA 3JARA 4M1YA 3KELA 1YFZA 3F4KA 4YLYA 2HK9A 5IWAB 2JIBA 3N2IA 4IZIA 3TLEA 3VRHA 2AR0A 1UBEA 3GT7A 3AR6A 3OJFA 2XUIA 1VYUA 3CVOA 2PRJA 3DGEC 1AM4D 3D6NB 4EKNB 3AF6A 1HT2E 2V03A 4WN9A 1Z2CA 3AVTA 3AI3A 3B6IA 3D6TB 4P5DA 2H9AA 1GHTA 4PSUA 3FD8A 5K3BA 4CRWB 1X39A 3UMSA 4P4SA 2I3BA 2LIVA 5KYWB 4UHHA 1RJ9A 5E7MA 2HREA 4Q6WA 3FCYA 3Q5GA 1SRRA 4KV9A 1GPJA 1YO6A 3H1TA 1KDRA 3P94A 4YIKA 4WLEA 4FZ3A 2BFCA 4NBUA 3VHQA 1ENPA 5CA0B 3L0CA 4MTLA 4ZO9A 4EI8A 2BR5A 1PJ4A 1UBMS 2AQHA 1P9LA 3DD5A 3JQ9A 1LTQA 2CXTA 4AZ3A 4Y2UA 4KI7A 5IJXA 1L4GA 1XU9A 3WY9A 2NACA 5BYKA 3SYMA 4L4RA 1VIYA 4BN5A 5CD9A 1KIAA 2Z2YA 3EWSA 4B84A 4MXDA 1XELA 3QG5A 3AEQB 4CPDA 4KPGA 2XBUA 4KFRA 4X45A 1ZM9A 1UXIA 4BAZA 4G0WA 3D8UA 5DHTA 3DE4X 4GAEA 5L7YA 3VPBA 5KAPA 1ECLA 2ZT5A 2GN8A 3QRWA 3S4YA 1TIKA 1RKQA 4LTNA 1Y1RA 4L02A 5A3VA 5GZ3A 2OV1A 1CJMA 5I6DA 1I0ZA 1RJFA 3GT3A 4GI1A 4J9UE 5FWXA 5HF8A 4EGCB 1LSOA 2R6GA 3IQIX 3UK1A 1FXUA 2PUWA 2XZLA 4K2AA 4W8HA 4GXRA 1M2NA 2AI3A 2FLWA 2PZAA 1BG6A 1JU9A 4YJ2B 2EC5A 3H2BA 3KXLA 4DDHA 5JJKA 4I1SA 3AEYA 5K2OA 3QLJA 3H5LA 3QXHA 4N7BA 4NZOA 3RSCA 1FF9A 1W5TA 5DGXA 4V0LA 4RVFA 5FUQA 3HRKA 1JXOA 1YR9A 2PXHA 4C7JA 3KT3A 2WF5A 2FX5A 1I2MA 4KMSA 4NU6A 3AR9A 1RP1A 2QV7A 2VJBA 3TNDA 5C7YA 2C3OA 2YVLA 4IIGA 1RM5A 1X1TA 4AU1A 2ZQ5A 3AVQA 2ZATA 3GZ4A 3KE9A 1ZIXA 4M4SA 4JHLA 5DT2A 5CDYA 5AW2A 5BQ5A 5KNBH 1PJTA 3L8ZA 1XGKA 1U0JA 4ZCIA 4K05A 4F11A 1NQXA 2PX2A 3IBYA 4WJLA 2GT1A 3C1OA 3MSXA 2JBAA 3OG9A 2XUFA 3KD3A 1HNNA 2PPLA 1MTOA 4FLFA 5EPUA 1OB5A 4CQLB 3OCVA 3B1KA 4ZA2A 3PGVA 3QVKA 1F1BA 1R6XA 5CAEB 1I6MA 1SB9A 2E5FA 2PU7A 4P3YA 1U2ZA 4IFBA 4B4OA 1PJBA 3ZW9A 3JQFC 5EMLA 3LTNC 1QRDA 5COQA 3V4FA 4A26A 1W96A 2JLWA 3K0FB 3JQQA 2VAPA 2ZIVB 1DO8A 3RJ5A 2CE2X 4QO7A 3QLUA 3VO2A 4IUCS 4MWSA 4YB8A 3T4PA 1FFDA 1G63A 3NR2A 4PLHA 4PZCA 1ZQ9A 2I3AA 2R97A 1ISJA 1RZRA 1M66A 2IYRA 1T8RA 2C4UA 3AESB 3KS9A 3N9IA 2FH5B 3QXSA 4GLLA 1ST2A 4TYQA 3ORFA 1JLHA 3WIUA 