3SI7A

The crystal structure of the nbd1 domain of the mouse cftr protein, deltaf508 mutant
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
280
structure length
265
Chain Sequence
TGIIMENVTAFWEEGFGELLEKVQSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Requirements for efficient correction of DeltaF508 CFTR revealed by analyses of evolved sequences
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 90
structure length 265
sequence length 280
chains with identical sequence B, C, D
ec nomenclature ec 3.6.3.49: Transferred entry: 5.6.1.6.
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3si7A00
3FHCB 3SZRA 2JLZA 1OYWA 5DN6A 3R7WA 1OFTA 3KUDA 1ZAKA 2EYQA 5J4VA 1QHGA 1UBCA 3QF7A 1E2KA 3RRMA 4C0BA 2B8WA 4LDJA 2RGCA 3QENA 3IEVA 1EG7A 3DEFA 4HLQB 3G82C 4GZLA 4B74A 3C16C 2C8VA 4IVQA 2AXNA 2W00A 3FYHA 3VKGA 1JECA 2IBMA 3CWZA 4P32A 2WJIA 3CX6A 5GJCA 4C2UA 4Q5IA 4NE2A 1HEIA 3AVYA 2NO6A 3DKPA 3UIEA 3ZVLA 4IFEA 4GOKA 1N6HA 4LHZA 4DEXA 3U60B 4GSYA 1QVRA 3K53A 3O8RA 5DIFA 5CIQA 2KI5A 5EUMA 1FUKA 5BWMA 3CNOA 1ZNWA 1HQCA 1G41A 4RD1A 3BERA 4RZ3A 3I92A 2QPTA 2ZUDA 2QY9A 2E87A 4WZBE 1FPMA 3TK1A 3BRWD 4W5WA 3HPRA 2QEQA 2V3CC 4AG6A 3AP3A 4URVR 2PEZA 4IVRA 3OIYA 3CF0A 1DG3A 4BLPA 2Q9AA 3IILA 4TQ9A 5KU1A 2IHBA 2I1QA 1KO1A 5JFGA 2AD1A 3ZVRA 4LJ7A 4QHSA 3DVLA 1UBGA 1P9WA 1Z0JA 2O0HA 5KPDA 5L3RA 2A7QA 1CP2A 3NH6A 5JS7A 2IS2A 2H16A 1F5NA 4IOLA 3ONWA 5TDHA 2RGXA 1R5OA 3A1VA 3FKQA 4V0NA 4BEBA 1E9DA 2Q3MA 1G3RA 4FINA 3WNDA 1M7GA 4BFXA 2D74A 2UZ3A 2XOKD 3WRXC 4AYTA 4B3GA 4Z54A 1I4LD 1KI3A 3AVUA 1E1RD 4KFTA 2KE5A 2X2EA 5E7JA 3BORA 4URYR 4RZXA 5BYJA 4DEYA 1XPOA 2QRNA 1KGDA 1DARA 1HE8B 4GFDA 1KI8A 1ODFA 2IS1A 3FB4A 4XWOA 5G3ZA 2DBYA 3EPHA 1L4UA 1ZD1A 2FU5C 1Z0IA 5FBVB 4OQFA 3BK7A 3OEHD 4L9WA 2V4ZA 2ECKA 3RSLA 4KO8A 4R98A 2IYRA 2Q0HA 1GG2A 1ZW6A 3G5UA 2IYUA 3SC3A 3WBJA 1IM2A 4C9BA 2ZRHA 3PITA 1XD2A 1QHSA 3QG5A 1G3QA 1TF7A 4D4MA 4ZV4A 2VBCA 4JKIA 1Z28A 3Q5DA 3BJIC 1S3GA 4I1OA 4GOJA 1PVOA 2H5EA 5FL7A 3B2EA 3HU3A 3VNUA 2HYIC 1QVAA 5SZKB 5G41A 4B43A 2AXPA 1KJWA 3FKSA 3MLEA 2IYQA 4FMDF 2IF0A 2C5LA 3UG6A 4BLQA 1AQYA 2ZI6A 4TMZA 1CR0A 3MMPA 3SEAA 5JEEA 4JL8A 3GEEA 3CF6R 4AKEA 2LKDA 4BFTA 2KWIA 3AF2A 2CEAA 5FPSA 3G0HA 3HDTA 2GRJA 1UKVY 3THOA 3QPWA 1MRSA 3LAWA 4Q4AA 3U3MA 4NDZA 2DFKB 1NN5A 1W5SA 4HDQB 1GNPA 4JSTA 1T4GA 3BXZA 5JRZA 1LY1A 2DFTA 3S1AB 1OH6A 5JCZA 1YZLA 4PPNA 4PO1A 2CE7A 1GRNA 1NVWQ 1QG2A 2WTUA 4QBIA 4LUCA 4L8GA 4V0LA 3UG7A 3EPLA 2N1BA 3QEJA 1SVOA 4DZZA 2IYLD 1KK3A 1UADA 3GFOA 2IUUA 2WJVA 1XEWX 2FSFA 1J8MF 1JEEA 3CKLA 3QKRA 2FEOA 3KUCA 3R8CA 2ZROA 3RWMB 2CJWB 1SGWA 3GD7A 4G5RA 1W2HA 1Z6TA 2C9YA 3O8DA 4R9UC 1UPTA 4OJQA 4OKSA 1II9A 3B1WA 2QP4A 4NYJQ 5DSZA 1II0A 1JXOA 3ADDA 1RYFA 4PPQA 4DLTA 1RFLA 4DDUA 2YKGA 3CPEA 4U5XA 1P73A 3A58B 4B76A 1GAJA 5C18A 5CM9C 1J8YF 4M1YA 3QKSB 1KY3A 4OK5A 3TSZA 1BKDR 1R4AA 5CIWA 3SBDA 2IF2A 3ZQ6A 2O8EB 4Z1MA 2ODEA 2ZPTX 4MRNA 3R20A 4Q1CA 4UJ3A 3KDSE 2Z4RA 1T8TA 2KBEA 4DDTA 4B34A 4LBZA 5HZHA 3LA6A 1E2HA 4Q9JA 3X1DA 4MRRA 2XX3A 4M8NE 2O52A 4XD7A 4XOIA 3KXKA 3TMKA 5LD2B 4LOAA 2QL6A 4LJ8A 1CEEA 2EW1A 4IJMA 3TR0A 2QE7A 2A5DA 2VHUA 3GLGE 4CEIB 2BMDA 1PZNA 2BM1A 3BE4A 5K8TA 1RC8A 4CIDA 5JHHB 4FW9A 4HB4A 2VLIA 2WAYA 3GJ8A 2QBYA 4BFSA 4TT3D 1KO8A 2BJVA 2BEJA 4MKGA 4NL4H 5G40A 5K8IA 2QTVB 5UKDA 4PC3A 4PZZA 2IS6A 3H0KA 4QNRA 3KQLA 3ZVNA 1KDTA 1XMJA 4X8HA 3M1IA 3CNLA 1LV7A 3IQXA 3BB3A 1CRPA 1TL7C 1VDZA 4ZCIA 2R2AA 4MDEA 3C7KA 2LCFA 1BH2A 1OSNA 4JMPA 4Q4JA 1H8EA 4P0TA 2ZI3A 4PFSA 3ZS8A 4F92B 1E9EA 2QGZA 5JSZA 1SXJA 4KLNA 4FMCF 4OQXA 4JYBA 3GLIE 5L3QA 5FPYA 1FUUA 4NONA 4BASA 3K70B 1Z6XA 2EQBA 5KSOA 3LQRA 1E9SA 3SI7A 3EIHA 4EFMA 2GBLC 3IPYA 5FPHA 5IF9A 3NXSA 4B35A 2PL3A 5P21A 4IW3B 4ZDKA 4EQ6B 2QAGA 2FSIA 1ZIPA 1ZNXA 1JAIA 1SQ5A 2WWWA 4MUAA 1QHYA 4QFMA 3TAUA 4NCIA 4ARZA 1T3LA 2WKQA 4V0KA 4TMWA 2RAPA 3K1JA 2EFGA 1DBSA 4LX0A 5J4KA 1XCMA 2P67A 3B13B 4QHTA 1YHNA 4QJ3A 2QP9X 3KTAB 2G83A 1VCOA 1YZQA 2P3SA 4Q9KA 3PEWA 1N6OA 4RFSA 5JJLA 4POAA 4HLUA 2QT0A 1UDWA 4QHYA 3UATA 2D62A 4UQOA 1YRAA 4BLTA 4DB4A 4HZUB 3BB1A 3CBQA 1ZRHA 1ZUHA 3VX3A 4P33A 4HYYA 2WWGA 3FMFA 3PUZA 5JCPA 2PZEA 1DADA 4XWAA 3RABA 1E79D 2IL1A 3AVPA 2ZSAA 2DPXA 2JJ2D 1N6KA 4LJYA 4H1UA 3DMNA 1ONBA 3AM1A 5LD2C 1XTSA 821PA 4AKIA 3AKYA 2O5VA 3OIWA 1U0HC 1GRRA 3ZDQA 5F98A 3A4NA 1DAHA 1S4QA 3UMSA 2ONKA 1F2UA 3KB2A 1XMVA 2BJWA 4Q47A 3B82A 2CBZA 3A4LA 2CL0X 4Q7JB 2XTZA 1IOZA 1N6NA 1SULA 5F3WB 1SVIA 1JAHA 1S1MA 2RHMA 3EWAA 1KSHA 2HUPA 4KITB 2FGJA 2GKSA 3WHLA 1HQYE 3LX8A 2ORWA 5IDVA 2YV5A 4BECA 2ZRPA 3QPUA 3AGQA 3GLHB 3IQWA 2ZRNA 1LS6A 2WOOA 3W5IA 3BD9A 1G7CA 2ONJA 1EX7A 5E95A 1E2MA 2WJYA 4V02A 4CZ2A 1OYYA 4ITRC 2OXCA 4KSCA 4O2LA 4CEHB 1P2SA 2V7QA 3C41J 4GT1A 4CEJA 2F9LA 1HUQA 2ZSFA 2O8BB 4LRWA 4M2LA 1K6MA 1M74A 1TQ4A 3KL4A 4JT2A 2BMFA 4IEIA 1TEVA 4LBWA 4N1AA 4PQFA 2EFDB 2LKCA 4D4LA 3D6TB 3ZZTA 4H9GA 5KNCA 1ZUIA 3AVQA 3PCRB 4C0JA 4PPFA 4GNKA 5C4GB 1Z22A 4MDFA 1XRJA 2R6GA 4PC1A 3K70C 3ADCA 1R5NA 1X3SA 1XXHB 1YZNA 2CNWA 5CDFA 4WZ6A 1Z6YA 5E7MA 2OCPA 2XSZA 3C5CA 1ZD9A 3TNFA 4GL2A 1EFRD 3P4YA 1MV5A 1NBME 