3SI7A

The crystal structure of the nbd1 domain of the mouse cftr protein, deltaf508 mutant
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
280
structure length
265
Chain Sequence
b'TGIIMENVTAFWEEGFGELLEKVQSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Requirements for efficient correction of DeltaF508 CFTR revealed by analyses of evolved sequences
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 90
structure length 265
sequence length 280
chains with identical sequence B, C, D
ec nomenclature ec 3.6.3.49: Transferred entry: 5.6.1.6.
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3si7A00
5CITA 2BKUA 4A0GA 4A0FA 1GILA 3FHTA 2ZRGA 2CLDX 4CYMA 1II9A 3W6PA 3NC1C 2QP3A 3W8NA 4ESVA 1LW7A 5C1BA 4M9XA 4YXWA 3PIRA 2YNMA 1T3SA 4BUJA 3KFXA 1M74A 4D4MA 1BO6A 4POAA 4M1OA 5FOVA 4LHVA 2BBOA 3VR5A 3LVQE 3KJIA 4P32A 3Q7QA 2WKRA 3HP1A 4DRZA 1E4VA 1KDTA 2NPFA 3DOFA 3H0KA 4GOKA 1Z28A 4NYMR 5ELXA 5JBQA 1UPTA 1NLYA 4TMTA 3V4FA 4D4LA 3PUWA 3KKOA 3KFVA 5EE9A 3Q72A 1VTKA 3VU9B 3CR7A 5KPJA 1XMJA 1TEXA 4V0KA 1NMZA 1TMKA 4AWXA 4D0LB 4F4IA 4HATA 4R98A 1J8YF 1U94A 4RZUA 1RC8A 4QM7A 2JCSA 2Q3HA 1Q20A 1FL9A 2VQSA 2WSMA 2ZI5A 4ZKEA 4B35A 1GFIA 3M1IA 5EUQB 2A3RA 2QRNA 4Q1BA 3DPUA 2DWQA 2ZUDA 4FI3C 4B3XA 3ADBA 2O0KA 3PVSA 1W0KA 2O8BB 1T8UA 4JVMA 1W47A 4AKIA 3IGFA 2IUSA 3KB2A 4LJ8A 1XXHB 4TMKA 4QC2A 2FFBA 4C0HA 4RD3A 4ZI3A 1G6OA 2IF2A 4IDPA 3GJ3A 4FCVA 4KODA 3LLUA 3HU2A 1L4YA 2AWOA 1DAGA 4CGZA 2X19A 3CR8A 3TVTA 2IUTA 3U4QA 2RGNA 421PA 1VG1A 3PFIA 1WRBA 2Q0HA 2CXXA 2B8TA 4M9ZA 1FTSA 3DZDA 4OL0A 5DYIA 3W6NA 4DB2A 4Q48A 2GBLC 3A4MA 4M1MA 1QHSA 4Q4JB 2PH1A 3ZIAA 4EPVA 2ZSAA 4OI0A 3R7WA 3AF4A 3L0OA 4XWOA 1KI8A 1US8A 3CX7A 4LK2A 3AF0A 3LX5A 1E2PA 4W5JA 1HQCA 1RE0A 4BZQA 1COWD 1G291 4JYBA 2ODEA 3CH4B 4BWYA 2GZHA 4EPRA 2V7QA 1K6MA 2QT1A 1W4CA 4DHEA 2ZSFA 1NSFA 4BLOA 3X1XA 2O0HA 1AQUA 2W58A 3THWB 2V4ZA 5GJCA 5E95A 4RCZA 3B13B 4B44A 5DGXA 4TQUS 3TH5A 721PA 1GKUB 1P9RA 1XJ0A 2PMDA 5TB5A 5EXTA 2D7DA 1MR3F 5TARA 3GPLA 3F3YA 3VR2A 4Y0AA 3REFA 1PUIA 5JJKA 1KJWA 4GOJA 4JLBA 2BCJQ 1TAGA 3SS8A 4OI4A 4JL6A 3CPHA 4WBSA 2NIPA 4B48A 3B82A 2H1LA 2OBNA 3IPYA 3NTUA 4FMCF 5EQTA 1NG9A 3ZLJA 4PO8A 5BQ5A 3DM5A 3VR3A 4ZDJA 4JBXA 4V02A 3LQRA 4R2IA 1KY3A 4PO9A 1AN0A 4QBFA 5KSOA 4FWIB 3AF1A 3RS3A 4YQFA 2HT1A 4W5WA 3GJ5A 3RABA 1XEXB 2QU8A 3FMIA 621PA 3U3MA 5TXGA 1BOFA 4G0NA 1CU1A 1P75A 3EIHA 3QKUA 4OHVA 4Z1MA 3QE0A 4BZXA 5C46F 1AS0A 2B92A 3LVRE 6Q21A 3VR4A 5L3SA 1BIFA 2XSZD 3ZH9B 2XZLA 2W6JA 1A5TA 2C78A 3GLGE 5FL7A 3OEEA 1D8TA 2DFNA 3HR7A 3CIOA 2EFCB 2RAPA 4C0QC 4DIDA 5JI2E 2ZSDA 2XXAA 4B74A 4R7ZA 5CDFE 4NZYA 3TAUA 4TL8A 3EPKA 1EFTA 2X77A 2IEYA 4E07A 2GRJA 2PZFA 2ZRBA 4B2PA 5IHPA 1JPNA 5LPNA 4RY2A 1GRNA 1P7CA 1SXJD 3L8YA 4X8LA 1IJEA 2A5DA 4CDGA 4A15A 1P9WA 3THYA 3REGA 4ZKDA 2G77B 3W3ZB 4RFSB 3KKPA 2OXCA 3EARA 1E2FA 1HTWA 1N2CE 2QENA 1ZIOA 2ECKA 3MWKA 4A1FA 3ZQJA 2QNRA 1ZJ6A 4IOLA 1R5NA 1XZQA 2ODNA 1ZBDA 5E7JA 5FI1B 1N6PA 4EPXA 3T06B 4XVRA 3BAFA 4OQLA 1QHYA 3MLEA 1E2GA 1WB9A 1W0KD 4BLSA 2AD1A 1YR8A 1EWRA 3VU9A 2UKDA 2VO1A 2NO6A 3K0FB 5GJBA 4GFDA 3ND9A 2AKAB 2CVFA 4XVUA 3FYHA 1UADA 2WSSA 3W9YA 3E5HA 3K9HA 4D80A 3BFXA 4NTZA 4YMVA 3PUYA 4RZ2A 1PLLA 1X8JA 4X8HA 5KSYA 4QJ4A 5FBLB 1FNNA 4BE7B 2IHYA 4WXRA 1XJQA 4Q7LA 5J5CA 4I1UA 3NKVA 1VG8A 3GCGA 2I1QA 1ZNYA 2CL7X 2PZEA 4FWTA 2JLXA 2N1BA 3EWAA 2J0VA 1KGDA 2VL7A 4GRAA 2B7BA 4TMXA 2RGGA 1NBMD 4ZIRA 1W44A 1T0JB 3VNVA 2HLDA 1J90A 1GNQA 3GFOA 5CYOA 3MSXA 2GCOB 1UM8A 1WMSA 1OPXA 1U9IC 5GJWC 3AH8A 5AK0A 3LBNA 2VHJA 2YJTD 5FOSA 2ZE5A 5AJWA 1HEIA 4A0HA 4Q4JA 3RS4A 3WYAA 4B73A 4IHQA 2X2FA 2Y8EA 3IIKA 4GP6A 4E5UA 2WJHA 1CJKC 1NP6A 2QA5A 3HYTA 4JBWA 5DH9A 4A36A 3H1TA 3LV8A 4RCYA 5FR2A 4Z54A 2JJ2D 5L3QA 4NP6A 4TMZA 4HLDA 3AVWA 5SZJA 5FTJA 3O8CA 4V0LA 4ZCIA 1N0VC 1VCIA 3K8YA 4Q02A 3RNLA 5L8VA 3JZAA 4HAVA 3Q3JB 4DT1A 4E03A 3EIEA 3QSYA 2GKSA 2JLYA 2BOVA 3B9PA 1KK1A 2FOLA 3JVVA 1KO7A 2HF8A 1UBFA 1SVWA 2OILA 4ABYA 1W46A 2Q21A 3Q7PA 1OFUX 1F2TB 4LRWA 2V8OA 2G3YA 4Z1MD 3FDIA 3QIAA 1R2QA 3LH5A 4JKYA 5TV2A 3ZS8A 1S1MA 2WKPA 2W6JD 3NG1A 2WWGA 1S1CA 1N6HA 1NRJB 1LS1A 2IWHA 3Q85A 3ZVLA 4XD7A 3KQLA 3K0SA 2W2VA 4GDFA 2KSQA 4ARZB 4G5GA 2Z83A 2EWWA 2GZAA 4NCNA 5K8IA 4QBHA 1BMFA 4I1OA 5B2ZA 2QG6A 4A4DA 1G7SA 3NDBB 4DLWA 1G18A 4MDFA 3AUYA 2JLUA 3G5UA 1G3UA 3FWYA 3M0EA 4LSGA 2R62A 1ZM3A 3SC3A 2VF7A 2NO9A 4MGZR 2EW1A 5GVRA 3MMPA 2EYQA 5CB8A 2GBLA 3U7GA 4TYQA 1XCMA 4HAZA 3EZ7A 4LGMA 1S4QA 4HSEA 5CK5A 5IRCD 1G5PA 3G0HA 4BFXA 5P21A 1Q1EA 3QI2A 1Z83A 1ZAKA 3B1XA 3VKGA 1N5IA 3I8XA 3SYLA 1JXOA 1G4AE 3CWZA 2HUPA 1U99A 2CK3D 1RFLA 4RFVA 5K8UA 1KI9A 4MGKR 1RRCA 5IF9A 1G8FA 2DR3A 5HTKA 2IYUA 1OB5A 2WMOB 3NBYC 1N5KA 2CHQA 2HXYA 1G7CA 1UDWA 4DDTA 4L5BA 2F1RA 1IXRC 3BJIC 4W5HA 2BMDA 1N6LA 2ZS8A 1LF0A 4AI6A 5EJEA 5JWOA 4QXAA 1XPOA 1IM2A 3VR1A 4JSTA 3V4RA 2F1IA 2OG2A 3DO6A 4XSGA 1G41A 1TNDA 2RKOA 3EZ2A 3UMFA 2ZRCA 1IN8A 4J0QA 4JVSB 4A6PA 2O8CA 2OBMA 1TUIA 3VMFA 1TQ2A 4AYTA 4FXPA 2JIZA 4L9SA 2WHXA 3RANA 1FW6A 1HE8B 4LPSA 5A0FA 1ESNA 3T1VA 1LS6A 2J7KA 2WWFA 4DDUA 1Z6TA 2ATXA 2CNWA 1R0XA 3R9WA 1Z0IA 