3SI7A

The crystal structure of the nbd1 domain of the mouse cftr protein, deltaf508 mutant
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
280
structure length
265
Chain Sequence
TGIIMENVTAFWEEGFGELLEKVQSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Requirements for efficient correction of DeltaF508 CFTR revealed by analyses of evolved sequences
pubmed doi rcsb
source organism Mus musculus
total genus 90
structure length 265
sequence length 280
chains with identical sequence B, C, D
ec nomenclature ec 3.6.3.49: Transferred entry: 5.6.1.6.
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3si7A00
4PHHA 5F9HA 1Z0FA 3V9PA 4A2QA 4Q7JB 2H5EA 5F98A 3A1VA 2OBMA 4NCJA 5E7JA 3EZ7A 2IS2A 3P4YA 2P3SA 1ZC3A 1WQ1R 3IHWA 2R9VA 1U8AA 2WSMA 4JVSB 2XITA 3RC3A 1AGPA 3IIJA 3NVAA 4A6XA 3BH0A 2OEPA 4PX9A 2FV8A 5E7MA 3LQRA 1DG1G 2IK8A 2QTFA 2PX0A 3KTAA 4QNMA 2IS6A 1W2GA 4MRPA 3VMFA 4RZ2A 5JWOA 2J7KA 3QE0A 4B74A 4B35A 3N2IA 5CJ2A 1SQ5A 1KI7A 4JL6A 2RGAA 4D6PA 1W0KA 4TT3A 3A37A 4MQBA 1HE1C 2BBTA 3NH9A 1F2UB 1F60A 3K0EA 2GZDA 3QKSB 4HDOB 4PO9A 4UXHA 4TYYA 3ICEA 3HU2A 1OXXK 3IPYA 3TUIC 2Q3HA 2XNDA 2GVDC 4QHSA 1G4AE 1Z6TA 3A58B 3VX4A 1ZNXA 1OIXA 3FOZA 4TYWA 1FMJA 4G5GA 4ON9A 4LJAA 1L4UA 3AP1A 3IPXA 3EASA 1YZKA 2FJUA 3VTKA 2C9YA 1ONBA 4KLNA 3R8FA 3RS2A 3V4FA 4CT5A 1KMHB 4IDQA 3PUXA 3W8NA 3BORA 2WMNB 3BWDD 4M21A 2AX4A 2BJVA 3GJ3A 3SN6A 4A2WA 1NMYA 3PITA 1YRAA 5AUOB 1YVDA 2ZITA 3S1AB 2ZXUA 3EZFA 2H92A 3OIYA 2X1VA 3RS5A 3GLFB 1S4QA 2ZAMA 3QBVA 3U60B 1SVKA 1RJ9B 2W6ID 1FMLA 3TSOA 3BC1A 1EFCA 3HPQA 3AGPA 4NBSA 2EYUA 3ADBA 2HYIC 1OT3A 2Z43A 3EWSA 4QRHA 2ZE6A 1MO4A 2DFNA 1YR7A 2NG1A 1FQKA 1RKBA 4GMXA 2PLFA 5TV2A 2L0XA 5FUYA 1NN0A 5DYGA 4LHYA 4DDWA 3I5XA 4P3YA 1RC8A 3QXSA 4OQNA 4GOKA 3GJ6A 5AK0A 1XMSA 2YOGA 4LV8B 1XTSA 