3SI7A

The crystal structure of the nbd1 domain of the mouse cftr protein, deltaf508 mutant
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
280
structure length
265
Chain Sequence
TGIIMENVTAFWEEGFGELLEKVQSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Requirements for efficient correction of DeltaF508 CFTR revealed by analyses of evolved sequences
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords Cystic fibrosis transmembrane conductance regulator
total genus 90
structure length 265
sequence length 280
chains with identical sequence B, C, D
ec nomenclature ec 3.6.3.49: Transferred entry: 5.6.1.6.
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3si7A00
1TEVA 2FSFA 1YJ5A 3C8UA 3RVBA 1VG8A 3KXLA 4BLRA 2AXPA 2IHBA 4G5GA 2BKUA 3AF3A 4CEIB 3WNBA 4ARZB 2ZXUA 1RC8A 3SE0A 3VX4A 2ZU6A 4ZV4A 5GVSA 2DBYA 4RFSB 1NVVR 5DNYB 1MABA 3UMFA 1CEEA 2IXEA 1X1SA 1QVRA 3H4MA 1H65A 1M7GA 3IKJA 4UJ3A 4DLSA 1NP6A 2WOOA 4P4UA 3TJZA 5JWOA 5L3VA 2B8WA 3ZJYA 4GZLA 1XD8A 1WQ1R 2YC2C 3FMPB 4NCHA 4BLPA 4PQYA 2DPXA 2PLFA 3SYKA 2GBLA 4EFLA 3QE0A 3TNFA 5JEEA 2BDTA 2RGDA 4GDFA 4GPTA 4Q1AA 2ERXA 2H7VA 3DEFA 2MSEB 1KSFX 3SHFA 1KJYA 4OHXA 4HZUA 4Q5IA 1XDBA 3AVOA 1IN6A 3QUSA 1S4QA 3K0FB 3SQXA 3IPYA 2GEUA 2WIBA 3PG5A 4CEHB 1L2TA 2E1RA 4WZBE 3SJBA 1AGPA 3K9NA 1QHXA 3EPLA 4A6PA 1U90A 4IDHA 5FUXA 4BGDA 2ZJ2A 3WP1B 4HLDA 4CEHA 3M6AA 1N0UA 1EFRA 2Q6TA 4EFNA 2R8RA 4WXRA 2W0MA 4AKGA 3LO5A 1E2EA 4XVUA 1E0SA 2GZHA 3IBGA 5EUMA 2FX3A 1Y3AA 2H17A 2NO7A 2GJ9A 2GNOA 4G5QA 4PHHA 1G4UR 1IN4A 2EWVA 4LBZA 1P9NA 1RRPA 4DCTA 2HCBA 1W44A 2R9VA 2ZITA 3HU1A 4G3XA 2ODBA 2MSDB 3QXSA 2DFKB 4E03A 5JSZB 4B3XA 3W90A 2HYDA 2O8EB 3RC3A 1G5RA 4O25A 1IQPA 5L3RA 621PA 2UZ3A 2FNAA 1LY1A 4RD6A 1NLYA 4MKFA 2NPFA 4PANA 1GL9B 1O87A 2ZR7A 1JJ7A 3QPWA 1E4YA 1DOAA 1N0VC 3OE7A 4PC1A 2WOJA 3WHLA 6Q21A 5HPYB 1F5NA 3A4NA 1PUJA 4MYUA 5J4YA 4KVAA 2JLZA 4AYXA 5CYOA 1DEKA 1Z22A 1T3SA 3SFVA 4M9ZA 1WXQA 3TKLA 4PSAA 2BBTA 4LC1A 3DKPA 1NJGA 4KXFB 3ZD7A 1ZUHA 1GP2A 2D7CA 3LNCA 5JRJA 1ESNA 3A4MA 4LJ7A 3DMDA 1HE8B 1II8B 2IUTA 2FH5B 5IK2D 5K8TA 4KU4A 2A5JA 4Q1BA 1E2LA 2OBNA 1Z0IA 1EX6A 1VCIA 4LYFA 1OH5A 2V3CC 3CZPA 4EPVA 2JJ2D 3CF2A 3L43A 1KK0A 2ZJZA 2OCBA 3IBYA 3JZMA 4U02A 2R6GA 4Q9LA 3WP0A 1SXJA 2F6RA 2WZQA 1P4SA 4W5WA 5JECA 4B3BA 2J0QA 3TUIC 4O2RA 3OFND 2XNDD 4D4LA 1VYUA 1OB2A 1CJKC 1ELOA 2EW1A 1XXHB 2YINC 1WP9A 1QHHB 3CRVA 3K0AB 5LDDC 2RGBA 4D81A 2PMDA 3KQNA 2XTMA 5JEDA 2OESA 2O0JA 1BH2A 3HYTA 5FBRB 1M6NA 2ZYUX 1DBSA 4P4TA 3QXHA 1W0KD 2CLCX 4AURA 4C0KA 4PSKA 5TB5A 4OQMA 1ZMXA 3ZIAD 1JEDA 1H8HD 2IL1A 3ZDQA 1YZQA 3IPXA 3NBYC 3R8CA 3R9IA 2C04A 2QTVB 4C0JA 1XCGB 3QOFA 2ORWA 1T3HA 2HV8A 3MWLA 1OJLA 2IW3A 3P4YA 5JCPA 4Q21A 1CJVC 5C1BA 3C4JA 2B6HA 4BECA 3TE6A 1GKIA 3GLHB 3CNLA 4WZAE 1SULA 5CM8B 4NYIQ 4HLUA 1E6CA 2ZEJA 2ZI5A 1EWQA 4RD3A 2IYXA 4A2QA 1Q3HA 2W58A 5FH9A 1DAMA 3OIUA 3G82C 2V8OA 2ZRCA 3OEED 3QXJA 1Z6TA 2JLWA 1HTWA 2ZYVX 4TL9A 2ODWA 2QSYA 4MKGA 3W6PA 3ZS9A 1EFTA 1Q1EA 1IN5A 4KLNA 3EASA 1YU9A 1F2TB 2YOGA 1KHTA 1SVLA 1XD2B 4JJKA 1R5OA 3U3OA 1G3MA 5KDDA 1L7VC 1NMZA 4KYUA 3I3SR 3RHFA 1DTSA 2Z43A 3I8XA 3QVVA 2QE7A 4I1UA 3U4QA 1M34E 3B9QA 1VYTA 4LHVA 2VSXA 2O8FB 4G5SA 1BYUA 2A5YB 1OXTA 2HF9A 5GADl 1TPZA 3QEOA 1UAAA 5J4LA 2ZE7A 2RHMA 1G4AE 5G53C 2ZAMA 1WMSA 3THXB 3CZQA 3H0KA 4OQFA 1N3BA 2ZRPA 3QVUA 5EP1A 1AJEA 2NGRA 5KPJA 5F2EA 3A58B 2CEAA 2JAQA 3EIHA 1A5TA 4WZ6A 4M1YA 2J9RA 2MMCA 3FWYA 5KNBA 2OUKA 2R65A 1A2BA 4AI6A 1FX0B 3IIKA 5FPTA 5H70A 1FX0A 1OT3A 4HUQA 1A82A 3WBKA 1IM2A 1KAGA 4Q00A 2IUUA 2XZPA 4A8JA 1OH8A 3SZRA 1D5CA 1JI0A 4LYHA 1VECA 3KL4A 1HEIA 3IHWA 2BEJA 2Z4SA 2GF9A 3TQCA 3PR1A 2PT5A 3PUWA 1N5LA 2ZRMA 4Q19A 2J0UB 4U5XA 3JZAA 5FTLA 1FP6A 1Z0KA 4GT1A 3PENA 3NTUA 4UNRA 3T06B 3L2OB 5DYIA 2J45A 3V4RA 3BIFA 2REOA 3A6PC 2XNSA 1GKUB 1MV5A 2FJUA 3WMEA 4CW7A 2B7CA 4HLCA 4UNSA 3RS0A 1KI7A 4LSGA 3SQWA 1GL7A 3VR4A 5BYKA 3MWKA 2CVFA 2VSOA 3N2IA 1NSFA 2ZPTX 4KJZA 3EWAA 3U7FB 4Z1MA 3MRSA 4B3CA 2D2EA 1Q1QA 4BQSA 1D2NA 4M0LA 1OXVA 3U2QA 2O0HA 4G1UC 5GJBA 1W4BA 5L3QA 2GCOB 2XOKD 1UFQA 4LOAA 3RYTC 1FZQA 4QG7A 3KXIA 1I4DD 1P9RA 4XJXA 3ONWA 3R7WB 1KSHA 2BMFA 4B71A 2F9LA 1Z0AA 3GEIA 1RRCA 2IS6A 3W3AA 3CWQA 3TSZA 4YDSA 1D8TA 3LW8A 3VFDA 2ZANA 3DZDA 3FHCB 1A1VA 1TUIA 3QF4A 5CDFA 2FFBA 3QEJA 1E9SA 5HCIA 1F2UB 1U8AA 2QQ0A 4LV8B 4C7OA 4ACAA 2EFEB 1T0JB 4FINA 4QL3A 3RRMA 2NPIA 3T1VA 2C78A 4C0BA 4DB4A 2PH1A 4A92A 2VL7A 1GTVA 3SYLA 5B58C 2FA9A 3QKSB 2ZSFA 2GILA 2IYVA 1OF1A 1TQ4A 2JJ1A 3ASYA 4EQ6A 1Y63A 1WE2A 4DUGD 4DIEA 3A1SA 4AKHA 1C4OA 3IEVA 4R71A 1IONA 3U4QB 1HQCA 2QGNA 3TBKA 3EWSA 1KKMA 2BOVA 2ZJOA 2EYQA 1OKKD 2VP0A 3D3QA 2O8BA 4BFSA 3B9PA 1N25A 5A4JA 1FFHA 3MFYA 2YWEA 2XSZD 3O8DA 1E2HA 1E2QA 3U6KA 2VQSA 2P67A 2PZEA 2FFAA 4B48A 2IBMA 2ZJBA 5K8LA 2QT1A 2FDCA 1E1RA 2BM0A 2ZSBA 1NSTA 1D2MA 1DAEA 2F7SA 3BRWD 1M7HA 3KKQA 4OJKA 3MUFA 1J70A 4RD2A 4TL8A 4ITRC 1DAIA 1G3QA 4EPWA 1XZPA 2H8KA 1L4UA 4XWAA 4RCZA 3GJ3A 1G5TA 4MGIR 2Q9BA 3TMKA 2LKDA 5E3HA 3IUYA 2XJ9A 1P2UA 5KPDA 1R10A 2TMKA 1AS0A 2KJQA 3W9YA 1IY2A 1G8FA 1XWIA 2PX0A 1GL6A 1TAGA 4Q1DA 2EYUA 4ZO4A 