3R8CA

Crystal structure of cytidylate kinase (cmk) from mycobacterium abscessus
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
220
structure length
198
Chain Sequence
b'SMVVAVDGPSGTGKSSVAKELARQLGASYLDTGAMYRIVTLWVLRAGVDLTDPAAIAAATDQVPMSVSSDPDAQTALLAGEDVSVPIRGNEVTGAVSAVSAVPAVRERLVRQQRELAESSGAVVVEGRDIGTVVLPDADVKIYLTASAQARAQRRNLADVQRRDHLPLRPAEDALEVDTSDMTQEQVVAHLLDLVRTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytidylate kinase
molecule tags Transferase
source organism Mycobacterium abscessus
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
total genus 68
structure length 198
sequence length 220
chains with identical sequence B
ec nomenclature ec 2.7.4.14: UMP/CMP kinase.
pdb deposition date 2011-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3r8cA00
5FBLB 5EUQB 1PLKA 2XOKD 4YDSA 5KDLA 4X8HA 2GVDC 1XCGB 2X1VA 2RKOA 4EFLA 4LRWA 4CF7A 2FZLA 3LQRA 4PQRA 1KMHB 2O8CB 2CL6X 4BGDA 3MJRA 3MGCA 2HLDA 1VHTA 1CJUC 4CW7A 2QA5A 2QRZA 1HV8A 4HAYA 1SZPA 3CF2A 1NSFA 4PXAA 1S0UA 1Z0JA 2CJWA 4YMUA 3LY5A 4YQFA 3EPLA 2H17A 1CP2A 2O52A 1KGDA 4AG6A 3GCGA 5FTKA 3ZQ6A 3CX6A 2AFHE 3LAWA 2QAGA 2WV9A 3DPUA 2W6JA 3GLHA 4JLAA 4DCNA 2ZREA 4KFRA 2JJ8A 2ATVA 4QC2A 2D3WA 2GCPA 1G7TA 2HXSA 2GZDA 2G9NA 4QHYA 1PJRA 2FSIA 2HCJB 3RS5A 2ZPTX 4AIIA 1RKBA 2WPDD 2H57A 5A4JA 1GRRA 3L0SA 1OB5A 2QAGC 1Z28A 1EX6A 2W2XA 2EWVA 5FBWB 1EESA 4C0HA 2R6CA 4LCBA 4AY2A 1KDPA 2GF0A 2ZYUX 3SN6A 3SHFA 3EXAA 3IUYA 1YZLA 4RD3A 5KSPA 3ZLJA 4UNRA 5AR1A 2VPPA 1NL3A 4RCZA 1G19A 1RJ9A 1DAIA 3B85A 4TTRA 1FMJA 2VEDA 3H86A 3SE0A 1G8FA 1N3BA 2HCBA 3B82A 3MAAC 2WKPA 2Z4RA 3CM0A 2P67A 3PV0A 4LJ6A 4PZYA 3I62A 4OI0A 2ZUBA 1W0KA 3R8FA 2J7KA 4FCTA 3SYKA 1R0WA 2D2EA 3Q9LA 1JBKA 2QP4A 3TK1A 5KHOC 2IS2A 1D5CA 3W5IA 3RS7A 4OQXA 3AP3A 2CJWB 2IUTA 1YE8A 1Z6GA 3I5XA 4DHEA 2DFTA 1E9CA 3A6PC 2WVJA 3NIBA 1EX7A 1DARA 3GFPA 1ANKA 2QRNA 1X1RA 2GXUA 1A1VA 2NO6A 3D7MA 5FUVA 3AF0A 5FUXA 2D62A 2EVWX 3OF5A 4AURA 3U3KA 2IS4A 4KXFB 2OILA 3H0KA 3PEUA 3Q7PA 4N3NA 1CEEA 2BM1A 2J9RA 4B6EA 4RZXA 3THOA 1G7CA 1ZD9A 3H84A 4B3FX 1D2EA 3IQXA 1E32A 2GWHA 2QQEA 1ZJ6A 2KBFA 1KO4A 4LYHA 2WTUA 5FH9A 4ARZA 4UNPA 4B47A 3AKEA 3SQWA 3MWKA 1YJ5A 2VSFA 2ZRHA 2ZM5A 2QMEA 4PX9A 4D4LA 3A1UA 4QKQA 2IYRA 1R8QA 3F3YA 2QSYA 3IIKA 1FUUA 2R65A 1XBTA 3EZ9A 4PAMA 2ZRIA 2V9PA 2CLDX 1L4YA 1RRFA 1VKJA 5AWFC 1E1QA 4JLMA 1C1YA 4DLUA 1XEXB 3D31A 3PCRB 4DSTA 1JB1A 1OFIA 4OHXA 3LBNA 4PO9A 4Q47A 5SZKB 2ASEA 2ONJA 2WAXA 2WJGA 1T5LA 3MWYW 3ZIAD 2WJHA 4YC7A 4G1UC 2G83A 3EIQA 1JJVA 1LVGA 5AUOB 5JWOA 1KK1A 1Q44A 1MRNA 2DBYA 5CK5A 4DT1A 3TR0A 3K70C 1E9SA 1EFHA 1TQDA 1W47A 1G7RA 2XTMA 3EZ6A 4LOAA 1XTRA 4QGGA 3ECCA 4U5XA 3PEVA 3FKSD 1VG1A 1T8UA 2FPLA 2K5UA 3BAFA 3GP8A 1IXSB 4XWOA 1O3YA 4R98A 4ZPXA 2FDCA 2ODEA 2Q9BA 4O25A 2JLVA 4D81A 5EXPA 4KFUA 4DC9A 5JJLA 1G4AE 2BMEA 3EA0A 2QT1A 3W9YA 3HPQA 4FW9A 1FOEB 1FP7A 1WXQA 2ZYVX 4DUGA 1Z0DA 1YVDA 1G5PA 2R6FA 1SVIA 4ZO4A 3VR6A 2JLWA 3CF0A 4FMCF 1BO6A 2G1JA 2JJ1D 1OPXA 2JEOA 2I3BA 2ZRFA 5L3SA 3NDPA 4DLVA 5L8VA 3OAAD 2LKDA 3PUXA 3TIFA 1BKDR 2D7DA 1E4YA 5A0FA 2OG2A 2VBCA 5BXQC 2VP4A 2ZJ2A 2VRWA 1N0VC 2PEZA 1OFUX 1HUQA 2JLQA 2W2TA 1UM8A 8OHMA 1XTQA 2OSBA 3E5HA 3Q85A 4DVGA 2QTVB 3H1TA 5FTMA 2AWNA 4UXIA 4C7OB 3AF2A 1TX4B 4LPSA 2BIFA 2VIIA 1WBDA 1HT2E 3RC3A 4I4LA 1FMLA 3T34A 2IL1A 4Q18A 4HB2A 1I4LD 2MMCA 3AVVA 1R0ZA 2C9CA 3FYHA 2V6IA 1S8FA 1IN6A 2GAAA 1J99A 1KAOA 4PC3A 4LBZA 1SVWA 4NU0A 4Y0VA 3TVDA 1I4DD 3F0TA 1EK0A 1G5TA 1CR0A 1KDOA 3AB3A 4PAOA 2A5GA 4DBLC 1AKEA 1NBMA 5SZJA 1SXJA 2CLSA 2HYDA 3B1YA 3KX2A 4D0NA 1OFHA 3ZD7A 4GP6A 1II9A 2RGNA 1F60A 3SJCA 2XZLA 2AKYA 2ODNA 2IXGA 3ADKA 3D3QA 3T1QA 2CNWD 2OO7A 1TEVA 3FTQA 2RGCA 5CDFE 2HYIC 4XTCS 2FH5B 3FMOB 1AM4D 2ZRAA 3FPAA 3CNNA 1KDTA 3TBKA 1QVRA 3VX4A 2O8EA 1L7VC 3IBYA 5BWMA 1GOTA 3AVOA 2CK3A 1SXJC 1NRJB 1XD9A 1D9XA 1MH1A 1P6XA 2ANBA 1KNXA 1G1MA 3I1FA 3NG1A 4JLBA 1SHKA 2AKAB 1SKQA 2B8WA 1JPNA 1F2TA 1ZM9A 2CHQA 1P9NA 3FHTA 3L0OA 1OV4A 2IF2A 3C8UA 4E03A 1F2UB 1VECA 3IEUA 2GCOA 4IOMA 4BE7B 1NI3A 4DDTA 1IN7A 5TY0A 1ZUNB 1OSNA 2WAYA 4M21A 4B73A 5JRZA 1P62B 4LYAA 4NE2A 3UKDA 4BLTA 1DS6A 1SXJD 2G0TA 2OAP1 3R7WA 2ATXA 1HE8B 3EG5A 1P73A 5HPYB 4C9BA 1ZCBA 2ZRMA 1FFHA 4ZCMA 2QM8A 2QN6A 5F9HA 2ZR0A 4B44A 1KHTA 2G6BA 3QPWA 4GOJA 2XAUA 4D26A 1QZXA 4DSUA 5LPNA 2QZ4A 3BBPA 3LV8A 4DEXA 3RYTC 4NMMA 5FBQB 2CK3D 4AKGA 2C77A 1E9FA 2L0XA 4Q1CA 3WRXC 1MO6A 2BJWA 3QKUA 3KQHA 1YKSA 3QKTA 1G16A 2JASA 4Q7JB 4NL4H 1LF5A 2FEMA 1J8MF 5FR1A 3LXRA 3AV0B 1OH5A 4HAWA 4RVCA 4TMZA 1X3SA 3BB1A 2ZI6A 5EE3A 2RH5A 4Q4JB 1U8ZA 4ACBA 3BJIC 1UADA 3K0SA 3IO5A 3RAPR 2C2HA 3WYFA 4E09A 3GJ7A 3T35A 1M7HA 3KXIA 2DFKB 4NCHA 4Q9HA 3FMIA 5K8TA 4ZI2A 3MG9A 4A2PA 4QJ3A 4FMDF 1GITA 2R6DA 1UKYA 5E7MA 2J45A 3QKSB 4EDHA 1JNYA 2KB0A 1N6IA 4AG5A 2J0SA 1I2MA 3ETLA 2NPIA 1A7JA 2CCKA 1NN3A 4M1SA 1VCOA 1XFAA 4C7OA 1GL6A 3CNLA 3K70B 2B7BA 4R2IA 5HKKA 4RD1A 2Q21A 4FWIB 4LI0A 1S1MA 421PA 3CB4A 2IUUA 1NBME 3TSOA 4A6PA 3NDBB 1HT1E 2CLCX 1TF5A 1ZU5A 2AD1A 3B8HA 1ESNA 2EFGA 2YINC 3RS3A 2XTNA 1MT0A 2OFOA 1IN8A 1ZNZA 4KHZA 4BWYA 3EPKA 3HYTA 1W36C 1YZKA 1F6BA 1T3HA 