3R8CA

Crystal structure of cytidylate kinase (cmk) from mycobacterium abscessus
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
220
structure length
198
Chain Sequence
SMVVAVDGPSGTGKSSVAKELARQLGASYLDTGAMYRIVTLWVLRAGVDLTDPAAIAAATDQVPMSVSSDPDAQTALLAGEDVSVPIRGNEVTGAVSAVSAVPAVRERLVRQQRELAESSGAVVVEGRDIGTVVLPDADVKIYLTASAQARAQRRNLADVQRRDHLPLRPAEDALEVDTSDMTQEQVVAHLLDLVRTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytidylate kinase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium abscessus
molecule tags Transferase
total genus 68
structure length 198
sequence length 220
chains with identical sequence B
ec nomenclature ec 2.7.4.14: UMP/CMP kinase.
pdb deposition date 2011-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3r8cA00
1JJVA 1RYFA 1YZNA 4PAQA 1FUKA 2FPLA 4LSGA 4Q00A 3AKDA 2WJVA 2XJ4A 4Q4HB 5L3QA 4L9SA 4BLOA 3AVYA 3A6PC 2VSOA 3A4LA 3U6BA 4Q1CA 1M2OB 2RGGA 4XVQA 2ASEA 3BFVA 3JZAA 3LO5A 3LVQE 3U44B 4MDFA 1SXJB 1XD9A 1KI8A 2H8KA 2V8OA 4PC3A 2V6JA 3I8SA 1HT2E 1W1WA 3W5JA 4BLSA 4KJZA 1KY3A 4RKFA 5GJCA 3EZ9A 4KHZA 2JLRA 1OJLA 3OAAA 3RNLA 3HU2A 1YVDA 1E9SA 1YR8A 2OBNA 3CW2A 2ZYVX 4PC2A 1QG4A 2QE7A 5FOTA 4EUNA 1KK3A 2FV8A 2ZVQX 3ZDQA 4EPRA 5JWOA 1CR4A 2B21A 4WBSA 1X3SA 4C3ZA 2WM9B 4MYCA 3MGCA 3HR8A 2GVDC 1E4VA 2QG6A 1G5RA 3KFXA 3OHMA 4LZZA 4FN5A 3U3KA 2FU5C 3B1YA 2RHMA 1UKEA 1ZYUA 1YQTA 1OB5A 2E9SA 4DIEA 2WJYA 4AYWA 5JJIA 2R6GA 4LJYA 2IT1A 4QRHA 2G1JA 3WXMA 2ODBA 2ZI6A 1M1YE 1P2VA 3GD7A 1BOFA 2WKQA 4R2IA 4JVNA 1T4GA 3RS3A 2X77A 4FCVA 1NKSA 3KJIA 2GVZC 5ANRB 4R98A 3CB4A 3LLMA 4IVRA 4EFNA 3PUXA 1XEFA 3KFVA 1NN3A 1VPLA 3ICEA 3AVTA 2WOJA 3LRPA 4ZDKA 2KSQA 3JVVA 1KO5A 2C77A 1HY3A 1XXHB 3AEZA 4V03A 2RGNA 3CIOA 4NE2A 1P2UA 1SQ5A 1RW4A 1UBFA 4YMVA 4Q1EA 5KSYA 5KSPA 4E22A 3R9IA 1C9KA 1N6HA 2IYYA 2BMJA 3GLHA 1P73A 2G0NA 1B23P 3GJ3A 2UZ3A 3L43A 3M6AA 2XB4A 1EFHA 1L7VC 5DI3A 5CDFE 3AQ4A 4BGDA 5KHOC 1DG3A 2HYIC 1JR3E 3THXB 3AGQA 1B0UA 3RHFA 1E0JA 4HB0A 3F0TA 3U3MA 2BIFA 4B74A 4IDOA 3VR1A 3TBKA 3HR7A 2FGKA 3MFYA 2OSBA 3AV0B 2FF7A 3QEOA 2EW1A 3QE0A 5FBWB 3VR3A 3TUZC 2VP4A 2HCJB 2ZJBA 5IK2A 3QSYA 5EQTA 2QROA 1NRJB 1ZCAA 2JDID 2WBLC 2Z83A 2AFIE 2D7CA 1KI3A 5FPTA 2Q0HA 1R10A 1XEXA 4JLOA 1UFQA 4CYMA 2XZOA 2IK8A 3CPEA 4I1VA 5EXXA 1D8TA 3PV0A 1ZD8A 1P9WA 4DLSA 3PQCA 2NO0A 1DADA 4WAUA 1ZINA 2WMOB 1G4AE 3NXSA 3I32A 2CHGA 4F4CA 5CB8A 5DLQC 4GOKA 2OHFA 1H8EA 2ZIAA 3T1QA 2IYSA 1G4UR 3NC0C 3ZIAD 1IY1A 5DSZA 2ZROA 4H1UA 1IN7A 4M1WA 1O3YA 2AKAB 4LV8B 2GAOA 121PA 5BN4A 2XNDD 4V0MA 4NL4H 3MWJA 3T5DA 1QBKC 4LYHA 5AK0A 3Q7PA 1PJRA 2IW3A 4XVRA 2IYLD 4IXMA 3X1DA 2J7PD 2IX3A 4Q9IA 2QT1A 2ZJ5A 2F6RA 4RFVA 2NZ8A 4IDHA 1W49A 5C4MA 1YZGA 2WWWA 1FX0B 4QGFA 4BFWA 3RC3A 2GEUA 4Z8YA 4YXWD 4JLPA 1MV5A 5DN6A 4Q01A 3FB4A 2ODNA 1EFRA 1OSNA 4OQXA 1KDRA 4FD2A 5FTMA 4NDZA 4BLTA 4A92A 3FYHA 3SEAA 2HF8A 2ZJYA 1SVMA 4DCUA 1LY1A 3FGNA 1WQ1R 1KDPA 5KYKA 3KQUA 2DFTA 2ZRLA 5FL7D 2AXNA 1UDWA 3QI2A 3ADBA 1J2JA 4NKRA 4UNSA 2JLVA 2RHDA 4W9MC 1W0KD 3B1WA 2X2FA 4N3NA 821PA 2OLKA 1G8YA 4DLRA 1GP2A 2LKDA 3VAAA 3ZD6A 3NBYC 1VECA 1E9DA 2IYWA 4MRSA 2QT0A 1P2SA 3ZVMA 1NVVQ 2BBWA 3DMDA 4OHWA 4N0DA 2VHUA 3VMFA 1OXXK 1IM2A 2JJ8A 4GZLA 1WBDA 1Z2AA 1HYQA 5IDVA 2GEVA 4PPGA 3SFVA 1Q0UA 4UJ5A 1Z6TA 1QHSA 1G8GA 1EWQA 2J9RA 2LWIA 1XZQA 1MH1A 2FMXA 2CDNA 3NDPA 1XMVA 2YWEA 1ZIPA 2OCBA 3CO5A 4IEIA 4PZZA 4Q7JB 4OYHA 4QHTA 4TYNA 2ANCA 2HJGA 3KKNA 1W4AA 2FGJA 3VR5A 1U8ZA 3P27A 2ZR7A 4B3CA 1LV7A 3W3AA 1ETUA 2CLDX 3CH5A 2GETA 5G40A 2VYFA 4ZCLA 5CYPA 3IILA 2DFNA 1N6KA 1KIMA 1AK2A 3I61A 1AS2A 3KZ1E 1IN4A 4Q7KA 5JZVA 2YWGA 4HAUA 2RH5A 1G41A 4MKGA 4RD1A 1MO5A 3NIBA 1H8HA 4LJAA 1MT0A 1S3SA 2HLDA 4KVGA 2WSMA 1TQDA 3PEWA 2UVQA 2WSSD 2ZS9A 3TW4A 4CEHB 1XJQA 4D2IA 2VL7A 1KK1A 4GSYA 2VSFA 2QMEA 3W9YA 3I92A 2QPAA 4ON9A 1NVXQ 2XOKA 3LBNA 3PJRA 3CNLA 3AUYA 4FXPA 1NJGA 2B7CA 4KLNA 5AJZA 1A4RA 5D3MB 1Z08A 1DAHA 3AM1A 1ESNA 1Z6YA 3VR6A 4LJ6A 2Z5FA 4B3GA 2FE4A 4Q9KA 3T34A 2Q3HA 621PA 3VKHA 3ZS8A 4D4LA 1BH2A 1YR6A 5EP4A 1RRFA 1YHNA 5KNCA 1OB2A 4PO1A 2A7QA 3RS0A 3SBEA 5AJVB 2JLQA 4PSVA 1UBGA 4HZUA 2P2LA 1E0SA 4IVPA 2AN9A 2V54A 2IHYA 3H4MA 2QAGA 4CT5A 1EXMA 2P3SA 5GJVC 2GNOA 2CE7A 2FSFA 3RRZA 1VCOA 1E3MA 3BH6A 4GFDA 1L4YA 3K0SA 1Q1BA 3DKVA 2WVJA 3WY9A 3ZQ6A 3O8DA 721PA 3L0OA 4C2TA 5FI0B 2VBCA 1LTQA 4L9WA 4OQMA 1VYTA 3T1OA 4NYIQ 4DDUA 4F93B 4OI2A 3SZRA 4RD6A 2F1JA 1FL9A 1IONA 1CP2A 2QM8A 3CZPA 1G21E 1E9EA 1WCV1 1S0UA 2F9LA 5E3HA 4O2RA 4TTRA 4AG5A 1CJUC 3FHTA 1OT3A 1G16A 2ZRDA 3EA0A 3UK6A 4MGIR 2O8FB 1E2FA 1ELOA 5H8WA 3EXAA 1V5WA 4AYTA 2BMDA 3Q9LA 3RC8A 1YZTA 1E94E 1VYUA 2W2XA 4QHSA 1JJ7A 5EUMA 1RRPA 3C14C 2W2TA 4LYFA 5GADl 4MYTA 4IDNA 4IKEA 4WOPA 2P6NA 3A1UA 4D82A 1N6PA 4G01B 1V43A 1HE8B 1MO3A 2VHTA 4AK9A 2GZAA 4TMZA 1CULC 1GAJA 1E96A 4M1OA 2WTUA 2O8CA 2ZUCA 3A58B 3I8XA 5FPYA 2IXEA 2R65A 4G0NA 1GSIA 3LQRA 4XTRA 4YDHB 1X8KA 2AHOA 2JLXA 4JL6A 221PA 2EQBA 4WA7A 1HT1E 4DT1B 1K5GA 2O5VA 5EUQB 3K9NA 3OAAD 2UZIR 1J70A 4Q4JB 1KI1A 2JJ1A 4DLWA 3M0EA 4G5SA 2AFHE 2QGZA 1Z29A 3LNCA 3SN6A 4TYYA 5EZ5A 4JVSB 4NCHA 4OI1A 3I3SR 4DWJA 3A1VA 3K1JA 4KXFB 3KQLA 