3R8CA

Crystal structure of cytidylate kinase (cmk) from mycobacterium abscessus
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
220
structure length
198
Chain Sequence
SMVVAVDGPSGTGKSSVAKELARQLGASYLDTGAMYRIVTLWVLRAGVDLTDPAAIAAATDQVPMSVSSDPDAQTALLAGEDVSVPIRGNEVTGAVSAVSAVPAVRERLVRQQRELAESSGAVVVEGRDIGTVVLPDADVKIYLTASAQARAQRRNLADVQRRDHLPLRPAEDALEVDTSDMTQEQVVAHLLDLVRTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium abscessus
molecule tags Transferase
molecule keywords Cytidylate kinase
total genus 68
structure length 198
sequence length 220
chains with identical sequence B
ec nomenclature ec 2.7.4.14: UMP/CMP kinase.
pdb deposition date 2011-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3r8cA00
5ELXA 1NVVR 3MFYA 1FNNA 3OZXA 2J0QA 5KUTA 4HLDA 2NG1A 3EIHA 2Q9AA 2F9MA 4HB4A 2WWGA 1YE8A 1LNZA 2VSXA 3ETLA 4Y0VA 2WM9B 1O3YA 4LC0A 3B1WA 1J7KA 3I3SR 4ZCIA 1G3QA 3KXIA 5F3WB 2EFDB 4DLZA 1G7TA 4EJSA 3HR8A 3IIKA 5FOXA 2ANBA 5DHFA 5IT5A 4AIIA 2QT1A 4BEJA 3U7HB 1OF1A 2MSEB 3OIVA 1DOAA 1W0JD 2P2LA 2LKDA 3EIEA 2WJGA 3VMFA 4E07A 1YR6A 1D2MA 2QENA 1IN4A 3R7WA 5CB8A 1MO3A 5KPJA 5CJPA 4AD8A 3MJRA 3L2OB 4LYAA 3RWOA 1JR3D 2VEDA 3O8RA 2X8AA 4IXNA 3SI7A 4XIGS 1RYFA 5FTNA 4MDEA 3C15C 1M2OB 3DMNA 1XX6A 3CO5A 1I2DA 4TL9A 3IO5A 3I5XA 4Q9IA 1QHIA 2W6ID 2P6NA 4QGAA 2JLVA 1OYYA 1S1MA 4QG7A 3GFTA 1DPFA 3IQWA 3IUYA 5KNCA 2V4ZA 3AF3A 3QKSA 4TLDA 5H1YA 3QEOA 1TEVA 4OK3A 5CJ2A 4DKXA 2JJ8A 1GRNA 3KQUA 4D26A 4B47A 5JECA 3WBJA 4C2TA 5JZVA 4TZ0A 4TZ6A 4RFVA 3E2IA 2G88A 4I4LA 1XEWX 2NZ8A 2XOKA 1OH6A 2C78A 5JWHA 2KE5A 1YHNA 3A1WA 2FF7A 4U5XA 1XCGB 4LSGA 3FVQA 2F7SA 1O87A 4PC1A 1CF4A 2V8OA 4CT4B 4FWTA 1UPTA 2BEKA 4Q4HA 3IHWA 4KFSA 4MGKR 3X1ZA 2C03A 5AJXA 5DE3A 3HR7A 4KBFA 521PA 3UWOA 2YC2C 4AI6A 2WKQA 4Q4JB 5DI9A 1J99A 1NMXA 1J90A 2P6UA 3FMFA 4XTRA 1U99A 4XJXA 1CKEA 1PUJA 5AUQA 2V55B 4M1OA 2GCOB 1P72A 2JGNA 2VO1A 1MOZA 5FI0B 5FOUA 3U4QB 4JIMA 1Q1ZA 2OHFA 3AF1A 3SR0A 4KI0A 2FSFA 1TMKA 2QGZA 4PO9A 3W3AA 4BFZA 3LV8A 3KQKA 1MO5A 3K1JA 4PHFA 2G0TA 2HUPA 2WWFA 2HT6A 5L3SA 5BW8A 4JLPA 5TV2A 5CK5A 1KSHA 1U0LA 3EIQA 1YZLA 4OK5A 5TMPA 4C0JA 2PJRA 1ZC4A 4LHYA 1A7JA 1G21E 1TQ4A 3V4RA 3KXLA 1NBMA 2EW1A 4TSFD 1G64A 4OQNA 2BMJA 4HAWA 3ZS9A 3ZVMA 2N46A 2CDNA 1JPJA 1QBKC 2PLRA 1E9FA 2WJIA 1XPRA 4Q03A 2E87A 3Q72A 3AVXA 3AVPA 1E6CA 2FSHA 4NDZA 4FN5A 3TLXA 3UMSA 4RFSB 1L2TA 3SNHA 3GJ7A 2XSZA 2Q9BA 3B1YA 5K8TA 4D0GA 2ORIA 4N3NA 4QFMA 1X3SA 2PLFA 4TMWA 3QXXA 2WJHA 4YXWD 4KU4A 4YDHB 2Z83A 3AGQA 4B3DA 1BOFA 3VAAA 2ZTSA 2BVNA 2KBEA 4F7WA 4A82A 1P62B 3WMFA 1LW7A 4DLTA 1PVOA 4Q7LA 2CHGA 3C7KA 1U8YA 4KAXA 1P60A 2VTKA 1II8B 4RKFA 3PUZA 4B76A 5FTJA 1OXVA 5HCNA 4MRSA 3SC3A 1E0KA 3VHLB 1PLJA 2WIBA 2IEYA 1WDTA 2AX4A 1KO4A 1QF9A 1E1QD 2VYFA 3CH5A 3T15A 5BQ5A 3T1VA 1DBSA 3U7GA 4BRWA 5L3RA 3FFAA 4LYJA 1KSFX 3WXMA 2IXEA 3NHAA 3ICEA 2OBLA 5J4VA 4LHZA 3HU1A 1N5JA 2GVDC 1KI8A 2NQ2C 1HQYE 2QTVB 1GDDA 3L0PA 4JBYA 4Q18A 1MO4A 4GPTA 4LJ8A 1R0YA 3O47A 4JLBA 1E9CA 3W3ZB 4V0ME 2B8TA 1OFUX 1Q1BA 2CE7A 2ZJ5A 4BWYA 3O8BA 2H7VA 3CBQA 3IIMA 3IQXA 1NL3A 5DI3A 3LWNA 2H1LA 3GJ8A 1ZD9A 4BASA 4ZI3A 1NMZA 2QBYB 1IN7A 5HZKA 4JLKA 4RY2A 5KSPA 5CIWA 5LB4A 2HT1A 1R0WA 2NTYC 1AA9A 1EX7A 2EYUA 2G6BA 4JVNA 3FFBA 4GOKA 1WA5A 5F98A 1H8HD 3PCRB 2HLDA 2AXPA 2ZI6A 3FKQA 3RSLA 2FSGA 3IHLA 4S2EA 1N6RA 3MD0A 3SN6A 5JSZB 1KNQA 1KDOA 1M7GA 4Q7KA 2ONKA 2OFWA 3K0AA 3MWKA 3SJCA 1W36D 1CU1A 3FOZA 4MRVA 1KTVA 3K9NA 3B9PA 2ASEA 3VKHA 1IHUA 4LUCA 1IY0A 1YVDA 2JDIA 4OQLA 4EFMA 3ND8A 2VPPA 4BLRA 3KXKA 2GNOA 2JA1A 3U44B 2FX3A 4HLCA 5AUPB 1NLFA 2GZDA 3M1IA 2XZLA 2XJ4A 4GZMA 3CR7A 3K0CC 5DGXA 3P26A 3QNUA 3LAWA 3QOFA 4NCHA 5GJVC 1EWQA 4B74A 2QGNA 4MKGA 1GITA 1L4UA 4M1YA 4UNPA 1YZQA 1U9IC 1RRFA 4JVMA 1U8ZA 1XNJA 2VHCA 1ZYUA 1NN1A 2ZU0C 4CGZA 1TL7C 1E79A 3JZAA 4UXHA 1NVVQ 3ZVNA 2C9CA 2BOVA 4NYIR 2ZS7A 2ZS8A 3AV0B 2J5XA 1W44A 2QAJA 1GUAA 1S4QA 3I62A 3GP8A 4O2RA 1KI3A 1E2KA 3K9GA 2V54A 4BE7B 1KO5A 3SFZA 1UBFA 2VP5A 1UEJA 2CJWA 3OFND 2RGNC 4HAZA 2A5DA 1Z28A 1G3RA 2BIFA 1VHTA 1SVIA 2AD5A 2AK2A 2HYDA 2ZRHA 3A4NA 4IEIA 1R0ZA 3BXZA 2C98A 1UBEA 4HYYA 1P7CA 1AQUA 3CPJB 4DZZA 2G77B 2WPDD 5JJKA 5BN4A 1U8AA 5K8IA 1RYHA 1LF5A 4OI0A 1R8SA 3K70B 1DAFA 1KY2A 1VMAA 1KK0A 4LPKA 2C77A 4XWOA 2BM0A 2XB2A 3DKPA 2F1JA 2PZFA 4KFTA 1DEKA 3S1AB 4DDVA 3T34A 1NI3A 1XDBA 3SQWA 1RC8A 1JR6A 5TXGA 1T4GA 3BB3A 4RZXA 3U60B 1SKYE 3RS0A 1ZU4A 4K46A 2PJZA 3ZZ0A 1ZRHA 2YC4C 5IHPA 1US8B 3LH5A 5D3QA 3DM5A 1G16A 3PXGA 1V43A 4UQOA 3VKGA 4A15A 3SBEA 2VHTA 5HKKD 1UADA 1F3OA 1ZM3A 3U4QA 1KK2A 4KITB 4FMCB 3MSXA 2PX0A 4DXAA 2QQEA 3PJRA 121PA 3L8YA 4ESHA 4NL4H 3OE7A 1R6BX 3GJXC 5DNYB 1XU4A 5EE1A 1GSIA 2BV3A 4UJ3A 3BB4A 3KB1A 4ARZB 4LRWA 5CDFA 2IXFA 3ZQJA 2IF0A 4DB2A 1KMQA 1P9WA 4TMZA 5AR1A 2R2AA 5JRZA 1DAEA 2ZYVX 3LFUA 3PFIA 4M1WA 4TYQA 2HCBA 4LBZA 1M74A 3QVVA 5FBQB 2QI9C 1E94E 2RGEA 3DZ8A 1GZSA 4US2R 2B21A 1EX6A 1RJ9B 2JDID 3OIUA 1I4TD 4JVLA 3VR3A 1N0WA 4AYXA 1OIVA 1R5BA 2O52A 3RRMA 1OXTA 1OFTA 3P4YA 1E2LA 4IFEA 4N0DA 4A1FA 1VKJA 2XNDA 1E2EA 3U3JA 5GADl 1IJFA 2O8DA 4JBXA 2NO6A 1VG1A 4D0LB 4TT3D 3VHXA 4DJTA 