2WJHA 4CGZA 2QE7D 3IIJA 3LW8A 1AS0A 5DI3B 3NKVA 3FMPB 3PUYA 5A4JA 2NO0A 2W2VA 3TSOA 1CBUA 3UWOA 4PZYA 3OE7D 2GEDA 1E0SA 1GNRA 3RRZA 1KMHB 4Q7KA 3BS4A 4MKIA 2PZGA 3PEUA 4XTCS 4PC2A 2H1LA 4Y0VA 1KI6B 3ZIAD 3EIQA 1YVDA 4BGDA 4LY6A 2IHYA 1HV8A 1T6NA 3FWYA 4M1WA 5JEDA 2NO9A 4ACBA 4BFZA 1RRCA 2OEPA 4NH0A 1F3OA 2JLYA 4TTPA 2IYZA 5FTMA 3LFUA 4KSBA 2RGGA 2C2HA 4RZUA 5EZ5A 4PHGA 4BEJA 4MRVA 1OV4A 1TU4A 2VA8A 5L3SA 4R2IA 3FTQA 4OI2A 2CE2X 2ZS7A 3TW4A 1JEDA 4EIWA 1G7RA 2QGNA 2WPDA 2JLVA 1LF0A 1IN7A 2EU8A 5IK2A 1G5TA 3ADBA 1GWNA 1QHHA 5KDLA 1UF9A 1OPXA 1AGRA 1XJ0A 3HYRA 4MYHA 3QBVA 1XJCA 3U6KA 1E2DA 3NH9A 5EE3A 2O8CA 1NVVQ 4B48A 1DG1G 2VO1A 3OHMA 3NBFA 1M34E 1VYUA 3I73A 3TQCA 3BGWA 4XVQA 1I4TD 3F0TA 5EXXA 1DAEA 2NOAA 2XZPA 1UEIA 4NHOA 1NNEA 1I2MA 1SVLA 3VR5A 5FBWB 1IN5A 2R62A 3K0CA 1UAAA 4PC7A 2CK3D 1E69A 1KNXA 1VECA 2F3TA 1M6NA 1Z0AA 2OFXA 3EC2A 1YRBA 2XAUA 3SN6A 3MUFA 1KAOA 3ND9A 3T1TA 2V55B 2X19A 3A1TA 1YZTA 1XEXB 1IN8A 3KJEA 1A5TA 1XX6A 5FBLB 4EAQA 5B64A 3GEHA 2FFQA 1IHUA 5JI2E 2YHSA 2WV9A 2CL6X 4PX9A 3WMFA 1NIPA 3NBZC 4KFRA 1W36D 4DCSA 1SKQA 4DSTA 1E4YA 4S35A 2BWJA 1EX6A 3AGPA 4Q03A 2NG1A 4UXJA 4B44A 4Q9LA 4XTRA 3T06B 4URZR 1HH4A 1E2IA 4DT1B 2O8FA 1Q12A 3VTKA 2E1RA 2YWFA 5FTKA 3BFKA 4HB2A 1GL6A 1N0UA 4R2HA 5DH9A 4Q9IA 3DZDA 1OXVA 3D8BA 4GP7A 5JBQA 2ATVA 3WMGA 1W4RA 1GILA 1IJEA 1RRGA 3EC1A 4WXRA 3QQ5A 5LBIA 4ZIRB 1WBBA 2BEKA 1F48A 2FGKA 2JEOA 2Q9CA 3DM9B 4I4LA 2FA9A 4TTQA 3SE0A 4JSYA 2REBA 2BDTA 4LJ9A 4MKHA 3CRRA 2HJVA 3TVTA 2ODWA 4LJ6A 4MRSA 4NPHA 2GF0A 2FX3A 2B21A 4M9ZA 2XOKA 3K0AA 4LSGA 2OO7A 1E1RA 5FFMA 1KSFX 2ZRGA 3TQFA 1JBKA 3FMIA 3KKNA 4A0HA 1NG9A 4AKHA 1KYIA 1U9IC 2FDCA 4DVGA 2XZLA 4M1MA 5AUOB 2GJAA 3GLGB 5FR1A 1XWIA 2CCGA 2NO7A 3BFXA 3CW2A 3LW7A 3B1VA 2G88A 2VH5R 3A1SA 5M04A 3X1WA 4GOXA 4Q19A 3ZYCA 2FWRA 3HU1A 2L0XA 4Q21A 4JLOA 3FOZA 1VIAA 1U2RA 4NTZA 2OILA 4HAXA 4OI0A 4AWXA 2O8DB 1GTVA 4PSVA 4QL3A 4AI6A 1WDTA 3IIMA 3FMOB 1A2KC 1E2QA 2HV8A 3VHXA 3GLFA 3QF4B 1VTKA 1ZP6A 1R0YA 4V0MA 3CRQA 2PX0A 4JZKA 1II8B 2QN6A 3A36A 3LD9A 1OHHD 3K0FA 3OESA 4OHWA 1ZD8A 2D7DA 1CIPA 2AR7A 4FCTA 5FOSA 2H18A 4B71A 3BFVA 3M4YA 5JZVA 2HT1A 3LBHA 3GCGA 4R71A 2WAXA 3GJ0A 3C14C 1WXQA 1N3BA 2PLFA 3JZMA 4G5OA 2VP0A 2ZE5A 4JS0A 4K81B 4TZ6A 3AP2A 4Q1DA 2FPMA 4G5GA 5HTKA 3CF2A 5BW8A 4U02A 1Z0FA 4YMTA 1IONA 1AS2A 2D2EA 1G5RA 3I4LA 3RRNA 1UFQA 2ZRLA 2W6JD 1IBRA 4PC6A 4TQUS 2Z83A 4AK9A 1W47A 2GXSA 1XB2A 1Q1QA 2OT3B 6Q21A 1P72A 3I5XA 1PUJA 2YOGA 1FNNA 1H65A 2OE2A 4DIDA 1FX0B 5JHGB 3RC3A 2XNDD 1VG9B 4JVMA 4M9QA 2DHRA 1E94E 1OLOA 2ZXUA 2EFEB 2YNMA 3KZ1E 4B3FX 1L7VC 2C96A 1Q1BA 4BLRA 3H4MA 2VP2A 4NYJR 2F43A 5H8WA 2WWFA 1GL7A 2ATXA 2OBNA 5IHPA 2QM8A 1T91A 2GCNA 3KQKA 4PSKA 1XD9A 3CZPA 2GVDC 3W34A 1CJUC 1BOFA 1IXSB 4UJ5A 4KAXA 3BH7A 4DJTA 3OF5A 1R0WA 2Q21A 3I61A 5FTJA 2RKOA 4PAQA 4JVLA 4US2R 4URUR 3GLHE 3LQQA 4DC9A 4C7OB 1F6BA 4KXFB 221PA 4JLBA 5A5GA 5EE9A 1OF1A 3ZGXA 4UKDA 2EWWA 3QEOA 4DLXA 3RYTC 2ZIAA 4D6PA 2BCGY 4BFUA 2ZR0A 1RJ9A 4K8OA 1NY5A 3SHFA 3ADKA 3TUJC 1G3IA 4M0LA 5DO9A 3V4FA 3AF3A 1G6OA 2GEUA 4MGIR 1RRPA 2B7CA 4V03A 1Q3TA 5TMPA 3Q7QA 1TX4B 3B5JA 1ZU4A 1US8B 1JR3E 1MR3F 1WA5A 2BV3A 2NQ2C 1W49A 2VQSA 4TMTA 1E3MA 1DS6A 3WYFA 2QRZA 3VR2A 3VR6A 5DNYB 1PUIA 1R5BA 3EXAA 4DCTA 4JLMA 1W44A 1KJYA 4HDCA 1XXHE 1WF3A 3Q9LA 2GZDA 4QGFA 4QM6A 4BE7B 5A0FA 4OHXA 1LVGA 4TT3A 1VCMA 2GZHA 3I1FA 4QBGB 4L9SA 2YWEA 1P2VA 3WXMA 4ZCLA 4P3YA 2XITA 5HE9A 4MYTA 3AV0B 5JJIA 2FZ4A 3PR1A 621PA 2D06A 4LYFA 3U3OA 2PZFA 4RY2A 2X2FA 4II7A 3SBEA 2P6RA 5IT5A 4NCJA 2D3WA 1KK1A 1E9FA 3NDPA 4A92A 5C1BA 4DXAA 3TAHA 3AUXA 4D2IA 3MG9A 2A30A 1KSJA 3R7WB 3QE0A 1KDPA 3GJ4A 1Q57A 3QKTA 4HB3A 1GZSA 2AFIE 2O0KA 2GXUA 4NU0A 4EKDA 4B47A 2AK2A 1E9BA 1R7RA 4JL5A 3NEYA 3QUSA 2ZAMA 4OK3A 4O0MA 2W58A 1SVKA 3EAQA 3O8BA 1G1MA 4JL6A 3E1SA 4MA4A 3KXIA 3S1AA 1SKYB 2V54A 1LS1A 4W7SA 1G20E 2JATA 3KKOA 3RRYA 4PO8A 1N6RA 3EX7C 3MGCA 2KJQA 4ASUD 2DWOA 4Q7MB 4A6XA 1DPFA 4N0DA 4I1SA 3CPJB 4LZZA 1OFIA 3EZ6A 4FCVA 5B58C 3RAPR 2ERYA 2H7VA 3UK6A 2K5UA 3CLVA 3UMFA 5LDDC 1CR4A 2DR3A 2MSCB 1KY2A 2ZJYA 5EE5B 1CLUA 1PLKA 1UJ2A 1Z2AA 2VP4A 2ZJZA 3QSYA 1AGPA 2J87A 2GA8A 4Q4HA 1M7BA 3GQBA 2ZJ2A 4EPTA 2F55A 4GMXA 1E79A 4U7DA 1CJMA 2ZS9A 1FQJA 1EXMA 2J7PD 4JLAA 3LX5A 2JJ1D 1G9XA 2N42A 4LPSA 1UKEA 2IYXA 2JJ2A 4Q1AA 4RZ2A 3EARA 4XJXA 5G53C 4ESVA 2AN9A 4OQMA 1KKLA 1RPZA 4DLUA 2XXAB 2IYVA 3VMFA 2HYDA 4GBMA 5E7IA 4AY2A 1IXZA 2C77A 1SVSA 2WVJA 5LB2A 2ZYTX 1W4BA 1JR6A 3CIOA 1J7KA 2QPAA 3MJHA 4Q00A 1BYUA 3WYAA 1DE0A 5AJYA 1YZGA 4HZIA 3SYLA 2ZI7A 2EFHB 1VCNA 1VG8A 4CEIA 1Z08A 2J5XA 4DSOA 2VSXA 2IXGA 3C4JA 4G3XA 2QPOA 3SJBA 1KK0A 4A9AA 4ABYA 1CJTC 2B92A 2QENA 5SZHB 1WB9A 1ZIOA 1E2NA 1P60A 3N2IA 3QIAA 3R9IA 1ZMXA 1Z63A 2WBLC 1PV4A 3WHKA 1XD2B 3MFYA 3I8SA 3MWYW 2WJGA 4LHXA 2F6RA 4QXAA 4B3BA 3NBXX 4CVNA 1I4DD 1NY6A 3W6NA 3FDIA 5CB8A 2IWHA 2GILA 1T0JB 1X86B 5TY0A 2WKRA 1Z29A 3V4RA 3GJ5A 4XH9B 2GJSA 4GP6A 4XVUA 1LW7A 2HF9A 2BCJQ 3UANA 5JWOA 4NCKA 3QG1A 2AKYA 4HEJA 2NPFA 5KSZA 1GKUB 2RB4A 5FH9A 1ESMA 4E22A 2PLRA 1NBMD 3I62A 1Z8FA 1U81A 2Z6VA 1EFRA 4E09A 1VG0B 3HWSA 4IXNA 