4DCGA

Vaccinia methyltransferase vp39 mutant d182a complexed with m7g and s-adenosylhomocysteine
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
297
structure length
291
Chain Sequence
MDVVSLDKPFMYFEEIDNELDYEPESANEVAKKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPAQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Mrna processing
molecule keywords VP39
publication title mRNA cap recognition: dominant role of enhanced stacking interactions between methylated bases and protein aromatic side chains.
pubmed doi rcsb
source organism Vaccinia virus
total genus 98
structure length 291
sequence length 297
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 1998-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4dcgA00
3SSMA 1D2GA 4FGZA 3SX0A 5EMKA 4M7RA 2H1RA 3GRVA 3B7PA 3SVZA 5KQSA 3EMDA 4LECA 4YV2A 2R6ZA 5HILA 3JWIA 3HM2A 3PT9A 3MQ2A 4YUYA 3CBGA 5EKUA 2R3SA 3JWGA 5BW5A 3F4KA 1NE2A 3O7WA 3R24A 1X1CA 5EZQA 3IHTA 4POOA 2XBMA 4OA8A 2B25A 3NVMB 3R0QA 2A14A 2Z6AA 3OU6A 4Z2YA 1IM8A 4YUXA 2P41A 2PX5A 3OE5A 4FSXA 4KDCA 3AXSA 3TPZA 1VIDA 3E05A 3OE4A 4AZWA 3V97A 2OY0A 4E70A 4GC5A 3PB3A 1O9HA 1Q0TA 2E5WA 2ZSUA 1D2CA 2FHPA 1F38A 1RI4A 3C3PA 1EG2A 4QPNA 3THRA 1H1DA 2C7PA 5LQRA 1FP2A 3G88A 5K0GA 1JG1A 3QOXA 5FA8A 4DCGA 5GIOE 3EVAA 2GS9A 1SUSA 3EVCA 5FTWA 1XXLA 1L3CA 2G72A 2YXEA 4AX8A 3NDIA 5EMJA 5EVJA 3FPJA 1UFKA 3DMGA 3CC8A 5T6BA 3LECA 2IH5A 3KR0A 3B89A 3D2LA 1R8YA 1NW8A 2EJTA 4CXMA 2YXDA 4RTKA 8MHTA 4OQDA 1SVUA 2IP2A 4FT2A 1DL5A 2AOTB 4GOMD 3OZRA 5EIFA 3BWCA 5C9ZA 3ORHA 3HTXA 5DRTA 5DTQA 4E2YA 5DRYA 2UYQA 3HNRA 2JJQA 4YMGA 3PTAA 4P58A 3SXJA 4F84A 2PGXA 2K4MA 5KVAA 3AY0A 1G6Q1 3P9CA 5LR6A 3RW9A 5EEGA 1WS6A 3HCCA 3LPMA 5FADA 2ZVJA 2VS1A 3UJ8A 3UJAA 3EEYA 1NKVA 2UYOA 1M6YA 1TW2A 3HCDA 3I9FA 4HSGA 2I9KA 4E31A 5E2AA 1YB2A 3BT7A 3LHDA 5IH3A 4OA5A 1WZNA 3KQWA 2O0LA 1JSXA 2WK1A 3A7EA 3DXYA 4A6DA 1JQEA 3MAGA 4GUAA 2PLWA 2CWWA 1L9KA 3BKWA 3UJ7A 1F3LA 3NJRA 2KW5A 1Q0SA 3THSA 3JWJA 3BKXA 3KR9A 1KPGA 1TW3A 2P8JA 5DLYA 4AZVA 4BLVA 2NXJA 3NTVA 4RWZA 3TRKA 5GINE 3KQVA 2FK8A 4DKJA 1KPIA 1SUIA 2NNWB 1Y8CA 3GDHA 3FUUA 3GJYA 4P7FA 5DX8A 3BGVA 3BZBA 5HIIA 3TR6A 3WSTA 3B5IA 9MHTA 4BLUA 2O07A 5KQRA 5EZSA 5FWAA 2PWYA 2AN4A 5K0BA 2O57A 5LQNA 10MHA 5EEHA 5BXYA 3MHTA 2O06A 3GIWA 3M4XA 4AZTA 3ER8A 5FHRA 2AOWA 2CMHA 3BWYA 4HTFB 4BP3A 5FHQA 3GCZA 2Z6UA 2OKCA 5CVVA 4RTLA 4E30A 5DM1A 3EVDA 1QZZA 3UA3A 4R6XA 5K0FA 3FYDA 5DTMA 2AOXA 4C08A 4QQNA 1P1CA 1ZGAA 3PX2A 2ZBQA 3TM4A 3JWHA 3NWEA 2G8NA 3EVEA 4BY9E 2N47A 1YZ3A 2V74B 4GOND 1SG9A 5FUBA 2UYCA 4PGGA 3G8BA 4RTNA 3LBYA 5KYGA 3TKAA 3DP7A 4FT4A 4H0NA 1M6EX 5HIKA 5GM2A 2NP7A 3SR4A 3P2KA 1ZKDA 2B3TA 1NV8A 2HMYB 1UIRA 2OB1A 2I6GA 2PXCA 5E1OA 5HIMA 1NV9A 2C7RA 1YFJA 2IBSA 2BZGA 2PBFA 3REOA 3IEIA 1G55A 3NW9A 4X1OA 2C7QA 2GB4A 3HCBA 5K09A 3OU2A 4QPPA 2JHPA 3CGGA 4HTFA 3P9NA 3PFHA 1NW7A 3UFBA 4RVHA 4YUZA 3P2IA 2AVNA 2OYRA 1SKMA 2OO3A 3KQMA 4R8RA 5ICEA 3M6UA 4FSDA 2AOUB 1EJ0A 3E8SA 3HCAA 1VP9A 4DQ0A 2IBTA 5D1HA 5ICGA 3OCJA 3LGAA 4ISCA 1V39A 2ZLBA 1L1EA 1KYWA 4X60A 3ID6C 1AF7A 5FCDA 3LX6A 4KIFA 1BOOA 3QOWA 3EVFA 3DOUA 4FR0A 2H00A 4QDJA 3G5TA 1Z3CA 5DX1A 3FUXA 5DM0A 3A26A 4PNEA 3G2OA 1WY7A 4XUCA 4XCXA 2PSSA 2Y1XA 2AZTA 3OFKA 3I5UA 4PYJA 4MWZA 2HWKA 3T7RA 7MHTA 2FRXA 4ER0A 2PX4A 5BW4A 2WA2A 2YTZA 4MHTA 4RVGA 2BH2A 3B3JA 5H02A 3UJ6A 2H11A 3C3YA 2P1DA 3TQSA 2PV0A 5CVEA 3A7DA 1DCTA 2AOUA 2OPBA 2QRVB 5F2KA 5F2OA 2P40A 2G71A 1N7JA 2BR3A 3HCFA 4BLWA 5K01A 3L8DA 5JR3A 3CKKA 3LDGA 2CL5A 1PJZA 3PVCA 5B1SA 1BKYA 3NDJA 5DX0A 4ER5A 1YF3A 3BXOA 3KQQA 5FQNA 2NXNA 1AQIA 2HV9A 5EGSA 3FZGA 1O9GA 1MHTA 2ZZNA 2AVDA 5CIYA 3PLAE 3TFWA 2AS0A 2PVCA 1FJXA 1DUSA 4QTUB 4QVKA 4K6MA 2FCAA 4HRAA 4QDKA 1N2XA 1XCLA 5T67A 4RTSA 1RJDA 4DMGA 4E2ZA 2IFTA 3EGEA 3E7PA 4PYOA 5C1IA 3I58A 3FTCA 3GRYA 5CVUA 1RJEA 2JHAA 1VPTA 3K6RA 2GPYA 3HA7A 5T64A 4RVDA 3M6XA 3UWPA 3VYWA 3EEOA 4FP9A 4L7VA 1KXZA 2NYUA 3LDFA 2QRVA 3H2BA 1NT2A 3C6MA 2ONYA 3MTIA 3KHKA 3MTEA 5U4XA 3ME5A 2XYVA 3R3HA 5EG5A 3V8VA 4C03A 1ZG3A 1RJGA 4IKPA 2IPXA 5HOQA 1RI1A 2O05A 4PONA 1L3BA 4MIKA 1G8AA 1VBFA 3GO4A 2NXEA 4M38A 1I1NA 3PS9A 2AOTA 4PYIA 2XVAA 1HNNA 4V0QA 5E9JA 5GM1A 3GU3A 5DWQA 4RTMA 1NW3A 4PINA 2DPMA 4X61A 2EJUA 1JG2A 2G70A 2LD4A 3DH0A 3ELUA 3EMBA 3MCZA 1JQ3A 3OFJA 4FZVA 2ZFUA 3VC2A 4CKCA 1VE3A 3LCVB 2JH8A 3RODA 3UJ9A 3OZTA 5LQCA 4QVGA 3T7TA 1BHJA 3EVGA 3KQYA 1WXXA 5ICFA 1XCJA 3UZUA 2AOVA 2EG5A 1O54A 3LDUA 2QYOA 4UOEA 3FPHA 3VC1A 5K8VA 4JXJA 3FPGA 3O4FA 4U7PB 2IDJA 3EVZA 1QAOA 5LSAA 4F86A 4YUWA 4C4AA 2VZ9A 1G8SA 5EPEA 1QAMA 1KP9A 2FYTA 3C6KA 4OBXA 2XYQA 2YR0A 5CM2Z 2YVLA 2UZ4A 2ZW9A 3HVKA 5K0LA 3SGLA 5LQKA 4PYQA 5DPMA 1ZHFA 5EIWA 1U2ZA 3I64A 5EMMA 4GC9A 4E2XA 3ELYA 3R9XB 5E1DA 3BGDA 3BGIA 3DTNA 3FTEA 4KRGA 2DULA 3MGGA 3NWBA 5E1MA 4AUKA 5IKMA 5DT2A 4E32A 4RTOA 3K0BA 1P39A 3HCEA 2BM8A 3P9IA 1QAQA 1FP1D 4CKBA 2IH2A 1JR4A 3CJTA 3UJDA 3AXTA 3KQOA 2FPOA 3Q87B 4P7JA 5E8JA 3OPNA 1SQFA 5E9WA 2B2CA 1EIZA 3P8ZA 3FYCA 4NECA 3G8AA 4PIMA 2Q41A 2ZWAA 4C05A 1KHHA 1M0EA 4PYLA 1VLMA 1KIAA 3DXZA 5EOVA 3S68A 1X1AA 2OZVA 4KIGA 1MJFA 