5KSZA 3B78A 3U5ZB 2OFXA 4NYIQ 1XBTA 2CEAA 2DFNA 2HYIC 5DI3B 3DMDA 2J1LA 5KTYA 1S3GA 4BFXA 2ZI7A 3B85A 2R6GA 1GILA 2BC9A 4KV9A 1KI9A 1TQ2A 5E3HA 3I73A 4DCSA 1VCNA 4TMVA 3SFVA 1E1RD 1MT0A 4CRWB 2H18A 4KFRA 4MRNA 1CJUC 1E4VA 3SBDA 3TVDA 5JS7A 1G5RA 2HCJB 2QPTA 2Q21A 1YZGA 2GXAA 1VYTA 2LCFA 3GEIA 2RAPA 3KX2A 2MMCA 3ADBA 2GEVA 2VBCA 2DWOA 3RS7A 4LJ5A 1WMSA 4IHQA 1OB2A 1KOFA 1XEWY 4IEEA 2ZRMA 3TR5A 1OIWA 2BKEA 2ZUDA 3I61A 1W1WA 2ZR7A 2P6RA 3I4LA 3QKSB 2DB3A 1Q1EA 1SGWA 2R44A 4FI3C 5FL3A 4QC2A 1XD2B 2OT3B 2ZE8A 2CCJA 1S8FA 2W6IA 4KVAA 5CM9C 2F3RA 4NTZA 2FFAA 3BH7A 4PAQA 1ONBA 2ZI4A 4MRPA 2Z4RA 2N1BA 4P4SB 2ZYTX 2GXUA 2KI5A 2V9PA 4Q4AB 3CB4A 3SEAA 2RGNA 2IYWA 4GOJA 1UKEA 5EXXA 1OV4A 1DAGA 2GJ9A 1Z08A 1E2QA 1TU3A 2AR7A 3UPUA 2Z6VA 4PX9A 3NVAA 3TNFA 5J5CA 3CRQA 1UKVY 4MUBA 1AJEA 2WSSD 5B30A 1WF3A 4YMUA 2EVWX 2I1VB 2FEOA 4R98A 3AKCA 1T3SA 3OEHA 5FPSA 3BWDD 2F1HA 2FPKA 1A82A 1VCOA 1PZNA 2OESA 1F6BA 5EE0A 3GLFB 4URZR 4RZUA 4MYHA 3NG1A 4P33A 4X8MA 3QPUA 4LJ4A 3A37A 4ZV4A 2O8FA 4CEHB 1Z6XA 3OEHD 1ETUA 2OCAA 2QE7A 1XCMA 5UKDA 2YNMA 5BWMA 1EFTA 2ATXA 3LX5A 2GTPA 1TAGA 2WOJA 2C9YA 4M0LA 3GJ3A 1E4YA 2X2FA 3ZIAA 1E0SA 4MH0R 1BMFA 4OI1A 4BZPA 4EQ6A 2XZOA 3EX7C 2GK6A 2CLSA 2EWWA 3LRPA 3TAUA 3NBZC 4NBSA 5A0FA 2IS1A 4B3XA 4D6PA 3WMEA 4QBIA 1ZP6A 4QL3A 2QL6A 2ZEJA 4LBWA 2A2ZA 2FV8A 4OQFA 2ZRCA 1E69A 2K5UA 5LD2C 4KJZA 2ERXA 1II0A 4ZI2A 3S1AA 1P9NA 2A78A 1GNQA 1M6NA 2YWHA 5BN5A 4PSVA 1KSGA 3IO3A 4DLUA 1XB2A 2JEOA 5BYJA 3ADCA 3T06B 3IGFA 3X2SA 2JJ1D 3KQLA 4PC2A 2F6RA 3DEFA 2NPIA 3Q5EA 1XPUA 4C0BA 2PL3A 1CRPA 4QXAA 5FI1B 1R0XA 1XMJA 3AF0A 3TH5A 1SXJB 2P3SA 4KSCA 2O8CB 3EPHA 4EDHA 4IVQA 4QNRA 1VYUA 2ORWA 1KJWA 1TQDA 2F43B 4Q47A 1CBUA 4GP7A 4ASUD 3QBVA 2ZRFA 1E98A 1SVWA 421PA 1HT1E 3N70A 1VHLA 4DIDA 2QSYA 4GBMA 4BLQA 2GXSA 2DFKB 3H86A 2GF9A 4G0NA 5HPYB 4TYYA 2ODBA 1E2GA 1QG2A 3KQNA 4E5UA 3VR1A 4W5HA 1Q3HA 2FSIA 3KJHA 1N5IA 5TARA 1HH4A 4TL6A 1UKZA 3F8TA 2IHBA 1UBGA 2YWGA 3PQCA 1IM2A 1BYIA 1MABA 3QENA 1MR3F 5DISB 2GBLC 5KSOA 4TMTA 4PPNA 1DAMA 4L5BA 4Q5IA 1RPZA 2PZEA 4GT1A 4MQBA 4U7DA 2ZJ8A 1N6OA 1IBRA 3L43A 3NC0C 1E0JA 1VDZA 3IPYA 5LDDC 4TLCA 4TYWA 1JNYA 1ZU5A 2PCJA 2WPDA 2R62A 4M21A 3WP0A 4WIAA 5J47A 2O8BA 3KFVA 3L8ZA 4MITA 2JASA 1Z29A 2QMUA 1WXQA 1G7CA 4QJ4A 1SZPA 5L3QB 4L9WA 2GKSA 2ZI3A 2AD1A 4ZKEA 1NMYA 5CYOA 3PEVA 1TF5A 3MG9A 2YV5A 4C30A 4PSAA 5HKKA 2O8BB 4QKQA 1VYVA 2P65A 5TY0A 4B71A 3B2EA 3RABA 4EPWA 1KI2A 1BO6A 3RS3A 1SXJC 1QVRA 3MMPA 4B2IA 1W36B 4PPGA 1CR4A 3V9PA 5J4LA 1FNMA 2VP4A 5EZ5A 4PZZA 4DSNA 2VP0A 3GLGE 1HV8A 1ZD8A 2R65A 2NMVA 3CZPA 3AVYA 5EZ6B 1TUEA 2QUZA 3GLHE 4G5SA 3T12A 4L16A 1IY2A 2WKRA 4ZKDA 1ZMXA 2E1RA 3N2IA 1SVMA 3L0IB 3IILA 2B92A 1YJ5A 2NPFA 3RANA 2GDJA 2GJAA 2IUSA 3EAQA 1KYIA 4OHYA 1EFHA 1KO8A 3TSZA 3VNVA 2JIZD 1T91A 2REBA 1M7HA 2G1JA 1ZIPA 2AN9A 2VF7A 4PZYA 2JLRA 1SHZA 1FOEB 4JLNA 1COWA 2B8WA 1HYQA 4LY6A 4WZ6A 1R8QA 1G1MA 1GL9B 1PLLA 1W0KA 3PEUA 5KNDA 1EG7A 1YR9A 2VP9A 1K6MA 3VKWA 4WA7A 2D62A 2IYYA 1EXMA 1IN6A 3DKVA 3K09A 1W2HA 1JB1A 4LV8B 4TL8A 1KGDA 4LV5B 4I1VA 4TTQA 2QRNA 2IF2A 4DUGA 2OAQ1 4O3MA 2WWWA 2VLIA 3REFA 1MO6A 1OPXA 1YZTA 4V0OA 2GJKA 4Q4JA 4M9QA 1TNDA 4JSYA 1M34E 2WOOA 4CEIA 1B23P 2GCOA 1DS6A 1A4RA 1GIAA 1G4AE 2YOFA 3O8CA 1KO1A 3TBKA 3THYA 3THWB 2NGRA 1E32A 3DOEA 4JZKA 4H1UA 4MGZR 1TU4A 4D2IA 3PG5A 4HLQB 5DHAA 2J7PA 4QRHA 4C2UA 3EZ6A 3SS8A 2QU8A 2XGJA 1AN0A 1G41A 3G0HA 1FQJA 2IYUA 5FR1A 4HUQA 2XJ9A 1P5ZB 3B8HA 1G8FA 3PUVA 4G5OA 3NH9A 4IW3B 4M22A 3BD9A 5C4GB 5TVKA 2BCGY 5FUWA 1KIMA 1DARA 2FPLA 1XJQA 1CP2A 2GHIA 2J87A 2QT0A 1AK2A 4EPRA 5FOSA 2GCPA 3AP1A 2F55A 5HZHA 1XXHE 2QM8A 5G41A 4JT2A 3X1YA 3CRW1 1ZNZA 2ZI5A 2ZE7A 2FZLA 5KDOA 4H9GA 1F2UA 4EJSC 1ZM9A 2ZVQX 3L0OA 1N6LA 4TQ9A 3A4MA 2IYXA 4BUJA 4JYCA 2GCNA 4PPFA 2FU5C 3Q7QA 5BXQC 5EP4A 2F43A 3SJAA 3QKRA 2A9KA 2LKCA 3QKTA 2BJWA 4B44A 2XXAA 2EQBA 1PLKA 4PANA 3QIAA 2FFBA 3QXJA 2C96A 4YXWA 3B9QA 5SZIA 4LI0A 3C14C 3H4MA 3AKDA 1WQ1R 1RKBA 2N42A 1KMHB 3LQRA 1GAJA 3OE7D 4GMDA 4EPYA 3QF4B 1Z0JA 1FX0A 1OH8A 5FUYA 1CS4C 4TYNA 1LV7A 2RHDA 4URUR 5DSZA 5CDFE 2GEDA 5AJZA 2J0UA 5IF9A 4LYHA 3K8YA 1GM5A 3CLVA 1N5LA 4YDSA 2Q9CA 3C41J 3DDCA 4LV6A 4YC7A 4IKEA 5DYIA 3KJEA 2IYSA 3BH6A 4IDPA 2BBWA 2GVZC 2H5EA 3FTQA 3WHKA 1G8GA 1VIAA 3BC1A 3I72A 1NY6A 1WE2A 2ZI9A 2ZR9A 3RNLA 2J59A 3ZD7A 5F2EA 4JVSB 1OKKD 4HSEA 4EPXA 1U0HC 2PMKA 2AK3A 2ZJZA 3AQ4A 4U02A 3O8DA 3D6TB 721PA 1D8TA 1OXUA 1DG3A 1RJ9A 4URVR 1VCMA 2QN6A 1Q44A 4O2LA 2B6HA 2FFHA 4BECA 3R9IA 3MAAC 4ZDKA 1UBCA 4BPBA 1G7RA 5L8VA 4B3FX 4JL8A 1Z0KA 2DYKA 3R8FA 4D4JA 1FTSA 1TF2A 4NU0A 1GOTA 3BAFA 3T35A 4C7OA 3TUZC 2GRJA 2ZVPX 3AGPA 3F0TA 4IOKA 3K70C 3FHCB 3CF0A 3NEYA 4JKIA 4RD3A 4BZXA 3GLHB 4AWXA 3P32A 1Z47A 3ONWA 3OAAA 4KCGA 3P20A 2EU8A 2IYQA 3RS2A 1G3MA 2QP3A 4P4TA 1OXXK 2OV2A 4P32A 2P5TB 3EZ9A 1FMLA 1N6NA 1G17A 1U94A 3HU3A 2BDTA 3EC2A 5DO9A 3RHFA 1WCV1 2ZRLA 5JJLA 3TAHA 3AVTA 4Q4AA 4NE2A 2ZJAA 4N0EA 3QY0A 3E70C 2O0JA 4HLUA 2VH5R 1LB1B 3FMPB 3LW8A 5J4YA 3PEWA 3WRYC 4IOMA 3K53A 3CNOA 2FA9A 4CDGA 1T8UA 2BJVA 2GA8A 1N0UA 3HYTA 5KOYA 4ARZA 1G20E 2FOLA 4DUGD 1OH7A 2UKDA 2X19A 