4FI3C 2ZSAA 5CLQA 3FVQA 4DDUA 3ZQJA 3BB4A 4QXAA 5IDVA 4C0SA 4Q66C 2J59A 3TSWA 5C4GB 2NO9A 3SEAA 1M8PA 3TK1A 4ABYA 2X77A 4TTPA 1TX4B 3BH6A 4NL4H 4DCUA 5JWHA 4IVQA 1W48A 1CTQA 1NN1A 3EZ9A 4A2WA 2W2XA 4Q9KA 1T4GA 2A30A 3BFVA 1JXMA 3U61B 2KSQA 1ZM9A 5E7MA 4B35A 8OHMA 3GLFE 5HR5A 1QBKC 2F55A 1OFIA 5TARA 1SXJD 1XTSA 4NBSA 2ZI9A 4TMXA 4IOKA 1XCMA 3NVAA 3JVVA 3PV0A 4II7A 2G9NA 2IWRA 4DCVA 3WBJA 2ZE8A 4NH0A 3PEWA 1KTVA 3TUJC 5HZHA 1OH7A 3GLIE 1LVGA 2GJ8A 3DOFA 4HYYA 4X8MA 1RJ9B 4QNRA 2GETA 2ZIAA 4JYBA 3TAUA 2E87A 1HURA 1UBEA 1XZQA 1NY6A 3FKSA 1TADA 5C18A 1P6XA 4IHQA 1COWD 3IQWA 2QL6A 2AFHE 5FOXA 4IDQA 4AG6A 2CJWA 4V0LA 3GQBA 1CRQA 4DXAA 1KDRA 1V43A 4DWJA 4FD2A 1XEWY 5SZKB 2BBSA 2HT6A 4YDHB 3B82A 4PFSA 1Q57A 4TZ6A 1L4YA 2N46A 4V0MA 1N6RA 1E0JA 2QPOA 4XD7A 4DSOA 4JLPA 1HQYE 1QHSA 5JBQA 4FCVA 4JLMA 1UM8A 2J87A 2QORA 2YV5A 2XX3A 3AF0A 2ANCA 3Q3JB 4KBFA 3AB3A 5KSPA 3DZ8A 3N70A 1F60A 3AQ4A 1N6LA 2G3YA 1XTJA 3LBNA 4Q7MB 4W7SA 821PA 5H68A 1NI3A 3D7MA 4PC3A 1NMXA 4ASUD 1W1WA 4F91B 1E98A 2XGJA 1YQTA 2HLDA 2R62A 4Q9JA 2IWHA 4HAWA 4Z8YA 1XTQA 3L0SA 1SKYE 1TTTA 5KO2A 3L82B 1W5SA 4QM7A 2J5XA 1UKYA 3BE4A 3GFOA 5P21A 2NTYC 2ZRIA 4NKRA 3X1WA 3X1DA 4DRZA 2RGEA 1OXSC 2QG6A 2ZRHA 3X1ZA 3F5FA 4TYYA 1G9XA 3GJXC 1EK0A 3PITA 1KI4A 2BV3A 4JT2A 4NHOA 4LJAA 2XITA 2WAYA 1KDPA 1NN5A 4RY2A 4OK6A 3CRRA 2IYYA 2GDJA 1OIWA 1KO1A 1R2QA 1PZNA 4TL6A 4QJ3A 4B34A 2J0VA 2GESA 2ZS9A 4HAUA 4D2IA 1T3LA 3SBEA 4ZKEA 4GP7A 1TF5A 1KO4A 2R6CA 1E4VA 2ZR0A 4QOSA 2VHCA 1E2JA 2NOAA 2OCPA 1FTNA 1OSNA 1Z83A 2QY9A 4X8LA 4B2IA 5C46F 2JLXA 1ZNXA 2FPLA 3EPKA 3PJRA 1U8YA 1X1RA 3A37A 1T0HB 4IXMA 4OI4A 4DLUA 5EP4A 4O2LA 4EQ6B 2IT1A 2OBMA 4HAVA 2REBA 4D4JA 2XB4A 4BZPA 1GITA 1M74A 4L9WA 1JALA 3AVYA 3MAAC 1TMKA 3E5HA 2RGNC 2QM7A 5E7JA 5B57C 2D2FA 2WWFA 2FWRA 5CJ2A 5LB2A 3Q9LA 4IEEA 4JBYA 4Q4JB 1F2UA 1MO3A 1NN0A 4ZIRA 1EFRD 1OXXK 3E1SA 4RD1A 2CHGA 3M0EA 5JSZA 4CEIA 1N6HA 4AKIA 2V55B 1DE0A 2NMVA 4DC9A 1LS1A 1VG9B 4KBGA 1Z2CA 3NH6A 4JLNA 1D9XA 1E9BA 1E2IA 4C30A 4DZZA 1VCOA 2O8DA 1Z2AA 5BN4A 2PLRA 1BMFD 1KMQA 3P4XA 3QENA 4AD8A 3OZXA 4C9BA 3LQQA 4XVRA 3T1OA 4M1WA 5FTMA 2QP3A 4C3ZA 1Z06A 3AKEA 4JVSB 3NC1C 1D9ZA 5J40A 4FN5A 1SXJC 4LV5B 3THYB 2VF7A 2EFDB 1R0YA 2OZEA 4LBYA 4CZ2A 2CE2X 4URXR 5HKKD 4KFRA 4TT3D 3IDQA 3THWA 1KO5A 1Q44A 4JLVA 4ZKDA 2CE7A 2IS4A 1N0WA 3DM9B 4DLXA 3BERA 4QNMA 1CKEA 4ZDJA 3WY9A 5FOUA 1GWNA 5TV2A 3IIMA 1NKTA 1NVVQ 2ZJ8A 1MH1A 2VA8A 1E9FA 2GAOA 3U7HB 5JLJA 2JEOA 1ZAKA 3I1FA 3OFNA 4H1UA 1R0XA 2RKOA 2IYSA 2D3WA 1NY5A 5BW8A 1Q20A 4HLQB 1G7CA 1G7SA 1JNYA 1XEXB 2XXAB 1U0HC 1E2PA 1HA3A 2CHVA 4LPKA 2C9CA 1W36D 4RCYA 1NIPA 1ZNYA 1PLJA 1KK1A 1Z5ZA 3FHOA 3H84A 3W5IA 2IX3A 3QKTA 1XP8A 5EXXA 3Q5EA 4Q01A 1Q0UA 2ZI3A 4MUBA 4TMTA 4YMVA 5CIWA 2QT0A 2W6IA 2KI5A 3R9WA 1KI3A 4TTRA 4BRWA 3T1TA 3CH5A 5F98A 4UQOA 2GCPA 2L0XA 2X19A 5DN6A 4IDPA 3ADCA 3R8FA 2ODNA 3GD7A 3I5XA 3VKGA 1VDZA 4NMMA 3BB1A 2P6UA 2C2HA 5IK2A 4ERNA 5KHOC 3REGA 1KY3A 1ZCBA 1N6PA 3UPUA 4C0LA 2KB0A 4F4JA 4GBMA 4RD0A 2LWIA 1WCV1 2GXSA 4TSFD 3EARA 3ZD6A 3VHLB 3DMNA 4B32A 3BORA 3O8BA 1AGRA 4KFUA 2ZS8A 1YR6A 2FE4A 1G291 1SHKA 4EIWA 3U5ZB 1R8QA 1UJ2A 4Q1CA 2XB2A 2AD5A 3KKMA 1E32A 2R6DA 3VNUA 2O8CA 3W6OA 2IEYA 4A8JB 2EWWA 3KB2A 3WMFA 2BMEA 5IHPA 3AP2A 1U9IA 1AKEA 2QRZA 1Z3IX 3QG5A 4M2LA 4L4UA 3UKDA 4IW3B 2UKDA 1EFCA 4M4SA 4LK2A 1H8HA 3B5JA 4BFUA 4KCGA 3RS4A 1NN3A 3EIEA 1LS6A 4Q18A 2P6RA 3ZH9B 3WMGA 4TLEA 2W6JD 3OAAD 4B33A 2IXFA 5FOWA 2ERYA 1F6BA 3B8HA 3DVLA 3CW2A 2C9YA 5DN6D 1BMFA 4QJ5A 2CHQA 4IXNA 3RNLA 1XPUA 3DPUA 1UADA 2QTHA 4A8JC 2QEQA 4L8GA 1QHGA 4G5RA 2JCSA 2YNMA 4DVGA 2WSSD 1S3SA 1DAHA 3QBVA 4LBWA 5UKDA 3W8RA 3GLGA 4XH9B 3CR8A 2Z4RA 2X2EA 4DLVA 4L5BA 3BC1A 3F0TA 4TYPA 1CULC 4MYHA 5GVRA 4E09A 2YWFA 1XB2A 4JBWA 4HZIA 1RRGA 2D62A 4UNQA 3W34A 2Q9CA 4Q03A 3ZYCA 2ZRNA 4TMKA 2YKGA 1CS4C 3Q85A 5LD2B 1KIMA 2P6NA 2RB4A 5FR1A 1XXHA 2R6FA 1G8PA 2Q0HA 3PCRB 1MO6A 4PR0A 3RS5A 3U7EB 5KYKA 2GK6A 1KDOA 2GA8A 1J2JA 2J46A 1CR1A 4AWXA 4U7DA 3WYFA 5CITA 2ZRDA 4QJ4A 4XIGS 1OXUA 1SXJB 1X8KA 3LD9A 4CRWB 1GZSA 4EUNA 3HU2A 1G8HA 3VR1A 3VR6A 4FWIB 4QBIA 4NU0A 1GG2A 1MO4A 4GRAA 1VG0B 4Q7LA 2REXB 1EESA 3RRYA 1XEFA 3BD9A 4FXPA 3UXMA 2AWOA 4HUQB 3VKWA 3PEVA 5GJVC 4ZPXA 3ADDA 1D2EA 4TL7A 4D25A 1LNZA 4HDOB 2HYIC 1NNEA 3SJZA 1II0A 1VCNA 3EW9A 3Q7PA 1P62B 3GPLA 2WKRA 2R2AA 3KJIA 2GK7A 2ZJAA 2BWJA 1VIYA 2YC4C 1KI6B 2AKYA 3LWNA 4PPGA 2Q3FA 5CM9C 2AFIE 5AUOB 4GP6A 3RAPR 1EFHA 1DG3A 1ZIOA 1QVAA 2BJVA 2BKEA 4PC6A 4B43A 3EXAA 2BHRA 3THXA 4MRNA 2Q9AA 4MYTA 5DGXA 4WIAA 1RW4A 1FPMA 1JR3A 4MGZR 1KSJA 5DHAA 3KDSE 4F93B 1Q12A 1G20E 2ZSDA 4B3DA 4IDOA 1LF5A 4URYR 2QGZA 4DT1A 4JKIA 2ZRLA 4HATA 5ANRB 4MRSA 2C8VA 2ZETA 4QHTA 1E1RD 1PJRA 4OHYA 4PAOA 5JS7A 2OE2A 3EC2A 2GBLC 3DOEA 1U2RA 3I8SA 4N0EA 1XFAA 2VHJA 2AD1A 3GEEA 1IXSB 4P33A 2NO1A 4OKSA 2I4IA 2Q3HA 5EZ6B 3WNCA 2HJGA 4HUTA 1JXOA 4CT4B 4DLTA 3B1VA 1YZGA 1BYIA 3U3RA 4JVLA 3WRYC 2BVNA 5L8VA 4D4MA 2KE5A 4PQRA 4B2PA 1RJ9A 2W6JA 3OAAA 4OHWA 1X8JA 2UZIR 4IRUB 2O52A 2X2FA 2ZJYA 4PHFA 3TIFA 4N0DA 3FHTA 1JQJC 3NBFA 2YJTD 4A4DA 4NONA 1FW6A 4ESHA 2ZRFA 3KB1A 4JLBA 2RAPA 