5GWXA 3LL7A 3G5LA 2GH1A 4GOOD 5FWDA 1INLA 1JG3A 3FUVA 3LCCA 3GNLA 2NXCA 3PFGA 1ORIA 1N7IA 1YUBA 3DXXA 3GRZA 1D2HA 3KR2A 3CCFA 3CJQA 3TOSA 4R8SA 3UJBA 4MQ4A 3UBTA 2PX2A 4HGZA 1UWVA 2V7EA 3KU1A 4LWPA 3ER9A 1XDZA 4PYNA 4DM3A 2OBFA 5DM4A 1BC5A 4OBWA 3P71T 3FPEA 3KPYA 3AWIA 1G60A 2GA9A 1G38A 3KQTA 5KS2A 5E2BA 3IYLW 4OQEA 5EKXA 4HG2A 4WVLA 5DXJA 4BP1A 4PGHA 3U81A 4ER7A 2ZTHA 3E23A 4M36A 2PJDA 2ONZA 2VDWA 1B42A 3DLCA 2BM9A 3DMHA 3CJRA 1X1BA 2VP3A 4YUVA 2OXTA 1KPHA 1IY9A 3ELWA 3KPJA 2P35A 3LCUA 4O29A 2C7OA 5K0CA 4FS8A 3RIEA 3LSTA 5P8WA 4YV0A 3M70A 1AQJA 2YQZA 5K0JA 4U7TB 5K0EA 2XYRA 2HNKA 3M6WA 4RYLA 5CVJA 3ELDA 3FPFA 1FPQA 3T7SA 3A25A 3MB5A 1HMYA 2VDUE 2YXLA 3A27A 5E8RA 2JH9A 1JSZA 4P7KA 1NBIA 3GXOA 3KR1A 3ERCA 3HEMA 2YX1A 5FULA 4CKEA 3LKDA 4HC4A 4EKIA 2PKWA 4ER6A 3QV2A 4RVFA 1T43A 1P91A 2AN3A 3P9KA 2CMGA 4RV9A 4X41A 1YFLA 1NBHA 4PCLA 3FUTA 3I53A 2JHCA 1R00A 3PX3A 1XJ5A 2ZIGA 5E1BA 4AZSA 1IXKA 1PRYA 3LBFA 2ZCJA 2YUIA 4E33A 2PT6A 3GRUA 4LG1A 5CUQA 1KYZA 5D1NA 3OU7A 3UJCA 2WA1A 1RI5A 4IWNA 2ZZKA 4IV0A 5JUWA 4GEKA 1VP3A 4A6EA 4IV8A 5ICCA 1XDSA 4RTPA 5DM2A 3X0DA 3SSOA 3SM3A 3TMAA 4EQZA 4C07A 4GQBA 2CKDA 4PIPA 5GIPE 3NVKI 2PT9A 3M33A 4B17A 5CCXA 5EHGA 2ESRA 1EJ6A 3KPUA 3OZSA 3P97A 2JG3A 4RSRA 5CCBA 4EMSA 5MHTA 5K03A 4V0RA 1XTPA 2HR1A 3BUSA 3CVOA 5HIJA 1KR5A 4OX9Y 4XUEA 2I7CA 4DZRA 4EKGA 2Y1WA 3TLJA 5K05A 2ZZMA 1WG8A 5ERGB 5FA5A 1JQDA 1X1DA 2P3QA 4KDRA 3DLIA 1R8XA 3A4TA 1I4WA 1ORHA 3Q7EA 3KQPA 4M37A 4ZTBA 5HEKA 3B3FA 1JTEA 3LKZA 2I62A 3M6VA 3G89A 4XUDA 4WXHA 4GBED 5HZMA 2XVMA 4KVZA 4CWAA 4P7GA 3HA5A 2PWPA 4PYMA 5LQUA 1XDUA 1NW6A 4MTLA 5G02A 3TKYA 4HH4A 4DF3A 3FTFA 3AJDA 2ERCA 5F2NA 2AR0A 4RTRA 2P3LA 4Y2HA 1QANA 3TM5A 4QTTB 1YZHA 2ORED 4X63A 5C0OE 1ZGJA 3MERA 1VL5A 1EAMA 2Z6QA 3ANXA 2QE6A 5DSXA 5GOZA 5LQJA 3G2PA 3GRRA 3FRIA 3HA3A 3G2MA 4KW7A 3GWZA 3EVBA 2VDVE 5FQOA 4ER3A 4YMHA 4DA4A 3HVIA 5K0NA 4R05A 3O31A 4LWOA 4YV1A 3BWBA 3DR5A 2IH4A 1OR8A 3FUWA 3R6TA 2ZIEA 3IV6A 4DCMA 2PX8A 2FK7A 2ZULA 1X19A 2ZWVA 4RTJA 3DULA 4CTKA 3C0KA 5EMLA 2IGTA 2IDKA 2HTEA 1TPYA 3EPPA 3KQSA 5DSTA 2BR4A 1R6AA 3VSEA 1RI3A 4C04A 1SQGA 1ZQ9A 1EQAA 3DMFA 4GF5A 5EQJB 1XVAA 3G2QA 1VQ1A 3BWMA 2BR5A 3P2EA 4KWCA 3KPVA 4ATNA 2EFJA 4EVIA 2GAFA 5EHIA 2PY6A 2QY6A 2ZIFA 3T0IA 2G1PA 5DTRA 2QM3A 3EGVA 4HGYA 4PYKA 3G7UA 2AN5A 2F8LA 5HFJA 2OB2A 1R74A 2P3OA 3DUWA 4G56A 1NW5A 1JG4A 1L3IA 2UYHA 5BP7A 2ZBRA 3KKZA 4RTQA 5E9QA 2PXAA 3FRHA 3HP7A 5CD1A 3MCTA 3SMQA 1FBNA 2B9EA 2IIPA 5M5BA 2ADMA 4RX1A 3EGIA 1WXWA 3B3GA 2EX4A 2ZBPA 3UA4A 2NP6A 4QQKA 2GLUA 1JTFA 3HVHA 5CVDA 3GGDA 1P1BA 4R6WA 5GP1A 1R18A 4C06A 4E2WA 4EK9A 2P7HA 3SSNA 1AV6A 1I9GA 4PCAA 1RI2A 4F85A 2PXXA 1RJFA 2B78A 2P7IA 5LQAA 4Y30A 4PWYA 3HVJA 4CTJA 3NMUF 5DXAA 5EC8A 3FTDA 4GOLD 1QYRA 3KPWA
chains in the Genus database with same CATH superfamily
3D0OA 5DN6A 3IVMA 4L9AA 1QP7A 2WP0A 4J2TA 4PAOA 3GLGA 1QR2A 2H1RA 1MV8A 2HV8A 4RVNA 5KVAA 4EUSA 5HE8A 1GGHA 2DPXA 3ZWNA 4JOCA 5TGDA 2GAIA 4IVQA 4OUKX 5J4LA 2PX6A 1IZYA 1NE2A 3L9XA 3QYJA 2Y92A 5F7OA 1AGYA 5FB3A 5LMNB 3JQDA 2ISCA 1G7CA 4JQYA 1DAHA 3G79A 4DQXA 2AMLA 2MYUA 3B6KA 3MN1A 4V02A 4A0HA 2CKMA 4O4JF 4XWTA 1N1EA 1ZD8A 4DCVA 2HA2A 2GD1O 2J4FA 4K2AA 3U6BA 1EXWA 1UP7A 1H22A 3D3JA 3ZBQA 1IHOA 2E1PA 3F1LA 1Q0PA 1W29A 2QK4A 1U80A 4Y7DA 2FHPA 2KX7A 1ACJA 1LZLA 1XCOA 2DUMA 1VPDA 1NX9A 3TL3A 4HNVA 2Z2KA 2OZEA 1TFRA 2RB5A 3B85A 5I4CA 1GGVA 4EEXA 1ECJA 1NKSA 3LPCA 1LBQA 1DP4A 4IXTA 1KFEB 1P8JA 1PT7A 1M1NA 2BMVA 1Z88A 4NH0A 1MJGA 1C3OB 1KZYC 4RD3A 3GT7A 1Y6JA 3HXOA 3ZTTA 3RTEA 1D6JA 4KGVA 2DU8A 4UE3S 3KJFA 3U7HB 1UM8A 4B43A 4ZDIA 1SCJA 1NTRA 3UOWA 4B3FX 3FVWA 2OQRA 4PSCA 1NFRA 5AVWA 4CXMA 1JDVA 2WQ6A 3EIFA 3BK7A 3IFSA 2QN1A 1ZWLA 4PNHA 4HRXA 2XYPA 4KMSA 1NASA 2BEUB 2YZ2A 5MF6A 3AOEC 1GTJ1 4LKOA 5AJTA 1XMQB 5CITA 5I9IA 4MWCA 4YMGA 1FRZA 4QBKA 4F1JA 621PA 5CXSA 2QWXA 2K4MA 3ISJA 1U8YA 4QT4A 4BWGA 3P2YA 3QFHA 3PRYA 3RW9A 3KVVA 3OA2A 3GJQA 3WA6A 3CLUC 1VG8A 2FZEA 1NKVA 3IHKA 2XHEA 3X2EA 4WXEA 1TUBA 3LWDA 1Y4AE 3VR3A 3MW8A 4IUYA 3QMVA 2WTXA 3DDZX 4KBFA 2XT6A 2R1TA 3N70A 4G86A 4AXBA 5HOEA 3BKWA 4ZN6A 2QTCA 1F3LA 4ABYA 2H4YA 1ZD4A 4OX9B 3DW3X 2G82A 2F64A 5BNIA 3RADC 3VZDA 2UUBB 4O4HF 3IEUA 4EP1A 2QM8A 5LVAA 4LF9B 2FPLA 3GZ4A 1M10A 3DE2X 2RGNC 4C21A 2IU0A 1RLMA 2CXUA 4DS3A 3NRBA 5JEEA 6ABPA 2A7XA 2QI9C 3Q3JB 3ZPXA 2D6FA 4JENA 1XAIA 3CW9A 3I3SR 3V7UA 4P4NA 1E64A 2O07A 3KZVA 4US1R 4YP6A 2WPDD 2XKAA 4G1BA 3ICQB 2ZIAA 3VZRA 4D8TA 2AJTA 4YCJA 1T2AA 3EUAA 3TVTA 4ZYZA 2IXDA 1OBHA 1KDVA 3ROKA 5IKOA 1ES9A 1GTL1 2O7VA 3EDOA 3Q85A 3V7FA 4JUDX 4WN9A 1RJ9B 2TMYA 5KOIA 1N2EA 3HJAA 4ZI7B 1QFMA 2Y0DA 1SUDA 2KSQA 2JJ1D 2YZNA 2O2HA 3ONWA 2NT3A 1M8KA 3EXFB 5EP1A 3GP3A 2PE5A 2RCNA 3C2QA 1H0KA 4ENVA 1TAQA 3IT0A 3HKDB 5H3LA 4DNQA 3DNPA 4ARCA 1R5BA 1PBNA 1WWKA 3IUJA 4KACA 1T0JB 4TLAA 1CIPA 1XPUA 3SR4A 2WD7B 1TEHA 4Q18A 5TJHA 5ALNA 3ZJTA 1O95C 2FI1A 1J22A 1GUYA 1Z68A 2G4CA 2JEYA 3H9EO 4TXJA 1GILA 2CNDA 2GB4A 1U8FO 3GJRA 4V2UA 2H3EA 3SZLA 3V34A 3BJRA 3UAWA 3ELBA 3VR4D 1FFGA 3BTOA 3SK0A 1G20A 4EEKA 2Z5FA 4KTVE 3BCSA 1M8GA 1ONPA 5FWYB 4CQJA 1I24A 1DMSA 2EFEB 