1NN1A 3TGPA 3BK7A 1W5SA 3EZ6A 2PLRA 1MR3F 1R0ZA 2EWVA 4Q1DA 5TDHA 3RS2A 5HKKD 2KJQA 4PTLA 2JDIA 2WJJA 1MKYA 4ARZA 4TLBA 5DE3A 4YDSA 1AS0A 3LFUA 1G3IA 1SVWA 2CLCX 5JI3E 4E03A 4U7DA 4IXNA 1PUJA 1F48A 4OJKA 1XF9A 4PO8A 4YMSA 2HV8A 2PZEA 3MJHA 4MRVA 1E2LA 1TF5A 2PL3A 2A5GA 1DOAA 3W5IA 3SYNA 3T1TA 2RGCA 4PHTA 1TEXA 5FOXA 5J40A 5JFGA 2GJSA 3MCAA 1KKLA 3NBFA 2XEXA 3TSWA 1QHGA 2KB0A 5HTKA 2FFAA 3R8FA 1JAHA 4TL9A 1KI7A 1GRRA 1D6JA 3ZD7A 2QPOA 3IHLA 5K8UA 3DOFA 3F8TA 3IBYA 1DO2A 2CCJA 2R6DA 3W34A 1X6VA 2AXPA 3VHLB 3AP1A 1KDTA 2J7PA 3DPUA 4B2IA 5C18A 1N6RA 2HXYA 5TXGA 3GLGE 1N3BA 1ONBA 3HPQA 1II8A 2FN4A 4LWZA 2DCUA 1G3RA 3BE4A 2D3WA 2V1XA 1XZPA 1KI6B 4Z54A 3U7FB 3K53A 1QHIA 4YXWA 4NYJR 2ZRAA 4M9XA 3QKSB 2O8DB 1GRQA 3GLIE 3B7GA 3W6NA 2OG2A 3AF1A 1R5BA 3LWNA 1OXSC 4M9ZA 4DKXA 4AI6A 3QVVA 5FPHA 3B9QA 5AWFC 2ZI5A 4MUAA 3ND8A 5AUNB 1OE0A 1XJCA 2ECKA 5KDDA 3GJXC 2GCPA 4HB4A 2W6IA 2B92A 1GUAA 2IF2A 2QAGC 3C16C 4L15A 1ZW6A 1HE1C 3I5YA 2W83A 2ZANA 1GFIA 1GKUB 2XNSA 4UXHA 3BGWA 2BBOA 2ZYTX 1W36C 3ICQB 4EQ6A 5LD2B 4OHYA 1SKYE 1QVAA 2ZM5A 1I2MA 2QRZA 2A3RA 2BOVA 1KY2A 3IKJA 3QPUA 5CM8B 3KKQA 3R7WA 2QP9X 4DRZA 4ESHA 2NO9A 4GMDA 5JRJA 2IS6A 5JHGB 2GHIA 3QUSA 4DSTA 5FUXA 3X2SA 2XXAA 3S1AB 4G5QA 3U60B 1VG8A 2WAXA 1T9HA 2C78A 2OZEA 2QRNA 2YINC 4P4UA 1LS1A 3A1TA 1YJ5A 3MJRA 2FH5B 1N25A 2HT6A 4KU4A 1TQ6A 3ZYCA 1L2TA 4XSGA 1TUEA 1C1YA 1DAKA 3WNDA 4BEBA 4QJ3A 5AR1A 1JPNA 4AKHA 4KSCA 1VCIA 3VU9A 3RSLA 4GOJA 3CR7A 5LB2A 1ZM2A 2PZGA 4GRAA 5CJPA 3GLGB 1XCMA 1SVIA 4KLZA 1GG2A 4D6PA 2C04A 2F55A 3EPJA 2F3RA 2W6JA 1AGRA 4TQ9A 3UG6A 2IXFA 3W90A 3IGFA 2G1KA 1NMXA 5E7JA 3BBPA 3PEVA 1XMSA 3OIYA 4B71A 4EJSA 2ZSAA 1J8MF 1NIJA 3SHWA 1KDOA 1Y3AA 2YWFA 4D0NA 2KWIA 5B57C 3GLIB 4H1VA 3ZVLA 4JL8A 4JT4A 2J46A 4OQFA 2BBSA 2JJ2D 2P65A 4TYQA 2IWHA 1TADA 1XCPA 1EFRD 5FOUA 3K0AA 1U99A 2Q21A 4Q4AB 4ZIRB 4TSFD 4HZIA 2BMFA 2HDNB 5CM9C 4BQSA 4RJLA 1BMFD 2L0XA 3WHKA 4DEXA 4LBWA 4X8MA 5KDLA 4TLEA 1E32A 4S2EA 1U9IA 4M2LA 5B64A 4B6EA 3GPLA 1SKYB 1M74A 5AUQA 1ZC3A 1DAFA 2W0MA 4V0OA 3G82C 2ERXA 5KPJA 4F4JA 5J4VA 4AKIA 1CS4C 4YMTA 2ZSBA 4A2QA 5AJYA 1OYWA 2JASA 3W6PA 1NMZA 3CNNA 4IOKA 2CJWB 2QPTA 2VP2A 3IIJA 3UWKA 2QENA 2GJ9A 4UJ3A 3RAPR 1OHHA 4I1UA 2VHCA 3Q5EA 3KTAB 2H1LA 4KO8A 4PC6A 1GRNA 3N70A 3RRYA 3ETLA 4TL8A 4P4SA 2ZSFA 3A37A 2BDTA 4XWOA 3NHBA 2CHVA 3DOEA 2O0KA 5CK5A 1KI9A 2MMGA 3B78A 1EX7A 1EGAA 3PUWA 3LBHA 4V0KA 1GL7A 1R0XA 1ZMXA 4AIIA 3AB3A 1M6NA 4TYWA 3I73A 1OW3B 1I4TD 4BUJA 3R9WA 2IHBA 1N5KA 1D2NA 4DCVA 1S2MA 2O52A 4PFSA 1FQKA 4TTPA 3DO6A 1E9BA 5J4KA 2WPDA 2QP3A 1WXQA 4DCNA 2ZRJA 2O8EA 1OIVA 1QHHA 1SKQA 3LXXA 2VP9A 3QY0A 1E79A 3BRWD 1OKKA 4LV5B 4C7OA 3LX8A 1YR7A 1XEWY 1P9RA 1M7HA 3B5JA 3WRXC 3VNVA 3O47A 1J99A 4LJ7A 3PR1A 1AGPA 1G6OA 3TAHA 3PENA 3MSXA 2QZ4A 3A4MA 1US8B 2A78A 2HLDD 5HE8A 2FJUA 4US1R 1NMYA 4TLAA 1DAMA 1SGWA 3IDQA 1FUUA 2CCGA 5FPSA 2P67A 1ZM4A 2VHQA 4IOJA 1JPJA 1S1MA 2RGDA 1GZSA 2BBTA 4XJXA 2XSZD 4EFLA 2YZ2A 1OPXA 4A8JA 3T15A 4FIDA 5CIWA 5EE9A 5JBQA 2I4IA 1A82A 1HUQA 4PQYA 1WE2A 1Z5ZA 4BECA 5J47A 3AGPA 2WKPA 3CX8A 2G77B 4YMUA 1TAGA 1K6MA 2C96A 4DHEA 3TR5A 3OESA 1N5IA 1YKSA 2LCFA 3B85A 2W2VA 1ZIOA 4L4UA 3UPUA 1YU9A 2BEJA 3CX7A 4GBMA 5DH9A 1G3MA 4RD2A 2ZUDA 1JB1A 5JSZB 2BEKA 1HEIA 1NY6A 3LDAA 2Z6VA 5FTNA 3WNCA 3GFPA 3MWKA 3CM0A 2H18A 1Y63A 2P6UA 1W36D 2NGRA 3U2QA 2ZSEA 4QG7A 4Q18A 2VRWA 3F5FA 4D4KA 5JS8A 2PMDA 5HKKA 3NEYA 4RCZA 4WIAA 1FP7A 4DJTA 2NIPA 1PVOA 1CR0A 1EFTA 2KBFA 2OAQ1 5EZ6B 3B6EA 1Z0IA 4IVQA 3SJZA 3TQFA 4D81A 3NBXX 3WNBA 1AKEA 4PO9A 5L3QB 5CK4A 2PCJA 3TSZA 4ZI2A 4P32A 1OH5A 4ZDWA 2ZTSA 2ZRBA 4Q9JA 3SFZA 2J3EA 4RVCA 1JBKA 4NCJA 4EJSC 4EDHA 3QKRB 2E1RA 1GDDA 1E2GA 3SS8A 1WB9A 5SZJA 3TSOA 4LC1A 3RRMA 5DHAA 3SBDA 4C4PA 3GLHE 4DSUA 1Z0KA 1ZM7A 1DARA 4WXRA 1AQYA 3RS5A 4CW7A 4UNRA 2GK6A 2VP6A 3QXHA 4NYMQ 2X1VA 2DR3A 3Q8XB 3ADKA 1RYHA 3HYTA 2V6IA 2WIAA 4A2PA 1KJYA 3TR0A 2GCOA 1CJVC 4CEIA 2ZJ2A 5EE1A 2NPFA 1E9RA 3AKEA 1R7RA 2GKSA 4OKSA 4Q7LA 2C5LA 2EYQA 4WZAE 1S4QA 1U9IC 1W46A 1J8YF 3PFIA 4JLBA 1DO0A 2ZSDA 3ONWA 4PSAA 3TUJC 3AVPA 1E9FA 2XITA 2VO1A 1KI2A 4OI0A 4NZYA 2WHXA 4U02A 2ZS7A 2R62A 3FKSA 4ASUA 3VFDA 3QXJA 1VIYA 3Q7QA 2JJ1D 2QA5A 5JCPA 3QBTA 4B76A 4ZKDA 2ZI3A 2VIIA 4JLJA 2JAQA 4MRPA 4AKEA 1RKBA 3TLXA 4DLZA 1AQUA 3K70B 2QL6A 1VKJA 4V0ME 3N5CA 3GJ7A 1TF7A 4A36A 4HYYA 4URYR 1A2BA 2VQSA 3ZGXA 4OK5A 5IT5A 4K46A 1ZAKA 3HDTA 3K0FA 3BWDD 5C2JB 5DISB 4RZ3A 4LCBA 4S35A 1Q20A 1CU1A 4DBLC 2A5JA 3ZVRA 1IBRA 3GLHB 3U6KA 1GWNA 2CL6X 3M1IA 2XB2A 2V4ZA 4BZPA 1IAQA 4Q21A 3BXZA 1E99A 2JCSA 3GJ6A 5DI3B 2YV5A 4JKYA 1J90A 4O0MA 3RLFA 2BC9A 1ZM9A 3SR0A 2C9YA 3T5GA 4BASA 4DC9A 2ZR9A 2GXAA 1IXZA 2VP0A 1G5PA 4MYHA 1Q1EA 1T8TA 2REXB 2BKUA 2HUPA 3MWLA 4IRUB 5FBVB 2J0VA 1XB2A 2EU8A 2R9VA 4N1AA 1ZCBA 4FCTA 3P1JA 3UIEA 1LB1B 1XEXB 4PQFA 4KFTA 3SJBA 4A8JC 2WWFA 3BS4A 4B3XA 4BFZA 5J4HA 1UBCA 4LJ8A 2WIBA 2JATA 1ZBDA 4Q03A 1M7GA 3QF7A 4DDVA 4B35A 1ZVQA 3LVRE 2JJ2A 2ZAMA 3OEED 4JBYA 5FI1B 4OK3A 1E2QA 1L8QA 5K8TA 1DEKA 2GJKA 4KYUA 4TSFA 2J59A 4HUQB 3TQCA 1CEEA 3U7HB 1NSFA 4C9BA 3GLFA 1IXRC 1BMFA 5A4JA 1W7AA 1Z0AA 2PJRA 2C2HA 1G8PA 