4NZYA 2AKAB 2J7PA 5J4KA 2P65A 1OIVA 2PCJA 1E2MA 4HZUB 4BFVA 5B30A 5EE5B 5AWFC 5J5CA 3ASZA 1IY1A 3HP1A 1YVDA 1FMLA 3NWJA 1U99A 3KKPA 5EXPA 4I1OA 3I32A 1XMIA 2FOLA 4MRRA 4Q4JA 5L3SB 1Q3TA 1UF9A 2QI9C 4FWTA 1VHLA 3TAHA 4PSVA 1E9CA 4XD7D 1Z6AA 3LVQE 2QUZA 2IXGA 2AR7A 3PFIA 1GRNA 4NCNA 1AQUA 5DI9A 2PZGA 4EAQA 1TU4A 4RFSA 3AEZA 3RS3A 4M8NE 2P0EA 2DFLA 4BFXA 2YYZA 2WJHA 3L0IB 3OEEA 4JJZA 5G3ZA 3UWOA 3CR7A 2WMNB 2F43B 4G0NA 4C2UA 1US8A 1XXHE 4PZLA 2QTFA 2WJVA 4LX0A 4RSGA 3QIAA 1VCMA 4M1MA 5BN3A 3QXCA 2A9KA 2V6IA 5FTKA 2BIFA 3TSOA 4LI0A 2WWIA 3D8BA 2QRNA 4UNPA 2RCNA 1GNQA 5M04A 2FFQA 1YKSA 2FGJA 4JS0A 4C0QC 4QGAA 4MUAA 3GMTA 4JIMA 2ZJ5A 4GSYA 1N5IA 4JLOA 4D0GA 4D82A 3B1ZA 2C95A 3QQ5A 1E94E 4QBFA 5EXSA 1ZINA 4LY6A 3ICEA 3GEHA 3NDPA 3B1YA 1GKYA 5DI3B 1Z6XA 2IF2A 3OHMA 1BS1A 4B44A 1Z63A 2O8BB 4B73A 5H8WA 3LRPA 3A8TA 2E9SA 2C96A 2DWOA 2JLYA 1NLZA 3PIRA 4K46A 2W0SA 5FUWA 1BIFA 3AGPA 4BRUA 4PPFA 1J8MF 5L3SA 1NKSA 1AZTA 1OYYA 3AF1A 3KQKA 4OYHA 3VTKA 3AGQA 2HXYA 2Z0MA 1AM4D 2WSMA 2YZ2A 2VYFA 3QKRA 4DT1B 3I73A 4YMSA 3AVXA 2OXRA 3MMPA 3ZS8A 2VF8A 3RS2A 1ESMA 4NYMR 4HDCA 2QAJA 4V02A 3LLMA 1G6HA 4KSBA 3TGPA 1WBBA 1RVDA 3K8YA 1DAGA 2VP2A 1E2DA 3R7WA 1OYWA 3U3JA 1OHHD 4RZ3A 3WHKA 4MDEA 1WDTA 3NBZC 4KITB 2XTNA 5JCZA 1JR6A 3LBIA 4US0R 4YLGA 3MWYW 1B23P 3HWSA 5FUYA 1Z07A 1L8QA 3ZZTA 3EZFA 1IXZA 3BGWA 1Z0FA 4IVPA 4Q4AA 2CMKA 3FOZA 1GNPA 3WXMA 2J0SA 2HEIA 1NBMD 1XRJA 3RABA 5JJKA 1MKYA 5CB6A 2JLRA 3EA5A 4Z8XA 4Y0VA 2WJIA 3QY0A 3A1WA 1V5WA 4KFSA 1AKYA 4BLSA 4LCBA 4GMXA 2HLDD 1KK3A 1GM5A 1P72A 2WPDD 1KKLA 2EFCB 4OQXA 2IYTA 3GLIB 3QI2A 2NZJA 3PQCA 1NVUQ 4M9XA 2C98A 1CBUA 1Z29A 2JA1A 1S8FA 4XVQA 1E2KA 3GP8A 4PX9A 5G41A 2Q21A 1G1MA 3FMFA 3EG5A 1P2SA 3DHWC 1JPNA 4DBLC 5KDOA 1F48A 2ZRBA 5AJVB 1KJZA 2AN9A 2OLJA 3W5JA 4C4PA 1K8RA 4JLKA 3VX3A 4BWYA 4HDQB 1MT0A 1SHZA 1SVWA 4F7WA 1IJEA 3KQLA 2ZSEA 4ILEA 4ZCIA 1W0JA 3Q72A 2GKSA 4ON9A 1P60A 4BE7B 1HH4A 1CJMA 2PCLA 2ZRAA 1SGWA 3FMOB 4B76A 2IK8A 1C1YA 5F9FA 4JL6A 4Q48A 1XTKA 4ZCMA 4GNKA 2JJ1D 1RPZA 3AP1A 4LRWA 3P26A 4R98A 3SHWA 4M21A 4A0HA 2PZFA 1Z28A 3CO5A 5KUTA 1JAHA 4I1VA 5E4FA 1EGAA 2O8FA 3B6EA 3IO5A 2G77B 2DY1A 4ZCLA 2N1BA 3THOA 4TLCA 3E2IA 4H9GA 3K9HA 3GLIA 3B2EA 4G01B 4US1R 1T8UA 5TVKA 2A5FA 1RZ3A 3O47A 4UNNA 3A1UA 2AK2A 3NHAA 5JS8A 1DARA 1EWRA 3B60A 4DLYA 3WRXC 1WA5A 2HUPA 3GLGE 2VP9A 5FPSA 2BJWA 3GJ8A 1XCPA 2F1JA 4V0NA 3RLFA 1ZIPA 4Q9IA 1XMSA 3VU9B 4NYMQ 4PC7A 1ZU4A 2VSFA 3KX2A 3UMRA 2OILA 2GAAA 4NE2A 2WKQA 3RSLA 4DEYA 2H57A 1O3YA 3BXZA 1GRRA 1ODFA 4A6XA 1W4CA 3HPRA 3U6BA 2OV2A 1DS6A 2P5SA 4QHSA 1E3MA 1RKBA 3NBXX 3H2YA 2YOFA 1OIXA 3LXRA 5F9HA 5AUNB 1WBDA 4HAZA 4HB4A 5FL7D 2FEOA 2EVWX 3QXXA 2A5GA 4OK3A 3H1TA 1ZW6A 1YHNA 2RH5A 5JI3E 3LY5A 3EIQA 2DWPA 2WBLC 1W2GA 5FTNA 5FOVA 2QBYB 2B7BA 4ZIRB 2OCAA 4KO8A 4FW9A 1G8GA 1E9RA 2V1UA 1ZC4A 3OEHA 4ACBA 2I1QA 2GCOA 3BS4A 3UANA 4B2LA 4OI0A 2QP9X 4WXPA 2PJZA 2WJJA 3V4FA 2XXAA 2CXXA 3OESA 1IBRA 3ECCA 5CLLA 5DHFA 1G16A 1U0JA 4F92B 5DISB 2GCNA 4QHYA 4IOLA 4EPYA 1KI9A 1T8TA 2GRJA 5SZIA 1DADA 4DB2A 3PVSA 4MGYR 3MSXA 4WW0A 1R6BX 1G7RA 3T35A 1P2TA 4QBHA 5AK0A 4FMDB 1NLFA 4OK5A 2HJVA 2JJ8A 2PBRA 5D3QA 4DLZA 4N3NA 4LHYA 3Q8XB 3MJHA 4A0FA 2PT7A 5KOYA 2B21A 5FBLB 1Z6GA 1ZJ6A 1Q1BA 2BBWA 4GOXA 5HE9A 2ECKA 4HAYA 3P27A 3K0CC 4JKYA 2ZRJA 4HB3A 4QGGA 3SN6A 2H18A 3F3YA 2AL7A 2V4ZA 4R7ZA 1G3UA 2JATA 3I61A 3TVDA 5AR1A 2BM1A 4TSFA 4URUR 4R2IA 2Z6VA 2HXSA 2GTPA 4DDWA 3ZZ0A 721PA 4B3FX 1ZD1A 4PZZA 1JR3D 1XJ0A 4GI7A 3U44A 2RGGA 2AX4A 1NMYA 4R9UC 2VHTA 3T34A 1WRBA 3LAWA 5LB4A 3T12A 3GCGA 3K0CA 4NCJA 1GFIA 3A4LA 3FDIA 4I1SA 1OB5A 2FFHA 2XNDA 2VHUA 2BCJQ 2H5EA 2A78A 5A0FA 3C5CA 2IYZA 1R4AA 3AH8A 5KSYA 4RZUA 1UDXA 1UKEA 2JLVA 1C9KA 4HEJA 3BOSA 3K0SA 3KQHA 1X3SA 1IHUA 1CR0A 3CH4B 3KTAA 4IDNA 4Q4HA 4QGHA 2VIIA 5HZKA 1P75A 1CR4A 4M1SA 1Z0JA 3GJ7A 3CX8A 4TMWA 1PV4A 1GIAA 2IEZA 3C41J 4Q4AB 3HPQA 3C5HA 2SHKA 3CKLA 4EPXA 4E22A 1R5NA 1ZVQA 4HLUC 4LJ9A 2D7DA 1ZD9A 3UK6A 1Q21A 1F3OA 1W46A 2FSGA 5HKKA 2KBEA 2F1IA 1XTRA 4OQNA 4TYWA 1IAQA 1OPXA 3K70D 2WWGA 2LCFA 4DJTA 3NC0C 3GLFA 1DO0A 4FMDF 1KI1A 3DM5A 3QPUA 4V03A 1FUUA 3FFAA 5KTYA 4MRPA 3A1TA 4L15A 1DELA 4OJQA 3NKVA 4TLAA 1XMJA 3EAQA 1R7RA 2ZUCA 3GLHA 4S35A 1IXRC 2ZS7A 4BZQA 1U9IC 4JVMA 4C2TA 1D6JA 4LDJA 3L0PA 1AS3A 4R2HA 1I4TD 1UBCA 1YZNA 3TRFA 4BUJA 2HDNB 3G5UA 2AK3A 2FZLA 4PO1A 2WSSA 2J7KA 4AG5A 3RC8A 3EPHA 1E9EA 2WWYA 4NCKA 3VR2A 3LBHA 1T5LA 4L9SA 1W4AA 2JLSA 1JBKA 1G18A 3F8TA 3PEYA 2V6JA 1JEEA 1ZUNB 4YONB 1X86B 5JHGB 2FSIA 5CIQA 4LJ5A 3AVPA 1UBFA 2IYUA 1E9AA 1T6NA 1NRJB 1QRAA 3FFBA 1R0WA 3HDTA 4BFZA 4EPTA 121PA 3MGCA 1DPFA 1RYFA 4XTRA 3VR5A 2QPAA 4WBSA 1UEJA 4BEBA 2GXUA 1VG1A 4DHEA 5G3YA 2G0TA 1KY2A 3TUZC 3MLEA 3ND8A 1RYHA 3M1IA 5KDLA 5FBVB 4TQAA 2WWHA 1B0UA 3KFVA 1OFUX 4FMCF 2QMEA 4JLJA 1RRFA 4O0MA 3SJCA 3ZGXA 4EJSA 4M9SA 2VO1A 3T15A 4QM6A 2GEVA 2HT1A 1GSIA 4OHZA 5HCNA 3EPJA 2C9OA 3LQRA 4N1AA 4MYCA 3AVTA 5BN5A 4TYNA 1A7JA 3LLUA 1TQ2A 3CF0A 1JAIA 3LH5A 2GWHA 2R44A 1DAFA 2OAP1 2QE7D 2B8TA 2CNWA 2W2VA 3NG1A 4LJ8A 3T5DA 2ONJA 1TF7A 2OSBA 3OIVA 1G7TA 1ZP6A 4GL2A 4FIDA 1OFHA 2BMJA 1ANKA 3LDAA 