3FPAA 1KI4A 1IJFA 1UEJA 4OYHA 1NL3A 5FOTA 4L5BA 2V6JA 4Q1FA 8OHMA 1G4AE 1B23P 1XF9A 3GFPA 1P2TA 4Q4AB 3D7MA 3OE7A 4BWYA 2G3YA 1XBTA 5KUTA 4HAWA 4H1VA 4PAOA 1N0VC 4TLCA 1TUEA 2WZQA 4FN5A 3AVOA 1E1QD 2RHDA 3QPVA 3TE6A 2MMCA 2F3RA 3ZIAA 2F1HA 3LNCA 4YMUA 5FL3A 3TBKA 1GM5A 3EPKA 4C0SA 1QBKC 2OUKA 2HT6A 4TSFD 4FWIB 5EP4A 3ZD6A 3TRFA 4LJ5A 3K0SA 3QXCA 1K8RA 2ZUCA 3AQ4A 3BB4A 2KBFA 1NMZA 3LXRA 4HZUA 4PXAA 2ZRDA 1XTIA 2RGNA 2F1RA 4LV5B 2DWPA 2XJ9A 4EJSA 4PQRA 4F91B 3U4QA 1W2GA 1KO4A 2TMKA 2WKPA 1EWQA 2VEDA 2BHRA 3CO5A 1DAFA 1NVVR 3LY5A 4NP6A 3UMRA 4CRWB 3CH4B 3GJ3A 3ZQJA 3KKPA 3WY9A 3EW9A 1OH5A 3OFND 3K09A 4DLZA 2UVQA 3FFAA 2VHQA 4MYCA 3WBKA 5KNDA 1XZPA 2DFLA 2HDNB 4EPXA 3T1QA 2ZJ8A 121PA 3B1ZA 3CZQA 1PJRA 3LV8A 1P9NA 4NMMA 4FI3C 3WNCA 3UPUA 2GCOA 1X1SA 1E0JA 2C95A 1OXSC 5D3MA 1NN1A 4NYIQ 2A5FA 4KBFA 4TYWA 1E96A 2G77B 2CK3A 2W2XA 3L8YA 4JLVA 4BRWA 3PUXA 1EESA 1QDEA 3DO6A 1JJ7A 1QRAA 3RANA 1W46A 3BC1A 5E4FA 1XJQA 4R7ZA 1G8FA 4WAUA 1Q1ZA 4P4SA 1KZGB 5C2JB 1XD8A 5B57C 2QBYB 4UXIA 1MO4A 3FE2A 5FOVA 1Q21A 3RS3A 2JCSA 4MH0R 3IBYA 4XVRA 1HA3A 4RD3A 1SZPA 2OCYC 2QQ0A 3ZZUA 4ZI3A 1D9ZA 4P4UA 1JQLB 4B75A 2QTHA 4DWJA 5DHFA 1COWD 2ZYVX 1OIWA 3T5GA 3RC8A 4EPRA 4RKEA 4WBSA 2J0UA 4WW0A 5DISB 2GTPA 1JJVA 1XCPA 4BPBA 3FVQA 4NCHA 2QMEA 5FOXA 1NKSA 4A0FA 1S8FA 2GJ8A 2XJ4A 5JSZB 1KJZA 3IHLA 2QP3A 1SXJB 2VP5A 5FI0B 1E2LA 1ZINA 5DI3A 1P61B 2HEIA 1ELOA 2Q3HA 4JVNA 3TSWA 4EPWA 1KO5A 3DPUA 2PBRA 5EP1A 4A4DA 4ZDWA 1X1RA 3O47A 3KXLA 1GKIA 4WZAE 5EXTA 4A36A 1E0AA 2CLSA 2GF9A 2FN4A 2J3EA 4FXPA 1Z06A 1Y63A 5CLLA 4C30A 1MO3A 3REFA 1G8PA 3FHOA 1UKYA 2QAGB 1RRFA 1CF4A 1VKJA 3KB1A 2IYYA 2V6IA 1MABA 2AK3A 4IEEA 5AK0A 3VU9A 4ARZB 2YC4C 5ELXA 1S96A 2PX3A 4PSAA 1VMAA 2I4IA 3DZ8A 4DBLC 5KTYA 3J81k 1HURA 1FMJA 3I72A 4KI0A 4C4PA 2VRWA 3U7EB 5GJBA 1ZM9A 2VP6A 4RFSB 2H92A 4B3CA 3THXA 1NJFA 1YR7A 2OXRA 1OIVA 2A5GA 1R6BX 4A8JA 2O0JA 1W5TA 2AFHE 2C03A 2JA1A 3A8TA 3MAAC 2JLSA 5FUWA 3CONA 1UBEA 3H84A 1A2BA 1W0JD 3GJ6A 1KSGA 3IGFA 2B7BA 1A4RA 2ZRMA 2C04A 3K70D 2GZAA 4M9SA 4E07A 2D7CA 2P6NA 4LYJA 1CJVC 1GOTA 2ANCA 2IUSA 2OFWA 4C0QC 4YXWD 5AJWA 5HPYB 5KPJA 1Z3IX 1RE0A 4OJKA 1Q44A 2PCJA 4EPYA 5FI1B 2BBSA 1X8JA 1SKYE 3U44A 2DWQA 4PPGA 3GP8A 1OHHA 5BN5A 4HAVA 4OQLA 3FFBA 2YVUA 5HZKA 2V9PA 5CB6A 1DOAA 3LH5A 2BIFA 4DIEA 1YR8A 5EP2A 1CJKC 4D25A 4F7WA 4MQBA 1TQDA 2BKEA 1EWRA 2IYSA 1TQ2A 3SS8A 4TYQA 2KSQA 4IOJA 1N2CE 4O25A 4JLKA 2Q9BA 4KYIB 1XEXA 1TEXA 1OE0A 1IXRC 3PQCA 1S9HA 5EZ6B 1G7SA 2IW3A 2W6JA 1WCV1 2W0SA 5F9FA 5J47A 4CEJB 4Q7LA 4FD2A 5C4MA 5AUQA 1QHXA 1E32A 3VR4A 2ZAOA 3SYKA 3LRPA 2PCLA 3PJRA 2XNDA 1Z83A 4BZQA 5K8LA 1OIXA 1U90A 2GVZC 5GVRA 4IDPA 1ZM2A 1SXJC 2ZVPX 2R9VA 3OEED 1E2JA 1Q20A 3SR0A 3TGPA 5FOWA 3B8HA 1M2OB 1OFHA 4CF7A 1GVNB 1BIFA 4TLDA 3Q7PA 1KTVA 1D2EA 1R0ZA 1AKYA 3T34A 5FBRB 3MRSA 3W3ZB 1N6LA 2VF8A 3ICQB 2QAGC 5EE1A 2W0MA 2AWNA 2ZEJA 1ZM4A 3E5HA 1P62B 1J70A 1IY2A 1FP6A 2C98A 1G291 1NN3A 2NIPA 2WM9B 4IXMA 1T9HA 4L4UA 5SZJA 2ORIA 4AYWA 1U8YA 1XTRA 4IRUB 4HLUC 3THYA 2OBLA 1FFHA 3RWOA 2QSZA 4YMVA 3SQWA 1AQUA 2JLQA 521PA 2R6FA 3ND8A 1JR3D 4CDGA 1AN0A 1XFAA 5D3QA 3EZ7A 2DFNA 1UM8A 1VCIA 2HXSA 3GLGA 4UNSA 4I81A 2X8AA 2PEYA 4URXR 4OHYA 4M1KA 1OT3A 2NZJA 2YOFA 3GMTA 4DLVA 4E03A 5AJXA 4F4CA 1OFUX 1VYVA 2QT1A 2NO1A 3K0EA 1XCGB 2YJTD 4KVGA 2J0QA 3NBYC 5L3SB 3DDCA 1GP2A 2WWHA 3T61A 1MT0A 1TF2A 4A2PA 1TUIA 4BFVA 2F1JA 4UNQA 5CM8B 1NG1A 5JS8A 4IDNA 3VKHA 4HAYA 1J90A 2V8OA 1VIYA 1N6PA 2IUTA 3D31A 3ETLA 3QF4A 2ZRBA 3DOFA 1HT2E 2D2FA 5DYIA 1GSIA 4M22A 4Z51A 2O8CB 2ZRJA 5GVSA 5B2ZA 1NVXQ 2IWRA 4TYPA 4D80A 3MWLA 3CR7A 2J46A 5CJPA 2FSHA 2RGDA 5TV2A 5AUNB 5JECA 3OIVA 4ZPXA 3R9WA 2VSOA 1AKEA 4D0LB 4C2TA 4L15A 1AK2A 3U3KA 1F2TA 1NRJB 3SHWA 1NKTA 5BYKA 2ZETA 4JBWA 3W3AA 4PHHA 2FNAA 2ZJOA 4Y0AA 5J4HA 5CK5A 3GLIA 4HATA 4HLCA 4UNPA 5J4LA 1WP9A 5FTLA 1G5PA 1H8HD 3CNNA 4S2EA 4PTLA 3IDQA 4RFVA 4QRHA 3SU8A 1KI1A 1U98A 2ZSBA 1R2QA 2QROA 2CCJA 3H86A 1N5JA 2OFOA 3ZS9A 5BN4A 1GIAA 1G8HA 1XMSA 1Q0UA 4GMDA 2W6ID 3PVSA 3TLXA 1YZKA 1JPNA 4ASUA 1CS4C 4O2RA 2F9MA 3P20A 2REXB 4DLSA 4DCNA 2FFAA 3V9PA 3WP0A 4TWZA 3AVVA 3TKLA 2ZU0C 1K5GA 4LBVA 2JLWA 4TYYA 1RVDA 3SDZA 2FE4A 1AIPA 1UDXA 3Q8XB 2RH5A 1B0UA 3LLUA 1W48A 4PO9A 5TARA 2O8FB 1G6HA 1GNQA 2R65A 2XZOA 1D8TA 1ZC4A 5CYPA 1C9KA 3OIUA 1N6IA 3SQXA 4HAZA 2UZIR 3RS4A 3RS2A 3AF4A 3ZZ0A 2XB2A 3EA0A 4KU4A 3Q85A 5DI9A 3SYNA 2J7PA 3GJXC 3WYGA 2JJ1A 4B33A 2IYTA 1SVMA 4Q01A 4DDWA 4GRAA 4B2LA 3AH8A 1NMYA 1Y3AA 3I5YA 3REGA 2ZRKA 3L0IB 1DAIA 5BXQC 2QORA 3UKDA 4V0OA 2OCBA 2XTNA 4AC9A 4BZXA 1NVUQ 2KB0A 2GEVA 5DYGA 5SZIA 4OHVA 2ZS8A 3K0AB 2AKAB 4C0KA 2W83A 4Q66C 4JKYA 4RD4A 1MH1A 1AA9A 1XNJA 5H70A 2ZJ5A 2JIZD 4M1OA 4DLRA 2ASEA 2EFCB 3IEUA 1MO5A 4RKFA 4TLBA 1KK2A 1GDDA 3U7HB 2ZYWX 1ETUA 1Z5ZA 5CK4A 1E2EA 2IXEA 2Q6TA 3F5FA 5FPKA 4HUTA 1YU9A 2GJ9A 1VHTA 4LV6A 5JWHA 3RS7A 5GADl 1SXJE 2HXYA 4JBXA 5L3VA 2A3RA 3CPHA 2H8KA 4A1FA 1CR1A 3DL0A 1TTTA 1CULC 3GLFB 2CMKA 1JI0A 3K0CC 4B73A 4F93B 3WNBA 2I1VB 3KKMA 4TL6A 4QOSA 2ZQ5A 1HE1C 4DDVA 3B6EA 2UKDA 2HF8A 3W90A 1DAMA 1MRNA 1MO6A 2ZI5A 1E6CA 3TJZA 2PH1A 3GPLA 1ZUNB 