4QJ5A 2W6ID 2C9OA 1U98A 1NNEA 2QTHA 5TARA 2AWNA 4WXPA 4BE7B 4DB4A 1DAIA 4PZLA 2GRJA 3EWAA 4LHVA 4DSOA 4QBGB 2JLYA 1Z3IX 1KI4A 1F60A 4FMBB 4EFMA 2OAP1 4KITB 1RRGA 4QM7A 3IQXA 3Q72A 2JLUA 1LNZA 1O87A 2GTPA 1NN0A 3THYA 1F6BA 4YMWA 3KB2A 4RSGA 4TL7A 1YZUA 4QM6A 3HJNA 4DZZA 5BN3A 3E2IA 3A1WA 5TVKA 3WBJA 2D7DA 3BH0A 5EXSA 1R5OA 2JGNA 2D4HA 1T0JB 4MGKR 4EPVA 3KKPA 3BB3A 4LOAA 4BFUA 4BZXA 1X86B 4R7ZA 4MH0R 2CNWA 1XTQA 2QORA 5JJKA 1BIFA 2DYKA 2R6AA 2QI9C 2ZYUX 2OFXA 1E4YA 2F3TA 5FBRB 4HDCA 2A5DA 4GOXA 2QM7A 3GJ8A 1OFTA 2Z43A 4JT2A 4QKQA 3AVXA 2W6JD 1W5TA 4LHZA 4NYJQ 4ESVA 2VHJA 2IS2A 4RZ2A 3LQQA 5FOWA 5HE9A 2D74A 1D5CA 2IYUA 3AF2A 4LRWA 3ZLJA 3IEUA 3K9HA 1Q3HA 2IC5A 1E1QD 3CF2A 2QN6A 1G9XA 1EESA 4IEEA 1TL7C 3AH8A 5FR1A 4HDQB 3RDPA 1U8YA 4DXAA 1OXTA 5FUYA 4HAWA 3IBGA 4QHYA 2J7KA 2V7QA 3TE6A 1ZUIA 4O25A 4HSEA 2XSZA 3EIHA 3Q3JB 3PEYA 2W0SA 2G83A 1JAIA 1U0LA 1XNJA 2MSEB 2QY9A 4Q47A 1R8SA 4TN1A 3SE0A 5FR2A 4LJ5A 3N2IA 2C9CA 2ZRPA 2BCGY 1YRAA 1KK0A 3FMOB 4C2UA 4Q7MB 4D25A 4W5JA 4Q9HA 3NTUA 1Q12A 1SZPA 1JQJC 3EASA 3P4YA 2YJTD 2OE2A 1GTVA 1P5ZB 2FG5A 4PC1A 5HR5A 3PUZA 5G53C 1MOZA 4A4DA 2CL7X 3BIFA 1OHHD 2CXXA 4FMCF 2ZU0C 3P4XA 4C0HA 3CR8A 2FFHA 1CJMA 3MAAC 4YQFA 4NCIA 1OH7A 5EE5B 5JRZA 1NLYA 2ZI9A 5CJ2A 1MABA 3E5HA 4JLVA 1GKYA 1XX6A 3VX3A 4A9AA 3EIEA 3QVUA 3MWYW 2IYQA 2Q3MA 1I2DA 3TRFA 2ZI4A 5EE3A 3THOA 3L82B 5TV2A 1NJFA 4GZMA 4JYCA 5JECA 1XU4A 1Z47A 1E9CA 4LHYA 3NG1A 2OILA 1XTJA 1XRJA 4P0TA 4YLGA 3WMFA 3BC1A 2VF8A 5M04A 2A2ZA 2WPDD 2QQEA 1G8FA 4JBWA 2OCYC 1F2UA 1AN0A 2G0TA 2MMCA 2ZJZA 2RGXA 3VQTA 2B8WA 1XCGB 4NCNA 3OIVA 4ZKEA 1E79D 1OKKD 3KXKA 1DTSA 2WAYA 1HURA 3UWOA 3CNOA 3KKMA 4HZUB 5DI9A 1DELA 4AC9A 4PPFA 2QAGB 4GI7A 4M53A 3FKQA 1N5LA 3B1VA 1R0WA 3HU3A 2ONKA 4IOLA 2XTMA 2ZE5A 3CRRA 4P4TA 4UXJA 1W36B 3QENA 2D62A 3FOZA 1OH8A 1NI3A 2JLSA 2PT7A 4Q4LA 3ZZUA 1W48A 4OHXA 1UADA 3QF4B 2HEIA 5HCIA 4BFTA 3J81k 2KBEA 1E1RD 2WMNB 5AJXA 3QXSA 1Z6GA 5LDDC 2GXSA 3U4QA 1E2KA 4PPQA 1RPZA 4QFMA 1FTNA 1XDBA 2G9NA 1KO7A 1T3HA 1SHKA 5C46F 3SQWA 1EFUA 1T5LA 4M8NE 2BMEA 3IQWA 4KI0A 3BORA 2Y8EA 3A36A 4EPTA 1M8PA 1T91A 3P20A 2JIZD 2ODWA 3U3OA 3W3ZB 1PLKA 5FUWA 3WYAA 3IEVA 1KK2A 2A30A 3T61A 4NH0A 4XIGS 3IPYA 4M1KA 4LBYA 3VR2A 3ND9A 2CHQA 3PUVA 1AZTA 1OFUX 5FTLA 3F3YA 3GEIA 1OIWA 4ZDJA 3SYKA 3KL4A 3K0EA 4C0KA 2OT3B 2R2AA 2IXGA 3ASZA 3FMIA 4CEJA 4DLYA 2PBRA 2DPXA 3SNHA 1KZGB 1XTIA 2FWRA 4JSYA 2O8CB 2WKRA 2J87A 3JVUA 1GM5A 3UATA 2AK2A 1KMHA 3A1SA 3RS7A 2DBYA 4LC0A 2J41A 4LPSA 4D0GA 2NZJA 1NF3A 3MG9A 4PX9A 3D8BA 1IHUA 3EC1A 3H2YA 3WP1B 2ZRHA 4BWYA 3GP8A 3NEJA 1AA9A 4AKGA 1XTSA 4A1FA 4QGGA 4FMCB 1VIAA 1PLLA 2GK7A 5EP3A 1KGDA 5UKDA 4O3MA 1E2DA 1DE0A 4TMTA 1NBMD 1G18A 1P72A 1QRAA 1AZSC 1MRSA 3DMNA 4UNPA 1II0A 1UF9A 3QBVA 4RFSA 2PZFA 3NKVA 2OUKA 4ARZB 4ZCIA 4TYPA 2DWQA 1W4BA 3GJ4A 3MRSA 5L3VA 1E6CA 2BVNA 1J7KA 1NVVR 4I1OA 1TTTA 5KO2A 1QF9A 3GQBA 1BO6A 4GP7A 3CF0A 2IS4A 1GNPA 2ZPTX 1IOZA 3B60A 3EW9A 3OEEA 1FTSA 3FKSD 4FWIB 5E4FA 4ASUD 5KTYA 2PH1A 4DLTA 4CZ2A 2VSXA 2OXRA 4BRWA 1I4DD 1W2GA 4AURA 1TMKA 4BFXA 1QHXA 3C5HA 3HPRA 4OBEA 4BFYA 2NQ2C 2CMKA 1E2JA 4NPHA 3KXIA 2G3YA 1JECA 2OO7A 2F43A 4FI3C 3TVDA 2EYUA 5CIQA 1G7CA 4QBHA 3K8YA 1AS3A 4LX0A 2GDJA 3L8YA 2OCAA 2YOHA 3FE2A 1E0KA 2OFOA 4WZ6A 2R6CA 3O8RA 5TB5A 1TQ4A 1II8B 4JLAA 2B8TA 4D26A 4B44A 4URXR 2P6RA 1D9XA 1ZJ6A 2XZLA 2QU8A 3RRNA 3CZQA 2ONJA 1T8UA 1XPUA 3AVWA 4Q1AA 3U61B 1OFIA 2DY1A 4U5XA 4Q02A 1N0UA 1ANKA 4MGZR 1NLZA 2WV9A 1XD2A 2QUZA 3AP3A 4EIWA 5L3SA 2AD1A 3PIRA 1KYIA 4II7A 4D80A 4C0LA 5KPDA 1F2TA 3B1XA 1S9DA 1NSTA 4MQBA 2ZUBA 4V02A 3CWQA 5JLJA 2WJGA 5F9HA 4DLVA 1OF1A 3AF3A 1KOFA 521PA 4MKIA 4I81A 4HAVA 3X1YA 4WW0A 4QBIA 2FNAA 5BWMA 3IPXA 1QZXA 2CK3D 1MRNA 4EQ6B 2QMHA 1D9ZA 2IUSA 4BRUA 3NBZC 4ZIRA 3ZH9B 3M4YA 1EK0A 4AD8A 3KUCA 1P2TA 2OLJA 3FFBA 1T3LA 1AM4D 1E1QA 5A5GA 4XWKA 5EE0A 2XXAB 3KJEA 4XWAA 3EA5A 3EAQA 5P21A 2V1UA 3QOFA 4TT3D 2DB3A 4US2R 1KO8A 3PXGA 3QXXA 1KSJA 4JSTA 2GXUA 3OIUA 2VH5R 4C0QC 4HLUA 4D0LB 2PT5A 1IY0A 4F91B 1FMLA 1ZC4A 2GZHA 3VU9B 4NU0A 4NYIR 1IY2A 2IL1A 2O8BA 3T06B 5LBIA 2EFGA 4DIDA 1Z6AA 2G6BA 3T12A 3DEFA 2NMVA 3NH6A 1FNMA 1U2RA 2BKEA 3C8UA 4HEJA 4A0FA 5BW8A 3DKPA 3GEEA 2PMKA 1SVKA 4GL2A 4JL5A 4JYBA 2A5FA 4EJSB 3FFAA 4IDQA 4KODA 2C03A 2J0UA 2AL7A 2GILA 2IUTA 2IYZA 2PEZA 4F4IA 1VDZA 1RJ9A 3B8HA 1CRPA 2ZQ5A 1R8QA 1NLFA 2D06A 2IS1A 1EFCA 4IW3B 2RKOA 3K0AB 4LYAA 2QP4A 4Q1BA 2EFEB 3NHAA 4JVMA 4R9UC 2ATXA 1VTKA 1Z2CA 2C95A 2CNWD 3K09A 4D4MA 2OEPA 3PUYA 3BAFA 1Z28A 2B6HA 2QBYA 4B3DA 3THWA 2CL0X 4IDPA 1CRQA 4OK6A 3WMEA 3PVSA 4M0LA 1ZNWA 1PZNA 3TKLA 2F9MA 3X1ZA 4RD3A 2IYRA 2GF9A 4CVNA 2NOAA 1OH6A 4JLNA 1P7CA 2FX3A 2RGEA 1OFHA 1C4OA 4B75A 2REOA 4PZYA 4JLKA 3BJIC 3E70C 1R4AA 5G3YA 3FWYA 2GZDA 5IHPA 1RIFA 2HYDA 3FHCB 3D31A 4Q4HA 5FBQB 4FCWA 1RVDA 1DG1G 1P3JA 3U44A 1SXJA 1NG9A 2V7QD 5H68A 4F92B 4C0BA 1VHTA 1ZU4A 3KQNA 5CITA 2ANBA 4B34A 1E2EA 1E1RA 5HZKA 2X8AA 4MA4A 2AK3A 3R8CA 5E7MA 4BLQA 2CCKA 2E87A 8OHMA 1ZRHA 4QOSA 1HQCA 1ZNXA 3VR4A 1NN5A 1OXVA 1S3GA 2FEOA 2Z4RA 3NC1C 5F9FA 3EZFA 4NTZA 1E2NA 3TJZA 1Z0DA 3ZZ0A 3CBQA 4E07A 1QHHB 4NHOA 