1AZTA 3U44B 1G3MA 4M2LA 5FPHA 3CONA 1R6BX 1ZM7A 1CR1A 1K5GA 5LDDC 4D80A 1JALA 4S2EA 4ZIRB 3OIYA 3THXA 3EW9A 3OIVA 2WSSA 3QIAA 4IVPA 2BMJA 3KFXA 4CEIA 2QMHA 2UZ3A 5G3YA 1E2GA 2D7CA 4Q4LA 2J5XA 4DLRA 2GJ9A 4W7SA 4CDGA 5JSZB 3HR8A 4GZMA 3AKCA 5H68A 4DT1B 4B71A 721PA 4OI1A 2D06A 1N6NA 4LJ8A 2PX3A 4C0KA 4MKFA 4C0BA 4D4JA 4H1VA 4Q19A 1ZAKA 3ZDQA 1Q3TA 1E2LA 2YOHA 2IX3A 2QY9A 4BLSA 5CK4A 2RGBA 1FP6A 1OIWA 1J8YF 1UEJA 2NIPA 5UKDA 1GZSA 3LVRE 2AXPA 3MJHA 5KPJA 4JSYA 2GRJA 3M4YA 5SZHB 5KTYA 3OIUA 4V0NA 4QGFA 5DI3A 2VYFA 3VR1A 4B6FA 1DO0A 2BCJQ 3N5CA 2GKSA 3UATA 3NEYA 1A4RA 3H2YA 3K9GA 2EFCB 2B6HA 2XEXA 1N6PA 1Q22A 1DAHA 4LJ7A 3DHWC 4M1WA 2OHFA 1G9XA 1KZ7B 1T5IA 4BASA 3EZFA 4HUTA 4DLZA 1IJEA 4JZKA 1CBUA 1JAHA 2QP3A 3UMRA 1E1RA 3CX7A 4MRRA 5JFGA 5DI3B 5ELXA 1DAMA 5C46F 3TMKA 2PJZA 1NKSA 4PO8A 2MSEB 4AKEA 3AVWA 1XXHA 3WP0A 4B43A 2YOGA 4I1VA 4OQLA 5HE9A 2GK6A 2J7PD 3OIWA 5CYPA 3MFYA 4TLAA 4DEYA 2BBWA 1XJ0A 4KU4A 3NKVA 5H70A 3CZPA 1GSIA 1JXOA 3LRPA 5E95A 2ZRNA 4RD2A 4MRNA 4B75A 2W58A 2OFXA 4XWKA 3BERA 1E6CA 2VSXA 4MRPA 2IYLD 3CRW1 5FOXA 2ORWA 3VHXA 3CLVA 4C0QC 2FFHA 4JT4A 5LD2B 1M7GA 3B6EA 2NZJA 2ZAOA 5J4YA 3MRSA 4QRHA 3SBEA 2KBEA 1RW4A 5KSYA 2V3CC 1QF9A 2RB4A 1H8HA 4OQFA 4JVMA 1N6KA 3NEJA 2VHTA 1PUJA 3ZVRA 1MKYA 3UG6A 1T6NA 4LJ5A 4GFDA 3QXCA 3GLIA 1KKMA 4PHTA 2IYZA 2FE4A 3A4MA 3K09A 5BYJA 2FSGA 1E2QA 3QXHA 4I1UA 3CWZA 1ZP6A 4E22A 4JLKA 4O0MA 4JL6A 2QENA 4Q9LA 2FWRA 1S2MA 2W83A 3MSXA 4M1YA 4NYIQ 2IYUA 2BMDA 1CKEA 2B92A 1WRBA 3W34A 3ADCA 2ZI9A 3K0EA 4FXPA 4DDWA 3SC3A 3QG5A 4FN5A 1XJQA 3R8CA 1FTNA 3U7FB 3OEHD 1NMXA 1QHGA 4WXRA 3GLHB 2VQSA 1GNRA 5EE9A 2NO9A 4TL7A 1HH4A 4DLSA 4URXR 3O8CA 4BLPA 1HY3A 3RWMB 1YHNA 1QHIA 2ZU6A 5JJKA 2F3TA 2Q6TA 5BN3A 4UNNA 2OM2A 1VYTA 2KSQA 3QBTA 5DYIA 4KV9A 4KITB 1X8KA 3OZXA 1RRPA 4JVNA 1P72A 2IW3A 1COWD 2WJVA 4PQYA 4BLQA 4UXHA 4WVFA 1N6LA 4Q21A 1VMAA 2OUKA 1RC8A 3G0HA 2XNSA 1Z6XA 4Q1FA 4P31A 4QNRA 3KB1A 2JA1A 4MGYR 2ZQ5A 2BKUA 1SGWA 3IHWA 2BDTA 2HT6A 4Q1AA 1HA3A 4WXPA 2FSHA 4DIEA 4GPTA 1LW7A 2I1VB 2XOKA 4EFNA 1KMQA 2GJKA 1RIFA 1JI0A 3QPUA 2OLKA 3W6PA 1Z47A 4YMSA 2XSZA 3GPLA 1HQYE 4YMTA 1AN0A 1S1CA 3U7HB 3K0FA 2QUZA 2WPDA 3OEHA 1BMFD 2WMOB 4EFMA 5AJWA 4QOSA 4IFEA 3P20A 2V54A 4XIGS 2VLIA 2ZU0C 1FX0A 2UZIR 2GK7A 5AUQA 2Z43A 3IQWA 3A4NA 1P2SA 4FCWA 3G82C 1CIPA 4P4UA 1ZCAA 3QF4B 4M0LA 3T15A 1SVKA 5AK0A 1SVSA 1F2UA 4O2RA 1RYFA 3VNUA 1VHLA 3UXMA 3KQLA 1COWA 1N2CE 4RD4A 1ZW6A 1NIPA 4PFSA 2WICA 5IT5A 3W6NA 1G6HA 1IBRA 5FPSA 3IILA 4K46A 4QG7A 3NH6A 4TT3D 1IM2A 1J2JA 3W6OA 4EPVA 3R9WA 4UNQA 4DB4A 5HCIA 2GNOA 3A1VA 4K81B 5CLLA 4DDVA 1RPZA 5JWRA 1FW6A 5IHPA 3EPHA 3IO3A 1W44A 5EP4A 4TZ0A 2VF8A 1IAQA 4MQBA 4B74A 1QHNA 2AR7A 4M9ZA 1ZM3A 4PO1A 4P33A 1DELA 2PZGA 1NSTA 2QPOA 4G5QA 2Q9CA 3WYGA 4BFTA 3K70D 3F5FA 4C2UA 3ICEA 5FFMA 3UG7A 1E9DA 3E1SA 4LY6A 4W5HA 2ZJ8A 2F1JA 1UPTA 1SXJB 2GEUA 2Z0MA 4IXNA 1T9HA 1D8TA 4TMKA 1Z07A 4EPWA 2Q0HA 4LYFA 2IA5A 2YYZA 4B3CA 1T3LA 1JR3E 4IXMA 1Z0IA 1D6JA 4AYTA 4K8OA 1WE2A 4Q9JA 3K8YA 3L8YA 2VH5R 1II8B 1VG0B 1P4SA 3JVUA 2R2AA 3QNUA 1CJKC 2DWQA 1U81A 4MYUA 1NY6A 2RHMA 1OIVA 2XB4A 2YVUA 1AIPA 5TDHA 3VTKA 4MUBA 3JZMA 1UBCA 1FNMA 2PT5A 2JLXA 1U99A 3UMFA 2CMKA 4Q7LA 4US2R 2ZSAA 2XZPA 4RFVA 5BN5A 1E2HA 2GDJA 3CRMA 4ON9A 2H92A 4US1R 5FOUA 3VR4A 1E2EA 5JJIA 2J7PA 5G53C 4TQAA 5FOVA 4LJYA 1KKLA 1E99A 3PEWA 2XNDA 5DGXA 1KIMA 4R7ZA 1SVMA 4AK9A 4IDOA 2WIAA 2QU8A 5EP2A 2NG1A 4GSYA 4Q01A 2NZ8A 3P27A 3CPEA 4E5UA 5LB4A 2VA8A 1II0A 4LBWA 1DE0A 3TNFA 4R71A 2IC5A 4WZAE 1X6VA 3K0CC 1CS4C 3GFTA 1TQ2A 1ZIOA 1A2BA 521PA 3QE0A 3VU9B 1LV7A 1ETUA 4A36A 3I72A 1Z0FA 4Q9KA 2Z4SA 2XITA 5DNYB 3WMFA 1X1SA 1W4RA 4KFTA 3SHWA 3ZIAA 4AI6A 3SJBA 3NHBA 2GF9A 1AJEA 3HR7A 4BFUA 2JLSA 1ZNWA 1QHHB 2DR3A 3AQ4A 3KUCA 2FV8A 1M6NA 5BYKA 1VIYA 4Q7MB 3KXKA 5EP3A 3DO6A 3FKSA 1UDXA 4DKXA 1XEXA 3RRYA 1UAAA 1T8TA 3QBVA 4ZI3A 1X86B 3QENA 2VP0A 3V4RA 1GVNB 3UMSA 1DG3A 3QXSA 3VNVA 2ORIA 4PHHA 1Q1BA 2G0NA 3B9PA 3KQNA 4ARZB 1UJ2A 3NC1C 2EFEB 2GZHA 4TYPA 1ESMA 2C8VA 4DXAA 2VP6A 2GXSA 1R5NA 2J1LA 2AN9A 5C18A 3CRQA 2ZANA 3TLXA 2VHJA 3CF6R 1IOZA 2WSSD 5EXTA 2GAOA 2FOLA 1FQJA 4A6XA 2G1KA 1IQPA 4WA7A 4EQ6B 4NDZA 4TMWA 5KOYA 1VG8A 3GQBA 5G41A 2A2ZA 1ZYUA 4DCSA 3L43A 4UXJA 4KFSA 2CHGA 5G40A 3AVQA 4ESHA 2P3SA 3OE7D 1DEKA 1UFQA 1XJCA 1E98A 2B21A 2ZI5A 3R9XA 2QPAA 2WM9B 3TSZA 1JR6A 4LHXA 3FKQA 1U0JA 3ZD6A 221PA 4JJZA 2ZRBA 5J40A 1QHSA 3KKOA 1S96A 1G4UR 3KJEA 4XTRA 3K9HA 5CJ2A 3GLGA 2V55B 5AJXA 2IYXA 5AJYA 3B1WA 3MUFA 5JS8A 1RJ9B 2IUSA 5GJCA 1VCNA 4MDFA 3BB3A 4I1SA 1QHYA 2BC9A 3NH9A 5KPDA 4QL3A 1KAGA 4LDJA 4Z8XA 2HUPA 3BH7A 3QEJA 1NG9A 2ZE7A 5HTKA 4Q4HA 3VQTA 4QHTA 1XP8A 5FTLA 3AH8A 3PJRA 1BIFA 1Q1EA 1TEXA 5E3HA 4H9GA 3TUZC 1KI8A 4OHVA 5KDOA 4B3GA 1U9IC 3TR5A 2Z6VA 1BS1A 1AGRA 1Z8FA 4OI4A 4CEJA 1CXZA 3NBYC 3E2IA 1KJYA 2GA8A 2A78A 3OFNA 3O8DA 3N70A 3UPUA 2BEJA 2BHRA 2PMDA 1P2UA 1WF3A 3QEOA 1G6OA 4OL0A 2QAGB 3K9LA 3GLFB 1R8SA 3KJIA 3REGA 3L2OB 4WAUA 2DCUA 2HJGA 4OI2A 4B48A 2V4ZA 3T61A 2GBLC 4HUQA 121PA 3FMFA 1W0JD 2ZRPA 2RGAA 3QPVA 3RRMA 5JCZA 1A82A 4HAVA 5JWHA 4BLRA 1H8HD 5CM8B 2A5DA 3FDIA 3KZ1E 2WWGA 