1R4AA 2GEUA 1NKTA 4UNPA 5DSZA 4L9WA 3ZZUA 2YV5A 2VHUA 3DZ8A 3BWDD 1P5ZB 3PEUA 1NVVQ 4B6EA 3UKDA 3I72A 3W5IA 2OHFA 4M1TA 4LYHA 1FP6A 1DELA 1DOAA 1P2VA 2XB4A 4LY6A 1G3IA 1OXUA 4TMVA 3TGPA 1AZSC 4MYTA 5FR1A 3SFZA 3C8UA 2Q9BA 3IHLA 3CF6R 2NG1A 1IHUA 2ZRLA 1ZUIA 4M0LA 2DWPA 1XTKA 1OYYA 2SHKA 4TTQA 5CK4A 3UATA 4FMCB 4OQFA 4BRWA 1W36C 3WMGA 3H86A 1F2UA 4F4JA 4R71A 4O3MA 2ZAMA 2CHGA 1JNYA 1W7AA 4TYWA 5L3RA 3K70C 2UVQA 1DAIA 5HZKA 2WJIA 4OHZA 2J41A 4WXPA 2GJKA 4BFSA 2XZPA 2FSIA 2PX0A 4FINA 4G5RA 2QN6A 2QTVB 2ZUBA 1S3SA 3I1FA 1NL3A 5KOYA 4B3FX 3IUYA 2J46A 3BH0A 3LQQA 4M1WA 3KQKA 1HQYE 2J5XA 3IILA 2RMKA 4AIIA 4XD7D 4RD6A 4W7SA 5G41A 4LZZA 1FQJA 2JJ1A 5EP2A 3B1YA 4JLKA 5L3VA 2PL3A 3GEEA 3MAAC 3TVDA 2ZPTX 1GOTA 1NN5A 2BEJA 1BMFD 4IXMA 3QG5A 4IFBA 4IDOA 2WZQA 2EFDB 2OT3B 2V3CC 3A6PC 2RH5A 4C30A 5JHGB 2IC5A 3I61A 2A9KA 4LBZA 5KTYA 3ZVRA 4GBMA 4TYYA 3KB1A 2VLIA 2XNDD 3GLIA 2ZRNA 2FF7A 2I1VB 3L0IB 4A8JC 2ZJOA 2XITA 4LYFA 5G40A 2W83A 4LV5B 3UG7A 1BYIA 2H7VA 4O0MA 4Q4HB 4URUR 4TYNA 3PEWA 2RGCA 2YWFA 3IQWA 1KI6B 1TF2A 3LBIA 1VCNA 1SXJB 1KAOA 1XDBA 3NH6A 4Q01A 1U90A 2ONJA 3CRQA 5JRJA 1OB2A 4FW9A 2CL0X 4CRWB 3SBEA 4MGYR 2DFKB 4LHWA 3THXA 1YZUA 1NVUQ 1U9IA 3LDAA 2IHBA 3DL0A 3RLFA 5JHHB 2H8KA 2C77A 3KUCA 4RKEA 4MDEA 4CIDA 4LHZA 5FUYA 3FFAA 4M53A 4DLRA 2NOAA 4QHYA 3K70B 1MO5A 2IXGA 2ZR7A 2I4IA 2JLVA 4DC9A 1WBBA 2AFHE 2ZEJA 1U8YA 3T12A 3A4NA 1EX6A 1XD2B 5JCPA 2YOFA 2V54A 4TSFA 1II0A 4WZ6A 4UXJA 4WA7A 2EU8A 2C8VA 4BASA 2HXSA 2NTYC 4QGHA 1V43A 1UBEA 4CZ2A 3ZVNA 1HV8A 2QGNA 1VIYA 2OEPA 2FMXA 1NVWQ 3CPEA 4IVPA 4YMTA 1HURA 1HYQA 3THOA 4ZDKA 3NBZC 1GKIA 2GILA 3AF3A 5FPYA 3AM1A 2VRWA 2VP2A 3A1UA 2IL1A 2WWHA 2W00A 4JKIA 5TY0A 2C9YA 1GNPA 2IYZA 2OESA 1NY6A 3LAWA 4PPQA 2VHQA 5LB4A 2ZQ5A 2QP4A 2H18A 4C2UA 1RRFA 5DNYB 3F8TA 3D8BA 2FFAA 4F4CA 3KXKA 3LWNA 1WE2A 4NPHA 2OBLA 2ASEA 5FBRB 3DM9B 2WVJA 2JLRA 3B9QA 3QPUA 4MUBA 2QBYB 1G8HA 5FOUA 3FMPB 3EC2A 5DI3A 1X1RA 3BS4A 2BBSA 1EESA 4PSVA 1JEEA 3EIQA 2QM7A 3D31A 5BYJA 4BFUA 3T5GA 1OJLA 1P62B 2R6DA 5EXSA 3K9GA 3K09C 2C9CA 1OKKA 4PZZA 3CZPA 4V0ME 4DLUA 1UAAA 2XAUA 4FIDA 5CJ2A 4JT4A 4GZLA 3GEIA 4DLZA 1MO3A 4EDHA 4LJ7A 3IIJA 2O8DB 3NHBA 3BFKA 1XP8A 1HY3A 2IYLD 3ZYCA 3AB3A 4CEJA 4B3CA 1JQJC 4QHSA 3FTQA 1SVIA 4C0BA 4C4PA 1II8A 1P3JA 1A1VA 1D2EA 3AVTA 1KK2A 2OCAA 5KUTA 3H4MA 3B60A 4PAQA 3BXZA 4HAYA 1XTQA 1Y63A 5DN6A 2HT6A 5EE0A 5KPDA 2E87A 5JEEA 2OFWA 5E4FA 3GJ6A 3A4LA 3T15A 1JJVA 3ICQB 1CJMA 1AGPA 5CM9C 4TQAA 1NVVR 4TLDA 2ZR0A 4OJKA 3CM0A 3L82B 2QROA 2ZI9A 2YWHA 4JYCA 2XOKD 4Q47A 3A58B 4MRVA 5DI9A 2RGEA 4G5SA 1D9ZA 4Q21A 1E1RD 4YDSA 1L4UA 2F9MA 2W0SA 3ZJYA 1KDOA 4BLPA 2BBTA 2FNAA 4Q7MB 4TT3D 1OFTA 1AZTA 4DBLC 4CF7A 2KWIA 4N3NA 3X1DA 4NYIQ 3WXMA 1E99A 1ZRHA 1ZD8A 3Q9LA 3AUXA 1VDZA 3BC1A 4DZZA 5KYKA 4YONB 1IY0A 2OCPA 3N70A 4KI0A 3SJBA 4EQ6B 1QHHA 1I4DD 1X6VA 2A5YB 4B76A 1OHHA 3ICEA 4BZPA 2BWJA 2GWHA 4TYPA 1YZTA 5BW8A 1O87A 1Q1QA 2FFQA 2AXPA 2P6NA 2BMJA 3X2SA 4JT2A 2QPAA 1G5RA 1G6HA 1TF7A 3KJHA 4NCKA 1HT2E 4JLAA 3FKSA 3T5DA 4ZDIA 1E2DA 1E32A 4PQRA 3AP1A 1WBDA 2K5UA 1ZUNB 4BFWA 2IYRA 5CM8B 5J47A 1G17A 1QHXA 4Q4HA 2YKGA 4ZI2A 4PPNA 4BFYA 2C9OA 4AY2A 3GLGA 3AVVA 4H1UA 2A5GA 2GJ8A 4PXAA 3CH5A 4IKEA 5DISB 3WHLA 3KL4A 2ZJ5A 3PEVA 4US0R 5HZHA 4G3XA 3A36A 1FOEB 1L2TA 1QRAA 3CRW1 3O47A 4C0KA 3PUVA 1G3QA 5CDFA 3NEYA 3FMOB 8OHMA 3AVYA 5CLQA 5AUOB 2C03A 2AFIE 4Q03A 4DEXA 3J81k 2WICA 2Q6TA 2WWYA 2AXNA 4IOJA 2WAXA 3R8CA 4QM6A 3ASYA 2CJWB 5GJVC 2GCPA 4PSAA 3VKWA 3C7KA 1YR6A 3NEJA 2GNOA 1P61B 1XB2A 2OUKA 4S35A 3PENA 5C18A 2RHMA 3NH9A 4IOKA 4B47A 4KLZA 2ZSBA 1R0WA 4Q5IA 4B43A 1KO8A 1TX4B 3TIFA 2AHOA 5AJZA 1BYUA 2UZIR 3OE7A 2N46A 3NBXX 4I1SA 3K1JA 2QQ0A 2ZITA 1VYVA 3DOEA 4EFMA 4PHFA 2GK7A 4PHHA 4P4TA 4D26A 1VG9B 1UKYA 1TEVA 2PT7A 4OQNA 3TR5A 1AS2A 1R6BX 2IW3A 4HZUB 4LDJA 4TLAA 3TJZA 3UMRA 4PTLA 1W5SA 3AVPA 2FN4A 3AVOA 4OK6A 2XTNA 2IEZA 2JDIA 3WY9A 5HCIA 1UEJA 2O0JA 5B30A 4O2LA 3U44B 2EWVA 5C2JB 1OKKD 3D3QA 1P4SA 1FX0A 2VSOA 4RJLA 2BKEA 1PV4A 4BQSA 1TADA 3A8TA 5HCNA 2ZXUA 3SU8A 1ZUHA 2ZJAA 1F5NA 4A8JA 2QGZA 3CBQA 1U0LA 4GNKA 4DWJA 2Q9CA 4NH0A 1NIPA 2LKCA 1NG1A 4GMDA 1XCPA 1OLOA 4L8GA 5H68A 1J2JA 2VTKA 1VHLA 4ACAA 3QXCA 4YMWA 2KI5A 2KE5A 4ZCMA 4EAQA 5DN6D 2CL6X 3HJNA 2REBA 4IFEA 2C99A 2QAGC 3B1ZA 4UNNA 3VQTA 4KFUA 3L8ZA 5CJPA 1SGWA 1EFRA 2FV8A 4R9UC 2IS4A 3EAQA 1CS4C 4B3GA 2DHRA 3U3JA 3TW8B 3C4JA 4Z51A 3R9IA 1XMSA 2Z4SA 3MJHA 1OH6A 2BEKA 4Q19A 4HUQA 3X1WA 3QQ5A 3WNDA 1RJ9A 2B7CA 4YXWD 1JR6A 2ZETA 2ZI3A 3KKQA 1Z29A 3VNUA 4KO8A 4Q66C 1KDPA 1S9DA 3MWLA 3OIUA 2PLFA 3ZZTA 1JR3A 1KJYA 3KXLA 5C4MA 3PCRB 3QKRB 3ECCA 4NCIA 3SI7A 2A5JA 2NO0A 2MSEB 4MRNA 2ZJBA 4EIWA 2C2HA 3MG9A 4BGDA 3SNHA 4AYWA 2GAAA 2WJJA 5BN4A 1R0ZA 4XTCS 3PJRA 2HCBA 3K9NA 3RWOA 1S9HA 1D6JA 5JS7A 4DDVA 2ZRIA 3I92A 4BECA 3FKSD 4ERNA 3VTKA 3HPQA 1WXQA 1XU4A 1UEIA 4LC1A 4K8OA 1DARA 1VYUA 4TQ9A 1KKLA 4NBSA 1KI7A 5A5GA 1GP2A 5KDDA 2A78A 4IDNA 1GL7A 3VR6A 1N3BA 4F91B 1JJ7A 1GG2A 1ODFA 2AN9A 3RHFA 1H8EA 2G0NA 5EE5B 4IOMA 2WM9B 3QJYA 1YZLA 3SFVA 4PPGA 3X1YA 2OAQ1 3TUIC 3MUFA 2W6IA 4AC9A 4BEJA 1QBKC 3OAAA 1QHGA 1SKYB 