3R8CA

Crystal structure of cytidylate kinase (cmk) from mycobacterium abscessus
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
220
structure length
198
Chain Sequence
SMVVAVDGPSGTGKSSVAKELARQLGASYLDTGAMYRIVTLWVLRAGVDLTDPAAIAAATDQVPMSVSSDPDAQTALLAGEDVSVPIRGNEVTGAVSAVSAVPAVRERLVRQQRELAESSGAVVVEGRDIGTVVLPDADVKIYLTASAQARAQRRNLADVQRRDHLPLRPAEDALEVDTSDMTQEQVVAHLLDLVRTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Cytidylate kinase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium abscessus
total genus 68
structure length 198
sequence length 220
chains with identical sequence B
ec nomenclature ec 2.7.4.14: UMP/CMP kinase.
pdb deposition date 2011-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3r8cA00
1RIFA 3AV0B 2FJUA 4LYHA 5DI3B 1K6MA 3UPUA 3FMOB 1US8A 4D0NA 5AK0A 1RKBA 1P5ZB 4M1YA 5FBWB 4HB3A 3V4RA 4B2PA 2VPPA 2JEOA 4EUNA 1M1YE 1E32A 2ZYVX 3AEZA 4GSYA 3CH4B 3FTQA 2OT3B 4HAYA 4BE7B 1ZC3A 4LJ7A 2H5EA 1IONA 2NZJA 2QORA 1KNXA 2O0KA 1UFQA 2VLIA 2CK3D 1TTTA 2CHQA 4M0LA 3W6PA 3HP1A 5D3MB 1TADA 3N5CA 1NBMA 4FXPA 2QP3A 1KAGA 2AK2A 4LZZA 2ZI9A 2ZIAA 3M0EA 4TLAA 2RGCA 2RGNA 4D26A 2FFBA 1E2LA 1T8UA 4D81A 2GCNA 2KI5A 2PT7A 4MYCA 2XITA 5FOWA 4G5RA 1EX6A 1Z47A 4DHEA 1RRCA 1QHHA 3L82B 5DIFA 5JRJA 3EW9A 2QRNA 2IYSA 5J47A 4ZDWA 1NJFA 1TL7C 2Q3MA 2W6IA 1ZNXA 4W5WA 4X8HA 3I32A 1AIPA 1E6CA 1GIAA 2J5XA 2IC5A 2IYRA 1E9AA 3SBEA 3GLGA 1NVXQ 1ESNA 2QGZA 3PXGA 5DYIA 5IF9A 2PX3A 2EFGA 4ZCMA 3GLFA 4BEBA 3RRNA 4GOXA 3KL4A 2OE2A 1XDBA 2VL7A 3RANA 2QAGC 2YYZA 1P2VA 2VIIA 5EE5B 2QMHA 3MWKA 4DWJA 3OFNA 2CJWB 1KJZA 4OBEA 5C46F 2H92A 5AJWA 3MG9A 5LBIA 2CLDX 5H8WA 1YE8A 2ZJYA 4C0AC 4MA4A 5CJ2A 1YZGA 4WXRA 1P9WA 3CRRA 2ZRFA 5JSZB 3WP1B 1RRPA 3ADBA 3ZZTA 4OK6A 3RS3A 2CE7A 2GBLA 3H4MA 2WKRA 2GWHA 3TNFA 1HEIA 1OPXA 4Q7JB 4B6FA 1OIWA 3HPRA 3B8HA 2G1KA 3CRVA 2EYQA 4TT3A 3AKCA 1S3GA 1SXJA 1RE0A 4IXNA 5FOVA 2PJZA 4KU4A 1Z3IX 2V1UA 4C4PA 4IW3B 2OCYC 3TIFA 1S0UA 3QG1A 1K5DA 821PA 1FZQA 1VKJA 4AKHA 1IY0A 2FMXA 3H1TA 4PFSA 5J5CA 2IS2A 3GLHA 3KKPA 2IXFA 4MQBA 5FOTA 3AF1A 2ZS8A 2AFIE 3U3OA 1E0SA 2I4IA 4BQSA 1L4UA 5DE3A 2F1IA 2PEYA 4B74A 4BRWA 3VR4A 1E2KA 2CLCX 1G7RA 3WHKA 2V7QA 1Z2AA 5CK5A 1UEJA 4NCKA 2RHMA 3P26A 1XXHA 2QBYA 3FYHA 3LH5A 1PLJA 2Z4RA 5DGXA 2GXUA 1XEXB 3LQRA 4IXMA 3AGQA 4M1WA 1Z5ZA 4FCWA 3CZPA 3CF0A 1JEEA 2QEQA 4FD2A 4EIWA 2BM1A 4LYFA 3PJRA 3AM1A 1KZ7B 2CHVA 2FWRA 4U7DA 1CEEA 4GT1A 2JIZD 2A2ZA 1XTRA 4HYYA 2HLDA 4Q66C 1W36D 5TVKA 2WAXA 1CS4C 4E5UA 3G5UA 3ZQJA 721PA 1EFUA 3A1VA 3Q9LA 3ZS9A 3CKLA 3QIAA 1DAEA 2HF9A 2WWWA 4QHTA 2XXAA 4ACAA 1CR4A 2ZRLA 5AJXA 4ZCIA 1E99A 1IN7A 2JDID 1UADA 1N5KA 2FZLA 1ZIOA 3B60A 4Q4JA 1KMHA 1F3OA 3OAAA 4P3YA 1GAJA 5FOXA 4NZYA 4MGIR 5FTLA 4FMBB 3TR0A 2HJGA 2QNRA 2R6FA 3B78A 2ZREA 2XEXA 4D6PA 4DZZA 1DAKA 4MGYR 4TYYA 3ZD7A 3U7FB 1B23P 4Z51A 5F98A 4LJAA 1Q44A 2XB2A 3R9XA 3ADCA 4XVRA 2CNWD 4MKFA 4OJKA 1XPRA 2IYUA 4URZR 4M21A 1N6PA 2Q3HA 3FFAA 4E03A 1IN6A 1WCV1 1IN8A 4LPKA 3SI7A 1M7GA 1XD2B 3DHWC 3U2QA 3SYKA 4I1VA 2RGGA 5JHHB 1Z28A 1WQ1R 4MYUA 1IN5A 5EQTA 2BEKA 5KUTA 2R62A 1D9XA 1WMSA 4HLUC 4OYHA 3PEVA 3R20A 1N6LA 1A2KC 1EGAA 1VMAA 3B1YA 1YZLA 1N6RA 5FBLB 1IN4A 4WBSA 1P60A 2O8EA 2CLSA 1Z22A 3QJYA 1SVMA 1W4AA 1RW4A 1OYYA 4CEHB 1T3HA 4Q00A 3RWOA 1FP7A 4AWXA 1HUQA 2ZRBA 2QL6A 1G21E 2DFLA 1Q57A 3LV8A 4OKSA 3ZDQA 4DSOA 1N6NA 3I8XA 2VYFA 2ZR7A 3PG5A 1CF4A 3N2IA 2EQBA 1CJVC 4M22A 4XD7D 2D7CA 1G7TA 3LAWA 5FPHA 1WE2A 2JA1A 4O2LA 4Q21A 3L0IB 5TY0A 4LOAA 5IK2D 1T4GA 5KSZA 5CB6A 1TUIA 1KDRA 3THYB 3CX8A 3REGA 1OFHA 4HZIA 3I73A 3QNUA 2QSYA 4XJXA 4EJSC 3ZIAD 4WZBE 5BYJA 3RRYA 5KDDA 2P65A 4A0HA 4F93B 1US8B 5AR1A 3LX5A 2JCSA 4XSGA 4XWAA 1AZSC 1ZM7A 2ZJBA 2ZRJA 4QHSA 3B13B 2R2AA 5JS7A 4PQRA 3CW2A 2WSSA 3LRPA 3KQKA 4P4SA 1WP9A 2WPDA 1VCIA 1JEDA 4J0QA 1UAAA 3KXKA 4BWYA 5JWHA 4PPGA 3P32A 2NO0A 1FFHA 2WWFA 3C5HA 2ZVPX 4C0LA 1HQCA 4JIMA 3THOA 2P5SA 3H0KA 4W7SA 1EFRD 1UDXA 1W49A 5FPKA 4K46A 1II0A 1AS0A 2RB4A 5A5GA 3WYAA 1GDDA 1ZJ6A 1G8FA 2BC9A 3E70C 3K9HA 3PUXA 1OJLA 3VAAA 1KO8A 3PEYA 4DIDA 4EPXA 4TZ0A 3ASYA 1AGPA 3B9QA 2CEAA 3NHBA 4HATA 5JJLA 3KJHA 3C8UA 5JRZA 1AS3A 4TTQA 4BLTA 4NU0A 2WM9B 1E1QD 3MMPA 4FMDB 1RFLA 1XJ0A 3Q85A 4V0OA 2ERXA 1P73A 1NP6A 2BDTA 2OO7A 3AF3A 4YC7A 1E9RA 1X1SA 3Q7QA 4M4SA 4JJKA 4ACBA 3L0OA 1E9FA 4CT4B 1JR3D 3SQXA 3PEWA 5FR1A 3ZD6A 2O0JA 5HKKD 3W6OA 3AKEA 3BH6A 4FMDF 5E4FA 3S1AA 2IS6A 1ZNWA 4KFSA 2LWIA 1Z0IA 2ZS7A 4GRAA 4DVGA 5JLJA 2ZRAA 3P4YA 2JATA 4GOKA 4D0GA 2YWEA 4PQFA 3AVPA 4URYR 5C4MA 2IXEA 4ESVA 1CR1A 1JAIA 4HAXA 4GBMA 1KK0A 4PC6A 2HT6A 4PO8A 3G82C 1UBGA 3B9PA 3ZZ0A 2ZITA 5FTKA 4GP7A 5FBQB 4CYMA 2JLRA 3L2OB 1IXZA 4RZXA 3WBKA 2ZPTX 1T0JB 4LCBA 1AJEA 4LX0A 2OCPA 3WHLA 2WWXA 4C7OA 2F1RA 3RRZA 3CM0A 1FNMA 4LI0A 2W0SA 2NO1A 1XZQA 2P6NA 4Z1MD 1IM2A 2CCJA 2PMKA 2NPFA 1SXJB 1D2EA 1R8QA 2Z43A 2Z4SA 2Z83A 3QKSA 1OH5A 3THXB 4PPFA 2NIPA 1X86B 3QXJA 3W5IA 5SZHB 1NNEA 1P2SA 1DO0A 2IUTA 2JGNA 2F55A 5GVRA 1U8ZA 1UKVY 3UWKA 4RFSA 1HE8B 4I4LA 4H9GA 1U98A 3GLHB 3KB2A 1U9IC 4BFYA 2OEPA 2BEJA 1KMQA 1E9DA 1ZU4A 1XPUA 2OFWA 1CIPA 2OLKA 5FUXA 1ZM9A 1BMFD 4LHZA 