1M34E 2GCNA 3GLFE 1Z22A 2PEYA 2ZR7A 1GILA 1G17A 3KJHA 4AC9A 1D2NA 4DWJA 5HE8A 2NOAA 1NN5A 5GJVC 4GRAA 2IT1A 1SXJE 2NO0A 2JIZD 3EZ7A 2EQBA 1E2KA 3HU3A 2N42A 2JLRA 3U3MA 3THWB 3RWOA 1YU9A 1RRCA 4Q4AA 5CDFA 2IWRA 2C99A 4YMVA 3FE2A 1IY0A 1NP6A 3ASYA 2P6RA 1ZM4A 3PQCA 1N0UA 4BZPA 4PPGA 4D82A 3BFVA 5CM9C 1CR4A 4ZCIA 3A36A 3I32A 4MGZR 3T06B 4QM7A 1R0XA 4URZR 2OBMA 4NBSA 4URVR 2IXFA 2I1QA 3TRFA 3I8SA 2ERXA 4AKHA 1S3SA 4FMBB 4DLYA 3JZAA 1S9HA 1TQ4A 1UKVY 1UF9A 2HV8A 4ILEA 2W6ID 4G0NA 4PAQA 2XNDD 5EE0A 3KQUA 4A15A 1G64A 1GL9B 5K8UA 2J41A 3U6BA 1XU4A 5IK2A 1B23P 2F7SA 3M1IA 2ZJ5A 3C15C 3CKLA 3WNDA 5KNDA 3QVUA 1NMZA 3ZVMA 2O8FB 1NVWQ 1QG4A 5B58C 4LV5B 4XVRA 4YONB 4ASUD 2CDNA 4WOPA 4CIDA 2Y8EA 5E7IA 1PLLA 2A5JA 2TMKA 3ZS8A 2DFNA 5HKKD 1W36B 2ZR9A 1T0HB 4OK6A 4EJSA 3IEVA 5JI2E 1E0KA 3T1TA 1J90A 2PCLA 1RYHA 2ORVA 2CCJA 4PHFA 5CIQA 2AK2A 2JDID 4C4PA 2RMKA 3WXMA 2KE5A 4B32A 2WWWA 4OQMA 3ND8A 3C41J 4HI0E 2WKQA 2H16A 3KXLA 1KI4A 1M74A 1LFDB 1UDWA 3ZS9A 1BOFA 4HB0A 5CB8A 3PEYA 1KYIA 4OQNA 3BB4A 5DLQC 1YZGA 1R5BA 4LC0A 5L3QA 2ZI4A 1RVDA 5DI9A 3AUYA 4N0DA 5B30A 2OXRA 3KB2A 2ZE6A 1ZUHA 3N2EA 4BPBA 1Z63A 1W0KD 3VAAA 2BM0A 1CU1A 1RRGA 1Z2CA 2ERYA 3CZQA 5DSZA 1GP2A 1F3OA 5GVSA 1AS0A 1JQJC 1ZMXA 2FN4A 2VHUA 3AP2A 2EW1A 4OJQA 5FI0B 1NMYA 1NN0A 4W5JA 5HR5A 1AK2A 2BOVA 4NCKA 3W8NA 2ZROA 3LBIA 5DN6D 1KSHA 4BFVA 4M9SA 1IN4A 3HPRA 1GKIA 1TU3A 2FFQA 2GXQA 2X8AA 5J47A 1HEIA 4H1UA 3QXXA 4LBYA 3GLFA 4IEEA 2P0EA 2WWFA 1XPOA 3GMTA 2IS1A 2VSOA 3ZZUA 2F43A 2PBRA 3WHLA 5F98A 3PUVA 3BOSA 1K8RA 4LV6A 4CEHA 3LQQA 3REFA 3SYNA 4V0KA 3WMEA 5TMPA 4TN1A 2AX4A 2BBTA 4JLOA 4NHOA 1W5SA 1YRAA 2ZVPX 4TZ6A 1E94E 5LBIA 3KKNA 2MSDB 3C4JA 5KUTA 4ZCLA 3A1WA 4HLQB 2Z83A 1FNNA 1Z6AA 3FFAA 4PPQA 5KNBA 1US8A 4X8MA 3FHCB 4JJKA 4AYXA 2XXAB 3EZ2A 4TQ9A 2A7QA 4G01B 3RDPA 5P21A 4XH9B 3I61A 3QKRB 2JLUA 4IOJA 2WOOA 4HAUA 4CYMA 3RANA 4BFZA 3BH0A 1GNQA 1LNZA 4BEBA 4F7WA 1XPUA 2FPKA 3JVVA 4YLGA 2ZRLA 4KI0A 4F4JA 2WMNB 1L2TA 3NTUA 2WJYA 3QUSA 5FPTA 4F4CA 1EFTA 1XTJA 4MRVA 5JS7A 3GJ3A 2EYQA 4HAXA 2ZSEA 3ZGXA 3VKHA 4P4TA 4A8JA 1DBSA 2G77B 4NCIA 2CXXA 3OFND 1ZC3A 2BBOA 3U3RA 2FFAA 4QBGB 4JS0A 3TVTA 2O8DA 5EE1A 2HJVA 4KODA 2ZITA 1G8GA 2GJAA 1Q3HA 1ZINA 4A0FA 2O8BA 2DHRA 2QORA 4V0MA 1DOAA 4DCUA 3C5CA 3X1XA 5EQTA 1Z0KA 2OZEA 2WWHA 3B9QA 4QBFA 4PR0A 2XGJA 4FCVA 2ZS7A 1V43A 2CVFA 1CJMA 1XMJA 2P5TB 3LX5A 2O5VA 1HURA 1KDRA 2C98A 2F3RA 5CLQA 4Q1EA 2GETA 1IN5A 3ZZ0A 3BGWA 1CJVC 2CNWA 3SFVA 4N0EA 4TLBA 4D6PA 1JR3A 4BFSA 1Z2AA 5J4VA 1WA5A 3SU8A 1UBEA 3X2SA 3U4QB 1BYUA 3MWJA 4LYJA 1KI6A 1NF3A 3TUJC 2YKGA 1PUIA 4TQUS 4XSGA 2O0KA 4V02A 1PLJA 2F55A 2BMFA 3GJ4A 3L0IB 3A37A 4V0LA 2OE2A 2SHKA 4YMWA 3ZVLA 1WQ1R 4L4UA 5FBVB 2GILA 4M22A 1DAFA 4NYJQ 5FOWA 4B33A 4P4SB 3AVTA 1YR6A 1E2FA 1TUEA 5FBRB 3RNLA 4PPFA 1XMVA 2B8TA 3VR3A 2I4IA 3NWJA 1F48A 2NO7A 3QKRA 3B78A 1NLZA 1KY2A 1CTQA 2E1RA 3LXXA 2XXAA 2QSZA 4Q5IA 5IK2D 3QG1A 4GDFA 4JLNA 5D3MB 2HXYA 3G5UA 1HTWA 1RE0A 5CB6A 2P6UA 1E9RA 1M8PA 3KKQA 5DE3A 3LW8A 4IVQA 4O3MA 2QG6A 4PZZA 4TMTA 4D25A 1OXUA 4JBYA 1AS2A 2ODWA 5FPYA 4EUNA 4G5OA 5KSOA 4JL8A 2PLRA 2QE7A 2YOFA 4TT3A 1GDDA 1G5RA 1JR3D 5DHFA 2ZS8A 3R9IA 1OB2A 1OKKD 4KSCA 4CEHB 1GRNA 4NYMQ 3MWLA 4PC2A 5FOTA 2C78A 2OFWA 1E4VA 2F6RA 3L0PA 4Q7KA 5IF9A 3I92A 1L4UA 1YZNA 3LW7A 4POAA 3U3OA 2PMKA 4IW3B 4PPNA 3DMNA 5EUMA 5JMTA 3KDSE 3N2IA 1AS3A 4G5GA 4RY2A 3IIJA 1OF1A 1X8LA 2QL6A 4TL6A 4IOLA 3RRNA 4HZUB 4M1KA 2ZTSA 4KYIB 1GAJA 4XJXA 2H7VA 3FB4A 2FG5A 3GLHE 1K5DA 3FGNA 4HDCA 1II8A 2IHYA 4KAXA 4BFYA 2JJ2A 4JL5A 2X2EA 3DM9B 3SOPA 3X1YA 4A4DA 1T0JB 4DLXA 3GEIA 3BK7A 2OLJA 3CRRA 1OYWA 1FZQA 2DYKA 2IBMA 4W5WA 3CH4B 5DISB 2AHOA 5D3QA 2JAQA 4HZIA 1MOZA 2Q3HA 4KJZA 3WBKA 1IONA 1FQKA 1M2OB 2WJIA 2YWHA 3AKYA 4HLDA 4A8JC 2XB2A 1W4AA 3PUYA 1NVVR 3DKPA 1GFIA 4JVLA 3P4XA 5LD2C 1XF9A 4MKGA 4EPXA 4RFSB 3U5ZB 4DSNA 2OBNA 3K0AA 1VDZA 4PC1A 4QJ5A 1OJLA 2PZFA 1BH2A 3CO5A 2WIBA 2YJTD 1OH8A 4A0RA 5KU1A 1YRBA 1IXRC 4EJSB 3GJ8A 4LHZA 3NBXX 2LWIA 3B13B 2ZJBA 2FNAA 4PTLA 1KO5A 4QM6A 1HYQA 3I4LA 4DCTA 5JCPA 3HU2A 1UEIA 4RCYA 1ZRHA 2RGNC 2QMOA 2O8FA 4A2QA 1OT3A 2VP2A 4U00A 4HAZA 3QF4A 3WYAA 4UJ3A 3C14C 1OLOA 5FUWA 3GD7A 1P60A 4M9XA 4D2IA 2IYVA 4PC7A 5ANRB 5E7JA 3IPXA 1EFUA 2YWEA 2J0VA 5J4HA 1XZPA 3BC1A 1O87A 1N6RA 4A9AA 2FSFA 4B3XA 5DIFA 2QPTA 1PV4A 1JEDA 2CE2X 4RKFA 5H1YA 1R7RA 4TYWA 4CZ2A 1KOFA 3TSWA 3UWKA 2QBYA 3VMFA 3WP1B 1AA9A 3WY9A 4BRWA 2OCYC 3TGPA 4C0SA 4L15A 2UVQA 3SR0A 3OESA 4AKIA 1RZ3A 1VG9B 4NP6A 2AL7A 1UKEA 3VKGA 2FU5C 1PVOA 2CHVA 3Q5DA 3AVPA 2ZXUA 1TF2A 1ZNXA 1A2KC 3LFUA 3Q72A 2ZJYA 4Q48A 3AM1A 3ZQJA 4WIAA 3X1WA 4ASUA 4JLDA 1WCV1 5GVRA 2QNRA 3RHFA 2E9SA 1P2VA 2ZVQX 5EE5B 2FF7A 3B1XA 3ONWA 3UANA 4GT1A 4CT5A 1WB9A 4IDQA 1OH7A 3LX8A 1P61B 2AWOA 3ADDA 4GNKA 4CGZA 2A3RA 2VO1A 3EAQA 3KL4A 1Z6TA 3BFKA 5AJZA 1TMKA 2IYYA 3KTAA 2OCBA 3DZ8A 3MD0A 3Q7QA 2GBLA 3CNOA 4HSEA 1U98A 3IGFA 4XD7D 2VHCA 1GL7A 2RHDA 1S4QA 4GL2A 1UBFA 4IRUB 3EASA 5KDDA 5TARA 5FTNA 2C03A 4IJMA 1VCMA 4GMXA 4A1FA 3HDTA 3SBDA 1VIAA 3L82B 1ONBA 1EGAA 4NKRA 4A92A 1X8JA 2QQ0A 2A30A 1E1RD 4F93B 3FOZA 2J0UB 2QBYB 1XD2A 2GEVA 3VKWA 