4JLNA 2AK3A 1EFCA 1YR9A 4EJSC 3K09A 2QE7A 3WBKA 5F9HA 2Z6VA 1IXZA 3GFPA 1BH2A 4PQYA 3TSOA 4ASUA 2WPDA 3GJ8A 3EX7C 3I32A 3KTAB 2QAGB 1UFQA 1YR7A 1GWNA 1Z6AA 1KI2A 2VH5R 3GLHB 5CLLA 1VPLA 3JVUA 4B6FA 3RS7A 1IY1A 4DEYA 3OFNA 4YMUA 1ZM9A 2O8BA 5FFMA 1E0SA 1JB1A 2GTPA 2MSCB 1XZPA 4NYIR 4Z8XA 3BB3A 4YC7A 2FEMA 1U2RA 1ZCAA 1XXHA 2RGAA 3NXSA 3AVXA 3LO5A 4TLEA 1H8HA 2ZYWX 3ZIAD 5FPTA 1P2SA 2WTUA 1J8MF 1E98A 1KO5A 2ZRMA 1YE8A 2X2EA 2GCNA 2IS6A 2OZEA 4XVQA 5FBWB 1MRNA 4B3DA 5CIWA 3ADCA 1QG4A 4GT1A 3OIVA 1W0JA 5HE9A 1U98A 4NE2A 4JLDA 3BIFA 1W4AA 3CW2A 221PA 2ZI7A 2V7QD 5J4KA 4FMDF 1B0UA 2CCKA 2OO7A 1NY5A 4G5OA 1EX7A 4GSYA 4KHZA 4Q4LA 2WAYA 3T61A 4BFZA 1BKDR 5JRZA 2ZJ2A 2JAQA 2VEDA 1KOFA 1E1QA 2Z0MA 3FB4A 3KKMA 5BXQC 4QNRA 5AJXA 5EP1A 4AKHA 2OM2A 4DXAA 1WDTA 1W5TA 2AKYA 1OF1A 1G20E 3QUSA 3HDTA 3PITA 3AV0B 5AR1A 2MSDB 3P4YA 1ONBA 3QENA 3ZQ6A 4OKSA 4NU0A 4CT4B 2C96A 1FP7A 1DAFA 2IX3A 2ZR9A 1JR3E 1WCV1 1CF4A 3RDPA 1IXSB 1E2LA 1XF9A 5TVKA 4G1UC 4WZAE 5FH9A 4P4SB 3THWA 3UK6A 5IK2A 1TQDA 2J0QA 5FL3A 3KKNA 1VYTA 3B8HA 2VP9A 4KSCA 4CEIB 3TUZC 3IO5A 2R6AA 2P6UA 4P0TA 3U6BA 2ATVA 3B85A 3ZD7A 2AL7A 3QF7A 1IN4A 1RYHA 4EJSB 3K53A 2FPMA 4PHGA 5DO9A 3VFDA 5FBVB 4DCTA 3C5CA 4F92B 4KAXA 3BORA 2ZS7A 1ZM2A 2CE7A 5G3YA 3BH6A 3B78A 3QKSB 1ESMA 4AURA 4F7WA 5FL7D 1YJ5A 2CBZA 1YZQA 3OEED 3BERA 4B33A 1Q1ZA 4RZ3A 5KDOA 3HWSA 5EP3A 1KMQA 4OK3A 3UXMA 5DLQC 4YMSA 1FFHA 4I1VA 1G8PA 1N6NA 3LXRA 4HZIA 5JMTA 1VCOA 2D74A 2ONKA 1KY2A 2GZDA 4DB4A 1XEXA 4M2LA 3RAPR 4DLYA 2FE4A 3N5CA 4Q9JA 4CEHB 2YZ2A 2XB2A 2B6HA 1Z3IX 4RD0A 2FGKA 2ORVA 4NCJA 1Z63A 3I73A 3K0AB 1KYIA 3O8BA 2ANCA 1KZ7B 2OV2A 4Q9HA 3TMKA 3HR8A 2ZRHA 3A1TA 3QXJA 5KO2A 4RD2A 5EZ5A 1XXHE 5EE1A 1NF3A 2HDNB 4IW3B 4AG5A 1LNZA 2R9VA 2O8EB 2ZRPA 4N1AA 2Q3FA 1DG1G 1GAJA 2ZJ8A 5BWMA 4EPWA 1IQPA 1H8ED 2QM8A 2ZS9A 1CR4A 4GZMA 4MYHA 3SR0A 4DCUA 3GJ4A 4WAUA 2GK6A 2FGJA 1SVMA 3KJGA 3L0SA 2NO7A 1R10A 5BN3A 4I81A 4RFSA 4D4KA 2WSSD 3BE4A 2QPTA 4DSTA 1CKEA 4C3ZA 1KAGA 1KMHB 3AP3A 5H70A 2HCJB 3NVAA 4GMXA 3AKYA 2Q3MA 3I4LA 5FOXA 3PXGA 4E22A 5A4JA 1K5DA 3T1TA 4TTRA 1C4OA 1EFHA 2REXB 1UDXA 4IEEA 3QNUA 4F38A 4V03A 4QOSA 1DVRA 4UNSA 1W2HA 1E9AA 4L15A 4XWKA 3OFND 4WOPA 1MV5A 2G6BA 1Z08A 2H57A 4D6PA 3RSOA 4GOXA 3K0FA 2BC9A 2XTMA 2FSHA 1G3RA 4Q7JB 2OSBA 2BM0A 4KBGA 1VG0B 5AUPB 3ADKA 1IONA 2ZE6A 3SQXA 3B7GA 4LWZA 5D3MB 3KTAA 1W0JD 1Z47A 4UJ3A 4JJZA 1NVXQ 4DSUA 2HLDD 1ZYUA 3O8DA 1P6XA 2ODWA 3CPJB 3LFUA 4PC2A 4MQBA 2IYVA 3W90A 4KV9A 3AKEA 2NPIA 4CVNA 1E1QD 2WBLC 4HDQB 2VHTA 3DHWC 3PEYA 5F3WB 3QVVA 1WQ1R 1Z2CA 1DAKA 3GQBA 1D9XA 1CRPA 1SXJC 3B6EA 4QGAA 4U7DA 1XTIA 3TKLA 2BMEA 1E2NA 4O25A 4P4UA 2FU5C 3EW9A 2QL6A 4KFTA 4Q1AA 1Z8FA 2F1JA 2GCOA 2JLSA 4A2WA 5HKKA 1MKYA 1ZD1A 5SZKB 3EPHA 3TSWA 5EXXA 2P6RA 1S0UA 4QG7A 2VSXA 1I4LD 3CWQA 4PZYA 2BIFA 4BLRA 3DMDA 4DLSA 2XTZA 4URXR 3IEVA 3ONWA 4UNRA 1VECA 1EGAA 3RC8A 1FMJA 3B5JA 3X1ZA 1XFAA 1DAEA 4Q4AB 3ETLA 4B3BA 5JJLA 5J40A 1NN3A 3CUEF 3QOFA 2ZVPX 1XEFA 3CNLA 2B21A 1MABB 4US2R 2H17A 2IA5A 2R65A 4K46A 1S96A 4I4LA 4QJ5A 2H16A 4AG6A 4C2TA 4ITRC 1F60A 3LBHA 4HLQB 4D25A 1XD8A 1T8TA 4AYXA 2O52A 2D7CA 2VIIA 2ZIAA 5K8LA 2L0XA 3TLXA 1N6RA 1ZINA 4RZXA 3FGNA 3TBKA 4NCHA 2ORWA 2RGDA 2P5TB 3N2IA 4KBFA 3FHOA 3WNBA 1D2MA 2F3RA 4HB2A 3GLFB 1DAMA 1XTRA 3BRWD 1AK2A 4JS0A 4EJSA 5HR5A 1UJ2A 1F2TA 2CLCX 4M22A 3NC0C 1XWIA 1KNQA 5AJYA 1E2QA 1S3GA 5FOTA 3WYFA 3CNOA 1KO1A 4HB4A 4V0MA 4TWZA 1CIPA 2PEYA 2NQ2C 3OHMA 1NMYA 2F3TA 4GPTA 1UF9A 5G53C 2FZ4A 1XMVA 4HLCA 4M1YA 3F5FA 4KVAA 2V6IA 4ARZA 4OHWA 5EZ6B 2N42A 3IDQA 4PQFA 4FMBB 1SKYE 3TNFA 4M1SA 3U3OA 4IDHA 2XJ4A 3EC1A 1KO4A 1KZGB 4B32A 3WRYC 4ESHA 3WHKA 3UANA 3GLHE 1X3SA 2ZTSA 4P3YA 3C41J 1E6CA 5FTMA 3E70C 4C0JA 1E4YA 2JATA 3OIWA 2QRZA 4AD8A 3BB1A 2OFOA 3U3KA 1CRQA 1SHKA 4X8OA 1AS3A 1FMLA 2WV9A 5BN5A 1R7RA 5JSZB 3WP1B 1TUEA 4JL8A 3M6AA 5AUQA 2O8EA 4AKGA 2JGNA 2V6JA 2WMNB 1Q12A 2YOHA 2JJ8A 4RKFA 1W49A 1KSHA 4HUTA 2GEDA 1SULA 1TL7C 2D3WA 1GVNB 2ZYVX 1E9SA 3SYKA 3EXAA 4NYJQ 2IBMA 5C4GB 5EE3A 2JIZD 3MWJA 3E2IA 5KSPA 3CRVA 4TZ6A 4A9AA 4D2IA 1GSIA 2AWNA 1Q1BA 2DCUA 2CNWD 4LOAA 2GJAA 3U4QB 3L43A 3H84A 4LJ6A 1C9KA 2JEOA 4FMDB 4KSBA 4A0RA 4ACBA 2F55A 1M1YE 1AA9A 3I3SR 3C5HA 5CYPA 1A82A 3I5XA 4O2RA 2DYKA 1CEEA 2ZE7A 5FUWA 2HEIA 3KQNA 4HDOB 1R5OA 3R7WB 3QBTA 4M9SA 1US8B 5JWHA 4URVR 1E94E 3UWKA 4QRHA 521PA 3U60B 5JFGA 1L7VC 2FSGA 2D4HA 2GDJA 3U7FB 3H2YA 2NZ8A 4Q00A 5LDDC 1Z22A 5D3MA 3O8RA 2ERXA 1EXMA 3SBDA 3Q8XB 1GNRA 2IS1A 1YQTA 2FG5A 2IUUA 3K0EA 1JQLB 2G88A 2J45A 2FPLA 1Z0JA 1JPJA 2HF9A 1R8QA 3CF0A 4EUNA 1ZM7A 1FQKA 4LX0A 1RW4A 2EFHB 3EPJA 2QI9C 2V9PA 1D5CA 2IYQA 3TR0A 3KUDA 2XGJA 3AF2A 3VX4A 2NGRA 4XSHA 4F93B 1E9BA 1TF5A 4H1VA 5H1YA 1Q3HA 4RVCA 1YVDA 1ELOA 4LHXA 3RSLA 1PJRA 1T3HA 1GITA 3VHXA 5J4HA 2JASA 3AP2A 4XH9B 1ZCBA 5FI0B 1F48A 1T3LA 1PLJA 1ZU5A 1G1MA 3SN6A 3CLVA 2P67A 4TLBA 2VA8A 4BFTA 2IYSA 4EPTA 3Q5DA 4KCGA 1Z07A 1G64A 3IKJA 1ZD9A 1YRBA 1ZM4A 2J7PA 2WWIA 2JJ1D 3NHAA 1VIAA 2WOJA 1R0YA 3P26A 3FMFA 1Q22A 2RB4A 2HJVA 3SZRA 2FFHA 5L3SB 4DKXA 3GFTA 4TN1A 1B23P 4JIMA 1T6NA 3SYNA 4A82A 1A7JA 4R2HA 1E2JA 2QQEA 