2FSGA 3AKCA 4A2QA 4IVPA 2FEMA 4U00A 1T5LA 2ZSDA 3L43A 1TADA 3HP1A 3B85A 1NBMA 4QM7A 4KHZA 2JGNA 4F38A 1X8KA 1XTQA 1XEFA 2VL7A 4JJZA 5L8VA 4IOKA 1YKSA 1OJLA 2GHIA 1U0JA 3KJIA 1G19A 3THWB 4A0GA 1IN6A 1YJ5A 4LJAA 2PT5A 2ZRFA 4CW7A 4QKQA 4IHQA 5AWFC 1XPRA 1WE2A 3MJRA 1E1QA 2ZE8A 5DE3A 4D0GA 3ZLJA 5K8UA 1Z0KA 1O87A 3FHTA 1XPUA 3NEJA 2WHXA 2ODBA 2PT7A 5EP3A 4TSFA 1DO0A 4QNMA 1IN4A 2G1KA 3BIFA 3U3RA 4JLPA 3PENA 2IK8A 4DUGD 3N70A 2F43B 3PEYA 4PAMA 1CTQA 2WICA 2WJJA 3ZVMA 2IC5A 3I8XA 5FOUA 1UBFA 2QAJA 2XTMA 4PQYA 1KDOA 4HUQB 3VR1A 5KNBA 4TL8A 5H1YA 4KYUA 3CUEF 4B6FA 2HLDA 1DTSA 4ZKEA 2A2ZA 2G6BA 3OAAA 4M4SA 1P6XA 3P26A 1NP6A 3AB3A 4YQFA 1XP8A 3BAFA 4ZCMA 2DB3A 4P4TA 3X1ZA 3OFNA 1PLJA 2WIBA 3M0EA 2XXAA 2GAOA 2IA5A 3AP1A 2A78A 3CH5A 3KX2A 3KQUA 4Q18A 1E2GA 2QQEA 2JJ8A 1TMKA 2FJUA 2GAAA 4QJ5A 3EPJA 1OKKD 3JVUA 1RJ9B 3H1TA 3W8RA 4QJ4A 3AKEA 4NYIR 2IYWA 421PA 721PA 3NC1C 3L0PA 1IY0A 4GZMA 4LPKA 4TL9A 5EQTA 2OM2A 1HTWA 3A4MA 2ZM5A 4ON9A 5F9HA 1UKZA 2GBLA 2VHTA 3JZAA 1TAGA 4MGZR 1LTQA 4D26A 2CJWA 5HKKD 1KZ7B 3L2OB 1NSTA 1G3UA 4P31A 3RNLA 2NGRA 4ZDJA 1PLLA 5EUQB 2BBWA 4QBHA 2ZI9A 3H2YA 5CDFE 1GKYA 1E99A 3L0SA 4M21A 4BFWA 2MSDB 1OXTA 4PZLA 4DCUA 4DCVA 1AM4D 2ZJBA 3RS0A 4QGHA 2ZE6A 5JWRA 3K9NA 1E0KA 3RHFA 3NHAA 3QKSA 2WMNB 3D3QA 4RCYA 1WRBA 5TXGA 3F3YA 3UWKA 1M7HA 1KNQA 3AVXA 2O8EA 4MGYR 3IO3A 3U7FB 1DEKA 3NTUA 2Y8EA 2JLRA 2OHFA 2REOA 3U2QA 2EYUA 1NIJA 2FFBA 5EE0A 1COWA 1GL9B 4FCWA 2QTFA 3VKWA 3IPXA 1OH7A 3ECCA 2GETA 4G5QA 3AVWA 1P2UA 1Z6AA 4YC7A 4GDFA 3PXGA 3NC0C 4FMBB 2OV2A 5AUPB 4BLSA 1FW6A 4Q48A 2WSMA 4C0HA 3BH6A 1WBDA 2QMOA 2JDID 2GK6A 4F4IA 1C1YA 1ZVQA 2NMVA 1W0KA 3KJHA 1BMFD 4TLAA 1XZQA 2BC9A 3B60A 3PG5A 3VHLB 1ZM3A 3EZ9A 4KVAA 1T3HA 4FMDB 2QM7A 2NPIA 2Z5FA 1ZCBA 4BZPA 2JASA 4UNRA 3AKDA 1T8UA 3CR8A 1SVWA 2ORVA 5HCNA 1N5IA 3DKVA 3K9HA 4XSGA 3RVBA 2FMXA 2OCAA 4RJLA 2OLJA 4NBSA 4NYMQ 3QOFA 3TH5A 4B2PA 1GUAA 1ZNZA 2FV8A 2CHVA 2J59A 1FP7A 2GXQA 2IEYA 5AJVB 1X8LA 1P7CA 1T0HB 1FMLA 2VYFA 4I1VA 4AG5A 4A82A 2OAP1 4LYAA 3VAAA 5KDOA 1ZYUA 4D81A 2OBMA 4DLYA 1MOZA 3LXXA 5DN6D 3A1UA 1IQPA 1NN0A 2QNRA 1GRQA 4HSEA 4E5UA 3T15A 3BBPA 4Q4HB 4Q1BA 4G01B 4RCZA 1W0JA 3X2SA 3MD0A 4A0RA 1IY1A 2BM0A 2EVWX 2A9KA 5G3YA 3LVQE 1KOFA 3MSXA 1HYQA 1M8PA 3VNVA 1VYTA 3EZFA 4YXWA 2R8RA 4HDOB 5CITA 2IEZA 3B78A 1E9AA 4EQ6A 1K5DA 3E70C 4LBYA 4JJKA 2HJGA 3LWNA 1S0UA 2B8TA 2F1IA 3Q72A 3CB4A 1X6VA 3SFZA 3K9GA 1RZ3A 4AYXA 2CL7X 3AEZA 4MGKR 4MUBA 4BLOA 3GFTA 4TZ0A 4ACAA 3X1YA 3KTAA 4KLZA 3SJZA 4M9XA 2DYKA 3KFXA 3QXXA 1NI3A 2CLCX 4IKEA 4EFNA 2EWVA 3QKRB 4AKGA 1FL9A 1G8GA 1V43A 4D0NA 5C46F 4RD6A 5KDDA 2ZYUX 1ESNA 1R8SA 2VHCA 2W2TA 4NKRA 4Q02A 5JI3E 1AZSC 3C5HA 2AL7A 2HLDD 3CRW1 4JLJA 3OAAD 1EK0A 2Z0MA 1QG4A 3AUYA 4JBYA 2RCNA 2J0SA 3AF1A 3RDPA 3PIRA 1DO2A 2C99A 3MWKA 3OEEA 1U99A 2WSSA 1YZUA 4JVSB 4Q1EA 1EFUA 3TR5A 5JMTA 4B2IA 1G7TA 2VTKA 3QKUA 4LHWA 1QZXA 4IDQA 1N25A 2V1XA 3MCAA 2QA5A 3CWQA 3A37A 1CU1A 1FQKA 1VHLA 3EASA 3L0OA 3QXSA 4X8LA 1HY3A 3P32A 3QNUA 2FFHA 3KQNA 2XGJA 1OW3B 4X8OA 3GLHA 2FOLA 1R10A 2XEXA 4HAUA 4CT4B 2OG2A 1ZM7A 2ZANA 2R44A 5JLJA 3EG5A 3I32A 2AX4A 3QXJA 1ZC3A 3KJGA 4CEHA 2VF7A 2ZVQX 3HR8A 4IDOA 4ZI2A 3QBTA 3BH0A 2O8BA 3QVVA 1W4AA 3W6OA 5DHAA 1TPZA 4TYNA 4MITA 1TU3A 2ZE7A 3KFVA 1D5CA 2D4HA 3HPQA 3EA5A 4IOMA 4QBFA 1G64A 1A7JA 1TNDA 3GLFE 3TUZC 3LO5A 1KHTA 5LB4A 3P1JA 1JR3A 2QMHA 3NWJA 4CT5A 4FMCB 5FL7D 4YMWA 1NSFA 1RIFA 2A5YB 4FIDA 4V0ME 2GCPA 2GESA 5CYOA 1KIMA 2BBOA 2P65A 3PUVA 4YONB 5KOYA 4YDHB 1G17A 3FKSD 3P4XA 2NTYC 1NLFA 4WXPA 2ZRAA 5HCIA 3P27A 1XU4A 1XXHA 4N3NA 1TQ6A 1ZU5A 1NMXA 2ZRCA 4W5JA 4BFYA 4B3DA 4QC2A 4RD2A 4Q4JB 1SHKA 2QZ4A 4WVFA 1Z47A 1V5WA 4XIGS 4EJSB 3U4QB 4BUJA 1NLZA 1ZBDA 5KHOC 3A6PC 1L2TA 2J1LA 3JVVA 1EFTA 1U94A 1ZCAA 1E4VA 3R9XA 5JRJA 2G0TA 4D82A 1DAGA 1R0XA 4IFBA 4OK6A 1Q22A 3A1WA 1HT1E 5J40A 1S9DA 1W0KD 5L3QB 4C0AC 2B6HA 1OB5A 3E2IA 4PHFA 4Q4LA 2WWXA 1QHIA 3O8CA 1NLYA 2P0EA 4JLNA 1KMHA 4AIIA 2BOVA 1FTSA 2ZITA 2P6UA 3B1XA 4MRPA 1EFHA 5J5CA 2FF7A 4OL0A 1KI6A 2YOHA 2I3BA 3CM0A 2WWIA 3LLMA 1WMSA 4NCNA 3EWSA 1DVRA 4DSNA 2GCOB 1KDRA 4IDHA 5D3MB 1FOEB 1D2MA 3ICEA 2E9SA 4KV9A 4TN1A 2X77A 3B7GA 1OB2A 2JLXA 2BMEA 1EFCA 1GITA 2MMGA 3PUWA 1MKYA 1H8HA 1S3SA 2GK7A 4BRUA 5HR5A 2PMKA 1G4UR 3RSOA 1E9RA 4P4SB 1RYHA 4CYMA 1D2NA 1P9RA 2C9CA 2LWIA 3ASYA 3LBNA 1YR9A 2GNOA 1U9IA 2RMKA 3KKQA 2P5TB 4A2WA 1KMQA 4UNNA 2W6IA 4EUNA 4TTRA 1BYIA 1W36B 1N5LA 2IT1A 1LB1B 5AR1A 1FNMA 2SHKA 1KI9A 1JQJC 4LGMA 2GJKA 4Z1MD 5IRCD 3CX8A 1BO6A 2YYZA 2YZ2A 3W8NA 1OXUA 4JT4A 5H68A 1YE8A 4Z8YA 5F2EA 4I1UA 1GFIA 1F2UB 2ZUBA 3CRVA 3L82B 4LJ4A 3BWDD 4YMSA 2J0UB 3NHBA 4QG7A 1XEWY 3U3JA 3U5ZB 4M1TA 3IUYA 4GI7A 2PJZA 3I3SR 4LC1A 4XD7D 3T1OA 3DMDA 3K9LA 5DGXA 1Z2CA 4DKXA 2RGAA 3QY0A 3TW8B 1AJEA 1N5KA 2FG5A 2J0VA 2HCBA 2OESA 4LC0A 3SJAA 1S2MA 4LYHA 4A6PA 3QI2A 1VG1A 2ZTSA 4KODA 1FZQA 4D4JA 4OI4A 2CDNA 3B9PA 5FUYA 1NJGA 3IKJA 1Z07A 1OXXK 2ZSEA 3F8TA 3R8FA 4HB0A 3TVDA 2J41A 4M53A 4OHZA 2RGNC 4MKFA 3UXMA 4EJSC 2CXXA 1U0LA 1NF3A 1EGAA 1KKMA 3MWJA 1Z0DA 1CRQA 1MABB 1D6JA 2R6CA 3IO5A 3OZXA 4LK2A 3VU9B 1LFDB 1D9XA 4LWZA 