3LQFA 2B4TO 4MEBA 5JAPA 4M1OA 1RYHA 1K2WA 2RAUA 1LPSA 1N0IA 3GLRA 2HA5A 121PA 4TS1A 1KI6B 5EWJB 4CF3A 1I13A 1S7GA 2G83A 1EUYA 1SG6A 2I4MA 3AHDA 3IP9A 4P86A 5DK6A 2ZIUB 2KS6A 3WY9A 5AVVA 1ADGA 1ZK1A 3I1FA 1E9RA 3AR4A 2PTHA 2IEIA 2OM2A 3ESZA 3BDIA 4EDHA 3G5TA 2X14A 3IAM6 4G8BA 5HKLA 5AM5A 3TB6A 1I1HA 3IQEA 2AKEA 1ODKA 1P2UA 4EUFA 1CY8A 3OEHD 3E9YA 1WHSB 2C00A 2CNOA 2ZUWA 3CFYA 4Q9JA 4N39A 3AVPA 2NTNA 2YZ7A 2UZ0A 3SS9X 2I2DA 4A91A 3UM9A 3I5AA 4L8YA 3G7SA 2JVIA 3LX8A 4HL6A 3T7RA 3GRCA 4LQDA 5HX7A 2W8BA 3FPAA 3KK0A 3H05A 3KT0A 5B3KA 5MGNA 3NAZA 4UBJA 2PYZA 1W4LA 4CMEC 3GLIE 3MMNA 5EJAA 3GGPA 3TOVA 2O1SA 6Q21A 5GVSA 3FLEA 1SIBE 2FSFA 2Q6VA 2QGNA 4KQ6A 4AJ4A 5IXJA 1SU8A 2QHXA 3DVAA 3B20A 3KV1A 3PNLA 1B0UA 5KX5F 3K31A 2QRVB 3U4MA 2PKRA 5K01A 2XJ9A 4FEEA 6PFKA 4H31A 3B3QA 1S8OA 2NVOA 1HNWB 4TQGA 4ZOQI 4EW6A 3U6KA 1J2EA 1LPOA 3A2KA 3PSHA 3KQQA 4AT1A 1CYEA 3AIIA 4WOJA 4PRLA 2X8WA 4KIWA 4A5SA 2IODA 4PZDA 2WB4A 1G3IA 1GKYA 1ZM3A 3O4IA 1V35A 1VIMA 3DYIA 2OAEA 3EDCA 1G7TA 3KZ1E 3L7DA 1ISHA 1ZGHA 1EP3B 3PTZA 5F1PA 1KO1A 2GD2A 2QQGA 1IQRA 3KFLA 3LT0A 4M7PA 4RK1A 1ESMA 2PWZA 3UMVA 4BMCA 3TOCA 4HNQA 1DEOA 1KI7A 2ZKIA 2O14A 2V5VA 4NARA 2C95A 3AUFA 4F2WA 4D9BA 5A4DA 2GZHA 3FTCA 4EWLA 2C5HA 1GV0A 2CF6A 4KXFB 5AKGA 5AKZA 3C8DA 2WUEA 4J6FA 1C9EA 4EQ6B 5K8LA 2OUIA 1YDMA 3EAGA 8GPBA 3L0DA 1VGQA 5LOVF 4I1UA 4R1OA 1F2TB 5ESRA 5F7ZA 3PCTA 5HA5A 2F8TA 1OXXK 1RQPA 4L2IB 1RJGA 1H2WA 4QGBA 3AKEA 3S1SA 1RI1A 2NSLA 3AEKB 4S1TA 3WKEA 3K16A 1WW2A 3IP6A 2OGUA 4MP3A 1G6KA 3LZCA 1WDMA 3L0CA 3ONDA 1C9MA 4X8HA 5AJVB 2Q3CA 1P4AA 3GU3A 4M8KA 4BNDB 1HT1E 4EUNA 1CQXA 1XA4A 1SKUA 4OLAA 1UINA 1N2OA 4GNRA 1ZOPA 4B09A 2G07A 1HE2A 2PWBA 4JDUA 2O8CA 3P27A 4RSGA 1MHPA 3UHAA 3OZTA 4MUGA 5LQCA 2QT1A 4S1NA 2VWGA 3O92A 4MVJA 4PFKA 1XKLA 4FYVA 3RTBA 2V7WA 3F7TA 3OH8A 4TXLA 5K8VA 4NXMB 4JI2B 2QD1A 3KYCB 3WVNA 3G0OA 1Z26A 3EVZA 2EW1A 3SIRA 2VPYA 3FKSA 1ZRHA 3SJZA 4TKUA 4BP8A 1GFIA 4JROA 2LKDA 2P0EA 5KO2A 4Q82A 3TNLA 4AJEA 1IN6A 4ECAA 5A62A 5JCJD 1EKXA 2B0JA 2J9XB 3MHPA 5D3MA 3WB1A 4DJEC 3MWDA 1T8SA 3T1HB 1SBCA 2VYVD 3A06A 3KOZA 3ELYA 1DNPA 1LPMA 1YS6A 1Z0KA 3TTYA 3WLJA 2OV3A 1OFIA 3OP1A 2R79A 4KE9A 1VKOA 3WGJA 1YE5A 2WSBA 1RXSA 4C6HA 3NVAA 3MXOA 4RF3A 5EXEA 5IKXA 3BB1A 4RA9B 1IG3A 1NOJA 3RSOA 3EW9A 4FBMA 3G8AA 5IZCA 3FJYA 4OD0A 4PIMA 3HVUA 4C1BA 4EW3A 1ZMTA 3FMGA 3L6EA 4YUAA 3R4VA 3DXZA 3U7QA 1HZZC 1MO5A 1X1AA 3GNQA 1EI9A 4XSVA 3BXEA 1RWMA 3DAFA 3K35A 2ZRDA 1CUWA 4RZHA 2BZ0A 5JH7F 3VKUA 3PEVA 1JG3A 1GL3A 4UJ3A 4ZODA 2C31A 4FNOA 2LCIA 1L5GB 2QNRA 3TOSA 3K4HA 3CCFA 3MRTA 1E7MA 3JR7A 4QDOA 1AZLA 4XR9A 1YDFA 1GRVA 4FK8A 1NLFA 1ZKMA 2XT0A 3WWDA 2Q0SA 4P35A 4GSLA 1HORA 4GMFA 2UXDB 2W93A 4S24A 1C9DB 1GUZA 4HVAA 1OLOA 3C45A 1KVSA 2F9LA 4RXUA 4Z9AA 5KTKA 3JATA 4WZBE 5A05A 1QVVA 2Q3EA 3H1EA 3DWFA 3NQ41 1BMFD 2OORA 4EGQA 5ILOA 1IN5A 1T4MA 2PJDA 2XH8A 4LGMA 4YQEA 2CN1A 4OLHA 4HDKB 2DBQA 2DFNA 2EEZA 3D6AA 4QNNA 1KPHA 1HSZA 2G5PA 2R85A 2ZANA 1K5PA 3M5WA 1V9CA 1PK8A 3KPJA 3ZGYA 5HKKD 4NJEB 4CLRB 1EA5A 1OIWA 2C58A 1EUCA 3GFOA 3LZDA 4FBLA 4XJXA 5LCXA 2PV7A 5FPHA 4BFWA 4BMDA 4MWOA 1U8XX 1DX4A 3BXZA 1ZNQO 3CA8A 2OHJA 4ITRC 4N8SA 4YONB 1WQ1R 2H4WA 3GQVA 2Y1CA 3PITA 4OSPA 3RJ5A 5FULA 5KNCH 3D0QA 2QJFA 3ETCA 3KKOA 1GHTA 1F1JA 1T43A 2JFHA 4OQFA 3MELA 2ORYA 3OCCA 5CD9A 1CZOA 2ZSDA 2VDRB 2ET6A 2ZIGA 3EOAI 4RHUA 4NBSA 4ACAA 2DYKA 2RHBA 1OAOC 4FHCA 2ZCJA 4W7SA 5EJEA 2PDAA 3PKIA 3WMEA 3PC8A 2XNSA 3AESB 5HSGA 3KZCA 1IXZA 3C3AA 3KBOA 4YRZA 2DHQA 3W4IA 5TVGA 4LC0A 5KNDH 1GYRA 1O3YA 4MAAA 3TBHA 5B4UA 4KVAA 2ZRMA 3LVQE 5FNZA 3BXPA 3TMAA 1E58A 1C3JA 3QFRA 2H0RA 2X0NA 2YIDA 2V7QD 4JJEA 4LYDA 4PIPA 4UTZA 2B1JA 2IPOA 3K0HA 4FHZA 3AV0B 1YS9A 1SUEA 1U2EA 1HEIA 2VKQA 3C7AA 1MIOB 3FPLA 3KPUA 2QZ9A 3QI2A 4JQCA 4CUJA 4EGSA 3H4VA 5MHTA 3WFZA 4BQEA 4NU5A 2GAAA 2V6IA 1IZZA 1FDRA 1T4CA 5HTOA 1V7QA 1ZC3A 4EUHA 4IQGA 1T6XA 3WOVA 4HP8A 4C0WA 4DZRA 4KR0A 5K05A 2CLSA 2DPGA 1W85A 1O58A 1ZXLA 3EBPA 2IZ7A 3SQMA 2YV1A 2CC2A 2V4ZA 3D1JA 3OOWA 3BSWA 1N5IA 2R86A 4JMPA 1LTQA 1MORA 2Y1LA 4MR8B 2OFOA 4MI6A 4WXHA 5L4LA 2VKTA 1AUOA 2W2KA 4XKJA 3CRQA 3WLQA 4DGSA 2J87A 1G17A 4W1PA 4F8EA 5JWOA 3DD5A 4XOIA 2ZUEA 1O4VA 1GN8A 1TK9A 5CYOA 4P34A 4B3DA 3FMOB 4KQMA 3ZWDA 4D9KA 3SYNA 1EAMA 4E0BA 4H7JA 4U2CA 5EA2A 2IYUA 4E88A 4R01A 1VCNA 2AW3A 4KW7A 4NAVA 4U00A 4KO4S 2AKYA 3PNVA 5K0NA 2ERYA 3O31A 1GCOA 3C5HA 3P2MA 4IV5A 4UOZA 5GZ3A 3GGCA 4E3ZA 3EF0A 3OI7A 4RKRA 2ZYIA 1OR8A 2IH4A 4BEBA 4FLEA 2CV1A 3UW3A 4HQRA 4F8JA 3OQOA 1ONBA 1BGWA 4JL5A 4DOMA 1EYZA 1DZIA 2C2YA 2K5UA 3AP3A 4RK7A 3W6UA 3HO6A 5B3LA 3PQ7A 4IF6A 3KXDA 2ATEA 2JI8A 2R1VA 4NONA 3SE0A 2J3DA 3GA5A 5D84A 2BR5A 5KTOA 3GLGE 2ZUSA 3WIVA 1WQ3A 2GAFA 4G84A 1EX1A 2G1PA 1C1DB 4IFBA 1LI4A 1WABA 1KDYA 3OIDA 3W5CA 4JJZA 2F8LA 5IDVA 1N34B 2QG9A 4XD2A 3SHTA 1JG4A 2QD2A 4OP2A 5A6SA 1KJIA 1L2TA 1SB8A 1OH5A 1Y0BA 4I8DA 3R8XA 3VAAA 3HXQA 1O87A 4AM8A 2HU2A 2J4CA 4XSHA 5KKAA 1GKKA 2NQ2C 1OLUB 1EEXB 5DULA 3EGIA 1KY2A 3MIZA 3U4DA 4QXMA 3ZIAD 1YU9A 4A73A 3EPJA 3SC2B 1T26A 3PEEA 1IIBA 2HO4A 1TMGE 1X77A 4FKZA 4TS9A 3D8RA 5ECWA 2CXNA 2UZIR 1R18A 2HZBA 