5FPHA 2IEYA 2YFQA 1ML4A 5DYWA 3DHNA 4E30A 4HN9A 1CBUA 1C3OA 1T3TA 1GPNA 1UBOS 4J07A 2NWQA 1LDGA 1PNVA 1J5PA 2OHHA 2YJ3A 4N65A 4US0R 2GN6A 3KPJA 3V42A 1XCLA 1II8A 2WF7A 3S2UA 2DKFA 5DOVA 3M82A 1XX6A 1NM5A 3OX2A 3F74A 4H15A 2OGZA 1TM5E 2HJSA 1N0IA 1CJSA 3KD2A 4P34A 3RC7A 1QYRA 5C52B 1Z25A 3N0XA 4B73A 1O97C 2VJNA 2RC6A 1OH6A 1ZY2A 1HT3A 3R3ZA 4AX4A 3PDCA 4AJEA 1K86A 1L7RA 4UM7A 1XTBA 3IMEA 3QELB 2Z9BA 5K3AA 3WQHA 4U7TB 4AJ9A 1SCNE 1BC5A 3CCCA 3HLYA 5CM2Z 5CLQA 1NX6A 4QJ3A 1CYDA 4Y2JA 4OXYA 2UYOA 10MHA 1SUEA 2J0SA 1DDGA 2ZB2A 3AYZB 5I7HA 2VEDA 5TJ9A 3VU0A 3BF7A 4QPJC 5HFNA 2ETVA 2X58A 3FGNA 3GGOA 1F3LA 1Z0KA 1ZW1A 2XMDA 3IQZA 3ZG6A 2BGKA 4LKRA 4HG2A 1UJMA 1EGHA 4BZPA 5LN1A 3GJYA 4Q4JA 3ETNA 4KNYA 2VA8A 1SU6A 1U5BB 2J09A 2P78A 4MI6A 3D7SA 2DFDA 5IDWA 4MQBA 3OZTA 1TJNA 5IPFA 4FN4A 2JEYA 4OB8A 3UGKA 4NBKA 3LWBA 3WJ1A 5B7NA 3HNPA 4N12A 3AO0B 3HGTA 1XCOA 4LHVA 3SX4A 3WLFA 3SBDA 5JOQA 4BNGA 3KLPX 5E4TA 1IM8A 3GP8A 2Q5FA 3PXUA 1JG3A 3MMXA 3FCEA 1N8TA 4F2PA 5F23A 4ZHQF 1SVLA 2R44A 2XCLA 4OA5A 3GCGA 5EZSA 3TJZA 1CEYA 4IXNA 1OGJA 4EL0A 4EZEA 3OE7A 1IRXA 1RBYA 1WXXA 3R3UA 3QU5A 4RTKA 1Y1PA 2A5JA 1OX4A 1H1TA 1OW3B 2YOFA 4IZ6A 4FFMA 4YP7A 3GGPA 3BB1A 2JDIA 1GG8A 4IWXA 4UBIA 3CH6A 3D4LA 3CCFA 4XKJA 5JS6A 4IHQA 2WDZA 2YVKA 1OKKA 1EM8A 1M0WA 3ASVA 1BEZA 4JBXA 1F06A 2PU5A 4GRIA 5BSMA 4DPMA 2BFMA 3GLFE 3LS2A 2DJIA 1VOTA 1DG3A 3LL4A 4GBMA 1SIWA 5DI9A 2KWIA 2AFIE 3S1AB 4GYYA 4UQLA 4J49A 5EJ9A 1E2JA 2Q5EA 3GDFA 1MQSA 2JJ2A 4YRCA 5K1ZA 1BXZA 4RK4A 4CFSA 4DLKA 4JQYA 5GTDA 5C4GB 5CDGA 4ZTZB 1JQAA 2O3TA 3ANTA 2ZVPX 2B36A 2WU0A 1REQA 5EHQA 3ZHYA 2HHCA 4ZEOA 4YRAA 5C3MA 1HTWA 4OXKA 1CX9B 3ULKA 1KMNA 1DAOA 1LLQA 5EGNA 2C3MA 1E2FA 2GNOA 2PRYA 1TPYA 4J1TC 5DEOA 3ZR4B 5HIMA 3CYFA 1T1JA 3AEZA 2I6FA 3BH6A 1FNBA 1M5UA 1NRIA 5J59A 5TEVA 3VV3A 3U4MA 2GZMA 1Z36A 4P0TA 4LYGA 4ZCSA 1ARZA 1QMPA 2CLCX 2DT8A 3C0KA 3GZTB 3GUHA 2OXTA 3RS7A 3TLGA 3VJKA 4AM8A 3H8JA 