2ZR0A 1QHYA 4ZO4A 4ACAA 1R5NA 2JIZA 4H9GA 4C7OB 3EZ2A 1EG7A 5DIFA 3BFXA 2ZJ8A 5DNYB 2GEDA 5FOSA 1E9AA 2IEYA 1LS6A 4Q66C 3IIMA 4NBSA 1XXHE 3SDZA 3V00A 1Q44A 4Z1MD 4LGMA 4TMKA 1FP6A 1G7RA 2FSGA 1YZLA 2CVFA 4M1YA 3UANA 2V55B 4MITA 4B43A 1E69A 3VKWA 5CB6A 3I1FA 1CJKC 3QKRA 1NBME 1UPTA 3SI7A 1NP6A 4A8JB 1TX4B 1Z07A 4M9QA 1FW6A 1CKEA 2AX4A 4B3BA 3C5CA 1GNQA 4JMPA 3R20A 2ZRCA 4R71A 1E0AA 4C0AC 1TEVA 2CE2X 2VA8A 2N1BA 1ZNZA 1S1CA 2MSCB 1KJZA 3I72A 4CIDA 3FPAA 4CT4B 1IN8A 4O2LA 3X1WA 5E95A 1XXHA 3AVOA 2WWGA 3W8RA 2A5YB 1X8JA 2GXQA 3U7EB 5IRCD 4KBFA 3X1XA 3E1SA 4POAA 4OI4A 5C4GB 4CGZA 2HF9A 2PX0A 1IQPA 4RKEA 1NBMA 2IWRA 1KAGA 1ZUNB 4QC2A 4DSNA 3HU1A 5JEDA 4EPWA 1JEDA 2TMKA 1SULA 1UEJA 4G5RA 3QKTA 4HLUC 1N2CE 1N0VC 2ZREA 3QQ5A 3REFA 2NO6A 2PLFA 3OZXA 1BS1A 1XJ0A 2Z0MA 3QG5A 3THXA 2BCJQ 5TY0A 3OFNA 4RD4A 3U7GA 5HZHA 5CYOA 5DYGA 3KQHA 2JLWA 4DCSA 1UDXA 4WZBE 3RWOA 2O0JA 1XD8A 2ZAOA 4HAYA 3KB1A 3TVTA 3EARA 4M4SA 4N0EA 2A9KA 2I3BA 1COWD 2ZI7A 3GJ5A 4GP6A 3C15C 1E2MA 4BFVA 1WRBA 3I62A 4EKDA 5J4YA 1A2KC 2H92A 2YNMA 3PITA 4PAOA 4I4LA 1EWRA 3N2EA 1OYYA 1Z63A 2BJVA 2KI5A 1AKYA 5BYKA 4UXIA 1VHLA 4G3XA 5C1BA 1ZU5A 5JWHA 1W0JD 1CXZA 2FZ4A 2FPMA 2W58A 4UKDA 2XX3A 4YC7A 3P32A 3H0KA 4W7SA 5J4LA 3B82A 5FH9A 3V4RA 4P3YA 2WOOA 3AUXA 3K09C 3PCRB 2GCOB 4CEIB 2QTFA 3DM5A 2P0EA 2DFKB 3LXRA 1I4LD 4FW9A 4X8LA 5SZIA 3QEJA 4HDOB 2QEQA 4LJ9A 3GFOA 2LKCA 1P4SA 3BB4A 1G64A 1ZP6A 3NWJA 3U3RA 5FTKA 2PJZA 3CRW1 4OQNA 3K9LA 5E7IA 4ITRC 3U3JA 3KKOA 4GMXA 3D6TB 4AYXA 2H17A 2GJ8A 2C8VA 2QTVB 4M1SA 4HAZA 3CUEF 3L0IB 4TMXA 1ESMA 4C30A 2I1QA 2W00A 4BLRA 1LF5A 1X8LA 2ZJAA 3B2EA 4Q5IA 1N6IA 2AR7A 4TMVA 2FEMA 3DM9B 5GJBA 1FX0A 3UG7A 3GLFE 2IA5A 3TH5A 2GWHA 2XJ9A 5CDFA 2CEAA 3WBKA 3L2OB 2CK3A 1SXJC 2MSDB 5GVSA 4MYUA 1JR3A 1P60A 2AKYA 1U90A 3HWSA 4TLCA 5D3QA 1FZQA 2EFDB 1A7JA 2IYVA 4PSKA 4HUQA 1CF4A 5BQ5A 4PPNA 4US0R 2QMOA 1W4RA 4CDGA 3K0FB 3ZS9A 2EVWX 4BLPA 1WDTA 4KFRA 3FHOA 4QGHA 4B48A 3FDIA 1S9HA 2GBLA 4NCKA 4ILEA 5IF9A 4TT3A 2GF0A 3LY5A 1VG1A 2P5TB 2XTNA 4DUGD 3AVQA 3LLUA 1GOTA 3G5UA 4JZKA 2VLIA 3SJCA 2VEDA 3EZ7A 1HQYE 1Q22A 4KBGA 1LW7A 4KV9A 2QQ0A 1K8RA 4OL0A 1TNDA 4GPTA 4Q48A 4DDTA 2X19A 2FPKA 3KQKA 1N5JA 3CPHA 4CF7A 4B2LA 1FFHA 3CX6A 3OIWA 4LBZA 1MO6A 1NKTA 1EX6A 1KSHA 3G0HA 4ZV4A 3KX2A 421PA 1QG2A 4B2PA 1G5TA 2JEOA 5FPKA 3KUDA 3AVUA 2PEYA 4DLUA 4RY2A 3GJ0A 1KSFX 2WWIA 4JLMA 1PLJA 2XGJA 4DLXA 4MKHA 2YHSA 4EPXA 4QGAA 4XH9B 4G1UC 5KU1A 1Z8FA 4UNQA 1IN5A 2FFQA 5L3RA 5CLLA 4HLCA 3CRMA 2SHKA 3AP2A 4JVLA 4Y0AA 5HPYB 2Q9AA 3CONA 3AKCA 5LPNA 1JQLB 4AWXA 1KSGA 3I5XA 3GLFB 3O8CA 1IN6A 1DVRA 2CLSA 4URZR 4J0QA 4X8OA 1GIAA 4MKFA 1P9NA 5AJWA 2QNRA 3QIAA 5GVRA 2IBMA 3SYLA 3V9PA 3K9GA 3CRVA 3OE7D 1RC8A 4HI0E 1U8AA 1TU3A 2FDCA 4CEHA 4AY2A 3R9XA 3W8NA 3CRQA 2QSZA 4PAMA 3H1TA 3THYB 1NVWQ 1OLOA 4FWTA 2CBZA 4KFSA 4B32A 1CIPA 4URWR 3VHXA 2D2FA 2IF0A 1K5DA 4NP6A 1UEIA 5G41A 1UKYA 3BOSA 5D3MA 2QMUA 3LH5A 2WJIA 1P75A 4TQAA 1IJEA 1RFLA 4ABYA 1S8FA 2NO7A 4A15A 3PEUA 1IJFA 2RAPA 5FUVA 4Z8XA 4KYIB 5HCNA 3K70C 2YOFA 2FSHA 3Q5DA 4Q9LA 1G7TA 2AWOA 5DYIA 2ZXUA 3P26A 4HATA 4PANA 3EG5A 3IO3A 2RGNC 5KNDA 1KKMA 2RGBA 5BXQC 2YC2C 5JHHB 5EXTA 1SVSA 3IO5A 3V4FA 2GA8A 1G3QA 1DAGA 2F1IA 3OF5A 2OFWA 2HCBA 3TMKA 3A4NA 1TQ2A 1XP8A 3H86A 1KO1A 2OBLA 2ZE6A 1ZM3A 3QPVA 1MO4A 4JIMA 1E2HA 2UKDA 1RRCA 1W44A 2DFLA 4FMDF 1P61B 3GMTA 4IFBA 3GCGA 3LV8A 2XAUA 1ZD9A 4PXAA 1KHTA 1QDEA 1RE0A 4M9SA 1G17A 5DGXA 4A6XA 4Z1MA 4K8OA 4E09A 4NYMR 1U0JA 3WYGA 1GL9B 3LBIA 4P33A 4DVGA 2DWPA 2ZRMA 4MGYR 4V0NA 1H65A 1II9A 2J0QA 1E2PA 3QXCA 4M22A 1T6NA 3D3QA 3EPKA 3EPHA 2O8FA 2BHRA 2CVHA 4BEJA 3I4LA 2RGAA 1X1RA 2XTZA 4U00A 1AIPA 1M7BA 2ZU6A 4D4JA 4MUBA 1NL3A 1KMQA 2FOLA 3VTKA 4HB3A 3SOPA 3FMFA 1HTWA 4LBVA 5SZKB 4LHWA 1XWIA 4OJQA 1Q1QA 3ADCA 3BH7A 2R44A 1Z6XA 3B13B 2GAAA 3QF4A 4L5BA 4JBXA 4M1MA 1E2IA 3RS4A 4XD7D 4LV6A 4M21A 4MDEA 2ORVA 5JJLA 4LJ4A 1G1MA 2NG1A 2GBLC 1WF3A 2YYZA 2YOGA 1G8HA 1CBUA 1SXJD 1CR2A 1LF0A 1MABB 4L8GA 1UM8A 4JS0A 4DT1A 1KTVA 1VCMA 1KO4A 1N6LA 1GNRA 3HYRA 5JMTA 1FPMA 3BERA 2R6FA 5B58C 3JZMA 4Q4JA 4TL6A 3WRYC 1A5TA 5KOYA 1UBEA 3CF6R 1F5NA 4GNKA 4ZI3A 1OIXA 2H16A 3OEHD 3AF0A 4OQLA 1YRBA 2YVUA 3GEHA 4L16A 4W5HA 5J5CA 4I1SA 3REGA 4F38A 5KNBA 2N42A 1F2UB 4B73A 4FINA 1WMSA 5K8IA 1GITA 1COWA 5FTJA 1XMJA 4A2WA 1G3UA 2WWYA 4IOMA 4XSHA 3T1VA 4B47A 5G3ZA 1P62B 4KSBA 3QNUA 3UKDA 5K8LA 3UMSA 1T0HB 2H57A 2Q3FA 3CKLA 2J0SA 2Q9BA 4XTCS 1DAEA 2VTKA 1W0JA 2VPPA 3LW8A 1NY5A 1YZQA 2D2EA 2R8RA 4OHZA 3TIFA 4QJ4A 1WP9A 2V3CC 3K0CA 4HAXA 3D7MA 4JLDA 1N0WA 2J5XA 3BD9A 4WVFA 2ORWA 3L0PA 4IJMA 5H70A 2IUUA 1N6NA 5JEEA 1G19A 2WWHA 5F3WB 3NVAA 1BKDR 4BFSA 2ZYWX 2BV3A 3A8TA 3U4QB 2QE7D 3DL0A 1XMIA 1UJ2A 3CPJB 3LX5A 2VF7A 4NMMA 2RMKA 1NIPA 2BJWA 3WMGA 3UMRA 4XVUA 3VKGA 2ERYA 1U81A 2F1HA 4M1TA 4BZQA 1ODFA 5LB4A 2ZRFA 4UQOA 4URUR 1KNXA 1KAOA 4C0SA 4FMDB 1LVGA 2G88A 2RB4A 5DHFA 4A82A 4A0RA 1UKVY 3FVQA 3SU8A 2YKGA 3B9PA 5DO9A 3ZQJA 3Q85A 2WZQA 3TNFA 4Q1FA 3W6OA 1KI6A 4GT1A 1SVLA 3NDBB 2O0HA 1R0YA 3C4JA 4MRNA 4HB2A 1CTQA 2OV2A 3CLVA 3QKSA 2O8DA 1DS6A 1JXOA 2YC4C 3L0SA 4CEJB 3HP1A 3IUYA 