1E1QA 1C9NA 3JRXA 4GOKA 3UAZA 2QN8A 1M74A 5CCEA 2QG4A 1AV6A 3HPQA 3K70B 1CERA 3E8XA 2ZEJA 1RI2A 4QUDA 2OQIA 3IBYA 1K0FA 2GR9A 1UBOS 2B78A 2WPNA 1O89A 4G24A 2H2WA 2PZKA 3TZHA 3HVJA 5E4YA 1N5MA 1P1JA 5LQAA 4U02A 4ON9A 2QYHA 3ZHCA 1HOXA 1O94A 1U1CA 2V58A 1KFKB 5JPCA 5J2UA 3CNHA 1RYMA 2AL7A 1Z4IA 5ELLA 3SVZA 1JHXA 4CIXA 4XTRA 1W75A 1NQWA 4M9CA 4RGVA 2I7XA 4L28A 4GU5A 3K8ZA 2OR3A 5EZQA 5K3FB 2BYTA 1XTUA 3BWXA 5L51A 4J07A 1Z4KA 4CDRA 3EPHA 4ZZ3A 3IAUA 1YZKA 4MWEA 2B9VA 3VNUA 1JTVA 1NJ2A 1O77A 4PG5A 2HLDA 2Z9DA 4H2DA 3SIXA 2ADFA 2XQFA 4KH0A 3V97A 4EY8A 3S2FA 1UJ6A 3DDSA 5C51B 1EJBA 1B6RA 3COSA 5B1IA 3ZTYA 4EL0A 5AW1A 1Z25A 3SIPA 5KNLA 3PJRA 4EKNB 4X5OA 1U02A 3A1NA 3U49A 3GJ4A 3RSSA 2XMBA 4MDFA 3THRA 2KBEA 4NZMA 1IY2A 4OB7A 5CA1F 2I22A 2Y6VA 3BD6A 5JS1A 3WE7A 1J99A 4CEJB 1AQLA 3USZA 3WMGA 3VA7A 2C3UA 2A30A 2FUG1 1MV5A 5A2GA 3BJIC 2HBYA 3HBAA 1RBYA 3IPCA 1IL0A 3O1HB 4R0VA 3SDBA 4YAGA 4TYYA 2GGSA 4RTKA 2JBAB 1IUNA 1AMNA 1E6LA 6ADHA 1UMDA 3U9TA 3LVBA 5EIFA 5IT0A 3F6PA 4DR7B 2ZYDA 3G2NA 1IEXA 1XDWA 2JRCA 4E2YA 3IURA 3HNRA 1E7QA 1NPTO 4UTRA 3MZ0A 3DOIA 3ISTA 1W581 5EP2A 4BO8A 1FZQA 3O3MB 5JAHA 1IN8A 1H4QA 2MT9A 2W42A 3F6RA 1RLUA 4I5EA 3J7AC 2Y9PB 1LPBB 3B78A 1TQ6A 4ND8A 1OFHA 4B79A 1GNVA 1RZ3A 3OPYB 2GKGA 2ZOSA 1N2IA 1WU8A 4HX5A 5DEIA 5SYNA 1E3LA 1M2WA 3KXKA 5LBUA 5T57A 2DKOA 3LQYA 1KH3A 2MR5A 4S1OA 4OA5A 3K0SA 2HT1A 2EKZA 3PUXA 1KU0A 1QQ7A 1Y89A 1JDJA 3UMSA 1IEVA 3PUYA 1FTNA 2G36A 1XBTA 4MUAA 4G97A 5EIBD 4H60A 2Q0QA 3GLKA 4ANFA 3U39A 1E2EA 3VDMA 1KDRA 4RF4A 2F2TA 2DUUA 2NUPA 4A2CA 1P7ZA 5IVKA 1K6MA 2IUTA 4MGEA 3EXHC 3LYHA 2FK8A 4N12A 3BA1A 2NV0A 1ABEA 3M5CA 3TQCA 4PLFA 2GDJA 3TDNA 3B5IA 3BFJA 3QJ5A 1XAGA 9MHTA 3LT2A 1LS6A 2WVAA 1RHKA 4XFKA 3UC9A 4CQLA 1EWQA 2W6QA 4R41A 4E13A 4F93B 2BTEA 1M5TA 5F9FA 1S9HA 4BFLA 2IIVA 3AO0B 1O9BA 1NJFA 3M4XA 1K27A 1E1KA 3E5MA 4JVNA 4L7QA 5D5PA 2X5OA 4JLOA 1AURA 5ESWA 2I03A 3VZPA 1P44A 2O19A 3P26A 3RPEA 3ZCUA 2B7CA 1TA4A 4B84A 5JD5A 3A2NA 1P0IA 1LRLA 4LHWA 1LLUA 3H9UA 4G1FA 4PNZA 4IDQA 1JBQA 4LFBB 4BFTA 2O2JA 5C7LO 1MW9X 2Y1DA 4PSAA 1MO4A 5JD4A 4FNAA 3AJAA 1XQWA 4RSHA 3QX7A 3HFGA 1RPTA 1QTIA 2AXNA 2FFAA 4QJIA 1I1OA 3AEZA 1N2BA 3TLXA 1IN1A 3PXUA 3TD6A 2WU4A 2XUKA 4Q4DA 3WXBA 5KEIA 2GCPA 2FMHA 4DTIA 3FDIA 5J4HA 2VXYA 2UV8A 1QJCA 1WNFA 2W0SA 3AR7A 3PCXA 3PQ4A 1CDOA 2VJLA 1NRJB 2YFYA 4FFRA 3W05A 4E46A 5A4IS 1DGQA 2CXSA 2I33A 3CT4A 3FNHA 5ALXA 1MU0A 1L4YA 2DXIA 3N53A 3ITNA 3D3WA 4G89A 4DCJA 4GT1A 1YQEA 5L7YA 1KMHB 2OYRA 4AQYB 1TK3A 1UQTA 4O4IA 4XJSA 1AKQA 3HCAA 1VP9A 2Z5VA 5DVZA 4OI2A 5E6UA 1VPVA 1QRAA 4B3GA 1AE1A 3U13A 3Q72A 1V39A 3V8MA 2D4AA 3JYHA 1ZU4A 3GPDG 4GX0A 4X60A 2DBVO 5F3DA 2IK8A 4AC9A 2DZDA 1Q22A 1GPMA 4XGRA 5T4HA 2YWHA 4DANA 1X14A 2HF7A 3CX8A 4QYSA 1PJAA 3LC7O 1QGAA 4WA7A 3ESDA 3RHFA 2V97A 4RL6A 3O9MA 3ES9A 4XUCA 3R9WA 1NQXA 3ICVA 5IMSA 3NB0A 3TI9A 4FIZA 4L16A 2AZTA 1X7ZA 2VHQA 3R0JA 4I4LA 4EMUA 4JJ7A 2QIPA 4HDAA 1FW6A 3LTEA 3INNA 3W2FA 1UPUA 5THXA 4HEQA 2PX4A 3IIMA 3C1AA 1LDBA 2BH2A 4TLMB 4EW2A 4IVRA 5BN1A 2OT3B 4OO3A 1P81A 1T8YA 3CW8X 4CR8A 1IY1A 1I2MA 5GONF 1TT5A 2D4HA 3LIIA 1C3VA 2JLSA 1SK9A 4IJUA 1E69A 1H4TA 2Z2XA 4JLMA 4O08A 5F2KA 5BWBA 4RPJA 4YLGA 2CYAA 4ZRNA 3AF5A 2PGLA 5A03A 5JR3A 3KTOA 3C14C 1JFFA 4B8YA 1Q3KA 1SUPA 1PJZA 1X7WB 1BKYA 3ETNA 5BR4A 5IWAB 1I3KA 1XKQA 1ZWKA 4GGOA 4MQLA 1NNLA 4JZYA 4NFSA 4GXRA 5JPDA 3QRWA 4N7JA 1O6BA 3KUCA 1ZGZA 1OASA 3ESQA 5E3HA 3P7MA 1C30B 2JIOA 3NFRA 4XYEA 3G17A 3PLAE 2GM3A 5AVYA 4TWBA 1L4KA 3IEPA 4I3GA 2DFVA 4OJYA 1FTGA 4QVKA 2FCAA 5CJJA 3WBJA 4YIHA 3TJMA 5HQ3B 2VPXA 1XRRA 2YW9A 4J0JA 4F7DA 3ZEAA 4WCDA 1AQUA 4RTSA 4LY9A 1JU9A 2IFTA 4Y2JA 1NJ1A 1CRLA 5CEEA 3RK4A 5A4MS 3NS7A 1W47A 2V45A 1H9CA 4OAQA 4MK4A 4FW8A 5T64A 4F4HA 3UFXA 3C7DB 2WVGA 4L7VA 1YKSA 1C9KA 1V71A 3KVOA 4N82A 2E4ZA 4WD3A 4UE6A 4C5BA 3ODGA 1QG0A 2QJOA 4E5MA 3BA6A 1GTSA 2W6IA 4BMXA 2QNIA 4BX8A 5GQSA 4MGKR 1G59A 4IFTA 1F7VA 4C2TA 3K0AA 2RAFA 3M5PA 4WI1A 1MF7A 4V0QA 1NAHA 5CDSA 5C37A 1QIHA 4DG5A 1NW3A 2VBIA 3FMFA 3DFMA 3R5FA 4C43A 4C7VA 3LTNC 3ZDCA 1JQ3A 1AQ6A 1R10A 2INGX 3A37A 3KDPA 3F3MA 2ST1A 2J8ZA 3D3QA 4LGVA 1DKPA 4S35A 1QM5A 4UUNA 3OQMA 4IQ8A 2C2WA 3T7TA 1DC7A 1N2ZA 1LSUA 4K6GA 5C8YA 4D6XA 3RU2A 3A36A 3EGDA 4C0KA 3U3KA 1A2QA 2I6QA 2GJKA 5DP1A 2MCFA 1GXSA 3DFIA 4H6PA 4TTPA 1XQYA 2BJWA 2GXSA 3IA7A 5B3JA 2FPGB 4F86A 4C4AA 5L4SA 1K8XB 4JC8A 2C94A 2AUMA 1E7YA 1KP2A 2I34A 1QHHB 2JPDA 2XYQA 2ZITA 3DKPA 3EZLA 4KE6A 4S0ZA 1NX6A 1F2VA 2P9QA 1DJPA 3QNUA 5A3VA 1X94A 2WF7A 4GC9A 3I05A 4E2XA 2V6JA 4FYHA 4DLYA 2HHJA 2Z09A 4GWKA 4NZNA 1V43A 4WFIA 5EZYB 3CG0A 4NZ9A 1TJ4A 4FCTA 4IDAA 5JRJA 2G17A 4UAGA 3GL9A 1UFRA 3QVGA 5BW6B 5DI3A 4QRHA 4E4YA 3SHWA 5KPJA 1A5ZA 4URVR 1H8ED 5JCZA 1ZMXA 1J5PA 3C24A 3L49A 3WL5A 4MRPA 2JLYA 4MV3A 4QNRA 4Z4QA 1DCMA 2EDAA 3RUFA 4NECA 3ROPA 1DU4A 4BO5A 2D7CA 5KVCA 1CEQA 2O8DB 2OGTA 1PUIA 3LHFA 5TGTA 3EZ2A 4GGMX 3NORA 4JU8A 2J3KA 5IBPA 3HI4A 1WPQA 3K4PA 2VR1A 3T7EA 3R5HA 3HUFA 4BGVA 1JG7A 1YRLA 2FAXA 4J16C 3UWMA 4EX6A 2D62A 4FI3F 1DFHA 4HNSA 1LX7A 1P2GA 3RJTA 4MMZB 3EYWA 1W0KA 4OIMA 4UBOA 1HE3A 4ROSA 4X3OA 4Q7LA 