1DG1G 3CNLA 2JIZA 2QY9A 3CX8A 4IDHA 3ZVLA 4B33A 2ZSFA 4EUNA 3H1TA 3WYFA 3AF2A 3W5JA 4QJ5A 4US1R 4IFBA 1NLYA 1TADA 2CJWB 3CPHA 2O8FB 4DT1B 1K8RA 3BBPA 1K5GA 4Q1CA 2WMOB 4FCTA 2IUUA 2FG5A 5JRJA 1RVDA 3BIFA 3ZH9B 1ZCAA 3AUXA 1Z0AA 4BFUA 1GL6A 5AUNB 1NRJB 3C5CA 5G3ZA 4PHHA 4JKYA 4FMDB 4AK9A 4P4UA 4XD7D 2J9RA 3MGCA 2QSZA 1KDPA 4EFLA 1R5OA 1OW3B 1W4BA 2O5VA 2WJYA 3D31A 4D4MA 3U6BA 2CNWA 1YQTA 4A2WA 1OT3A 4QM7A 1JALA 4KFUA 4DEXA 4DB4A 4A6XA 2QP9X 4PC6A 4KVGA 3CZQA 1NG1A 2X1VA 3G82C 2HLDD 5DN6D 3W5IA 3LY5A 3NHBA 1XPOA 1LS1A 4RD4A 2XOKD 4JLMA 2AHOA 4IDQA 4KYUA 2O8DB 4GNKA 5G53C 3SQXA 2VHUA 4A8JB 2AXNA 1P3JA 3L0SA 2IHYA 1N6HA 1XCPA 4QHTA 1DO2A 2R6AA 3QQ5A 4NCJA 3GLIB 1T6NA 2HJVA 2KBFA 4JT4A 4FMBB 3LX8A 3R7WB 1OE0A 2OE2A 1XTSA 2J41A 1ZNYA 2CXXA 2CCGA 4WXRA 3QVUA 1DTSA 1W4CA 5CLLA 2H17A 3W6PA 1YKSA 2C95A 4NP6A 2Q0HA 1XFAA 5LBIA 1BMFD 3EZFA 4C0HA 1AS3A 5E4FA 1X1SA 4ZDIA 4XVRA 1XRJA 3A1TA 4PO1A 3GMTA 5C4MA 2IUTA 1CR2A 4A9AA 2Z4SA 2IWRA 3M0EA 2GXQA 2IXGA 3W6NA 1JXOA 1G8PA 2DBYA 2GBLA 3GFPA 4HAVA 3OIWA 4W5WA 3HPQA 3P27A 4RSGA 1D6JA 2OLKA 1D2NA 4B3GA 3ZD6A 1E9DA 2IL1A 4AKHA 4A0HA 2IYVA 3FYHA 4FMCF 1A1VA 2FDCA 1TF7A 2PT7A 3UK6A 1DE0A 4RCZA 2QRZA 4F91B 3L82B 2A5GA 4MYCA 1KNXA 1VECA 2G83A 3QPWA 1KSJA 4G01B 1DO0A 3ZS8A 2V1UA 1Z83A 2ODNA 2R9VA 2ZRIA 2CMKA 2CCKA 1UAAA 1UEIA 2ZIAA 4MYTA 4Z51A 4FXPA 3I32A 4YQFA 4B35A 2GZHA 3KFXA 2J45A 5HE9A 4V0NA 3SYLA 3OFNA 1ESNA 4JLOA 2GZAA 4B3BA 1CJTC 1GL7A 4JLDA 3QPVA 1IJEA 3A58B 1W4RA 1KKLA 3WP1B 4DLWA 4HLUC 5FPYA 3W6OA 3T1OA 4AKIA 1I4DD 3LXXA 1IONA 3DPUA 3VNUA 2OEPA 1N25A 1W48A 2JJ2D 4ACAA 2Q3MA 3UMRA 4BLTA 2V3CC 1JXMA 4C4PA 4EIWA 4QBFA 1HQCA 4OL0A 1GNPA 4M9ZA 2PBRA 1E9AA 5AWFC 3VR5A 1BYUA 1QHHB 3UG6A 4ZDJA 4AURA 1L7VC 4HDCA 4QNMA 1VG9B 4BFSA 5P21A 3R20A 4RD0A 4A0FA 4Z1MD 2ONJA 3CRVA 2O8EA 2WAXA 2GWHA 1X8LA 4B75A 2VSFA 3Q3JB 4CEJA 1PJRA 2ZJBA 2LWIA 4AY2A 1NSTA 4OHZA 1YZUA 4YLGA 1II9A 4ZPXA 2VA8A 4QGHA 5SZHB 4M1KA 4Q9LA 3AKYA 1AGRA 3KDSE 1P73A 4LK2A 3QF4A 3QEJA 4JLVA 4OK6A 5IRCD 3CWZA 1NN3A 1P2TA 2VRWA 3U3RA 1SXJA 2A30A 5EXSA 5HR5A 3GJ4A 4XSHA 2H16A 1CULC 4QJ3A 1EFCA 4H1VA 1H8EA 3U7FB 1HURA 3UIEA 3VX3A 5KU1A 3EA0A 4BFYA 3GQBA 4CZ2A 4XVQA 1ZM7A 3TQFA 5FFMA 1RRCA 1NP6A 1Z8FA 1P2VA 4B6FA 2ZRDA 2VHJA 5G3YA 1GKUB 4FIDA 2J0VA 1OIXA 3QKUA 2BMFA 4RCYA 2F9LA 2ZR0A 1KJZA 4XTCS 4M1TA 4C7OB 2REXB 5DIFA 4LJYA 4BEBA 1E96A 1IN8A 2D3WA 2IS6A 1QRAA 3F5FA 4LWZA 1W47A 2C99A 2QEQA 4B34A 3H0KA 1OLOA 2WIAA 3LXRA 5J4HA 2XZPA 1JI0A 2JCSA 4BLOA 3WY9A 2ODWA 1W2GA 2YVUA 3QG5A 4HATA 3AVVA 2RKOA 4IRUB 3FGNA 5EJEA 1MH1A 4NMMA 4RD1A 1MV5A 2V6JA 4W5JA 4WZBE 2BEJA 2WSMA 4UJ5A 4BLPA 2W0MA 4TLAA 3FE2A 2WV9A 3W8RA 1GNRA 3BERA 4MYUA 3WBKA 2DY1A 3WHLA 3X1DA 4AYTA 1F60A 2OG2A 2QA5A 1ZNWA 2GETA 4LC1A 5HTKA 4R71A 4I1OA 1XMSA 5F9FA 5B2ZA 3MRSA 3I92A 1H65A 1W4AA 2D2FA 2I3BA 1SVLA 1ZM4A 2VHQA 1NVXQ 2D2EA 2JLWA 1SQ5A 1FP7A 3K9HA 2HJGA 2KSQA 3H2YA 3LA6A 5K8LA 1OFHA 1VG0B 2WHXA 1BS1A 2WICA 3TSOA 1EFUA 1CR0A 2J46A 2ZRPA 3UWKA 3HPRA 2CVHA 2WWHA 4Q1EA 1NVUQ 3M4YA 2BBSA 1FPMA 5FL7A 4Q66C 4V02A 4BFVA 1OB5A 5JMTA 2YZ2A 4ZDWA 1AIPA 1G6OA 1L8QA 3CPEA 1NG9A 2JAQA 1SKYB 1FFHA 2PH1A 1HEIA 4P3YA 4A8JC 1W36C 2IYRA 1QHGA 1QHYA 2OXRA 2Z43A 1XTKA 3CKLA 3SJBA 4G5QA 4UKDA 4DEYA 2PEZA 1US8A 4PZLA 1NKSA 2IS2A 1P6XA 1Q0UA 3PR1A 3KKMA 3RYTC 4B2LA 2FH5B 4Q01A 3RAPR 4Z1MA 2QNRA 3NBXX 4QM6A 4P0TA 3K0SA 2MSCB 1J8MF 2HV8A 3K09C 3P1JA 4PPQA 1WRBA 4OHWA 2VL7A 3QG1A 2W58A 1X6VA 2G0NA 3B1VA 5LB2A 3PUWA 1E2NA 2J0UB 5CB6A 2C2HA 2R6DA 4F4CA 1KI6B 4TTRA 1S9DA 3C5HA 1FL9A 3IBYA 3RSOA 5J40A 3CUEF 3TR0A 2IYTA 3JVUA 4P31A 1IAQA 1E9BA 2X2EA 1NF3A 1XTRA 4Q4LA 3SYNA 5JI3E 2EYQA 4PHGA 4IDOA 1OJLA 5KNBA 2YKGA 4LCBA 4B6EA 4Q9KA 3AVOA 3CF2A 3LVQE 2FGJA 5JEEA 4V0KA 1CLUA 1P2UA 4HAYA 5K8UA 1S3SA 2CLDX 2CBZA 1I2MA 2GEUA 2YINC 3TK1A 3GPLA 3MLEA 4OJKA 1U2RA 3ZJYA 2IK8A 1CEEA 1ZUIA 4R9UC 4I81A 4R2HA 5FTLA 3NBFA 4G5GA 3PENA 1E1QA 3SHFA 4UNQA 1Z5ZA 2UZ3A 2ZXUA 2EFHB 1JJVA 5FBLB 4B73A 2YJTD 4FWIB 4RFSA 3U61B 2J3EA 3PEYA 4FCVA 3N2EA 3FWYA 4LJ7A 3B1XA 1XF9A 3WYAA 4JS0A 4RZ3A 2ZYWX 5KPDA 3AP3A 1RRPA 1TEXA 1G7SA 3W8NA 1N3BA 4KO8A 2IC5A 2PCLA 2MMGA 2BHRA 4Y0AA 1AKYA 1Q21A 4F38A 5JFGA 2GK7A 2IX3A 1LY1A 3VR6A 1ZIOA 1Z2AA 2F1IA 3RLFA 4LHVA 1GVNB 2BMDA 2JLQA 4PC3A 2IEZA 3WNBA 2P67A 5FTKA 5E7JA 1Z0IA 2A7QA 2XTMA 4DLXA 1XEFA 2FFQA 4RJLA 1XZQA 5EP1A 4YMWA 1R7RA 2V1XA 3TQCA 1P75A 2ZJYA 1KAGA 2BBOA 3UATA 1PUIA 1Z6YA 3TRFA 2W6JD 4LHXA 1ZNXA 4LDJA 3P4XA 3VQTA 1P61B 2W83A 1NJGA 2PX3A 3LD9A 4TN1A 2QPAA 2AFIE 2RB4A 4FMDF 4ILEA 4CVNA 2RGCA 5CLQA 1M1YE 1HA3A 3WNCA 1DAHA 5B57C 3GCGA 3EZ2A 1T0HB 3QXHA 2UVQA 4LPSA 2CNWD 4MUAA 1ZVQA 2XSZD 3FDIA 1KDRA 3CIOA 4PC7A 1QHSA 1R2QA 3THWA 2IBMA 4LHWA 3JVVA 3DM9B 3QBTA 3MJHA 1D9ZA 2VQSA 3W34A 2WBLC 2WKPA 4D4LA 5H8WA 1VG8A 1WP9A 4Q48A 5EQTA 3VTKA 4CIDA 4ZO4A 3D3QA 3KUCA 1BH2A 2W2VA 2OAP1 1E9EA 3PUXA 1KZ7B 5IDVA 1E2PA 1NLZA 3CW2A 2IT1A 3KZ1E 5FUVA 1NBMD 4ABYA 3R8CA 4NONA 5GJBA 1EESA 3OIYA 1J2JA 1XD9A 2GJ8A 1KK3A 4NCKA 4A8JA 5FPTA 2QP4A 1U98A 3KB2A 3AP2A 2QAGB 4OHXA 1NN0A 3LDAA 5A5GA 4CEIB 3AEZA 2VSOA 4Q02A 4DC9A 1X8JA 