3ZIAA 3BB1A 5KDOA 1BYIA 1XPRA 4RZUA 4XOIA 2NO1A 3UXMA 1Z22A 3OFND 5BYJA 5FFMA 2XNDA 1KMHB 4DCTA 4DB2A 3RABA 4EPYA 4CRWB 4QL3A 1VG9B 2ZRKA 1XBTA 3L8ZA 3K70D 4DUGA 4F7WA 4HLDA 4PR0A 1GVNB 1XFAA 1PV4A 4LHXA 1YR9A 4E5UA 3QKUA 4V0LA 3EX7C 5F98A 4IFEA 5EP2A 3DHWC 1Q1ZA 3AVVA 3O8BA 2QSYA 3UMFA 1CR1A 2Z4SA 2ATVA 3EWSA 2GESA 4IHQA 1QHNA 2ZRGA 4GDFA 1Z06A 3SHFA 3WP0A 3WYFA 2BWJA 3NH9A 3S1AA 6Q21A 1S96A 1TPZA 1SVOA 2RCNA 5EP1A 4RFSB 2ODEA 2ZE8A 5ELXA 2REBA 1VMAA 4RD0A 3T35A 2Q9CA 1JALA 4A0GA 1FMJA 3KDSE 5EJEA 4W5WA 1G7SA 2HXSA 1ZD1A 1U0HC 4G5OA 2GJAA 4MRRA 3TAUA 3WHLA 1Z0JA 1GILA 1HH4A 1T5IA 5JI2E 2EWWA 5FL7A 2FFBA 3GLGA 3RANA 1JXMA 3ASYA 3RVBA 5B30A 1W0KA 3B1ZA 1Q3TA 1DPFA 4QBFA 2BM1A 1UKZA 3KJHA 4ZDIA 2PCLA 5FOVA 5IK2D 1L4UA 3ZJYA 4JKIA 5KSZA 3ECCA 5B2ZA 2OM2A 4QNRA 1TUIA 4QNMA 3GFTA 4RCYA 3IIKA 1R6BX 4UNNA 3RSOA 2HJVA 2K5UA 2C98A 1G6HA 1NVUQ 3GLIA 1SHZA 4A0HA 3LW7A 2F43B 3OE7A 3EIQA 5KSOA 2ORIA 4LUCA 4PHHA 5KUTA 3ZZTA 1JR3D 2KE5A 4TTQA 4B33A 4TQUS 1H8ED 3MMPA 4B3FX 4EAQA 4Q4AA 3SC3A 3RYTC 2HT1A 3R7WB 1Z83A 5GJWC 4JJZA 3VX4A 4DDWA 4TLDA 1CLUA 1WBBA 3FTQA 2Q6TA 3FMPB 3MD0A 3IHWA 2X2EA 4OHVA 1F3OA 1D2MA 1CJTC 1FQJA 2DHRA 2V9PA 2ZRNA 3KJGA 3VNUA 1XD2B 1G20E 1Z0FA 2FZLA 2FSIA 2VP5A 4NONA 3MLEA 1P6XA 1XTRA 5L3SB 3EPLA 1FOEB 1Q57A 2CJWA 4LI0A 1F2TB 4URVR 5AUOB 1KJWA 4ZCMA 3DDCA 3KXLA 3QG1A 1OV4A 1OXUA 2ZVPX 4PQRA 2QAJA 3KTAA 4Z51A 1JEEA 2FA9A 5JS7A 1W4CA 1LFDB 1W2HA 1VCNA 2H7VA 4KFUA 5F2EA 1GKIA 3LAWA 3PG5A 1WA5A 1RZ3A 1QVRA 2IYXA 3K0CC 2BM0A 2P5SA 2WSSA 4I99A 5AUPB 5DN6D 4HUTA 1M34E 1NG1A 2ZEJA 2WWXA 2ZS8A 1XTKA 1VG0B 1JI0A 3DVLA 3LA6A 4PHGA 5FL3A 1G291 2I1VB 2ZJOA 2C99A 1DBSA 2JA1A 1X1SA 4LDJA 5A0FA 4Y0VA 1ZUHA 4ERNA 2NPIA 1Q21A 3TUIC 2NTYC 4QXAA 2OESA 2GCNA 3C7KA 2AD5A 1KZ7B 4X8HA 3DZ8A 3RWMB 4LK2A 1JR6A 2J1LA 3CH4B 3MUFA 3TK1A 2OXCA 4TWZA 1T3SA 4TZ6A 2DWOA 4PHFA 1SXJE 1U94A 4PC7A 2H5EA 1W47A 2O8BB 2EFHB 1XEWX 5TMPA 1US8A 1HV8A 1UAAA 4LYJA 1YE8A 4LPKA 4TZ0A 1KNQA 2PX3A 3U5ZB 1TU4A 4KVAA 4Q19A 1VYVA 3DZDA 1JNYA 2F7SA 3QPWA 3QJYA 5BN5A 2XZPA 4G5GA 2J0UB 2ZE7A 1ZNYA 4XD7A 2N46A 2QGNA 4JJKA 4C0JA 1BYUA 4P31A 1RJ9B 1PUIA 2IYTA 3EC2A 4TMWA 1XPOA 4BPBA 4P4SB 4LY6A 2ZRIA 4K81B 3LD9A 2OCPA 4KAXA 1E98A 5EXPA 2OBMA 3SJAA 2WICA 5LD2C 5CLQA 4HLQB 4AG6A 5H1YA 2J45A 2IEZA 1IXSB 5FBLB 3C41J 3ADDA 3H84A 5JSZA 4ACBA 1D2EA 2ZITA 1N6OA 4A6PA 5SZHB 1A1VA 2QBYB 1GL6A 2WJHA 3BFKA 3TW8B 5JWRA 3THWB 1H8HD 1R2QA 5JCZA 2ZETA 3OEHA 3AKYA 4B6FA 3SQXA 1AJEA 1FNNA 1HA3A 2B7BA 3ZVNA 4R2HA 2YWHA 2JLZA 4YONB 4RZXA 2O8EB 2EFCB 4DEYA 5L8VA 4ZPXA 4KCGA 3AF4A 3CWZA 2F1RA 1TF2A 1YZKA 2XOKD
chains in the Genus database with same CATH superfamily
5DSTA 1AXEA 2JHCA 2AW3A 1OLXA 3OP4A 4G1CA 4W7IA 2FPLA 2FMFA 4QGBA 3AKDA 1H2BA 2H51A 2WJVA 3BHMA 3MFQA 3EVGA 3WRWA 4BLOA 5FI5A 2VSOA 1JFFB 2XRMA 1T5OA 1M2OB 3A4LA 4GLOA 2ASEA 3BFVA 3BE6A 4WHMA 3U44B 4MDFA 3JQAD 5A3VA 2Q6OA 3SFTA 1VE1A 2PX2A 2V6JA 2YIJA 3LPNA 3QEBZ 2I80A 1UBUS 2G9RA 3ZV3A 3GFRA 4OM8A 1KY3A 1I3CA 4BLSA 3FOWA 5EC8A 4D3FA 1C0IA 5GJCA 3H4TA 1I7QB 4KHZA 4BB5A 1IZ9A 1DX9A 3G6WA 3TLGB 2PH3A 4G1FA 1YR8A 4OM7A 5FPYA 2MSWA 2OBNA 2HGSA 3ORQA 3FSGA 3PGJA 2XVYA 4UFOA 4I36A 3HG7A 5GY7A 2UYGA 4LSMA 4P5DA 4QEDA 3VZPA 4RF3A 2ZVQX 3IUBA 1WQ4A 2GAFA 3ZDQA 4EPRA 4F6RB 5JC1A 1YHZA 2WSBA 1XHLA 4I8IA 4WLUA 2WM9B 3RYFA 4CDMA 4IGEA 4D9KA 5BMVA 3OJWA 2GRAA 4IKOA 1EZ1A 3OUUA 2QG6A 1G5RA 1MQAA 4YEDA 1KQGA 3VC7A 3RU3A 1ZJWA 4EYEA 4D46A 2W6OA 4FN5A 4C78A 4J49A 4TV8A 4RESA 1ZYUA 3DCIA 4YAIA 5M29A 1EP9A 3Q8WA 4I6EA 2JIMA 2H0RA 4GPZA 3CSUA 4DIEA 4XVCA 4AYWA 4F85A 2I55A 4EL0A 3M6XA 4QRHA 4J90A 1F8YA 2XH8A 1Z13A 4JNKA 3CLHA 2CLOB 5DBOA 3K96A 3P45A 1VHQA 4M9CA 1QP0A 1SWWA 2ODBA 3QTBA 4QXOA 1P2VA 1T4CA 5B7PA 1I7NA 2WKQA 4HMQA 3LPDA 4BWGA 3RSSA 2WAMA 3ESZA 3KJIA 4U7HA 4R98A 3FYSA 1EBBA 5EIHA 3EW7A 3S7ZA 1I1NA 1OXKB 4OQYA 2PZBA 5IULC 4PVDA 4ZDKA 3F3KA 2I4LA 3LRPA 1UJMA 2FUKA 2VA9A 3KHKA 4HWTA 4KC0A 4JELA 2C77A 3EG9A 1XXHB 3H9EO 3MZ0A 3S3TA 5BV1A 4CLDA 4FD3A 5HBRA 1O6FA 1DWPA 2L42A 4KR0A 4NE2A 1AMUA 5A2QA 3NBKA 3WWZA 4RKWA 6REQA 1T6BY 3QVKA 4UE3S 5L51A 3NBMA 3BIWA 5KSPA 1CUIA 1N6HA 3IVRA 3MTJA 1SUAA 3OCJA 1P73A 3U49A 4JJAA 5LLDA 3M6AA 1PK8A 3V4ZA 5CB0A 1MO2A 2EP8A 2WF8A 4KRGA 4ZRNA 5G1PA 5H3CA 5CFNA 2HYIC 1DG3A 4MW1A 3G9ZA 2WA1A 3THXB 3TQIA 1E0JA 1SD5A 3Q4GA 5ICGA 4D4GA 5JD6A 4ED9A 2BIFA 9LDTA 1E3WB 1SUEA 4B74A 2V58A 2JGIA 3OQIB 4IDOA 5KYUA 3WGLA 2GPJA 1I5EA 1L4FA 3U48A 3OT1A 5IJXA 2IPOA 4HNAA 3AV0B 3BJZA 4S12A 4ZQHA 1ZIYA 3HWWA 1MLDA 2B2NA 3PDIB 3QE0A 3B9RA 2Q5JA 4Q93A 3VR3A 4BMCA 2P1DA 4JP2A 1RC1A 2JDID 1ZCAA 2WBLC 2VAPA 2Z83A 4P2BA 3FM9A 2KW5A 1KI3A 5FPTA 4YECA 1N3LA 1R10A 4RXTA 1SZCA 1UFQA 3QEMB 3SF8A 3SC2B 3T7IA 2XZOA 4QPPA 3RAFC 5E8RA 2IQ5A 2Z8YM 1LD3A 4RLSA 2EGHA 3KPWA 4ENVA 1M33A 3RC7A 5P8WA 3PRYA 5KINB 2I29A 3H17A 5JG7A 4ZI7B 2PGXA 4NC9A 1M1YB 2PKEA 2NXNA 2G40A 2WMOB 1G4AE 3NXSA 3MJVA 4WAUA 2VTEA 4YP5A 1YT5A 1H2WA 3Q3VA 1PZFA 5JPIA 3ZK7A 5CB8A 4DQXA 4KQIA 4IGIA 1AMNA 1H8EA 1WOYA 4RORA 2XXBA 2X1MA 3E18A 1G4UR 4ZHQF 4RTOA 3DDUA 3DULA 2ZROA 4H1UA 4QDTA 1JP7A 3DFIA 2XCOA 1FE8A 3DCNA 