3W90A 1OSNA 3BE4A 1KSFX 2ZAOA 5AWFC 5DI3A 2HEIA 3DEFA 2QBYB 8OHMA 1BKDR 4LC0A 4IOJA 2WMOB 1TEVA 1VPLA 3CPEA 3OHMA 4Q9HA 5IDVA 4HLUA 3ZQ6A 1YR7A 2EW1A 3EZ7A 4M9QA 4WZAE 1NI3A 1E79A 1W48A 1ELOA 1XRJA 4NKRA 3AVWA 2ZS9A 3MFYA 5IHPA 1OKKD 3E5HA 5FR2A 3FMIA 2XSZD 4LBZA 3TKLA 4PHGA 2AR7A 3CZQA 3WMEA 5L3VA 3WP0A 4Q9LA 3WNDA 3X1ZA 3NXSA 5JI2E 1NSFA 2G1JA 5D3MA 1Z2CA 2J7PD 3AH8A 3BGWA 2ONKA 1NG1A 1Q1EA 1ZVQA 1TQ4A 1G4UR 1N6KA 2OM2A 4M8NE 4N0EA 3C14C 4TTRA 1E2EA 4M1OA 2GVDC 5K8LA 2X2EA 3NHAA 2ZRNA 3PUYA 4Q4JB 1U81A 1CTQA 4V0LA 2D62A 4DLWA 3ZH9B 2A78A 1ZYUA 1MKYA 1H65A 1ONBA 2BMEA 5DHAA 1EX7A 4HSEA 3IGFA 2C8VA 2DY1A 3NH9A 1E98A 2O52A 3LD9A 4QC2A 2VSXA 2JJ8A 4K81B 2HDNB 4NHOA 4TSFA 3Q8XB 3K70D 3Q72A 2GAAA 4DEYA 1F2TA 2UVQA 4B35A 4OK3A 3CR8A 2JLWA 2ZXUA 3Q3JB 4TTPA 2RGXA 2GK7A 3C7KA 3VKWA 4TYWA 1G8PA 2CDNA 2R6GA 1FNNA 4KODA 4JLAA 4JYCA 5E95A 3TSZA 1E1RD 1AM4D 3QG5A 3I5YA 4AG5A 2OUKA 4EPYA 3V4FA 1GTVA 2CJWA 2Z5FA 4Q4HA 3U7GA 1XPOA 2O8EB 4DC9A 1N3BA 5JCPA 3VR6A 1A7JA 4DLSA 4PSVA 2ZTSA 3ADDA 3WYGA 3W8NA 5KSPA 1EWRA 3JVVA 4HB0A 4IDHA 4Q9IA 3SU8A 4BLSA 1TF7A 3QBVA 2WVJA 5JSZA 2AXNA 2P2LA 4PZLA 4L9WA 3AVVA 5J4YA 1P6XA 5CYPA 2H16A 2BBSA 1R10A 1E2QA 1I4TD 1QF9A 2BM0A 3CR7A 3GJ4A 2JASA 4ZPXA 5F3WB 3NDPA 2B7BA 2C03A 4HI0E 2B8TA 4I1OA 2PZFA 4C30A 3VMFA 5FFMA 5FPSA 1Z0KA 2PL3A 3BS4A 3NWJA 4NBSA 1KDTA 5DHFA 1A4RA 1AGRA 4P31A 1FQJA 4JLKA 5HE8A 2WIBA 2J1LA 3SOPA 1QHSA 5SZIA 1Z6TA 4A8JA 4FIDA 1KI6A 1JAHA 1LFDB 3RS4A 2QT1A 4AG6A 3GFPA 3RLFA 4FN5A 3TUJC 1JQJC 4YMVA 2QAGB 2ORVA 3F8TA 3A36A 4PR0A 4LYAA 4DUGA 1T3LA 3DPUA 1D6JA 2ODBA 3KJGA 4P4SB 5G53C 4Z8YA 1NBMD 4NP6A 4TYPA 3K0CC 3BB1A 2A5DA 4QNMA 2BOVA 4EPWA 2NPIA 3UIEA 3X1XA 1KI8A 1U2RA 2DBYA 4ZKDA 2XJ9A 5GADl 2IYLD 1SVKA 4NCJA 2EFCB 2ZE7A 1KK2A 1Z6XA 1M7BA 1EG7A 1JECA 1XEXA 5EXXA 4YDHB 1XEWY 3LO5A 2FA9A 2WWIA 4AK9A 2QMOA 3GJXC 1NMYA 2W6ID 3K9GA 4TMWA 4NE2A 5DYGA 3SQWA 2ZETA 2R44A 3NC0C 2UKDA 3OIUA 4URUR 3TAHA 1E2HA 1S8FA 3K53A 2ZE6A 5FBRB 3UANA 3KKOA 3DL0A 5JS8A 1BO6A 1G6HA 4G5OA 3LXRA 3OE7D 1CULC 3CNLA 3TQFA 3V00A 2H18A 4LRWA 3OIYA 1ZCBA 4US1R 4CZ2A 3TMKA 1U9IA 1E2DA 1UPTA 1C9KA 1SVSA 3PFIA 2KE5A 2C9OA 4Y0AA 1E0KA 1D2NA 2WOJA 1TQDA 1YJ5A 1XP8A 4G5GA 4A92A 3IKJA 5JJKA 4M1SA 2E9SA 2WJYA 3K1JA 4A1FA 3K0SA 1X3SA 2A3RA 1SKQA 2YNMA 5DO9A 2PJRA 1XX6A 5EUQB 2QROA 2F1HA 5FOUA 1ZCAA 3GLHE 1VYTA 1C4OA 2ATVA 5KTYA 3F3YA 1VIAA 3AUXA 3ETLA 3W34A 2RGEA 1GFIA 2WJGA 5DH9A 1GKIA 2BIFA 2N1BA 3GJ6A 4NDZA 1XD2A 5LPNA 4B75A 1R6BX 3PUZA 3A6PC 1Z29A 1DTSA 3CX6A 1SXJD 4OQMA 5JFGA 4YMWA 1U8AA 1VTKA 4TL6A 2OFXA 3CNOA 3EIHA 4GL2A 1KI1A 2A5GA 4RCYA 5C2JB 2NMVA 4Q4LA 2VA8A 1RRFA 1G5RA 3BRWD 4X8LA 4AC9A 1I4LD 1Q22A 4B73A 2W00A 3X1DA 4JBYA 2GXAA 2EVWX 5LB4A 5DI9A 1WDTA 5BN5A 1KK3A 5HPYB 4NH0A 4G01B 1XTIA 3QKRA 1N5JA 2HCBA 4TQUS 3D8BA 1E2MA 5G40A 3UK6A 2J0QA 4JJZA 2YKGA 4HB4A 5FOSA 4RFSB 2IL1A 3MSXA 3RAPR 1J99A 2YINC 1OT3A 5J4HA 2YWFA 3SEAA 2ERYA 2QN6A 4B48A 4DSUA 1FUUA 2YV5A 3SJBA 1DOAA 2ZJZA 4OQXA 3ZLJA 1VECA 1FQKA 3AKYA 2QGNA 4ZCLA 1HQYE 121PA 1P2UA 2WWGA 3KKMA 3MGCA 1LS1A 5HCNA 4LPSA 3UMSA 2C2HA 4YDSA 3TW4A 4RVCA 2VTKA 4C0HA 1U94A 1DE0A 1M8PA 4KJZA 5E3HA 2HLDD 1CKEA 6Q21A 2FPLA 5BXQC 1PUIA 2ZI7A 3I5XA 2AFHE 3TK1A 3U7HB 3RVBA 2QPTA 2VO1A 1UJ2A 4PO9A 1SGWA 1HT2E 1OH7A 4C3ZA 1DBSA 3QENA 5L3SA 2KJQA 1NN0A 2P3SA 4IDOA 1IOZA 3EZ2A 2QP4A 4IKEA 1E4VA 1TU3A 2CL0X 5BN4A 4PHFA 2VH5R 2WTUA 3B82A 1ZIPA 3KFVA 3OAAD 3TLXA 2QPAA 2IYQA 4IOMA 1A1VA 3RABA 3GJ3A 3QXSA 4AKGA 1NLFA 2FFQA 2HUPA 2XZPA 2WBLC 2Q0HA 1UBEA 1SKYB 3U6KA 2CL6X 2C96A 3TRFA 3GD7A 2IK8A 4UNPA 2HT1A 2REBA 1DAIA 1G16A 4EJSB 3RC8A 5M04A 1GL9B 4MRVA 4MKGA 3SYLA 3LVRE 3QPWA 1F2TB 5L8VA 5CDFE 2CL7X 2GESA 4BLOA 2EFDB 2B21A 2QRZA 2J9RA 2XGJA 2A5YB 2GDJA 1AA9A 4TL8A 2VP0A 3K0CA 2GF0A 2HXYA 5TXGA 4F4JA 4ZDJA 2ZSEA 3KTAB 4QNRA 4ZIRA 2KSQA 4S2EA 1RYHA 5KSYA 4Q4HB 4KVGA 1KOFA 2QTVB 4MKHA 1M2OB 4BEJA 3KJIA 4P0TA 1KI2A 4QJ3A 1T0HB 2GNOA 1T3SA 3B2EA 1XB2A 3CF2A 1NJGA 3I92A 5JWOA 3FKSD 3DDCA 2JLYA 1B0UA 2BJVA 4GOJA 1OB5A 4IDNA 3CBQA 3CWZA 4LBWA 2Q6TA 4KBGA 3DZ8A 4LJ9A 4QBFA 4R2HA 1NN3A 2ZANA 5JECA 2E87A 1TEXA 3NBXX 3KUDA 4Q48A 2I1QA 3TSWA 4YXWA 4OHXA 2C9CA 1SHKA 2Q9CA 3GPLA 4A2QA 5GJVC 4ZO4A 3WY9A 4DIEA 1QVRA 1FW6A 2AHOA 3THXA 2ZM5A 5BW8A 4DCNA 1VIYA 2V3CC 2I1VB 2WPDD 4A8JB 2OBNA 1KI6B 2OV2A 3UWOA 1OXUA 4D4KA 1CJKC 4DXAA 3QF4A 4R71A 5KNBA 2IS1A 1VYVA 3DKPA 2YHSA 2VP5A 4QRHA 4RFVA 1ZC4A 3UATA 4V0MA 5G3ZA 2XTNA 3ND9A 1DEKA 4POAA 1EESA 2BMFA 5CB8A 4LHVA 4DB2A 3ZS8A 5GVSA 1Q21A 2FGKA 2WJIA 2WZQA 4B6EA 2JLXA 1FTSA 4UJ5A 3K09C 3T61A 2GZHA 3AP2A 3IDQA 4XOIA 3PITA 3MD0A 4XH9B 3T34A 3RRMA 4DEXA 4DRZA 3PCRB 3EX7C 4KSBA 4PAOA 1JBKA 1MR3F 1W36C 1V5WA 3HYRA 1RVDA 1XBTA 2F9LA 5G41A 1W0KD 1G4AE 1XNJA 3RSLA 2Q21A 2FZ4A 4U00A 3NBFA 2ATXA 4BZXA 3PEUA 3RSOA 3MCAA 1I2MA 4B43A 4OI0A 2O8DB 3SBDA 3GEHA 5E7JA 2C5LA 2W2VA 4ON9A 2PLFA 3FMPB 4A0GA 2IS4A 3UMFA 5JWRA 4Q1EA 1DAGA 1KSJA 2FF7A 3RS5A 5JZVA 1XZPA 2BCGY 3EPKA 4CT5A 5LD2B 1IHUA 3CB4A 3OF5A 3H2YA 1CXZA 4L16A 4RZ3A 1NRJB 5EE1A 4C0KA 3P4XA 2YOHA 2DWOA 2DB3A 1QG2A 3NEYA 1P7CA 1J8MF 1NSTA 4YMUA 4LV5B 