1C4OA 2JIZA 4WA7A 2WSSD 4XSHA 4DT1A 2AWOA 5FPTA 2HCJB 4OI1A 3SFVA 4Q9HA 4MYUA 3U7GA 1XTJA 3HJNA 2BMJA 4URWR 3K09C 4ZKDA 2C78A 3THXB 5B30A 1S1CA 4O3MA 3B1YA 1H8ED 4KBGA 4AURA 1W7AA 1A1VA 4A8JB 3FGNA 1XDBA 4JLDA 3T35A 1E98A 1P5ZB 3WMEA 1J2JA 1VPLA 1QHNA 1SXJD 1ZNYA 4LHVA 1KAGA 2ZU6A 3LVRE 1AS3A 1TF5A 4ZIRA 1JPJA 4EPVA 2AHOA 4ZO4A 1W4CA 2RGEA 5FR2A 2ZR7A 4M1SA 4TMKA 1M1YE 5KSYA 4TQAA 2JAQA 3U61B 2CVFA 4PHTA 4RSGA 3VQTA 3U44B 4X8MA 2MSEB 1T3SA 3W5JA 2R6DA 4TMVA 2R6AA 1L8QA 3X1XA 2BBTA 5CLQA 4WIAA 4K46A 5BN3A 1E2PA 2IXFA 1DELA 4G1UC 5JJKA 2RGBA 4PANA 4PR0A 1ZJ6A 4US1R 3SJCA 5FBQB 1W36C 2XNSA 5J4YA 1KI2A 1G18A 4W9MC 1XTKA 3EIEA 5FTNA 1YQTA 3QXHA 2GWHA 3N5CA 2N46A 2O8DA 4UXHA 1JNYA 5HE8A 3ZH9B 3WRYC 3RS5A 3SOPA 3CX7A 5TVKA 2P2LA 4Z8XA 3TUIC 2G1JA 3VFDA 1QHHB 4HLDA 3T5DA 5ANRB 1II8A 1R8QA 4DB2A 2QG6A 1QF9A 4HI0E 2ZRIA 4L16A 4DHEA 3VR3A 1IAQA 1I2DA 2CHGA 4DUGA 3ZJYA 3DM5A 1DAKA 1U8AA 4QGGA 3QJYA 2ZR9A 3GJ7A 4YLGA 2WWYA 3GEIA 1SHZA 5KSPA 2YC2C 2CVHA 4DRZA 2WMOB 4G0NA 2QUZA 1RW4A 1YR6A 1T5IA 2H57A 4KFUA 4KFSA 5KYKA 2IX3A 1CXZA 5KO2A 2OLKA 3ASZA 3CRMA 3IIKA 1CR2A 2QU8A 4LHYA 4RVCA 3QVUA 4ESHA 1WQ1R 1G16A 2QI9C 4TLEA 4XWKA 1J99A 1Q3HA 2ANBA 4F4JA 5EJEA 1P4SA 2PJRA 2V7QD 3C15C 2GDJA 2QSYA 1W1WA 1P75A 2DY1A 3VX4A 1OKKA 3NVAA 2ZI4A 3WP1B 3RLFA 4B32A 5LPNA 3THYB 1F60A 1A82A 1FX0A 5TB5A 4A8JC 1G21E 3Q5EA 3T1VA 4ZDIA 1E9CA 2CLDX 2YINC 3NDBB 3M6AA 2PMDA 1JB1A 1O3YA 2H17A 2VHJA 3PFIA 4QGAA 5FUXA 2WIAA 3B9QA 4W5HA 3V00A 3W6PA 2X1VA 4YDSA 2ODNA 5HKKA 4EFLA 2C9OA 2VPPA 3OEHA 4KCGA 2J7KA 3NG1A 3ZD7A 3TIFA 2YWGA 5GJVC 1JALA 2CNWD 1Z6GA 4JIMA 2P5SA 1ANKA 1LNZA 2XSZD 3IHWA 2Z4SA 4JYCA 4OBEA 5CJ2A 2VSFA 2OSBA 3EZ2A 2F7SA 1JXMA 5EXSA 1N0WA 4DLWA 4I99A 2A5JA 4EDHA 4B3XA 3AF0A 4C7OA 2QMUA 2DCUA 1XMIA 1G3MA 1FTNA 5BQ5A 2OZEA 4FWTA 2ERXA 3PEVA 4AD8A 2ZREA 4DSUA 1G8YA 4NZYA 2XB4A 2FH5B 1AZTA 3HR7A 3BOSA 5E3HA 4TL7A 4B6EA 1P3JA 5FUVA 2WOJA 3NIBA 2J45A 2FPKA 3LBIA 3K8YA 3N2EA 4LCBA 4RD0A 4G5SA 1US8A 2Q3FA 2G9NA 4BQSA 1F2TB 4KJZA 2Z43A 4LI0A 4OQNA 1LF5A 1RKBA 2OAQ1 3HYTA 3T12A 1KI7A 4ERNA 3GLIB 2YWHA 3W9YA 2IS4A 2JDIA 4GPTA 1BMFA 5EXPA 2ZJAA 3THWA 2NZ8A 2CHQA 2JLUA 1KO7A 3PV0A 5DLQC 2V1UA 2J9RA 4ILEA 3SNHA 2WPDD 4NYMR 1OH8A 4LV8B 4TMXA 4A15A 2BVNA 5IK2D 2FZLA 4US0R 3C8UA 3DHWC 3DOEA 1U8ZA 1L4YA 5AJZA 1BS1A 1Q1EA 2BKUA 3KQHA 1CKEA 1E2FA 2VP9A 4J0QA 2VIIA 4D4KA 3HU2A 3L8ZA 2CCKA 3LDAA 4WOPA 5GJWC 4C0LA 3U6BA 2AD5A 3AVTA 2G0NA 4N0EA 2FPLA 3K0FB 4C3ZA 2GXAA 4HUQA 3Q3JB 3IBGA
chains in the Genus database with same CATH superfamily
2OAEA 1OYWA 4JLUA 3R7WA 1E92A 2C3UA 4YP6A 3KUDA 4DEVA 4R16A 1GN9A 1SZDA 2AOTB 3JWHA 1X1EA 3IESA 4JB2A 1RKVA 3TW0A 5CTJA 1AKMA 1LWOA 4LDJA 3Q6IA 3PICA 4CLXA 4N76A 2FAXA 3ETDA 2VF2A 1YE5A 2PUJA 2CYBA 1NVBA 1SCBA 5J2UB 4C4SA 2DPMA 6AT1A 1HEIA 2PWBA 4K6CA 3UV6A 4WRRA 3LECA 3ZV4A 3OUTA 1LJ8A 3DOIA 4FGJA 1V1MA 1N6HA 3P9RA 1Y6QA 2PGDA 4DEXA 3QIVA 1GGMA 4GSYA 5DU2A 1GTG1 4YP1A 2OK7A 3LPCA 5DIFA 5CIQA 3SJ7A 1IOWA 5EUMA 1FUKA 3E58A 3KJXA 4HAOA 3ZXXA 5BWMA 3CNOA 3QEBZ 1ZNWA 1H6CA 4RD1A 2HWKA 4RZ3A 1TKCA 2PGOA 1LSOA 2OP0A 2WTEA 3N2KB 1FY2A 2LR0A 3AHCA 2AUNA 2E87A 1NW4A 3WGVA 4W5QA 3QX8A 3TK1A 3VOTA 3AI2A 1K92A 3HPRA 3JQPA 2ZJ6A 1N2CA 4ERXA 1TUGA 1ICEA 1DX4A 1V1JA 3AP3A 2HF7A 3OH8A 4OBXA 1XQ9A 2PEZA 3ACBA 3MCTA 4QWMA 2C2OA 4S2UA 3U39A 1DG3A 2H1VA 1PL6A 5SYNA 1BX0A 2XT6A 2CW5A 1WO8A 2AEFA 1KO1A 2B1GA 1PI3A 4KXLA 2WB4A 4BMOB 2Y1CA 3ZVRA 3CVOA 3M49A 4LJ7A 1P5FA 3BMNA 5T8KA 5CXQA 2X23A 2O0HA 2XW6A 1E0DA 3BGOS 3EXHC 2QVYX 4HGNA 5IKOA 3WLFA 4S0ZA 5B3LA 1CP2A 3MVEA 1F5NA 1OTHA 1DKRA 3PFNA 4OB7A 3DZFA 5JZBA 5K0GA 2ZIXB 3KKKA 1R5OA 4V0NA 4CM4B 4ENTA 4ZI7A 3F71A 4FINA 3OPYI 3JD2A 2JLCA 1GQYA 1QYIA 1M7GA 1ZMBA 2VPYA 1PN3A 1HE2A 2ZSIA 3BTVA 3RK4A 4Z54A 1I4LD 3RHTA 2QRJA 4CL2A 2I2FA 2KE5A 2X2EA 4IV5A 1LLQA 1Z4JA 3B1FA 3K2BA 4M6WA 1EYZA 5BYJA 3FLBA 3ROMA 2O7RA 3U3XA 3UTDA 1UM9A 1XPOA 1ZAYA 4N7RA 1PDOA 2QU7A 2ONCA 1WXIA 3BCUA 4LZWA 4W1RA 4PYQA 3K1AA 2CVZA 3M7IA 2GOYA 1N34B 3BK7A 3OEHD 3O4RA 4BGEA 2V4ZA 3PHIA 4R98A 2IYRA 3HM2A 1RM3A 5EPOA 4YJDA 1XQWA 4CLOB 4TZ6A 3RIGA 3SC3A 4DR4B 4YI3A 3F67A 5JY1A 3IJEB 3LYAA 3PITA 1YS7A 4GECA 4I50A 1M0SA 4YQZA 5IDXA 2GM4A 4RJIA 3KSZO 4CM9A 2VDUE 4MV1A 1FNDA 4GZ5A 5I9SA 1U3DA 3T3NA 1ONSA 3B20A 3EIWA 2VK2A 4IMIB 1NQAO 2XNJA 4GXTA 4I1OA 2ID4A 2E4AA 3OY7A 5A7HA 4PLWA 1SRQA 3BTUA 5FNVB 1BQEA 1QS0B 2AZ4A 2HYIC 5SZKB 1BJKA 2PVPA 3FKSA 4O63O 2MOKA 3B9BA 2AXQA 3E23A 4JC4A 2J5RA 5FLEX 3A04A 3IOBA 3Q12A 1TK2A 2C5LA 4FMDF 1T9BA 4LXGA 4YJ3A 1SCUA 4BLQA 2CYCA 4V1CA 1YB7A 4BKQA 5JBNA 1ZJ4A 4MIYA 3CVXA 3WL7A 2UUCB 2VYND 1G9SA 2A59A 3AR5A 3CJQA 3DSRA 4JL8A 4RL4A 3CF6R 4M0KA 4AKEA 621PA 4DZRA 2MTBA 2FZGA 4FBMA 1JIKA 2HA7A 2O05A 3I09A 1OAOC 3HVHA 1JA1A 1XAJA 4H7DA 4JBGA 4F1WA 1HT0A 1TVKB 5LN1A 1ZKDA 1Y3FE 2EIHA 1BW9B 5DP2A 1DLJA 4HDQB 2J5KA 4JSTA 1NJSA 1QO9A 3WO0A 3PIDA 1LY1A 2ZFUA 1R6XA 1AO0A 5FNZA 1S8NA 3UAZA 2G6TA 2ST1A 3JX9A 1OH6A 5B1YA 5JCZA 1K5HA 2C5FA 4FR5A 4EB8A 1NC1A 2CVPA 2YUIA 1JLKA 1HLGA 1GRNA 3FYUA 3T7IA 1NVWQ 1QG2A 2XD9A 2HCRA 3AR9A 3KOZA 4Q9NA 1TJ3A 4V0LA 