3OQ6A 4QPJC 5ALDA 2CHFA 2CXTA 5AM3A 3EJ6A 5M04A 4Q00A 4OMDA 5CFPA 4L73A 1ODTC 1XDZA 1U0RA 2GLTA 1D0SA 5BO5A 4XUGB 4QGFA 4M99A 3WYDA 3HMKA 4TOIA 1LY1A 4WNYA 4DAOA 3I12A 3LC2O 4IJQA 3K09A 3GJTA 2EF1A 3NBZC 4UEJA 5EUQB 4BGUA 1B1CA 4PCVA 2FPKA 3JVUA 3OM1A 5J1SB 3S8MA 2FW7A 4H27A 3PL1A 4LXYA 3KCQA 5LNK1 3I8SA 1J2JA 2FP4A 4Y6SA 1FUKA 2OHIA 4EG4A 1PDWA 1QK5A 4EYSA 1CUHA 3NDBB 4C7OA 3R76A 4P98A 3TW8B 1RE1A 2PX0A 5DHTA 1XCPA 3ILXA 4RYLA 3FM9A 5CG1A 5IHPA 1D1PA 1FPQA 3KKEA 2YXLA 3BL5A 2I4RA 4XQCA 4TMTA 1I32A 4FUTA 4EFKA 3FCXA 4DDMA 1JLHA 1P9WA 4J4HA 4Q4CA 4LZOA 1ZVQA 1DPGA 4ESEA 1KDTA 4NCKA 4RJJA 1CR0A 1A3CA 5HFAA 2VHZA 4YPFA 4BJ5A 3GPLA 4N18A 1SOWA 1Z4NA 2BBTA 2IA5A 2HLPA 1CE8B 4GH5A 2AFHB 1F20A 4M0LA 4IHKA 4PW0A 3IQDB 3AKZA 5D1NA 4CF6A 5M2QA 1KRXA 2AHOA 4LISA 4BX9A 2ZZKA 5HGXA 2IYYA 4TRJA 4COOA 2RHWA 2Z6VA 1BKSB 1NRWA 2V7PA 1JB1A 3D43A 3MJVA 3BRSA 3M89A 3IR6A 3NTQA 3OKFA 4HPWA 4MWTA 3URKA 2JEZA 5DBFA 5IJ9B 5GIPE 3N2KA 1RYEA 3OTIA 5AJZA 2XIQA 4ID3A 4JU9A 5MFZA 2F90A 1AN9A 2HJWA 3CH7A 2NZ8A 2YOGA 1S8AA 1KOLA 4YT2A 1QLJA 2OBXA 3K7EA 2VHYA 4R3WA 4JHXA 5HDQA 1YJ8A 4AN0A 5CCBA 2JAXA 1LLFA 2PD3A 3I5MA 3UANA 3W5AA 4JVMA 3CVOA 1OT3A 5AOCA 2XEDA 4OHZA 2X7HA 3WDKA 2GF2A 5JATA 3THXB 2Q0HA 4K03A 2XSZA 5DISB 3OF2A 3IUEA 1APBA 1JQDA 1X1DA 1Z2NX 1SNYA 5HEKA 2CVZA 2X9VA 4RK6A 5FXMA 1N9KA 4A27A 3JASA 4AIIA 6REQA 3V4PB 1OIVA 2VF8A 4N6NA 4OG2A 5FUYA 1GNLA 3INGA 5G02A 4A6PA 4YJDA 3EQ9A 2IYVA 3ZX4A 3UV6A 5I9LA 3WWZA 4ZV7A 5F2NA 2AR0A 1J42A 2G04A 3B1VA 1QANA 3SYTA 4KQXA 4HDMB 1KYVA 5C0OE 4M88A 2W6MA 1U90A 2ALJA 4C87A 4H1UA 3LV8A 4L07A 3LOQA 3FTPA 1TM1E 1CFZA 5GOZA 2ID4A 3GBVA 2P1RA 3PNYA 2VDVE 5I7RA 4O1MA 5A0VA 3DD1A 2BFFA 3NHSA 2WD8A 3O8BA 5GV7A 4HNUA 1G21B 2YMLA 3VPGA 1DQPA 3BM5A 3VKGA 1Q0UA 2HWXA 3DAYA 3DKKA 3LM8A 4I5DA 4BFUA 5ANRB 4YJGB 5KZMB 1FNDA 3SBEA 1EX7A 1FFHA 5DBGA 2EZUA 1JXAA 1PUXA 3C0KA 2ECQA 4KQCA 3RH0A 3WR5A 4ZQIA 3A9SA 3FBTA 4ZV4A 1XLVA 2A9OA 1Z22A 3GYBA 4KXWA 4Q1FA 3PXXA 4C04A 4JSRA 3W1VA 3G0HA 1UM9A 4N5DA 1B7GO 4I9UA 2C4TA 1JA0A 1R4NA 3I61A 3G02A 5EMNA 2EFJA 2IUSA 2VSFA 4KMRA 3L79A 4RXMA 4BGIA 1F4VA 2L0XA 1T6YA 1UAAA 2WHYA 3O9ZA 4Q3OA 1Z08A 3ZBUA 3ORRA 4GECA 1L3IA 5KYYA 1U7WA 3NHUA 1K5GA 1MOQA 5D5HA 1IJEA 1ZFNA 3IVCA 4NBTA 3TBKA 2VK2A 4F6CA 5TVKA 1R15A 1QO0D 2X8LA 3QBEA 2ADOA 4RX1A 5IF3A 5LYJF 1XWFA 2D2EA 2CLIB 3H1PA 3I0ZA 1W36B 3WQHA 1I51A 1XD9A 2Q8QA 2XQGA 5JQWA 4DMUB 3PR1A 2FEMA 4QQKA 4RMIA 3ZOKA 2OCAA 2FF5A 2MSDB 4N8DA 1U9ZA 4FDLA 4WBXC 2JFVA 4R9RA 2P68A 1WNTA 2FSIA 1Z33A 1HYQA 3PDIB 4TUYF 3K1AB 5KAPA 3UQYS 1QYWA 2GFQA 4I4TF 1IXYA 5JD3A 1JIXA 4ZCQA 2DH6A 1KI3A 3TPZA 1QYRA 5CH3A 3FCAA 4IVPA 5A6VA 3UUFA 4H9GA 2JFYA 4KWTA 4JB2A 4E5SA 3E5HA 1XKXA 4GXNA 4M7RA 4RNCA 4CF4A 3SYLA 4MR9A 3HRKA 2BFDA 1SKYB 3QBJA 1M2NA 2YJNA 1EUQA 3JWIA 1FFCA 3HM2A 1GGMA 1RABA 3I72A 3PT9A 1TLLA 5EKUA 3SFVA 5LJLA 3IUYA 2HQRA 4TLEA 1OFGA 2O8VA 2HPHA 3IHTA 4KLNA 4MUFA 3QVJA 3HN2A 3JWPA 4R51A 1DHTA 1L5YA 1LK7A 2NO5A 5TNXA 3H0KA 4A23A 1P75A 2N3ZA 3FHLA 2DTDA 1Q1QA 1E0AA 4J90A 1W4RA 1CY7A 4FDTA 5F4BA 3RK0A 4BDTA 5ADWA 1WMEA 2GBIA 4CTOA 1NUTA 3W77A 4ZVSA 2O5VA 3G68A 1O9HA 1L7VC 2J3IA 3O8OB 5DO9A 4XEHA 2QAGC 4H7IA 1D2CA 4R7GA 1WETA 3ZDRA 4ZVMA 3AM4A 3ECSA 3ZH2A 2PQ0A 4TRMA 1IWOA 3UGJA 1E6EA 4BNUA 1PNQA 5LQRA 1JG1A 1NJSA 2A94A 1VL8A 1WSWA 1SIWA 2EDCA 3TW6A 3T5DA 1J2RA 3EVCA 4MPJA 5IJXA 3QWHA 3LP6A 3M2TA 5EMJA 1Q0ZA 2AQHA 2P6PA 2R25B 2DY1A 2F48A 3MNFA 2K2QB 3CCBA 1XK6A 2PZGA 1VA5A 2C4MA 4NS4A 3I4FA 2H9IA 4BNVA 2ZS9A 4UXHA 4IFIA 2ZCVA 4ARUA 4HB0A 1WBJB 1RZUA 4FT2A 2HKIA 3UXHA 1Y1KE 5K3SA 4KDFA 1IBSA 2B4YA 2PMEA 4H0CA 3LUDA 5AI0A 5H81A 3M1AA 1G3QA 2QD3A 4S1PA 2P30A 3HFJA 1CUVA 1W44A 5H68A 3X1ZA 2ODTX 4CM9A 4YASA 3UBMA 3FZYA 4OQZA 5H3HA 1G6Q1 2HRZA 5JC1A 5LR6A 1A9ZA 1EDEA 2P9CA 2OO5A 2QQ0A 3HB1A 4O4LF 2OD7A 1K3UB 4U39A 3SR0A 3TX2A 4QM6A 3I23A 3LGSA 1N9ZA 1OFUA 2QAJA 3NANA 3D7SA 1GDTA 5JJCA 2ZAMA 1JLMA 5HZGA 1NDUA 1WZNA 3WBFA 3NHZA 4DWWA 1JSXA 1NI5A 4W4TA 1LU9A 4NFYA 4DCCA 1Y80A 1S6YA 1WIWA 1HLFA 5TPWB 4KNYA 1RWBA 2FX2A 2H85A 3UMCA 2GKSA 2ZRNA 3ER6A 4OBEA 3F6YA 3ZV7A 2WAAA 1KO4A 2WMYA 4I0WB 3BL6A 3R7NA 4H6XA 1QVZA 1RAFA 4YGXB 4CI9A 1W19A 1MCZA 3D1VA 4A03A 4DM7A 5DX8A 1IXRC 2G9UA 4MRMB 3GRAA 4UHEA 4DCPA 3AHJA 1A7KA 3P20A 3D9QX 4WESA 4IIJB 3VGPA 1OI3A 3FPCA 5LXTF 4GR9A 1Z2DA 5K4HA 3JQAA 1BFKA 1FMJA 1J23A 2A0YA 4OHRA 2BEVA 3LWNA 4UMFA 3CG4A 2IHJA 3QU9A 3UGKA 4UPEA 1F0KA 2V9PA 3C70A 2QN6A 1XO1A 2PN1A 3FGNA 2FFQA 1P0CA 2JFOA 3L7AA 3PC2A 3WFJA 3IIEA 2GYVA 3NGMA 2QG6A 2MYPA 3PGLA 5TJ9A 2QTTA 2XYHA 1SUAA 3KJIA 1AKUA 2D8AA 3KRTA 4WZAA 5FNVF 3R7WA 2WZDA 3VV3A 5KVQA 3TLEA 2ZRHA 2I7VA 3AEQA 4PZ0A 1RLJA 4E6EA 1UDRA 4Q66C 4O2BF 1H2HA 1Z4JA 3I04A 2E5FA 4J4TA 5K3BA 1CUXA 5KOJA 1PSWA 3HB9A 4X66B 1VHWA 4MB2A 4B2YA 3C3EA 1DI0A 1XEXA 2QI9F 2WFLA 3KYJB 2FMIA 2FXIA 3L82B 4LIPD 5LZ4A 3BF7A 1CRWG 1II8A 4MJ3A 3VR5A 4GM4A 1E2DA 1PJSA 2Q9AA 3NW9A 4GZ3A 3ITKA 1P2TA 4WJLA 1QH0A 3BEDA 3UFBA 4DNFA 1YA6A 1VMIA 2DQ4A 2PPLA 1TF7A 4U7JA 2O3QA 1YR1A 5DCYA 3T38A 1LNSA 4HQNA 2X0FA 1YR3A 2PGDA 3D8SA 2FDRA 5BR7A 5ICGA 1EK6A 3OCJA 2JCVA 2F8MA 4OP1A 