3DM5A 1S9DA 4FD2A 3QF7A 4M1TA 4V03A 5KNCA 4Q4HB 1E0SA 2LKCA 1ZUIA 3EARA 1MO5A 2FFBA 1A5TA 1ELOA 4I99A 4JSTA 2OXCA 2QGNA 1KO7A 3U7EB 2QROA 4M1MA 3OAAA 1NVUQ 3BE4A 4B2LA 2CE7A 3S1AB 2ZEJA 4B76A 1FTSA 3AVXA 3EIHA 1IHUA 3AP1A 1TUIA 1DAGA 2ONKA 1W5TA 3PG5A 4OHYA 3BD9A 2QAJA 4G5RA 1OXTA 2F1RA 3B1ZA 3LLMA 4QNMA 1LS1A 1TU4A 3I3SR 4TLEA 4QGHA 4IEIA 2F9LA 3TJZA 1UKZA 4QXAA 4Z51A 4RD0A 3RC8A 4FMCB 3RSLA 1MV5A 2IYWA 4Z8YA 4YXWA 2KJQA 4XD7A 2YHSA 4TMXA 3X1DA 1I4TD 3QQ5A 1WP9A 2H1LA 3LLUA 5F3WB 3PFIA 2WJJA 4F38A 1CF4A 1G8PA 3U6KA 5JHGB 4EQ6A 3O8BA 1XXHB 1KSGA 4Q1BA 4LZZA 3RS0A 2PCJA 1DADA 3I73A 4L8GA 1F5NA 3BWDD 2BBSA 1CULC 1MABA 4F92B 2V1XA 2WWIA 3K0AB 4OHZA 3IPYA 3DDCA 2J59A 4MGIR 3DOEA 2IK8A 1OXXK 3WMGA 1JAIA 2J0QA 1W2HA 2C9YA 1ZU4A 1LS6A 4QJ4A 2P2LA 4EAQA 2C95A 1E79D 2V7QA 5LB2A 4ZDJA 3T1VA 3LO5A 1N5JA 3KKPA 1XTKA 3K9NA 1IY1A 5HCNA 4OKSA 4UNSA 2ZIAA 1N5LA 4R9UC 1EWQA 1H8ED 1Z06A 1KY3A 5CJPA 4Z1MA 1G3RA 3FVQA 3H4MA 3Q5EA 1VCIA 1N5KA 3DVLA 3AKDA 1OXVA 1XRJA 3TUIC 4BEJA 4D0GA 3VFDA 1D2MA 3RSOA 4RZ3A 4YXWD 4KBGA 3FFBA 1QG2A 3LWNA 1SKYB 2Q3MA 2PL3A 3GEHA 1YZTA 2R6AA 1P9RA 4NZYA 5F2EA 4NCNA 4TYYA 3U3JA 1U9IA 2W6IA 5EZ5A 3GLGE 5TV2A 5JSZA 1G18A 3GJ0A 2RGGA 3I5YA 3CWQA 4KLZA 2KI5A 3UWOA 3FHOA 3VU9A 4V0OA 3CUEF 1H65A 3UK6A 3THXB 4HYYA 1Z6YA 4KCGA 1XEWY 4ZIRA 3SYLA 3OHMA 4LPKA 4Q00A 5FOSA 3X1ZA 3HP1A 3QI2A 3NC0C 1SQ5A 2GTPA 1XMIA 4AYWA 4KVGA 1XB2A 1XNJA 5B2ZA 4CVNA 3U44A 4I81A 4TYNA 3KFVA 4YDHB 5B57C 5KSZA 1XTSA 3GJ5A 2YWFA 3GJXC 1Y63A 4PZLA 1D9ZA 2ZETA 3CBQA 1M7BA 1BMFA 1GRQA 2IHBA 4N1AA 3SFZA 2JDIA 2NGRA 3IBGA 2AK3A 5FI1B 4A82A 1LF0A 4MYCA 4GP7A 1LTQA 5D3MA 4HB4A 1W7AA 1E2IA 3C7KA 5AUNB 4DZZA 3B7GA 1QBKC 1R5OA 2WWXA 3E70C 4I1OA 4JT2A 4LJ4A 1W36D 2HLDD 4KLNA 5BQ5A 4CRWB 3DL0A 1GKUB 2EFHB 5CIWA 2ZYTX 3OEEA 4D4KA 4EJSC 1BYIA 1Q0UA 1NIJA 2HF9A 1XMSA 3QKSA 4JYBA 4P4SA 1MO4A 4Q66C 4X8OA 3AGPA 2OEPA 4C2TA 3WNBA 3WNCA 1IY2A 4Q03A 2HT1A 4NH0A 4RZUA 4DDUA 4JKIA 2HDNB 3EC1A 3P26A 3BFXA 4RSGA 1QDEA 1N5IA 1NVVQ 4DLWA 1E9AA 2IYTA 2W6JD 2VF7A 2ZJOA 1EG7A 1Q20A 2FX3A 2ZAMA 3PVSA 3AGQA 1KSJA 4Q02A 1VPLA 3T1OA 1AGPA 1OIXA 3U60B 4DIDA 3UIEA 2OESA 3GJ6A 4LWZA 3VR5A 3NXSA 4E07A 2QEQA 3R20A 1Z0AA 2NTYC 4IKEA 1KI1A 5J4LA 2ZUCA 4TSFD 1W4BA 1OKKA 2REXB 3D6TB 4EPRA 4ACAA 3IIMA 1G20E 4EPTA 1Q1QA 1YR7A 3P1JA 1N6OA 1MABB 1NG1A 3L8ZA 3NBZC 5FTJA 2Q3FA 1JJ7A 2AD5A 1KJWA 2IXEA 3PUZA 2JATA 2RGDA 1ZNYA 2ZE5A 3ZH9B 1U90A 3AF3A 4IDPA 4C0LA 3IHLA 2A5YB 2YV5A 3Q3JB 4ITRC 4P32A 1AKYA 2QP9X 2HF8A 2EWWA 4BUJA 4EIWA 3BS4A 4M9QA 1LY1A 4LC1A 1AZSC 3CH5A 4QBIA 4M53A 5F9FA 2G88A 2JCSA 4US0R 3HWSA 1KO8A 4NYMR 3VX3A 5A5GA 1P9WA 3LVQE 3CX8A 3MMPA 3TQCA 3KJGA 1N6HA 1W46A 2GCOB 5JECA 3S1AA 1MRSA 2Z5FA 3TH5A 2GJ8A 4ZV4A 1GM5A 2CL0X 1TQ6A 2DFLA 1N25A 3U7GA 1Q21A 1G3UA 4C3ZA 3D8BA 3W5JA 2RGXA 4Q1DA 4WZ6A 3KUDA 4C30A 2P65A 3MCAA 1Z08A 1XD2B 1XPRA 2ZI3A 3NBFA 1U0LA 2J0UA 3RS4A 3GLIE 1DO2A 2GVZC 2O8EB 4PC6A 1TPZA 4HDQB 4AD8A 2R6GA 3IDQA 1G8HA 4MYHA 4Q9IA 4XVUA 2GHIA 5FPKA 3ZYCA 3B60A 4JBWA 5DH9A 4B3BA 2WZQA 3TW8B 4JBXA 5G3ZA 4MA4A 3W3AA 5C4MA 2GEDA 3KTAB 5K8LA 2CCGA 2F43B 5IRCD 2PJRA 3QOFA 2BVNA 3RRZA 2XZOA 4UKDA 4G3XA 2VL7A 2IYQA 4M8NE 3RLFA 3ND9A 5K8IA 4C0JA 2A9KA 1CLUA 2YWGA 1SKYE 4U7DA 5JZVA 2VP5A 4BQSA 4M4SA 4OK5A 3PENA 4PANA 1ZM2A 2V7QD 5E4FA 1G21E 2W2VA 2ZRDA 2WBLC 3K09C 1E9BA 1NLFA 4MITA 2R44A 2X2FA 1P2TA 3I8XA 4JMPA 3A1TA 1NJGA 1R10A 1TAGA 2QMUA 2X19A 4J0QA 1EXMA 1I2DA 1U8YA 3PIRA 1ZD8A 5JI3E 5C4GB 2DWOA 1OW3B 4RZ2A 2V1UA 2OCPA 1C9KA 2OBLA 1DPFA 4OBEA 2IYSA 2PH1A 4IOKA 4QBHA 4R2HA 1ODFA 2D74A 2FA9A 2FEOA 4B2IA 3DZDA 3GLIB 4EPYA 5GJWC 5JEEA 3GEEA 2KWIA 1V5WA 3K1JA 1XX6A 1RFLA 1TL7C 4URUR 1QRAA 1NNEA 4TLDA 5FL7A 4IVRA 1VYUA 3B1VA 1XXHE 3OE7A 1WBBA 1NJFA 4URWR 4B35A 1P7CA 3NVAA 4MKHA 4Z1MD 4TWZA 4TL8A 1LB1B 1R4AA 1QHXA 3BXZA 4KO8A 4BZQA 1TF7A 4NONA 1U8AA 2XTZA 2IWHA 2ZSFA 1U94A 2EU8A 3J81k 1YQTA 1G3IA 1OHHA 4ZDIA 1GWNA 4TTPA 2E87A 1FPMA 3PR1A 3M6AA 3TAHA 1KZGB 1CRPA 2O0HA 2ANCA 1XZQA 2ZRCA 4ABYA 1W4CA 1WDTA 4RFSA 2X77A 4L16A 3WHKA 4UQOA 2CBZA 3CR7A 4KYUA 1HQCA 1FL9A 1OH6A 1KK2A 4LBVA 1OXSC 3GFOA 3W90A 3T5DA 1EFRA 2QE7D 1ZC4A 1ZD1A 6Q21A 4D4MA 621PA 2FMXA 2RGEA 3TW4A 3ZJYA 2NQ2C 2JIZA 4LHWA 3HU1A 2NPFA 4Q4AB 821PA 2FPMA 1IXZA 3THWA 2GJSA 1DVRA 2H5EA 3A58B 4DJTA 3QVVA 3SJAA 2DWPA 3T5GA 1T4GA 4PQFA 3TQFA 4LHYA 4MH0R 4QHSA 1DAKA 3CRVA 2W0MA 4RJLA 3KQKA 1S3GA 4PHGA 3SI7A 1XTIA 4LJAA 4XVQA 5M04A 3U2QA 2W00A 4L9SA 1KI2A 2ECKA 1NBMD 2N1BA 2NO1A 3OEED 4HZUA 2YNMA 3EC2A 4GMDA 1DG1G 1G7SA 1KI9A 2HEIA 3EPJA 3PUWA 4AWXA 1E2DA 3B2EA 4FMDB 1ZIPA 4HUQB 3VR2A 1XEFA 1GTVA 4O2LA 1T3SA 3SNHA 4JVSB 4CEIB 2VP9A 2BCGY 2YZ2A 3CPJB 4B34A 2PT7A 3ICQB 3SDZA 3DEFA 1TTTA 3VHLB 2J46A 4JLVA 4DSOA 2MMGA 3HJNA 4FI3C 4KBFA 1SHZA 1XDBA 1W1WA 1KK3A 1YR9A 1JPJA 3QY0A 3EWSA 2REBA 1EFRD 3V00A 1KSFX 2XSZD 5L3VA 1NY5A 2D4HA 2LCFA 2CEAA 2H18A 4LSGA 1XCMA 3TKLA 1OYYA 1TNDA 4DRZA 4CEJB 2ZE8A 2QI9C 3LDAA 1R2QA 3WRYC 2ZUDA 2ODBA 1H8EA 4RD6A 4BFXA 5HZHA 4RKEA 2IEYA 1E0JA 3SEAA 3EIEA 4NPHA 4BFWA 2IF0A 4FINA 3RVBA 5DHAA 1XWIA 4Z54A 1EFCA 2WKRA 3BORA 4NCJA 2DB3A 4ZDWA 