2OM2A 2PMKA 1KI2A 2YHSA 1FNMA 3D6TB 1HYQA 1CXZA 1K5GA 1UPTA 2O8EA 1DO2A 2PX3A 1KDTA 1QHNA 5CK5A 3VKHA 1E79D 2OCYC 4IVRA 3SFZA 4BFYA 3EX7C 4NDZA 2H92A 3AVWA 5AJWA 2QNRA 5EP3A 4NYJQ 4MDFA 4W9MC 1HE1C 3CONA 3PUXA 4QRHA 3KUCA 4MH0R 4AYTA 1S9HA 5HE8A 2F9MA 5IRCD 1SKYB 3VNVA 1HUQA 2NO0A 3B1WA 3OE7D 4OBEA 4CVNA 1AN0A 4EPRA 1JB1A 3C15C 1XJQA 4DDTA 1FQKA 4V0KA 3ZZUA 4Z1MD 2H16A 3WNDA 3KFXA 3KXKA 2WMOB 3W6NA 4M1TA 1EFUA 1LV7A 2J3EA 2PL3A 4L16A 1RFLA 4K8OA 3N2EA 5GJCA 2V1XA 2DCUA 1W2HA 3NHBA 3T61A 4EDHA 5A5GA 1OV4A 2XAUA 2QM8A 3K9GA 4JLAA 1KZ7B 2J1LA 4BLTA 3MG9A 5FI1B 2VRWA 5B2ZA 1LF0A 4TN1A 3B7GA 5EE0A 4PZYA 2CCKA 4A15A 3KUDA 4Z54A 1BO6A 4G5OA 5IT5A 2WWWA 1DG1G 1XX6A 5D3MB 3GJ6A 4MKIA 4JBXA 1IJFA 4Q02A 3NEYA 3RWMB 3SBDA 4CDGA 5B64A 4KFTA 1J90A 3SR0A 1OH6A 4PHGA 1KI6A 3SDZA 2OFOA 1CF4A 2J0UA 4M22A 3FYHA 3QKSA 4PAQA 3HJNA 2FG5A 2ZVQX 5SZHB 1E2NA 3LXXA 5AJZA 1AK2A 3TW4A 1FOEB 2DHRA 4BPBA 5TMPA 5EUQB 521PA 2IHYA 1G19A 1TF2A 5LPNA 3GJ5A 1LTQA 4YC7A 3U3KA 3KQUA 2WICA 1S3GA 3CX7A 2FU5C 3B85A 2V7QA 2ORIA 1GVNB 4GMDA 3TR0A 4A0GA 2VLIA 1G3RA 2ZUBA 4FMBB 2ZI4A 3VMFA 2PJRA 5FPYA 1KMHB 4I4LA 3OIWA 4KHZA 5K8IA 2CL0X 2XZLA 1KOFA 4AKEA 2GZDA 3BH7A 3FKQA 1Z08A 4Q1EA 3NDBB 3CWZA 3A36A 1KJWA 1UEIA 3FMIA 4IKEA 4Q7JB 1NL3A 4DLWA 2LKCA 1G41A 2WJYA 1CR2A 3K09A 2JLQA 4DCNA 3CRQA 221PA 5DIFA 1A2KC 5L3QB 2O8CB 3S1AB 4LC0A 2FF7A 1AA9A 2CK3D 4GOJA 3CBQA 1XMVA 4AYWA 2A3RA 2QU8A 2DB3A 2ATVA 4DUGA 3DDCA 1AZSC 1VHTA 3DKVA 2FN4A 1G21E 2WAXA 1X6VA 4XSGA 1FQJA 1ONBA 1RE0A 2V7QD 3C16C 3AUXA 1SVMA 3RRZA 2MMGA 1NVWQ 3KTAB 5DSZA 1P5ZB 2X1VA 5KNDA 3WYGA 2GF0A 3GJ0A 3K53A 4EFMA 3GLGB 1OLOA 1NF3A 1S9DA 3V00A 1T9HA 2RHDA 5FBWB 4YMTA 4LHZA 4M53A 2I1VB 4AY2A 4D4KA 2O8DB 2W2TA 3IEUA 2Z83A 1GRQA 1SVKA 3GLHE 4TT3A 4BEJA 1FUKA 2QAGB 4P4SB 5H1YA 4KODA 1XPRA 1N2CE 4ZDIA 1J99A 1EX7A 1PLKA 3VHXA 4JSTA 3HU3A 5JMTA 3U44B 2JJ2A 4TMVA 2KWIA 4PAMA 3AF2A 4P4SA 2OFWA 3VQTA 1E69A 4B75A 4D26A 3SI7A 2GXAA 3ZIAA 4DSTA 5F3WB 1XF9A 5JRZA 2A7QA 1E0AA 4Q9HA 2OXCA 3M4YA 2FEMA 2AHOA 4LJ6A 3OEHD 1R0ZA 4HB2A 1CJUC 4XWOA 1VMAA 3X2SA 2DR3A 1BKDR 3QPVA 2W00A 5BQ5A 2Q3MA 2G83A 3RDPA 4LV6A 2ZE6A 2ZM5A 1W36C 4PTLA 1DVRA 1G64A 1NG1A 1UBGA 4JZKA 5TY0A 3SNHA 4NP6A 4M1KA 1NBME 2DWQA 1KNXA 3ZQ6A 1FTSA 2F1HA 1JPJA 4RKFA 1FL9A 3K0AA 5J4HA 1S96A 4ZI2A 4LHXA 2ZREA 3THWB 4EJSC 1KI8A 4AK9A 2YVUA 5E95A 1II9A 3L0OA 5CJPA 1ZYUA 4PO9A 4EKDA 1OW3B 4TMZA 2C77A 2OG2A 3THYA 2RGNA 4XSHA 4B47A 1SVIA 3NXSA 1YR9A 3IHLA 4Q47A 2XZOA 1HV8A 2CCGA 1KSGA 3LA6A 2AWNA 4BLOA 2BCGY 4P0TA 3QSYA 1KZGB 1LW7A 1S1MA 2DYKA 2RMKA 5KSZA 3PXGA 5EE3A 3BJIC 2C03A 2PEYA 4DSNA 3FKSD 4JYCA 4W5HA 4RZ2A 3LFUA 3ADKA 3EZ2A 5EP2A 1MRNA 2IS1A 3N5CA 2P2LA 4KI0A 3ZVNA 3QNUA 2BMDA 1CRPA 2I3BA 3B78A 1NJFA 5BYJA 3RANA 3PUVA 1KO8A 4UXHA 1CU1A 3TH5A 5GJWC 1T5IA 5DO9A 1AIPA 3LVRE 4DLRA 4JLDA 4HB0A 3V9PA 1EXMA 1GUAA 4UXIA 4LWZA 3R9XA 3PUYA 5J47A 2WM9B 5AUQA 5LBIA 2FSHA 3QKRB 5JZVA 1MR3F 3CX6A 3BWDD 1YRBA 2BC9A 2WKPA 4HI0E 5FTJA 2NIPA 1TQ6A 2FPMA 1YR8A 421PA 4DEXA 4JVNA 1U94A 2W6ID 2CLDX 4C0AC 3CPHA 1AQYA 2P5TB 1T91A 4D0NA 3O8CA 1QHHA 2A2ZA 2CJWB 2WPDA 2XSZA 1XPOA 3K9LA 4TQUS 2IF0A 3CNOA 3KJGA 3REFA 2QROA 3UIEA 2RGXA 4BLQA 1PVOA 2XJ4A 1JECA 1JQLB 1TL7C 3LW7A 4TYQA 3SOPA 1K5DA 3SYNA 4MA4A 1FP7A 2GZAA 2R6AA 1VTKA 3P20A 3K1JA 4LZZA 4KSCA 3B13B 2IUSA 2X8AA 3CF6R 1W0JD 1Q1ZA 3DO6A 4I81A 2NZ8A 2ZU0C 4CT5A 3U7GA 3KZ1E 5HTKA 3FPAA 3FGNA 1ZBDA 2OLKA 4GZMA 2ORVA 3I62A 2FMXA 4LUCA 4PHTA 4YXWD 2WWXA 3K0FA 2GEDA 3Q5DA 2ZE5A 2J7PD 4QC2A 4WOPA 5JI2E 2ANBA 2RGAA 3CUEF 1E96A 1XNJA 2YOHA 3R20A 4LBVA 1E0KA 3VR3A 4TLBA 2CL6X 3CRMA 1E1QA 3AM1A 2QA5A 4DSUA 3QG1A 3X1XA 3WYAA 3TVTA 3ZVRA 2CCJA 2HCJB 2JDIA 2JASA 3C7KA 2V9PA 5CK4A 4DIDA 3T1QA 1YZKA 2ZAOA 5TXGA 4JT4A 2GVDC 4E07A 5FPHA 4MITA 2QSZA 1XBTA 5FOTA 1CP2A 2OEPA 4YQFA 3P1JA 1YZUA 1MO5A 3BFXA 2JIZD 5JWRA 1NBMA 1N6KA 4ARZA 3AF4A 5FR2A 2IYQA 4JL8A 2OBLA 2CDNA 1P7CA 1U98A 4BZXA 5KU1A 1G17A 5EE1A 3FB4A 1XD9A 3I72A 5DI3A 3J81k 3CLVA 4P3YA 1G8YA 3CNNA 1P3JA 1W0KA 4Q7KA 1S1CA 3TQFA 3EZ6A 3RS7A 3E70C 1OHHA 1RIFA 3H86A 2VPPA 3KKNA 1Q22A 1I2MA 1P9WA 1ZUIA 1GOTA 3A1VA 1ZM3A 3CPEA 3L8YA 3PUZA 2VTKA 1N6IA 2H1LA 2ZYTX 5DYGA 3IQXA 2DFNA 2G0NA 2WIAA 5FL7A 2F3TA 1XEWX 1YZLA 5BXQC 2F43A 2OAQ1 4PQFA 2OFXA 4HSEA 3BK7A 1XTIA 3U3MA 4LYJA 3MCAA 4FMCB 2ZI7A 1WF3A 4Q1FA 1BOFA 3AVVA 1M1YE 2D4HA 4JSYA 4URVR 5FI0B 1LFDB 1QDEA 5K8UA 2AXNA 1OFTA 3G0HA 3ADBA 3HYRA 4MRVA 3ZVMA 4YXWA 3GFTA 5EZ5A 3O8RA 3QF4B 4X8OA 3X1YA 1W5TA 4PC2A 2CNWD 1N6OA 4POAA 1IY0A 1E1QD 3DL0A 3U60B 4NTZA 3UWKA 2WHXA 1SKQA 1PLLA 4LJYA 1IOZA 3EC1A 3MJRA 5FL3A 3EZ7A 1KGDA 1Z8FA 4OL0A 4V0OA 2G1JA 4B6EA 4LJ4A 1U81A 2VP5A 2BEKA 3VAAA 4Q4LA 3K0EA 1QF9A 4FCTA 4IEIA 3UATA 5BWMA 4US2R 2B92A 4B6FA 2IC5A 2V54A 3CRW1 2G88A 1OE0A 3CPJB 3LX8A 4IFEA 3SC3A 2EFGA 3OIYA 2D06A 4OI1A 2FGKA 2ZVPX 4Q4HB 5EQTA 3LV8A 4F38A 4DDVA 1KAOA 4LHWA 4DKXA 4B3GA 2ASEA 3GFPA 2JGNA 3SS8A 1J8YF 1GILA 4KVGA 2MSCB 2CLSA 4IFBA 3TR5A 3K70B 4KAXA 4PXAA 5JHHB 1W7AA 4RKEA 1OKKA 4XOIA 2GVZC 3KJHA 4JL5A 1SVOA 2GJAA 4UJ5A 2QAGC 4WA7A 4PO8A 2QZ4A 2WVJA 2YWHA 1MABB 1R5BA 1TNDA 