3HU3A 5KPJA 2AD1A 1G20E 4XVUA 2N42A 1WBBA 3I62A 3B85A 1VG0B 4A4DA 1XMIA 4W5HA 3CPJB 3ZVRA 4GDFA 4UNQA 1HYQA 2J45A 4EPTA 1N2CE 3LW8A 2IUUA 4QXAA 4PHHA 2W2XA 3GFTA 2CK3A 1WF3A 3KKNA 3CWQA 2UZ3A 2F3TA 4Y0VA 1S9HA 4JYBA 4DLXA 4HAUA 1UKZA 4MDFA 2QE7A 4ZDIA 5ANRB 4F7WA 3L0PA 1D8TA 2H17A 2P6UA 3AB3A 3GJ7A 4RCZA 2D4HA 1AQYA 4IOLA 2QENA 3EWSA 1OH6A 4N0DA 4WIAA 1JXMA 3TSOA 1XTJA 3QKRB 2UZIR 2OG2A 1G3QA 2MMCA 2FU5C 1W4BA 2NGRA 1J90A 3BBPA 5DN6A 1ZUIA 1V43A 3EC1A 3IBGA 1DAMA 4CEJA 1O87A 5H70A 1G3RA 4L8GA 4AY2A 3QVVA 2V6JA 2DWPA 2YJTD 3VR2A 3KDSE 3H86A 1IY2A 2W6JA 3F5FA 3W5JA 3WRYC 5LB2A 4L15A 5CDFA 2TMKA 4LBYA 5H1YA 2IF0A 2VHCA 1KJYA 1VCOA 4URWR 4DLRA 1TU4A 1L7VC 1Y3AA 4B47A 3SHWA 2ZUDA 1E9BA 1SKYE 1T5IA 4RSGA 1W5TA 4JKIA 5TARA 1E79D 4MRNA 1DO2A 3B5JA 2O0HA 3I3SR 4ZI3A 4NCIA 1MABB 4HUQA 2QAGA 1L8QA 2JLZA 3OIVA 3GFOA 1X1RA 1N0WA 2V4ZA 4KVAA 3SR0A 3X1YA 4QG7A 2MSCB 1A82A 2V54A 2B8WA 3QKUA 5EE9A 5L3SB 3MRSA 3NG1A 3LWNA 3CUEF 2XNSA 3SHFA 2CCKA 5JEDA 1SZPA 2J41A 3B6EA 1D5CA 2D3WA 4CGZA 1NLYA 4C0QC 1IJFA 1XTKA 4MYHA 4GPTA 4KLNA 2VSFA 4IFEA 5KOYA 4JLDA 3FMFA 3LY5A 3IHWA 4JBWA 1NMZA 1JPJA 1F60A 3U3KA 4DJTA 5KYKA 1GSIA 1Z06A 3OEHA 4JS0A 4TN1A 3CRQA 3DM5A 3NVAA 4DKXA 2OFOA 3P27A 3U60B 1I2DA 5FL3A 2ZYUX 1E0JA 2N46A 4S35A 4EPRA 1G3UA 1YZQA 3C16C 3RS2A 3VFDA 2Q3FA 4BZQA 1Z0FA 5AJVB 4JLPA 3A37A 2YWHA 2IT1A 1JR3E 1DADA 2IYVA 1E4YA 4BLQA 2BJWA 1Z0JA 1HTWA 2VHUA 2REOA 2J0SA 3BORA 2IYTA 4BLRA 2F7SA 2RCNA 5F2EA 3A4LA 2ZRIA 4KFRA 4O25A 4ZIRB 1Z6AA 3HWSA 5HCIA 4QKQA 2ASEA 2VP2A 3TJZA 2ZU6A 1MO6A 1QHXA 3WYFA 1KJWA 4H1UA 4KFTA 2X19A 3NTUA 4B76A 1E2PA 4TMZA 4Q7MB 1QHGA 3K09A 3WMGA 2FH5B 3EC2A 4LJ8A 2GJ9A 1PLLA 3LLMA 1FX0B 2JIZA 2PZEA 2PMDA 5HE9A 1G19A 1X8LA 3FFBA 4A2PA 1KI3A 1DS6A 1Q12A 2CCGA 2FPMA 4Q18A 3VHLB 1NVVR 4DLYA 2R8RA 1XMJA 3SS8A 1IQPA 2DCUA 2JLVA 1TX4B 1PZNA 2BCJQ 1KI4A 2D7DA 2JDIA 4D4LA 3MAAC 1G64A 1W47A 1S1CA 2OAQ1 4RD6A 1LW7A 4JVMA 2RHDA 5EE0A 4DUGD 5JI3E 3U7EB 3PUWA 3BFXA 3VX3A 4MRRA 3U3RA 5IT5A 2EU8A 2ZUBA 2PZGA 2GJSA 5DNYB 4Q9JA 1KNQA 3EWAA 4HZUA 4UXHA 4Z8XA 3T06B 2C9YA 3LBNA 3QF4B 4LSGA 2PH1A 4I81A 4UNRA 5GJBA 4QHYA 1KHTA 2J46A 4Q1AA 3J81k 4B2IA 1IXRC 4JBXA 1FP6A 1G7SA 2RGAA 1MRNA 2ZRDA 4PPQA 4AD8A 4TZ6A 2OXCA 3FB4A 1CU1A 4JVNA 1LF0A 4RZUA 3KUCA 4DLZA 2GHIA 2GZAA 4N3NA 3VKGA 1R5OA 2ZE8A 3BD9A 3TUIC 3RYTC 4JT2A 2GKSA 2R65A 2XOKD 4B33A 4ASUA 4C0BA 1BIFA 4IVPA 1R0YA 4KXFB 4RD3A 3DVLA 1ZM2A 4G5SA 4RD0A 4XTRA 2XZOA 3B7GA 1IJEA 4OHWA 421PA 1CJTC 3HU1A 1XF9A 4PAQA 5FI0B 2CVHA 1KTVA 2VF7A 1IAQA 4BPBA 2ZUCA 1Z08A 3IO3A 4IVQA 3W9YA 5J4KA 1COWD 3AVQA 2OCAA 1OXSC 4PX9A 4Q1DA 1S96A 3A1WA 2C78A 5IK2A 1QHNA 3BC1A 1OHHA 2NO9A 2O8CB 1ZM3A 1UF9A 4BFTA 4I99A 4QGAA 4L5BA 4DLVA 2QMEA 1G3IA 4BFSA 4QM7A 3ZVNA 3BXZA 4G5QA 4GP6A 3ZIAA 4PZYA 4B3XA 2Z0MA 2GCOA 2ZRPA 4YQFA 2ODNA 4IEEA 3K70C 4TLCA 3ZJYA 4QGGA 5B64A 1W0JD 3PV0A 3ADKA 5E7IA 4EJSA 1YQTA 5CIWA 3A1SA 4URVR 4M2LA 4D0LB 4QM6A 1KKMA 2IHBA 5TV2A 4FCTA 3UMRA 4JVSB 3IIJA 1MO4A 4NMMA 2WSMA 1YZUA 2QQEA 4DT1B 4Q02A 1ZD1A 5C18A 2ZSAA 5KHOC 1ZRHA 3BFKA 5AUQA 3VTKA 3KB1A 4DLUA 2IF2A 1DAFA 3KTAA 2DR3A 1IBRA 1UM8A 4YLGA 1N25A 4JKYA 1ZW6A 2ZI4A 1HURA 2DFTA 2VQSA 2W83A 5CLLA 4E22A 3SFZA 4CEJB 1ANKA 2GEVA 1DG3A 3UG6A 1YRAA 2OLJA 4R2IA 4UXIA 1CRPA 1KK1A 3KQHA 3SN6A 4C2TA 4Q7LA 4A15A 5L3QA 2D74A 2YZ2A 1JR3A 1KO5A 3TUZC 4LJ4A 3DZDA 1E0AA 3IHLA 1XJCA 5K8UA 3KKQA 1CR0A 1JNYA 3HJNA 2GZDA 5H68A 4LYJA 1NL3A 4HAWA 1JJVA 3GLIB 3UXMA 3T1TA 5BQ5A 2WWHA 1Z0AA 3FE2A 3CNNA 4FWIB 3SNHA 4HUQB 2RGNC 3R8CA 4Q1CA 4ZV4A 2GEUA 1P4SA 1OXXK 3LDAA 4II7A 3TVDA 3X1WA 3TVTA 1U99A 4R9UC 4G1UC 4N1AA 1HH4A 3DOFA 1S1MA 5D3QA 4LHYA 3Q5EA 1DG1G 4URXR 3U4QA 5EUMA 3WNCA 2W2TA 3QI2A 2GCPA 2ECKA 2P67A 1DAHA 3NDBB 2GA8A 3LQQA 4A6XA 1TQ2A 2G0TA 2XB4A 3IBYA 1CJMA 5FPTA 2X2FA 5B2ZA 2G83A 4Q47A 3U61B 2PEZA 3L8ZA 1ZD9A 1C1YA 3AUYA 2V1XA 1JALA 3FWYA 3VKHA 1LB1B 2AXPA 1GOTA 2FSIA 5AJZA 1E94E 1YVDA 2CBZA 4ZI2A 4WOPA 1D9ZA 1QHYA 4BZPA 5K8TA 4MH0R 3DM9B 2XNDA 4GI7A 2O8DA 221PA 5KDLA 2JJ2A 3M1IA 4R98A 5P21A 3BH7A 4DDVA 4CVNA 2FOLA 4LDJA 3OFND 2C77A 4C9BA 4BFXA 2H1LA 3L8YA 2RMKA 3HR7A 3HR8A 1N0UA 3F0TA 1W2GA 4LHXA 4KAXA 3CRW1 1Q0UA 3NH6A 2G9NA 3L43A 4UXJA 2GBLC 2OZEA 3PR1A 1ZMXA 2IX3A 3N70A 1R5NA 2ANBA 4HLQB 2FPKA 1FMJA 4LWZA 3A1TA 1ODFA 1NVVQ 2ZRHA 1T9HA 2GTPA 3K0EA 2HXSA 4DCVA 1ESMA 1SXJC 2PCLA 3OZXA 4V0ME 1G9XA 2ZR9A 3I4LA 4EPVA 5TB5A 3SJCA 2O8BB 4C0SA 1W36B 3BH0A 5EP1A 1S4QA 1GKUB 4TT3D 4DCTA 3IILA 2XZLA 2V9PA 2SHKA 3IPXA 1N5IA 3IEVA 1P2TA 1R8SA 1M34E 2EYUA 3U3JA 2OBLA 3BFVA 4JL6A 1TF5A 2AWOA 3DOEA 2ZYTX 4BLPA 2QAJA 1VCMA 4AI6A 4IHQA 1RZ3A 5HTKA 1QZXA 3SC3A 4C2UA 5DISB 1MV5A 4TQAA 4PZZA 4B3CA 1TF2A 3BK7A 3CH5A 1W46A 2ANCA 4M1TA 1UKYA 2Q9BA 1MOZA 2W0MA 2AKYA 2QG6A 3EA5A 5G3YA 4OI2A 1OFIA 3VU9B 4OQFA 1P75A 1AKYA 1TQ6A 4HZUB 4KFUA 4Q4AB 5ELXA 1YZTA 3GJ5A 3MJHA 3QPVA 5SZJA 2BWJA 2D2EA 2V7QD 1LNZA 3C5CA 4US2R 1OLOA 3ZVMA 2IYXA 2GF9A 1X6VA 2GXQA 2WHXA 5F9FA 3BWDD 4NONA 2FN4A 1P61B 1M6NA 2QU8A 3Q7PA 2QA5A 1T8TA 1H8HA 2XTMA 3ZGXA 1XCGB 1Q1QA 4UKDA 5A0FA 4E07A 4UQOA 3I72A 3T5DA 3G0HA 1W1WA 2WAYA 1X8JA 