1BGWA 5CM9C 4TXMA 3FB1A 4DLPA 2HYDA 3RRMA 4O8ZA 1U8XX 4OHVA 3DB2A 2J3DA 1HRDA 1UKVY 3JQPA 4ICIA 5A62A 1GGHA 5J5CA 4GO1A 2YUTA 4A82A 4ABTA 1CFZA 1JR2A 2H54A 3SOPA 1ZHOA 1VG0B 3EVTA 2ZYDA 1ORDA 5CCXA 2ODQA 2YOHA 4BYGA 3DE2X 3LZ6A 3U13A 2GTHA 5AXDA 5FBRB 3A6JA 2WA2A 4X95A 2JA2A 1GILA 4N5LA 3ZBPA 4X66B 4J4HA 1VKJA 2BI8A 4QHSA 1BDIA 3W9YA 4AUMA 1GGNA 1R6VA 4Q15A 2DFPA 3MQ2A 5HQ3A 3PZBA 4NU8X 4H0FA 4KE7A 3WLOA 1JHQA 3R8CA 2Z6AA 1EESA 3KJGA 1W94A 2H65A 1C4WA 1CJUC 4MVJH 5CVVA 3D5EA 3WWCA 5SYMA 4IJ5A 4GW3A 5KNDD 5LMNB 2FPXA 2J3EA 1T10A 1VPVA 2WKSA 4L4XA 4NCNA 5C5DA 1L0BA 2I2AA 3D2AA 4M0PA 5A4AA 1VZ3A 4B3SB 1PSDA 1JJ7A 1NGSA 1HDGO 1U7OA 1YB7A 1OBVA 2LBPA 3LPMA 4OEHA 1EWRA 2GMWA 4PZYA 1Y4SA 4J90A 4XEUA 5A3JA 2EJVA 3PXEA 5CFRA 2NU8A 4PZZA 5A7FA 1BWQA 4DA6A 3UZUA 4GMXA 1AGYA 1NVKA 3CBQA 3PA8A 5E7IA 3AI2A 4Q4HB 1C7FA 1CP2A 1DC6A 1JEOA 5F21A 3ERCA 1K98A 3U9SA 3SDBA 5K3CA 2IV3A 1LLFA 1YS9A 4RPHA 3RUIA 3VZBA 2R6HA 4MWBA 4PBSA 4NFSA 3GLFB 4N5HX 1Z6AA 1EFRD 4UEWA 5HTOA 2XGJA 4U6NA 2BISA 2EFJA 2AFIB 3UJDA 5JAOA 4G9EA 1M6EX 1XZMA 1UKYA 2V9PA 4GZ5A 1WU8A 2JLAA 3KZOA 4KTTE 2QMYA 3I1YA 4NCIA 4R3UC 3LK6A 5JAUA 5JAIA 3UAVA 3FGZA 5E6RB 5BN1A 1NPDA 1NUTA 2C7RA 5AI9A 2IYWA 3VDNB 5TQ2A 2EGUA 1I6KA 1U0LA 2P0EA 4WIAA 2F00A 3AZQA 1XVIA 4A6PA 3VA7A 1HFWA 1RWVA 4N7JA 5E3JA 4LUCA 3VBEA 4K2HA 4W5TA 2YW2A 4ZVSA 3CQ9A 4DYHA 5AK6A 3ER6A 4G5QA 3MAGA 4EENA 1CYEA 1B93A 2CMHA 3V4PB 1EFLA 2C88A 4UMDA 2PIAA 4MHTA 1PD1A 5H3HA 5JRJA 3E6AA 2C2HA 1T36A 4TTQA 1N1GA 1HMPA 2HA7A 3HE3A 2YFHA 3H5RA 2QNIA 1YU9A 4P7JA 3N76A 1Y3AA 3JWIA 1ONNA 1UZLA 3JRNA 5JZVA 3T1HB 4MCHA 4ZRMA 1AF7A 1RSZA 4MWOA 3HXPA 3HJCA 1ZSVA 5GPBA 2FSVC 2ODAA 3E05A 3KFXA 1PSWA 5LBIA 4ZI7A 4E5UA 3NEJA 4HBZA 4QGBA 5TQ0A 3IS3A 2BE9A 3QVGB 2MSCB 1DC7A 3N5KA 4MI1A 3TEJA 4CF7A 3EEBA 1SFRA 2PUCA 4L9AA 1VHJA 2QJOA 4K28A 5BMVF 4IPTA 4BGDA 2JGDA 1TEHA 1I10A 4O08A 4YLEA 4ESEA 3WISA 1MW8X 1CULC 1VLLA 3GDGA 1G5QA 4OBXA 