4EHIA 2J9FB 2O6LA 2QVBA 4RPGA 3ISVA 1AK1A 1XTVA 3GR6A 5IAGA 4MQBA 3IEMA 1B76A 2CJWA 3TGLA 3EVFA 2GPSA 3OIFA 4PHCA 1KWKA 2W7TA 4R1SA 3U4CA 1L6IA 3L6OO 4EFLA 2N75A 3H99A 2Q5OA 2C92A 4GI5A 3KO8A 5HK8A 2A84A 4F4UA 4CUZA 5CB6A 1ODIA 4HFRA 5BQ3A 4TS3A 2NM0A 1B0AA 4ZU6X 2NU9B 3O93A 4OUDA 1H65A 2W6CX 4QDZA 4L5JA 5AKIA 4H4EA 2IQ5A 3PQFA 4RKWA 1I2ZA 1J8DA 2XGMA 1H8HD 1P5ZB 4JBGA 4NNOA 1M3SA 2I4NA 4OM7A 5A9RA 4D46A 3R5SA 1GQ2A 1PJLA 1QH9A 3PUHA 3ETJA 3JPWA 2P9BA 1CC1S 3P9YA 4J0FA 4MW6A 3K9QO 5E6RA 1RQLA 2X42A 1J25A 1K9VF 2FJ0A 8OHMA 4BXOB 4FEGA 5KYWA 3QUSA 2VRWA 2CWDA 3IT1A 1H2YA 4JA2A 4PLWA 3W9BA 1A9QA 1XMOB 1JEQA 2WOJA 4JKYA 3SX4A 1HT0A 3O8DA 2VXCA 3NHJA 4CRWB 1IBMB 1QU2A 1P0FA 4XASA 2COKA 3RAFC 2YHUA 4L5BA 4MQMA 5DN6D 4TL8A 2GX6A 3HDTA 2ZI9A 1N6LA 2AFHE 1S96A 4KLZA 2JB9A 3QPAA 4H7FA 4M6WB 4WIAA 3PVSA 3ZLBA 2NXNA 4ER5A 1AQIA 4QBGB 1WV1A 1SUBA 3MYRA 4JVOA 3UXEA 1BYIA 4YYEA 5TQ2A 4G41A 5FTMA 2YHAA 1LX6A 1TZCA 3T3NA 1JW9B 4AP5A 5JQGB 5JSYA 1D2EA 1BVHA 3OZBA 2GWHA 2C59A 1NN3A 1RQ2A 3CO0S 4ISBA 4MPPA 5D7NA 5PGMA 5FOVA 1F5SA 1NWHA 1XCLA 1G5IA 1DTEA 3SM9A 1CEXA 3EGCA 1AGPA 4MQUA 3TG2A 2X2EA 2GJ9A 2RH8A 1V11B 3GRYA 5CVUA 4J0CA 4ZICA 1VE9A 3CB4A 3OPMA 3MT7A 1MJNA 3M6XA 4K5QA 1W87A 2V3CC 3JVEA 4WBSA 3MTIA 4Z49A 1UBGA 1USIA 3ME5A 4X1YA 1KTIA 1BQ4A 2PA3A 3DE4X 4S05A 4IKPA 2LGJA 5ITZB 3ROFA 5A06A 3MGBA 4MWGA 5HJ7A 4MIKA 2HK8A 3M6MD 4PLGA 3YASA 1VI5A 1J2YA 1EE9A 4M38A 2ETVA 3R5JA 1F14A 1X0VA 1I1NA 4Q7QA 3OT5A 3NNDA 5DMXA 5C7IO 5KYXA 2EZTA 3IAFA 2AFIB 3V55A 1KI4A 3K5WA 4PINA 2DPMA 4QE3A 1Q0QA 4I4IA 2HEGA 3EWIA 2KQUA 4Q24A 4XI9A 1NVMB 1BGXT 1E5DA 2JANA 4LYAA 3JU3A 1PR5A 3EQ8A 4YB8A 4KCGA 3ZWVA 1HC7A 2ASVA 3M83A 4DLRA 1PEYA 1UFOA 2PSEA 2I2WA 4FGUA 2NZYA 2NUTB 5FBWB 1XF1A 1G21E 4JXJA 3O4FA 3KV3O 3PQ3A 4F3TA 1YIOA 4HF7A 2PBZA 4BQPA 4BO2A 1AF4A 1CR4A 5FFNA 4B1FA 5ICMA 1XZCA 3X43A 1S2LA 4I14A 3AM5A 4RANA 1SBHA 2YVLA 2HA0A 3R2JA 4BNJA 1ULAA 4JIMA 3KOYA 3BN3A 3S40A 4BNKA 3EXEB 4E1AA 4ITUA 2WAYA 1JHZA 3KETA 1YHNA 1WLYA 1OX6A 5FA6A 2J4DA 3R9XB 4WNAB 1PZMA 4ALLA 1LLQA 2DKFA 3DL2A 2PD4A 3NPAA 3ZU6A 1GQOA 3DV2A 4IJKA 1PNTA 4D74A 4TVOA 5LIPA 4HPJB 2AFVA 2YWRA 5CFMA 2BLNA 2IVZA 1RHRA 2JHFA 2CUZA 3RVDA 1QAQA 2BF7A 2NQ8A 1SD5A 3AXTA 3KUDA 4D44A 3E1GA 4YJ3A 5K4AA 2B2CA 3KKKA 1NAIA 2C96A 4RCVA 4PWZA 2NVWA 3D2AA 2AH5A 2ZATA 3G23A 4C7MA 3IOEA 3L7OA 4KBYA 1M0EA 5FWNA 4P3KA 4JYAB 2OKGA 5EXSA 4KYTA 1WMAA 1KARA 3RUPA 3UT6A 4DREA 4J8PA 3GUZA 4KQ9A 3FYUC 3G5LA 2G9NA 2FUCA 3TJZA 2OGWA 4QZVA 1B3BA 1NP7A 1YUNA 1C7IA 3QMWA 4JR2A 1DEKA 2YW2A 3REQA 3CJQA 1MJGM 1ULSA 1E9AA 1W96A 4I1SA 4UU0A 2NAPA 2R96A 3FG9A 5NULA 4KNVA 5E4TA 5BP7A 5JTUA 1NXWA 2WG2A 2CXRA 2DBYA 3QENA 5FBQB 3RTGA 3P71T 4F6RB 2J3EA 2P6NA 2XA9A 1Q7CA 4E94A 2IX3A 1XDDA 2EFYA 3KPYA 3LA8A 4TV9B 2XIJA 5JZOA 1ZH8A 2QL7A 2FFJA 5CP8A 4Z3OA 1DB3A 4DGQA 2IUUA 2VHVA 2ONZA 3EFOA 3LZ6A 2XB8A 4M83A 2VF2A 2BELA 2WG1A 2ZE8A 2E82A 1KSGA 5EE3A 4D3SA 4DZTA 4XWOA 3JQGB 5I9SA 1UBSB 4YMTA 3M9WA 4NDZA 2I78A 5AKXA 5E0KB 4JGIA 3PNSA 4YV7A 2GCOA 4WKPA 1KC3A 4MUIA 1YQTA 4B4OA 4KMMA 3DT6A 1MGPA 4L9SA 4IIYA 4J0KA 3ZGXA 1T5HX 4IZIA 3LKDA 4ER6A 2PKWA 4PG8A 1PD1A 1XU9A 3IVRA 3AR9A 1A9YA 3C3BA 1NBMA 3BBPA 4RHXA 4Z3KA 3GMTA 3HE3A 3FUTA 2DR2A 821PA 1RTKA 3SLKA 1L5WA 3VYRB 1BX1A 2R6HA 4NSNA 1SOVA 1Z0AA 3H0EA 4R9SA 4BY9E 4EHAA 1OH7A 3PXBA 3R9KA 3LH5A 2YC4C 1C8LA 1TJ5A 1CWUA 1S2DA 2I66A 2Q6LA 2X3UA 2H65A 3HB4X 2REQB 2FRDA 2PO5A 4ADSG 4CW7A 1R0RE 2N46A 1GCGA 5KTRA 1E1CA 1XDSA 3SM3A 4LJ9A 2ZRGA 5CA1B 2Y3IA 3ZG6A 4H1HA 1PYOA 1I2DA 3K8QA 3N6XA 3WICA 5CCXA 2RONA 4NJOA 2P27A 4KVFA 4C4OA 3ON5A 3JYPA 3H87A 2J3LA 1EUDB 1E4YA 2ZDHA 1COWA 2ZU0C 4Q37A 2AMYA 2UYGA 3KTAA 4NYMR 4PHTA 1C0KA 2J45A 4IIUA 2FN9A 3C16C 1ZQ1A 3EIXA 4W6ZA 4Y2PA 4B0OA 5K5EA 3F1KA 1ZOLA 3TLJA 4KO8A 1CS0A 5ER6A 4H7HA 2AK2A 1YMQA 1R8XA 2FEAA 1DRJA 1BXRB 5TLSA 1KQGA 1HE4A 4PS0A 3NIBA 3DTVB 4JK3A 3T5BA 1KS2A 2ZJZA 3HG7A 4CWAA 1VJGA 5JO0A 3KJXA 4X9XA 5LQUA 2RD2A 4Y6QA 3U4QA 3IL2A 5EJ7A 2DFDA 3GFSA 3LRXA 4Y2HA 1D6NA 5TQ0A 2ORED 1R9NA 1MIHA 1KEEB 4LI3X 3PR3A 1CP2A 4GOXA 3L4BC 2QMUA 4M9RA 5EMHA 1YUMA 1QYDA 2ZUCA 3ANXA 3PI6A 5I5EA 1SCQA 1BXZA 1UXIA 3F6EX 3OSZA 4W99A 5HTKA 5LQJA 1DXYA 1T5TA 5FQOA 3ZV4A 2HPVA 1OYWA 4FGWA 1TD9A 4MS3A 1N0VC 4L2IA 4QYWA 1C0EA 2V7GA 4MUBA 3FCCA 1E4EB 1O4WA 3NTOA 1PGOA 3R6TA 1U5AA 2Q6IA 3TH5A 1KZ1A 3SHVA 4XIYA 1OXMA 3S0JA 1Q2XA 1YJAA 3W1WA 2VJOA 4ZKDA 1TM7E 3IQFA 2ZDQA 3G1WA 4CGZA 5I7SA 2O8EA 3G2HA 5F3RA 3U31A 2BP7B 1T15A 1OAAA 1U0TA 1IQPA 3ANNA 4JQZA 4U9IS 1R6AA 1WOYA 2ZYUX 3PQ8A 4KPUA 4UBIA 5D5QA 1BROA 2UUPA 3IAS6 4BTLA 2TS1A 3HDVA 3B1FA 4NNPA 3BWMA 1YV9A 3UCXA 1DBIA 2GUWA 4BMOB 4CODB 1A98A 2H1OA 3MLBA 1NYLA 1D0IA 2YKGA 4DA8A 5KJ1A 4L8GA 4JLBA 1A95A 1RR6A 4NG5A 4YK7A 2C7GA 3I6YA 2P3OA 4F2GA 2EL9A 4RK0A 3K0CC 1EXDA 1YJCA 4QBTA 4KFRA 1TA9A 3F6BX 4MVJD 4N0QA 1SM4A 1GFZA 2I8AA 3HP7A 3O9VA 5H4GA 2DM6A 2IIPA 4TS4A 2QE7A 1K7EB 4DLBA 5JSHA 1C0LA 2Y2UA 4TV8A 3FKSD 4QXOA 3GPIA 1YR9A 3CUVA 2O2XA 3A04A 3HVHA 3S2EA 2FZCA 1B00A 2D59A 3ZEIA 4GYWA 5JALA 2MDTA 2V7BA 3C39A 5CB8A 1Q0LA 3N0TA 3LQRA 2W2NA 3ED5A 4XH9B 1XN4A 