3UG7A 1CFZA 4UUQA 1G59A 3KHTA 4EZBA 4NNOA 5LR6A 2X41A 1UADA 2H48A 2HRZA 1U2GC 2QUJA 3AQIA 1FP1D 2DJ5A 3BEOA 3GFOA 3HDVA 4IIDA 3CKLA 5E4YA 2IUUA 2R79A 4JOCA 4RLQA 4B4UA 5DOVA 1SGWA 4RK1A 1TFRA 5EYPB 4K9LA 5IZCC 1TB4A 1J2RA 2P4UA 2PKRA 2XUIA 3TM5A 4R9UC 1UPTA 2JBAA 3GWZA 4O4LA 2EW2A 4OJQA 5BMVF 3ICPA 4NYJQ 1AHHA 1GPKA 3RBVA 1COZA 1JXOA 2MSWA 3Q7SA 3UB3A 4AWAA 4PPQA 2J32A 4GMGA 1QIKA 1U5BA 2YKGA 1KE1A 1P73A 4B76A 1NURA 1UKAA 5C18A 4Z53A 1WSDA 3FIJA 4Q3BA 2JJQA 3T4XA 5FV4A 3HJBA 2XBMA 1U4SA 3SHOA 3QKSB 4WZAE 1MB4A 4OF4A 4FR2A 4I66A 2G72A 2YICA 3E2PA 1FSZA 2IF2A 3H2JA 2O8EB 2UUOA 1HF3A 3CBGA 1RJDA 3H9UA 2PNFA 2I8LA 2Z4RA 3KDSE 4QELA 4B34A 5KTTA 3LA6A 4YASA 1N33B 3V7NA 3X1DA 5JYBA 2XDAA 4MRRA 2XX3A 3LUGA 3DO8A 1O6BA 3TPZA 3VYVA 1YZ3A 4KE6A 3A6LA 1IBMB 4V2IA 1P0MA 2DTXA 1YL5A 2O2ZA 3Q87B 2OYCA 4LJ8A 1XLTC 3E3LA 3Q2IA 4P54A 2MR6A 2EW1A 3ZWOA 1Y3DE 3DDZX 4QUGA 4M49A 4B71A 1WG8A 3BE4A 3EISA 4D97A 2OQRA 2FFRA 2GZ2A 4CIDA 5JHHB 4PS1A 2JFOA 3CGWA 1UUFA 4WGGA 1IH8A 1NZFA 1BMDA 3CLUC 1SPBS 4Y9RA 2WAYA 4PLVA 4G63A 3HLYA 1ITZA 1G60A 4TTVA 5KSWB 2QBYA 5GWXA 4QTZA 4PC3A 4QDUA 3H0KA 3KQLA 1TVEA 3SZUA 2XRFA 3UN1A 1KDTA 4J3NA 3DPSA 1A9OA 1XZNA 1GV1A 3FZNA 1XZBA 1IC6A 1K7SN 4KLCA 3M1IA 1KY5A 1JBEA 2EL7A 4HG2A 3JXEA 2TRSB 3IQXA 4DSAA 3NEAA 4FBLA 4LS3A 1CRPA 1WMAA 3DQQA 3GARA 1RS0A 1VDZA 3DW3X 2R2AA 4MDEA 2WEKA 3GZNA 1GGEA 3CRNA 1VXOA 4JMPA 4KQHA 3TG2A 4DR6B 1A69A 5JSUA 1ZXBA 3NCHA 1R9GA 4RPJA 2FMIA 4X95A 4N48A 1U04A 3IDSA 3MA0A 4F92B 2Q07A 2ZT7A 1USKA 2HSJA 4HVLA 1O58A 2QGZA 5JSZA 1JTEA 2OHVA 3IA7A 4KLNA 3WGIA 1GGKA 3IHTA 5AQEA 2OB2A 5CHYA 3ZWXA 4OQXA 4BAGA 2RGRA 1N2GA 3I04A 3AEUA 2RC6A 3OP4A 4NBKA 5L3QA 5A71A 3FCAA 4I36A 5CDSA 3PC4A 2PDAA 3EOAI 1Z8DA 4NONA 4BASA 1VLJA 1Z6XA 4E3WA 5KSOA 4LXYA 2TMGA 3SI7A 1EXDA 5BWBA 1GRCA 1WQ3A 2RJOA 3QPBA 3UMJA 3HXOA 4CQJA 2BMVA 2PN1A 5LSAA 3ZCXA 3IOYA 1CEXA 2FSIA 3HJUA 1SQ5A 3TAUA 1WV1A 2ENWA 4ARZA 2AUTA 4NZ9A 5EXDA 1DBSA 1I2ZA 2J3QA 5J4KA 3MMSA 3U1BA 1N1MA 2OCKA 3AEKB 4QHTA 3Q40A 3O4FA 4FQ8A 1ZH0A 3KR2A 3ILSA 3ZWQA 4DDHA 5KHAA 5HQ3B 1VCOA 2OCDA 2P3SA 4Q9KA 3ZUGA 1N6OA 3ILXA 4RFSA 4RTOA 5FADA 1UDWA 4W8HA 1PEKE 4F46A 3I1JA 3S2ZA 5HQTA 4HZUB 4RJKA 1SUPA 4DWVA 3CINA 3MMZA 5HA5A 1UAYA 2D2XA 5JCPA 1T4CB 1MXFA 1B4DA 1BJTA 1LQUA 1WTAA 2PZ8A 1KYVA 1U0EA 1DADA 3HCWA 3PXEA 4XWAA 4R0MA 5A4KA 3RABA 1NVEA 3C3AA 4OB8A 4CKWB 5DX0A 2ZSAA 4HQ0A 2IXBA 4L0QA 1TZMA 2PQ0A 1UC4B 3OE4A 2XYVA 4RENA 3WIEA 1ONBA 1RACA 1T6ZA 5LD2C 1NFRA 2CZCA 3ZIDA 4IINA 3OG9A 3OIWA 3EIUA 3HO8A 2H29A 4KOEC 1S4QA 2ETXA 2WD9A 3E6AA 1N92A 2HA5A 4XRRA 4D5EA 1XMVA 5GPBA 3ZDXB 2QPLA 3B82A 3SHTA 1L5HB 1DC4A 1S7GA 2B82A 1A04A 2JAHA 5E4TA 5LWQA 2YMPA 1SULA 2C61A 4AN0A 5F3WB 3C3DA 5JR3A 1JAHA 1S1MA 2RHMA 1E6KA 4UVGA 1DL5A 2IUFA 1Q91A 2HK9A 3ZGLA 4KITB 1PJ4A 5DWQA 2ZB7A 4TWBA 4C5BA 1HQYE 1AUXA 2EZTA 4K9NA 4QUEA 1LCIA 4QVGA 3V8EA 3VOAA 4DNFA 4BECA 5FO0A 4PLPA 5CDGA 5IEJA 4L2IB 2EP5A 1C30B 1LBIA 1LS6A 2V6FA 3W5IA 2NXEA 3AK4A 3GVHA 2C54A 2HFKA 2WJYA 3H2SA 3HA2A 4UCQA 1PJLA 2IYEA 2V5VA 1Q95A 4PONA 4GT1A 3C41J 3ROKA 1LDNA 1Q7BA 1RAIA 1NNLA 1RC1A 1SQFA 2F9LA 3DWIA 1HKUA 3DYBA 3O6VA 5CVTA 2IIPA 4CT0A 4LRWA 1VLZA 5AM4A 2CDAA 4BWFB 2B3TA 2QZPA 4FB5A 1GZUA 1KYYA 1WKCA 4Q3OA 1X7XB 4LBWA 4N1AA 3SLKA 5JNTA 4C7JA 3H4TA 3K4QA 4H9GA 4LDRA 3TLKA 4ZOQI 5DMHA 4MDHA 3V80A 2HRRA 3RJMA 1M2OA 2IPXA 2PS3A 2R6GA 4TTSA 1R5NA 4JUAA 1EJ0A 1E6LA 2JFQA 1YO6A 3BXXA 4WESA 4BEWA 5LMZA 1GLVA 1WMEA 5E7MA 2Z4TA 1KQNA 1UBKS 2ZUVA 1CUYA 4JNCA 2X0DA 1UINA 3SZGA 2JVIA 2B20A 1EFRD 3N58A 1E1NA 4ONEA 4R05A 3JD3A 2V74B 2VCYA 2YVLA 3OF3A 3KP1A 3LGXA 4R01A 4MO9A 4RIHA 3RUCA 3R9XB 3L02A 3C6MA 2H59A 3HFGA 4IG9A 3FMPB 1R4MB 3PUYA 4Z51A 2P75A 4G1MB 4G56A 4WK4B 1KQOA 4JIGA 5A4JA 1JRLA 5KYNA 4PZYA 3CLTD 3PQ8A 2FUG1 2YZMA 1GNRA 1FXWF 3OZEA 1QORA 1Z9BA 2QR2A 4Q7KA 1DIRA 3QFRA 2PZGA 2NU6B 3FW1A 3K72B 2E4ZA 4XWYA 4PC2A 2EBFX 2H1LA 4Y0VA 5F33A 1AZWA 3EMVA 1DQSA 5E6SA 2C88A 4F2HA 3L01A 4M1WA 4BFZA 4LRUA 2PYDA 1TCVA 5D85A 2F3UA 3ESYA 3LOPA 1OT5A 2RI1A 5B12A 2IYZA 3CA8A 3LFUA 4KSBA 2RGGA 1PFGA 5JZ9A 1TA4A 1IL0A 2KLBA 2MJLA 3BUSA 3NYQA 1ZI6A 4H3HB 3FVWA 2MINA 1ZN2A 4WXYB 4IVNA 3IAS6 1IK4A 1TU4A 1B0AA 2VA8A 1FUIA 2XA9A 4ZGWA 1U8TA 2CE2X 3FNGA 2ERCA 2W6ZA 3TW4A 3CE6A 5JTTA 1GDTA 5AOAA 3IVXA 3WGKA 2FZEA 4QAQA 2PU5A 3IAFA 1DC6A 1W1UA 2I6SA 2PU7A 5T3UA 2CV2A 2JLVA 1WETA 2EU8A 3OM9A 1G5TA 1X1DA 3SXUA 1AGRA 5H16A 4V0QA 5A1JA 3R7SA 4ND7A 3FOWA 4BNFA 3G9TA 1E2DA 3NH9A 5EE3A 2ZBUA 5I7UA 5KNDD 3GLKA 4MZXA 1NVVQ 4B48A 5IVKA 4KYVA 3R7FA 3OHMA 3WZ2A 3D3EA 3QE9Y 1PFYA 4CKEA 3TQCA 4FEGA 1ENZA 1RQ2A 2ZB3A 2EERA 4F1JA 4MS1B 4LWQA 1UEIA 3BD6A 4PFKA 3T41A 1J4AA 3NWPA 4Z3DA 1DIHA 1H6AA 3EC7A 3UUFA 1V8PA 3K0CA 2XIJA 2G76A 4PC7A 1QQTA 1T5SA 4ZO8A 4F5EA 4CGZA 1E69A 4QQRA 4ETNA 1UWKA 5CLHA 4PGMA 1QVZA 4RXMA 5C1DA 1JG7A 2F3TA 1M6NA 1Z0AA 2XUFA 3FCCA 2EXXA 3U7IA 1YV9A 4LNAA 3MUFA 1KAOA 1FU4A 2X0KA 3OD5A 3PGA1 5F12A 3T9FA 5PNTA 4R1OA 3T95A 2G80A 3TVYA 4R54A 1CC1S 3V8BA 3SR4A 1A5TA 4X1IB 5C1OA 2D5BA 2IPOA 4OH7A 1CPYA 4R9SA 2WV9A 1N8NA 2CL6X 2D5IA 5AIAA 3H1GA 4MJLA 3SS7X 4EHDA 