1VIAA 3QJYA 2VEDA 2CK3A 4KV9A 1J7KA 1E2GA 3B1XA 1JJVA 2HF8A 4YMUA 2CL7X 2IS2A 1YE8A 4M1OA 1QHIA 1UKVY 4F4CA 1NG9A 4D6PA 3P32A 4P31A 4KYIB 2VH5R 4IOMA 4CIDA 1N6NA 3Q7QA 1IN7A 5DLQC 1X8LA 2GXQA 2QMUA 2VP6A 3AKYA 1Z47A 5TDHA 3GLFB 2D74A 3C14C 3AVQA 1XJCA 2DFTA 2QAGA 2Y8EA 3BH0A 4A9AA 4B74A 1ETUA 1W4RA 5G40A 1ZRHA 1YZTA 2G6BA 2NO6A 2XOKA 3UG6A 1LB1B 2QMOA 4H1VA 4Z51A 4BFWA 5KSOA 2F1RA 4NPHA 3ND9A 3AP3A 3BFKA 5FOSA 2ZROA 4XTCS 1IN8A 4PPQA 2J41A 2UVQA 1WB9A 2FV8A 3AUYA 4MKHA 4O3MA 3AV0B 2IA5A 3HR7A 3NEJA 4RJLA 1YR7A 2W83A 1G6OA 1SZPA 4DCSA 2K5UA 3VU9A 4QBGB 2IYWA 3ZLJA 4LGMA 4ESVA 3IO3A 4E5UA 5CDFE 1AS2A 4P32A 1TQDA 2VHQA 1YRAA 1XD2A 1I4LD 3I4LA 3RWOA 3TLXA 5C2JB 2QN6A 2ZQ5A 4IJMA 2O5VA 4LYAA 1M2OB 2ZYWX 2QQEA 5JFGA 4MQBA 4C7OB 1KYIA 2ODEA 3D31A 3IGFA 2KBFA 1ZCAA 1W47A 4QKQA 1KMHA 2XTZA 3NH9A 1W36B 4CYMA 2QP4A 5AUPB 4LPSA 3W8NA 3I5YA 1K6MA 2Z5FA 1CJTC 4HAXA 1QG4A 1SVSA 4UKDA 4BASA 3KKOA 4CEJB 5CYPA 1U0LA 1PUIA 5FFMA 4GOKA 2ZR9A 1ZNWA 1UKZA 5KNCA 2BBOA 4Y0AA 4NYJR 4ZI3A 2JLUA 1H8ED 3KJEA 4I99A 5DH9A 1S2MA 4A82A 2OO7A 3TW8B 4OHVA 4C0HA 4XWKA 2WTUA 5EE9A 1Z0DA 2ZRKA 3UMSA 4TQ9A 3IIJA 1FMJA 1ZU5A 4PPNA 3ZVLA 2QENA 1I2DA 1CIPA 5JJIA 4URZR 1E9DA 3K09C 5D3MA 5EJEA 1G5PA 4YMWA 4OI2A 4F4IA 3L8ZA 3AVUA 1GNRA 4AIIA 3CB4A 4TWZA 1NIJA 3HR8A 4UXJA 4S2EA 1KO7A 3EA0A 4URWR 1S0UA 2EFHB 4GFDA 1R8SA 3I92A 2VBCA 3RSOA 3AKCA 2P3SA 2PEZA 3QF7A 1ZD8A 3SU8A 2WJGA 1A4RA 3W3ZB 1KK2A 3IILA 2O0KA 5SZJA 4IOJA 1F2TA 4QGFA 4OQLA 1SQ5A 2ZTSA 3QKUA 4ZDKA 3CIOA 1DAKA 1Z6YA 2QBYA 5FBQB 2F3RA 2C99A 3MWJA 5AJYA 3QBTA 4ASUA 4TZ0A 1P61B 4D80A 5EXTA 4U00A 1U8ZA 5IF9A 2C5LA 2CVHA 1TU3A 4V0ME 1QZXA 5AJXA 5JJLA 4X8HA 4AC9A 1VKJA 2ZI6A 4M9QA 5CB8A 2VP4A 1XU4A 4J0QA 4TLDA 2OHFA 4TTQA 1QG2A 4RVCA 1G3IA 4ZDWA 3BAFA 2N42A 4CF7A 2G1KA 4BFTA 4RFVA 4CEJA 1ZM2A 3AKDA 2ZUDA 2GJKA 1ZM4A 3T5GA 1VPLA 4A36A 2RGCA 3NIBA 2FPKA 2YWGA 1E99A 1XEXA 2IYLD 3ETLA 3PEUA 3K70C 4K81B 2CBZA 3ICQB 1NVXQ 3JVUA 3BB3A 5LD2C 5FUVA 3UG7A 1HY3A 1H8EA 5ELXA 3CM0A 1ZNZA 2XEXA 4JMPA 2IYRA 2EQBA 2GHIA 3OF5A 1CLUA 1P2VA 1VYVA 2ATXA 4MGKR 2QPTA 2OT3B 1MOZA 4W5JA 4RZXA 3FTQA 1HT1E 2WV9A 4QFMA 1GAJA 3LX5A 2ZRGA 4EJSB 4CGZA 4NCIA 2JDID 4WVFA 4A0RA 3SJAA 5C4MA 1COWA 2NG1A 2ONKA 5DE3A 2GJSA 1ZM7A 1E2FA 1SXJE 1M7BA 2NQ2C 4NYIR 3S1AA 4FCWA 1MRSA 1JR3E 2EU8A 4A1FA 5FPKA 1N5JA 1N5KA 1GDDA 1II8A 5J4VA 1E79A 2QMHA 5E7IA 2FZ4A 3GJ4A 4RD4A 4WAUA 1HT2E 1P73A 1TUEA 2JIZA 1EG7A 1FNNA 3MD0A 4D0LB 1KNQA 1ZC3A 1TEXA 4KLZA 3FE2A 1UDWA 1W49A 2A5DA 1QHYA 1US8B 3BBPA 3RRNA 4A2PA
chains in the Genus database with same CATH superfamily
2FEXA 1TEVA 2DRIA 2GN0A 5DFAA 1YJ5A 5TQ0A 1VG8A 3KXLA 4R1QA 1CY2A 4F97A 1YDEA 1LV8A 1Q7CA 2AXPA 4M0KA 2EZ4A 1XDWA 1FK8A 2CLFB 3M2TA 1DGQA 3PL5A 1X42A 5BT9A 1RC8A 5D51S 3Q7TA 3I04A 3MJEA 1PJTA 3PXXA 4AJPA 3TQOA 4RFSB 4BMSA 1Z25A 3ZU4A 1LRLA 4AY3A 4XLTA 1J0DA 1DIOB 3JARB 3JPWA 2YASA 4MW6A 1AF7A 4OPMA 4UJ3A 3TECE 3DBIA 4FYMA 5ITZA 5AXAA 4LGVA 1P17A 4RQUA 3ZUPA 5L3VA 4TTIA 2B8WA 4GZLA 4IIVA 1XD8A 4PZAA 1P31A 2GBLA 4N3BA 5C3UA 2VJAA 2WP8J 2HU8A 3HB4X 3FCSB 1C1DB 1CUAA 1HYEA 3LKVA 4GPTA 4Q1AA 2ERXA 3OFKA 5BV1A 2MSEB 5LXTA 1XZBA 4OHXA 4UTPA 1DCMA 4QG3A 1H1LA 4PLWA 3JR3A 5L4LA 4EA9A 2ZWAA 4IMJB 2L18A 4HF7A 3LX6A 1S4QA 4P0QB 3EWIA 3F2IA 3L6OO 2AGVA 5CA0B 3QEAZ 1LTHR 2Z1NA 3NOXA 2VJDA 1FRFS 1NW6A 1QMPA 2ZYDA 3WK4A 3WSVA 4WZBE 3RRXA 3K9NA 5T5QA 2VDWA 1A71A 3GLSA 4A6PA 1T5TA 2JFGA 3RB8A 5LJLA 4UATA 4DR3B 1NX6A 1K3UB 2VDUE 4BWGA 4OQ4A 2JJYA 4CEHA 1Z8NA 1ZGBA 3M6AA 4U6QA 1EFRA 2Q6TA 4H3VA 4QTXA 3NBQA 3HDYA 1TM3E 2JI4A 2R8RA 1BXRB 2I34A 2W0MA 3K5HA 3GFRA 1KPHA 3LO5A 4FYKA 4YO8A 5I7VA 2FX3A 2O07A 1NUSA 4G5YA 4Z0PA 3ZNNA 4G5QA 2Q4EA 5FI5A 4PHHA 5D01A 5BWOA 4LBZA 3WSWA 3NATA 2REQB 3ELUA 3S99A 2IU4A 4DCTA 1EP9A 3ZGZA 1V1JA 1W44A 3G2JA 3OZUA 4G3XA 4ZTBA 5IKOA 3VH4A 3PFBA 4AJJA 2C0CA 2MSDB 2FMHA 2DFKB 2OFPA 3HFJA 2ATCA 4UPDA 1WJGA 4E03A 3U80A 1EFVA 2VG8A 2I9KA 3AI2A 3W90A 3AT1A 5A4KA 3A2NA 3R8XA 2C83A 3C39A 3M89A 3AJEA 4EG4A 2VH2A 3FY4A 3E81A 2QG4A 621PA 5L3RA 4D9FA 1LY1A 1TFRA 4L7QA 2XCUA 1Z4QA 4S04A 1SKBA 1CVIA 4ZJUA 1GL9B 2Z09A 1JJ7A 3EVAA 3L5OA 1NJ2A 5JVDA 3OE7A 1TKCA 3WHLA 2J48A 3R2JA 3H9JA 4NS1A 4WADA 4N8DA 3ILVA 2Q5IA 2VUUA 3A4NA 1EK5A 2XV1A 3NVMB 1V5EA 4MYUA 5ALSA 3HVRA 1MD9A 2JLZA 4O1HA 1QNFA 1SG9A 3G8CA 5CYOA 2VDQB 4RA6B 1Z22A 4FONA 4CL3A 4C89A 3EZLA 5H9VA 4CBVA 1CUZA 3TKLA 4EA6A 1TO2E 3E4CA 2DECA 2BBTA 8LDHA 2V74B 5I9BA 2ACVA 3DKPA 2PTHA 3T5CA 3ZD7A 5CFOA 3MIZA 1J9GA 1NHGA 2D7CA 3LNCA 4QTTB 3UHAA 4WBNB 4OHUA 3F6SA 4LJ7A 3R24A 4Y2TA 3WGJA 1WUYA 5DNWA 4LYDA 4FX2A 4EBFA 2WDPA 3GVHA 2GOYA 4MVYA 1ADJA 4MGHA 4JU9A 2A6PA 1H1LB 1E2LA 3L06A 1Z0IA 2XUQA 4J94A 1OH5A 4LYFA 4YCNA 1JSZA 2JJ2D 2GD0A 3CF2A 2FUNB 5I7FA 1LPAB 1YGYA 4U02A 1DOHA 5BSFA 2R6GA 3P2MA 4ENQA 5JECA 1P4SA 1GTZA 2PQMA 4XASA 5DHRA 1Z18A 5I9NA 3TUIC 2IU6A 2Z95A 2FZCA 5CT5A 1ZGHA 3ZV5A 3JQQA 3OC0A 2XNDD 4REOA 5EJ9A 1SMKA 5IC6A 2HF7A 1OB2A 4CCYB 1QDUA 5LP6F 2YYSA 2DAPA 2EW1A 2YINC 3B9BA 2QRLA 4DA9A 4WCFA 5A6VA 5I01A 2D54A 3NNNA 3OKCA 1F1JA 3R5TA 1XKXA 3R5KA 2RGBA 4GZ6A 3MVEA 2P5YA 2XTMA 1W75A 