3KKMA 5KDDA 1PLKA 2VYFA 1NN3A 4QBGB 1HURA 1II0A 4ZDKA 1XPOA 4A0HA 4PFSA 1UJ2A 3WP1B 4TWZA 2A30A 3UG6A 4BEBA 3MLEA 4U00A 5G53C 2QZ4A 3P4XA 1W7AA 2PL3A 3SU8A 2ODNA 3ZDQA 1UPTA 3CX8A 2R6GA 5HZKA 4CEIA 4BFWA 5K8TA 3T15A 3A8TA 1XD9A 2ANCA 3RLFA 3K9GA 3K70C 1QHXA 1CU1A 4C2TA 5FOUA 3SC3A 1NVUQ 4MYTA 3QKUA 2Z5FA 5TB5A 3H1TA 1XTJA 3U7HB 4LWZA 2QRNA 3RS3A 2HXSA 4BLQA 3QXCA 1CJMA 1EX7A 2CCKA 4P32A 3WBKA 4DUGA 5KSZA 5H70A 3SBDA 2ONKA 1EGAA 5JLJA 1J99A 2N1BA 3W8RA 2ZEJA 4WXRA 4CDGA 4JLNA 4I81A 4QNRA 3IIKA 2P67A 5CITA 2JJ1D 3A1UA 2QAGA 4ZPXA 4TTPA 2J0VA 3CRW1 2O8FA 2YC2C 1G291 3MG9A 4M1KA 4OHXA 4RY2A 3FDIA 5DGXA 2G88A 3BB3A 1N25A 1ZC4A 1LV7A 3V4RA 1P7CA 4G3XA 2J87A 1BO6A 2J0SA 2J0QA 4QJ5A 2QA5A 5DHFA 3NDBB 2WHXA 3ZVRA 1Q1ZA 4Q9HA 2FFBA 1HUQA 2F1RA 2FFHA 2GNOA 4WZ6A 3LVRE 3TGPA 4B3DA 3MD0A 1Z22A 2GXUA 4L8GA 2C9OA 2DPXA 2ZUDA 1BMFD 4KITB 4D2IA 1XZPA 4PSVA 1AKYA 1SXJE 2ZE5A 4NYJQ 4KFSA 3ZJYA 1IXZA 1UBGA 1E2NA 1E2HA 4V0OA 2WSSD 3PUYA 3NBZC 3CRMA 4M1WA 3SFVA 2ZAOA 5JS8A 2JLSA 1KNXA 2OBNA 5DN6D 4GMDA 5KOYA 3DDCA 4JJKA 3BERA 4TL8A 3FMFA 1VYTA 2JIZA 3SJZA 1KJWA 1HE8B 2F9MA 1VG9B 3MWJA 3X1DA 4HUTA 4HAVA 4Z51A 3GLGA 1JQLB 3SQWA 2DWPA 3DL0A 4JLOA 1YR8A 2FPKA 1DS6A 5KSYA 2WAXA 5B64A 1E9SA 4R9UC 2MSDB 2WWXA 1J2JA 2BV3A 3NBXX 5IK2A 2OZEA 4PC2A 3UPUA 2JGNA 3I92A 1J7KA 2XX3A 2IHYA 2PEZA 2V7QA 2CL6X 5JSZA 4NYIQ 1YJ5A 3AP3A 1R5BA 4P33A 1YZTA 1AGRA 1TNDA 4IKEA 3AKYA 3TJZA 1E2MA 3RRMA 4ARZA 2GBLC 4UJ3A 2ZUBA 4JMPA 2ZJAA 4M0LA 5FOWA 3C16C 3I8XA 4B2IA 3G0HA 4B3FX 1EFRA 1P75A 4W5JA 4YMVA 3KB1A 1XWIA 4CEIB 3T5GA 2BBSA 2JASA 1ZD1A 3VAAA 3SJCA 1S9HA 2OILA 3KFXA 3WRYC 2DY1A 5SZKB 4E22A 5DSZA 2ZYVX 3LBHA 2C9CA 4Q48A 4LPSA 1S3SA 2J5XA 3B1YA 2RHDA 4KBGA 1NMZA 3QPWA 3VNUA 1VHTA 3SYLA 3BIFA 3PCRB 3B13B 4C0JA 1Q1EA 2H1LA 4PC6A 3KZ1E 2YJTD 4XJXA 1T0JB 