2OCBA 2R6DA 4BFVA 4F4CA 3AF0A 1GM5A 2QP9X 1KYIA 1MABA 3ICQB 2F6RA 4WXPA 3CO5A 3SJZA 2AN9A 2J3EA 2QUZA 2QMUA 4P4TA 2J87A 1P72A 3FHTA 1PUJA 3KJEA 3QXHA 4PHTA 4Q1FA 3RNLA 1CR2A 3BB3A 2BKUA 1XFAA 3PIRA 4L4UA 1FL9A 3ICEA 1H8EA 2CE2X 3DKVA 1D2MA 2FNAA 2YVUA 4IRUB 4US0R 2QZ4A 4D25A 2FX3A 4ZKEA 2JJ1A 4FMCF 2IA5A 4IDPA 4TLEA 2RGDA 2WKQA 1R2QA 3O8RA 4RD4A 3OEEA 1P9RA 2C04A 2QM7A 2V55B 1HE1C 3QY0A 4F38A 4PC2A 1Z63A 4TL9A 3E2IA 2MMGA 3TE6A 5KNCA 4UNNA 1XD9A 4A2WA 2GCOB 3GJ8A 5FTMA 4KBFA 4JSYA 2ODWA 3IQWA 4DCSA 4R7ZA 2RH5A 2VSOA 1U0HC 3V9PA 2G3YA 1BYUA 1F6BA 4TMTA 2X1VA 1J7KA 4NYIR 2OAP1 1AK2A 2BMDA 2J0UA 2WJJA 4MKIA 2PBRA 3CONA 4Q01A 2QE7D 3D6TB 3SE0A 2QTHA 4FI3C 2IUSA 2X8AA 2IWRA 2EWWA 2VP6A 3MLEA 3ONWA 4KYUA 1OB2A 1E69A 1EFHA 3T5GA 2OESA 1W5SA 3LA6A 1SULA 3RS0A 4AYXA 2ZVQX 3GLIE 1ZP6A 1VHLA 1SVWA 2XX3A 5E7MA 3D3QA 5DN6D 4TYNA 3BJIC 3EIQA 1NN5A 1KGDA 1G41A 1N6IA 1JJ7A 4QGHA 4U02A 1KSHA 3R7WA 3FPAA 1AN0A 3MWLA 3QBTA 1PJRA 2W6JD 1WBDA 2B92A 1FX0A 1GITA 4TLDA 4HDOB 4D4MA 4PTLA 3WMFA 2ZSBA 5FUYA 2G6BA 1TAGA 3FHOA 1BS1A 1ZD8A 3OE7A 2YC2C 3W3AA 2XTZA 5CLQA 4PC1A 1P9NA 4BUJA 2NO7A 4U5XA 5L3QB 4V0NA 5TMPA 1WB9A 2ZJ5A 5EE3A 5AUOB 2QSZA 4EQ6B 3A4NA 2AWNA 1G5PA 4LBVA 1P62B 1SVOA 2FE4A 4PC3A 5EP3A 3MWJA 2WSSD 1A2BA 1I4DD 4A36A 1UDWA 5BN3A 3QF7A 1Z83A 1AZTA 2IWHA 521PA 1JB1A 4HEJA 5UKDA 5FL7A 2JLUA 1XTSA 1GILA 1RJ9B 2VP4A 3TW8B 4Q7KA 2DYKA 2GJKA 5JMTA 4LHWA 4BRUA 2OXRA 3TGPA 1P3JA 3KX2A 3CF6R 2ZI5A 4TLBA 1YR8A 1G8YA 3EZ9A 2G0NA 3I8SA 4PAMA 4TMVA 5AJYA 3TQCA 3LLUA 3OIWA 4DBLC 3U4QB 5AUPB 2BBTA 1R4AA 1PVOA 4AYWA 4TMKA 1WXQA 2Z6VA 3B1VA 3EARA 2D06A 2P5TB 1W4CA 3WRXC 3GJ0A 4JLVA 3SZRA 4B3GA 2QTFA 4WW0A 3VHXA 3OEHD 2GJAA 3LFUA 4QBIA 5FTJA 4IOKA 2MSDB 2IYZA 2B6HA 4M1MA 1TPZA 2ZE5A 5C1BA 4F91B 1QG4A 3KZ1E 2B7CA 4BGDA 3GP8A 2RGBA 3VX4A 4JLOA 4PSKA 4TMXA 1NG9A 3L0SA 4F4IA 4KITB 5EXTA 4JLNA 3IO5A 3PVSA 3AGPA 4LV6A 2FSGA 2FSHA 4ILEA 3MWYW 3ND8A 5JHGB 4MDEA 2BVNA 5AUNB 3GEIA 3HYTA 3BOSA 2EWVA 4JZKA 4QL3A 1MRSA 1KY3A 1FOEB 3QXXA 4MYTA 2O8CA 2JLSA 2G88A 4C0JA 3TBKA 1HT1E 1E2FA 2DFKB 4OI4A 1AQUA 1E2NA 5KPDA 1YU9A 4M9XA 4PANA 2ZROA 4NCHA 1XD8A 2RAPA 3HDTA 3QEOA 3LBHA 1NKSA 1CRQA 1OH8A 1II8B 2NQ2C 5HZHA 1LF5A 2IHYA 4ARZA 5A4JA 3O8BA 4LGMA 4GMDA 2FEOA 1QBKC 3CIOA 1EWQA 4MRPA 2QY9A 2K5UA 4FW9A 2C99A 4DT1A 3K9LA 1N6OA 2IEZA 3AF4A 3OESA 1EFCA 4LV8B 1GZSA 1N6HA 3U44A 3QSYA 3REFA 1ETUA 1BOFA 1YKSA 2BBWA 2E1RA 2NZ8A 1XMVA 4X8OA 5LDDC 2QI9C 1PV4A 1GUAA 4LC1A 3QE0A 5JBQA 3THWA 3W8RA 5BYKA 2KBEA 2FV8A 2VF8A 2F9MA 1VDZA 3AVOA 1SQ5A 4A6PA 4EKDA 2VP9A 4H1VA 3EPLA 4JLMA 1GVNB 4Q5IA 1NIJA 4YMSA 1W7AA 3VNVA 1A5TA 4QFMA 2FFAA 3A58B 4B2LA 2ZRGA 3CLVA 1LTQA 3NKVA 2Q9AA 3K70B 4AIIA 4D82A 1AKEA 3QKTA 4M53A 4KV9A 1MT0A 2FSFA 3CRMA 2W58A 3IQXA 1J2JA 1E96A 4XIGS 3D31A 4ASUD 4QJ5A 1LY1A 1FMLA 4NYJR 3QVUA 2AL7A 1IY1A 1YRBA 2DFNA 3ASZA 2YOGA 5EXSA 5L3RA 4DCUA 3GLIA 3GCGA 4MGKR 1GG2A 1KI7A 3C4JA 4OHZA 3TH5A 1Q20A 1WRBA 5CJPA 1LS6A 4OHVA 1VG8A 3KFXA 3I61A 2ZQ5A 1F5NA 4YMTA 2ZJOA 3FKSA 2F43A 1OHHD 4LK2A 4O3MA 5EP4A 3R9IA 5TDHA 3K0FA 2WV9A 5F9HA 2YOFA 4X8MA 1ZU5A 4EAQA 4CEIA 2NO6A 3A4MA 4MGZR 1LVGA 1VHTA 2PLRA 2GETA 3B1ZA 1SHZA 4HLDA 4PPNA 1G18A 2CMKA 3QUSA 4OL0A 2FEMA 3FDIA 1R0XA 3T12A 4A82A 1Z6YA 1X8KA 4XWKA 2Y8EA 4NYIQ 1J70A 5KSOA 1II9A 4LJYA 2O8FA 4TSFD 3EAQA 3H84A 1KO1A 5GJWC 4P4UA 1GWNA 4MUBA 4RKFA 3LNCA 3ECCA 4AKIA 3O8CA 3NIBA 1XWIA 2KWIA 1E2IA 2J0UB 3AQ4A 5CIQA 2QT0A 5FBVB 1EXMA 1L2TA 1OFTA 2NOAA 5K8IA 3SDZA 3JVUA 2F1JA 3QEJA 2JAQA 4ERNA 3QXCA 3EZ6A 3LX8A 3EXAA 1E9SA 4OQNA 4BFWA 3DMDA 1E2GA 1U0LA 3K0AA 2DPXA 1KDPA 2PX0A 3AVXA 1QHHB 4PQYA 1FPMA 2C95A 2J0VA 3JZMA 2DWQA 4FWTA 1G1MA 2QPOA 4QOSA 3NC1C 3RC3A 3RS7A 2J7KA 1UEIA 5DLQC 4B3DA 621PA 1HA3A 1NN1A 4NL4H 1W0KA 3R7WB 4BASA 3GLGB 5EP2A 3VR5A 2QM8A 3T35A 1G17A 1Q3HA 1AS2A 4KCGA 1XU4A 3TR5A 4RKEA 2O8BA 4QBHA 1GL7A 4A8JC 4EDHA 3W3ZB 3GLFB 4JSTA 1W2HA 4JT4A 5DSZA 1JI0A 4JMPA 3DO6A 4PSAA 4AKEA 5GJCA 1G8GA 4G3XA 3BIFA 1W4RA 2WJHA 2ZJ8A 1U90A 2LCFA 4B3FX 4K8OA 4D2IA 1F2UA 1FTNA 3LW7A 2ZSFA 4XVQA 2LKDA 4L9SA 1M7HA 2ZI3A 3T1OA 2ORIA 5FUVA 3M4YA 4M1KA 2IXGA 2AKAB 3VU9A 1QRAA 3K9NA 5IRCD 1NVUQ 3B1WA 4Q4AA 5JCZA 2J59A 2GAOA 1MH1A 4FCVA 2CNWA 1E9CA 4B34A 1NY5A 4WVFA 1RRGA 2CXXA 2OSBA 5FTNA 4QJ4A 4D4JA 5JJIA 4HB2A 1XMSA 1KO4A 2X77A 5JEEA 1RYFA 3AKDA 1JPNA 1GNQA 2A5FA 3EPHA 2A7QA 4EFLA 1KZGB 1DPFA 1R7RA 1QDEA 1DARA 3SJAA 3NBYC 4TWZA 1NVWQ 2I3BA 3X2SA 1S3SA 4MITA 2IEYA 4LJ6A 2EFHB 4W9MC 3PQCA 4A0FA 4YONB 2HCJB 3EZFA 1GL6A 4XTCS 3U3MA 1FUKA 2WMNB 1R0ZA 2F3RA 1VCNA 2WKPA 3MUFA 1XCMA 1BH2A 1DELA 1J8YF 2MSEB 2XNDD 2REXB 4PC7A 4WZ6A 1NY6A 3EIEA 1OE0A 3LVQE 1KIMA 1T91A 2GK6A 2JJ2D 1GNRA 4OI1A 4NYMR 4RJLA 5LD2C 2HYIC 3SYNA 4DSNA 1OIVA 1NLZA 4OQLA 1KDOA 2ZEJA 1R5BA 2AX4A 4XD7A 1YZKA 2YWGA 3Q5DA 1XXHB 1O3YA 3T1VA 4LY6A 4B44A 1Q1ZA 3PUVA 4ITRC 4Q9KA 3CPHA 4KSCA 2IBMA 3NBZC 2R6AA 1ZNYA 2ZJAA 1XCPA 4CF7A 2R9VA 2WWYA 1Z6GA 1T5LA 1ZM4A 2PT5A 1EFTA 3AP3A 4GMXA 2VHJA 4HLCA 4KYIB 5CYOA 3VR1A 1RPZA 5EXPA 1ZNZA 4GZMA 4DDTA 1RC8A 2HYDA 1ZBDA 2NTYC 4RD1A 3SFVA 3RWMB 1G6OA 2ODEA 1GP2A 3AVYA 4ARZB 1U0JA 