4OK5A 4IVQA 3ZGXA 2G9NA 2JLQA 4TL7A 5KDLA 2IXFA 4JLMA 1NNEA 2QPOA 2ERYA 2E1RA 4HB0A 4C0AC 1FZQA 2PJZA 3KQHA 2LWIA 4A2PA 4IXNA 1NLFA 1RKBA 3RC3A 1AJEA 2J0SA 2DB3A 2QSYA 2OLKA 4H9GA 2CLSA 3FPAA 1OV4A 2FX3A 3ZZ0A 4ZDWA 1LV7A 2XSZA 4URYR 1G21E 2QTHA 3AGQA 1F3OA 1CLUA 1MT0A 2ORIA 2PBRA 3UIEA 3BH7A 2ZI4A 4LYAA 2IWRA 3THYB 3SHFA 1KKMA 5F2EA 1OXVA 1ETUA 3A1SA 3KJEA 4MRPA 2CVHA 3GJ7A 4IVRA 4DIEA 2ZAOA 2BVNA 2H92A 3L2OB 3WMFA 1KK0A 4D0GA 4PAOA 5FPKA 3ADDA 4DSNA 2FPKA 2VPPA 1Z0FA 1KI6A 1XRJA 2QUZA 2W2XA 2ZRKA 1S8FA 3CX8A 5FTLA 2FSFA 1SXJA 3ND8A 4TSFD 5M04A 1GM5A 4MKIA 3ZVMA 4A92A 2NMVA 4P33A 2WJVA 3MGCA 2PCJA 1T9HA 2DFTA 4HEJA 3C14C 3SJAA 2HJGA 3IQXA 2Q9AA 4C0SA 2EYUA 4PR0A 2QMOA 3IIMA 1G19A 1TU4A 2ANBA 1GKYA 2QMUA 3K0CC 2ZJYA 5JSZA 2OCYC 4EFLA 2J3EA 2GESA 3CB4A 1IN7A 3LY5A 1XD2A 2CE2X 1N5JA 2FWRA 3JZMA 1JALA 4Y0VA 1XNJA 2J0UB 5LD2B 4OQXA 5E7IA 4WZBE 1CULC 1S2MA 2EFGA 2MMGA 3SJCA 4QKQA 3AKDA 5FOWA 4HAWA 4MH0R 2Z4RA 3TAHA 3WRXC 1KK3A 4ZIRB 3RRYA 4DVGA 3V9PA 1OXTA 3EZFA 1KIMA 4V0OA 4NONA 3KX2A 3WYGA 5JLJA 2BBWA 3U7HB 3C16C 3ZD6A 1GL6A 4LUCA 3KDSE 1GIAA 2NZJA 2XNSA 5IDVA 4OI1A 2QTFA 5HPYB 3MFYA 2BDTA 3SE0A 1GRRA 4MKHA 5EP4A 2C98A 1KI3A 3MJRA 1W2GA 4M21A 5JJIA 1NBMA 2QBYA 3IBYA 5L3QB 2IT1A 1KSJA 3LW8A 1JXMA 1DTSA 1KSFX 4JVNA 1T4GA 1Z0AA 2W0MA 2ZRDA 2G1KA 1Z6YA 3B1VA 3GMTA 4NYJR 3UPUA 2J1LA 3GLFE 3GP8A 1E2MA 2PX3A 1UKVY 4JLJA 1DAHA 1XEWX 1Z2AA 2OAP1 4IEIA 5E3HA 3Q5EA 3CF2A 1NI3A 3QXSA 3QBVA 4DT1B 3K9LA 2VBCA 3BBPA 5FUXA 1GUAA 3P20A 1ZMXA 1JBKA 2DY1A 2ODBA 4WW0A 3T35A 3OESA 1P72A 2PCLA 3EWSA 1CJVC 1YZKA 1G7RA 3AEZA 2J7PD 4OJQA 1RVDA 2R44A 3RS2A 3WNCA 2O8DA 2JJ2A 4M1KA 1W1WA 4HI0E 3B1WA 2I3BA 4RD1A 4QNMA 2IS2A 1OH7A 4ILEA 3PUXA 4B2IA 1W4RA 1OIVA 1IAQA 4EFNA 1JAIA 3WMEA 4BLQA 1XPRA 3UG6A 1AM4D 3N2EA 2R6CA 2GAOA 1SKQA 1Q21A 1SXJE 1KI4A 1VHTA 1FNMA 4JLPA 4OBEA 2GJSA 1WA5A 2A7QA 1X8LA 2J87A 4JZKA 3FVQA 1I4TD 1FTNA 1OIXA 2QY9A 3MRSA 4D4JA 3P32A 3NWJA 2F6RA 4DLTA 5H8WA 1Q0UA 1OHHD 1DEKA 1XBTA 2BHRA 2DPXA 3HYRA 3I5YA 1JECA 5FPHA 2R2AA 3CRMA 5B57C 3BGWA 1TQ6A 1ZC3A 3FE2A 3TQFA 2F9LA 3SQWA 1Z5ZA 2JLZA 4E09A 3IPXA 3WP0A 1M7BA 3ZS9A 5JECA 2ZU6A 4JMPA 2IXEA 3P27A 2XZOA 3TE6A 4BLTA 4XWAA 2XJ9A 821PA 3QXHA 1KHTA 3GJ0A 1JEDA 1MH1A 1LVGA 4ZPXA 4EQ6A 2ZANA 2VHCA 5GADl 2OCBA 4EPYA 1W48A 2PZGA 4LPKA 4QGFA 1NMXA 1J70A 4MYCA 1Z6GA 1UKZA 1E9EA 2WIAA 4UXHA 4AKEA 1QHNA 3SJZA 2D2FA 1VCMA 1W4BA 1MRSA 2BCGY 2VP6A 1TTTA 2GXSA 4X8MA 4Q1CA 5B58C 1TQ4A 1OIWA 1W36D 4MKGA 2WKQA 3QF4B 1DO2A 4U02A 1E69A 4ZO4A 3QVUA 1N6OA 5FTKA 4AK9A 3K70D 4B75A 2RCNA 3DDCA 2QMHA 3IEUA 4B71A 2CK3A 2ZRJA 5TMPA 4UKDA 3AQ4A 5FTNA 1UBGA 4NDZA 2WJYA 3RYTC 5EUMA 1NBME 1E79A 1SVSA 3B2EA 1QVRA 3PG5A 2CCGA 2O8CB 4NMMA 2YINC 1IBRA 5SZIA 2FEOA 2KBFA 3AKCA 1YZGA 1XTSA 2VSFA 2DBYA 1E2EA 3OE7D 1SVOA 1GDDA 1VMAA 4PSKA 1OW3B 3TRFA 5B64A 4PZLA 5DHFA 1IY2A 1F6BA 2VP5A 1G8YA 2CJWA 1Z6XA 1G7TA 1E0KA 4ON9A 4Z8YA 1GZSA 1TPZA 4IDQA 2J59A 3EASA 1QG2A 2JDID 1XJCA 2WWXA 5CIQA 4KYUA 1IN5A 2J0UA 1M34E 4LJYA 3QXXA 4Q9KA 1NN1A 1RRGA 3U5ZB 3OIYA 1EFUA 3BK7A 4LC0A 2ZROA 2R6GA 4LV6A 4PFSA 5SZHB 4BFVA 2P2LA 2OLJA 3EG5A 4QBIA 4DJTA 1CR2A 2OFXA 4M4SA 1XPUA 3BOSA 2VP0A 5FBQB 1DO0A 1YU9A 4HZUA 3VHLB 2IYXA 1Z0DA 1G9XA 1F2UB 1YHNA 3CKLA 2YHSA 2C04A 5J4LA 2TMKA 3U44A 1XTJA 3T1QA 1G8GA 4MKFA 3QPWA 4P31A 4U5XA 1CR1A 3QG1A 1EWQA 5AJVB 3TSZA 2GA8A 1A2BA 4ZV4A 4LBWA 1EFRD 1OSNA 1E2IA 1SVLA 3MCAA 4HLUC 3EPLA 1N6KA 4US1R 4OYHA 4HB3A 3LA6A 1E2KA 2AX4A 5AUNB 1SQ5A 4OI2A 3HU1A 2C95A 2C5LA 5DHAA 1D2NA 2QAJA 4DCSA 3GJXC 1N6IA 2IK8A 2P5SA 5UKDA 3OF5A 2F1HA 2EVWX 1X86B 3GEHA 1E0AA 1ZW6A 4FD2A 1LFDB 3RVBA 1JR3D 1X8KA 2GVZC 4PC1A 5KNBA 1VKJA 1WP9A 5ANRB 5JS8A 4UJ5A 2V1UA 121PA 2VYFA 1V5WA 4XOIA 1RZ3A 4XTRA 4D82A 3K0CA 1X1SA 1YRAA 3CZQA 4DSOA 3LXXA 2FH5B 4PANA 3RS5A 3GLIB 4LBVA 5JCZA 2PJRA 1CBUA 1LF5A 2CDNA 1XD9A 3CNNA 2NO1A 4PO1A 3U2QA 5FUVA 1SVKA 1OH5A 1Q57A 3FOZA 1MO6A 1ZNWA 1UKEA 3U6KA 4A2QA 3QKRA 2ZJZA 2O8FB 5E7MA 4Q18A 4QFMA 1DE0A 4KVGA 3LRPA 1U0JA 2P3SA 1E9DA 1KNXA 1YKSA 2FDCA 4DDWA 3THXB 3R8FA 4TL6A 3VKHA 1KDRA 1OT3A 2XNDA 4Q1FA 2D2EA 3BFVA 2QZ4A 2W6ID 4MUAA 3OAAD 1M7HA 2MMCA 5DIFA 3RRMA 1PZNA 4PX9A 1J7KA 2QE7D 2ZRAA 1RYFA 4C9BA 4C7OB 4ASUD 3A1VA 3RS0A 2QORA 2WPDD 2IYWA 4LHYA 5G3ZA 2FJUA 1P2TA 1N25A 4TMWA 4FN5A 3SOPA 3W5JA 5F9FA 3DVLA 4D0NA 4DCVA 3VX3A 1E79D 2F43B 1HUQA 4BRUA 2AK2A 1N0UA 1A2KC 4MITA 1E3MA 2G1JA 1KI1A 1H8HD 3QY0A 2DWOA 3NIBA 2RHDA 3QF4A 3SHWA 2ZRFA 4BEBA 5K8TA 4B2LA 2HYIC 2GF0A 5KHOC 2QAGA 2YOGA 1AQYA 2WWWA 3GLHA 1PVOA 3QEJA 4OHYA 2XEXA 2GJ9A 4L4UA 1C1YA 2V1XA 2GEVA 5DE3A 1A4RA 2YYZA 4II7A 1XEWY 3FKQA 3MD0A 3OEHA 3KQUA 4S2EA 3A1WA 3L0PA 4PHTA 4NHOA 1Z06A 4HDCA 1P2UA 4GL2A 2YVUA 1ZVQA 5TDHA 1CR0A 1T5IA 3S1AB 2E9SA 3EA5A 5EXPA 5DI3B 3I8SA 4MA4A 3EA0A 1EG7A 1T5LA 1U8AA 4G5QA 4QHTA 1I2DA 5LB2A 1FUUA 4N0EA 1QVAA 3G82C 2EFEB 4PC3A 3PQCA 5IK2D 4FCTA 5BYKA 1LTQA 2IF0A 3AGPA 2CCJA 3W3AA 2PT5A 3C15C 4K81B 2KJQA 3FHCB 4V0NA 1RPZA 3M4YA 1HA3A 4DUGA 2X1VA 1WF3A 5J4YA 3R20A 4JJKA 2AR7A 4Q7KA 1K5GA 4CW7A 1P60A 3HU3A 1SHZA 4CEJB 3ASZA 1GRQA 2Z5FA 4KFRA 5JWRA 