1CS4C 2PT7A 3SQXA 2HLDD 2ZE8A 1FX0A 1NKTA 2QAGB 3C4JA 2F7SA 4KJZA 1GAJA 2O8FB 4B75A 2QROA 1KKLA 2R6FA 4ESHA 4UNSA 2F3RA 2PCLA 1VYUA 2PCJA 2ZRIA 4NYJR 2BEKA 1UBCA 5BYKA 4LPKA 4EQ6A 4BFXA 3EARA 4AURA 2VSFA 4FMBB 2A9KA 4MH0R 4TSFD 1JXOA 2QORA 5FTLA 4BLPA 5C4MA 2QAJA 4PZLA 4DLZA 2AXNA 2ZVQX 2JLXA 2IC5A 4MDEA 1H8HA 1PZNA 2IYTA 2VPPA 5LBIA 1HYQA 2OBLA 3PEUA 1WXQA 3GEHA 3BJIC 3OIVA 3I61A 2XEXA 2ORVA 1G6HA 3OEED 5EQTA 4EPRA 3DO6A 3UXMA 2VP9A 1LF0A 4RJLA 4F91B 2W6JD 1RE0A 4O2RA 3RYTC 4XWOA 1C4OA 3VR3A 5E7IA 1JEDA 3THOA 2AK2A 1AS0A 1I2DA 1Q57A 1S96A 4Q5IA 1C9KA 1FPMA 1LW7A 3GLGB 1KGDA 5ANRB 1W1WA 2HYDA 1Z6YA 1FUKA 2DR3A 2WBLC 1U8ZA 1XTIA 3OAAD 3C7KA 4ESVA 3EIEA 2G6BA 4O25A 2D2EA 2FA9A 4PPQA 4OHYA 4A15A 4Z1MD 1W4BA 4C2UA 4V0MA 2JDIA 1OXSC 5JSZB 4BPBA 4R98A 5C1BA 3FB4A 1W2HA 4HB2A 2IUUA 3TIFA 1I4DD 5KO2A 4AD8A 2NQ2C 3TVDA 2ZI9A 5KPJA 2W83A 2G1KA 1LS6A 3NHAA 4ARZB 4YXWA 1EWRA 3SI7A 4Q9IA 3CX7A 3HWSA 3B9PA 1XEFA 3VKWA 1N6NA 2C78A 4URUR 4BGDA 5TMPA 1T8TA 1NY6A 3E2IA 3CNOA 4O2LA 1KKMA 2KBEA 3QVVA 4LC0A 3T12A 3CNNA 4LV5B 5JECA 4M8NE 5KDLA 4Z54A 3Q5DA 1JI0A 5HCNA 4JLPA 1US8A 2QBYA 1SVOA 4P4SA 3GJ8A 3JZMA 2RHMA 2X2FA 1AK2A 3BFVA 2OM2A 5FPHA 3O47A 5FBRB 1XB2A 5E3HA 4XSHA 1XXHE 3DKPA 1OH6A 1AQUA 4GL2A 3IBYA 2D74A 2C99A 2C2HA 2REBA 4N1AA 4CT4B 2ZM5A 4ZI3A 2RGCA 4HB4A 1FX0B 3BXZA 4LYFA 1OIVA 1KSFX 2OAQ1 121PA 4CIDA 4IDNA 2QGNA 1RZ3A 3RS4A 3ZQ6A 1XTQA 1XMVA 4HATA 4AG5A 4E5UA 2HCJB 1ETUA 4US2R 5EZ5A 4EQ6B 2UVQA 3QXHA 4G0NA 3W6NA 4IW3B 3LFUA 2JLUA 1M8PA 5CM8B 3IDQA 2HT6A 4W9MC 4NDZA 2OO7A 4DLXA 2O0KA 3PIRA 3R20A 4Z8YA 2QENA 4HYYA 4Q9KA 4DHEA 3I73A 5G40A 2TMKA 2FNAA 1KOFA 4BLRA 1KI8A 4HAYA 5JMTA 3THXB 4DLTA 4DCUA 1II8A 1G16A 1OLOA 3NBYC 4LC1A 1Z0KA 3E5HA 4TMVA 5FOXA 4HAWA 4ZKDA 1KTVA 2QL6A 2GJSA 1EWQA 4XWKA 3BB1A 3LW8A 5AJXA 5EXPA 