3C15C 2A9KA 2YC4C 4D80A 5B57C 3EG5A 1VG9B 3CX7A 2P0EA 3KQUA 3JZAA 3MJRA 1ZINA 2XXAB 2BKEA 4A0RA 5HZKA 3N2EA 1MO3A 1XEWX 3QPUA 3U44B 2GILA 4W5JA 2HJVA 4E09A 4ESHA 1KMHB 2H57A 1EFRA 1ZUHA 3LBIA 4ABYA 1E2JA 1Q3TA 5KDOA 4F92B 1GRRA 1Z07A 3ZYCA 2OBMA 4TQ9A 5EZ5A 4RD2A 3ZZUA 1CBUA 3HU2A 2IYWA 3THWB 3KXIA 3GQBA 2FFHA 4M9SA 1UKEA 3UKDA 2G77B 1OW3B 1Z8FA 2BBOA 4GNKA 3RHFA 2GXSA 4CW7A 1R0WA 1GNPA 2BHRA 4TYQA 2XJ4A 5B58C 4GFDA 2D2FA 4CRWB 4KHZA 1E1QA 2EFEB 4PXAA 4HUTA 3VQTA 4IEIA 3DMNA 2A5JA 4NYJQ 3HPQA 4B32A 1ZUNB 4KO8A 4DSTA 1H8HD 2ZRKA 5J4LA 3AVUA 3KQNA 1S2MA 4IVRA 2GVZC 1E3MA 4EQ6A 1N5LA 4AYTA 1F48A 5HKKA 1GRNA 2KBFA 3KQLA 4Z54A 1YHNA 4JL8A 1DVRA 2AD5A 1OFUX 3T15A 1W44A 2O5VA 3GMTA 5C4GB 4CIDA 5BWMA 1KAOA 1RJ9A 1H8ED 4FINA 3TAUA 2HF8A 1OXVA 4BFUA 5HR5A 1NBME 4RY2A 2JJ1D 1VYUA 5CM8B 3FOZA 2CHGA 2LKCA 4WA7A 2F43B 2BV3A 3OEED 4HAVA 4Q1BA 3K0FB 3VR3A 2CVFA 4Q19A 1TNDA 4CEIB 1YZNA 3AP1A 2VHTA 1KI9A 4MUAA 4V02A 4V0KA 1YR9A 4HDCA 5KNDA 4DDWA 2QQ0A 1HY3A 3BERA 4Z1MA 4CDGA 5CITA 1N0VC 1U8YA 2H8KA 4OJQA 4RZ2A 3K8YA 4EFMA 3GLGE 1M74A 2JLQA 4OK5A 2O8FB 3ZVLA 2VRWA 1Q1BA 1K8RA 3WNBA 2WIAA 5KO2A 1XEFA 4O2RA 2IYYA 3GLFE 4O0MA 1BYIA 3EA0A 1KKLA 5FUWA 1S9DA 2AK3A 2ONJA 2R6CA 1NIPA 3U6BA 4GZLA 1NKTA 3A8TA 2C98A 1ZAKA 2XAUA 3AF2A 2GRJA 1SVIA 4OHYA 4NTZA 1TUEA 2FGJA 4EFNA 4JVLA 1BMFA 1OYWA 1G3MA 2DHRA 4AURA 4ZDKA 3O47A 1OF1A 1WA5A 2H7VA 4G0NA 4HDQB 5J40A 4NCNA 3IUYA 4XWOA 3B1XA 2KB0A 3FKQA 3K0AB 4MRSA 5CK4A 4IDQA 1MO5A 3FVQA 3P1JA 3P20A 1PLKA 2XOKA 5FH9A 2WICA 3E1SA 1G7CA 2VEDA 3M6AA 3C41J 3UG7A 4HAZA 1II8A 2GJ8A 2VBCA 4JL5A 4I1UA 2NG1A 1CLUA 1QHIA 2ZAMA 2HV8A 3WBJA 2V6IA 4IJMA 1VG1A 1Y63A 2ZR0A 3O8DA 1OKKA 4DLTA 4XSHA 5EJEA 3D7MA 2XSZA 3U5ZB 3I1FA 4KI0A 4IFBA 1COWA 1TMKA 4YXWD 1OV4A 1L4YA 1SXJE 4B71A 3AVTA 2ORWA 1UBFA 5EZ6B 1G291 1CP2A 2GEDA 2RKOA 3S1AB 3R8FA 2J7PA 4UNSA 5FPYA 2WOOA 2IW3A 4KLZA 2ZYWX 1F2UB 3VNUA 1Z0DA 3RDPA 4NPHA 2OHFA 1G8HA 3A1UA 5FL7D 5J4VA 4P33A 3IIKA 1K5GA 3EASA 1XJQA 2OILA 1LV7A 1SVLA 4DDUA 1QVAA 2ZI6A 1XTQA 4Q03A 1W0JA 3IIMA 1OXTA 4JLJA 5FI1B 1CJUC 1YR6A 4V03A 4BFZA 2P6RA 1NF3A 2VHQA 1E9EA 2FG5A 3LXXA 4I1SA 3BB4A 3W6NA 1KSGA 3WXMA 1XXHE 4WAUA 4C7OB 2FDCA 2ZU0C 2ZJ2A 2ZSDA 4DB4A 1JR6A 3QOFA 3BAFA 3FGNA 4PO1A 1JQLB 2BMJA 2PCJA 2ZRCA 4CEHA 1G5TA 5SZKB 1HV8A 1E1RA 2V8OA 3PENA 1T6NA 3QKSB 3EPJA 4LUCA 4B3BA 3NEJA 4UJ3A 1UBCA 1OIXA 4QBGB 3IEUA 4NYMQ 1JXOA 1GKYA 1GRQA 4JLBA 1IXSB 4TL7A 3T1QA 4M9ZA 4BECA 2ZRMA 1EK0A 4FMCB 4P32A 3GEEA 5CM9C 4A9AA 3R9WA 1KY2A 2L0XA 3KXLA 5KU1A 3FHCB 4LJ5A 2WJVA 3THYA 4QGFA 3IPYA 2A30A 5B30A 3QQ5A 1NMXA 1KO7A
chains in the Genus database with same CATH superfamily
4OOEA 3G79A 2X3FA 1MV8A 1LPOA 5CR9A 4JC8A 4QJBA 3WOHA 5EY5B 1RKBA 3H18A 2OCLA 2NU8B 2NV6A 4EG1A 5AVQA 1U6JA 3S81A 3V4RA 4B2PA 4V2UA 1PHRA 2JEOA 2FETA 1M1YE 3ZHTA 5AW7A 2I6XA 3ONFA 2OGTA 4PQGA 1KC1A 3FTQA 2GGSA 4BE7B 4C6TA 3UJHA 1FRZA 2I6GA 1C1XA 4JODA 1UK8A 4XGNA 3ZWXA 3F9RA 1UR5A 2D1YA 1HL7A 1QGAA 2WHEA 2Z2KA 3A1DA 4CF5A 2CK3D 2W90A 1M76A 1TTTA 4BNMA 1YJAA 4HMQA 4PFKA 2PXXA 3KSBC 1W85B 5D3MB 1TADA 1T24A 2YXBA 4BVEA 2CVOA 2QP3A 1KAGA 2AK2A 2J9XB 3CVJA 1W93A 2Y1WA 3MC1A 4R69A 2CD7A 2RGCA 3WIEA 1ORVA 2LDXA 2FFBA 1E2LA 1JHMA 3L1VA 1T8UA 4G56A 1M2HA 1ONNA 5DM70 4H3KB 4JI8B 4MYCA 1SBYA 1BQ4A 5FOWA 1QKKA 2PRZA 1IYZA 4DHEA 1RRCA 3L5KA 4NS1A 1HBJA 3EMVA 4HVCA 3SG0A 5HW0A 2BRUC 1N75A 3EW9A 4HS4A 3ZW8A 1V8BA 3KVRA 4YP6A 4CMBA 2QRNA 1NVFA 3GUZA 4ZDWA 3ZK9A 5J47A 5G1OA 2FUEA 1TL7C 2Q3MA 2HV9A 3SF0A 1ZNXA 4OQZA 4K2AA 1OWLA 4X8HA 1VMIA 1CUBA 1S2GA 5EIWA 1E6CA 2C4WA 4WHMA 4I9UA 2EKDA 4AWBA 2ZYDA 4FE4A 4GBED 3FOEC 5KX5B 4J8PA 1FB5A 3KYCB 5J2UF 1KMNA 1S8AA 2Z57A 1GQ2A 1XWWA 5DGTA 4ADSG 3BICA 4ZCMA 2UYCA 4BEBA 2G8LA 5FO0A 1E4OA 2WAMA 1U0RA 3RANA 2ST1A 2YYZA 1P2VA 1XL1A 2VIIA 4REQA 2AZMA 4TRRA 5LCXA 1YBHA 3AM3A 4CDMA 1GLGA 2TRSB 1SZDA 4FUQA 1YMVA 1H2WA 1ZH8A 5LBIA 1BW9B 1C3JA 1DUSA 4TXMA 5LFAA 3UGQA 5A5FA 2HSZA 2C9BA 1JIXA 3CRRA 4EG8A 3E5RA 4IQ4A 4EHLA 1RRPA 2H4FA 2JIOA 1R88A 3IVXA 4PYMA 3ZZTA 4KO3S 1ESEA 1PBNA 1QG6A 4PRLA 5LLTA 2IHKA 4GMFA 4P5PA 2ON6A 2IGBA 2DC1A 3MILA 4P86A 1ZXBA 4YB8A 3TNFA 2JIPA 4FZ3A 3QE4A 2W2QA 4Q7JB 5HKLA 2G1KA 1XA3A 3IPRA 1S3IA 3A3PA 2PJZA 3LWZA 4FZ5A 4KU4A 4TRJA 2QVXX 2WUVA 3RFUA 1JVBA 4MR8B 4RLFA 3U31A 5C3MA 4IW3B 2OCYC 1S0UA 5FWXB 3G6KA 3DO8A 3OZEA 4TLLB 3P5BA 4Y2TA 4J0DA 4MHTA 1QRTA 4F71A 4BMVA 4DIBA 1QTIA 2X6TA 3KEFA 2IS2A 1ECLA 4HRAA 4LXXA 4N48A 4RIIA 2PWBA 2IXFA 4W82A 5ER9A 2ZS8A 1BH6A 1XMPA 2AFIE 2CZQA 3GYBA 3N1UA 5F76A 1KQNA 1E0SA 5AT1A 5KOJA 4X65B 4RF3A 2I4IA 4MKXA 5AW2A 4Y2VA 2GNAA 4UUMA 4YDQA 1E3SA 4Y9UA 3HYLA 5EZYB 2HJSA 3RJMA 2IHZA 1TK2A 5CK5A 3D0QA 2VOJA 1QRUA 1EB8A 3P26A 1I10A 3AUTA 2OPHA 4JLUA 4U9UA 2RG1A 7MHTA 4MJXA 4XA8A 1QU2A 3MTGA 4HBZA 3GCZA 4IXMA 1UFVA 3GRYA 1SMKA 1Z5ZA 1FSPA 1A9XB 2IIVA 4FCWA 3HH8A 2FDXA 1T2EA 2Q1TA 3CZPA 4JUDX 3PTLA 2VPZA 3CF0A 3K6JA 4X1OA 5EZYF 4LYFA 1KZ7B 4R0MA 1CQPA 4PF1A 2C1ZA 2C4MA 4KL8S 4NBWA 2VDKB 2JIZD 3C7CB 4KLAA 3CH6A 2VZEA 1MORA 4EZIA 2I9KA 1ZX1A 4BU1A 2DUJA 2WF5A 1HK7A 1JSXA 4KDFA 3RWBA 1C7RA 3QA9A 4E7PA 2HMSA 