2I9KA 3Q6MA 4N39A 1L1FA 2RHGB 5JD4A 2QQGA 3T7KA 4DSTA 1FYEA 1J5XA 1PNTA 1MAAA 3WLNA 3FSJX 3IXLA 2Q2NA 3P2YA 2CC2A 1I6WA 3MBIA 4Q03A 5TSDA 2HDWA 4L72A 4UZFA 1V6CA 2HMAA 5I7OA 4L4YA 1LJLA 1HH4A 3Q0IA 2VPQA 3WV4A 4A03A 4BE9A 5IXYA 1VM6A 2ZWMA 3S8MA 3BQNB 1T8PA 5FTKA 4KPEC 3UCEA 3L4SO 4HB2A 1GL6A 2M9MA 5HUHA 4RGVA 4B4KA 4BBJA 4R68A 3DZDA 3AG5A 3LXUX 2NV6A 3DLAA 4CIYA 4M1QA 4ZCTA 1JHZA 3UWSA 2WE7A 4CKZA 4PG7A 3OA0A 3QITA 1TZBA 1MGPA 1Y82A 2YWCA 3NGMA 1GILA 3KE9A 4L0MA 2R8XA 2BFWA 4HNGA 4IKOA 3E1KA 5LBIA 4U2GA 2AZTA 4RVUA 5DVZA 3BREA 3A3YA 2MSLA 5EL0A 2W2LA 3DKRA 4OHOA 2K2QB 2GM5A 3CRRA 5JMOA 2JIMA 3GNLA 4LJ6A 4NPHA 1B26A 1NP7A 4WLOA 3BHJA 3WWPA 2FQWA 2ZBPA 1MNAA 2I3ZA 3LZCA 3PC7A 2H7YA 4LSGA 4U8HA 4WLVA 1PX0A 2BD0A 2OO7A 4HTFB 4NFHA 4G0MA 5BW5A 1SPXA 2GH1A 3BXPA 3DDOA 3NZEA 3GDFA 4MV3A 3LBFA 4YBRA 1KYIA 3OZSA 4HPXB 5FXMA 3S5JA 3M1AA 5ALLA 1FRQA 1RSZA 3QX9A 5HILA 3UC5A 1QC5A 2PIDA 4M1MA 1SEVA 3UNXA 2WRZA 4N6GA 5FR1A 1WXXA 5BT8A 1JTVA 1XWIA 3LUPA 3M6MD 5AM1A 3CZRA 1I3LA 1Z37A 2CCGA 3GCZA 3H5AA 5NULA 3WFIA 4DCOA 4DMKA 3LW7A 3BF8A 4ZVNA 2I03A 1SU7A 2XWBF 3ROFA 4EFDA 1CUIA 1X80A 2QLTA 1ZLXA 2FWRA 1SD5A 2JLBA 4KXWA 1P4HA 2QNBA 5ARCA 2OILA 2CMHA 2YY6A 1GTVA 3F2IA 3FZYA 5EJ9A 3S8EA 4AI6A 2VHYA 1E2QA 1Z4PX 3WQQA 2CMFA 2QZJA 3ZY4A 3HZHA 1Y89A 4YCJA 2VDNB 4RLFA 5ITZA 2C9ZA 4DV0B 4ZQCB 2PTHA 4V0MA 4XEHA 3KZMA 3VYWA 5U4QA 2QN6A 3A36A 2GFQA 3LD9A 4RDXA 2D7DA 2O19A 1C7QA 1CIPA 2XUOA 3T3MB 2XCLA 4N5NA 5FOSA 1IPEA 2H18A 2Y9PB 4IMPA 3ZOKA 4YUAA 5KQGA 1PR5A 2GPBA 5FYDA 4R71A 3GCGA 4OVKA 3S7ZA 1P5HA 3C14C 3L8EA 2RHHA 1WXQA 4DA4A 2DFPA 4BLWA 2R1VA 2X0JA 1DU4A 3NTLA 4OYLA 2VP0A 5FHQA 4BL5A 5CBPA 4K81B 4NJMA 4X44A 1QOPB 4G9BA 1XEAA 1OBOA 3AP2A 4G5GA 4KYTA 4C7KA 4UPEA 1U2QA 1DHRA 5JG7A 4TUYA 4CG0A 1IONA 2Q8NA 1AS2A 3F9RA 4GG1A 1QTQA 3FWZA 2C7QA 3RRNA 1E5VA 4MQ4A 5LXTB 5BQXA 4AK9A 1B41A 3LT4A 4MVJM 3SDBA 4ETIA 3L7CA 1XB2A 3DAHA 2BF7A 4FHDA 1Q1QA 4GU5A 6Q21A 1G2QA 2OY0A 1Q83A 2OYSA 5KYYB 1FX0B 3L9XA 1N7JA 4GPIB 3O9MA 4JVMA 5FQNA 3RG2A 5LOVB 1O9BA 3WC4A 2PAFA 3VDMA 1J8FA 3F49S 2ZXUA 4YWHA 1QLHA 1R4ZA 5ALYA 4BLRA 2C96A 1Q1BA 1E4EA 1AC5A 4H6VA 2IYAA 3I53A 3WJ7A 1GL7A 3CKKA 2DBQA 1T36A 2GCNA 4LHSA 4W9NA 4EUKA 3K0KA 3LKDA 1NKVA 2OOKA 2P8SA 3I6ZA 3RIEA 3FPKA 2CD9A 1JIUA 1Y3BE 2SCUA 3JRXA 4KAXA 3OQ1A 3OF5A 4RVGA 3SQOA 3R24A 2LE0A 3RM3A 5FTJA 3T7SA 4ZOEA 4RTPA 3LI2A 2DOKA 4US2R 4K6KA 4I4CA 2H3EA 4XVCA 3NETA 2XYHA 3OTQA 4KXFB 3HP7A 1X1AA 1KDYA 4UKDA 3JWEA 4O4HF 5CFPA 3BIJA 2QVCA 2D1QA 2R7NA 4LNUB 4BCBA 3DMRA 5I8WA 1VRVA 3PD0A 4GYYA 4K8OA 2CV0A 1CIVA 3H5OA 1NY5A 4FIZA 4J2HA 3TUJC 2H9IA 1VLQA 3DZJA 3FPEA 1XNHA 3IYLW 4M0LA 3T52A 3WGZA 4WKNA 1U0NA 3P0RA 4FT2A 4M46A 4UDNA 5BQFA 4NSNA 2GEUA 4MGIR 5GOZA 1RRPA 2B7CA 1EVZA 1BE0A 3HJAA 4QRIA 1ZU4A 4FXOA 5AI0A 2BV3A 3FWPA 4TMTA 3T5AA 1DS6A 4JJAA 3ADOA 1GGFA 5EESA 2QN7A 1BGXT 1YQ9A 3DEZA 1IM8A 4OX9Y 1SUAA 2J3JA 1R5BA 4EF5A 4GPBA 4D9JA 5EEHA 1KJYA 1Y1KE 2GLTA 3ZY3A 1XXHE 3MRVA 2GF2A 3S44A 3VPAA 4QM6A 1U7XA 3PR3A 3I0NA 4BO6A 1H0HA 3TO5A 3AJDA 3M2TA 1JDVA 3CCCA 1B8VA 1QNFA 4FW8A 2HQRA 2H31A 3L92A 4MPRA 2GLUA 3HXTA 4H27A 3I1FA 1SUCA 2YWEA 1L5NA 3AILA 4C0XA 1Y7HA 3WXMA 3FH0A 4S05A 1UCFA 4MQFA 3OX3A 5JJIA 4UATA 3EB9A 4LRQA 5CCDA 2CGEA 4MVJG 2QXYA 3PR1A 3AFOA 2D06A 2VWQA 2A33A 3PU6A 1W88B 4G9GA 4LQDA 4COKA 4F5WA 5A1TA 4RY2A 4II7A 3SBEA 3ZJVA 4UMVA 4NCJA 5IT5A 1KK1A 2HMUA 3V1KA 2H4YA 1E9FA 2ATIA 2CDCA 2HA2A 3VZCA 4WCDA 1QP7A 1J0AA 4F5YA 4AX4A 1KSJA 5TGDA 2I65A 4ENUA 1XLUA 3R7WB 1WSBA 1PJ3A 2QJFA 1KDPA 3E0QA 4KQJA 1R15A 3E18A 3OKAA 3LQ2A 4HB3A 3WV5A 4F5ZA 5I9IA 2P2GA 3HI4A 1E9BA 1IEWA 2EGGA 4PCLA 1EJ2A 2ZAMA 3WGMA 2CF5A 3O4JA 4MR8A 4JL6A 1M1YA 1SA0A 3D3WA 4ZVRA 3D4NA 4OKIA 4XLLA 2KYRA 3G17A 3HI6A 3K0HA 4IZHA 5D2CA 2DQ4A 4RHTA 3HABA 5F2KA 4Z0HO 4C4RA 4W7SA 1ONPA 1V1MB 1WB4A 1G20E 3E7XA 2JATA 2Y93A 4HWOA 3G6WA 3IKMB 1TAQA 3KVNA 5AD1A 1N6RA 1QZZA 1OI7A 5B3KA 5CCBA 2VXYA 2KJQA 1D1QA 2WNHA 3HFRA 1XRMA 3PP8A 3TXYA 1U1CA 1DPFA 4N0DA 3KEMA 4A6XA 4AMGA 4BVFA 1ODTC 4LZZA 4MZDA 2XUGA 3LUDA 1Q7TA 1OFIA 5EWLA 2OXTA 1E5LA 1UK7A 1XK7A 2VNJA 5AKGA 3RAPR 4OQDA 3UFXA 1RYNA 2H7VA 5M5BA 1TZ2A 3GUYA 3VKFA 1QFYA 2W2QA 3UMFA 1CR4A 3DNMA 3E9DA 1KY2A 2ZJYA 4IHJF 1N2CB 2G82A 4CCWA 5CA1F 3TRDA 3VPXA 4F9GA 4ND6A 1PLKA 5AW5A 3DLHA 1UJ2A 1KJ8A 1UMBA 4XDHA 5JRDS 7AT1A 4XPIA 2DLDA 2IYFA 4DMRA 5KMGA 1FFSA 1KS2A 2O2GA 5ARDA 1F8XA 1AGPA 3QSYA 2GA8A 1JH8A 1RXSA 1JXQA 1M7BA 3GQBA 1NA5A 4HS9A 4MWDA 4F21A 5D86A 1ENPA 4P4LA 1E79A 4U7DA 2G08A 2ZS9A 5ALSA 2EFYA 1EXMA 3Q7EA 4IH9A 5GGYA 3BMNB 4CF3A 1G9XA 4M1EA 3V1UA 2JJ2A 1ULHA 3G1TA 4XYBA 5G53C 1DEOA 2BF4A 4B87A 1WOYA 5JNLA 4OQMA 1PFVA 4HNQA 5IC4A 5IYZB 5KZMB 1RPZA 2IYVA 5TNXA 4DDKA 2DUNA 1N57A 4FFMA 5HGJA 3URMA 4N54A 1Y33E 5E7IA 5L7YA 4PGGA 2IGBA 1EGQA 1UBHS 3BSFA 3EEBA 3MC1A 2CBXA 2JHAA 4ZI7B 5LP6A 3MCWA 3NONA 1W4BA 2ZBFA 1JR6A 1HNZB 1B8UA 1NMQA 1OC2A 1Z0UA 2DWUA 3CIOA 3DFMA 2I6XA 3MJHA 3O1IC 3VBEA 3WX0A 4CFSA 4M6WB 1K27A 3OICA 5BVHA 1JWBB 3EVCA 1DE0A 1XGKA 1DXQA 1H4VB 4EUFA 1N78A 2ZI7A 1UM9B 5T4EA 4KQXA 3H5VA 3JYPA 4LVCA 5F7ZA 4CEIA 1Z08A 1L7RA 