4MUAA 4MRSA 3A4LA 4GI7A 1E96A 2C96A 2QT0A 2ZS9A 1VTKA 3QJYA 3W3ZB 1C4OA 3PITA 4MKIA 5JEDA 2MSCB 3GLGB 3V4FA 2C04A 4U02A 1G3QA 2EFDB 2C5LA 1E2MA 1E1QD 1KI7A 1MR3F 1J70A 2F1IA 4LJ9A 4P0TA 4EKDA 3LD9A 4TTQA 4OYHA 2FGKA 3M0EA 5EZ6B 4C0AC 1Z5ZA 1UBGA 1Q1ZA 1XCPA 5DYGA 1OE0A 1K6MA 3AF1A 5SZIA 4HEJA 4B3DA 3CPHA 4JYCA 3SZRA 2UKDA 4UJ5A 1KI6B 1VYVA 2Q9AA 1T91A 5C2JB 1GKYA 3U4QA 2H8KA 1QVAA 4OK3A 3CIOA 5EXSA 1GUAA 3ZVNA 2GXAA 3EWAA 2ZI7A 4Q4JA 4DLTA 4IDHA 2WOJA 4D0LB 2CVHA 1E9EA 2WHXA 3K0CA 4HATA 3ASZA 3C16C 3LNCA 5DN6A 1CR2A 2OT3B 1ZVQA 2XJ4A 1KTVA 4MYTA 1KMHA 2O8CA 1P5ZB 2BEKA 3ZZTA 3SQXA 3BIFA 2REOA 4NTZA 4HLCA 4WZBE 2ZJZA 2R62A 1KNQA 3DKVA 4OJKA 1E2NA 4QFMA 2BV3A 3SS8A 3C5HA 1FUKA 3MLEA 2AFIE 5EJEA 3IKJA 3QXJA 4LX0A 4ERNA 2O8BB 2EYUA 2IS6A 5C1BA 2O8DB 3O8RA 1MO3A 2FJUA 2WSMA 1P3JA 3R7WB 3B5JA 3BRWD 1G41A 4A8JB 1Y3AA 1G291 3NHAA 4MGKR 4TLCA 1JXMA 1Z29A 3SJZA 2RCNA 1OFTA 2BKEA 4P3YA 3A8TA 3TE6A 4CT4B 4FIDA 1QHHA 5GJBA 2ZRKA 5DO9A 1ZBDA 3Q8XB 2CL7X 3F8TA 3W8RA 2BWJA 5FUYA 1JECA 1KI3A 3HYRA 1F2TB 3P4YA 1KO1A 4TSFA 4PSKA 3T12A 3AF4A 4IFBA 5L3RA 1B0UA 2XX3A 1NN1A 2DY1A 2JLZA 1US8B 2ZJAA 5B64A 4F91B 4KSBA 2QTFA 5GADl 4B2PA 3PXGA 4PSVA 1P75A 5EP1A 4A0HA 5H8WA 2GESA 4JIMA 2NMVA 5FL3A 2AXNA 1OHHD 4BECA 1SULA 4II7A 3LH5A 4G5SA 4XSHA 2FZ4A 4ZKEA 4BRUA 2J87A 4IDNA 2C9OA 1Z3IX 1GIAA 1M1YE 4JLJA 5JHHB 4WBSA 4JLPA 3CR8A 5KYKA 4TL9A 3FMPB 4OHWA 1JEEA 1E0AA 1CRQA 2R9VA 1YR8A 2F1HA 2P6NA 4GOXA 4DB2A 4S35A 1KK0A 2F9MA 1SVLA 3V9PA 2WWYA 3TAUA 2YC4C 5BW8A 2ZRGA 3P32A 4KVAA 3LBHA 5HZKA 3THYB 3AVYA 3CW2A 4MDEA 3EX7C 2P5SA 4W9MC 3THYA 1SVOA 5TB5A 4NYIR 1IJFA 1JQLB 2ZRJA 4QGAA 3A1SA 5TVKA 1DTSA 3EA5A 1N0WA 3AVUA 4ZKDA 2B7CA 3AEZA 4LHVA 2QM7A 1NKTA 4XWAA 2R8RA 3AUXA 1W48A 4GBMA 3BH6A 4HDOB 4NYJR 1XD8A 2V6JA 3DOFA 3RS2A 1GNPA 5CITA 5AJVB 2PLFA 1G8YA 1Q57A 4LUCA 3K53A 5L3QB 1KJZA 5L3SB 1NLYA 5J4KA 1W49A 4XOIA 4LGMA 1XEWX 1Z83A 1NVXQ 1TADA 3FWYA 2BJVA 4HB3A 4M1OA 2ZYWX 2OAQ1 3KKMA 5EXXA 2ZSDA 4L5BA 5AUPB 2D2FA 5JLJA 1CJTC 2FGJA 2N46A 2OCAA 4BLOA 2IEZA 2JGNA 2VHQA 1HE1C 1E79A 5CYOA 4ZDKA 4HLUA 4LK2A 5J5CA 1U0HC 4DCVA 1YZUA 4URYR 5JBQA 4TYQA 1E3MA 1GG2A 4GZLA 4X8LA 1E2PA 2O0JA 1E2JA 4BZXA 4WW0A 4TMVA 1W2GA 2GZAA 1EWRA 3ADBA 4IHQA 1R0YA 5FR2A 5TXGA 4L9WA 5BN4A 1WMSA 2A5FA 4FWTA 1PZNA 2XJ9A 4A0GA 1L8QA 2PZEA 4HLUC 2W0SA 2OV2A 4GOKA 4DUGD 1DAEA 5JRJA 4Y0AA 3DMDA 1E69A 2VTKA 2JJ1A 2ZSBA 3O47A 2JLYA 1W0JA 2QGZA 1FX0B 2YC2C 3RABA 1AQUA 3QSYA 1Q12A 2G3YA 1J7KA 1AQYA 2J3EA 2PX0A 1YZQA 3K0FB 4V0ME 2DPXA 5KO2A 5IDVA 4JKYA 2V8OA 3WBJA 4A2WA 4F4IA 2RAPA 4LV8B 5FL7D 4ESVA 2JJ2D 3LA6A 4PSAA 1U2RA 2QTHA 3U61B
chains in the Genus database with same CATH superfamily
3ZGZA 4D3XA 5T8KC 4PLCA 4X8HA 2GVDC 4H3KB 4TKUA 4AJJA 5HKBA 4YRJA 1GSHA 2VTVA 3PT5A 2FZLA 1QOQB 1NLUA 1V4BA 1KMHB 2R7LA 2GK3A 2VDVE 3FLEA 3H0CA 4PQRA 2O8CB 3MJRA 5B4UA 4CT0A 1GFZA 2JGIA 1QPGA 4DLLA 5I9LA 2G1UA 2F3UA 3ISTA 4CW7A 3PX7A 2PS9A 4NJOA 2QA5A 2QRZA 1SZPA 3CF2A 3M1AA 4S24A 3SK0A 1YB2A 3RD5A 3QIVA 4ZEOA 1ZUD1 1GVHA 2X41A 3EGWA 2D0IA 4YMUA 3TRKA 1SXGA 1G59A 4FQ8A 3SLGA 1B1AA 1V11A 4NMXB 1ZCJA 2RG7A 3A6KA 3D6MA 3LY5A 3EPLA 2H17A 2O52A 2DOKA 4AG6A 3GCGA 3QBJA 4CR8A 1ISGA 1D2GA 1RAGA 3F71A 4P9NA 3DQZA 3UCEA 2WIDA 4K8RB 2QAGA 1YVRA 4U7PB 5TX7A 1NTRA 3ZNQA 4YRZA 2W6JA 4G9BA 5ERYA 4D79A 1H2ZA 3FCAA 3DHNA 3FIUA 3JQ7B 4JX8A 1V7ZA 4NECA 2ZT7A 2FB9A 5C8YA 2VNAA 4I19A 4FZJA 4MV6A 4U63A 2FPGA 5FWYB 2HXSA 4GYWA 5DFAA 3GXOA 3RJ9A 3D4OA 3N6XA 3MTEA 1FFXB 4BE4A 3ZE1B 3UGJA 2HCJB 2FMHA 1NXQA 5IBQA 1GRRA 1I24A 1JQAA 1QH1A 1ZXBA 4EGJA 4D9IA 4LDNA 4R2XA 1JF8A 4UD2A 3VGJA 2EWVA 4J3NA 5FBWB 3UAGA 1U3FA 1H1LB 3GCDA 4J2HA 4YDRA 1KZ4A 2GF0A 3Q3GE 5DMXA 3EPRA 1OROA 4J7UA 2WNHA 3TZ6A 2QPLA 2ZYUX 4HDAA 3SN6A 5EZQA 4EYOA 4KZPA 2QD3A 4Q12A 3WXBA 2QUHA 2VPPA 4XDHA 5LFAA 5CLJA 1WF6A 3HLYA 4O33A 4RCZA 1G19A 1RJ9A 3IQIX 4TTRA 4XWGA 4KR9A 4JITA 3SE0A 2HCBA 3E4DA 4F5ZA 1ODSA 4LJ6A 3CYFA 5EC8A 4OI0A 4GPEA 3WKAA 1W0KA 1DWQA 4FCTA 3CTPA 3SYKA 3Q87B 3STWA 3Q9LA 3VHXB 2IS2A 4BX9A 5I01A 1XN4A 5J43A 3W5IA 3OC0A 4OB8A 3BL6A 3R5JA 4OQXA 4CV2A 2A6PA 5LYJA 3KKLA 2HQBA 3KOMA 4MRMA 3RGGA 4B40A 3A6PC 1U5BB 2WVJA 3UMCA 4RDIA 1IDN1 1S2LA 3UUWA 3UK1A 4AF6A 3QVGB 1QZUA 1TEHA 1DARA 2ID4A 4I14A 3GFPA 1ANKA 3K5WA 3BJMA 4LJKA 1YASA 4OG2A 1KP3A 5DGHA 2FPPA 5FB3A 3D7MA 4YVFA 3PGA1 4NK5A 3Q88A 4P80A 2P1DA 2D62A 5KYUA 2C7BA 4WTOA 1J25A 1VJDA 4L85A 3B7WA 4NV3A 1AG9A 3NGLA 2IS4A 1QU3A 4RZHA 3DEAA 4CCYB 1NVAA 5DHTA 2J9RA 4R83A 3WQQA 4B3FX 1RWBA 2XQFA 4LNUB 2GWHA 2J31A 1RYYA 2O2ZA 1ZJ6A 2KBFA 1KO4A 2FMIA 2XIQA 3L7JA 2H51A 4UE6A 5EHXA 5FH9A 2FEWB 2ZQYA 3ICOA 3SQWA 1SU6A 5H3LA 2ZM5A 4PE5B 2GBPA 4AS3A 4OQEA 4Y2TA 4AO6A 3ZZ1A 4Q9AA 4MV7A 4S12A 4DXHA 4FYWA 3W3AD 1DKQA 3IIKA 4K9SA 1EWKA 3IAS1 4ALLA 1NW7A 4F85A 1A9QA 1L4YA 2W90A 2PDAA 4UZSA 2PZLA 4JLMA 1M6HA 3FPJA 1M3SA 3RUDA 4L7VA 3D7KA 3GPIA 1XEXB 1Z38A 2VUHB 3SWWA 1JB1A 1UXOA 1VYHA 2DTEA 4KQEA 3EXIA 3IAAA 1SC9A 1VKHA 4PBSA 3W5DA 3IEMA 3ZCXA 1XKLA 4JQOA 2WJGA 3ZJ4A 4F4UA 5LM3A 5JADA 1XK6A 3LS2A 1GAWA 3K0KA 1D0VA 3LPLA 4H7IA 4HD8A 3LLSA 5ESXA 2X0FA 4CLOA 2NP6A 4YC7A 