1YRYE 5BUSA 4JI2B 4Z9AA 4K9NA 3NHMA 2VCHA 4NL4H 3T5DA 3IFSA 1QBKC 4L7VA 1KC3A 2O3RA 3RJ5A 2PVSA 3OZEA 4DEVA 3PGKA 1PJRA 5F78A 1ECFA 2DFDA 2HXGA 4XVRA 3HNRA 1JB9A 7REQB 1Z7EA 5HDQA 3L4SO 4HQ0A 1CQIB 3P2YA 4MJLA 4F2WA 4W5TA 3AINA 3E23A 1JDBB 3QV2A 3VSEA 3ZW9A 5IJ9A 5T6MA 5KZMB 4NV0A 1J1ZA 3SBXA 1G2OA 1P5RA 3ST7A 3K6SA 3OU2A 3WIBA 3CGWA 5K3DA 1SK8A 4X1IB 3G85A 4BUZA 4QGFA 1RZVA 5IC6A 3WYNA 5LP6B 1YNSA 3NYWA 4AQDA 2Q27A 2I6QA 1Q1GA 4Z8YA 4LXHA 2PWAA 4FZ3A 3ENZA 3VR0A 2I87A 1OSNA 2PV7A 1PJAA 1XROA 8GPBA 1NE2A 5AH0A 2IOFA 5DP2A 4CT0A 3R3JA 1FLDA 3EMVA 1EK1A 3FYHA 4N82A 3TGLA 6LDHA 5F1OA 1SVMA 2GFQA 4DCUA 5FV4A 4I4TA 4OIMA 1LY1A 3MMZA 3WB0A 4OAQA 5KYKA 2HSEA 5IVHA 2Q0QA 2WU3A 1BXRA 2YXLA 3GA5A 4I1YA 1D1QA 4YV1A 1CYEA 1J2JA 2Z2IA 5DM70 1J24A 4W9MC 4TROA 4IJ6A 4ZAWA 2Y3IA 4RA6A 4E5YA 3MCUA 1DX6A 2ZJ3A 3WGKA 1EK6A 3ZE8A 2HWUA 3E27A 5DNCA 1J09A 1Q95A 2P69A 2K7FA 3ZD6A 1VECA 2IYWA 3IEXA 2QT0A 1IM5A 2PG3A 2VJYA 4DYHA 2A5LA 2YS6A 3D8NA 4OHWA 4OYRA 2WU4A 1SKMA 3PTLA 3QWFA 4RHFA 3U16A 2QS9A 3GVHA 4N0DA 3EY9A 1WBDA 1YDGA 3DFKA 4GZLA 5D5QA 3TTUA 3O5AA 1U8CB 3OP1A 5IDVA 4ZHQA 3NOOA 5B1YA 1H2RS 5I9TA 2VSQA 1QHSA 1WSDA 1Y3CE 2EDAA 3PEEA 4QTUB 4BE4A 5A5VA 3SBOA 4JOBA 3FZNA 4V39A 4ZJYA 1YDEA 1U80A 2LWIA 1XZQA 2W4QA 3NETA 3R3VA 2CDNA 4JJ8A 5T8KC 1I4EB 4OYHA 5U4QA 3IT1A 5IJZA 1YDHA 4NZNA 2YWCA 4CXMA 2Q50A 2BTEA 3SQDA 1E2BA 4QYIA 3VNAA 3K8OE 3KKNA 1A3CA 2COUA 2JVKA 3OH8A 3HRHA 3GDOA 2Q5QA 4XIFA 4ENPA 5JTTA 4DL9A 1YVPA 2CLDX 1LWNA 2GETA 4JU9A 5D8DA 2V5VA 2VYFA 4D4IA 4IKPA 4RELA 5CYPA 4ZMSA 5AI8A 5E38A 3SLKA 1N6KA 3BL6A 5KCMA 2GEBA 1AS2A 5JZVA 3CE6A 4H77A 1RI3A 4CNQA 2QZ9A 2Q0SA 4RD1A 1X7HA 3TR6A 1CQJA 3AONB 2A8YA 1LX6A 1MO5A 3IJ5A 3I37X 3GDHA 1S3SA 2GARA 3A14A 4KVGA 2WSMA 4UBOA 2UVQA 2WSSD 4L6IA 2H2AA 3V1NA 4XYGA 3HVUA 4DDHA 4HT3B 1W9MA 4D2IA 1DBIA 2VL7A 3SGLA 3DLBA 1HLPA 1OPRA 2VSFA 4DCGA 3TDKA 4YAUA 4EENA 5AW9A 1FFXA 2YFKA 1KH1A 1VB3A 2CFSA 3A7EA 3LBNA 4B6SA 3CNLA 3NRBA 4EJMA 4B6PA 2PD6A 1Y33E 5AJZA 1A4RA 4CV0A 3HO8A 3ZU5A 1X80A 1Z6YA 4B3GA 2Z5FA 1PI3A 3W9SA 3ZXIA 1JDVA 1OX4A 1I30A 2V7BA 2Q3HA 4OREX 5GOTA 3SK0A 1NTOA 3VKHA 4D0RA 5HA5A 4E4TA 4EYGA 3I52A 4K26A 1U7OA 2Q4OA 3PXAA 4J43A 4JGGA 4JFAA 1ND5A 1RRFA 3IRVA 5EP4A 3T52A 2RSLA 1WTCA 4IQFA 1G4HA 3VGPA 1YFKA 2F90A 3QFTA 4FYKA 3SBEA 1KRXA 2J9XB 3I1YA 4PSVA 2WYIA 3BJRA 4IVPA 4HZUA 2P2LA 4S2UA 2OQRA 4X5OA 2V54A 3H4MA 4IG4A 2OD2A 3SX2A 2WG0A 3D6NB 2AG6A 4OATA 1UK7A 1T3GA 1YQ9A 2GNOA 2R97A 4I3HA 2HRBA 5DRYA 1DRWA 1KEEA 2PUJA 4M0MA 3BJMA 2A58A 4NAVA 4GFDA 1L4YA 4ZXFA 3K0SA 1U1FA 1Q1BA 1V3VA 2WVJA 1CF2O 2QF7A 3SR4A 3O8NA 4D5GA 2MYNA 5FI0B 2VBCA 3UAWA 1DQRA 4MHOA 2PKQP 4L95C 3ESCA 1JTEA 1ONOA 5EKXA 1VMEA 4FYIA 3AFMA 2ZQYA 3I2YX 1FQWA 2P9TA 2F1JA 4HDMB 4RD6A 4D5EA 1HDIA 4DLBA 1K6JA 3A3OA 3I2FA 2XD4A 2CXNA 3AO0B 3CZPA 3JQAB 3PFFA 4OHKA 3UA3A 3W1VA 1E9EA 5FOQA 3AETA 4KE6A 2F9LA 1AKNA 4R1NA 4AG5A 4TTRA 4CIYA 3W06A 1ZH2A 3KU4A 1X7XA 2XMZA 2ZRDA 5AIAA 3O4JA 1P0CA 4AMGA 2H2GA 1E2FA 1ELOA 1QE5A 5D5HA 3WLEA 5H8WA 1JILA 2E2WA 4NLLA 1S8OA 1CDOA 4X7PA 1U5BB 2GEJA 2FZGA 4CE6A 3KR2A 3RC8A 4DILA 3NB0A 3LNTA 3MTIA 4W8HA 3E1KA 2VDWA 4KB5A 3FCCA 3UJNA 3NIWA 4X1OA 2C1XA 1IQUA 4IKEA 4FNAA 4WOPA 3T6KA 4AP5A 4C08A 1A9TA 3WQHA 2RAVA 4Q15A 5KC8A 5D87A 1HE8B 3B6IA 3NHWA 2GZAA 2PRYA 1NUTA 5KKAA 4J7XA 1XG5A 3ZWWA 4O3FA 3O21A 2O8CA 2FJ0A 2ZUCA 4FPXA 1ULTA 4Q3BA 2OGSA 2ZZNA 2ZT5A 2R65A 4EYQA 1LDNA 2AHRA 3ROFA 3LQRA 1F6DA 2BZ1A 4FE3A 4IZIA 4U63A 4YDHB 5ECWA 4FC6A 5LA6B 4BJHB 4H0NA 3IPAA 3UM9A 1LBTA 1XDDA 3EGIA 3GAAA 1K5GA 2FKNA 4N39A 2YN2A 2ENWA 3MT9A 3K9NA 4EKYA 1PJ8A 1M0EA 1FNDA 2YN4A 3OAAD 1YB7A 5THXA 2IEIA 4Q4JB 5F5NA 4ENRA 1KI1A 5LYJA 4DMHA 4E6PA 3M0EA 4L78A 3PJEA 1PFGA 1HLDA 5BRNA 2F1OA 4CKYA 2P9FA 1KFKB 2JFUA 3RHTA 4DWJA 2PQ6A 4UOEA 1QSGA 5EJGA 3TGPA 3BK7A 5BV8A 3EZ6A 4TTIA 3G7UA 2PLRA 3QA9A 3CXUA 3D8RA 2BRUC 4O2AF 4U2CA 3NASA 2OCKA 2ZUSA 4W1RA 1N1MA 5TDHA 3JQFC 3HK2A 4PTLA 4ARZA 2WJJA 1B41A 1MKYA 3B2QA 3DZHA 3WLTA 3DV9A 4YDSA 4C4XA 4HMPA 1IQ0A 1G3IA 1SVWA 2JFBA 3WAJA 3ZDYB 4MWCA 3JATA 4RFLA 1UPBA 2HV8A 1KBZA 1G21B 1CUDA 2IY9A 3RTBA 4YQEA 2B5WA 2PZEA 2OYRA 1JIKA 4MRVA 1E2LA 1EVYA 4HYTA 2A5GA 1GAEO 5KVCA 1DKOA 4OFWA 3OD5A 1TEXA 1BU5A 2QUIA 2QLJA 5IS2A 4Q6WA 5JFGA 1KIAA 4DY4A 5DLYA 2FZKA 4URFA 2AFHA 2JAXA 3VH1A 3OF3A 5LYYA 1QTNA 3BHNA 2XMBA 2KB0A 3WYCA 1B0ZA 5HTKA 1B43A 2FFAA 1RPTA 2UZ1B 2VH1A 3Q8LA 1G6Q1 2Z2ZA 4GG1A 2Q3LA 4CMJA 4FFBA 4TL9A 4BOYA 3EDOA 2P2CA 4WKCA 4H3VA 4DFDA 2FZCA 4H1TA 1NMSA 3K8QA 4UDNA 5BQPA 5E1DA 1I13A 3DOFA 2R6DA 3FTEA 4KYTA 5AICA 3TIIA 1YQEA 3ZNNA 3H0CA 4Q82A 4B3MB 2J7PA 2Q29A 1EWKA 1KVUA 2WAOA 4HWRA 1I3MA 2HXYA 1I4OA 1Z5OA 2IITA 1NKVA 2X7HA 2FN4A 1JI3A 1T2AA 2DCUA 4QPNA 5DBEX 1OBHA 3AUKA 2NT3A 3F6RA 3NR2A 1AV7A 3WRXA 5AVSA 1KMCA 3EOBI 5CB4B 3R7DA 5KYXA 3ER9A 4WUVA 5ESXA 1RTTA 3F6YA 1GPWB 2UUCB 3HH8A 1QHIA 4YXWA 2L17A 2GF2A 4NYJR 2ZRAA 5IANA 2O8DB 1GRQA 3LVFO 3B7GA 3UB4A 3FDFA 4LDRA 4JI1B 3GLIE 1AUXA 1R5BA 3LWNA 1OXSC 3FSEA 4OAOA 5FPHA 5AWFC 1HYGA 2W8BA 1C14A 2JS7A 2QHXA 1AF4A 1OE0A 1W96A 1YUNA 1K3TA 2BFPA 2CHEA 2ECKA 2X0DA 5KDDA 2WDZA 