3PXDA 1FFWA 1VDZA 3ET5A 1JU4A 1QYXA 1T0HB 1VCIA 4C3ZA 3FTEA 3NUZA 3K4QA 3T9CA 1J56A 2PLFA 1I6MA 1Z62A 4KN6A 2ZPTX 3H04A 2A9VA 4RWEA 2R97A 1R37A 5FIUA 4AUMA 2IEYA 1G18A 5KQSA 3H6GA 2JLQA 3QE3A 4FFBA 3WTBA 3JCZA 1GPJA 1LH0A 1VMKA 2EP5A 1UIMA 1SHJA 3N8DA 4O59O 3NVDA 2A9PA 4OA8A 1VL1A 3UWOA 4CQMB 4G67A 3W9SA 2EEPA 3CPJB 3CNOA 3ZI0A 2GZAA 3U40A 2R7LA 1OBVA 5HM8A 3KYIB 3NTUA 4OK6A 3RVSA 2IY8A 2MTBA 4L5AA 1XRQA 1XWWA 4BFXA 5B2EA 2XCRB 4ZHSA 4I1VA 2H1SA 3FDZA 4YP5A 1T3TA 4I4NA 4WMLA 3FTQA 1P7PA 3DWIA 1YI0A 3HXPA 4CM1A 3ZXXA 5K3AA 4P6VF 4EB6A 1OWOA 4GWLA 1H2AS 2X1HA 1HE5A 2UVPA 3IOBA 3I09A 4MA4A 3OPVA 5BOSB 5BUQA 3RS5A 4R8MA 5K8TA 2PG3A 2AZXA 3E8MA 1DSSG 4IP0A 1GUDA 2SCUB 2PLNA 2NZWA 3IALA 4R2IA 5COQA 4DCGA 1B26A 1Z7EA 2BPOA 2QSZA 4F56A 3H1TA 2FSSA 4DCUA 4MVJM 1T9AA 1ZLYA 2P0AA 4NBNA 3USCS 3NDIA 4L57A 3PYXA 4AX8A 5DM60 1X87A 2PUBA 3EXIB 1MA0A 3AHEA 2HB6A 1IMJA 2JD0A 4MARA 4R1NA 3NUQA 5JADA 2FJUA 5DZSA 2BRUC 1NW8A 1V95A 1UKBA 1Q17A 2WZQA 2EJTA 1XXHA 2D0IA 2XD9A 2ZAYA 3I9OA 3I6MA 3WMRA 3X1KA 5GJBA 1SVUA 4BBJA 5CU7A 1DBWA 5CJPA 2CDRA 3ZY5A 1PU2A 1BIFA 3M4ZA 1XEAA 1QB8A 3OLCX 4GNKA 1NQ5A 2PO7A 3P0RA 5FL7A 3FZNA 2MWMA 4L9RA 3SHFA 4LC9A 2YMPA 3G9TA 4F1KA 4XM2A 2JJQA 1QC5B 4MW1A 2L19A 2O8BB 4B74A 2VRCA 1CEYA 4QPZA 1UBEA 1SRQA 2VK4A 3LUHA 5J2TF 1MAVA 2OZPA 5EEGA 4DADA 1T9CA 1BXGB 2OHFA 3LPLA 5I9NA 4KIJA 2A0KA 5CAEB 4EF5A 1YR6A 3CU5A 2OBLA 4DVGA 1YMUA 1X7YA 3D6TB 5E2AA 4Q9LA 3WV4A 3EVTA 2O0KA 3AZQA 4U0JA 4G5GA 5DNDA 3VC3A 5AVZA 2C97A 4CM4B 2JGEA 1CJVC 2O2YA 4KITB 1U2RA 1JEDA 4A6DA 2ZREA 3AGPA 3HGMA 1HT2E 3SIWA 1A4IA 1GKIA 2EARA 3OQVA 3W78A 4BMYA 2F62A 4DIBA 1PEAA 5KDLA 3F74A 3EBOA 4CV2A 4N6OA 4ILKA 1T9HA 2LWIA 4BLVA 5EUBA 3Q9UA 1BTOA 1FYEA 2VN8A 5GINE 2E5LB 1TE2A 4DKJA 5CXUA 3QY0A 1IJFA 3GJYA 1XDGA 1HQDA 3FUUA 3MWJA 1X8XA 4IIBA 5HIIA 1FNMA 3GJ5A 4XFDA 2B4QA 3WB9A 1E6WA 4MVWA 1GGJA 1SHKA 4EH1A 4HZUB 1UKYA 1LK5A 1USUA 5LQNA 3T6KA 5CDTA 3NKFA 1JDTA 3TTTA 2AHRA 1W59A 2JIQA 1H0HA 3A70A 4D82A 2HCJB 4CLDA 4JUBA 1UUFA 2OHOA 3O03A 6LDHA 1L5ZA 3IESA 5DM1A 5DU2A 4EB8A 2DT5A 5IM4A 3KQUA 3JQ6A 4UM5A 4IW3B 3VBCA 1TEXA 3Q6MA 2APJA 3LBNA 1WUKS 1YR7A 1I0IA 4BLQA 2BAGA 2FMXA 2HIMA 2QPAA 1Y3DE 2YN4A 1DX6A 1HH4A 3I32A 3PXCX 5HKAA 4MRSA 5FUBA 4FE7A 4PAGA 1T8TA 2F3TA 3LBYA 1CY6A 2BBOA 3NFYA 1SA0A 3NHAA 4MGYR 4YP0A 1H85A 4P81A 1Z82A 4YMLA 3PUVA 1L5HA 3REGA 3VX4A 2BI7A 1WBDA 2ZBFA 3ROMA 4HAZA 3TRIA 1EWYA 3P2KA 4ZU3A 4OFWA 4F4FA 1ZSVA 5HIMA 3FW1A 3K6SB 4AKHA 4PCUA 3LKVA 1J1ZA 4BJ6A 1ZLXA 4GAEA 4CIDA 1JPJA 2XUDA 3MINB 2DMRA 2O8FA 1THMA 2JASA 3T41A 3ULKA 4UQOA 4Q7JB 1RAHA 4YN3A 4AULA 5M34A 1X7XB 4AICA 1FVHA 3NO4A 5JU6A 3RVNA 1QKKA 1HDYA 3BIOA 2PCLA 2Q5FA 3E8SA 1GU7A 3IQXA 4FE3A 4GLOA 5ERYA 1E2NA 1U28C 5IEBA 1UOPA 4DE5A 2OXEA 4A9AA 1N5LA 3AJEA 3KXLA 5IC4A 1P74A 3HS3A 4YJ2F 3E58A 1B8NA 2BMAA 2IUYA 1ZIDA 1JQLB 4MQFB 4QDJA 3BICA 5DHUA 2IYWA 1P4GA 1XTIA 2YHIA 1RQ7A 4KNWA 1D7OA 4C0HA 2YZMA 2WWFA 4XCXA 4BVAA 4K6KA 1POWA 2QRKA 3H2JA 2F43A 5D01A 4NFHA 1ULBA 2P62A 5G0WA 1YIDA 3FR7A 4TN5A 2J0VA 3RM3A 1E2BA 3ASYA 4WJKB 2JAQA 1M1YA 2QVGA 4L0DA 2FRXA 1JPUA 4EITA 3U61B 3EE6A 3LXMA 3L4EA 1IOWA 1IY0A 2F1KA 3QEKA 4NS1A 4RVGA 3TZQA 5DNUA 5JIBA 4MVJG 4PN7A 2AN1A 2AG8A 2O1XA 4L4RA 1DAMA 4P9NA 5JC8A 3FMVA 2WJIA 1E1QD 1JMVA 4TZTA 5JO9A 1FMLA 3UWKA 1E18A 3P9ZA 3HJRA 1LSJA 4CU2A 4F2PA 1TOAA 4QLAA 4F3NA 3K5PA 4EY7A 2BISA 2QL6A 2PL5A 3BCRA 1WVGA 3JARA 4KV7A 1N7JA 4ZXPA 3V1NA 2ARKA 3LVRE 4EYGA 1U1IA 2BI4A 5DGIA 3TQFA 5B12A 3C43A 3B6IA 1O94D 4W5QA 2A5DA 4B6SA 1GWNA 1O6CA 1W5FA 1GU1A 2GN6A 1SCAA 3T3IA 4NCJA 1XZKA 3ZV5A 3ORYA 5B30A 3UXYA 4RW0A 2PSHA 3PZRA 1M6NA 1T1GA 1Y9EA 3QE9Y 3KG2A 1FJXA 2RK3A 3EWSA 1BX3A 1BU8A 3VAZA 4RV4A 2P6UA 4HRAA 3EN0A 4V0KA 3SHOA 1ZH0A 1EP9A 1LTHR 1DBSA 2Z08A 2GK7A 3U48A 2YH2A 3NP9A 2EJVA 2LIPA 1KH1A 3TLYA 3RREA 1V1RB 4IJ6A 3UWPA 2EYQA 2HADA 1PV2A 2XQJA 1VCHA 4LMBA 5F4ZA 4RLSA 1ZJ4A 3VR6H 1UANA 1PGNA 3OF3A 3PJDA 1SCIA 1UMCB 4DEVA 3DHEA 1BEUB 3QNMA 2F4VB 3L5KA 4QFBA 1EBBA 2NO1A 5JVDF 5AO9A 2IPXA 3C6ZA 3SNHA 2D1SA 2ODWA 4YWHA 3QNWA 2WJVA 2RHGB 3LPDA 1B93A 2BZ1A 5G4LA 1VBFA 3PHBE 4NBVA 4NOLA 4ZA2A 4PC6A 1KAEA 2XVAA 3F7OA 1P4RA 1K92A 3R7BA 1JKJA 1U6IA 4TWIA 2LUOA 4RK4A 3VPBA 1SG0A 1UPTA 1A8SA 4TLBA 5AVXA 5ITVA 3R20A 1T2DA 3HCRA 2H92A 5KTMA 1NN1A 3GN1A 4OXRA 1FBTA 4RPCA 2QTNA 4J29A 4DLUA 5TEVA 2DJ5A 2BFEB 2OWEA 3BMCB 2JARA 3L9WA 3VSAA 1QVAA 2DHCA 3FFBA 3NEYA 4Y2TA 3TQQA 4D0NA 5MFPA 2QORA 3WGYA 2A9JA 4QG7A 3FOAA 2OTCA 1FEZA 1BCRA 1MRSA 1KJQA 1Y42X 5LSAA 4DIFA 1RPZA 2CE2X 1TZ2A 3BMNA 1V3UA 2CXOA 4EJFA 1YOVA 3HVKA 4MW7A 4PYQA 1I7PA 1W30A 1Y4UA 1Z5UA 3W90A 4EA6A 4D9NA 2XW6A 3BXXA 1F3OA 3R6LA 3KVYA 1OLSB 1LV7A 2PNFA 1RACA 4LKRA 1V2HE 1KVUA 3BGIA 5AI9A 1TT7A 4HWKA 4B35A 4CG1A 1RP7A 2GMWA 4MRNA 4N6GA 1WJGA 2HDHA 4UTNA 4OHUA 1E94E 2W37A 1ZMRA 1E0SA 5MN6A 3N3AC 4OHXA 2QLFA 4H17A 4JP8A 4R1QA 1IN4A 1B6GA 4TMXA 5CIQA 3C6XA 2CLEB 3OUZA 5DKFA 5CFOA 1VSBA 3HO1A 3D3KA 1V6SA 3IP1A 3IMCA 4UM8B 5E9WA 5CLQA 5A5DA 1ODFA 1PL6A 4KPEC 1KHHA 4TWJA 1JSLA 5EOVA 5LWQA 1MUUA 1JFTA 1K06A 2V6MA 3O4JA 4C7BA 4ZJZA 4UUMA 1XNQB 1EFHA 1PL0A 