3EZGA 3ANSA 5CVUA 4YWHA 4FC7A 5T4HA 3BL8A 3ZDEA 3L7KA 3CKLA 4XCXA 3QIAA 2HF9A 5JASA 4BO5A 2XXAA 4DWOA 5TF4A 4QD3A 2ZRLA 4KQCA 5AJXA 4RTKA 1G42A 2QX8A 1IN7A 4HNAA 5EJ2A 1UADA 3QOWA 2FZLA 3NOVA 4R8KA 3STUA 1O08A 2AG0A 4KE9A 1ZA1A 1GAJA 5C8YB 4NZYA 1JIQA 5FTLA 2ZAYA 2G9VA 3ZK8A 1UBNA 3ERCA 2EJCA 2FW6A 1X1TA 3K5IA 2R6FA 1I2CA 1IEXA 2NQTA 2ZREA 2XEXA 3B78A 3ECSA 2E3JA 5A71A 4EBFA 4ETNA 3K6SB 2DR0A 3IV9A 4TXHA 5CDTA 2DUUA 3U7FB 1B23P 4Z51A 3LCJA 3VYUB 1IEVA 2E7ZA 2FFJA 2VC2B 2NSLA 2XB2A 1KDVA 4OJKA 1XRQA 2PH3A 1T1SA 1OA1A 4E03A 1K88A 4C7MA 1IN8A 2ES4A 2XQKA 3K0BA 3MJSA 2XUAA 4Q82A 1M66A 2W93A 4Y7CA 1ONPA 1TM5E 2OB2A 2OHJA 3E35A 3U2QA 3E5NA 1UZAA 1DKMA 2PVPA 2RGGA 1WQ1R 3WLKX 2PD6A 5JHHB 4IMJB 3WHIA 2BGKA 3MMZA 4YRTA 3C85A 1A2KC 1XJWA 1C1DB 1L4EA 3LOUA 5FBLB 1J0AA 1IN4A 4AP5A 3K2QA 2IEAA 2A88A 5BYBA 3GGPA 4DLPA 3QJYA 4LMBA 1BCRA 1EJ2A 1RW4A 3GAZA 3JSXA 3KWMA 1IVSA 1GADO 2YMQA 1T3HA 1MX1A 5A62A 5BN5B 1M75A 3DDNA 1NW8A 1A4XA 3NTQA 1EGVB 3AFOA 2QL6A 3T3MB 2JEYA 2DFLA 1PJCA 3HY6A 3MHTA 2XBMA 1HX7A 1F9EA 1C2TA 3DW1X 3OA2A 4M83A 1PAUA 2EL9A 3CRNA 3N2IA 4X45A 1ND6A 4RHEA 1EM8B 2FEPA 1G7TA 1SEPA 2XCQA 5EESA 2Y0EA 4OFWA 1AK1A 2Q1XA 4JGIA 4Q21A 6GPBA 5EIOA 2DUNA 3IMEA 5CB6A 2Q5FA 1KDRA 4PBSA 5JLAA 3CX8A 1E18A 3BDAA 4MUEA 3REGA 3DTVB 3V34A 4J91A 5BSVA 4FX5A 4WZBE 2BFDB 3FYDA 5KDDA 4N47A 1J21A 1US8B 4IFTA 2NO5A 3JASA 1T2NA 4XSGA 4YXFA 4BQRA 4C7XA 1AZSC 4LGCA 4JP5A 2ZJBA 4JBGA 2RAVA 4QHSA 1AHHA 4LGYA 2R2AA 2OV1A 5E6UB 2WSSA 1L6IA 4OUKX 4M9UA 4P4SA 4CLXA 1ORHA 1WP9A 4M76B 1BXZA 1JEDA 4OAQA 3WWZA 2P9YA 3TZ6A 1F4LA 4R1MA 5EMMA 4U7JA 2DTXA 3EUWA 1O96B 2WWFA 3VR4H 2VWGA 3OETA 3WLMA 4AIRA 5DWDA 4C0LA 4JIMA 4DL9A 2FMFA 2JNWA 1SCJA 4W7SA 3QU5A 3UFXA 5JCXA 2O3JA 1GCGA 1UDXA 5BQ3A 1Z33A 2J85A 4K46A 3AT1A 3BTSA 5I8WA 4QEZA 1QF6A 1PWYE 3WYAA 2PRKA 4KQ2A 2RJ3A 4R6WA 1YFLA 1KRHA 4EG5A 1XC7A 1XI2A 1XCJA 1KO8A 4DG8A 3PEYA 4RQTA 1EGHA 4DIDA 2EXXA 4ZI7A 1MW9X 1DV1A 2X0EA 1WXWA 5JSFA 3U1BA 5G02A 2AI1A 2C84A 2B1RA 2O14A 2G28A 2CEAA 3N87A 4QNNA 3R7NA 4FPXA 4M8LA 4KXLA 4CM9D 1ZO8A 3C8HA 3LT1A 1U2GA 4RACA 4MIOA 1AS3A 3W2HA 5DASA 2WM9B 2EARA 5DYTA 2Z9CA 3MMPA 4OF4A 3COZA 5DT2A 5KREA 4Z4FA 4YC7A 1E9RA 4KWTA 2XWPA 3M9XA 4M4SA 4DS3A 1IZZA 3GRCA 3Q2KA 1K3TA 2BHTA 3AHFA 3M34A 3TM5A 2W4IA 4I5GA 3I6YA 4Q7QA 3MFQA 2O8VA 5FR1A 3PEWA 3ZD6A 2Q27A 1MCZA 5HKKD 2J6BA 1AN9A 1CRWG 4QSMA 3VPXA 3CR3C 1DEOA 1HYHA 4KFSA 2NYUA 2IS6A 1MIOA 1M10A 4BXOA 4RBNA 5K09A 4PQFA 1L4HA 4EG3A 4PZAA 3GRAA 5HTOA 5ALVA 3RD5A 4CN8A 3VJKA 4JSRA 4NI5A 1KK0A 4NBNA 3G82C 3PR2B 3ZZ0A 2ZITA 1MOSA 3D3KA 2JLRA 1GGHA 2EFYA 3L2OB 4OKNA 1GRVA 4EB8A 4K05A 5ESRA 3EPRA 3CNBA 3T9DA 2IYNA 2FI1A 2NTEA 1QV7A 4OQYA 4LX0A 2EAUA 1NXXA 3I8OA 1E5LA 1RU3A 1BE6A 1X80A 3WDSA 1L5RA 1QYIA 1E20A 4TXLA 4B4KA 4LI0A 5KNDD 2NO1A 3UAWA 2ASVA 2I91A 4OIMA 4BU0A 2GN9A 1IM2A 1DKNA 2CCJA 1BFDA 2PMKA 1SXJB 3DUWA 2Z43A 2Z83A 3R74A 5EJ9A 4MPPA 3QVGA 5DLDA 1JHPA 2O2DA 2WV7A 4PPFA 3TPFA 4EY6A 2DBZA 2MYUA 2W48A 5HRAA 2JGMA 4H0FA 3W5IA 4QRIA 2IUTA 3SZUA 3D7LA 2E4YA 5HEKA 5LZ8A 3Q5GA 3EUAA 1U98A 4X90A 1VL6A 3K8ZA 3KB2A 4RH3A 1UJBA 4B31A 3FVVA 3CX3A 1YE3A 5E2IA 2BEJA 1P4JA 3PYLA 4CKBB 1R3UA 1W5BA 1WCIA 2YN2A 3MF4A 4YJHA 3UW1A 1MZVA 4D02A 3DL4A 1BMFD 3OWHA 3ND7A 1QANA 4NPAA 4U6QA 2XD4A 3T94A 1OSNA 3V4PB 5ALNA 3W90A 2B36A 1XZDA 1V48A 5T64A 2BKXA 3SJ7A 1DJLA 1RWMA 3CIFA 5DI3A 3ZV4A 5CXSA 8OHMA 5EWLB 3ZBPA 4IOJA 4UHDA 1ZI9A 1IFXA 2WMOB 2GYYA 1YQEA 3WXBA 3QELB 3AG5A 3WQRA 3N2KB 3H17A 1NYRA 5K2MA 3ZQ6A 5EJ4A 3A9TA 3EZ7A 1MQ8B 3ZBUA 2W6OA 3G5MA 2VQ6A 4WZAE 3W2IA 5D8DA 2WFMA 3WWOA 1R16A 1ICEA 3B6MA 4WESA 2XYPA 4EEXA 1ODKA 2H2WA 3G2QA 3AVWA 4M0MA 1G21A 2Q99A 4PHGA 1YAHA 5BSRA 2YN0A 2PGAA 3WP0A 2NYAA 4Q9LA 3MAJA 2BFFA 4FLEA 2C88A 2JGRA 3NXSA 1C0KA 3K6KA 4G2TA 4GLOA 4XM2A 2VDUE 3AH8A 2CVZA 4YAUA 2DAPA 1PJQA 2ONKA 1NG1A 1Q1EA 2Q3DA 1RYZA 5U9CA 3L8CA 4KMRA 1AF4A 3R5JA 4UCXA 3U13A 1N6KA 2HFJA 2JH8A 2OM2A 3ORYA 4J76A 3CW9A 4OIFA 3IMFA 1BVHA 4EO9A 2ONZA 3PUYA 4QICA 1QZUA 1Q77A 3PFCA 1CTQA 5JAPA 1JL3A 1CUUA 1OVMA 1X8XA 4DLWA 4C6SA 2HD4A 3N7TA 5AVSA 1RWXA 1ONBA 1MB3A 4Y2JA 2CXUA 2EJVA 3ZCXA 2X4DA 3N39C 3DPIA 3DQQA 2O52A 3Q40A 5AHWA 1NU8A 1OASA 3F3SA 1GKLA 2ZYHA 1BCSA 1G5IA 1MA3A 4QC2A 1GCAA 4A5OA 1D0IA 1DFHA 2NXWA 3QBJA 1XG5A 3CR8A 2W2PA 4YRAA 1O4VA 3Q3JB 3X2EA 2ZXUA 2RGXA 2G9RA 5CA1F 4GVPA 4KIWA 2CFTA 3COVA 1G8PA 1C8LA 2A0KA 2R6GA 3VSBA 2OV6A 2FW8A 4KODA 4AL4A 4C87A 1E1RD 3PF8A 3D6AA 3VVBA 3I5YA 1U11A 2R1UA 2JARA 2FWPA 4EPYA 3RUIA 2O2SA 2X8JA 4PX2A 3QEAZ 4Q4HA 2Z5FA 1M6EX 5IC5A 3BE6A 1HRDA 1XPOA 3LUGA 1N3BA 4PZPA 4YP0A 2O8EB 3HL4A 1SUSA 1A7JA 4FFPA 1CCWA 4ZICA 4TTIA 4ZCSA 1FMCA 4RL6A 2FQWA 1FVHA 5ALWA 4Q9IA 4HB0A 4IDHA 4FYPA 4JOCA 2CXHA 3QBVA 1ORRA 2WVJA 4RL4A 2P2LA 3FJOA 4AJ9A 1OTHA 4I6JA 3CG0A 4QFBA 1JJAA 4IIBA 1KYWA 1FFEA 1ZSNA 2H16A 4KOEC 1R10A 1IHPA 2PGDA 3A0UA 3DTVD 1C4XA 1YJQA 1JA0A 2QTCA 2B7BA 1IBLB 4ZGGA 3O3OB 2B8TA 3D0RA 1QH8A 2LIVA 1BHJA 1SQGA 1Z0KA 2R47A 3BS4A 5KIAA 1KDTA 3VU3A 1A4RA 1AGRA 2ACVA 2Q41A 5DBFA 4CMIB 2W5UA 4Z4CA 1BDBA 2X86A 4P31A 1FQJA 5B7NA 1O8BA 4BP1A 4MJLA 2J1LA 3SOPA 