1FP7A 2WJJA 1KK1A 4PC7A 1NMXA 2QMUA 1DAEA 2NGRA 2A3RA 3BH7A 3LLMA 4Q7LA 3F3YA 1R0XA 3KKNA 4XTRA 1E9AA 1E2EA 1VCOA 2ZS9A 3M0EA 2XB2A 3VKHA 4DDUA 4TTRA 2YC4C 4ZI2A 1RW4A 2CDNA 4UQOA 3CF2A 4R71A 2QEQA 2BMJA 4HB0A 3U3JA 4F38A 3B9QA 4X8OA 5DYIA 3AV0B 4HZIA 1XEWX 4URVR 4U7DA 1MT0A 4DWJA 4LX0A 1XJQA 4XD7D 2OT3B 5AJVB 2YOHA 2Z6VA 3ZQJA 5KNDA 2ZI7A 3TVTA 4C30A 4NPHA 1RIFA 1ESMA 1UKZA 1YZLA 3I5YA 5CJPA 1XJCA 2IYWA 2XAUA 4EJSC 1E79D 4R2HA 2J3EA 1M7HA 3AUYA 3NXSA 4II7A 4AI6A 4B48A 3FWYA 2EFDB 4DSTA 1XU4A 1US8B 2P0EA 2QBYB 4P4SB 5JHGB 2WJGA 3DM9B 1YZQA 4LJ6A 1T3SA 4XH9B 5JRZA 2QAGC 1N6IA 4JBXA 4KFRA 4MGKR 3HP1A 4Q1DA 2RB4A 1XNJA 2QPTA 5TARA 1Q21A 2DFLA 5AJWA 1IXSB 3FKSD 3PEWA 2ZRLA 3MMPA 3PUZA 1QHGA 3ZIAD 4QBFA 2SHKA 3U3KA 2I1QA 2CLDX 4KFTA 5KDOA 1JR3D 3KKOA 4KU4A 1QHNA 1NBMD 2UZ3A 5FBWB 4RD1A 2GDJA 2F6RA 1Q0UA 3FE2A 3OE7D 2RAPA 3QQ5A 3MJHA 2MMCA 3CX6A 3T35A 4HDQB 4B2PA 1I2MA 2ZJOA 3EAQA 4B32A 4WVFA 3SEAA 2ZVPX 2WWFA 3PFIA 2IYRA 4DCSA 1V43A 4TL9A 4A8JA 1XP8A 3IO3A 3K0AA 5IF9A 5CB8A 2ZRNA 1R0YA 1SVLA 4A36A 3PG5A 4IVQA 4R2IA 1CJVC 1JJVA 2OHFA 1OJLA 3BOSA 1RVDA 3HPRA 3QKTA 4JYBA 3T1OA 3W9YA 2OCAA 1M7BA 1II8B 4JIMA 4RD3A 2CHQA 4WZBE 1YZUA 3SYKA 2NOAA 3QY0A 2ZRFA 3FYHA 4BLOA 3GLHE 3I4LA 1A4RA 3DEFA 5BN5A 1Z6AA 4FW9A 1XBTA 3DHWC 1G8FA 4PHTA 1CBUA 1RRPA 4NCKA 2GJKA 3BB4A 2VLIA 4LUCA 5FFMA 3K0FA 2P6UA 1KAGA 1T3HA 3RRYA 2ZRCA 4N0EA 2YZ2A 1HT2E 2V9PA 2XJ4A 5SZJA 2F3TA 2VA8A 2WIBA 1DO0A 4IFEA 1JQJC 1G8GA 2D2FA 2XB4A 2Z4SA 3ZH9B 2W6IA 4DCNA 2EW1A 2GXSA 2VHQA 2YWHA 1UAAA 4MKFA 1RRCA 4I1OA 3AM1A 2O52A 4EPWA 2YINC 1HTWA 2P65A 2F9LA 4MGYR 5KNBA 1W48A 5HKKD 2IS4A 1I4TD 3CWQA 1IN7A 2QSZA 4LV6A 1NF3A 2BWJA 4A92A 2J46A 3X1WA 4C0SA 3EPJA 5FUVA 3MGCA 2XXAA 3CW2A 1NY5A 2QQEA 2WWIA 4OI2A 2CNWD 4ZDIA 4FWTA 3BK7A 1ZCBA 2OFWA 3GQBA 3I32A 1M2OB 