4UCWA 2CLMB 3QV1A 4P4NA 4RHTA 3TQSA 4JJEA 3UBMA 1WMDA 4TTAA 1D4FA 1ZD5A 2ZYUX 4OLAA 3QXHA 3D0KA 5TB5A 4OQMA 1YB4A 3DOJA 3ELWA 4FKMA 3ZIAD 3WYCA 1HZZC 3BXFA 3LKZA 5TF4A 3ZDQA 5I8PA 3TL6A 4JNKA 1YZQA 2BR4A 1L5NA 3U7QA 2WR8A 4AMVA 4H0FA 2DBRA 3AG6A 3SVLA 3R9IA 1RWVA 2IOFA 5AOVA 5AK3A 1NQUA 1G6KA 3P7MA 1VBMA 4ZRDA 3QOFA 3BE5A 1T3HA 4DM7A 4H18A 4LW8A 7MHTA 1I3NA 1OJLA 4X65B 3P4YA 3KJFA 1EB9A 1SWWA 3PHGA 3CEHA 2Q41A 1XA0A 4HP8A 2E4UA 1GKIA 2ZYGA 4HDAA 3E2PA 3GLHB 3CNLA 4EFKA 1SULA 4DV0B 4HLUA 1E6CA 3I2KA 3CEMA 1Z75A 2ZEJA 2ZI5A 4ZVRA 1WBBA 10MHA 1EWQA 3HN2A 1AMNA 3PNKA 2HCTA 1J24A 3EG9B 1DAMA 2VQ3A 1ULZA 2VDKB 3OIUA 2ZRCA 3OEED 3QXJA 1VE6A 2SCUB 2JLWA 3RREA 4X64B 1JG2A 4XGRA 4IJKA 4AZ3A 1JLMA 1HTTA 3S2EA 4MKGA 2OCXA 4BJHB 3HP4A 3ZS9A 2CB9A 3V48A 5F7XA 1PL8A 1XRQA 3PX3A 3QBDA 4M0UA 2HH9A 5GONA 5JANA 3DZKA 4BKOA 4I5IA 1KHTA 3G7SA 4JWKA 1N9GA 1R5OA 2P62A 2XYQA 2W90A 3HB9A 3U39A 1G3MA 4CM9D 1V95A 1MJGM 4KYUA 5KDDA 1P4GA 3RHFA 4QGSA 3BEDA 4UFOA 1MOPA 3GGOA 4WKGA 5DHTA 4PYOA 3MSCA 4BNZA 4MHTA 5K99A 2JFVA 3K6RA 4QLOA 6ADHA 4CM4A 4RGBA 3IR5A 3OT1A 4G5SA 2A5YB 4GXQA 4HDSB 3V2GA 4N7RA 5EWMA 3QU7A 4BNUA 1D6SA 5EN4A 1UAAA 5J4LA 2P4SA 3MMXA 3OJCA 5TEVA 3SNKA 5HW0A 5JZMA 4NBTA 3STWA 3O3NB 5D3KA 3DCJA 4BPRA 3B12A 1TAQA 1RM0A 2YUIA 4FLMA 5JH7B 3BVPA 1YZFA 1RJDA 4ZTUB 2I33A 4CKZA 5LP6B 3C3WA 5KKCA 2XYVA 3WWPA 4TS4A 3UGKA 4ZO9A 2BTQB 4WERA 3EIHA 2CF5A 3GBVA 3LDGA 5CLFA 1OGJA 4TMYA 3ANLA 1JFTA 3VYWA 2J9RA 5E8JA 1C9YA 1GRCA 5DWQA 3ANNA 1GUDA 1U0NA 4P6VF 4TV9F 1HMPA 3IIKA 3PXUA 1CQJA 1PL7A 3BTVA 3JZIA 4O63O 1LPSA 4HYQA 4XUGB 5H70A 3WBKA 1PFKA 4NOJA 1T4DA 1KAGA 4Q00A 3RIXA 3ZW7A 2WQ6A 4YRNA 1PX0A 4B83A 2FWIA 3SZRA 5CA1B 5HM6A 3KL4A 4Y2XA 5HJEA 3NONA 2Q2WA 2GF9A 1QUFA 5A03A 4V39A 4XR4A 1V6CA 4RIHA 1N5LA 2O7QA 2ZRMA 3RGWS 4EKEA 5J23A 2PKQO 3OX3A 4KSYA 4OOEA 2XF2A 2GF2A 3LUDA 4ZOLB 1OBHA 4TWIA 2DR0A 4UNRA 3T06B 4ZVPA 1ZEMA 2J45A 4KH0A 5HZGA 4QECA 2ZCJA 3O4IA 4CFYA 4L6AA 3M6WA 5KU7A 5A0TA 4HDKB 4MVJE 2B7CA 5A7HA 3IJEB 4KQEA 1XZHA 3WHIA 1KI7A 4FT2A 3BZBA 2AFIB 4RL4A 3VR4A 2J3JA 1DC4A 1S3FA 3CJTA 3FPEA 3IV9A 3C3KA 2AYXA 1F9EA 1NSFA 2YFQA 1B0AA 2WQZA 1L1QA 3DXFA 2RIPA 3EWAA 5FNVA 1O6FA 1XAHA 4Z1MA 3I04M 1MMFB 1Q1QA 3IXQA 3OE4A 3BUSA 1D2NA 5JV5A 1OXVA 4H59A 3DZJA 4ZT2A 4RF5A 4BB9A 2QAIA 1UFQA 2NW6A 1ZSVA 1XJWA 4MUMA 3E7DA 1E58A 3DGEC 4LEIA 3W4IA 1P9RA 1REQB 3IDZA 4AW9A 2Y93A 4IIJF 3ROZA 1FMTA 1Z0AA 5EIHA 4ZWNA 4B71A 2IS6A 4QUIA 2AZDA 2E6KA 3SHOA 2PRIA 3U7JA 3LW8A 4MV9A 3ACDA 4F6RB 4ZI5A 1M1YB 3FHCB 2WY2D 2P3QA 3ZX5A 3OM0A 2WHPA 5IAEA 4KVFA 3QF4A 2PR7A 1AKRA 2Y1WA 1T1RA 2VT6A 4G4IA 4F8YA 2QR3A 3QEJA 1E9SA 1F1BA 4L51A 3EFHA 4Y6RA 4RENA 2WSLA 2XWSA 4LV8B 4O3FA 4ZYUA 1YRYE 5LZ4A 4C7OA 3CC8A 4QL3A 4LTDA 3HCEA 3C7CB 1WETA 4DB4A 2C78A 4MVWA 4J6EA 1QIIA 1GTVA 2X5OA 3SYLA 4RTOA 2ZSFA 3QVXA 2GILA 5JVDF 3E18A 3FWHA 3RRBA 2JJ1A 1W0CA 5BPHA 1PP4A 3MB8A 1DBVO 5IN5A 3AYXB 1M2JA 1ZXXA 4KMSA 1EVLA 3HKBA 3SC2A 3L8HA 4YXFA 4AKHA 1FFWA 3SXUA 2P1RA 3U4QB 1SCNE 2PD3A 3PP8A 4PX5A 4M86A 2Q3BA 3TBKA 4X1KB 4UARA 1KKMA 4F06A 3A4TA 2EYQA 3TNYA 3AHGA 4QPDA 5I48A 1CYDA 3W8DA 3P45A 4BFSA 4BO8A 1T29A 3A3OA 5GOZA 5LM3A 2QRUA 2I7CA 2V7XA 1SH7A 1YDHA 4UU8A 4L5JA 4XWTA 4C29A 2VAMA 1IM5A 1E2HA 1XK6A 5K2MA 1BDIA 5JD5A 1XVUA 2FFAA 4G1VA 1MB0A 1YQ9A 4NU6A 3WGYA 1G4HA 2V0NA 5K8LA 2CV0A 4OYYA 1P19A 1I36A 1NSTA 1OX6A 1DAEA 3MQ4A 1L4GA 4GOOD 4E7PA 3TEMA 4DG5A 4RD2A 5CDYA 2C5EA 4LF8B 2VYQA 4R31A 4TL8A 1CUWA 3RSSA 1DAIA 3TOVA 1PTJC 1XZPA 1PYDA 2OMEA 4KQHA 4KPUB 3AR7A 1UPBA 4LISA 1VPTA 1E2UA 1Y48E 3GJ3A 3KLBA 4DV3B 3OTQA 4R9NA 3SQDA 1QTNA 4ZO8A 4P0PB 5E3HA 1C30B 1NMSA 3KFLA 1VKRA 1P2UA 2B9EA 2PPLA 3IOYA 3MFQA 2JPDA 1XQVA 3NRBA 4NFYA 4Q82A 2HLPA 1G8FA 1XWIA 2R60A 2GRUA 2VNAA 1Y1KE 2XF8A 4MS4A 5J5VA 5KYWA 5ALWA 2WU0A 4DDUA 3CT6A 2GZ1A 3ABIA 3CFYA 4GYKA 4EPRA 3VUEA 2DCMA 3LY8A 4QXAA 3WFJA 1E4EA 5IDVA 4C0SA 3CVUA 2EJVA 5ER9A 3FFWA 2NO9A 5A02A 1E60A 1ECBA 3BH6A 4N03A 2YMLA 4NL4H 1WUTA 2B1GA 4J6FA 5JWHA 1MH9A 1W48A 5JR3A 1ZI9A 4DIKA 1CUCA 2Z9DA 1FDSA 3V4ZA 1T4GA 1JXMA 4S1WA 2KSQA 5E7MA 4B35A 8OHMA 2JH9A 4O4JA 3FHLA 2QG9A 5TARA 1SXJD 2HUNA 2BGKA 2VQDA 4GZ5A 2ZI9A 3UT5B 2V6BA 4TMXA 4YPVA 2AS0A 2I5PO 2NSHA 2OO3A 2WP0A 2XIJA 3IESA 4J7UA 4MEJA 5JMPA 4YCBA 1Y3DE 2W70A 2G9NA 2H4ZA 5HIAA 4URFA 3PEWA 4LOIA 1S01A 3A7DA 1DKMA 1Q2XA 2VPIA 3R40A 3T94A 1LVGA 4HYYA 3VOAA 4BQRA 1IUOA 4PLYA 4BNGA 3B8EA 4CXMA 5GQSA 2F59A 2ZVDA 4RIEA 1S3IA 4Y2RA 3HWX1 4CLDA 5JFOA 3CU5A 5IAAA 1JVNA 4AZ3B 4JYZA 3LX4A 3FKSA 2UUCB 1NY6A 5CGZA 4AJEA 4DLPA 5C18A 3FVWA 2EL9A 1COWD 1TMOA 3IQWA 2R751 3PPVA 2QL6A 1XQWA 2BFPA 4RE5A 2VJMB 3V8NA 5FOXA 1HFJA 3V4VB 5C8YF 4UD6A 4V0LA 4K87A 5IJXA 3IQFA 1JEQA 4DXAA 5ALRA 1UPXA 3DMPA 5FADA 3T7DA 4HLNA 3CGWA 3N9IA 5AVJA 4HZGA 3AEYA 4KO4S 3B82A 4YDHB 1QP0A 2EG9A 3WVNA 3FUUA 4DM4A 1NW5A 2KX7A 3DLTA 4S0ZA 2YXLA 4C88A 3UJ3X 4XD7A 2F62A 4HNSA 4WNCA 1J1UA 3F97A 1HQYE 1QHSA 3BILA 3FZEA 3KSUA 3D7LA 4R1UA 2IU0A 1JT9A 3VO2A 2QV0A 3KZNA 3EHDA 3PYLA 2QORA 3ZEAA 1B15A 1U0TA 1KFJB 3KVRA 1UMDB 2YYYA 2ANCA 4KBFA 4PYMA 3UJBA 4YRJA 3N70A 3F71A 4Q7MB 3LY7A 1EP2B 