2FP4A 2ZJ1A 3CMMA 1EDZA 2A0XA 1V9CA 3FYUB 1GZDA 3CG4A 4A8JA 1LFDB 2QT1A 4AG6A 3N8GA 3RLFA 7ADHA 4O4JA 4JNCA 4L6AA 3L4JA 1XA0A 2ORVA 1R6XA 2Q0SA 3TZEA 3IAXA 3UWDA 3MBKA 1YFZA 4C76A 9LDBA 4G8CA 4KMMA 1WUYA 3LGAA 5AK6A 4CHTA 3JTEA 1NBMD 1O95A 4NP6A 3K0CC 4GYYA 4Z8YA 4AJPA 3KC2A 3LFHA 4X7BA 1CS0A 2FEKA 2IPLA 1L8AA 2WP0A 3SYTA 3JYPA 1J07A 4EPWA 2R8OA 5DFAA 3LS2A 4I9HA 4ZKDA 2XJ9A 2ACWA 3RSCA 4DLNA 5CXXA 2ZFUA 3S68A 3TZCA 5LQCA 1J25A 2QTBA 5GAJA 4G0QA 4RYDA 4F7DA 1M7BA 1WVGA 3ZNPA 5C53B 3AEUA 1YZVA 2AZXA 1R74A 2JFNA 1XEWY 4BQNA 4IMIB 1NXWA 2QMOA 3GJXC 3L93A 1NMYA 1WLYA 1UMBB 4OJNA 5TGDA 2W6ID 3W9SA 1K7XB 1CVRA 5IC6A 1WL8A 4TXNA 4YY3B 1FDRA 3MYYA 3PNYA 2R44A 5CVCA 3OIUA 3ISTA 4FFDA 1V1RB 1ZBQA 4URUR 4TROA 5K0CA 4YDRA 3BK2A 3NOQA 2ZE6A 1CJBA 4GLBA 3KKOA 1WV1A 4XXHA 2A4MA 1BO6A 4D9CA 2YIVX 1ZGAA 2L19A 2HR1A 2Z95A 1P1RA 3OZTA 5AVVA 5FWYB 6AT1A 4LRWA 3OIYA 3OHPA 3IIEA 1U9IA 1E2DA 1U3FA 3PFIA 1SVSA 4PGGA 1PCXA 3ORFA 5FD8A 1TYBE 4UTPA 4Y0AA 1QB7A 1A4IA 5JJKA 1XP8A 3GCXA 4F21A 5F51A 3ZOZA 1Y5IA 5YASA 4ALNA 1KAMA 2Q7XA 1D2AA 3SDBA 1ID8A 2PZJA 2GM9A 1NVMB 2C2WA 3ZE1B 3K0SA 2PJRA 1GUYA 5ALQA 2YHAA 1YOVA 2F1HA 5FOUA 1ZCAA 3GLHE 3VPDA 2Y1OA 3I01M 4OO3A 5KTYA 2JKZA 1VIAA 5C8VA 1TIBA 1RTTA 2EP7A 3CT6A 5DH9A 4KRYA 3URMA 2N1BA 5BV0A 1QWSA 5K8CA 1NJ5A 1E3WA 1K97A 1XD2A 3HLYA 1D6MA 4MHOA 5E4YA 4PGMA 1R6BX 3ZBQA 4C4SA 1Z29A 1DTSA 3CX6A 1JZQA 1SXJD 2AVNA 1NASA 2C5FA 3TE7A 4ALMA 1JW9B 2QVZX 1CDOA 1KEPA 3EIHA 3BXFA 1QGDA 4BPBA 1EG2A 3MT9A 3CVWA 2NMVA 1QAMA 4XZ3A 4CTNA 1KR2A 2HHAA 3HKDA 1Q22A 3AU8A 3I6BA 4GM0A 5ALDA 5IJ0B 1BD4A 4QRDA 2O2HA 4I5DA 2DPHA 5K7SA 1AKMA 1WDTA 4E7OA 4LZLA 5FI3A 1CPYA 4YAKA 1HFWA 1XTIA 2BKAA 4FDUA 3QKRA 4XIFA 1DCTA 5HSGA 2HCBA 5HUQA 2I2WA 2A84A 3C4QA 5CMLA 4JJZA 3UK6A 5JZMA 4HB4A 2NUBA 5E1BA 2YKGA 3H3XA 1M1XB 1V11B 1W59A 4H77A 3OBIA 3USZA 3ZHSA 4HQNA 1J99A 2YINC 2Z08A 1XLTA 4H4EA 1IZ0A 3UCXA 5KCZA 3BJMA 4B46A 1U2ZA 1AHIA 4LZAA 1WLSA 3KJFA 5J4HA 3PP8A 3OQNA 1IMOA 4JQCA 2YFYA 2V6BA 1XEAA 3G5LA 2YV5A 2Q5JA 3T3DA 3UK0A 2ZJZA 1LPPA 3FF4A 2HQSA 5JANA 5I3ZA 3LUPA 4ARVA 3AKYA 3KB6A 1UAYA 1IBKB 1CHNA 1FDWA 1WY5A 3W05A 2B30A 2NNWB 3K8QA 3P9NA 4ZCLA 3KKMA 3WWPA 2WWGA 5EJFA 1WNTA 5SY9A 2BFOA 3REOA 3V4SA 1GZ6A 5TEVA 4CHGA 5KYXA 5EKUA 2VTKA 4AMYA 4IIJA 1YJCA 1U9YA 4KJZA 1GA6A 1H1LB 2I6UA 1RXEA 4HV4A 1PUIA 1JHRA 3PDIB 2AFHE 4KWEA 3WMRA 5KHLB 3I5XA 3U7HB 1UJ2A 3ZDXB 1DXQA 1N3YA 3LZ6A 4FM9A 1U1FA 3PPYA 2QLMA 1RP1A 1C7QA 2JFZA 2QN2A 4Y2SA 4AJEA 1TU0A 5L3SA 5HP4A 3BZBA 4NULA 3T3NA 3DKKA 1AGYA 1NN0A 1TM2A 4RTQA 3EZ2A 3V8MA 2QP4A 1E4VA 3JPYA 3E9MA 4J0JA 2WB4A 2WUWE 3B82A 3OAAD 3N2GA 5H3CA 1NUAA 4RVOA 3VUFA 1A1VA 1FYEA 3HYNA 5LLSA 2CF5A 1I94B 3UQYS 2JBAB 1W8DA 4Q15A 3HLTA 2R7AA 4PTZA 2VHZA 5B1YA 1IJBA 3W2EA 3U6KA 3GC6A 3TL6A 4F3KA 3BCUA 3E9QA 3HY3A 3TRFA 4ZCRA 3OOYA 5FBHA 3TOVA 2FWBA 4DV2B 2HT1A 1TZ2A 2REBA 1DAIA 1TJ3A 3GJTA 1D09A 2H85A 3PLNA 2XKAA 3NAMA 4MRVA 2QUJA 5DW3A 1C30B 3UBMA 3PFHA 5FNVF 4BKRA 1C0LA 4DNOA 5CDFE 1V0JA 2CL7X 4BLOA 2EFDB 2JHCA 1OGIA 2B21A 5H3HA 1H23A 1UBHS 3OEYA 3KJXA 1AKNA 1KPIA 2ZR8A 4GPZA 3DL7A 2GDJA 4QOGA 1U2PA 4AMZA 3BD8A 1FSGA 4EVSA 4CQNA 3X0DA 3AILA 2ZSEA 5FADA 4ZIRA 1JKJA 3IUMA 5G4LA 5KSYA 4HEA6 3ZXIA 3EIWA 4KVGA 2HGSA 4HK4A 3TIIA 4MKHA 3F46A 1M2OB 4FS8A 4BO4A 3O2JA 4N8EA 3DCJA 3KJIA 2YHUA 4UHEA 1KI2A 2DX7A 1T0HB 4GU5A 4QJ3A 4ZYUA 4FWBA 1CY8A 1H4TA 3IV6A 2X0NA 4BDSA 1RKXA 4HX9A 3CF2A 3UK7A 4DSZA 2QUKA 4MMZB 3VC3A 5JWOA 1N3LA 2TMGA 4ZEOA 2HU5A 2Z30A 4J9UE 5KVCA 3FKSD 1A9TA 1P80A 3DDCA 3L7DA 2JLYA 3DDSA 1B0UA 2RSLA 2H7XA 3PHHA 4C07A 1RAGA 2XVZA 3M1AA 3C3AA 2J07A 4GOJA 4E6EA 2PUBA 3DMFA 1TMGE 3CBQA 3DULA 2AEEA 3EGWA 4L4ZA 2Q6TA 4LGVA 4YRQA 4DTIA 5BT8A 5THQA 1Y7LA 4P4GA 2EZUA 3SQMA 4WKPA 2I1QA 4U6SA 2G6TA 3BFJA 4IDEA 1IEWA 3EXEA 4UATA 4LTDA 5SV2A 1M8GA 3BMOB 4FEYA 4H7IA 4PS0A 3FSRA 3GPLA 1FTQA 1V45E 3F98A 5GJVC 4A2QA 1X0XA 1QVRA 3GVXA 2PUJA 4DCNA 1A8QA 3MNFA 2I1VB 3B3QA 1BDMA 1A9YA 3VH1A 1NC1A 5MFZA 1SURA 3KPUA 1K86A 1ORDA 2CNLA 2APJA 2X8LA 3AM4A 4YTEA 3UWOA 1OXUA 4L7QA 1CJKC 4BO3A 3ZD8A 2Y1EA 5EC8A 1B3BA 4JR2A 7AT1A 3M89A 5K3CA 1UBKS 2YHSA 3AY3A 4RHXA 3FLEA 2G67A 1AO3A 1FP1D 3H05A 3LTEA 2Q6KA 1EVJA 4XQGA 2WTEA 4FKMA 1A76A 2C61A 3PXUA 2YYSA 4S3MA 3A4IA 3NHSA 2EWMA 3ZQKA 5GVSA 1W88B 1ZGJA 3T7KA 5A3JA 1N33B 1OB5A 1DWUA 5CX1B 4G89A 5IS2A 1QXSA 4LHSA 4R0VA 5IXJA 4DEXA 2H54A 2PJUA 1DFIA 3PITA 3RRMA 3PCRB 1J09A 5AJTA 1OWNA 1V5WA 1TZKA 1UEXC 4XWYA 5BSFA 5TMEA 1W0KD 3UMBA 2EGHA 3L05A 4O3FA 4G1BA 4D4HA 2A3NA 4WTOA 2Z9DA 2FZ4A 3UPDA 1PZMA 4AZ3B 1T6ZA 2HK6A 2EERA 3AXSA 1SBCA 4BZXA 4OI0A 1I2MA 1Y8QA 4G85A 1OLSA 2M6SA 2VDQB 2OXTA 3DV0B 2O8DB 3CSUA 3KAJA 3GEHA 3SBDA 1A71A 5FKJA 5E7JA 2C5LA 1K98A 4W5QA 4JXKA 5K03A 2A9VA 4OCZA 1J9ZA 1I0IA 1VMKA 3DS8A 1JXAA 3JQAB 4O2AF 3UMFA 5JZVA 2IS4A 2BCGY 1XN1A 2VUSA 5CTAA 3IQDB 2XT6A 1DBPA 1USVA 4H1HA 1ZITA 3EEFA 4KGVA 4L16A 5EE1A 1SG0A 2HM7A 4MVJM 3S8EA 5C7YA 4Y0NA 3WRVA 4KREA 1SBNE 4P3NA 4LV5B 5HF8A 10MHA 2BHSA 3TG8A 5MGNA 3C48A 1G20E 2X9VA 2N42A 1YTUA 1V7QA 4JDUA 1VG0B 3VU1A 1XMIA 2IU0A 1O03A 2WF6A 1LBEA 4EF5A 4EQ6B 1YBMA 