2R8RA 4AG5A 4BLSA 3OEEA 4URWR 3UG7A 3THXA 1R4AA 4PFSA 5JHHB 1IQPA 4CEJB 3T5DA 2GF0A 3K0FB 3UMFA 4AC9A 1SXJD 3CR8A 1YZKA 4HI0E 3GEHA 3WYGA 1DADA 3CH4B 2WJJA 3C8UA 3BFXA 2WWIA 1SKQA 2HF8A 1CR1A 4GI7A 4LGMA 4D81A 1JBKA 2YHSA 3LQQA 2YYZA 5JWOA 2C9OA 3OAAD 5LPNA 4E22A 4FCWA 5EUMA 2BMEA 1G4UR 1KI4A 1XMIA 3IEUA 5DYGA 3RS5A 1QZXA 1JEDA 5C18A 2H8KA 4DWJA 1S96A 2ZPTX 4HUTA 3IKJA 4KLZA 3X1WA 2NIPA 2W00A 1KAOA 5H70A 5FPKA 2AKAB 3ND9A 3BORA 1MRSA 4BZQA 4LJAA 4OYHA 1TTTA 5KHOC 2QTFA 3B13B 4WZAE 4B32A 2JLSA 2ZU6A 2W2XA 4C0SA 3KTAA 2WMNB 5JBQA 5JCPA 3AVWA 1WB9A 4HZUA 5E7IA 2FE4A 4Q7MB 4XSGA 3GLIE 1G3IA 2SHKA 4QBGB 3NTUA 1OKKA 5FUXA 4A36A 2ODEA 4QOSA 1Q20A 5FL7D 2Q3HA 4II7A 2OBMA 4S35A 1T5IA 3M6AA 4B2PA 4WOPA 4B3CA 2WTUA 4C0KA 3RDPA 2CL7X 4N1AA 3A8TA 1UDXA 2OXCA 2D4HA 1IXSB 4HDOB 5CIQA 5M04A 2W6JA 1LTQA 2AL7A 1SHKA 2ZSAA 4YONB 3SZRA 3TVTA 3VU9A 4IXMA 1G8YA 1N2CE 2FNAA 2REOA 3DO6A 3MWYW 4YMVA 4B48A 2CHVA 2ZS9A 3FMIA 2XTNA 3BB1A 4C3ZA 2RGGA 4L4UA 3EARA 4IDNA 3RVBA 3W90A 5HCIA 1S1CA 3THYB 4U00A 3A4LA 1G8HA 3ZZTA 5AUOB 2KB0A 2DWPA 4GOXA 4LX0A 1A2KC 4NH0A 1NJFA 3K0CA 4AKGA 2V6IA 4K81B 1IXRC 1KJYA 2QAGA 2WZQA 2FEMA 1HY3A 1EGAA 1E2JA 3KKNA 3D8BA 1JEEA 2ZRNA 1GKIA 1T3LA 2G1KA 5DLQC 5E7MA 3ZZUA 2VP6A 4HB3A 4NYJR 1S2MA 5JWRA 1K5DA 5AK0A 1S9HA 4D0NA 2GESA 4M1MA 2OCBA 3EXAA 1A5TA 3EPJA 3EPKA 3NXSA 3HP1A 3KJGA 2CL0X 1P4SA 5AJWA 3G5UA 4I1SA 1RZ3A 2BBTA 1CIPA 2PZGA 2C5LA 1CJKC 2ZSBA 1KHTA 4FD2A 2I1QA 4A2QA 2O8EB 3GLGA 2HXYA 3U6KA 2VIIA 2OILA 3I8XA 4LJ6A 3THOA 2CK3A 1E99A 4Z54A 1OYWA 2F3TA 1ESMA 4GDFA 1ZW6A 4POAA 1UDWA 3GLGB 1RIFA 1KI7A 3EA5A 5H68A 1R10A 4RVCA 1Z07A 1T8TA 3PV0A 4M8NE 2NO7A 4NZYA 4Q1BA 2YWEA 5FOTA 1WBBA 4PSKA 5BN3A 3K9LA 2A5YB 1AZTA 3ZLJA 2BCJQ 1E79D 1W49A 1XP8A 4UNSA 1OH5A 4LYFA 3FHTA 5JLJA 1T9HA 4IOLA 5BYKA 1ZBDA 3IDQA 3K0AB 4KYIB 1ODFA 6Q21A 1AM4D 4M9SA 1DVRA 1MRNA 1HT2E 3GJ0A 4M4SA 2YOHA 3VR2A 4HZIA 2XAUA 3T5GA 4M1SA 4F4IA 3C4JA 3Q9LA 1QDEA 3E5HA 5EE3A 5JEDA 4UXJA 3PVSA 5SZJA 5C1BA 1FUKA 4X8LA 4KSBA 3KKPA 3ZDQA 4X8HA 4NYMR 4PQFA 4Q1DA 1IY1A 4HB2A 1YRBA 1H8HA 3T61A 3NH6A 1AGPA 1EFRA 3AB3A 4MA4A 4JL5A 4QHYA 3NWJA 2PT5A 1HE1C 5C2JB 4A0RA 1HUQA 2WJVA 4TLEA 4MKFA 1WBDA 1U90A 2FWRA 2ZUBA 1W5TA 1YRAA 3LLMA 4LOAA 2ZSEA 3AVUA 4RD6A 2XTZA 1GFIA 3QJYA 1GG2A 2ANCA 4J0QA 3THXB 1W46A 3IEVA 1G6HA 1B0UA 1MABB 1E2MA 4OQXA 3RC3A 1G18A 3AF4A 3CX7A 4Z8YA 4QHSA 4Q7JB 1ZUHA 4Q1AA 2ZROA 4EAQA 1XEXA 1Z0DA 4RKEA 4E09A 2WSSA 1YR8A 4XH9B 1W0JA 4F93B 3K0EA 4JSTA 3U3KA 5B64A 1JAHA 1X8KA 1RE0A 2ORVA 2JLUA 4EKDA 2ZYUX 1XZPA 2DFLA 3TJZA 5FBVB 3A1UA 1MKYA 1G291 3ZGXA 2I4IA 1SVSA 3TMKA 4KHZA 4DLYA 2GAOA 3MUFA 3W9YA 1XXHB 2CL6X 1ZAKA 1HTWA 1OHHA 4CYMA 4NYMQ 4XWAA 1II8A 2Z5FA 5GJWC 4TTPA 2KWIA 4EFNA 3LLUA 1JPNA 4V0LA 5FH9A 3H84A 4L9SA 2A5JA 1CTQA 2ZJOA 3MCAA 3V00A 4BRUA 3HYRA 3NDPA 1Z6AA 2DPXA 2IS4A 1N0VC 2Z0MA 3ASZA 3CWQA 1F2TA 1P9RA 3PIRA 2O0HA 2JLYA 1C9KA 1V5WA 4ZCMA 2XB4A 1GKYA 2ERYA 5D3MB 3ZVRA 2EFEB 4TWZA 3GJ6A 1M7BA 1NKTA 2NO0A 4DT1A 2DCUA 2AKYA 4LBVA 2HXSA 1GP2A 2YOGA 4YMSA 1Z63A 1E1RA 3VR4A 1UFQA 4M9XA 3AUYA 2XNSA 4MKIA 1XTQA 3K0FA 2GJSA 4HAXA 4W7SA 3A1SA 3AKEA 4NCNA 1KK1A 3ICQB 1OHHD 221PA 3HWSA 4JYBA 1N5KA 5DN6A 1NVWQ 2OSBA 3SOPA 1U0JA 1AS2A 2XNDD 4PO8A 2JATA 3TUJC 3PITA 3UANA 4MGYR 4OJQA 4E03A 3I8SA 3SDZA 2V7QA 2QMHA 3ASYA 3V4FA 3CRRA 4RD2A 2WVJA 4ACBA 3HDTA 1LVGA 3B6EA 4IVRA 4WBSA 1ZC3A 4QGGA 3QE0A 4DDTA 3MWLA 2DFTA 3NBYC 2OM2A 1NNEA 2V7QD 3CRMA 2ZE5A 1XWIA 4OBEA 4JL6A 4D82A 3BJIC 3LBIA 3RC8A 3OEED 2HEIA 1U9IA 1IOZA 4OI4A 1NY5A 1Y3AA 4B43A 1QG4A 1W0KD 3GLHA 2GILA 2EFCB 3EZ7A 4DCVA 4LBYA 2EWVA 1J70A 4OKSA 4DSOA 3ADKA 3TGPA 1F2TB 2C8VA 4Q9JA 4D25A 3VX4A 5FPHA 1HE8B 4UNRA 5IK2A 1D9XA 1Z6TA 4D80A 1QHNA 2BWJA 3TW8B 1SVOA 2ZSDA 4JJKA 3U3MA 2DWQA 2ZRBA 1VTKA 4PQRA 1UKYA 2QAGC 4R2IA 3GEEA 4ZIRA 5FR2A 1KI6A 2XX3A 3CF6R 1Q3TA 4JJZA 5A4JA 5JHGB 4UXIA 4WXPA 1PV4A 1Q22A 2O8CA 1RFLA 5KYKA 4G3XA 1Z2CA 2ZITA 2NZJA 5KDLA 3RS4A 3NKVA 2XITA 4KBGA 4CW7A 3CNNA 2W0SA 5JCZA 2IA5A 1J8YF 1UJ2A 2ZAMA 3KUDA 1G5PA 4HDQB 2QMEA 2ZRKA 2H57A 2R6CA 3GLFA 1FMJA 3TSWA 1P2SA 5LD2B 5DH9A 2RGXA 4PXAA 4JBWA 3HU2A 3BE4A 4ON9A 1E2DA 1KKMA 5CK4A 4ZCLA 4DSTA 1LF0A 2HF9A 3WMGA 4HB0A 3QUSA 3NDBB 1E2FA 5GJCA 4PAOA 3U2QA 4Q21A 4TL7A 3SE0A 2JLXA 3LBHA 3PUYA 4MGIR 1Y63A 3A1VA 3HJNA 1ZCBA 821PA 1LS6A 2OZEA 2DHRA 1RRGA 2GAAA 3FB4A 3WNDA 1Z22A 1E9SA 3TW4A 1W7AA 2ZQ5A 4GP6A 1XJ0A 1XD8A 5C46F 5EP3A 1JQLB 4BFTA 1YR7A 2A5FA 1AKEA 2TMKA 2D7DA 2QMOA 3U7EB 1Q1QA 4C0LA 4WVFA 3BH0A 3I5YA 4XD7A 3ZQ6A 3SYKA 4L8GA 3CONA 5EXPA 4QGFA 1KY3A 2E9SA 1E9RA 2FGKA 5L3QA 4KLNA 1ZD1A 2H92A 3TE6A 4BFWA 5L3VA 3ZYCA 1AS0A 4BQSA 3ADDA 2IYZA 1H8ED 3AH8A 1FP6A 4FINA 2ZRGA 3FMOB 5FBRB 3LO5A 1X86B 4EPTA 3RRNA 4DLSA 2G3YA 4GL2A 3TKLA 2ZRAA 1FQKA 1OFIA 3KJIA 4NKRA 4XOIA 4ASUA 4DVGA 5JSZA 2RGAA 4F4JA 2J0SA 4PR0A 2RGBA 4D4KA 4ESVA 1FW6A 3KKQA 2FN4A 4A6PA 5EE9A 1A2BA 4MKHA 1VIYA 1FTNA 4JLAA 1YZNA 3FKSA 1M8PA 3T1TA 2J7PD 4GSYA 5HE8A 2JJ1A 2RCNA 2AWNA 1JQJC 1NIJA 1XMVA 4O0MA 2AFHE 2VF8A 4G1UC 3LBNA 4HAUA 1QVAA 4YMTA 1FUUA 2CHQA 3B82A 3ECCA 4TQUS 2FZ4A 4DHEA 2CK3D 4GFDA 