4C08A 1RQ7A 4DA4A 4BKUA 4V1CI 1O3YA 4CM4A 1C3EA 3CG4A 4JUFA 4AQ7A 1H2YA 2OOKA 2CJFA 3F0TA 1OLUB 3QIAA 3S0JA 5B3KA 5LLTA 3TQOA 4RFSA 4G0VA 4FDVA 4HAZA 3QUQA 2ZJ5A 2QTMA 2XCSB 1YS2X 1NL3A 3H04A 3GP3A 4MV1A 2P8JA 1E4OA 2DPYA 3KUKA 4CEHB 3G2OA 3H83A 4TLBA 2WWFA 4LJSA 1T25A 1AIPA 4GR9A 3PEUA 1FMCA 1Z4OA 2HW8A 4DCOA 4LSMA 4PY2A 2CJPA 3C3DA 4QM7A 3LIIA 4D0LB 1F4LA 3AY7A 3OT5A 2VHYA 4BLUA 3WMRA 2ZYVX 1F5SA 3VMMA 3AVXA 2IY8A 1N6LA 3OZCA 2ES4A 2TMYA 4E31A 5JNVA 3CW8X 4H1UA 3AZPA 1RJGA 5F5LA 2O2IA 3LUJA 3ZH2A 4AK9A 2FNAA 2HD4A 2HIAA 4P4GA 1M7BA 3AINA 4TLCA 2WI8A 3W3AH 2LPMA 1C0LA 1JJBA 1EVZA 1NF9A 3JD2A 2YRXA 3D81A 2I3DA 2ZBQA 4EI9A 2FSHA 3BEDA 4AXXA 4MP8A 5FOWA 2BZ0A 1FP4A 3ROTA 4QGSA 2IZ5A 1KYWA 3SPXA 2QAJA 3EMDA 2LWIA 5BR8B 5JC1A 1Y63A 2QDXA 5A9SB 1PFVA 2YS7A 1E64A 1ENOA 1XDWA 4ONEA 3UBMA 1MIOA 5IH7A 1FL9A 2IHNA 1VHWA 4ZTBA 4KRGA 5SZHB 5J4LA 1RPZA 1NE2A 4OP3A 4MYDA 4MPDA 1JN0A 1SZCA 1XMJA 3FUTA 3DFMA 4IDFA 4DBLE 3ZY5A 3NYQA 2R5NA 1AKYA 2P11A 2FPOA 2ATEA 2A88A 5CFQA 3ROXA 4R7ZA 3MCWA 1UK7A 4KQIA 3GUZA 1ZESA 4BJ1A 5IXSA 3ZNPA 5FUXA 3D9QX 1KPGA 5E1MA 3UWPA 4E33A 5JE8A 2REBA 1X7DA 4Z4HA 5GZ6A 3U7GA 2WMYA 5DLEA 3WNZA 4Q1AA 3UAOA 1U0RA 1DJLA 4QU5A 4CMEC 1E9VA 4H4EA 4OB7A 1XQYA 5C5IA 1JYEA 3QYFA 4MARA 2IXGA 2B8JA 4DG9A 1NBWB 1SIOA 1LW6E 4LYYA 3VGJA 3MQ4A 1K97A 1M2EA 2DJ5A 4AJHA 4IG9A 1R5OA 1JGTA 2X76A 4DQKA 4JLJA 1UPXA 4R2WA 3JQ8B 4GM1A 1J6UA 2V7QD 3GFTA 4TTTS 3WQQA 4XYEA 1Z56C 2ZWMA 3PC6A 4G5OA 3T12A 3QKSB 1X8XA 1ADBA 3PLNA 4P32A 1SKBA 3BDAA 1O87A 3L7KA 2IOQA 4FFBA 3PKJA 1AUOA 4LVOA 5FNVA 1VYHA 5KYXB 1TJ5A 4DSUA 1BRTA 3QENA 1PR4A 2B4RO 4TMVA 1ZNQO 1KAMA 4KQEA 4XA8A 1U2GC 1BCRA 4HDMA 2B7LA 5JQGA 1A96A 2FPIA 2Q50A 1CXZA 3LO8A 1GCAA 2XHZA 3EHEA 4JSYA 2HI0A 5JEEA 2IODA 4UARA 1L5OA 3FR7A 4MUGA 4RPCA 5K3DA 3P0JA 3CZ5A 4Q82A 2LCQA 2C5LA 4RAOA 1C80A 3UJAA 2C9DA 1ND6A 3I2JA 3LOUA 1EU1A 1M34B 5AP9A 5ILGA 3T6KA 2D1QA 5FWYA 1EWKA 2HDNB 3UWOA