1II8B 2X8AA 4KJZA 5GVSA 1E9FA 4LCBA 3U3RA 1TU3A 1RIFA 4P4SA 4NYMQ 1U0HC 2B8WA 4M8NE 3TUJC 4QJ3A 4GP7A 4OQMA 4QGGA 4XIGS 2GF9A 2IYYA 4LJAA 2FZLA 1IJFA 4KITB 4CEIA 1CXZA 4KU4A 2RGNC 5DYGA 1UBCA 1XMIA 3PUZA 2CEAA 1OFHA 2A2ZA 3U7EB 3NBFA 4TLCA 1L8QA 1CTQA 3IBGA 2YWEA 2ZI6A 3TQCA 2Z43A 4JVLA 3P4XA 1K8RA 5IT5A 4JLOA 3T34A 3HPRA 5CB6A 1DADA 2BJVA 3PV0A 4A6XA 3QKSA 3D7MA 1M7GA 5JZVA 4RD4A 1Z0KA 1R5BA 1PLKA 5JI3E 4Q1EA 2QT0A 2P65A 2FA9A 5KSZA 2V55B 1CP2A 1DG3A 1DPFA 4IJMA 3MWYW 3BB4A 4URZR 1NN0A 1QHHB 3LX8A 4GI7A 4C0LA 1E9RA 2D62A 3TK1A 3WBJA 1G3MA 4TTPA 4CEHA 3D6TB 3LNCA 2D06A 2XOKA 4BPBA 4URWR 1DS6A 2A5FA 4LI0A 2KBEA 3AVQA 1E1RA 1JI0A 2R6FA 1NSTA 3K0AA 3GD7A 4KLNA 4CT5A 4DLXA 1OH8A 2EQBA 4LYJA 4UNQA 3CONA 4TT3A 1T91A 1NKSA 2LKDA 2QMEA 3QKTA 1JAHA 4JL5A 4PC7A 2RGBA 2OE2A 4G01B 4PPFA 2ZE8A 1E0JA 3OZXA 2ZUCA 4QL3A 1SZPA 2HYDA 4TZ0A 3DKPA 1DBSA 2XX3A 1QHIA 4XJXA 4LJ4A 3RRZA 3GLGB 4HYYA 3LD9A 1OFIA 4OHXA 4B34A 1E2HA 2O8FA 4TL9A 1AGRA 5FPSA 1N5LA 1OYWA 4YLGA 2PMKA 1MO4A 5LBIA 4U00A 1J99A 3CRRA 1NLZA 2REOA 4LV8B 1W36B 2OXRA 1PUJA 1E9CA 2CHVA 1E96A 2GETA 2W2TA 1OXSC 4JBYA 1U81A 1IOZA 1KMHA 1KSGA 4C7OA 1RRPA 2ZM5A 1NIJA 2VP4A 3A37A 4JLVA 1ZNXA 3UMSA 2PLRA 4I99A 4YDHB 3R9XA 1CJTC 1XCGB 2LCFA 2F7SA 4HLUA 2F43A 1QDEA 2BMFA 4JSYA 4NKRA 3W6OA 5KNDA 2R8RA 4HAXA 1CJUC 1U8ZA 3F0TA 2CMKA 1M2OB 4Q9LA 5KNCA 3OEHD 5HE8A 2BM1A 1I2MA 2BV3A 2RGXA 1ZC4A 3P1JA 3KZ1E 2ZYUX 5D3QA 1ZU4A 1QF9A 1ANKA 3KXIA 1NJGA 3LW7A 2YC2C 1G16A 2ZVQX 2VF8A 4W9MC 4RSGA 4MRRA 4Q9IA 2ZU0C 3CO5A 1ZNZA 5HKKD 4DLVA 4WVFA 2G83A 1AIPA 1Y3AA 2IYTA 4HAUA 1T0HB 3DMNA 3V00A 2ZSEA 1FX0B 2QP9X 3E1SA 4Q1DA 3I62A 2HV8A 3EZ6A 4DUGD 1GTVA 1HT1E 1MOZA 3SDZA 4QBGB 4A8JB 1LB1B 3W34A 1COWA 1KTVA 1AKYA 3S1AA 2GVDC 3DEFA 3QEOA 1EK0A 1KJZA 1AKEA 1ZIPA 3NDPA 2ZYTX 1YZNA 4FCWA 4KXFB 4D81A 2GXUA 1HE1C 2YWGA 3U61B 3ZDQA 4WIAA 2KB0A 1OE0A 2J9RA 4PAMA 3DKVA 1HH4A 1FUKA 5J4VA 1G4UR 2YC4C 1BS1A 5AWFC 3CX6A 1Q44A 4UQOA 4ZCLA 1R8SA 3UWOA 3TW4A 1GL9B 4PC6A 4MRSA 1ZP6A 2GHIA 2UZ3A 3LLMA 3RWMB 2WIBA 2JLWA 3GLIE 3IHWA 3IO3A 2WOOA 3SEAA 3VAAA 2GXQA 4M9QA 3BD9A 4Q4AA 4DCNA 4EKDA 2QEQA 4KFSA 2A30A 4L16A 4MGIR 1N0WA 1MABA 2QSZA 4UXIA 5KU1A 1FPMA 1Q3TA 2ZREA 2JA1A 3PR1A 1M8PA 1IN6A 2H5EA 4MYUA 5LD2C 3RRNA 1M6NA 3W8RA 4IRUB 4LBYA 5JEDA 1G5TA 2WJGA 3QPVA 4HUQB 1RJ9B 4NL4H 3T1OA 1H65A 3FFBA 2BJWA 2XXAB 3AVUA 2AD5A 4KYIB 5F98A 2O5VA 2G0TA 1QZXA 4LJ9A 1NJFA 1P9NA 3EZ9A 1OXXK 2DFLA 1O3YA 1P73A 3GLFA 2PEZA 4N0DA 1LY1A 1XX6A 2P0EA 2GXAA 4LJ5A
chains in the Genus database with same CATH superfamily
4V0SA 1KZ4A 3MWFA 2XEDA 4KPEC 2ZRGA 3DNMA 3EIWA 4A8HA 4CYMA 3W6PA 4F2HA 2RHWA 3MMZA 3W8NA 5JSHA 4ESVA 3HDJA 4TS3A 2X0IA 5EMNA 3OE5A 5CNMA 1HK7A 5ADVA 4BUJA 1Z0ZA 3O31A 4LN1A 5FWDA 4XGQA 4P7BA 1MA3A 4M1OA 3R5TA 3TZ6A 4LHVA 4EYGA 4KHPB 1PX0A 3LVQE 2Z6QA 2QZPA 2QTCA 5B5SA 3JD3A 4QLOA 4P32A 1QIGA 2FETA 4DRZA 3H0KA 1W35A 3CW8X 1YUMA 1D4FA 2J6BA 3DDZX 4FVTA 4QUBA 4XYMA 3V4FA 3PUWA 3EVAA 4MR7A 3KFVA 4BNJA 1K89A 4ENPA 5KPJA 3HXOA 2C8JA 5AVYA 2Y1GA 2DWUA 3EUEA 1TMKA 4UZFA 4W9NC 4AWXA 4D0LB 2PVPA 3H2HA 4HATA 3CZ9A 1T2VA 1A95A 3CIFA 3OTWA 1OYVA 4PSCA 1KEEA 4RZUA 3NIFB 3GAZA 3PFGA 1Q20A 4RKWA 1T0BA 5TC4A 4ZKEA 1ORRA 1MX3A 1GFIA 2EATA 5EUQB 5K4GA 1BQ4A 4Q1BA 5KVVA 3DPUA 1U2DC 2NTNA 4B3XA 3ESQA 1PGQA 1W1IA 3ZWNA 3I2YX 4EY3A 5YASA 1CK4A 3IQDB 3PVSA 4TM7A 4EP1A 3ADBA 1KF0A 2R48A 3EE6A 1T8UA 2C84A 1OI4A 1W47A 2YX1A 4AKIA 3ZGNA 3HV0A 1XXHB 5EJMA 3A6DA 1RXSA 3CTMA 4Y8VA 1OROA 2JIOA 3KU4A 4RD3A 4ZI3A 4WN9B 4ZCPA 3GJ3A 3D3KA 2YDYA 3JQCA 3LK6A 4KODA 5C0OE 2EV9A 1YIDA 3UJAA 3WQQA 5F7OA 1APBA 3RRFA 3N75A 2AWOA 3ZWBA 1MB9A 4EY8A 1WXDA 4X60A 3SC2B 4ZI7B 2FN3A 4Q3AA 4MO9A 2X19A 3N87A 4LMBA 1N3IA 4C2AA 5BV8A 1ZGBA 3PRHA 2F48A 5BSMA 1KP2A 3K1TA 5D84A 4FNGA 3TI7A 3F5SA 2B8TA 2AGVA 3DZDA 4TS9A 4Q48A 5F9MA 4DR7B 3ADOA 3WNZA 3CJTA 3O38A 4KK3A 4DG9A 4M0PA 1N2CA 4HEHA 1JFSA 3UT5A 2YY7A 2Y05A 2V0CA 2VUTA 1L5FA 3LQYA 4G0PA 4BMNA 4EPVA 4YHHB 4J7AA 4NWIA 1KI8A 4WECA 1MGOA 3P5BA 5DHRA 4LK2A 3GEPA 3OP1A 4IIUA 1E2PA 2IOQA 1HQCA 2C5HA 2VHWA 3PJGA 4JQCA 1COWD 2E5LB 1YL5A 2QT1A 1W4CA 5DWDA 2ZSFA 3MAGA 1K6EA 4WHMA 4LRYA 1N5RA 4PCVA 1AQUA 1UT8A 3DAOA 4JC0A 5GJCA 3RU7A 4JXZA 3LHFA 5TX7A 1MZPA 2E37A 2OP0A 5DGXA 2PA0A 4FZVA 3BCRA 3TH5A 5ADUS 4R1TA 1PJLA 2XKJE 4R8RA 4EKGA 4AJ1A 1HNXB 1UOPA 1GKUB 2PAAA 1IB0A 4RJTA 2JCGA 3U4GA 4ENTA 1P9RA 2J3KA 1X7WA 1SCUB 1SG9A 2O05A 1V8OA 5K3AA 5TARA 2ZIXA 1UMCB 2HNAA 4LQDA 1CUJA 1L4KA 1ID8A 1U5AA 4IJ6A 1JS1X 2BGIA 3G0CA 4A0SA 5HS4A 4N5HX 2VCHA 2PVSA 3E8SA 3HBJA 3BMNB 3SS8A 3OLVA 4I5GA 1E1NA 3FZNA 1DJOA 2G5TA 2W2NA 1NG9A 3FIJA 3HFSA 2Q62A 3R5SA 4YAFA 1EUZA 3DM5A 4UM8B 1V9CA 1ZVJA 4ARIA 2QGFA 6REQB 3FY4A 3H97A 4QBFA 1RBZA 5KSOA 2IIVA 4D46A 2GZRA 4YQFA 1GEEA 3TEJA 1E3TA 1CQZA 2UVPB 1DRKA 3PQ8A 4GBGA 3ZBUA 3EFOA 3EVDA 3W2HA 2WABA 1CU1A 4Z1MA 4OXQA 4RESA 4ZZIA 1LQUA 5AJHA 3VR4A 1Z4OA 4WRRA 1BIFA 2GNAA 2W6JA 1WY7A 3GLGE 1GNLA 2AJCA 4ISCA 2DFNA 2OO3A 3BXOA 5EJ5A 4XI9A 3CIOA 2XVAA 4D3XA 1XMXA 3WK9A 1T8RA 4BLWA 3WICA 4I8IA 1XT6A 4DIDA 4GZ3A 1U4NA 1Y1TA 2C4NA 4HDKB 2XXAA 3VTAA 3K0HA 