1C50A 1LVGA 3D8TA 1JS1X 1XMXA 2DBYA 3INGA 2VAPA 5CK5A 2MTBA 3D6VA 1EFHA 1W47A 4R81A 2XTMA 3PEVA 5EJGA 4P84A 5F77A 3FCXA 3LHFA 4ZJYA 4EB0A 3OQNA 3VMMA 1NF2A 3AIMA 1IXSB 5FD8A 3IIIA 2ODEA 3HCRA 4O2AB 3T6KA 2EKDA 4ZI5A 3TLMA 1GPH1 1H2RS 3WO1A 1L3IA 1EUCA 1XL0A 4HPXB 1I3NA 1TKRA 3RUIA 3TX2A 2I67A 2QLLA 3SMQA 3UCFA 3H42B 4BDTA 4AB1A 3P97A 4KQFA 1FOEB 1WXQA 3PDIA 2ZWAA 4DUGA 3BWEA 4ZO4A 4BNNA 4WNYA 4R16A 3QXGA 4PAGA 3GUYA 4V38A 1BO6A 2EEPA 3ENKA 2JJ1D 3BG5A 1EX1A 2QD2A 3VVCA 2PUEA 5KSWB 2I3BA 4F46A 2D2VA 2OGSA 5HHTA 1NJ5A 2RONA 2LKDA 4MCJA 4PZUA 1BKDR 1EA7A 1SU8A 2PR2A 3TIFA 3UFBA 1YR1A 4ISCA 1UJBA 1ODTC 2VP4A 5DNWA 4E3WA 2VRWA 4DWOA 1TA4A 4UTZA 1KVQA 1XZKA 4FWBA 8OHMA 1UM8A 3IRVA 1XT6A 2C5AA 3E5HA 1YJXA 2HHHB 4DVGA 1R18A 2QTVB 1XZIA 3K15A 3CVXA 1GPUA 1OWMA 1P5RA 5F23A 2YV3A 4B4KA 5CVCA 4RHTA 1OZ0A 1QFMA 3HVKA 3MWEA 3G8AA 5DV9A 3TM4A 4ZXFA 2XZDA 2O1SA 4LPSA 4UHCA 2DXIA 2VIIA 4Z0PA 4BGVA 2JHCA 1YB1A 5KYTA 2E6UX 1NBEA 5BXYA 3NU1A 3CISA 4C0XA 1R0ZA 3QMMA 2C9CA 2CXQA 1J39A 2V6IA 3FYHA 4FX5A 1I01A 4HRXA 4Y2VA 3ROQA 1WHTB 3ZK8A 2GAAA 4RPCA 4AZ3A 1PS8A 2XR1A 2O54A 1CCWA 1K9VF 1SVWA 2O7RA 4NU0A 5KYXB 1KFKB 4Y2HA 3VYVA 4Y98A 2JAUA 4B1FA 5REQA 5H4HA 4X84A 5EHQA 3CKYA 4ZVKA 2A5GA 1AKEA 3B6IA 4XGIA 5THXA 2HSEA 3B1YA 4E5MA 5KOHA 1ZHOA 3WRXA 2PM8A 1XQ6A 5EJ9A 3SJCA 1II9A 2RGNA 2AUNA 3RRXA 4EJ0A 2AKYA 2XZLA 1ES9A 2J33A 2ODNA 4HTFB 3DP7A 3C85A 4P0QB 2XWPA 4AO7A 3FTQA 1G5IA 3ZX4A 5K3BA 4P3XA 3OCCA 4B6GA 2BTEA 2VWGA 2BGKA 1QQ5A 4Y6OA 3WNQA 3CEHA 2O8EA 3ONNA 4KR2A 2O05A 1TDJA 3IMKA 3HVHA 2EZUA 1NRJB 4W8OA 1YKFA 2A57A 1V9CA 3BXEA 3IUMA 4GMGA 3TLEA 4RLFA 2B5OA 1I6WA 1HBJA 3KKKA 4WJZA 2P6OA 2RK4A 2B8WA 2AOUB 4ZHQA 1RI3A 3QQPA 1IM5A 1P9NA 1CRZA 1NM5C 1PWHA 3LPDA 1HDXA 1UBLS 4OQDA 3T54A 4AXXA 5K0JA 3HVRA 2IF2A 4D9GA 5CAEA 3GLSA 4M36A 2ZUFA 1UJ6A 1VECA 5HBGA 2GCOA 4I55A 4IOMA 5EPEA 4BE7B 4Y6QA 1NI3A 4ZODA 4DDTA 3MTGA 1OSNA 2QTNA 4UAGA 2I29A 1CDZA 1B41A 4B73A 1FSGA 5JMPA 5JXWA 4GECA 1P62B 2GNAA 4NE2A 3RJZA 1L6IA 4LXXA 1KVTA 3DTVB 1XTVA 2FRDC 2QW0X 3BXXA 3CLTC 4NJEA 1FBNA 1HNWB 3RHZA 3PJGA 4IUDS 1MNQA 1KERA 4R40A 5DCWA 2PNFA 1ZSVA 2L17A 2AQ8A 2AOUA 2QM8A 2QN6A 2ZR0A 3TTUA 1PJZA 1Z37A 2G6BA 1MD9A 2F3QA 1H1TA 1UAYA 3ESYA 2VK8A 3FB1A 5IJ0B 3OZAA 3P45A 3NT4A 4YAGA 3BRSA 3MOGA 3R4VA 4JMLA 4M99A 4XZ3A 2AS0A 1FFDA 1OOEA 3RB8A 1XELA 1KMIY 3K6SB 1GTG1 4AKGA 4DA9A 1SD1A 3WRXC 2G4LA 2PMFA 1YKSA 3QKTA 3S1SA 4PWZA 3F6EX 3BN3A 3MOSA 2BRUA 5CUQA 1EM6A 1DC3A 1J8MF 3A3OA 3AV0B 1OH5A 4C4ZA 4RVCA 4M9UA 2E1PA 1AN9A 4RMNA 1BEEA 2IXTA 3U4AA 2RH5A 4UHEA 1JDBC 1VA4A 5CVVA 1QS0A 4MARA 3B2NA 4W1QA 3VTAA 2Q4TA 2YJ6A 3H99A 3JWPA 5AH0A 3RAPR 4HV4A 3IA2A 3MS7A 4YJ3F 2VSNA 4QLAA 2VXCA 1VE1A 3BMXA 4YP1A 3SKVA 4EHLA 1PNQA 1W88A 2FWIA 2HB6A 2IXDA 2L2QA 2LE0A 3KXIA 4MVJP 4P3KA 2W93A 4Q9HA 3I3OA 2XW6A 3BWYA 4BNDA 2A7XA 2GLUA 3AM4A 4G89A 5LN1A 2YFHA 4V1CB 2C5GA 1SKAA 2I2AA 3IVMA 2Y1EA 1OY1A 1Z4OA 2W71A 3P96A 2J45A 1A96A 1TZKA 3OM1A 4EDHA 2J0SA 2YWDA 4AG5A 3EIFA 1I2MA 4F3YA 1NN3A 3CBGA 2O0LA 1XFAA 2R8BA 4R2JA 2MSKA 2FMUA 4M8IA 3GMIA 4PYOA 2Q21A 4FWIB 2XDYA 4RHFA 3O8QB 3OPQA 5HMLA 2BI7A 3INRA 2H1SA 3MJEA 3V1YA 5JH7F 3CB4A 1I7SB 3TSOA 4O63O 4A6PA 1QQTA 3MHTA 2I8AA 1BCSB 2UYCA 4LG1A 1WNFA 4URFA 4BMXA 5EJ5A 5K0CA 5DEOA 2FXIA 1TCUA 3PKIA 2EAUA 4EX7A 4GNRA 2EFGA 4S05A 3LJKA 2IEIA 2XTNA 3R44A 3VBEA 1MT0A 5K09A 1IN8A 1T36A 2P9EA 3H19A 4KHZA 4NNOA 5I5GA 3U7RA 5JQGA 5LYJF 2GPJA 2WK1A 3LGAA 2VKTA 3MJDA 5AI4A 3YASA 2X9NA 1T3HA 1Y80A 4CHTA 3AEUB 3AY7A 5LIRA 4G0UA 3E22A 4XX1A 1Q5PA 1UP7A 3K1TA 4KAAA 5H9VA 2BCEA 1QVWA 3CUSA 5TGDA 3W8DA 1WZUA 2IKQA 2OOSA 5CVTA 3E35A 1CR1A 1K5GA 1PBNA 3RARA 3FPSA 4MUEA 2MYPA 3HCEA 1JALA 4R8RA 4G97A 4MVYA 4E13A 3N0XA 4N6GA 3OIVA 3THXA 1BQ4A 2VF4X 4IIXA 1U80A 2BMJA 4IVPA 1ZGZA 1YAJA 4XR4A 4CEIA 3ZCVA 2CNOA 3BGVA 4YS6A 4LWQA 2J5XA 1WB5A 4FT2A 1FJHA 2UDPA 3FA2A 3H83A 3JSXA 4QD3A 3FWNA 1Y1TA 2FSSA 2QSJA 3HR8A 3JD3A 1R6AA 1BNCA 4FYKA 1L7MA 4PWYA 2FCRA 4R2WA 4BTLA 2QXYA 4WK0B 2Q1UA 2BI4A 4FHEA 1K4MA 4MQFB 1Y7HA 4D4JA 1Y1RA 5EJIA 1Q3TA 1E2LA 2X5XA 3NAZA 2QY9A 7AT1A 6YASA 2IX3A 1PRYA 4F4FA 3AUTA 3QMVA 2NIPA 3SVLA 1RI2A 2PGXA 1FUEA 4K9LA 2UYHA 3K3PA 1OBVA 3MJHA 2RHCA 3H9BA 4IS3A 4JSYA 1CK4A 1MLDA 1VHWA 3DULA 3I2IA 1T5OA 1GR0A 3M4YA 3VOBA 4V0NA 4QGFA 4YX9A 4RMGA 3GH3A 4IDBA 4FLFA 4IJQA 4EHBA 1KZ1A 3F73A 1S8NA 3NEYA 2PS3A 5LC1A 4FJ1A 2CMGA 4AF8A 1L7EA 1CVLA 3H2YA 3EGXB 4XQEA 4Z9XA 1AXGA 1XHLA 2D1QA 2XEXA 1JXQA 1N9KA 1DAHA 4JBIA 3M9LA 4LJ7A 3T1NA 3UJ6A 2OHFA 1KZ7B 4BASA 1XEAA 2HA4A 3VA7A 1ULTA 3EZFA 4M38A 1CB7A 2JAXA 2JZNA 1U0FA 2JFGA 1T3ZA 3PNOA 3V1MA 3LGSA 4WD3A 1IJEA 4JZKA 1LPMA 2R751 4LRTB 1A97A 1TMYA 4Q3OA 1E1RA 4RPIA 4E46A 5ELXA 3KVVA 3OKCA 4Z2YA 5C46F 4ZYYA 2FEXA 2PJZA 1NKSA 4KIJA 5IKOA 4AKEA 4K9MA 4QELA 3SXPA 3PF8A 3PLAE 4OM8A 4WHMA 1FNSA 2Y93A 2J9YB 3DZFA 3W2EA 3OIWA 1QAOA 5CYPA 4LFCB 3OZIA 2CFCA 4KU4A 4MCHA 5ALVA 1Q95A 3AX6A 4BYGA 2AHRA 5D87A 1GQQA 3L4EA 3OBBA 4MV9A 4E7PA 1GSIA 1YRQA 3LRPA 4KIFA 2ZRNA 4KVFA 4RD2A 4U2GA 4MRNA 2W58A 1OD6A 1GNTA 1E6CA 2JARA 2Q4DA 4LKRA 2HK6A 4IFTA 5EY5B 1Z88A 3WG9A 3OZUA 2PD3A 