3JQ9C 3ZUGA 3BIJA 3ZCRA 2QXYA 4F91B 1E98A 3C3AA 2IV3A 1GGKA 4O33A 4CQLA 1ECJA 2C29D 5H59A 1CUUA 4D4HA 3GQVA 4Q9JA 4PZPA 4GMHA 4HAWA 2IWHA 4EK9A 5JYEA 1CP3A 3UB4A 1TTTA 1UINA 1N5OX 2Y2UA 4QUAA 5BQPA 1U4NA 4PCUA 5C7IO 1H23A 5FBZA 3V8BA 2HA4A 3BE4A 3GFOA 3RYHA 4TT8A 1GAWA 3FDJA 2NTYC 2ZRIA 3TIGA 3X1WA 5DEIA 3TZHA 3KJXA 2NV2B 2QG6A 5CVJA 2Y1EA 2P2ZA 3GPBA 4LYYA 3QX9A 4J0FA 1TAHA 2D8MA 4TYYA 4RIIA 2XT9A 1B6TA 1G9XA 3KHKA 4FU0A 1ODIA 2IE8A 4JT2A 4C43A 4WCDA 5DNVA 3UM9A 5MF6A 2FZKA 2XITA 2BHTA 1O54A 2R4UA 2IYYA 1DC3A 3CRRA 3ND7A 4LC9A 4DV4B 1WY5A 5GM2A 1UXJA 3PEFA 4FSHA 4GUAA 1Q0LA 1DT3A 1XAJA 4QXRA 1YNOA 3SBEA 1C1XB 1JEJA 1TF5A 1SUPA 1GPDG 3A6LA 2B4QA 3ST7A 2QB5A 1XHLA 2NOAA 4IIUA 4OJMX 3O91A 1OLUB 5FNZA 4GGMX 3RVSA 1FTNA 3T9AA 5AM1A 3E82A 2Q50A 1YS7A 2XMCA 1QH1A 1Y8QB 2HOQA 4KV7A 5C1IA 4J0GA 1I8TA 1XRLA 3WA6A 3BMOA 3NFRA 3WY9A 3HBAA 5ALGA 5F52A 3DCYA 1U8YA 1X1RA 2Z2ZA 4NS4A 3V1LA 4DLUA 3W5CA 5JDIA 4D4JA 3KQPA 2XB4A 1UMDA 2IJGX 4IINA 4CMBA 1M74A 3NV9A 3G5TA 4MW7A 1JALA 4S0XA 4LGCA 3ORSA 3GUZA 1EM6A 1CRZA 4FFMA 5E7JA 1WQ4A 3RG8A 4GWGA 5B57C 1JEYB 2D2FA 4KGDA 1DX6A 2GYUA 1RPAA 4Q4JB 5BSTA 4ZIRA 4QU8A 1GQQA 1RFGE 1RQ7A 5E3IA 3M0EA 4KEAA 4DYDA 4CEIA 1N6HA 5LBTA 3ZBQA 2IHZA 3LUBA 2HWWA 3JD2A 3W1VA 1V4NA 4PM4A 4RX1A 2V55B 4DMMA 5CW2A 3CH6A 3EBOA 5PNTA 4YRFA 1T6BY 4GS5A 3SLRA 2VTBB 1DXYA 4KXNA 1R6TA 1KYQA 4JLNA 4LYEA 3B1JA 2BZSA 4WNIA 3KXDA 1HR0B 1E9BA 1E2IA 3TYXA 4UPEA 4DV6B 3B5EA 4GLOA 1VCOA 5J2TF 3AUSA 1I2AA 1BMFD 2ZW9A 3OZXA 4C9BA 1B8PA 3L4BC 5CU7A 3OLCX 4XVRA 3JQCA 4M1WA 3UA4A 2ZCVA 1ULAA 3WDKA 4DQLA 5IASA 2DWUA 3JALA 3S2ZA 1D9ZA 2MIIA 4WFQA 4FN5A 4EBBA 1QBGA 4O4HF 1EK6A 3IEXA 1JFLA 4D8UA 1XZ8A 2HC9A 4G85A 1XWFA 3IDQA 3DD1A 4CQNA 3FDZA 1C9JA 3FSGA 4Q9DA 3SY8A 3QH4A 3VNSA 1Q44A 1F12A 1ABEA 4JLVA 4LZPA 4RMHA 4ZKDA 1BQ3A 1X19A 1ZITA 2J4FA 1AGYA 1J5PA 3EXIA 3I6BA 3TLMA 4DNPA 5CFLA 2GPBA 3EOAI 4ZDJA 3BEOA 3DXYA 1JMVA 5J9FA 2UV8A 1ICIA 1TOAA 1D3AA 2NUTB 3IIMA 3KDPA 3PU6A 4OFBA 5TV2A 4C5CA 4WOBA 2IXAA 1VSBA 1W96A 4B7XA 2E4AA 3KQTA 2GAOA 3CZCA 2QW8A 3UENA 5JLJA 2JEOA 1BRMA 2RKOA 3QVTA 2IYSA 4WNAB 2YN4A 1KY4A 4Q7EA 5GGXA 4HLQB 2XHZA 1G2PA 1G7CA 1YOVB 3A1CA 4HRYA 5LN1A 4R68A 3EEQA 3JZDA 4WX2B 5IMSA 2RGWA 5FORA 4IY1A 1YIAA 3I4CA 5H83A 1U0HC 3G88A 1ZN7A 1RQPA 1HSOA 1RHQA 2CHVA 2YRWA 4LPKA 3UYKA 2JCYA 3DULA 3QLUC 4DR4B 1ZMBA 2Y4NA 1LLCA 1Z5ZA 4FJ0A 3H84A 1AZWA 3KQOA 1XP8A 2H1CA 1IZZA 1NVAA 1STOA 2R4QA 2YR0A 3Q5EA 2Q3JA 3IFSA 4KGVA 5I5EA 3SS7X 2I3AA 3V7UA 1SWVA 4CM3A 3W5AA 3GVPA 5EJ7A 3D6HA 4TMTA 5EPEA 4YMVA 4NQZA 2A94A 2Q6IA 4LJKA 4J0JA 1W8DA 3JQAD 4PGMA 2CUTA 4TTRA 1JSLA 3MINB 4OLFA 5ALOA 3CH5A 4EB6A 5F98A 3DOOA 2DFVA 1IVNA 4K6HA 1YNSA 4BNNA 2B30A 1LU9A 3WQBA 2JCVA 3RU7A 3NCHA 1WDWB 3JQFA 3J7TA 4JQOA 3T3PB 1J0XO 5BNIA 1VDZA 3AY3A 2C3PA 2FDRA 3BHJA 1DBQA 1PJBA 1H2HA 2ZBDA 4YWJA 4ERNA 4I66A 4PLHA 1WAMA 1R64A 4BO2A 4FHFA 3TLCA 2F8MA 3LCJA 4B6OA 1CZOA 2PX5A 2LWIA 1WCV1 3ZD6A 2G09A 2Q62A 4XUEA 3KG2A 3DMNA 2X4LA 3VHLB 1K68A 3LPLA 3OICA 4AP9A 2PUWA 1IMJA 1QIHA 2YYAA 2C4NA 3BAZA 1WVIA 3AR6A 1WF6A 1QNLA 2G08A 3MJDA 4DGQA 4F3CA 3O1JC 1FJGB 3G79A 1JS1X 1TW3A 2FPWA 3RUHA 1E32A 2GNPA 2L19A 1N4AA 1JG4A 4EF6A 3QOYA 2A4MA 3IKVA 4WDQA 1GGVA 5JMWA 5G1NA 3KB2A 2J33A 3S5JA 3LOUA 2BMEA 5EIBD 1QAQA 3BRCA 4F5DA 5IKXA 2QUIA 1BWRA 1SY7A 3ITDA 1AKEA 3OBIA 4M88A 1Z34A 3ESXA 4DMKA 2UU9B 4B9EA 3G0GA 4L4XA 4M4SA 3BG5A 2CVQA 1ZSNA 2Q8QA 1H8HA 2EP8A 3GUUA 2M6KA 5KNLA 3LWDA 4ERXA 3ITEA 1QWSA 3AW8A 3VSBA 2YFKA 4Q18A 2I9PA 4MQFA 2G67A 3KEMA 2V9CA 3WIUA 3WMGA 4YNBA 4E21A 2FR8A 3IBCA 4FOLA 4YRCA 4ZAWA 1OZHA 3ESQA 2DHQA 2AC4A 4B33A 3OEWA 1O94C 1P5HA 3QX7A 1ATZA 3QFSA 3CW2A 2C9YA 5DN6D 3V7FA 4QJ5A 4IXNA 3S2IA 3DPUA 1UADA 5IWAB 3AZOA 4AMZA 4EA8A 4A8TA 2EKBA 2JCSA 3UMCA 2GO7A 3GLGA 1S3SA 2PKWA 2BR5A 2NU8B 3W8RA 3MCTA 4BE4A 1T9ZA 5L6MB 2Z4RA 2X2EA 4FE3A 3AKZA 4L5BA 1E1YA 1T2DA 3C43A 3F0TA 3M5PA 3P2IA 4C0WA 3QJ5A 4IXDA 2WD7B 4L76A 4YJ3B 4ZVSA 4GBED 5HRCA 1B76A 3K9WA 1PGOA 3H8VA 3F73A 3MM4A 4HZIA 4RGVA 5C5EA 4UNQA 3W2EA 1SXGA 5MN4A 1IY9A 1QH9A 3M3PA 5CFNA 3SF8A 4Y30A 1T8YA 3MS4A 4TMKA 2YKGA 1D1TA 1LKZA 1YT5A 1RWMA 3EXG2 2P6NA 3EEIA 5FR1A 1R15A 4YP6A 2O7RA 2FRDA 2X0NA 1G8PA 1PQUA 1QCZA 4H7IA 2VZ8A 1ESCA 1QC5B 3U7EB 2FCAA 3PF9A 4ZPJA 2JGEA 3ZW9A 2YW2A 1A97A 3GV0A 1HNZB 3AR3A 4RKRA 4UCQA 3UGJA 4AWXA 4UHBA 1PL0A 3WYFA 4U7DA 1A8PA 5CITA 4EHNA 3WGZA 4CRWB 4FDVA 1GZSA 1FLDA 3VR6A 3F6RA 5DP1A 1AKUA 1C3OA 2QE6A 1XTUA 5JFTA 4IYRA 3G2PA 3KDAA 1H66A 2REXB 5K9ZA 1LI7A 1O4WA 3CEJA 1BC5A 1ONPA 2I67A 1PAUA 4WXEA 4FXPA 3UXMA 1LQUA 1PR9A 1N2EA 2JHPA 5G0UA 2ZSUA 1GG5A 4PGGA 3S2FA 4L4SA 1OGIA 1BOOA 4DA4A 5BXYA 5T3YA 1P74A 1JT2A 1KORA 2RHCA 4MCAA 5ABPA 2ZTMA 2HYIC 1K8XB 2Q5FA 1KEPA 1PNQA 3Q7PA 2CKDA 3UAYA 4JI1B 4I55B 2WKRA 2C2OA 2R2AA 1LDYA 2NV6A 4OMDA 4QPNA 2ZJAA 3M81A 2ZIUB 3HA5A 3LWNA 5BN1A 2AKYA 4U6SA 2H9YA 5IVPA 4FC6A 5EYPB 3DUFB 3Q0EA 5AUOB 1BTOA 8ATCA 2X6QA 5DHQA 2I54A 1NLMA 1EFHA 3ROGA 1O97D 1QVAA 3ONDA 3FLBA 2FOXA 4U63A 1Z4NA 2H4WA 4D6XA 2Y1CA 1YO6A 3IXMA 1LBEA 3F7OA 1H5NA 4JR2A 1IQUA 5AI4A 2FPPB 3SEQA 3QNMA 3TQQA 4F93B 4N5LA 1W88B 