2QG9A 1PT7A 4M46A 2B92A 1ZK1A 3B1FA 1K8XB 2QAGC 5CX1B 2Z2JA 3OUTA 3VM6A 3WLJA 4GC5A 2QXTA 2O1XA 4C1NA 4O2AA 1GFIA 2SNIE 4YBRA 5B37A 1CPYA 4OBWA 1LRJA 5SY9A 2BBOA 2OGUA 3ILXA 3WK6A 2XY4A 1SCKA 5LD2B 1ZI6A 2EJVA 1ADYA 1DCFA 1Y0BA 1QVAA 1SKYE 2W2LA 4E2XA 3T5TA 2ZM5A 1RKXA 1RYEA 1TYCA 2E55A 4LZLA 2BOVA 1KY2A 3PZRA 4X93A 3H5LA 5CM8B 5LM3A 1EX9A 3DC7A 1YQWA 2QP9X 3OOWA 4PZDA 3R7WA 1T2UA 2VJCA 5JSKA 5JRJA 2IS6A 4RZIA 4D97A 4BNZA 3WQSB 2IOHA 4G8DA 3X2SA 2XXAA 4IHJF 4ANFA 2XB9A 1Z73A 4NMWA 1WABA 4BAZA 3EGEA 3HDJA 5EIAA 4P4UA 4KO3S 3MJRA 5EZSA 4G9GA 1PJ4A 2P75A 2H31A 2NSLA 4MR9B 3GGCA 1U02A 3V5NA 1DAKA 1NMEA 2XA9A 4JJGA 4BEBA 1EMDA 2F4NA 2LPMA 1JPNA 4ZGBA 1VCIA 3VU9A 2Q5CA 3C98A 1ISMA 4R51A 3CR7A 2H4ZA 3TQRA 4CF4A 2PZGA 1SPBS 3V2UA 4GBJA 1K08A 1DI0A 3HM2A 3PKZA 4B80A 3AX6A 4KLZA 4D6PA 4IIEA 1XJ5A 4M0PA 5AJUA 3E9MA 3UG6A 1T1GA 1X7GA 2O7RA 4X85A 1AC5A 3BBPA 1RJGA 1XMSA 3CKMA 3EODA 3PEVA 4PCUA 5EHGA 3SHWA 2APJA 2YJ6A 5JALA 1X42A 4IMIB 3ZLBA 3ZWNA 1QIGA 4H1VA 2AOUB 4TTAA 3OPQA 1DKPA 1BD4A 1U0EA 3HUUA 1Y9DA 4W5RA 4Q37A 1JG7A 2PX5A 3EGOA 2ONYA 4G26A 1WMFA 4K9SA 3TFOA 1YRQA 1FJ2A 5FNVA 1YL7A 5FOUA 3V3TA 3LQFA 3SDBA 2WABA 5JXJA 2HDNB 2RCYA 4V24A 5F9MA 4KHPB 3DJYA 2RBKA 3ZQKA 2PT9A 3DZFA 1Q83A 2JARA 4X8MA 4GE0A 1UOOA 5B64A 2BYTA 1P4AA 4B6EA 3U31A 4IZ6A 3NV7A 2XYQA 5AUQA 1W6UA 3PNYA 1IFXA 4K8RB 3WL4A 2H6EA 2W0MA 4UOZA 3VTFA 3G82C 1SOWA 5ABPA 1DOZA 3ZDBA 3EGDA 4YMTA 3AFGA 1XZFA 2ZSBA 4YRPA 5AJYA 4A2QA 4Q7EA 3O3CA 2JEZA 2CXRA 4LQCA 2RK6A 1RWOA 2AJ8A 2QPTA 5JLAA 3UWKA 2QENA 2FR8A 1LJ8A 3FPGA 1C7ZA 3P9SA 4J0KA 1C7IA 1EGMB 3LLSA 1EYZA 3MWEA 1N0IA 2VHCA 4KQ9A 3S99A 4D9BA 4IHJA 1WY7A 3KWJA 1DWOA 1ZRNA 1BROA 1RBQA 4LRSB 3EQ9A 3WISA 3ZBPA 1EDZA 1HDYA 1U3FA 2XIJA 1G0NA 4NK4A 3U7QB 2Y9MB 3D2BA 2XYGA 3RF6A 1IUPA 3DDZX 2Q6LA 2ZSFA 3S55A 2OCXA 2Y0PA 1NJ6A 2DVMA 3DOEA 1IG0A 2G9UA 1U7PA 3HKEB 3NWEA 1KI9A 4FX5A 4NBLA 3L7KA 4GICA 3BKWA 1IC6A 1XCOA 1EGAA 5JS6A 3IVGA 1GL7A 1R0XA 3FG9A 3FVWA 5DWVA 3GIWA 4O02B 2WIDA 5NULA 4TOIA 2N47A 1W88B 1N5KA 5BSEA 3IR7A 3DNPA 1D2NA 4XR9A 1A9XB 1C7JA 5IKPA 1VL0A 1S2MA 3RO7A 3BWXA 2L82A 3M6MD 1XUOA 3DO6A 3GFQA 5J4KA 2R84A 1WXQA 2K4MA 2I99A 3GNLA 4DCNA 2ZRJA 4GMFA 1J8DA 1SKQA 3SKXA 1E79A 2C5BA 1ENPA 2VDQB 2RIRA 3BRWD 3DMTC 4DLNA 3LX8A 2XQJA 2WHRA 2LZ0A 1G0OA 1M7HA 3R7FA 5BSGA 4LRTB 2BISA 1J99A 1TCCA 1W5AA 1ZOLA 5BR1A 1FP4A 5IYZB 4UVEA 3PENA 3MSXA 5KTKA 3RARA 5K4GA 4DVJA 5IARA 8MHTA 1KH2A 3TPCA 4CLOA 4TLAA 4F3RA 4GMHA 3IDQA 2FW9A 3KJNA 5FPSA 2YCLA 4RQBA 5H80A 2B3TA 2UUPA 4JQOA 4IOJA 4WCVA 4WE3A 1SBCA 4BX3A 1JPJA 2CSUA 4P3KA 2BBTA 3G0IA 4G81A 2XSZD 5BN5B 1CUHA 3WG9A 2XQKA 2PR2A 2M1XA 2VVTA 3OOJA 1RI1A 5EE9A 3VR6D 4OHRA 1OXBB 5D1HA 1KORA 1UCFA 3GU3A 4B7ZA 1CUUA 2O6HA 3BDVA 3B8EA 3AGPA 2GK3A 2WKPA 5J47A 2OKGA 5TEVA 4JX9A 1LC0A 1S6YA 1WXIA 2G77B 1X1TA 4KIUA 5FA6A 4BGEA 3DBRA 1TAGA 1Y5LA 3HLTA 4IVNA 4TKUB 3R2JA 5AI9A 5DLPA 3TR5A 4OMFG 4C0WA 1GPH1 1YU9A 2WI8A 3GLRA 1FSZA 1RS0A 3U4DA 4U39A 3LBFA 2AC4A 2F8LA 1TMGE 2ZUDA 1JB1A 4QWMA 5JSZB 1HEIA 1ZX1A 3DE5X 3U1TA 2XLCA 4OL9A 4N5MA 2GCIA 1ISPA 3FPFA 1L9KA 1LPSA 1F6WA 4IXTA 1AKWA 2H18A 1TA0A 2IHTA 3N2GA 3TLCA 5IVKA 5FIUA 1GCAA 4PWZA 4PNZA 2HRDA 4WFQA 1ZUNA 1W36D 4EVIA 3B6JA 3U2QA 1RRMA 3PF9A 4G84A 4Q18A 4BAUA 3F5FA 3SLRA 4HNVA 4W8GA 3NEYA 1RQGA 1VDMA 4CF5A 2JAHA 4CMCA 1FP7A 2NIPA 1PV2A 4E0BA 2WKSA 5EZ6B 3OG9A 2H0QA 4XDYA 5AHOA 1GFSA 2BLNA 2ZT7A 2DJ5A 2Q5HA 3GRCA 3MWDB 4IIBA 4MQUA 2ZWVA 5BY2A 1DAOA 5L3QB 5CK4A 1D5WA 4MDHA 4R9SA 2X5OA 2HQOA 2WFAA 4ZI2A 3MCZA 3QLTA 4K6FA 3FR7A 3PHCA 1LW6E 5FLKA 4ZVOA 4BZZA 5FBZA 5C81A 4N76A 4CV3A 3UUFA 4BCBA 3OPYB 4MKXA 2FK7A 1U6IA 2PN1A 3RF7A 4JQZA 1JBKA 4NCJA 4O63O 4ZVUA 3ZWAA 4EDHA 1P7WA 1E2GA 2FYTA 4ZYLA 5SZJA 1A5AB 4WCFA 3TSOA 4C4PA 4F11A 1EAYA 2QRVA 2MSKA 4AG3A 4DSUA 1Z0KA 4R9RA 3CLKA 1AQYA 1E62A 1LCIA 3H19A 1I24A 4RAQA 1VCHA 5KYXB 4RTMA 3GO4A 4IIXA 1TECE 4UNRA 3QXHA 1QTQA 1WR8A 3ADKA 3G3EA 2XUQA 3RFUA 5MDHA 1YKGA 5ALJA 2H52A 2JAUA 3HYTA 3CX3A 3OECA 5JSQA 2WIAA 5C5EA 2E89A 5AW2A 2AXEA 1CJVC 2WDPA 4CEIA 1WHTA 1JG1A 2GKSA 1U04A 5CAEA 2C5LA 5ARCA 2WMDA 1PBNA 1P6QA 4HBGA 1WKVA 1DO0A 1EFPA 4PSAA 3TUJC 3MVEA 4FE4A 1L4BA 5TSDA 4ES6A 4AW9A 3TL6A 5I7OA 3ROMA 2D0PB 1HF3A 3MS7A 1JKJB 1AN9A 2WHXA 4BNKA 5IDWA 3L04A 1ECPA 5M5BA 2QTVA 3WWOA 1KY5A 5DCWA 4W1PA 1FVHA 2ONCA 3PFHA 2Y4NA 2P2GA 1VIYA 3DEAA 3H97A 3Q7QA 5E4YA 7MDHA 1PZMA 2D5IA 2D54A 1I7PA 2R79A 3QSGA 4J75A 4CGYA 1E7SA 3OOHA 1MTZA 1WZEA 2JAQA 4R2LA 1ZS9A 4JWTA 4AKEA 2AT1A 6ADHA 2O7QA 2XNCA 1N2CA 1W1IA 1ZN8A 3TLXA 2DUJA 3KVYA 1ORDA 4DLZA 4E31A 2DHQA 3ILVA 1QCZA 1TF7A 5KTNA 4HYYA 2X7JA 3NTVA 2GZ1A 1A2BA 3UKJA 3USES 4F60A 3ZGXA 4QIHA 1A8QA 2P0AA 6ABPA 2UUOA 1T6XA 1A0OA 2B4QA 4F12A 4EHBA 4JI4B 3UWSA 3C5WP 2AJDA 2WV7A 4RZ3A 2FK8A 2PWYA 1ZD3A 2A5JA 5A5DA 1IBRA 1NRIA 2FQWA 3MOIA 4QVKA 3W4KA 5AM1A 1GR0A 2CL6X 3D4IA 3OM1A 1CETA 1MPTA 2CLIB 2ISCA 2V4ZA 1KR2A 2CVPA 3KPYA 2W43A 3BICA 2FPOA 3KYDA 5T67A 3HHPA 3RU9A 4BZPA 3FNBA 1ZOIA 1OI4A 1A7KA 2FOXA 3L1KA 4JKYA 3P96A 5T3UA 5F12A 3MBOA 3GG9A 2HRRA 2BC9A 3T5GA 4BASA 4GWKA 4YUXA 2GXAA 3ZKWA 1MW9X 4BVHA 1KTIA 