1T4BA 1TVMA 2J45A 2PKRA 3DZKA 1GKKA 4WZAB 3W5AA 2ZXEA 2XAAA 3IOYA 4QXAA 3CEJA 5F64A 2IUUA 5JQGB 4G25A 2Y1LA 1BX0A 1L9XA 3CWQA 4O4IB 4CMJA 1WF6A 3FGOA 3HUTA 2JGKA 2H9AA 1YIOA 4S12A 2ZTHA 4DLXA 2QJOA 5DHSA 3A9UA 3RIYA 2FPPB 2QE7A 1PWZA 1QM5A 1QE5A 4F7WA 1YCHA 3L0PA 2Z58A 4Q37A 2XV1A 1QIJA 2NTJA 5EMJA 3OLXA 1Y5RA 2AI3A 4MARA 1X74A 1UZNA 3AB3A 3K0KA 4NX2A 1T2CA 2D4HA 5AHKA 4YN3A 3HJTA 2GLUA 2QENA 2LGJA 2QF7A 4NLLA 3RUFA 3UENA 4X97A 3Q8WA 3PCXA 4CQMA 4I2NA 3IKMB 5IVDA 2UZIR 4INPA 4BV8A 5C1PA 1A69A 1OY1A 2YZ7A 4F0JA 1E7MA 1J90A 3BBPA 3V6LA 3JATA 4E21A 1WETA 5HHTA 1V43A 1R8XA 4U2FA 1EXVA 1SVNA 1Z17A 5H70A 4CEJA 4L8GA 4AY2A 1UIRA 3EDYA 3TOSA 2H1SA 3JQ8A 5A06A 2YJTD 2A33A 4K1LA 2A57A 3F5FA 4CM8B 5ITZB 5LB2A 1FPQA 2UZ0A 4L15A 4LBYA 1D2HA 2FR1A 2H06A 2VHCA 3WGHA 4DLRA 1QIEA 4B47A 1FS6A 4BJ1A 2NUTA 3NONA 1JDUA 2O2GA 1SKYE 4KO2S 3MPUA 4RSGA 3HO1A 1W5TA 5E3JA 3HBJA 5TARA 1CUFA 2B2XA 5JDCA 1PHPA 4N5NA 5H4GA 1PYGA 1D7OA 2PNFA 1U3VA 4A0SA 1L5HB 3I3SR 5KNBH 4CIWA 1I6KA 1TRKA 3NOOA 3OVMA 3DMHA 1D6NA 1HTTA 2BR5A 4MQ5A 4J3JA 1X1RA 4KVAA 4MVJP 4NAHA 5ILOA 4MV3A 4QG7A 3GMIA 2F48A 2WQ6A 1YBFA 2GSWA 2B8WA 1ARZA 3EYAA 4Q12A 1SU6A 3GAAA 4X0EA 5EE9A 3MRSA 4EMBA 4DAEA 3EW7A 3NG1A 1MQ9A 1WUJS 2CFOA 3NTLA 1P4AA 4MWEA 2CCKA 5DHPA 5BN4B 1U2TA 2ZIGA 3OFSA 1D5CA 3WJ7A 2FW7A 2CNKA 3PNSA 4A10A 4AQ7A 2Y71A 2PKQO 3F7MA 2J0QA 1UP7A 3H2SA 4FDAA 5T8KC 2JFPA 1JVSA 4GPTA 4YRKA 4Q16A 3CX4A 1YOBA 1ZK4A 2HSEA 1DINA 2QE6A 3FMFA 4HAIA 1JWAB 4KVFA 3QLJA 3UT5A 1YBAA 2FQQA 4DV7B 3JS5A 5CTJA 3PQEA 3RVRA 1BAPA 5L4LA 2GBPA 3PA8A 4IHJF 4MI6A 1RCUA 1EJ6A 4JS0A 1UC8A 1R27A 4RXUA 3NVAA 3G5AA 1XK7A 1AURA 5ENZA 2HBZA 2VBGA 2ZYUX 3KYBA 1E0JA 2N46A 4NG4A 4EUSA 3KALA 3M5WA 2VNJA 4BZQA 1Z0FA 4CT0A 1PRYA 4XB1A 3ZY2A 1B0PA 4X1KB 1Z2DA 2IT1A 3R8XA 1L0BA 1NI4A 4Q05A 1P0IA 3GRZA 4GMHA 2WE8A 1ZKMA 3QEKA 1XNHA 4QUKA 4D45A 5B4TA 2XMRA 5AM1A 2HO5A 1IK6A 1JLHA 3SS7X 2XCTB 4O8CA 3WBBA 3RADC 4LVOA 3ZD9A 4KXYA 3BN3A 4I4CA 2Y1KA 4KFRA 3KQMA 3GFGA 5D85A 1Z4OA 2R4QA 3HS3A 5DP2A 1BOOA 2ASEA 3HA3A 3LL4A 3I1IA 3O4HA 1MO6A 4F97A 3WYFA 5G1NA 1MNQA 3ZY3A 3Q8LA 3ANTA 3NTUA 2D5IA 2XADA 2JAXA 2WVHA 5DVZA 3VYTB 4E5DA 5JXIA 2RE8A 3V6MA 2QZPA 3EC2A 4UOQA 2PWZA 5ILQA 4GBGA 2J9FA 1E3JA 3L02A 3CKMA 5DP1A 3CU5A 4CKEA 2ORED 4NFLA 1G19A 2VXOA 1X8LA 1XRRA 4DRXA 3DR5A 1ZHHA 2O0LA 1DS6A 2FEXA 3AHHA 1NI5A 2HCTA 3JU3A 1NVVR 3WWYA 2R8RA 3INYA 3H6KA 1XMJA 4AECA 4BEVA 1YDWA 2QWXA 5I9NA 1K68A 4BNLA 5ABPA 2DCUA 1PZNA 1S2LA 2WIKA 1DX6A 1R37A 3K30A 1SCUB 1AQIA 3TSWA 2D7DA 4EKIA 2Z3VA 3QUTA 5CH3A 3AF5A 1IATA 2ZIVB 2PX6A 3TKYA 2OAQ1 3EFHA 4YPOA 3EQ2A 2Z6UA 1R15A 2FTKE 4LZWA 1QMGA 5IVPA 3S1LA 3KWLA 2HK9A 3RHZA 4OHMA 2OLEA 2EU8A 3RRFA 2GJSA 3NVMB 4GKJB 4Q9JA 1YC2A 1QH1A 1LWOA 3QF4B 2QG9A 4I81A 4YVFA 3H2GA 2O7SA 3ORSA 4QHYA 2AN1A 2I4TA 5C8DA 5LNK1 4I9GA 4Q1AA 4OXIA 1N2CA 5CG2A 3DMPA 1GFSA 2ECPA 4EY8A 1FP6A 1G7SA 4BCBA 1MRNA 3BWYA 1I33A 3IBSA 5JADA 4ISCA 1GV1A 2P4SA 8ADHA 4JB3A 5C1IA 2H5LA 1LF0A 4FEGA 1NXPA 3B53X 4RZUA 3W78A 5A9SB 3TSCA 4C7BA 5GQSA 4BAGA 2VDWA 1ZKDA 4QYXA 3RYTC 4JT2A 1E7YA 2GKSA 3R6TA 2XUQA 4NOLA 2PRYA 1FUYB 1BIFA 3IVGA 4RD3A 5G1PA 1ECJA 4A8TA 1SBTA 2J32A 2ZYRA 4RD0A 3G7SA 2BY4A 3QMPA 4HQOA 4G5HA 1IJEA 3C3YA 3N0RA 2BR3A 4WLOA 421PA 2BGNA 1F8GA 1V9LA 2A35A 3AR9A 3H5OA 3HU1A 3MERA 1NJ6A 4MVJG 4FYIA 4DR4B 2ID4A 2Q62A 2VF7A 1IAQA 2XVYA 3IAAA 5J4KA 1NZDA 1ZFNA 1YD7A 2BGIA 1OXSC 4IG4A 3D64A 4PX9A 2EV9A 2NZXA 3C6XA 4ZZIA 1RRMA 2C78A 1YL6A 1QHNA 2CDRA 1NLUA 2EKBA 4O63O 3CMCO 4QGAA 5A4IS 2OA0A 4GWLA 2QMEA 2NXNA 1RAEA 1SFRA 3GU3A 4L72A 2ZWOA 3H3JA 4G5QA 2WY2D 4GP6A 4ZHQF 5C8XA 3F3MA 1YIDA 1KEWA 2BP7B 1AKUA 2ZRPA 2O0MA 3WYNA 2PGIA 2DSTA 4IEEA 4YQFA 3IE2A 1H9AA 3NRBA 4TLCA 1NJ2A 1F0PA 4MCAA 2QM3A 5EPOA 3T4EA 3ZW7A 5HJ5A 1AX9A 1FSFA 4H7PA 1DQZA 2OPBA 4WN9A 1THGA 4LRYA 4UHJA 1DCFA 4X94A 2R2GA 1XKTA 2B9EA 1Y81A 1KKMA 4GSLA 5TV2A 3RR2A 4D0LB 2RD2A 1HLDA 3FKJA 3IIJA 3AIIA 3VC2A 4LTMA 2QXYA 3DE0X 5CFPA 5COQA 4DT1B 2AOTA 3BGDA 3VI4B 1A8IA 3IP3A 5C18A 1EP1B 5HVNA 1RWBA 4D3YA 1X15A 1FRNA 1GSOA 2GCGA 2GT1A 3GT3A 4IH1A 4MW6A 4OD0A 3KB1A 2ZZMA 5HQTA 2EBWA 5EWJA 3W5HA 5LBTA 3HSYA 1RJDA 2IF2A 4DMHA 1DAFA 4MYDA 4LSWA 3BKXA 4U7WA 3ZGOA 1KS2A 2DR3A 2EKLA 4FEAA 2R68A 4X61A 3KELA 4ARBA 1P0PA 4HWRA 2QX9A 1EHCA 5ELXA 2V65A 4JKYA 3BIJA 4LRSB 4CCYA 1EFPB 4FSXA 4GWKA 1IUKA 4YP7A 2O1SA 1L1RA 4FGLA 4UAGA 4X92A 1HURA 3TR6A 2ENUA 5F7OA 1QX3A 2RAFA 1GTRA 3OQJA 3U9LA 1S7CA 4E22A 5JO0A 3NYRA 1NVBA 1J7JA 1UL1X 2OC9A 1U3UA 4KQGA 4WDRA 3ZHBA 5BUZA 2PX4A 1CRPA 5GIOE 2OBYA 1DWQA 1XMXA 2MSNA 3NB0A 4OY3A 4C2TA 1SCAA 4A15A 5L3QA 2E5WA 1JR3A 1KO5A 3LQ1A 1ZIYA 2PT9A 3CPSA 3IKTA 1KH3A 3DZDA 1RXUA 1UANA 2D0PB 3K4HA 3MIIA 3RSHA 4XOUA 1P7YA 4DKJA 3S44A 3T7EA 4E5NA 4HAWA 3LL7A 2HPAA 1S3FA 3GLIB 3UXMA 3E15A 2O1XA 2VJLA 2B8JA 4ND8A 4G63A 2QD2A 2R3SA 1W87A 3KKEA 2R4UA 5AI5A 5TE9A 4U6NA 4OX9Y 3SNHA 2Q5OA 2RGNC 4HUQB 2FN8A 1UQUA 2GEUA 1XZJA 5CB0A 3TVTA 3G9ZA 5JBIA 4OHCA 5E2AA 1HH4A 4J2HA 1RYNA 5C4IA 1XFDA 5HKBA 2M32A 1FLVA 5BSHA 1VYHA 2AVDA 1URPA 2KS6A 4NBVA 4DM3A 4E3ZA 3KQPA 4E5VA 3JD2A 1ML4A 4X93A 2D1QA 1U63A