2WFAA 1XQ9A 3MOGA 4H7JA 3D3NA 3SAJA 4QOIA 4IIXA 2HK8A 2JFHA 1HI9A 2X0RA 2ZRLA 5ANRB 1XRMA 2ALJA 2O5CA 3KKEA 4H1TA 4QHTA 5FHQA 4AO6A 5IX8A 4GEKA 3AUUA 3ZY6A 1PJRA 4NABA 2H85A 3ZV6A 3UWMA 1KXZA 1O94D 2R1TB 4FGLA 2OE2A 1RMQA 1ST2A 4XX0B 1L5HB 5C3MA 1NATA 4X85A 4NPCA 3ZDRA 2AD1A 4DQKA 5K6AA 1P5FA 1NR7A 4PYQA 1EGMB 3OVMA 1KAMA 2NO1A 2I4IA 4JMLA 4FUQA 1TZ2A 3C5WP 4WGFA 3KVNA 3K31A 4JENA 4CT4B 3P5BA 3A6FA 5CXXA 2RDMA 3E9RA 3O75A 5CH3A 4CDNA 2X41A 3RVDA 4D6YA 4JVLA 1P0QA 1VIVA 2HD4A 3PNMA 3ZY5A 4EO4A 5D2CA 3IUNA 1QGUB 2W6JA 3OAAA 2UZIR 4PYKA 3UH1A 3EFOA 3OCXA 1QGUA 2VSNA 2O52A 1T5HX 2X2FA 3GC6A 4COKA 3FHTA 3NBFA 1ARZA 2G5CA 4INPA 4UBJA 3BA1A 2ZRFA 4JLBA 2RAPA 4FOSA 3EH2A 3NWOA 4FR2A 4NZYA 3DXXA 3UQZA 1E2MA 4REQA 4XSVA 5IW8A 5IXJA 2EDAA 3JD0A 2O2CA 3H04A 4WCVA 4HNUA 1NYLA 5LWHA 1QV9A 3AIKA 2NWQA 5B2FA 2HCRA 5KMGA 4LXXA 2BLNA 5B7NA 1EVJA 1K8YB 4R54A 3O95A 1KIFA 1T0IA 3E03A 4CM8A 1J49A 3RKRA 4Z4FA 2C54A 3LGAA 4MRRA 4RANA 4OY3A 1PNRA 2X1LA 2WUVA 1T3TA 1VHLA 4IH1A 1A98A 1D2AA 3HVHA 4P5EA 3QEKA 5C51B 1E9CA 1GV1A 2GI4A 4Z4EA 1ODLA 2PX6A 3RC2A 2QUZA 2ZT7A 4S2UA 5ELLA 5DI9A 1ILWA 1GRNA 4EP1A 2Q8NA 2IY8A 4H3KB 3JY6A 4KQ2A 4I4NA 1UT5A 3K4HA 1EDBA 2PLAA 2XGOA 2XE4A 1Z7WA 4C0XA 4JJZA 1L6IA 2GRAA 1T9BA 4NMHA 2VWGA 1P80A 4IWYA 2PKYX 5TIIA 2CNNA 1JXAA 2JIMA 4LX0A 2WJVA 1VE1A 3GFFA 4G0MA 1VCMA 4PRLA 5ULLA 2VDWB 2CGEA 2VSYA 3PIIA 5F51A 4LI0A 4I1IA 4H1HA 6NULA 3ONEA 1T2CA 2GFQA 1GNQA 1GFZA 3LZCA 1LUAA 2D1QA 4QGAA 1KF0A 4DUYB 1SBYA 1W4LA 3OIFA 3HCWA 3QFFA 1BCRB 1LRKA 1ZINA 2GB4A 4IQ0A 3NRCA 1TYCA 4AJ4A 4Y6QA 4O4JF 4Z7JA 2BFEB 5CVUA 1JDZA 3CUSA 1Z63A 3GGPA 2IEIA 3OPYB 4YLYA 4NNPA 3RTCA 1Z73A 5D5HA 4F2GA 1ZQ1A 4NXNB 1FQOA 2RGUA 3KB6A 5BSUA 1WLSA 1LSJA 4AJHA 5JVDB 5BUCA 2PT6A 1HRKA 2VXCA 3SBOA 5IXSA 2JLYA 1NLZA 4UDOA 5DSXA 4B3HA 5DX0A 3RIEA 4EENA 1W93A 3AGPA 2FEKA 2HDWA 4BRUA 4IP0A 2IZ1A 1LWNA 3BIOA 1TIBA 4IIEA 4ZGWA 1AZTA 3AF1A 5AVZA 5ETJA 2B3DA 1D7AA 3ONNA 3P9SA 2FFRA 1ND5A 4X92A 2JBWA 3PNLA 3L4EA 3VJMA 2AUNA 1AM4D 2COEA 2VYFA 3KP1A 1RT9A 1DKLA 3PFGA 4OD0A 5BVGB 4OYRA 4Q3OA 4FB5A 3PPYA 4M8KA 3ZS8A 1DJOA 4EOGA 3EGWA 1ESMA 5JC8A 5ALDA 1G21A 4EELA 4KR7A 4DM3A 2LR0A 3A10A 1ZDMA 4U7TB 1NUQA 4B4OA 1RVDA 1DAGA 1E2DA 3U3JA 1HGXA 2XUHA 1LXCA 1P1FA 4YJGB 4MDEA 4BNHA 4S3MA 3ZXIA 1TO6A 2YVLA 3CE9A 4I2NA 4MW4A 1QFYA 3OQIA 4FI3F 4US0R 3MWYW 3ED1A 1XQYA 3WGUA 1Y33E 3HWSA 3LBAA 3TCXB 3D4NA 3E0QA 4Q4AA 3LDFA 3GQBB 4ZI7F 4RWZA 3FYUA 4L5YA 4AS2A 1VCHA 3EOBI 3TTWA 4HNGA 1JJAA 4F0JA 4E31A 1I0LA 1Z5OA 3W5HA 3D0OA 2G9UA 4DRXB 5JJKA 1LX7A 3EVGA 3SM9A 4F7DA 3LHFA 2E48A 2WJIA 4Y0VA 5E6UB 2Q5LA 3A1WA 3EVDA 3QY0A 3GFBA 1IIBA 1PX2A 4B31A 3AETB 2HF2A 4PO3X 2PS3A 3MD9A 3R3HA 4KO2S 1VA4A 1L7BA 3ZQKA 5A5FA 2HLDD 1A9QA 5BV2P 1SOWA 1OFUA 4MZDA 2WF8A 1U2GA 1ZL2A 2C2WA 3HB5X 3QX3A 3UVEA 4OQXA 1HETA 1XZJA 4OAPA 3A11A 3ZCTA 2QDKA 1X39A 3MQ2A 4ZQFA 1O6GA 3UMYA 4HEA6 5H3CA 1CBUA 3D4PA 2AOUA 2FUG6 1B16A 1Z29A 3Q3HA 3L0YA 2JA1A 1EEHA 4XVQA 4ID9A 1P1HA 3L9XA 4DJJA 3N0TA 1QC5A 2OO5C 4MV1A 4O4JB 2JGLA 3LY9A 4HQLA 4AN4A 3VPCA 2W4IA 5KDOA 1BNCA 1KZHA 2IHVA 5J3JA 1BN6A 1ZI8A 3JYNA 1E3JA 3MNFA 3OX1A 4C7XA 3F3MA 4UOEA 1GARA 1K8RA 2X86A 4BWYA 1Q11A 4HDQB 4FW8A 2X6TA 2NSDA 4TLCA 2AJDA 3KQLA 4J16C 4WVLA 4ILEA 2JLCA 2PYZA 4Y2JA 1OTYA 3M6IA 4LOJA 3Q87B 5HF6A 4BZZA 1P5RA 1HH4A 1SXHA 4W8OA 1CJMA 4B6SA 3FNEA 2ZRAA 2QNBA 3HLKA 2DQZA 1KMMA 3ENVA 3FMOB 3PKIA 3GU3A 4D41A 1C1YA 5ALJA 4PX3A 5F9FA 2VFAA 2ZATA 4Q48A 1XTKA 4ZCMA 1X9GA 3DV0B 4GNKA 1PWHA 4IQ8A 1MVNA 2PSFA 3CBGA 5BSMA 3U09A 5FB3A 4UBIA 3SX4A 3DPIA 2C5SA 5HJ7A 2AVNA 1NXXA 1N0IA 3GZNA 5E9AA 4BO4A 1Z28A 1P0MA 1ZGJA 2PT9A 2P77A 3CO5A 4G63A 2YJ4A 8ABPA 3K32A 4JJ4A 1TKAA 5FFFA 3RJMA 2A0FA 4ZVUA 3HZOA 3IO5A 5JS6A 2PYIA 4UCFA 2N1BA 3ASUA 2AI3A 5ADWA 1Y7LA 2IEBA 4FEGA 3K9HA 3QFTA 3M1YA 4IV5A 4QOHA 2LD4A 1UIMA 3R7SA 3WNVA 2W48A 3N53A 1BA2A 1QS0A 4US1R 5BSEA 4WECA 2WB2A 4DUZB 2BRUC 4OHOA 2JK0A 3GN1A 2G9VA 3NHAA 4MAFA 5IDYA 4L02A 3WOHA 5JS8A 1V7CA 1GRVA 1BHSA 1PV2A 2I4LA 4UNIA 4ZU1X 1JVBA 3GJZA 3JQ8B 4GGOA 5AOAA 3SQOA 1VJCA 3UWPA 4KWEA 3QTTA 3DC2A 2F1JA 2YZGA 4ZZ3A 1ZIPA 4Q9IA 3A6KA 1XDSA 1XT6A 1DIBA 2G5GX 3GPDG 3KVVA 3RJTA 3RSCA 1Q7EA 4KWCA 2VSFA 1ONSA 1SC1A 1U7HA 1UPAA 2YICA 3KX2A 2YQ4A 5FWYA 1YL7A 2VJYA 2R85A 2I2AA 5SYNA 1VL0A 4PBSA 1GZHB 3BTSA 4K0RA 1K5HA 4Q24A 3RSLA 4DMGA 2VUTA 4U9HS 1GRRA 3CUWA 1FTGA 3VDRA 4A6XA 1JSRA 5JSHA 1DS6A 1TCVA 4DR7B 2ZJ1A 4XE5A 1SOMA 4QHSA 4NCAA 1FUEA 1SVNA 1BHO1 3S8YA 3H2YA 1QCYA 1V8OA 2YOFA 1OIXA 1QAOA 2BF4A 3LXRA 2CF6A 3NC4A 2VSQA 3PPIA 3W04A 5AUNB 5CG1A 2WNHA 4IZHA 4CN8A 1WBDA 4BBZA 2FEOA 3R44A 4B3RB 1KH3A 1FNSA 3N0XA 4K86A 3EIQA 2DWPA 1MX9A 5JY1A 1W2GA 2A9PA 1H9BA 2Q4DA 3ZWKA 3ZD9A 2B7BA 2QBYB 4D3YA 1S8OA 1VMEA 1DLJA 2OCAA 4FW9A 3E9DA 1ZC4A 3KEFA 4ZRNA 5CCEA 5A62A 5KCMA 5JXWA 4OI0A 1EFPB 2HHCA 2C3MA 3U16A 4IFIA 1SBNE 4EUHA 4QASA 1XZEA 2C4VA 2RKBA 2H1FA 3NQ41 3ZIUA 4C04A 2M2IA 4NVRA 4AZ0A 4F92B 4YT8A 5DISB 1SCQA 1VLMA 3ZE0B 2VUHB 1GU1A 5BVHA 3TF5A 3NYQA 1BVUA 5AM5A 4HYEA 4MGYR 3MSXA 1BEEA 1HZJA 4OMCA 1PYOA 2O2HA 3BGOS 4TXJA 4OK5A 1OLUA 1PFUA 4Y2YA 2AJTA 3G9UA