3VOSA 4J1TA 3TLZA 1DFGA 3I6MA 4A26A 3R7SA 1KXZA 2AC2A 3U56A 3BXOA 3BAZA 3CZRA 4IRUB 2BGLA 1MAWA 1C7RA 5D5PA 5FBVB 4V0QA 2ZUEA 1FX1A 1E3QA 5K03A 1YFZA 4CBVA 2GHTA 4CV1A 4RTJA 4L7QA 1LBHA 2Y1CA 1VL5A 3JASA 3UIEA 1GLVA 1V4BA 2FX5A 3H9QA 3PRHA 1YB4A 4KFTA 3SJBA 2W2KA 1E7RA 4NE7A 3IR6A 1XP5A 1I0IA 2O07A 2INGX 2J6HA 2V7GA 1IY9A 4WNAB 1C0PA 2WIBA 5TJ9A 2F4VB 1ZBDA 3BMCA 3QF7A 3QEAZ 3AR7A 3OFSA 3S2UA 8ATCA 2ZCUA 4C6TA 4F4CA 2JJ2A 4W5NA 5H02A 3Q10A 3LXMA 1XCLA 4IMJB 4OK3A 3TSAA 3W4IA 4E33A 3R3HA 4AL4A 1DEKA 5K8TA 3CVOA 4UC0A 2A7XA 2J59A 2OHVA 2X3YA 5AVWA 2NWQA 4CKCB 2PDAA 2QRPA 4FGLA 1RFGE 4CQNA 2P2YA 1RWKA 3P9PA 1W7AA 3BULA 2C2HA 1G1AA 3IV6A 1U0TA 2W6ID 2C9OA 2QMYA 1GNVA 1KZ4A 2QTHA 3G2HA 5F5LA 4BE7B 3EMDA 3FYUA 1DAIA 4OIFA 4QECA 4DSOA 2B5OA 3EWAA 1EVLA 1FDSA 1X77A 3I76A 5I7VA 4AO8A 1JKMA 1IB6A 3BQNB 2QD2A 3WGJA 4FMBB 4YYZA 2G72A 4KITB 5EJ8A 2AIRA 3FLMA 3E4CA 3IT0A 4JBHA 4RM2A 2Z3VA 1J5XA 3THYA 2YHIB 4GXQA 4NEQA 3UENA 3RVJA 2GYWA 4YMWA 3KB2A 4FKMA 5ITVA 5LXTB 4ZQBA 2XKAA 2YZ7A 3S8YA 4D8UA 4QM6A 2EKQA 2AJLI 1HM5A 3OCUA 3PWZA 3HUFA 2BGRA 1RXUA 1DJLA 3L9XA 1R5OA 1QF7A 1YV9A 3E81A 2CNBA 3OWHA 1BE0A 3FRIA 3GPCA 2D1RA 3FA2A 3RT7A 3WFIA 1AHPA 3ITKA 4XD2A 3SMQA 2BZGA 4TXJA 3BB3A 4AMVA 4BFUA 5TS3A 3ESYA 4BZXA 1KEKA 3EH1A 2AN5A 3S68A 2HO5A 4TS1A 2CNWA 3FCUB 2EEZA 4C88A 3SXPA 3UYLA 3KE9A 3TG8A 4I5DA 4X3PA 5AQEA 1RHQA 5IC5A 4KWIA 4LYEA 3PL1A 2GH1A 2RI0A 3KQVA 3QMVA 5M34A 2DSNA 3C48A 2A5DA 4GOXA 3CGGA 4CL0A 1XZCA 2AC7A 3S5JA 3GUCA 2ZYHA 3NGLA 2QM0A 4FGKA 3U7IA 1T6ZA 1XU9A 2QUJA 3AVXA 4RDHA 5TPWA 1DJNA 3MLBA 2W6JD 3RADC 4ESVA 1JKIA 2QTLA 4IRXA 4L2IA 5CA1F 1O97D 3NO4A 2FEPA 1DDIA 4DCOA 4IMRA 2IYUA 3O82A 3UMVA 3CNHA 3IEUA 1J0CA 1GPUA 4KRFA 2R1TB 2YXDA 3O73A 2HBRA 4R1LA 5CR9A 1ZLYA 4X20A 4HDQB 3ZNPA 1K7SN 4BQNA 2J4CA 3K4PA 1DJPA 3N3AC 3P9ZA 4ZOLF 5BSMA 5KKCA 4S04A 1LPMA 5FUYA 2C4TA 4GP9A 3RVPA 2V7QA 4B4KA 4CUZA 4G1MB 1ZUIA 4I5GA 1QG0A 4XPIB 4O25A 2X5JO 5GZ3A 1DV2A 1RP7A 1WVGA 2EJCA 5DTIA 4WH0A 3RTDA 1TK3A 5LJIA 1M0WA 1PSWA 3ETEA 4Q47A 2OGZA 3ENWA 4YK7A 3ILHA 2Z04A 3UWDA 4J94A 5FR2A 5DSXA 4IWNA 3WMWA 3ZHOA 2HCTA 4ICIA 2ZRPA 5IXYA 1Z5NA 2JB9A 3IUQA 3MS4A 4Q7MB 1FYWA 4MARA 4W5JA 2C54A 3HO6A 3OICA 4RDXA 1FY2A 3NTUA 1MHTA 3OZRA 3LTNC 3QJGA 4UCFA 3EQ7A 1BW9A 1MC1A 1GGJA 2AOWA 4OY3A 4CL2A 2QU7A 1XYYA 4UE2A 3ECAA 4BLWA 1HRDA 3E9YA 1FUIA 1I51A 1UP4A 5ELMA 1MOZA 4A4DA 2SCUA 4JODA 4CMGA 4DMKA 2F67A 3QNMA 4LF6B 5F4BA 1TRKA 3I34X 3LECA 1FQOA 1QUEA 1ZVJA 3P4XA 4RHXA 1ICIA 3RFFA 4WK6A 4XB6B 3UJ8A 1J0AA 4MQLA 4HN9A 5C8YB 1J1UA 3PBKA 1KJ8A 4HEA1 4INOA 3S40A 4AMYA 5JIBA 1XNQB 5KREA 4YIHA 4PWYA 4BB0A 5IN4A 2RC6A 2VBIA 2Q46A 1Q1NA 5CJ2A 4CL8A 1ISFA 5JAPA 3ISJA 1XX6A 3VX3A 3OQNA 3K6RA 3GFFA 5HRAA 1YBVA 2NZ2A 3TRFA 3UCFA 2O8NA 5EE3A 4EMSA 3TG2A 4DA8A 5TV2A 1H3FA 1NJFA 1V3QE 2JFPA 2P41A 3LK7A 4G1EB 4MCAA 8ADHA 5IUJC 1GYQA 1TIPA 4HDAA 3HJHA 3K9WA 3V7UA 2OILA 3WGOA 5EKDA 1XWFA 5JDCA 4X3CA 1ABBA 1RWNA 5FP0A 4Y8VA 1G8FA 5CA1A 1LLUA 2OCYC 2ZJZA 2VLBA 1E8MA 3LT1A 2Y0CA 4Q9AA 2B8WA 4EKNB 5E9WA 3BD8A 5A4AA 3KXKA 1UZLA 1C7QA 2X0NA 3X2EA 2XHZA 2X8JA 3NUGA 4PQEA 1KOLA 3CNOA 3UWOA 5I7SA 4B4DA 2WTEA 2GBPA 4LDAA 5D6OA 3WLOA 2VKTA 1BXZA 4NMLA 3UPTA 4ZOLA 2F3QA 1XZKA 2RIPA 1N5LA 3B1VA 3NJRA 4JEIA 1ISJA 1K4MA 1R0WA 2ONKA 2QVGA 3ANYB 4IL5A 1JX6A 1LNQA 2XTMA 4X1YB 1Z7WA 1BG6A 2DZDA 4H7KA 3NDJA 3WWDA 3QENA 1W36B 5K3OA 3FOZA 4B3JA 3QVGA 5KYWA 1M0TA 2GGSA 4JIGA 4Q4LA 2CVZA 1QKIA 4WSOA 2H0AA 1UADA 2ATIA 3EZXA 4EELA 2EHDA 3Q88A 5CBPB 3HY6A 1BRMA 2WMNB 1KMIY 4IY1A 5KBYA 1L1FA 2AFRA 1H4SA 5LDDC 2GXSA 1ZD2P 2TSYB 2J07A 2RDMA 1E2KA 2QE6A 4PPQA 1RPZA 1JT2A 3FVTA 4QFMA 4M89A 5BN1A 3B70A 4LYYA 1L5NA 3DO5A 4M8NE 4MIOA 2BMEA 2GQ0A 1FXWF 2Y8EA 4MUKA 3GC6A 1YJCA 1J33A 1T91A 3QVOA 4PLTA 2H00A 2PJDA 3UTCA 1QIMA 3ZKAA 1VIDA 1ZGCA 2BM9A 3IEVA 4CM9A 4LRYA 3O6VA 3FYCA 3RNOA 3L8MA 3S4YA 4XIGS 3E9NA 1Y8AA 2GD2A 3CEJA 3U37A 2JFFA 2CHQA 4PTZA 5EKTA 2ZJ1A 1KVRA 2XGOA 1UDCA 3GEIA 1OIWA 2R66A 1RAAA 4PBTA 2P11A 4DV5B 4E5DA 1QP4A 1CRLA 3DHYA 1NF2A 4BGVA 1KOJA 3ASZA 4CEJA 2AZMA 1KEZA 2P6MA 2PBRA 3GRVA 5HVNA 1KZGB 3HCNA 2QPLA 4JSYA 5KWIA 2OZLA 2H2WA 2QRMA 3JVUA 5SV2A 1NZDA 4R8KA 2TYSB 2HA3A 2WSYB 1YZ3A 3NTOA 1WCWA 1X7YA 2J9ZB 3EC1A 4YV2A 1ZG3A 4N3BA 1AA9A 2BR5A 1U28A 3CG4A 4QO7A 2E37A 3WL3A 2QV0A 3DLIA 3MQ2A 4G1VA 1N2GA 3TL2A 1DT5A 2GK7A 1TA9A 1KGDA 2FPIA 4FP9A 2RFLA 3F1KA 4L3OA 4Q9NA 3SVLA 3GNSA 2P8JA 4KXVA 2VUSA 3ZE9A 5DYWA 5KI6A 1E2DA 5H3LA 1C0LA 1NUUA 2C7VA 2DQZA 1NBMD 4TMTA 4XYEA 3TD6A 1P72A 1JG6A 3JTMA 1EVQA 1QRAA 1MRSA 2F8MA 2VZ0A 2QTNA 3DMNA 1UF9A 3I23A 3NTLA 2QX8A 2PV0A 4OF4A 1FLAA 3NKVA 3R3ZA 4YJ3B 4WFKA 4ZCIA 4LQDA 4R5MA 1T4BA 1Q17A 2DWQA 1W4BA 2HTEA 3GJ4A 4KTVE 1E6CA 3QE3A 1J7KA 3V6LA 3KSRA 4RGVA 3ISTA 1OCEA 1QF9A 2ZXFA 1U1EA 4GH5A 4IV8A 4ND1A 2ZPTX 1IOZA 1FXWA 1U31A 3B60A 3I1IA 3M5PA 4HJXA 4M83A 4OP1A 1HG0A 4CM8A 5E4FA 5DBFA 3WA7A 1Z2DA 1SHUX 2PH1A 3G79A 2JGJA 4RDIA 2GD0A 2DTEA 1I4DD 3IESA 4D56A 4YN3A 1TMKA 2JH9A 4JB0A 4BFXA 2YUIA 1DQSA 1M1UA 3JYQA 5MF6A 1Z4LA 3HGQA 2CMKA 4I55A 1E2JA 5JVDB 3H5WA 2V4MA 1F0PA 5TJHA 2C3PA 4ENUA 2OO7A 2F43A