2RHMA 4ZIRB 1AZSC 4KODA 4DDWA 3KKOA 1XTIA 3N5CA 3IPXA 4OQMA 2JLZA 1NBME 2OFOA 3AM1A 1KDTA 3A6PC 4NCIA 3B7GA 1JJ7A 2ZJ2A 4US0R 4QBHA 4DRZA 1D5CA 4URXR 1KO7A 1SULA 2Q6TA 1L4YA 3UKDA 5AJVB 3X1XA 2W2TA 4DSUA 3E1SA 3QXCA 4ERNA 4URYR 4DCNA 2QBYA 5FBWB 3Q8XB 2VP2A 4M53A 3CX6A 4TYPA 4R7ZA 1T5LA 1QHXA 3WRXC 5B58C 1GWNA 1Z6GA 2B7CA 5G40A 3QSYA 1T0JB 4NYJQ 3GLIA 5D3MA 1DELA 4Q1FA 4JLJA 5E95A 5SZKB 3IBGA 2C04A 1ZM2A 2QE7D 1VCIA 4CF7A 3I1FA 3VU9B 1Q12A 3FPAA 3BGWA 4WAUA 3MWJA 4KXFB 4IJMA 4EQ6B 2WWYA 4OHVA 3OF5A 5JJIA 1IXZA 2ZANA 4PTLA 3CM0A 5KO2A 2OCPA 4C9BA 2B7BA 3U3OA 1S0UA 1F5NA 1NN5A 3J81k 4DIEA 1TQ6A 2P0EA 4OI2A 5CYPA 2EFGA 1CXZA 3Q5DA 3AVQA 3U44A 4ITRC 1DAIA 3SHWA 3BFKA 2OCYC 4XVUA 1G19A 4O25A 3TUIC 1G3UA 1SXJE 3IIJA 4HUQB 2Q3FA 3LNCA 4TMXA 1VPLA 1XD2A 3LVRE 1E0AA 3F3YA 2PMDA 2WAYA 3KTAB 2OBNA 4L15A 1X1RA 4PQYA 1JR3A 4K8OA 8OHMA 4V03A 2BKUA 3RRYA 5EUQB 3ZIAD 5EE5B 2X77A 5TDHA 4W9MC 3EW9A 2G9NA 1Z0FA 5JS8A 2ECKA 2ZRJA 1C1YA 4LJ9A 2QQ0A 1IN5A 3DHWC 3EC1A 1Z3IX 2KJQA 4CT5A 4RZ2A 2XXAB 2QROA 5JI2E 4GZLA 5GVRA 3QKRB 3SU8A 1JAIA 3RRZA 5TB5A 3SJZA 2ZM5A 5F9HA 4TSFA 2R6FA 3BOSA 1CRQA 1N6PA 3EASA 3R9WA 1DAKA 4X8OA 3RWMB 2ZE6A 1CJVC 2A3RA 1GTVA 4I1UA 1SVKA 5FTMA 5CITA 4AYWA 2P5SA 1EWRA 3EG5A 3GJ5A 1D2EA 2CE2X 1XJCA 3OESA 4NPHA 4P4SA 4TLBA 4A0GA 4TQAA 4CEHA 2HDNB 1UF9A 2QORA 1KMHA 1EFRD 1C4OA 2QM7A 1OXSC 3A36A 4Q9HA 5KDDA 1T3HA 4HEJA 3JZMA 4I99A 4JMPA 1LFDB 1QHHA 3EWSA 3DOFA 3DZDA 1JR3E 3B1ZA 3QI2A 2IW3A 3R9XA 1ZINA 3KQHA 1BKDR 3GLFE 2ZUCA 4TT3A 3UXMA 4Q19A 4EJSB 3C16C 2OO7A 2FJUA 4IOJA 4DLRA 1RW4A 3BS4A 1NSFA 1UM8A 2IYLD 3FHOA 2L0XA 2PEYA 2CLCX 4FW9A 3REGA 4AG6A 4A92A 5ANRB 5IK2D 4MDFA 3Q7PA 2MSDB 1N6IA 1ELOA 4PAMA 2F1RA 1KI1A 2JJ2A 3EWAA 1XTJA 1AQYA 2DR3A 2O0KA 1ANKA 2OUKA 3K70D 1XXHA 2Y8EA 4WW0A 2NOAA 4XWKA 1E3MA 3NIBA 3FKSD 3B5JA 4NHOA 1OSNA 1YU9A 3DL0A 1TPZA 1NIPA 3BFVA 4HZUB 3DVLA 3LW7A 4UNNA 2QTHA 1F2UB 2NO9A 1EK0A 1N6KA 5FOVA 4BGDA 4C0AC 2QG6A 5EP2A 4IVPA 4LZZA 1XEXB 2YWFA 3QXSA 1G9XA 4DCUA 5CM8B 4Z8XA 1G5TA 3D7MA 2NO1A 1FZQA 4C0QC 3NC1C 1BIFA 2ATVA 4M2LA 1E2HA 4PHTA 621PA 3BK7A 3GFOA 2ZETA 2D06A 3GD7A 5GVSA 3Q85A 5J4KA 1KZGB 1GRQA 1R5NA 2WWXA 4A4DA 2RH5A 4AKEA 4GRAA 4EPVA 3QF7A 1I4LD 2FPMA 2RMKA 1ZJ6A 2RGDA 4Q4HB 3VFDA 1E2IA 4DLVA 1W5SA 1FX0B 2AWOA 2XEXA 4F92B 4DDUA 2BM1A 1U81A 1F48A 1ZUNB 4Q00A 5FOWA 5AJYA 4A2PA 2QPOA 5EXTA 3OHMA 3B60A 4V0MA 4GMXA 3KL4A 2D74A 3TIFA 1TX4B 2QZ4A 2IWHA 3T1QA 1TUIA 5KSYA 1Q57A 4G5RA 1JECA 2OLJA 3EPLA 1CJMA 2CVFA 2J7KA 3BRWD 2FMXA 2D7CA 3NEJA 5L3SB 2UZIR 1GRRA 1Z06A 4TMKA 2ZREA 1COWD 2ZAOA 4DBLC 4DCTA 4MRRA
chains in the Genus database with same CATH superfamily
5ELXA 1LPMA 4CKYA 3O6VA 4RHFA 4TOIA 5F7XA 4KIUA 4UU0A 2NG1A 1PTKA 1XZNA 4AN4A 1KQ3A 1UH5A 5C4IA 4I3FA 3SDSA 2A9QA 2PZKA 4Z3DA 3QHQA 2WWGA 5F1KA 5CJJA 1EP9A 4L4ZA 5GZ3A 1JEYA 2VSXA 3D7LA 5IXSA 3ETLA 4DABA 2R3SA 2CF6A 3RIHA 4ZJZA 3I3SR 2WYUA 1X70A 1PDWA 4B6EA 4BKPA 3LPDA 1G7TA 4DLZA 5FOXA 3RKUA 1PBNA 1YKGA 1EM8A 2F00A 2K7ZA 2TMDA 5DHFA 2Q0QA 3EIUA 3FGPA 3H2KA 2I80A 5IT5A 1NYQA 5MGBA 3DS8A 2G5TA 5TF0A 1DOAA 2VC2B 3ORQA 3MRVA 1KMIY 4M9CA 2H1OA 4E07A 1YR6A 1D2MA 2QENA 3U7QB 1LLUA 2VA9A 1I2BA 1VLVA 1EUQA 3UFXB 1IUKA 2BAGA 1JR3D 1ZH6A 2D4AA 2VEDA 1DG9A 3RB8A 2X8AA 1TYZA 3SI7A 5ISMA 5M7EA 5FTNA 3FSEA 5J5VA 3E58A 3C15C 4DMUB 4E7OA 4DV7B 5DPMA 1YS6A 4I6EA 4LIPD 2GHQA 1NM5C 3UJPA 2FN9A 1QG6A 2ZWVA 1DBWA 3DNMA 4CMHA 3TRHA 1CIVA 2XTAA 4Z53A 3IUYA 4OHUA 3AF3A 4TLDA 5H1YA 5IARA 4C29A 1VHJA 2BFEA 4B47A 5JZVA 5L7YA 1T2CA 3UPDA 4R9RA 1I4OA 5H02A 3TF5A 2VZ9A 1XEWX 2NUTB 1X0XA 3UQYS 3IE1A 3CRNA 5JWHA 2KE5A 4QPNA 1PL6A 2VT3A 4L27A 1Z7EA 2F7SA 1AV7A 1O87A 3FVQA 4TXHA 2V8OA 3KYBA 3FUWA 1IDN1 2YXLA 4RLSA 4KMOA 1SU6A 3PR3A 1M34A 1FS6A 1RAFA 1V8FA 4FQ5A 4DE5A 4X62B 3HR7A 5BSTA 521PA 4M99A 5TF4A 3UWOA 1H1DA 4AI6A 3ABSB 2IIVA 2PGLA 5B1SA 1GFZA 1NVMB 4EB0A 3H3FA 4JJGA 2HQOA 4BXOB 2C2KA 4K6CA 3AR5A 3LQKA 1SVUA 1T29A 3MCAA 4GKAA 1Q19A 2I78A 4X1OA 4DLAA 1TIKA 4R9NA 5AUQA 1GZ4A 1YRYE 2CLMB 2VDLB 2JGNA 5ALZA 1MOZA 5FI0B 4I4TA 2E4YA 2WI8A 4DMKA 1JTEA 5H3HA 2BI4A 3SR0A 1ZMOA 3S28A 2OHOA 1YA4A 2HHLA 4NS1A 4XCVA 2V6GA 3JQ8A 3GLVA 4P4NA 1E89A 2NSJA 3TQIA 3FIJA 4HZGA 1GPLA 3I6IA 2QL9A 2W6CX 1MO5A 1IIBA 4R0NA 1NYTA 2AH5A 2G0TA 2VDOB 1PZXA 1SY7A 3OQ6A 5CK5A 4Q9NA 1YZLA 2FZCA 3LPAA 4IIYA 4C0JA 2PJRA 4LHYA 2RHBA 4UQLA 3BL6A 1A7JA 4UOEA 2B3DA 1QK4A 5I8PA 2C7QA 1YQQA 2Q3JA 4YLYA 4ND3A 5EA2A 4KR7A 4MS3A 3BMQB 5L6LB 4RADA 4N7JA 4C2AA 4R0MA 4RSMA 1MCZA 1OV6A 2BMJA 4FJ2A 1T5TA 3P2IA 1CS0B 1KFEB 2FG6C 1QBKC 2O1WA 1HQDA 1OFUA 1Z74A 4ZAYA 2P4UA 4YJGB 2E87A 2XE6A 2DUNA 4FCCA 3R5KA 5EUBA 3L7CA 4E14A 2FSHA 4NDZA 4GMFA 4QBKA 4RFSB 5E6RA 1QP7A 2BEUA 2O05A 3DBOB 3GJ7A 1U3TA 2RKWA 3D0RA 3FDZB 4N3NA 1YZFA 1YDHA 2Q2NA 1X3SA 4DYDA 2PLFA 4UPEA 3L7NA 5KCZA 3CZ9A 1AKWA 1A0OA 2C7RA 2DKOA 4UTPA 4B3DA 3AGQA 1BOFA 3AOEA 2E49A 2KBEA 3ISVA 1UP6A 2J3HA 3HH8A 3ZQ4A 4Q24A 3WMFA 3EH2A 1DTWB 2FZWA 4DLTA 4Q7LA 3C7KA 5CG1A 5K3OA 3PC8A 1GDTA 1P60A 2VTKA 3QVGA 1II8B 4CLEA 2H9AA 4DQXA 2JFVA 1TAHA 3CUKA 3PUZA 2IUFA 4RKFA 5FTJA 4C1BA 1AXEA 3QP9A 2P2YA 3SC3A 