4B6JA 2A0YA 2EJVA 3MRSA 4K26A 2XWJI 3ADPA 4C7XA 4OLBA 1DIAA 2V5UA 1T5SA 2RB4A 4ZD6A 4B7AA 4CKEB 3CSUA 1PFKA 3N74A 3PRYA 4F45A 1PUJA 3ZVRA 1SBQA 3FTDA 4P08A 3COWA 5T41A 3CRNA 5CA0B 3QXCA 4GICA 3GLIA 2YVKA 4F0JA 4TRJA 3NP9A 4FR5A 1TJYA 2BZ1A 1FC0A 1YQDA 5BYJA 2GLXA 1WSBA 1L4BA 2XF2A 2LCQA 3ORSA 1UMBA 3HB9A 3I9OA 2QQGA 4MW7A 4MI3A 1TIPA 2E3JA 4O0MA 4JL6A 1XTBA 4L8FA 2FWRA 4NYIQ 3NV7A 1N2GA 1QH1B 2ZK7A 4RIHA 1V9LA 4YAFA 4WJLA 3KELA 4H08A 1WRBA 3W34A 1XKXA 1XVLA 1DC7A 4OF4A 4DG9A 4H3SA 3KLMX 3QG5A 3GFVA 2WJ4A 1D1PA 1EHYA 2P90A 3EUAA 5AI8A 4JZYA 2V45A 1Z36A 4BNKA 3VDNB 1BN6A 5TGZA 1NQAO 1QHGA 4PLHA 3TTTA 3DBHA 2GPSA 1RS0A 2LP4Y 4JJ7A 1UPCA 4KRYA 2WFAA 2GFHA 3S2ZA 4U7JA 2L18A 2BHSA 2GOYA 4IJ5A 4ND6A 4QXMA 3PWTA 4MRAA 3O4GA 1V11B 3IQDB 5DVZA 1ZGGA 1FFAA 1MB0A 2A0KA 1Q92A 4JP8A 3L9XA 3QBEA 1FMFA 4GM0A 3KOZA 1R9MA 2JIPA 4ARIA 1HQKA 4GLOA 1CUJA 2HK7A 3ONEA 3AIKA 4BLQA 2FUG1 3AKZA 1FZTA 4Q21A 2D0DA 4OLAA 3VISA 3RTGA 1VMAA 2OUKA 1RC8A 1EHCA 2A4KA 4P6VF 2FKNA 3DAGA 3U1TA 3TL6A 4P31A 4QNRA 4E2FA 3KB1A 2JA1A 4MGYR 4EUEA 1RQGA 2YXBA 5DXJA 1J1UA 1SGWA 2CYAA 2PQ6A 3GDGA 3C74A 4DIEA 2BM9A 1LW7A 2I1VB 2XOKA 1QHFA 6PFKA 4J7CA 2GJKA 4R8VA 1H3EA 1JI0A 3QPUA 4J0GA 4AY6A 2OLKA 4GYKA 4CKWA 1WVGA 1WXFA 3V8BA 1XALA 1RP1A 4QFDA 2X14A 3GEMA 1HGXA 1RHKA 1E6WA 3NM5A 3U7HB 1A77A 1OBHA 1TZCA 3BJEA 3UJCA 1HMYA 4CCWA 5BV0A 5EIBD 4X45A 5HP4A 4EVRA 1KEEA 4EMSA 1A50B 2V54A 3DL2A 5U1PA 5JG7A 1G8SA 1RC0A 4JLSA 5IZ4A 2FOIA 4R2LA 4PR3A 4EHAA 3QPAA 3KS9A 3G82C 1SIUA 4P4UA 4LYYA 5ELLA 1ZCAA 1Y4SA 4LHEA 4I36A 4M0LA 3T15A 4FW8A 1E2UA 1C8LA 3JQGA 4IZ6A 4AG3A 4AW9A 3AR4A 3WNZA 3CZRA 1LH0A 1I1NA 1OAOC 3VNUA 5A2QA 3U0BA 1NIPA 3T7AA 1G6HA 1IBRA 3KSDO 4EO7A 3IILA 3PX3A 3U0VA 1M2VB 2E21A 3F4KA 3NHKA 3NH6A 1WWKA 3KV1A 2GLTA 4TT3D 4XIFA 4EPVA 2HQRA 3HP4A 1HXHA 1B8VA 2IUFA 3B20A 3KOYA 4J91A 4WK2B 2FFJA 2BFOA 3WFZA 3AYXB 2Y0EA 2PS0A 4MX8A 5HS6A 1HFEL 1FY2A 1U04A 3KQQA 1BFKA 4OGLA 4YECA 1W52X 4JWTA 4UVHA 4G56A 4GDMA 4RESA 1XA4A 3FUWA 3U9TA 5EP4A 5KBYA 2CUZA 4TZ0A 4MQBA 2C7PA 4B74A 1ORRA 1QHNA 4GZ6A 4I5EA 1KQNA 1ZM3A 4PO1A 2QPOA 3K70D 4BFTA 2JGFA 3R3XA 2QJFA 1M0TA 1GZDA 1TLFA 2C2BA 1E9DA 2ZJ8A 4LDAA 2F1JA 1SXJB 3OQIA 3CMMA 4IZOA 3U56A 2CZQA 4LYFA 2IA5A 2YYZA 4B3CA 2YIMA 3W9SA 1Z4NA 4YCNA 1SUAA 2ST1A 1JR3E 2OLEA 3D2CA 1Z0IA 1OLUB 4RPJA 4AYTA 4K8OA 2AUMA 2M6LA 4GE3A 1WE2A 4Q9JA 1P1IA 3RFUA 2OXFA 1JYEA 1HOXA 3L8YA 4O0LA 4DQKA 5T6BA 1VBMA 3JU3A 3PC3A 4TVOA 3JVUA 1ORWA 2GM4A 1OYOA 1T6BY 2V7VA 3BJZA 4CMJA 4CCAA 4YAEA 5TDHA 3SF8A 1E7SA 1T0BA 2PWPA 1UBCA 2R96A 3JZMA 5JYCA 1ISFA 1U99A 2FN7A 3UMFA 1AKUA 4JI6B 3V8PA 2JLXA 1ZJ5A 3H2SA 4BEWA 4MOWA 3ZBUA 1Y6GA 1M76A 1XP5A 3RGWS 2H1RA 4RFVA 3STVA 3LE8A 3T7KA 1DMSA 3A3YA 2H92A 3QFSA 2FSPA 4OHBA 3VR4A 4J76A 1E2EA 3HDHA 1SRQA 2O2HA 5EZYA 4AKTA 4QECA 1KKLA 2IX9A 2XNDA 3SSNA 4X61A 2E4WA 2HY7A 2AMVA 4BO9A 2PBLA 1U1GA 1TVKA 1XUOA 3ZXSA 4PSUA 4DR3B 3EXEB 1UBJS 3CPEA 3IUPA 3NW9A 5LB4A 1II0A 4KYTA 1XFDA 2DPGA 1DE0A 2FLWA 3TNFA 3VU3A 2IC5A 4WZAE 3BIJA 3H5TA 1CS4C 1I2CA 1QU2A 2C4TA 1O0CA 2GKGA 4YAWA 5C1PA 1DWOA 1JW9B 3DQQA 1ZIOA 3UICA 5K0ZA 5LMCA 3OZEA 5I8PA 1PX0A 4FNAA 3DMGA 2IW1A 3UHJA 2LRHA 2I34A 4FCCA 1PZFA 1RADA 2YHBA 1Z0FA 5TR9A 1VXRA 3TD2A 2Z4SA 2XITA 3OF3A 1Y6ZA 4G4SO 1L4HA 3BCRA 4LXTA 3FDZA 5JPCA 1W4RA 2C58A 1DTEA 3X0DA 3ZXUB 4BGEA 1ODCA 3UHFA 2RIPA 1VKOA 3JAMA 4YJFB 5F2NA 2C2KA 4AQYB 3HR7A 4AX4A 1K68A 2JLSA 4HDSB 4QT4A 1V8FA 4K6FA 4QUJA 4OA8A 4E51A 2DR3A 4M8LA 1J5PA 3L1IA 1U2PA 4UOQA 4DVJA 1A71A 2O0MA 1C3JA 3KUCA 2FV8A 2QTAA 3A1FA 5FQNA 3E5NA 2ZZNA 1VIYA 2Z04A 3A2LA 4Q7MB 3FKSA 5EP3A 2B30A 1UDXA 4BX2A 1CYEA 4K9NA 4L5JA 4D3DA 1W5AA 4NZMA 1X86B 2CVOA 2VP0A 1AGYA 1JQEA 4DL9A 1HWYA 1YDWA 1QH9A 2FN3A 3QXSA 3VNVA 2QN7A 4PHHA 4PYLA 4M60A 2G0NA 3B9PA 4OY3A 3QYAA 1HZZC 1PN3A 2P62A 4KXVA 2EZ8A 3DAYA 3E9EA 1UJ2A 1C4WA 1U1DA 3H2JA 3NC1C 1PVDA 1KFEB 1O96B 4PLZA 5TS3A 2OKGA 3O75A 4DV0B 5D85A 1XVVA 1YSCA 2JA2A 3CRQA 3FSEA 3MYRA 2VHJA 3CF6R 3N2KA 4RH0A 1WXXA 2WSSD 1EGQA 3A4VA 3B8EA 3SAJA 5GZ1A 4JXZA 2GAOA 3VHRA 3CF4A 1IQPA 5HMMA 4EQ6B 1D4ZA 4MICA 4OH1A 3OTHA 3HV2A 2W6ZA 3GQBA 5G41A 2WFZA 4JEMA 3DD5A 3L43A 4NDNE 4UXJA 5G40A 1L4GA 1A8HA 3FOFC 2GEKA 1KDYA 1RQPA 3WTBA 5IASA 1R16A 4HQ0A 3ZKWA 5A04A 4QREA 1D0IA 1RNLA 2WM9B 4BWVA 4G2NA 3V4OA 5BOSB 2DETA 3TSZA 1JR6A 4LHXA 3FKQA 3OE1A 3ZD6A 4RXUA 2CV2A 4BPRA 2F9FA 4N0PA 4NBVA 4BU1A 1EFVA 5K0NA 3SR4A 3EDMA 4AJ1A 1QHSA 4W7HA 2OWDA 2ZSHA 1NUPA 3KZCA 4RDCA 3OVMA 4J0IA 4GQBA 4KTTE 1Q0ZA 4CV3A 2IYXA 2H31A 3N5KA 4DBVO 2BKAA 3B1WA 5JS8A 4OJMX 1M67A 1GKLA 1HX7A 3EF1A 2NVBA 1DIBA 1J49A 1MA0A 4GH5A 4GKBA 2PWBA 3PXDA 4D4GA 1YS6A 1P2GA 5G2OA 3WK4A 2BEVA 3GUZA 1Q0RA 4JR2A 2ZE7A 1VPVA 3M49A 3VPFA 1S2DA 5FBZA 3Q2KA 1TFUA 3ORYA 4LF4B 1EAYA 1RDFA 4G8CA 1GZ6A 4RK1A 2VTDA 1JX6A 1G2PA 2QQFA 4AL4A 5E3HA 3KIPA 5IABA 2Z8YA 3TUZC 4K2HA 2RD2A 5KOJB 1AKNA 4CMIB 3HK2A 1N78A 2O3SA 4MZDA 3HU5A 4IMRA 1WXWA 4G0QA 2XUQA 5F7JA 2VCEA 3PKJA 4OI4A 3ZCSA 1POXA 4MV0A 1VL2A 2GKOA 1UIMA 3JARA 3JQPA 3SQMA 1XN1A 2GA8A 3EHEA 4CKCB 4P58A 3N75A 1M73E 1PZMA 4TTTS 2QK4A 3UPUA 1PTKA 2BEJA 2OENG 5JVDB 5J23A 