1FDSA 1JMKC 5IDYA 2E4WA 5CDFE 4NZYA 4AS2A 1SEPA 2OGZA 4CL3A 5JIBA 2GCGA 3ILXA 1MAWA 4QYTA 3UVEA 4E07A 5LMZA 1TIKA 2Q1YA 4N7BA 1I0IA 3NDIA 4DLLA 5IHPA 2I9PA 3AOEC 3CVOA 3A0UA 1GRNA 1SXJD 1VIVA 1P2BA 4XUGB 4UEOA 4CQMD 1H9AA 1ZK0A 4OYRA 5KQGA 5K0EA 3GCZA 1P9WA 1X0VA 5BRNA 4DA4A 3L7IA 4ZKDA 1NLUA 3UFXA 3W3ZB 5LP6A 2OXCA 4MI9A 2XB9A 3BMCA 4O4IF 4XM0A 3R0VA 4XLLA 1E5XA 2AJBA 2M2IA 3MWKA 4A1FA 3ZQJA 1R64A 1X80B 4TTIA 5DPMA 5AXAA 1ZJ6A 1PFGA 4MMZB 5HTOA 1XZQA 1ND6A 5CH3A 1T1EA 3MJEA 1I1HA 1W5BA 2V7PA 5E7JA 5FI1B 5FBKA 5B3JA 3T06B 4XVRA 1BU8A 3PDHA 4UDNA 3A1NA 4CNBA 5K6AC 5KOHB 3G1TA 3VVBA 1PNRA 5MHTA 3IJ5A 2AD1A 1EWRA 3F4LA 3QFSA 3ESRA 2UKDA 3HJUA 1UZNA 1A9RA 3PGA1 4CTMA 1NVAA 3BIOA 4QD3A 4U8HA 2NNLD 2RSLA 4FOTA 2CVFA 3QFTA 1DBWA 2XMQA 3FX2A 3ESAA 1HDEA 3W9YA 3E5HA 3REQB 4D80A 4PNEA 4GXQA 4K0RA 1JHVA 4KLRA 3FAZA 4IX9A 4ETMA 2VTBB 1XMOB 1X8JA 2BE9A 4B7CA 1T6XA 3BKWA 4RUKA 5AXCA 4OMFG 2EP8A 5J63A 1HGXA 1L7DA 4EF6A 5LVAA 3KHTA 1X42A 1EIWA 5FJJA 2EZUA 1Y6QA 3QUQA 4M1QA 2BSAA 4S04A 3G2KA 5ALXA 3W77A 1W5AA 2I1QA 2I6FA 2ZTMA 2CXQA 3F2VA 4OHFA 4Z3DA 5ERYA 3SVTA 4FWTA 4AUNA 1U2ZA 3EWAA 2JLXA 5EAIA 4RA9B 3T7JA 3QK7A 1KGDA 4L4YA 2AR0A 3V46A 2RGGA 1TYZA 1NBMD 4L02A 3HCAA 5IABA 1W9MA 2HLDA 1O7JA 1Z2PX 2WJ3A 3IYLW 3OKCA 5TQ0A 3WBFA 4ZHQF 1RQLA 1UM8A 4MUJA 3FZEA 2VAPA 4IS3A 2BEVB 2XDAA 4X44A 1V5GA 2R8XA 3OQ1A 5AK0A 4ZGGA 2D0OB 2VHJA 4TV8B 5TQ2B 5FOSA 4B85A 2ZE5A 1KKUA 2XWPA 1WMFA 2O0LA 4Q4JA 4ONEA 3WYAA 2A9OA 4MB0A 1GLGA 4PQGA 2X2FA 5JROA 2X5KO 4Q39A 1JDBB 5FWNA 4GI5A 2Q3LA 2H48A 2QA5A 3I8OA 4KLCA 2HJRA 3WWZA 3TLJA 3PHBE 5BXYA 4R7TA 1J5PA 4CKCB 3LV8A 3L07A 4PS1A 3UEOA 1KFKB 4YUWA 3FR8A 3GOQA 1BE8A 1RD4A 4GMGA 4TMZA 3VYSB 1RAGA 2VBFA 4OXKA 4DJAA 2XKKA 1K27A 5AM2A 4WUTA 5SZJA 3RAEC 3F7OA 3QSGA 3V33A 1N0VC 1VCIA 1VLVA 3D6JA 1Y37A 5ECGC 4HAVA 3Q3JB 4DT1A 3IAS6 1G4HA 1YNOA 4X3PA 1R9JA 5JUWA 1E3JA 1AKWA 2CNOA 1KK1A 3BMQA 3OX4A 1JLKA 4W9NA 3CVYA 3GG2A 3VVMA 2VJMA 5JYBA 4D1YA 2F67A 2VYVD 3TYXA 1B8NA 2AQKA 3Q7PA 1AF4A 1F2TB 1SO8A 3NHUA 4ROTA 2AC7A 4HH3C 4CTJA 1S2LA 3GZJA 3NYQA 2G3YA 4R8LA 4TV9F 3TX2A 5FYDA 1U2DA 3KIPA 2RK4A 3LH5A 3PE4A 4JKYA 1S1MA 3OC0A 5DGDA 2WKPA 2YYYA 4RU1A 3ZW9A 2WWGA 2EEPA 4WACA 1LS1A 3U4HA 1SJ9A 1YZHA 4HN9A 2VF2A 2VRCA 4PLZA 5C4IA 2W2VA 4ARZB 2VWHA 1EIZA 1I3KA 4G5GA 2A92A 1HE2A 4HJXA 4K03A 2F8TA 3KE9A 1QIFA 1W6RA 2CB0A 3GBSA 3FYUC 3KQYA 3AI3A 3HDYA 1BMFA 1RRKA 1VZ3A 4NNPA 5IAOA 2C7PA 1MFPA 2QG6A 2NUAA 4A4DA 3K3PA 2OB2A 2PS9A 3NDBB 3EMDA 3FPLA 2XDWA 4NQRA 3BXHA 3EIXA 4PZUA 1A04A 4OGFA 4UAVA 5LLSA 3DD5A 5B12A 2JLUA 1DQZA 1G3UA 1SMKA 3M0EA 4U7WA 4Z9AA 3IPRA 4ZAGA 3V1KA 3ZUPA 1JIKA 2XZDA 3L7KA 1EVEA 1IZZA 3PNBA 4G1FA 4ZYUA 3GVIA 2NO9A 4BN4A 4BV3A 3MGBA 3ROXA 4H77A 5CX1A 2EBWA 1NRIA 1DTWA 5CB8A 1P17A 1XTZA 2BAGA 2YBEA 4TYQA 3G02A 1J2UA 3W79A 4RL6A 2IKQA 5IAEA 4E5YA 2SICE 2QZZA 1JEJA 4UW9A 3QI2A 5P21A 1GSHA 4R2LA 5BN5B 1R4MA 1ZAKA 2BFCB 5BYBA 2BSQA 3HR4A 1S8AA 1G4AE 3CWZA 4H4CA 1AO0A 5C8DA 1IHXA 1KI9A 1RRCA 1NMEA 3OCWA 5JSUA 5LQUA 3G8BA 3N0TA 1EK6A 4BU0A 1USWA 1V4NA 2DR3A 5ALGA 4DWWA 2XBMA 1QV9A 3D8HA 1JZQA 5BV1A 2HXYA 1G7CA 2AMVA 2WILA 2F1RA 3W9UA 1IWPB 4DA8A 3AX6A 1R0RE 2E18A 4L75A 3RYFB 5DTMA 4ZYVA 2BMDA 5EJEA 5JWOA 2WJWA 1FYDA 1GN8A 2E85A 3JTEA 1PJSA 5D01A 4MWEA 1IM2A 1I3NA 3VR1A 1F2DA 1KA9H 4LDNA 3L7DA 4EUKA 1R6XA 3T38A 2HMWA 3DO6A 2FMHA 4DBLE 2RKOA 3EZ2A 2ZRCA 1OBVA 2JGKA 4J0QA 4EEZA 5KYTA 4BUCA 4DC1A 1ABEA 3E3MA 1GZ3A 1M3SA 4KN8A 4M9UA 4TUYA 2OAEA 3PQ7A 5E0OA 3VMFA 4YYEA 4BC1A 1NFRA 1EZ4A 2JIZA 3V1TC 5EZYB 4L9SA 1GR1A 4LVNA 2NU9B 4LPSA 4O5OA 1FW6A 2VPYA 1VRCA 4IDBA 2X2OA 1WETA 1JZTA 4G97A 4AF7A 2HNBA 3V7WA 4DUZB 2IPAB 3HCWA 3LNTA 3R9WA 2Y27A 3HNPA 1B8UA 4QQRA 2HRRA 4UNPA 2RGYA 4L9WA 5AK5A 3T41A 1SQ0A 3V8PA 3ZJ5A 5EIBD 4XCQA 4RHCA 2VHUA 3BWDD 3RUAA 1P5ZB 3OQBA 3LHKA 3L7AA 1TRHA 3WHPA 2JFGA 5M5BA 4ZGWA 5EJGA 3WTBA 1C9JA 2YN4A 2YS7A 4LYHA 1TXGA 1RR6A 3DZHA 4MPDA 2A0WA 1FLDA 3DE1X 3HKBB 1OXUA 1Q7EA 3TGPA 2FZKA 4WXMA 2GERA 2ZDQA 4GPIB 3T3HA 4BQQA 3HM9A 5DK4A 2JVJA 2H2AA 1HXHA 3CF4G 4M0LA 1NQAO 3CG0A 3GH1A 2FZCA 3MGAA 4MK4A 1N2SA 2QRUA 1XTKA 4Z0TA 4WZBB 1UBJS 2BGJA 2E6KA 3DMYA 5CXSA 3CR3C 3EMBA 5A3RA 2FJ0A 1F2UA 1KJQA 2PUGA 3W9BA 2BRUC 2F1OA 1JNYA 3GXOA 3AOEA 3KOXA 1U65A 3TFWA 1W7AA 4TTTS 1IVSA 1Y3FE 4UMDA 2AG1A 1UJ6A 2UVQA 3SQNA 4MR9A 1CQIB 1C50A 4R54A 4HHEA 2ZIVB 1E1MA 5EHNA 1JUDA 3D3WA 3K1AB 2NUTB 3MC1A 4JJEA 4TMFA 2YN2A 3ZDYB 3R6LA 5HJ2A 5IKPA 1EXVA 2C7OA 3BMOA 1B41A 5F7ZA 4DSAA 1PD1A 4LNUA 2BFBA 2GJKA 2VBGA 4PGFA 3KHKA 3LBYA 4NY1A 1GPBA 2PX0A 3G5TA 4FINA 1WVMA 3D4LA 4P54A 4RHYA 3G1WA 3UGQA 3F90A 4DIOA 1M6WA 4XD2A 2ZUBA 1NL3A 1J24A 3I9LA 3S2IA 3KLOA 2Q6OA 3N5KA 3OQVA 4KMSA 4BCBA 3ZCTA 2VXOA 2J5XA 5K6AA 3M9LA 2HTEA 4DM7A 4AIIA 1PRYA 2Q27A 1MN6A 4GLLA 1GTZA 5G41A 1IZ8A 3L92A 2JAHA 4C76A 1SCIA 2PL3A 3BJZA 3GEEA 1AKRA 3I04M 3TCXB 4GQBA 5JJBA 3ER9A 1WL8A 2HRQA 3HJRA 4C30A 3AHIA 4QXRA 2IC5A 4ZAVA 1UC9A 1FFCA 1WSBA 2R8ZA 5GONA 3RUDA 3I61A 4YP0A 3ZN2A 1TJ4A 1XUOA 2FK7A 3LC2O 4L9RA 3KLBA 2JAWA 4TYYA 2VLIA 1XOIA 1TI7A 4NQZA 3GLIA 4BXOA 2H63A 1VI2A 3NAZA 5BR7A 2ZRNA 