3AFGA 1PLJA 1LDNA 2Q6IA 2I34A 2AX4A 3W5HA 1Y4AE 4J0HA 1QF9A 1RWNA 1E1QD 2RH4A 3LG2A 4E31A 3STXA 5KTRA 4U0KA 3U7GA 4BRWA 5IWAB 5L3RA 3NHAA 1USWA 5J4VA 2AG5A 5CIYA 4KEAA 4DXHA 4X24A 4NU6A 2NQ2C 5A1JA 1MORA 1XTBA 1QGAA 5AXAA 2GPBA 4Q18A 4LFCB 3UCXA 3RAEC 3WS7A 2JCBA 4JLBA 3O47A 1TKBA 1TEHA 1JG2A 1XNGA 5ALUA 3TD2A 1T15A 4OAQA 5G0VA 1F4LA 3QJ5A 4BQQA 1UFOA 1OFUX 1UOOA 4L5JA 1DUIA 5FAKA 4BNMA 3ZDZB 5A0TA 3HHEA 2PVPA 1R8XA 4GSLA 4XI9A 1W6UA 2H7VA 4AMUA 2WA2A 2GN9A 2D2XA 2WG2A 2XNHA 1SD1A 1RPNA 3WLPA 3F46A 1ULAA 4ZMSA 4MOWA 2HCTA 3K15A 4AXBA 1S3FA 2CXOA 4ZI3A 2I6QA 1ARZA 1TJYA 2H2GA 4IJ6A 5TPWB 3UK7A 1IN7A 2QBYB 4N3AA 5LXTA 3DLIA 2QYTA 5LB4A 1BU8A 1ZH4A 1EX7A 3TQTA 4EFDA 1B26A 1XZ8A 2XCOA 3FFBA 1D04A 3H2ZA 1R6DA 5F98A 5ECYA 3PCRB 4YCDA 5HIJA 4L5IA 4YJ2B 4GSKA 1LSSA 3FKQA 3ZHCA 1GHTA 1PWHA 3UUEA 2O59A 1NQVA 1M7GA 3WDLA 1PR3A 2OFWA 3MWKA 5ERGB 1UPFA 1CU1A 3FCCA 4MRVA 1KTVA 3B9PA 4KFCA 3VKHA 3DEZA 1V3QE 4EB6A 3COJA 1M6VA 4AZ0B 1J22A 1R0LA 4LOIA 4BLRA 2RAVA 4Z9YA 2XE7A 3EEBA 3ZW7A 5IYZA 4HLCA 4BVJA 5HRAA 3U3DA 1UBMS 2ZM6B 3BXOA 1ORRA 3WWZA 2C58A 10MHA 1YOVB 3E7XA 1HSOA 1L4LA 2D8MA 3TZKA 3LAWA 3QOFA 4CG1A 4RENA 5HW0A 5LQRA 4FGZA 3GEBA 3P2KA 1EWQA 1K66A 1VSVA 3PDUA 3N8GA 4WKOA 5LMCA 4FFRA 2C4MA 3P4UA 1L4UA 4KE8A 4FNMA 4ZAVA 4EBFA 4QQRA 4DV1B 4QPZA 2ZP1A 1YZQA 3O8QB 1RRFA 4K9SA 5B12A 1W85A 1QP0A 4O2BB 4W6ZA 3GUZA 1ZWLA 5IULC 1XNJA 2AA3A 4JQSA 4CGZA 1TL7C 1E79A 4ZVLA 1JIJA 5GV8A 1AH2A 4UXHA 1SWVA 5DDIP 3FSGA 4L75A 2WFMA 2ZS7A 3AV0B 4DHWA 5CA1F 1W44A 1Z62A 5EINA 4EY6A 1NJ2A 3UJ8A 5ULLA 3WK7A 1OYOA 1KL7A 3K9GA 2RHCA 3AF6A 4UAVA 4AZTA 4IUCS 4N8EA 2V59A 1OTXA 1UEJA 3OFND 4MQFB 1CY2A 3GELA 2W5UA 2P79A 2VATA 1YI8A 1MBZA 1DKUA 2R4TA 1C29B 1WF6A 2JGFA 2RGNC 5KNDD 5J23A 3KSBC 1ODSA 4OX9Y 2QG9A 2X23A 2AD5A 4AW9A 1EA7A 4N82A 1IH8A 1R0ZA 2DPMA 2GZRA 5B1DA 3FJOA 4PRLA 1O0BA 1AQUA 4C06A 4X3PA 2G77B 3SICE 2WPDD 1GDHA 3QUAA 4A23A 1YJQA 3HS3A 4HP8A 4P38A 1KR5A 3GO4A 5K8IA 1JEOA 1GYQA 3O26A 1RT9A 5IH7A 1R8SA 3ZIDA 4OI0A 4YRAA 4B87A 3K70B 3SIPA 4ND2A 1Q6YA 2A9RA 1VMAA 3EAFA 4HK4A 4QG7A 2LRHA 4ZO7A 1XJ5A 3AYXB 3NGXA 4LPKA 4G5HA 3R7AA 4XWOA 1WIWA 2BM0A 4L1KA 2F1JA 4PHCA 4P5EA 2JI9A 4U2GA 4KFTA 1DEKA 3JYLA 1B76A 1CS0A 2V58A 1RBMA 4GQAA 4XIIA 4M36A 2F17A 2NU8A 3T34A 2VSYA 3B53X 4RBNA 3VSEA 1RC8A 1QFSA 2HIAA 4ZWNA 2OCIA 1T4GA 1U5AA 3BB3A 3DFZA 3U60B 4DCGA 1UJ6A 5FI3A 4BLWA 1ZRHA 2OPBA 1JLLB 2BR5A 3BQMB 1US8B 3MTJA 1OI7A 3NATA 5E9QA 4HLNA 3KZOA 3ZHYA 1SIBE 3WGMA 3LQ1A 3VSAA 2Q7XA 3P0JA 2P9QA 3V5NA 4A15A 1EVLA 1K7YA 4RJTA 1ZW1A 5KKNB 5EIWA 3U4QA 4FMCB 2F2TA 1LZKA 3MSXA 3RFVA 3TJRA 4AY4A 1AHIA 1SXHA 4KK3A 3ZKWA 4AJEA 3R3VA 1O4VA 4FTWA 1QFJA 1R6BX 1NVFA 5EE1A 4L6CA 4KAFA 4XJSA 3PA8A 5B2FA 1DV2A 3KB1A 2G40A 4LRWA 3UOWA 5CDFA 2IXFA 5AQ1A 3PNVA 2ZK7A 4AVYA 5GGXA 1FQOA 1JG7A 1Y8QA 2ZYVX 3UENA 4TYQA 1N8TA 2HCBA 2Q9UA 1FUEA 2BEWB 3AJ9A 1U6KA 2YVQA 1NFFA 1O0SA 4IKPA 2A9OA 4Q0MA 1XTUA 2AR9A 4E30A 5DV9A 1GTG1 1XUOA 1GZSA 1PKXA 1SBHA 2FQXA 4Q3DA 3TXAA 3AL3A 2IDZA 4G4SO 4QXMA 2JGDB 3JWGA 4K88A 3W5VA 2FSVC 2QTBA 4FOLA 2FP4A 1A9TA 4LNHA 2WR8A 4AYXA 4D9NA 3LHSA 4O4LA 1SCNE 2WIKA 3AC0A 4N0DA 2WRZA 2WDPA 1VKJA 1FEZA 1D2GA 4M76B 1DRWA 1UXGA 2B4RO 3I1JA 3ONDA 5IVIA 4DJJA 2F62A 2PUAA 5K8CA 5AVJA 2NO6A 3JQ7B 4DJTA 1RU3A 1ZGBA 4K8RB 3EOZA 2RK6A 2AIRA 3MCWA 4R68A 2HYIC 1ONPA 1B15A 3KUXA 1TD1A 4QUHA 2GPYA 3UV3A 1GV1A 2P78A 4BFXA 4A10A 2ZI7A 3Q3HA 1WUJS 2M1XA 2R6GA 4MI1A 4NI5A 4YAEA 3TI9A 3UT6A 2BC9A 2ZUVA 3T7AA 3U1VA 1KI9A 1KYVA 4ZPJA 2Y0PA 5KAPA 4DF3A 1EFAA 5EWJB 3RT9A 3ZK8A 3UJNA 1U0NA 1CJUC 2YW9A 3SBDA 2HFJA 4DNQA 5JS7A 2IXDA 3BE6A 2LCFA 4FE4A 3B9RA 3R3SA 3GEIA 4EZIA 1FX1A 2XPCA 3WAGA 1QS0B 2GEVA 2OQIA 3GNTA 3KOXA 4RWZA 3CR3C 3RS7A 1FTGA 5L4LA 1TA0A 2HO4A 4O4HA 1MG5A 2HPHA 2ZRMA 4FHFA 2J9ZB 4GM1A 2BKEA 3S2YA 4FDAA 2PGDA 1D1SA 2BW0A 4EHBA 1PZHA 4LYEA 4CM7A 3QKSB 2OD9A 2DB3A 1EZ4A 1Q1EA 1SGWA 2R5FA 3D3KA 5AKYA 5FL3A 4XUGB 2G4VA 3NTVA 2H1HA 2ZE8A 3CLHA 4KACA 4NE7A 4B3MB 4QTYA 1JHOA 3K6KA 4JB2A 4QT0A 3UOAB 1MB2A 3FI9A 4C78A 1L5QA 4MRPA 4UTNA 1U04A 2Z4RA 4P4SB 5E8JA 5CB4A 5KYXB 1E8NA 1LWNA 1UM9A 2V9PA 4Q4AB 5KYNA 1UKEA 4ARAA 2BM9A 1OV4A 1CB7A 3EULA 4AKTA 1RXCA 2PUVA 2QRPA 4YLEA 1I3KA 3S44A 3SIRA 4PY2A 1E2QA 1XLTC 3U4MA 2KLBA 4TV9F 3ZWCA 1L3CA 3NVAA 1FTYA 1CQIA 1MOPA 1UKVY 3CRQA 3KVOA 3KVYA 3AEUB 3T7SA 3PFBA 1ZOSA 1WF3A 3T5PA 2JFUA 5A9TA 4YMUA 2V74B 2BD0A 3JAWB 5KSWB 2IHVA 2JGAA 4R69A 2FPKA 1BKYA 1TZ2A 2H85A 1F6BA 4H4EA 4BO6A 5IAOA 3HE3A 4URZR 5DYTA 3RSZA 3CE9A 4O4JF 2IQIA 4P33A 2IOHA 4ZYXA 1WOYA 4G9BA 5IJ0A 5K3AA 3A37A 2O8FA 2P4SA 1ETUA 2Z2JA 4Y1FA 4EMUA 1EA5A 4AWBA 4Z3OA 1R15A 3KB8A 3G9XA 3LQYA 2F3UA 1TAGA 4J91A 4ETNA 1T36B 1NFQA 4R0VA 2C9YA 3H1BA 4II3A 3HY4A 3TNDA 4XKJA 1EJ2A 4AS3A 2CLHB 3DT9A 1H4VB 3ZBUA 4HEA6 1KTIA 1W76A 2JGJA 3KTOA 1RQPA 1X14A 1WXGA 2BFBB 2RKBA 1MJHA 1M2NA 3DO8A 3TAUA 1M6HA 5A4FS 5JNVA 2IS1A 3N2LA 5IZCC 1T9BA 2VAXA 1MD9A 2FW6A 1I1QB 3ACBA 3OJWA 4LBWA 3ZDXB 5FOQA 1OZAA 1TVKB 2FV8A 3NT2A 5C8YB 2PX6A 1WS6A 1WZEA 1E69A 2ZRCA 1UINA 4KJZA 4MS4A 4G4GA 4X7PA 1JFRA 1P9NA 1GNQA 1OWMA 1AUQA 1M6NA 4TWRA 