2WM3A 4HO1X 5FUQA 5DTMA 2M98A 3F6RA 4QPJC 4J1TA 3RHSA 3GEGA 3I58A 4UU0A 4N47A 3K72B 3L2OB 2HJGA 4OI2A 1DV2A 1Y5NA 2V4ZA 1JHDA 2C7QA 1DINA 2RGAA 3FGOA 1BFUA 2I76A 3QPVA 3N8GA 1SBNE 1A82A 1L5OA 3BSSA 3U9SA 3ENQA 3AI1A 3ZW9A 1H8HD 1BX3A 5CM8B 2YCBA 3FFWA 3Q3IA 3FDIA 1DXYA 2WWGA 4E4TA 2VZ8A 4OHCA 5K6AC 3DW1X 3PTAA 1Z22A 2PEYA 5DM70 1IBLB 3H5IA 1V8ZA 2Y0BA 1KIAA 4D3SA 4F6RA 5T4HA 4AC9A 1FJ2A 1IG3A 1PEKE 2NOAA 1DQNA 3T5AA 2V5VA 3RRBA 5BMVB 1SXJE 2A9PA 2JS7A 4TX1A 1E2KA 5EGSA 3U3MA 2EX0A 3PBKA 3THWB 4ZGWA 1RRCA 4B2YA 1AMUA 2C99A 1ZBQA 5JD5A 1WHSB 2XVXA 1FFWA 3L7BA 4HEA6 3IOMA 5CDYA 3PQCA 3H75A 2QNIA 4HMPA 5CM9C 2RB5A 1N77A 4E88A 1ECCA 1G20A 3A36A 3FGZA 3I32A 4ZCIA 4UBKA 1EUYA 5F52A 2UVPA 4MQEB 1T2NA 2YTZA 3TRFA 1ESEA 3PPYA 3OPVA 5IEBA 2VTBB 3TPZA 2QMZA 2ZWMA 3H5AA 2VPXA 2LGJA 1CE8A 1UF9A 3CEMA 1Y8ZA 4LJLA 4B31A 2AFRA 1HDZA 2POCA 3MINA 3BMQA 4BB9A 3KQUA 4A15A 1EUDA 1G64A 3IP8A 3JAWB 2P2ZA 2LPMA 4V3BA 4ZEXA 3ZHZA 1VCHA 1B23P 3MAJA 2F7SA 2RHLA 4PN3A 4H6PA 3HDVA 3CKLA 3N59A 3WNDA 2EFJA 5BSEA 1KJQA 3KEQA 1PR2A 3E53A 1SCQA 3A9CA 4RK5A 4UARA 1POWA 1Z75A 3WGIA 1EVYA 1UWKA 3NIGB 4LV5B 5CR9A 4XVRA 4YONB 4H7KA 4DM4A 1Z5WA 4PLFA 4CIDA 3BKXA 1PX2A 2GHQA 1PLLA 1QGED 1SFRA 3OQJA 4LE0A 2DFNA 1HC7A 2EARA 5HKKD 4PW0A 4ENTA 4EG6A 1PF7E 3W8FA 2A35A 1W36B 2NAFA 2OMKA 5JI2E 2PCLA 1KC1A 2VC2B 3WSTA 2ORVA 2B20A 1RAAA 5IC4A 4C4PA 2GZSA 1YA8A 3WXMA 1V7QA 3IJ5A 3FIJA 1GQFA 4W5QA 1LX6A 4OQMA 5TLSA 2PPLA 3CUWA 3WI7A 3NLLA 5K9ZA 5LBTA 1N2JA 2HSWA 2EP7A 4ZICA 5FBVB 1OILA 4BMOB 1DJPA 1LFDB 3B89A 1V2HE 2Z8ZA 3IAM6 4QBTA 5TEVA 4N3GA 3A04A 1XL1A 4C1BA 3E9MA 3UJBA 2C4HA 1QO0D 1YZGA 2IZZA 2OR3A 4LC0A 2BZ0A 4Y8VA 4EG4A 2RKWA 3IA7A 2C82A 5B30A 1Q6YA 3KB2A 3T7DA 3TLZA 3ED5A 3EDRA 2ZE6A 4U5QA 4BMVA 1K2VN 1ECGA 1YQUA 1ZUHA 3OLZA 4BPBA 4R7GA 3TTSA 4EF4A 4HNGA 1Y0BA 4RPGA 3WLTA 2HJWA 1NF8A 1NOKA 3CZQA 2RHWA 3T9DA 1GP2A 1QDLB 2YY5A 4OFXA 1FF9A 1I7NA 1JQJC 1NI5A 1PGQA 1ZMXA 2AFHB 2FN4A 3QX7A 1M1ZA 2H7XA 4PFQA 3MNFA 2NUPB 5KOIA 1SD5A 1AK2A 4NCKA 1U7TA 3VR5D 2O8VA 3CRZA 1PYDA 2V58A 4WACA 1XMOB 1CERA 3UWSA 3HPRA 2WY2D 1GKIA 4DYDA 4G25A 4GWGA 4KYVA 4JROA 1PDVA 1ZPDA 3F5MA 1LSJA 1PZGA 2V97A 1EHIA 4OU5A 4UM5A 3CUYA 4N5HX 4B3TB 1OA1A 4YN3A 4IEEA 2WWFA 3AT1A 2PBRA 3S28A 5B7NA 3BOSA 3FYUA 1ZMRA 3REFA 4G41A 3SYNA 3CZ5A 1VJGA 5TMPA 3VM6A 3OLVA 2LIVA 1KGSA 5K0FA 2AX4A 1VLMA 4KDCA 3CNQS 1PR9A 2DRIA 3F3MA 3NDIA 3G2JA 4J6EA 3GGOA 2MSDB 2XB6A 1RQXA 3L18A 3VZDA 4BCCA 1T5DX 5KUTA 4AJ9A 3KR2A 1KORA 1UBHS 4UEOA 3AV3A 1JLMA 5DYWA 1I9GA 1YVUA 3NUGA 4MKRA 5JO9A 1YS2X 1L5HA 3UW1A 2H11A 5TQ0B 4D8UA 2QRKA 2HHAA 1ZHFA 3FFAA 1NXPA 4IIYA 1FS6A 1KZ9A 2AA3A 2ZJ3A 3FHCB 4AYXA 4GBGA 2FEKA 3UXHA 4YRBA 4G2TA 1JSZA 4HAUA 4X95A 1XPUA 3RANA 4BFZA 3D8HA 2P4SA 4E1BA 2IQIA 3SZLA 4CI0B 1SCJA 4P82A 4HQRA 4NRDA 2FUKA 3LBYA 3OQ1A 4LVUA 4YP9A 4N82A 1QV6A 3PNYA 3O84A 5FPTA 4XEUA 4BKPA 4JB2A 1ISIA 1SQ0A 2FW7A 3GJ3A 1B8NA 1JKJB 1XCBA 1YDEA 2AE1A 1PFVA 4L78A 2BTQA 4QTTB 2ZSEA 4D9FA 4EUKA 2JCVA 5D5PA 4Z4CA 4A5SA 4BNUA 1C1DA 3VKHA 3DYBA 3IBCA 2Z30A 4WXEA 5BNWA 2Q8PA 1RR6A 2CXXA 3OFND 4E30A 3R9XB 1Q7CA 1X7ZB 3IDZA 2FFAA 4X54A 4UEKA 1JQBA 2D59A 1KQFA 4LVNA 1L8AA 1L4FA 1W4ZA 3OPMA 5DHSA 1KY4A 4COKA 3LGXA 2ZITA 1ECLA 1E1KA 4FNGA 1Q3HA 1ZINA 3BX1A 2XKBA 3UGQA 3VOTA 1V5FA 2DHRA 3CVWA 2WV7A 2ZSJA 2QLNA 3UT5A 3AFNA 3FY4A 4UVIA 4C01A 1DEHA 2G72A 4LJSA 4XGRA 4DANA 3LYAA 2XGJA 3BA1A 4WDQA 2XCIA 3LP6A 4MWTA 1BGWA 1V43A 3WLEA 5LKRA 3QA9A 3LQ2A 2CVFA 4RQTA 3USZA 1T8PA 1JEOA 2ZAGA 5LZ2A 4XCQA 2MHCA 1HURA 1KDRA 2F3RA 4FE4A 1LLUA 1HOTA 2XE8A 5KJ6A 3ZZ0A 7ABPA 4Q0MA 2V6BA 3TOXA 5CM2Z 2QN9A 3FFXA 5JIBA 4ZOBA 4YRTA 3PC6A 1C29B 3UUGA 4YWJA 1IN1A 1E1CB 1I9CA 3EFEA 3F97A 4MP6A 2VXYA 4NH4A 1UBEA 3L7KA 3TUJC 1KI6A 2YKGA 3KWJA 4IGAA 3UHPA 3U7JA 3G0DA 1NHGA 3RFVA 4XSGA 3RYHA 2P2YA 3ANYB 1JKJA 1PLJA 3D2AA 5E1OA 1Q0PA 3L0IB 4YT8A 3H87A 2XCSB 2YV2A 4IIJA 2L19A 3V8RA 1YB5A 3ZVLA 3MUNA 4M0FA 4QOGA 3R6TA 4B33A 3FYSA 5AK3A 1QK3A 4HWTA 4X20B 5FBRB 4PPFA 4DS3A 4EI8A 2CV1A 2B8TA 5EKUA 2LBPA 1YL5A 3QKRA 2NO7A 5AXAA 1DX4A 2NZUG 3NKFA 3OE4A 5F78A 1T1SA 2R84A 4UHBA 2E1RA 5AKIA 1JG6A 1PWEA 2QSZA 1V5GA 4JXXA 4MWZA 1NQXA 3FCOA 4GDFA 1YIAA 2VXOA 5D3MB 3TLKA 2QN1A 5KYNA 5LWHA 1GU0A 1PT5A 2DHEA 5K8VA 1MNAA 1QZ3A 2FPXA 4V2IA 5CB6A 1NRXA 2P6UA 1M8PA 1OGJA 4Z2AA 5DE3A 3OU2A 3NT5A 3VO1A 1T9ZA 5AHKA 3UFXA 4D25A 4ZO7A 4JBYA 2CNKA 3ACBA 3DNFA 5KSOA 5FPYA 4U2EA 1H2WA 4JL8A 4B48A 5ECDA 3IUEA 1G5RA 3EAGA 3R9IA 1PKEA 3O7WA 2POQX 1W76A 2C1XA 3BSFA 3Q9UA 4UAJA 2UXDB 3QEMA 1PZXA 3MWLA 1V71A 1OWLA 1U2DA 2C97A 1E4VA 1JHXA 2B7LA 2F6RA 3DMTA 1Y8AA 5TMEA 4O1MA 1PZHA 5IF9A 3I92A 3A28A 3IB6A 3NNNA 3OD5A 1YZNA 2Y27A 3V4PB 2PMKA 3ZN2A 3WGJA 2R5NA 4IW3B 1TECE 1CB0A 5IWAB 3N2IA 4HS9A 1AS3A 3WHIA 4HWKA 1ZW1A 2ZATA 1GUFA 5ITZA 2AEJA 4X44A 4HZUB 1VKRA 3BZUA 4JCCA 5TMDA 2XQGA 5E6UB 3BAZA 8MHTA 4TUYB 3FB4A 4YRPA 3GMSA 4HDCA 1II8A 3KR1A 1S7CA 3Q2OA 4BNIA 2XNJA 3PQEA 5BYBA 5IAKA 1H4TA 5J3JA 4A73A 3NT2A 5F1YA 1MEEA 5DW3A 4RWEA 1H5NA 5JCJD 3FF4A 1J0AA 3X1YA 2FHPA 4HFMA 4DLXA 3RVRA 1E9VA 2JCXA 2HIHA 1F5SA 4LZLA 1OYWA 2IBMA 2DYKA 4EJ2A 1PDOA