3BRCA 3OZVA 3R41A 3G6KA 3L4KA 3F4LA 3K1AB 3TI9A 2JG3A 1R0CA 3JTEA 4JP2A 3BK1A 4AP6A 4KXYA 2UXBB 1Y5LA 1CJTC 5SZHB 5IVPA 1EXWA 5EKXA 1ZSYA 5J5AA 5LA6F 1N9GA 4TN5A 2PKYX 3WVNA 1BGVA 1YULA 2NO4A 1L4KA 4LE2A 4ZEVA 4ND4A 4F2PA 1NVTA 3WHKA 4ZTZB 3FPJA 4XLZA 1SN7A 3P2OA 1UBTS 3CNEA 4PX5A 3KB8A 2JIBA 3WK5A 4YRBA 3NBXX 4I46A 2OM6A 3LO8A 1MBZA 3IAEA 3E03A 3D8RA 5GZ1A 4AF6A 1H6BA 1T0JB 2X6TA 3ZJUA 1M2HA 1P2FA 4U2KA 4Q3KA 2OXIA 3HFJA 3LWZA 2GJSA 2HMSA 4O3MA 4XVUA 1H1LA 1U0FA 3R0ZA 2WK1A 5GZ3A 2Y1LA 2BCJQ 3IODA 1H2XA 5ESDA 3ZCRA 1S89A 4NAUA 4YJ3B 1SCUB 4FR0A 3ZU2A 3ENKA 5TVGA 4BKPA 4V1CB 5ADHA 3ZY5A 2RB4A 2XCUA 5FH9A 1JG1A 3V2UA 4BNHA 2JGMA 1NBMD 3G0DA 3I62A 1U81A 2Z6VA 4E09A 1MIOB 2IEBA 3KZNA 1VG0B 4BQEA 3UKOA 1KI4A 1UEJA 1ISRA 3QUAA 1JZQA 1K63A 1QLJA 2V6JA 3NX4A 1G4AE 4H7HA 1HE3A 4FFNA 4HKTA 3GUHA 1B23P 3QYAA 1HK7A 2VUSA 3IE0A 1RRVA 1L5RA 3WAKA 4HDNA 2G3YA 1BHJA 1T29A 2EV9A 5A5FA 9ATCA 1WULS 2QN9A 1UH5A 1P3Y1 4PAOA 1JLLA 2MMCA 1JHMA 4UHEA 1BC5A 4DV5B 1S01A 1UL1X 2BZ1A 3FYUB 2W43A 4XQCA 5FL3A 3TBKA 4CIAA 3EPKA 3NJ8A 3HNOA 2Q7OE 1XV5A 3K0SA 4DIUA 3LPLA 2DH6A 1OTYA 4DCGA 3LGAA 1U7WA 2XMSA 1N2BA 3AQ4A 4GXRA 2RSLA 4TV8A 3ZK9A 2KBFA 2R8OA 3LXRA 3EVGA 3HUEA 4MR7A 1M2WA 1U02A 3ZWAA 1U6IA 2F1RA 1NMEA 2DWPA 4LRYA 3ORQA 5DMXA 4O4LB 4F91B 3U4QA 2OBYA 3CF4A 3M4JA 2GT1A 4IEFB 2P79A 3DOCA 3RVDA 1PTJC 1C7EA 2C4UA 4MV4A 1U5BB 3EMBA 1TRHA 3CH4B 3NUGA 4HD8A 1W85A 4GGPA 5KEIA 3MZ0A 2FKAA 2QLFA 1ULAA 2EKLA 3EGDA 3LUHA 4MYDA 4ZVKA 3EW9A 1EIWA 3OFND 4CLDA 4Z9BA 3TOSA 1S2NA 3IUQA 4IJUA 4KXNA 3FFAA 2KQUA 1V8BA 1SEPA 4LZNA 1P4RA 3A2KA 4BVAA 1W76A 4EBBA 1E66A 2H2WA 2X5JO 3ZD8A 4GPZA 1NXWA 1ESDA 1GYQA 1NJ6A 1WY7A 2PFSA 3NCTA 3CZQA 1GKKA 4Y6LA 2WHYA 3ZLUA 2JFZA 4JODA 3OQJA 3QLVC 1F4VA 2CBGA 3L6CA 1RTTA 1IAVA 2OWDA 3N07A 1E64A 3AR8A 3TX6A 4MULA 1WXDA 4IQGA 1OXSC 3UENA 3UWMA 1J9EA 3DZCA 2A5FA 4DAEA 5IKEA 1T0PA 4F2DA 4TYWA 2AMVA 4I6EA 4S3MA 1VC2A 3LYLA 4XUDA 4BRWA 1NV9A 4M0UA 3DO6A 3FUXA 1QRAA 4KWHA 3RANA 4BKUA 1E3EA 3R3WA 1XJQA 2NU7A 5EFZA 4WAUA 3W7AA 5I8PA 2B2CA 2HADA 3B6ZA 3IMKA 1EB8A 1N2IA 4PNZA 4MVCA 5A05A 3OT4A 3QLUA 2QBYB 1P45A 2J6HA 1XDWA 2PWYA 4RFLA 5ITVA 4MPTA 5FOVA 3WRWA 3OM1A 4H35A 1O7JA 3KKZA 3IBYA 4YMHA 4XVRA 3GD5A 4QXRA 3FMGA 2PXCA 3MOSA 1L1RA 2O14A 4LWPA 2XRYA 3LHSA 4O29A 1J56A 1TKAA 4P22A 4XWTA 3ZZUA 1NW3A 3S2IA 3EYWA 4MUFA 3TZ6A 3QX3A 4KJXA 2OP1A 3K2EA 5DX1A 2FZWA 4EKEA 4Y67A 4XIFA 1COWD 2C2BA 1VJDA 3UMBA 4EPRA 1TT7A 2DXIA 3FTDA 2D0PB 3GZNB 2JBHA 3H9EO 4WW0A 3WRYA 1SKAA 1JJVA 3TKAA 1Z38A 2JGLA 4NR0A 1MDBA 2QMEA 3TINA 1LZLA 1H3FA 4QUJA 1RWBA 4N6OA 2BI4A 1HXHA 1KH3A 1U3WA 5JSZB 5FT9A 4OJNA 3IHLA 1USVA 1S8OA 2VP5A 5FI0B 2R7AA 2PL5A 3KTDA 4E70A 1E2LA 2VZ8A 4MLCA 5DI3A 3F1KA 1O97C 3B2QA 3AEUB 4JVNA 1YBAA 2BP7A 3GROA 3KWFA 3FROA 4FFSA 3C3YA 2O2HA 1J06A 4WFKA 5GONA 4F04A 1TLTA 2VDPB 1E0AA 4QPJC 2DKOA 2VP3A 3R09A 4C30A 1Y63A 2JFBA 4CR7A 1C0IA 3FHOA 2VQ6A 4V3BA 5TEVA 1BRTA 4QD3A 4JJ4A 4L4RA 3OPQA 4IQFA 4WT7A 1DX6A 3DTTA 4OYYA 4G0QA 3KB1A 3NAZA 4DOMA 1IHXA 3STYA 2Y4NA 3RTCA 2IYYA 2V6IA 2AK3A 5AK0A 3VU9A 2X8JA 4H59A 4ARZB 2YC4C 4CV0A 1S96A 4PSAA 2I4IA 3DXFA 2WMYA 5KTYA 3COJA 4NS1A 1FMJA 1RYDA 1FTQA 1J5EB 3IUSA 5BW4A 1ZM9A 4GI1A 2W98A 4RFSB 1JU3A 2H92A 2VDMB 3VDQA 3G79A 4BTLA 1W5FA 2CLHB 1QFMA 5DNDA 3HY4A 3MAAC 4R8SA 5FUWA 1T9GS 3CONA 1BWSA 3QFCA 1THGA 3DHNA 3W5SA 2WU3A 3AUJB 3MLBA 4G8CA 1X87A 1VL1A 4RMNA 1YVEI 3GJ6A 3KOUA 2CWDA 4J1TC 4JC5A 3V1LA 3Q2KA 4GGMX 4X6UA 1ZH6A 1TD9A 1FP2A 1RI4A 1TJYA 1AK9A 4FGSA 4REMA 1CJVC 4M7PA 4C0QC 4YXWD 4E5KA 4ZCQA 1JWAB 1NXOA 3GZJA 2QMYA 3L40A 4IQ8A 5FI1B 2WTXA 4G8BA 4TLMB 3DFIA 3CUYA 4IUYA 2WY2D 3GP8A 4PAWA 3VVMA 4AZTA 5BN5A 2FOXA 5FDFA 4L9AA 5EKDA 2Y9MB 2GHTA 3ISTA 2VQFB 1Z0SA 3M33A 4QTUB 3O3CA 2FR8C 5AM3A 1DOAA 3LH5A 3A2MA 4V1CI 4YRNA 4Z6KA 1JKJA 2ZTUA 1WNFA 2FDRA 3KVVA 2YHIA 2X5KO 3A1EA 5HMLA 2BKEA 2EBWA 3IP6A 1TQ2A 1H42A 1MB9A 3DEAA 1VJGA 4O25A 4L8VA 2WM8A 1ENOA 4I6JA 5MN5A 5TR9A 4AQ7A 5EZ6B 4CQMA 1CQZA 1PT8A 2YH2A 4G86A 2YZKA 1AKUA 3RREA 4HL6A 1ZMRA 3EDCA 4J0GA 2OXFA 2ZWAA 1I4WA 3NHPA 2ZAOA 4CDRA 3Q6NA 1Y6FA 3PJRA 1MFPA 1U0RA 3PQFA 5K8LA 5EIBD 4D7AA 4D9EA 1XAHA 2GVZC 3HWX1 3Q3EA 1AGXA 2BDUA 3NYIA 4B7UA 3GZTB 4X91A 1MGOA 1RIIA 3EQ6A 4KQGA 4O6VA 4EMUA 3G2LA 5TT0A 3TW6A 1Y4AE 3JAKB 3ZHUA 3SR0A 4PGFA 3HC7A 4D3YA 3EBPA 3K9CA 3B8HA 3B52X 5JAIA 1M2OB 1MAUA 2VJPA 4U2DA 1GVNB 4TLDA 1C3OA 2M98A 1RKUA 4Y6SA 4YS6A 3E2MA 1RLMA 3K35A 2RAUA 3P2EA 4KN8A 2QX8A 4NC9A 1D2EA 3SX4A 1AKYA 4Q37A 3T34A 4GZ3A 1PHPA 2R60A 4WESB 4YCAA 3GJZA 1Q77A 1N6LA 3AEYA 1WLSA 4UCFA 4HH4A 2OBXA 2PVSA 1VB3A 2QAGC 1Z62A 4KQEA 2OHJA 3C85A 3HKCA 4RWZA 1K3FA 2ZEJA 2GTHA 1WIWA 2GD1O 2HHCA 2FLWA 1IY2A 2C98A 2FX5A 1OR8A 4KGXA 4RBNA 2NIPA 1E63A 4IO0A 2HJWA 2WM9B 4AJLA 4IXMA 5SZJA 2AI2A 3FDZA 2PWZA 5DTEA 4BMDA 1U8YA 1AUPA 3MUEA 4BUCA 3RODA 1IATA 4P0QB 4UE3S 4FQ5A 4FQ7A 3LYHA 4HLUC 2OBLA 1EQAA 2C4WA 1U9YA 1WPQA 4J4HA 4YMVA 2OBBA 4NPCA 3DO5A 3OWXA 5DWDA 3VTAA 1FIUA 2PMCA 2FPIB 2VOEA 4OFXA 1ZD4A 2JLQA 3MTEA 5E6SB 2CVQA 2O7NA 3L7BA 1W30A 1XFAA 5D3QA 4CM6A 5ENVA 4R81A 1XL0A 4YJKA 1SUWA 4E4RA 4BFLA