1JKJA 5FB3A 3VDQA 4LZNA 1S2GA 4F84A 1CZNA 4TVSA 4DLUA 4M0EA 2JEOA 3IGFA 2HTFA 4TUYA 1I3NA 4DQVA 2OBXA 2JJ1D 2WHPA 3DEFA 1C4XA 3NTOA 4U7FA 2NPIA 1Y1SA 4EF4A 1XPUA 5ALWA 3RT7A 5FI1B 1R0XA 2VK2A 4RVSA 3TH5A 1PI3A 2P3SA 3LE8A 4KSCA 3A3NA 1N2XA 2EX1A 1J8VA 4IPTA 3MMZA 4XDYA 2QN7A 3NAZA 4EDHA 2ACVA 2C4KA 2V6FA 1LVUA 2VK4A 4REQA 1V9SA 3CCCA 4GP7A 5GIOE 2H4JA 3MZ0A 3EIOA 1E98A 1XIVA 421PA 4W4TA 3O73A 2X0JA 2XYPA 3AR8A 3N70A 4KN6A 3R7NA 4KSYA 3GRYA 5DM0A 4AIRA 4YRMA 3TL6A 2WF5A 3HY3A 5HKOA 1ZOPA 4MDHA 4RHXA 3ZHRA 1E1LA 5A9SA 3WLHA 2GF9A 3RH0A 4PNEA 4UTRA 1JHMA 3V1UA 4QEKA 4F2PA 1JKFA 4GX5A 5J1TB 2VS1A 2VNSA 3VR1A 4W5HA 3FY4A 3KJHA 3GB9A 5ERXA 5F3DA 1HH4A 4TL6A 1PIWA 3JWEA 1VKHA 3F4KA 4NG5A 3UAZA 1IIRA 2CD9A 3OZRA 4QPCA 2IHBA 5E7QA 4RULA 3N9IA 3HCBA 1O89A 3PNYA 3PQCA 4M55A 1PNRA 5GV7A 3QENA 3DFUA 2WMYA 1PZGA 4TMTA 3IUQA 4IH1A 4CMAA 4L50A 5F2OA 3CLSD 4QD3A 1O5IA 1T5DX 1A9YA 4C08A 2D0OB 5ILOA 5JG7A 4D96A 3DUWA 3L43A 4DG5A 1YC2A 3CSDA 3IPYA 5LDDC 2H9YA 2MWMA 2JFNA 1ZU5A 3JAKB 1QK3A 3L6UA 4EJ2A 4QFDA 3LHKA 2IZ6A 4FGKA 3RSFA 3WP0A 4WIAA 1O6CA 3KFVA 3RG2A 4E12A 2ZT5A 2JASA 1UXJA 3KZKA 3QVMA 3Q2KA 4MUHA 1SOMA 2HMVA 3Q10A 2W2OA 4XM1A 1TF5A 4C30A 1RAIA 2CZQA 2RI0A 3M4JA 4M0DA 1KOGA 2P65A 3V1TC 4OH7A 2X0RA 4I14A 4UVIA 5IZ4A 2RBGA 4IQ0A 4BJHB 3IDZA 3PGVA 2Y1WA 3HXKA 2FZ5A 2GSDA 3QTTA 2D5AA 1NWHA 4U1RA 3E9MA 4XGQA 1HV8A 4D3ZA 4F6RA 1TJPB 3CZPA 3VKUA 3EH1A 5CFMA 1E61A 1ML4A 2HUNA 1T8WA 2XIJA 1K1EA 3IPRA 2ZIZA 3RRBA 3ZE7A 3S1SA 1H05A 1DCFA 3ZD9A 1T1EA 5FWDA 3RR2A 4X45A 4W8GA 1G0OA 1EUDA 2OB1A 4D1YA 2AC7A 4CLRB 2B92A 1EPUA 4R1OA 3FHLA 4OHCA 4HDSB 5DIZA 5DK4A 2IUSA 1OVMA 3EAQA 3TXXA 3TZEA 4XYLA 1SN7A 4BAZA 2P35A 2ZWAA 1VGRA 4D8WA 1K8QA 2JD0A 3TDKA 1P0IA 3K5HA 3JALA 1EIWA 1ZGGA 4U4AA 3DTVD 4N47A 2JIZD 5CMLA 2X0FA 2REBA 4FUQA 3L1IA 4NVRA 1JHYA 1P45A 3H6GA 1EGQA 3NORA 3I6YA 3UAVA 1T2DA 3FDFA 5IS2A 2M1ZA 1FOEB 2YYYA 5AKJA 5JMPA 4KPEC 1J0BA 1HYQA 3KR0A 4Y2RA 1BMQA 1SHJA 1GL9B 4IQ4A 4FHGA 5KNDA 1WZ2A 3DAHA 4B7ZA 4K9LA 1Q50A 1DXYA 2WVAA 1YR9A 3RFXA 4B3IA 1C3VA 1K6MA 2FSVA 3CLKA 1DX4A 2FEAA 2D62A 2QZ9A 1QH8A 2TS1A 2GEKA 2X13A 1DV1A 1IN6A 1UIMA 3B3QA 3HA2A 2P1ZA 2VKQA 1MXFA 2QRGA 3IB3A 3DKVA 3LC1O 3LQFA 3TNLA 4GYJA 4L5AA 5I9TA 1V2HE 4G41A 1N77A 3ZK7A 1YXMA 1BHQ1 3DQPA 4TTQA 5TT1A 2NYRA 1JEQA 4MHTA 2ID4A 1YB6A 4H7PA 4OU5A 2WWWA 2VLIA 4IIHA 4J0DA 4RACA 2EP7A 4DR2B 2AMVA 3OQBA 4E3ZA 4HRVA 4KL8S 1WTAA 3UJDA 3WO0A 2BI7A 2QTAA 1TNDA 1UBTS 1M34E 1FUYB 4M8LA 3U40A 4Y7DA 5J2TA 2FDRA 3K94A 4B45A 5JAIA 1BEUB 3DP7A 3IUJA 1CVRA 1Z4MA 4HRAA 4JZKA 3NWPA 5LM3A 1TU4A 3LPLA 3LUDA 5LWHA 1ODJA 1JP7A 1KVQA 3B3JA 1ZA2A 3HKEB 2ETVA 2HQRA 1CE8A 2EKDA 3AUTA 3STWA 3ZR4B 9ATCA 4N6GA 5BSVA 2XGJA 1OREA 1S6YA 5HUHA 1G41A 1EVJA 4CQLA 1CB0A 1TM7E 3DFKA 2BH9A 4OJMX 1YRWA 3U0BA 3QFFA 3P5SA 3FPLA 1G8FA 3PUVA 4URXR 3NH9A 4H17A 1W88B 5FUWA 5LQCA 2FOIA 5KNCD 3GR6A 1DARA 2FPLA 5EWMB 3DJFA 3HYCA 4J0IA 4HGPA 2GHIA 5JNSA 1S2DA 1P6UA 3K0BA 5JDIC 2C1XA 4MB6A 3DULA 1FFAA 1XXHE 4HRXA 1EJ0A 4DIKA 3CRW1 5A3RA 3S8YA 4LMBA 2G9ZA 2FRDA 1GPDG 4D9FA 3L6DA 2WA1A 5BYBA 5EJIA 1KOLA 3I23A 2QJFA 1IJKA 2ZVQX 3A26A 3L0OA 4TQ9A 4DCPA 2O8VA 2VJLA 4PO3X 1VIDA 4KLRA 2X8JA 2FU5C 1YOVA 4N54A 2F43A 4LKRA 1GPMA 3SJAA 5IM4A 1VLLA 2BJWA 1XQYA 1PLKA 3LKZA 1C9DB 4PANA 2RHLA 5E6SB 3QIAA 3ER9A 4WI1A 1E3JA 2FFBA 2COUA 4LZOA 2C96A 3VYTB 1LD3A 3H8VA 2EDCA 3SVLA 1BA2A 1WV1A 1NXTA 3MAGA 3BIOA 2QF7A 3AEQA 1E8DA 5F7ZA 1XVIA 3H4MA 1L7EA 2Z3WA 1RKBA 2N42A 2GEFA 3A14A 3L0ZA 4NDAA 2XEDA 4TN5A 3N2GA 4BAGA 3GJZA 2O0MA 5BWBA 1PFVA 5LP6A 1Z7YA 3Q1KA 3HKBA 4B3TB 3T38A 1O7JA 4IDCA 1NJ5A 1DO8A 2Z2XA 4URUR 3GYBA 4ZHQB 1IZZA 2B4TO 3DBHA 1UDCA 2EARA 4G0XA 3CVVA 1ML3A 1JXAA 3GZNA 1OX4B 1EAMA 3PXBA 1N5LA 1GM5A 3MHPA 1U2GA 2Y0BA 3C41J 4FYMA 5BNZA 3I42A 4JHXA 4YCCA 2IXAA 1F20A 3LDHA 3BH6A 4IDPA 4RJ2A 1L4EA 1YHYA 2ZLBA 2F1OA 3HP4A 2BBWA 5I7SA 1DGQA 1G8GA 4IIJF 1VIAA 5EIFA 3W78A 5JJBA 4LCEA 1G38A 2ENWA 2J59A 1V45E 1ZX1A 3PEFA 4JVSB 1OKKD 4EPXA 3V9AA 2PMKA 4HTAA 3DDUA 1NPYA 2ATEA 4XQ0A 3ZLBA 721PA 1U2GC 2ZIUB 1DG3A 1VCMA 1Q44A 1GPH1 3OWHA 3TYXA 3R9IA 4C20A 4PLCA 1CUYA 2Q29A 1UBCA 2VHVA 1BN6A 2QDXA 1G7RA 2O7VA 3BJRA 3LCMA 5BSKA 2JJQA 3AO0B 2HMWA 1TF2A 1OI4A 1A98A 1ZESA 2HBZA 4DEVA 3GRKA 2RH9B 3K70C 2XH8A 3F0TA 1NJSA 3A0UA 4RTOA 2XVAA 4AY6A 4AN0A 3GLHB 2I9PA 1JWBB 2O06A 4BNWA 3FFXA 3WLEA 2DXIA 1UBSB 5KTMA 1V6AA 1OXXK 1EFPA 1TGYA 2O2DA 3B1FA 2K2QB 3MD9A 3EZ9A 1FMLA 2RH8A 3UNXA 3KELA 1OU4A 2VKTA 5K3BA 5DO9A 4RCVA 1Z2PX 2ZRLA 5BYAA 1XZIA 3CJQA 5K0ZA 3K9FC 3R23A 2AOWA 2BRUA 5IJZA 4K3UA 2JBWA 1ZL0A 3EIXA 2ACEA 3JYOA 3L18A 1B3BA 2FMIA 1CQXA 1EH5A 3E70C 4Q9DA 4S1VA 4YGYA 3N2ZB 5EEHA 3WGJA 2V7XA 4RVHA 4YUAA 1V16A 2I3GA 4Z5XA 3A10A 1T8UA 2BJVA 3OC6A 3BDIA 1KVSA 1N0UA 3G2PA 4YJ2F 1G8SA 5P8WA 1T5SA 1G20E 1SQFA 1UWCA 1U28A 4J7UA 3EZGA 3FZGA 5K6TA 2BGMA 5K3DA 3NVMB 4IDHA 4H7HA 3ZVLA 1Z3CA 3QU9A 1WDKA 3WYFA 4IFBA 1NLYA 2CJWB 3CPHA 5TRTA 2ZBVA 4N8DA 1C7FA 4HBZA 1K8RA 1UBHS 3BBPA 3DP9A 1SCDA 2WMOB 3GRAA 1SCBA 4YVFA 3QLVA 1YT5A 3PVCA 1RQGA 4F3KA 1RC1A 1ZCAA 3OC0A 1H5QA 4GGOA 3AUXA 2G09A 4CLDA 1T9CA 