5CNJA 5KC9A 1GLNA 3X44A 1ZAKA 3W8RA 2OV8A 2HA6A 3OQBA 2NU8A 1W4CA 4OHBA 3A4MA 3R7DA 2V7EA 3MWEA 2XY4A 1PR2A 3CUSA 1UC8A 3CIOA 1JNXX 2AJCA 3S1AA 1AHHA 4GMDA 4I50A 4XB6B 4PQYA 4F4JA 2REBA 3R5TA 1WZIA 2Q50A 2N1BA 3CURA 1NZDA 2I55A 1B4DA 2CDBA 4G07A 3B1JA 5D6OA 5IASA 5JLJA 5K3EA 5IT9A 1I4OA 4GDFA 4YLYA 1M1UA 4Z8XA 4Z4CA 2OVFA 1XLTA 1R5NA 2EKBA 3P4XA 2C78A 2R4TA 2QVXX 4PIVA 3ANLA 2X9NA 3WZMA 5IF9A 1J07A 2Q9UA 2VP3A 4YUVA 3AR5A 4FJ1A 4CCAA 5K6RA 1BCSA 1UPXA 4PC2A 2QTVA 2Y1KA 4FS8A 5DHSA 4MMXB 5P8WA 5I3ZA 1L5SA 1P7CA 2YHSA 2YQZA 5ALEA 1AQJA 3HKEA 1B8VA 3C5CA 3RVBA 3ELDA 3ZW8A 3GAFA 4UVEA 2ZBDA 2QR2A 4DLNA 4QHYA 2HCBA 3KJHA 5U1PA 1BDBA 1ZJ6A 4BNGA 4MUMA 4PU0A 1E3WA 5HXAA 3SQDA 1A2OA 4Q1CA 2WC1A 4X7MA 4HC4A 4IX1A 4PSKA 3RAPR 1SZCA 2R4UA 2XOKA 1YFLA 2QRZA 1QMPA 1SU6A 1P1HA 2AB0A 4X64B 4LNUB 5JI2E 4W8HA 4EPTA 1JF8A 5BWOA 5JDIA 3PR2B 4BECA 4EPVA 5KTYA 3LK7A 4B34A 3KAJA 3GELA 2RIPA 2YUIA 5EYPA 2O8BA 4R69A 3MJRA 1KYZA 1VZ2A 4C0SA 2AG6A 2OLEA 1LPPA 2VHCA 3IEXA 4NH4A 5FJIA 3WIUA 1AA9A 1MC4A 2B30A 5KIAA 2NW6A 1EDDA 2V54A 4BN5A 1NUAA 1MEEA 2E4WA 1YB4A 3CRNA 4IDFA 4Z2AA 1GCUA 5FOQA 1Z4PX 3M82A 5KJCA 4MVCA 2NVUA 2NXWA 2P2YA 2PJZA 1DV2A 1D4FA 1UWLA 2EBUA 4R84A 5ILGA 2W2TA 3BSYA 3TCNA 2RSLA 3ZGOA 4Z0NA 2X0KA 4LZZA 4QU9A 3I92A 5HIJA 1A9SA 2G08A 4Q4JA 1EFCA 1B74A 2J67A 3FJOA 4JSYA 4RHCA 1HDOA 3JYQA 3SYMA 3L7KA 5DK4A 4Z9BA 1BGVA 4N5LA 1B8PA 4R8VA 4UMVA 1HL3A 1BMQA 3Q7EA 3MJDA 2WKPA 4G1EB 4YS6A 1ODCA 4JLDA 4ZTBA 2ZI3A 2VP6A 3TX6A 1IPFA 4BX0A 2ZE5A 1Q6ZA 2R7MA 5ADUS 3O0TA 4G4SP 4PYMA 4EMTA 5BNFA 1UBKS 1G8HA 1R8QA 1YBHA 2ZWIA 1Z6QA 1KH2A 2A6PA 2Q3FA 3GI1A 4O4LB 4ZOLA 4DF3A 4XFJA 1KXJA 3OC0A 7GPBA 1SEPA 4EAAA 3OZVA 3SF8B 2IW1A 1N7HA 3ZV6A 4D7AA 3HFSA 4M1YA 3E70C 4I3HA 2GCGA 4EJ0A 3ESYA 4PQEA 2Z6QA 2WE8A 3HA3A 1OWLA 4LXIA 2HU8A 2XMQA 3JAKB 2CXHA 3KDSE 2XOEA 1L7QA 2P2ZA 3HVIA 3KLNA 3MTAA 1T0PA 1VA4A 4B85A 5BQXA 3W6NA 4ZT7A 2PTGA 3EZNA 3KOWA 4Y1RA 1B0PA 2BEWA 2FG6C 2PX8A 4UBKA 3RB8A 5ESXA 2PLAA 3K70C 4A2PA 3L77A 2CSUA 5FUMA 1V48A 3GZNA 1ZJZA 3Q5DA 2EVWX 2IDKA 2W6ID 4YEDA 1NYRA 3L0PA 4I55A 3M3PA 4YIKA 3ANMA 1WXQA 4WJZA 5EI5A 2CBGA 1JDBC 2I1QA 1N9GB 1UJCA 2QUZA 3RC1A 1E5VA 4BATA 5LXTB 3TW0A 3F5QA 1WOMA 1XD2B 1GKUB 2OL4A 1Q74A 2XVYA 3BWDD 2ZYVX 3SEZA 7AT1A 2PY6A 3NDPA 3T0IA 2IZZA 4W9RA 2WUGA 1QQ6A 1FLDA 2A33A 3MM4A 1Y9DA 2D54A 3B6ZA 3EGVA 4KAFA 4LJ7A 5FEMA 5I48A 2P79A 5JPIA 3AF0A 1ZA1A 1YD7A 5CW2A 5HZKA 3ILHA 3PDUA 4LGCA 1MX9A 1Y8QB 5AHWA 3T5MA 3LRTA 1N77A 4CEHA 1GNQA 3I6IA 3N2EA 4LNHA 4OQYA 3SZMA 1CF9A 1G3UA 1HI9A 2E2WA 3G0GA 3B3GA 1HWYA 2EX4A 1UPAA 3R3WA 4GPAA 4MW4A 5F73A 5FOWA 1GQRA 3RSQA 3E5NA 1IE3A 1XYVA 2W6JA 4HS4A 4JI0B 3H5NA 1GPUA 3UAGA 5ELXA 4ENRA 1M5RA 3GLSA 3W9YA 2CLHB 1BWQA 1JN0A 1R0XA 3FGZA 5K99A 2WG0A 2XDYA 2HQOA 2AE1A 4I9HA 1ZH6A 4PWYA 3PEFA 2X8JB 4BMVA 4BO3A 1HDGO 4L4UA 1ODLA 3JSXA 4PEVA 5K2MA 2WWVD 2HF9A 1EVKA 5ALYA 3B6EA 1SPXA 3BORA 5C8VA 1QNFA 4NZZA 1NC3A 1ZN8A 2GXUA 3G5MA 1LLDA 1O5IA 3PV0A 4Y3UA 3WBKA 4YT5A 4CL3A 4DSZA 4U7DA 1XXHE 2JLAA 5ES4B 1DO2A 1ZL0A 5C46F 2OQVA 1ZCFA 5TS3A 2D2FA 2RI6A 3UYKA 4F9GA 1SEVA 3NAMA 3CF4A 3F67A 1JWAB 4XEUA 3ZNPA 2C3YA 4A26A 5BNTA 1IM8A 1BS9A 1OJ7A 5LBIA 2PX5A 3QTBA 1GN9A 4D9JA 1P80A 1YZYA 4WVFA 2H06A 4OXNA 1WCIB 4U0KA 2ZSAA 1NN0A 1ZK0A 2I8LA 1E8DA 2VUHB 4A8JB 2R6CA 1U5BA 4XZ3A 4GLJA 1QB7A 3IJ5A 3L41A 4CN8A 2H1CA 1ZESA 1BWPA 3FNIA 4CG0A 3P19A 5EFZA 1DFIA 4P4SB 4KAAA 2FGKA 1SUSA 2W2MA 3OLYA 2J3JA 1Q91A 1SCNE 4GLLA 3KEOA 1KS9A 1TXGA 1P1RA 1ECCA 4MKXA 3ZIDA 1NFQA 5E4FA 5IX8A 2Z5LA 1RHQA 1EK1A 5AICA 2P9HA 4FHFA 5HGJA 4M1QA 3IUPA 5HG0A 5IVIA 5AXDA 5IAEA 1MG5A 4XLZA 2HAEA 3M5DA 3TRDA 2GBLC 4YRFA 3WS7A 4DLAA 1J9EA 2IOFK 2QD4A 3M4NA 3D54D 3R40A 4GOMD 1H6AA 1CV2A 4GM1A 4PICA 5CDYA 1ISRA 2NPOA 5FUXA 1P73A 4YCMA 3GGSA 2GSWA 3FHCB 1WP4A 2CNKA 4B40A 4BV2A 3OZFA 3AF4A 4O4JA 4P58A 4HXEB 3ZD8A 3CNQS 1XZLA 4K9DA 3L1VA 3HB0A 2BGJA 3I9MA 3PFBA 1M8JA 2WTEA 4XQGA 4MULA 4EB3A 4NAUA 1BNCA 2CCKA 4KQGA 3WLMA 5FD8A 4B33A 2VS1A 3MG9A 3UJ8A 2O5CA 1FQJA 3IMGA 3AVVA 3MS2A 1G7RA 4F97A 1Q7RA 2ZJ8A 4JL8A 1BMTA 1CS4C 3G1UA 3CVXA 2W2LA 3DXYA 4V3BA 3W5BA 4OJNA 3E22B 4GUAA 4O2LA 2XVXA 3A58B 3F0TA 4GMGA 2CVFA 4MNTA 4ZPJA 3R3SA 2XBMA 3NETA 4FNMA 3H97A 1EXMA 5DASA 1EWVA 1ACMA 1KAMA 2XBLA 4U8GA 4XXHA 3TRKA 2IHVA 3FLAA 3D7RA 4XYGA 3HJGA 4JC4A 1HDRA 4LK3A 4WY2A 4EVRA 1NONA 2Q2QA 1Y8CA 4P7FA 4A0FA 3LUKA 1BO6A 1W8IA 5I9MA 4CPDA 1G1MA 3L6CA 1ZOIA 2GXQA 2XNKA 4K86A 5GZ1A 3GGJA 1XRNA 2C8KA 1E6KA 2GNOA 3AJ9A 4PG7A 4ZALA 5BT9A 2R60A 3RS4A 5F78A 3BGSA 2VPPA 1VJRA 3LVFO 3MGKA 2I6SA 4M46A 4Y67A 1PVOA 2AOWA 2PT7A 3BWYA 4OOEA 1AH2A 2OG1A 3RYTC 4DIEA 1NU8A 5JG7A 4V1CB 1I4DD 1L7DA 1TQ2A 4Y0VA 1DCFA 4BO6A 2WU3A 3WQBA 1ZGAA 2EFCB 1B14A 2H1HA 1QIJA 4LE2A 2N47A 1HSOA 2VFAA 2WWWA 3HZZA 1JALA 4FTWA 4JBIA 1V4VA 4LDQA 4TMKA 1UFQA 3DZJA 2CV2A 3QLVA 5KYGA 2PCJA 2MMCA 2QUJA 5ECGC 3I83A 3TGWA 4FT4A 2PMKA 4J9VA 4P31A 3HJCA 2XA2A 3I3OA 3I45A 1TB4A 4O4HA 4L9WA 3GQBA 2LCFA 3ZKWB 2A7QA 2BMWA 2NQTA 3N3BC 5E1OA 4DYVA 3NIDB 2DFTA 3MPUA 2ZTSA 3RHZA 2ICAA 4C4TA 1M67A 4QEDA 3CPHA 4Z4EA 2YYZA 1JAXA 4EKDA 1XA3A 1AKWA <