3AJRA 3IQZA 2I1VB 3L0IB 2P1DA 4LVOA 5J2TA 4W5QA 1V4VA 3VU1A 4F3RA 2W83A 3SOZA 1FYWA 3VOTA 1OZ0A 3D9QX 3NAQA 3FR7A 4URUR 4Y2TA 4TYNA 4AS3A 4MKZA 2G08A 2A14A 2I71A 2OCKA 3LBIA 3ROZA 3ZLVA 1XDBA 1FRZA 1KAOA 1KZHA 1T6YA 4B46A 4F4UA 3U26A 4HPWA 4B9EA 3AWIA 1CV2A 1YB4A 1F8UA 1E1CB 5E6UA 4BNMA 1Z68A 3SBEA 2WB2A 4MGYR 2DFKB 4R2WA 4LHWA 3THXA 3N2ZB 3E0XA 3Q8LA 4G56A 5CA1A 5JHHB 4XDYA 1YDEA 2H8KA 2PH5A 1T0PA 3HKEA 3KUCA 3N6XA 1B14A 2O9JA 3IEXA 3JQQA 3HVHA 3M6XA 1ZH6A 3DMFA 3FFAA 4HF7A 2WD8A 4LHZA 5G1NA 4CV0A 2NOAA 3KQVA 2J3MA 2CNNA 2Y66A 3LF1A 4CIXA 1MO5A 2ZR7A 1Z2NX 2GZMA 2C7VA 1TYEB 2ZEJA 3EFBA 1U8YA 3RS9A 4UFOA 3P4UA 3RHSA 5JCPA 2HPVA 2PD6A 2Q6LA 4WZ6A 4UXJA 3N86A 3JQFC 3QA3E 4FC6A 1NW6A 3FSEA 2C8VA 4MR8B 4CZ2A 1V43A 1NUHA 2D8MA 2WG2A 3MGGA 2QZSA 1RP1A 4IHJF 5ARCA 1GUYA 1P44A 4ZVUA 5AXDA 5JR3A 3OCJA 1HC7A 3PL1A 2GM4A 1N3YA 2R85A 4XGRA 3T99A 4HK4A 5JT1A 2J09A 1YBMA 4F21A 4QBKA 2VP2A 3MXOA 4OFXA 1FUIA 3X0DA 4FWBA 1GNPA 3U1BA 3EAGA 4B1FA 2XUZA 2PGOA 2Y68A 2YZGA 4G4SO 5LB4A 3CUSA 2WJ4A 3STUA 2EFJA 2LDXA 1BW9B 1XLTC 4UZSA 1E89A 3NCHA 3MS4A 1FY2A 1WXGA 5I4BA 3IOEA 3WLMA 2HWUA 1CZLA 3TR6A 1VE7A 5JS2A 1R16A 4F4CA 2YL2A 2NZVG 5DK6A 3C1AA 1H42A 4ISBA 1E3LA 5EIAA 1WE2A 1SHLA 2ASEA 1FE8A 3JD2A 4GYJA 1M1NA 2JLRA 1TJ5A 2XYQA 1Z26A 2ZYHA 1RC0A 3QVLA 5EKDA 3DBRB 5I7EA 3FYUA 2Q1XA 5B2FA 2UZ0A 2QM7A 3D31A 5DLYA 4BFUA 3GN1A 3T7CA 1YBFA 3T5GA 1OJLA 2CYAA 1WKCA 2MSNA 1E0DA 1P62B 4TV8F 5EXSA 3WAGA 3K09C 1CE8A 4J0DA 4R1QA 1OKKA 4L74A 5E2BA 1N8SA 1WPRA 2B7LA 2X8WA 2P1ZA 4DCOA 4RK5A 4UD2A 5I9TA 4GOND 5CLJA 1GPNA 4JT4A 4CIVA 3IC5A 3V2HA 2VNAA 3H6KA 3MOIA 4EY7A 4EDHA 3RD5A 2WAAA 4B6JA 1I24A 3DAGA 1ZHOA 4PO3X 1M8FA 1NNUA 3C7AA 4ZZ2A 1ML4A 5KHAA 4UM9B 1P3JA 3NEAA 2CEKA 2QVZX 4OH7A 3OTOB 1KK2A 3QHQA 2WHQA 3H4MA 4J9UE 4PAQA 1JFLA 1U0OC 1YB2A 1Y63A 2HT6A 2X86A 3QVOA 1WD7A 5EOVA 5BW5A 1SKUA 5E4FA 1YAJA 3NHJA 4KQ9A 1W96A 2GI4A 5I9IA 3PWKA 4N8EA 4J0JA 5A71A 4L6IA 1IAVA 5LUAA 1E64A 5EVCA 2O6LA 1LX7A 3NWEA 4BVBA 3ICQB 1UANA 1L5ZA 1J1ZA 3R44A 2ECOA 2YHUA 4QQFA 4WZAB 3GRKA 3FGOA 4OA5A 1WHSA 2HF2A 2W5UA 2L2QA 5FT9A 1YB6A 5CEEA 1JG6A 1L9XA 4H0FA 4JLSA 3TTSA 3L82B 2LZ0A 1PUXA 4EWLA 4Q47A 4KZKA 5DI9A 4MRVA 4XEHA 1N9ZA 4HN4B 3W06A 2HN9A 4LGYA 2GUWA 4YDSA 1L4UA 5BNFA 4BLPA 3WYEA 1SC9A 4Q7MB 1Z5GA 4YRDA 1NMSA 1I2CA 5IKEA 2ZIWB 3NFRA 2VDVE 5JCJD 1ZRHA 1TLTA 3Q9LA 3IVCA 1JFFA 3BC1A 2YUIA 4C21A 1IY0A 2OCPA 4HMPA 3DE2X 4KI0A 3SJBA 2PGLA 3K8QA 2AI1A 4DQ0A 5CDYA 4YIHA 1I4DD 1XNGA 3DZJA 3T7DA 3QVGB 2JC3A 4PX5A 4LJSA 2GWHA 3O4FA 4PCAA 4RPCA 1Q1QA 3H04A 1A69A 3V5NA 4YUZA 4B0PA 1XMQB 1G5RA 1GHTA 3F3KA 4HLNA 3UK0A 2I3GA 1AZLA 3GRZA 4I5IA 1HT2E 3N2GA 1Z7BA 1JWLA 4PQRA 4P5DA 4W6QA 1TO2E 2EQAA 3VNBA 3EPRA 3W1EA 2QQGA 1VHWA 4Z6KA 4YECA 2J9XB 4LZJA 1P80A 1PK8A 3T3MB 1ZNQO 2FW7A 4Q4HA 2YKGA 5G4KB 1A2OA 4UE3S 5FBHA 3GAMA 3T54A 2XT0A 1NNSA 3Q9UA 4LWPA 3R1IA 3RKUA 1UBUS 2X7HA 3CH5A 4AZVA 5K2OA 3PEVA 2ZJ5A 3J80A 2HMTA 5HZHA 3HBMA 2B36A 3OSUA 1IJKA 1FOEB 1G2OA 2V6FA 4X71A 2JHAA 4IIFA 5KNDD 1CFJA 1RNLA 2J4CA 5CCXA 5AFSA 3V32A 3HFGA 3AEYA 5CLQA 4PAWA 3TE7A 2AFIE 1Z4LA 1Y8QA 2BRUA 4P81A 4DEXA 2WICA 4O4LB 4LF7B 5ALUA 2B4AA 4IOJA 4QM6A 3F1LA 1U28C 3TPZA 4PEVA 4PSAA 1BD4A 3VKWA 2ZUTA 1YR6A 1SFRA 4X1YB 1HLPA 2GNOA 1GNSA 1FYEA 1HDOA 2I8CA 2O7NA 3OEYA 3OZGA 1KDVA 4BO6A 2X1HA 3ZGLA 2RHMA 4B47A 1NZDA 3LZ6A 4MYRA 3L6BA 1OGYA 5HG0A 5A4DA 4JR2A 1R0WA 3BXFA 4WJKB 3ROKA 1ECCA 1TX4B 1ZITA 2JGAA 3KUKA 1IZ7A 5AJZA 5PGMA 4D8UA 5JZBA 1BYUA 2G76A 2P2SA 3BGIA 3MPUA 4M55A 4MXDA 4QDKA 3NBXX 1TMOA 1FA9A 1W85B 2HD4A 3DW1X 1JYEA 1SY7A 3K1JA 1ZY2A 4E4RA 1JE1A 3JASA 1L8AA 4YCAA 3UAZA 4P0PB 4CCYB 4HP8A 2GK7A 3ZXSA 3UMMA 1AN9A 3FI9A 2FK8A 1VG9B 3TQHA 3ZTWA 4D26A 2PT7A 2QRJA 3R6TA 4ZOLA 3TJZA 1FSGA 4GPZA 1JQ3A 2Y2UA 4PTLA 2Q7OE 2VT2A 5BV0A 4A7PA 1QVWA 3TNLA 2HZ7A 3ELWA 1PEAA 1S5PA 5F78A 2NVOA 4R2XA 1E4EA 1NC3A 2O0JA 3KYCB 2C0PA 5K0ZA 2IZOA 2WG1A 4E5KA 4MICA 5AHRA 3KTDA 4EGAA 2NXWA 3VTFA 2H2GA 1P4SA 3D3QA 1TEZA 1PV4A 2BH9A 2BKEA 1JG7A 3BJRA 2N75A 4KO1S 1BFDA 5HCNA 3VDMA 3HY6A 3G2JA 3QE4A 2ZXUA 1U63A 4Y7CA 5FI5A 1JA9A 1F5NA 4O2AB 4Z4HA 1BVYF 2I2XB 3EZLA 3Q7SA 3IPLA 1CPYA 4NH0A 2OC9A 2CXNA 4GEKA 4H0NA 1C7JA 2HHAA 1OLOA 4L8GA 3DDHA 1SNYA 1S8NA 1EFPA 1BHO1 3CEHA 3KYDA 1U2PA 1CS0A 4ACAA 2CFOA 2XW6A 2KI5A 3KBOA 4ZCMA 2ZXEA 4CKWB 4BNGA 4EAQA 5DN6D 2I8AA 4GYKA 4KIJA 1HX7A 4IFEA 2C99A 3NIDB 1N3LA 4QASA 5T3UA 3U0VA 4EATA 3AG6A 1VMEA 1LD3A 1YVPA 1YQWA 2RI6A 2GYVA 2FEPA 1SGWA 1IXKA 1UJNA 2VYNA 1EFRA 2IS4A 2Q99A 4ZOEA 2ODAA 3BDIA 3TW8B 3C4JA 1F0YA 3R9IA 4B09A 1OQAA 1Z5UA 3AWDA 4JXKA 2Z4SA 3KAPA 5B1HA 4WQMA 2J9GA 4NFSA 4WA8A 4MB6A 1G20A 1O96B 2X0FA 3JQFA 1DBIA 2ZI3A 3WL8A 2YNMD 3WGJA 5AW4A 2DKFA 2H65A 2DUMA 1I2ZA 1ZGJA 4KO8A 2O2JA 5A9RA 1IIRA 3MWLA 3OIUA 3KR2A 3SMVA 3VYTB 1PBNA 1AHHA 1GVHA 1KJYA 2GYUA 3KXLA 5T4HA 3TINA 3VR5D 1KBZA 3M5CA 4DR2B 3C8ZA 4K7JA 2VC2B 3ECCA 3OE1A 4NCIA 1RMQA 2A5JA 4OKNA 4PG6A 4PIPA 2NPOA 4WN3A 4FFRA 4FGSA 2NUPA 3GH3A 3L6OO 3MG9A 4BOYA 2XVYA 1Q2XA 1N2IA 4AYWA 1R0ZA 1AQ6A 1T2CA 1HM5A 1U7WA 3NUZA 1V11A 3OLXA 4XTCS 1OT5A 2O7RA 2FSUA 4DDVA 2ZRIA 