2JFOA 5LBUA 4N48A 1NRJB 3FIUA 5EIAA 5BO5A 4DMLA 4FMDB 2ORED 5HKLA 3WDMA 4AK9A 1PR4A 1KYWA 3DVRX 1R5OA 2BFBA 1W4BA 3VVMA 4RVOA 4ZT4A 4XVHA 2Q1UA 4A2WA 1OT3A 1U7HA 5A03A 5I9IA 1HZZC 3LSYA 4ATNA 2ZOSA 2XLCA 1J0CA 3CZMA 4PC6A 5M34A 1TAUA 3G82C 5DN6D 2HLDD 1DIHA 2VDKB 3IODA 3LY5A 4LNAA 4N7RA 3H11B 2D59A 3QQPA 3Q3VA 4RD4A 2W42A 1E3LA 2XT0A 1L7BA 3RLIA 1JYSA 3KJXA 4Q6BA 3TW8A 5ARBA 4D8VA 5TQVA 1N6HA 4REMA 3OURA 4X90A 3QQ5A 3G85A 3FROA 4G89A 1PAUA 1Y6ZA 2HU2A 2KBFA 1CY7A 3OG9A 3R7WB 1OE0A 3SS9X 1XTSA 1ZNYA 4NBUA 2CXXA 4KPYA 8MHTA 1D4FA 1YTLA 2H17A 3PXUA 1USUA 2KQUA 1YKSA 2C95A 3W6PA 2BYTA 2GZSA 3CLUC 2Q0HA 3M5DA 2KX7A 2I6FA 2ZJ7A 3RUPA 5E4FA 3BHIA 1DKLA 2N3ZA 4XVRA 1NT2A 5JC1A 3ZKWB 4FYPA 4E5NA 3AIMA 3IXMA 4X20B 1OX5A 4J8PA 2C7BA 4GVLA 4XGNA 2ZZNA 2XCIA 3K35A 2BSAA 3M0EA 3U7JA 2EFJA 3C1OA 2GXQA 3JQBC 5CURA 4ZOBA 3W6NA 1O1YA 3GFPA 1G8PA 2WVGA 4HAVA 4HGYA 2IDMA 3BE8A 4HXEB 4W5WA 1X7GA 3HPQA 3HXLA 4F86A 3CVWA 4I9NA 2Y68A 3BRWA 3K2QA 2ONCA 4B3GA 5FUMA 5LQAA 3CEAA 1TJ5A 3IAM6 2HFKA 1RBYA 2H4FA 4FMCF 1A1VA 1E1CA 1TF7A 1GGEA 2BKXA 2LIPA 2F3PA 1CQWA 1C41A 5DGDA 4FEYA 2QRZA 2Y1LA 3L82B 2OVFA 1YKFA 4IUDS 4QWMA 1VECA 1Z4IA 4J0FA 1E60A 4WY2A 3OU7A 4KX3A 1NSYA 3I39X 2JGRA 3I2FA 1CWUA 13PKA 3PDCA 1Z83A 1SUBA 2EDAA 1H42A 3RC2A 1JJAA 3SM3A 4HPWA 2PUJA 3SSAA 2CB0A 1SOAA 2H59A 1VDMA 2MTBA 1JDZA 3FBTA 3K2EA 3ZUPA 1HXHA 1X1BA 5JQGB 4MYTA 3MB8A 4B0OA 4UC0A 3MUNA 4RAOA 1XVVA 2ZWOA 4FHEA 4YQFA 2G06A 3SY8A 4ARSA 4Z9BA 3BMCA 5BNWA 4WEOA 3GZNB 2I71A 4V0NA 3SYLA 2QRLA 3URKA 1GRVA 4G85A 4RKRA 2BUBA 5L7TA 1O03A 1ESNA 1YB2A 3OFNA 5D5PA 3S5JA 3QPVA 5EZYF 1IJEA 1KKLA 4XEHA 1FYVA 1PK9A 5FPYA 3ND6A 5NLLA 4FZ5A 4M54A 3FJYA 3NW9A 3RF6A 1QGED 2B4YA 3ZPXA 4K40A 3ZW9A 1ZR4A 4IIEA 4FOOA 2OEPA 4HGRA 3TLAA 2YASA 4PONA 2CC2A 4MQFA 4BLTA 1ISHA 3OBIA 1JXMA 1CW2B 1DRJA 4XB6B 5CW1A 2YW2A 1HQCA 5IASA 2CKMA 4OL0A 3OJXA 1H4TA 5AWFC 3VR5A 1OYVA 5HBRA 4YR9A 2ASVA 1OBFO 2XB8A 3IJRA 4AURA 5BSFA 2VPIA 1O08A 4AJJA 1M2KA 3FN4A 4K6MA 1I01A 4A0FA 4RD0A 1CY6A 4BFSA 5FKJA 1CUUA 2WAXA 5SYMA 4D9IA 3T4EA 2PMWB 1SUDA 3NWOA 4H77A 3S70A 2VSFA 2X6TA 2RJ3A 5LOVB 1VJDA 3MRTA 2LWIA 4E4YA 1D4ZA 3WWYA 4TV9B 1GLGA 3GK3A 4E7PA 4YLGA 2VPZA 2O1EA 2J9XB 4WLEA 5LQMA 4QIHA 3LJKA 1B1AA 2P6OA 3M6UA 1N2CA 5SZHB 1TK9A 1PL0A 4LE1A 5AM4A 4NEGA 2HMAA 3VU8A 1WZCA 1S5PA 2C3OA 2OGWA 4NZNA 2A1UB 2RGWA 2VRWA 5K0LA 1OXMA 2A30A 5B4VA 3G3EA 1W4ZA 1Q5PA 2QLBA 2V45A 5DX1A 3V4OA 3ABIA 4HWKA 2REQB 5EHZA 1QYWA 5D8DA 1W59A 1H8EA 2YTZA 4JGGA 4X1IB 5F1YA 4I5EA 2QIOA 3NIGB 4RESA 3UIEA 3VX3A 3EA0A 4CZ2A 3SF8B 1W5BA 1ZM7A 2E89A 2PGOA 4JUIA 4M49A 3UWPA 2XT9A 1WXEA 1RRCA 4B6FA 3R44A 1SIOA 5FA5A 1Q0SA 3KM0A 3KT8A 4FIDA 4RZHA 3P94A 3QKUA 4BNFA 1CVIA 4ESOA 2ZR0A 3RKSA 2Q5JA 3ROMA 1QDUA 1JIUA 2I62A 1XZJA 5DIFA 2DUWA 4BEBA 1CEQA 2VSQA 3KOUA 1GUZA 4YREA 2XAAA 4KPGA 3F5FA 4J90A 4LWZA 3ABRB 1JJFA 1FNBA 1XE3A 4INOA 1QVZA 4G25A 4RY8A 4ZVPA 1I33A 1PHPA 1WMBA 4RANA 4BS9A 3LXRA 4MYDA 1ZN8A 3V7NA 5ILGA 3TSCA 1Z7WA 2EBHX 3IP6A 4BLOA 2HA2A 3OM0A 2ODWA 1GPUA 1KYXA 4IH4A 5AKZA 1E20A 3WY9A 2YVUA 3QG5A 3IEMA 3AVVA 4IRUB 3FGNA 3DDWA 4NMMA 1RZVA 4M1ZA 5BQXA 4JI2B 4IR7A 1XU9A 2BEJA 4EO7A 2IYNA 3HLKA 3FE2A 3FYTA 1NNLA 1SO8A 1I7SB 1GNRA 2I7CA 5E6UA 5KAMA 4DCCA 2DY1A 4H16A 3X1DA 4AYTA 4F4HA 1F60A 4ETMA 5K6AC 1MNQA 2YRWA 1U1FA 5DLDA 5I3CA 1ZNWA 3FZQA 4LC1A 3ZWPA 2R1TB 2WD8A 4R71A 4I1OA 4CMKA 1S2LA 4K2AA 2FR8C 1WULS 1MC5A 4QQFA 4AJ1A 4LZWA 5BR4A 3I92A 5EHXA 1G63A 4I19A 2R11A 2BZ1A 2D2FA 3F6PA 3LX4A 3IAS6 1EVEA 1A88A 4D9HA 2YJ3A 2D2EA 2WJWA 3KB6A 1J00A 1R64A 3BD8A 5DNWA 1K6JA 1OLXA 4IO1A 1TK3A 1FP7A 4LYGA 4GLLA 1NDHA 3I52A 2O23A 2J30A 4OM8A 4RF4A 4O4JB 5JXWA 5F7JA 1VG0B 2PKEA 2QTVA 2VWHA 3PQ3A 2Q2VA 2XWSA 2CJFA 3E7FA 3Q0EA 1N0IA 2FQ1A 1EFUA 1ZHHA 5BQPA 1Y1PA 5FV7A 5EZYA 2DUJA 4AP5A 3HPRA 5BRAA 3O8OA 3ZV5A 3GV0A 1NVUQ 3NNDA 3M4YA 3RVJA 1CSEE 1FPMA 1MOSA 2QPLA 1BWQA 3I6ZA 2FCRA 4WJKB 3UEOA 3T3HA 4ZDWA 1Y8RA 1NG9A 2XUZA 2IYAA 4JU8A 1FFHA 4CODB 1WVIA 3NFYA 3R76A 4A8JC 2W2NA 3SWWA 4DKJA 4DEYA 1XTKA 1QZ3A 4G5QA 5I9SA 5TGDA 4NCBA 2PX2A 3MTGA 2LUOA 1WW2A 4P6VF 3NLLA 2B2NA 1P6XA 2B9VA 2OGZA 1KYTA 1O5OA 1ZRNA 2G63A 1L4FA 5HM6A 1IMJA 1FUIA 3RAPR 2AC2A 3NBXX 4OHPA 4EUEA 1O8CA 3WJ2A 5IHXA 1T2UA 2MSCB 4MP8A 3K09C 4PPQA 5I9MA 2IH2A 2YCBA 4OHWA 3RTEA 3QG1A 1XHLA 2QJWA 3M3PA 5LB2A 5I47A 4YP6A 5HNKA 4U2FA 3Q88A 5HRUA 5CB6A 3K0HA 4RZSA 2C1EA 3FH0A 3IKTA 4N9QA 2XUDA 4XEUA 1FL9A 3K4HA 2YVLA 3OM1A 4WACA 3CUEF 4KO1S 2XRFA 2IYTA 3JVUA 1IAQA 3LM8A 4K5QA 4UBOA 1CPYA 1NF3A 4Q4LA 1PYGA 3E18A 3SYNA 3ZCRA 3R75A 1GZ6A 1UOQA 1OJLA 3HC7A 4TMFA 2FWNA 4XRRA 1GZ5A 2APJA 3VYRB 3DMPA 3LVQE 4N65A 3MOIA 5C53B 2XGSA 3F7TA 1CLUA 1TKAA 3JATA 4G0OA 1RBQA 1Z68A 3UT5A 1YRQA 1S3SA 2CLDX 1DPGA 2POQX 2AOVA 3MQ4A 5MN4A 1EXWA 3MLEA 3DV0B 2JVIA 3MJVA 4P1ZA 3T95A 3TZLA 4CTKA 4E6EA 3C24A 2PV7A 1MG0A 3L02A 5EMKA 3GAMA 3MUEA 1DEAA 4F5EA 4R2HA 5DNVA 3TAXA 2IBSA 1FJGB 1JWLA 3O9VA 4HWPA 4E32A 2SKEA 4O59O 4QZVA 1Z12A 5E2IA 3PDIA 2ZXUA 5FBLB 4XWWA 3KT0A 4GX0A 2I91A 4JP8A 3B1XA 1XF9A 3H0CA 1T4CB 2H2IA 3R0ZA 3SD7A 2AUMA 1DKPA 2ZYWX 3NANA 3IT1A 1RRPA 2WE8A