3O1IC 1GRCA 4ERNA 3VTKA 1XLTA 2QJFA 4TQ9A 1XU4A 3CLRD 3AHJA 4HXGA 1E6UA 2IPOA 5B53A 1F1JA 1KI7A 2L42A 2JD1A 1Z38A 5A5GA 4EG6A 1GP2A 1YR2A 5KDDA 2KLBA 3AY0A 3HK2A 5CDGA 1GL7A 2ZBUA 3Q3VA 5ALWA 4MVJH 4RGVA 3BMXA 3S28A 2G0NA 2IDJA 3IIIA 5EE5B 2WM9B 1WXWA 3UCFA 1QG6A 4MWTA 3TIGA 4BNNA 3C6YA 1CEYA 5IH3A 3MUFA 4Q82A 4BEJA 4Y6LA 3HWRA 4A03A 4K9DA 2O5CA 3OAAA 4PE5B 1EFVB 1SKYB 1CUAA 1VPVA 2I78A 1KMIY 3Q88A 3BT7A 3K09A 3N8KA 3WBKA 2R8PA 5J2UA 2W42A 3GFPA 1XZBA 5ITZB 5THXA 4PQYA 3JD1A 5SYAA 1FLAA 3I32A 2BI7A 1BGVA 3KTAB 1GWNA 3MWEB 2VH5R 2YQZA 3VBCA 2HV9A 3WLIA 1VPLA 2VEOA 1YS9A 2UXCB 5H82A 3H7IA 3QU9A 5DRTA 4FLEA 3OFNA 5F3RA 2O8BA 3EOZA 2GTPA 1JB1A 5FFMA 4F85A 3P7MA 2H52A 2G8LA 3C3YA 2FVXA 5LP1A 3EXG2 1BRTA 1ZCAA 2RGAA 2W43A 5C3UA 2ZQZA 4TLEA 2ZYWX 3D6NB 4ALLA 3UHJA 3ZTTA 3FBWA 2EFYA 4MJXA 1YE8A 3TPCA 3V4OA 3UMJA 2X42A 5KSWB 1CHNA 4GGPA 1LDYA 2C5FA 2EG5A 3OIVA 4GT1A 5LXTA 2QPLA 5HE9A 5TMBA 3MB5A 221PA 2V7QD 3I53A 3KO8A 2OO7A 1TQ8A 5I7UA 4XYEA 3DTVA 5JPDA 1AE1A 2W6CX 3D1JA 4NHEA 5AMXA 5EWJB 4CM1A 2P41A 2P2DA 4U9HS 1KOFA 4FGWA 2Q07A 4CG3A 2Z0MA 3FB4A 3KKMA 4DPMA 1I7DA 2A86A 5EP1A 4XX1A 2ZWIA 3QIVA 1E7MA 3EDOA 5CNIA 3PJDA 2ORED 1LFAA 3AR2A 2VDKB 3GGSA 3JYPA 5HFJA 3SJUA 5HYVA 3A26A 3GFQA 3P4YA 1XRMA 3OBBA 3N2LA 1ADCA 5AM3A 3VR2D 5DEOA 1K8YB 2IX3A 4X66B 4CLOB 1Y81A 3E8MA 3AIMA 3HP4A 2B8NA 1LCIA 1IK6A 4FMPA 1LVUA 4FOLA 1E2LA 1KQ3A 1AKUA 3IR5A 4L28A 1AXGA 1N2BA 4RK4A 4WZAE 3VAZA 1FPQA 1DJNA 5FH9A 2XTAA 5IK2A 1TQDA 4I0WB 2J0QA 1NXQA 3PGMA 3JPWA 4G67A 4Z7OB 3WA7A 3RIXA 4Z53A 3IXLA 5LQKA 4KSCA 1R0SA 1FXUA 4CEIB 3TUZC 1RCUA 1I51A 3IO5A 3OCYA 3BWVA 1NNI1 2I22A 2P91A 5BQOA 2ATVA 3B85A 4BP8A 4CHGA 3N9IA 1XAGA 4MRMA 4UUNA 1IN4A 3TECE 1F51E 3HBNA 3FSGA 2RGUA 2LGJA 5FBVB 2YWJA 3C5CA 1ISHA 4F92B 2Z2JA 3AT1A 4KAXA 3E9ZA 4WXYB 2IVZA 2ZS7A 5F33A 3U7IA 4TKVA 2NV6A 4KPFC 4FE3A 4HZGA 1SQGA 3DWIA 3GT0A 1SU7A 5FL7D 1SUWA 1YZQA 3GDHA 4DLNA 3ZNPA 1YI8A 4HNVA 1UH5A 1KAMA 1PYGA 3IKTA 2YY6A 1RZVA 5JYDA 3UXMA 1N2JA 3WLJA 1FFHA 3GGOA 4I1VA 1G8PA 3LXRA 5DULA 3ZDFA 5JMTA 4KWCA 4JT8A 3P9PA 1X39A 2LD4A 1W2WB 4EG3A 3UCEA 1KQFA 4DB4A 2O5EA 5B1YA 2FE4A 2Q50A 5G1OA 1U28A 1TAQA 2YZ2A 4G1VA 1HT3A 3LOPA 3WWOA 3ZD8A 2FGKA 1G8SA 1O97C 2D5LA 2V3WA 3EEBA 3VDRA 3BWXA 3KQWA 2ANCA 4OGWA 3WLNA 4EYEA 3QVJA 2OV2A 1YACA 1IMJA 3R3WA 4LDQA 4IMJB 1QE5A 2Q6IA 5ALOA 3TB4A 1UFOA 2WZCA 3KVNA 1Z0SA 3QXJA 3T7EA 2XXJA 1P2GA 1DWQA 2NACA 2WQ6A 5F4BA 4MQUA 4C88A 3HXQA 1CUBA 1RABA 1NXWA 2ZSUA 3I58A 3OPVA 2BLLA 3BHJA 4FZRA 2R9VA 2O8EB 5H0IA 5HIJA 1C7RA 3G6KA 5CPFA 3KSRA 4I9GA 2WINI 3ESCA 2ZJ8A 3LKZA 5BWMA 4EPWA 1H8ED 1BA2A 5AVOA 1RAFA 3JAWA 2CUNA 3MILA 4MYHA 1R6AA 2V0NA 5IVIA 4Z86A 1M2EA 3RU3A 1QGDA 4JUIA 2BR5A 4LOJA 4HUJA 1SVMA 4FXOA 3WRVA 2OQRA 4U2DA 4DWOA 1U5BB 2NO7A 1KJ9A 2Q4TA 5BN3A 2X41A 3DV0B 3WLHA 4RFSA 3OE4A 3I1IA 4PYLA 4FGZA 2GN6A 4IQFA 4MB2A 3PPYA 1M72A 2ZK7A 5EJ2A 1A98A 4IJWA 1LLDA 4M98A 5H70A 5KNLA 3AKYA 4S1OA 1DBQA 3OFSA 3INNA 3RW9A 2QI9F 4TTRA 2REXB 2C31A 3KB8A 3ILVA 1OXBB 3ZHBA 2C3OA 1P0CA 1TJPB 2YVAA 4UNSA 1VB5A 5D8DA 1XQ9A 2FWPA 4L15A 3RTAA 5LL6P 4WOPA 2DTDA 1MV5A 1O6ZA 2BEUA 2Z1DA 2H57A 3RSOA 4HDMB 4AJ4A 3FPJA 2FEAA 2E55A 3MHPA 1SVUA 1NVDA 3EMKA 1F17A 2OSBA 1V41E 2BM0A 4ZVTA 3IPAA 4MQLA 1Z36A 1VG0B 3RJMA 2YIDA 2CSXA 2PIDA 4MUIA 3SQXA 4MVYA 3LQKA 3K31A 4B7AA 2DAPA 3HVIA 4KREA 5D3MB 3MTBA 3UY4A 1W0JD 2YIJA 4UJ3A 3ZY3A 1QC5A 2PR2A 4DSUA 1P5RA 2EKDA 3BK1A 1XZCA 2ADFA 3V9AA 3CPJB 3Q9NA 4PC2A 5EHIA 2P9QA 2Y71A 4KV9A 2HQBA 1Z7YA 5KTRA 4NENA 4E5VA 3LPNA 1E1QD 4HQLA 4GI1A 4CJXA 5FHQA 4GH5A 2VHTA 5KX5F 4AU1A 2FPOA 3RFCA 3NCTA 5EYPA 1YZ3A 2IE0A 1WXXA 2WLTA 4RJIA 3N2YA 5DHPA 1XZGA 2QW0X 3B6EA 5HF8A 3HCFA 1XTIA 2HTFA 2WMDA 5AVTA 1RI5A 2AC4A 2BMEA 3LFTA 4Z51A 3HLKA 1FNBA 4Q1AA 5IVHA 2GCOA 5BVHA 3EEYA 5LMNB 1ZD1A 5A2GA 3HKDB 5SZKB 4YK7A 1KR2A 2P6RA 4R3NA 2XQJA 4TSKA 4C1BA 2O3TA 2Z9CA 4QG7A 1I4LD 2H1OA 1E18A 3A3KA 3RK4A 2Z6UA 4PZYA 5BSGA 4BLRA 1SOUA 1V9SA 2G09A 2XTZA 3M1AA 3WWYA 5B7GA 2C2MA 3ONWA 4URXR 5LJIA 1OFUA 1YRWA 4FJ1A 3TWOA 1EGAA 3UHFA 2R6HA 4GSKA 1GTSA 4YP1A 3B5JA 5C7IO 1DAEA 1M1YA 4P82A 3BTUA 3L7OA 2PQ2A 4F3NA 1NN3A 2ZVPX 1XEFA 1JDTA 2B21A 2GPJA 3CNLA 2H17A 1AQLA 3HGTA 1KE2A 5KYUA 3R74A 5DXAA 4CG0A 1SHJA 4UBIA 2M6SA 2J3LA 3TLGA 1JX6A 2G28A 3MYYA 3LBHA 3MJVA 4GF5A 3LHDA 2VQFB 2I7CA 4RIHA 3VYRB 4IDCA 2BFDA 3HNOA 4AYXA 2O52A 3B8EA 1TO1E 2JH3A 4JODA 3GU3A 4ZT7A 1C3LA 1XRNA 2RGDA 2P5TB 4QJBA 5A06A 2FHSA 4HB2A 1DAMA 4AS1A 1JFRA 3GJQA 5J5AA 3BRWD 2IIBA 4YO7A 5HR5A 1ZD3A 1V8BA 2X8JA 5B6JA 3E9NA 1CRZA 2AX3A 2HA2A 2NQ8A 3NC0C 1KNQA 1U8EA 3V8MA 2C3MA 1KO1A 1EP2B 3FYSA 4M49A 3ME5A 4KXLA 2NQ2C 3UAWA 3I62A 1MAAA 3N28A 2OYSA 4O63O 5DLEA 1YFZA 4N49A 2QT9A 1XE3A 4BFLA 4YLYA 5FA5A 3AUUA 2PT9A 4Y2UA 2FQYA 1GLNA 3FZQA 4KVAA 3FCYA 4OHWA 3OLYA 5EZ6B 3RF6A 1GFSA 3IDQA 3PGLA 4U7JA 3RBXA 8GPBA 3T8YA 1ECBA 2NTEA 1SKYE 2EC5A 3L1IA 3Q3CA 3ZOZA 4YI3A 5HA5A 1XF1A 1Y6FA 4BO7A 1E3SA 3OU6A 1LV8A 1KO4A 3EC1A 4EELA 1ZH2A 1GGHA 1KZGB 1XPJA 4B79A 4MINA 3WHKA 1Q0PA 1KS9A 3LVFO 1X3SA 1B3BA 1NJSA 2ZTSA 2PX2A 4GX2A 1E6CA 4IH4A 5FTMA 4D9EA 1RZRA 1OTHA