3UMFA 1NIJA 1A5TA 4TL7A 1DEKA 1M34E 5B57C 3G5UA 3ADCA 3LLUA 4URYR 1DAKA 1LF5A 5L8VA 1WB9A 4CGZA 5FOTA 4D80A 4UNNA 2QGZA 2YWEA 1KJZA 3CB4A 4KI0A 1E2LA 1DELA 4PO8A 3NG1A 1H65A 2IEYA 4RD2A 1TQ4A 4YDSA 2FN4A 1KO4A 3FTQA 4QJ4A 1W36D 1JEEA 1OHHD 4A4DA 1KI3A 5BYJA 2F1JA 2ZANA 1N6RA 3KB2A 1ZD9A 1RJ9A 1XEXA 4JL5A 1N0WA 4C0AC 5IDVA 2JJ1A 3IBGA 4G5OA 2E9SA 1QRAA 1L4YA 3FKQA 5K8IA 3TMKA 3K9NA 3DMNA 4G1UC 1UADA 2A5FA 1XX6A 1A2KC 3K0AB 1JNYA 5JI2E 1U9IA 5AUQA 5KPDA 3MRSA 1G17A 2PMKA 2WKQA 1EX6A 3AF3A 5KSOA 2OLJA 3GLIE 4UKDA 2PZFA 4LDJA 5JCPA 4GI7A 5EZ6B 4Q19A 1XPRA 4HEJA 2AXPA 1OXTA 1PUJA 4Q01A 2DHRA 1HT1E 1BMFA 5F3WB 2GRJA 2JLQA 5JEEA 1E9EA 1NVWQ 2Q6TA 4ZCMA 4FD2A 1TPZA 2C04A 3DKVA 4I99A 3W34A 1P5ZB 1U0JA 2WSSA 4U02A 4ACBA 1T5LA 4JLAA 4MRSA 2BDTA 2I1VB 3K0FB 3MWKA 5EE9A 1CULC 4AG6A 3IGFA 4AKGA 2OCBA 5DN6A 3MUFA 3Q7PA 4IXNA 1BOFA 3PVSA 2D7CA 4D4LA 3C8UA 1IAQA 2JJ2D 3FGNA 1P2VA 4XVRA 1Q3TA 2VTKA 2PZEA 4NYMQ 3X1YA 1QHIA 2OAP1 2FEOA 3WY9A 1R8SA 1XCGB 1ZU5A 1IXRC 2JLRA 1S0UA 1DAMA 4LYAA 4OK6A 3GCGA 5HE8A 1X1RA 4GFDA 2JLYA 2Z4RA 1QHHA 5JHHB 4Q4LA 4TQ9A 4I4LA 2BKEA 1Z8FA 4RKEA 1SXJD 1JPJA 2QM8A 1KI1A 2XXAB 4TYNA 5FBLB 3U3RA 1Z0IA 3LA6A 3T34A 3K53A 4MKGA 4HAZA 5EP1A 2ZSAA 4KO8A 1OF1A 1DAFA 5GJVC 1VIAA 4L9SA 1Z28A 3WYFA 3KQKA 2YV5A 4BQSA 2H8KA 2YWGA 1DVRA 2JLWA 3CONA 2YVUA 2IF0A 3AVUA 2CBZA 4HB3A 1R8QA 4XTCS 2IXEA 4C9BA 1PLLA 5HZHA 1IQPA 2NO0A 5J47A 4KODA 3WMEA 2W2XA 3FHCB 4ZDJA 1U0LA 3DOEA 4HLCA 2CL7X 2O8CA 2FX3A 1DG3A 3L2OB 3L8ZA 2YHSA 4EPTA 4LK2A 4IDOA 4JLVA 1KY3A 1L2TA 1IN4A 3H84A 1XEXB 2HLDA 4MITA 4RCYA 1NN5A 3O8RA 1K8RA 1JECA 2XNSA 3C41J 1Z3IX 3UG7A 1E1QD 5J4KA 1MO3A 3VR1A 4S35A 1ZUIA 3A1TA 4JT2A 4DIDA 4AY2A 4DKXA 3TBKA 3G82C 2ZI6A 2GETA 2I4IA 5L3SA 5A5GA 1KZ7B 4I1VA 2H16A 3QOFA 4TSFA 1OFUX 2DBYA 4LHZA 5GJCA 2GF9A 4IRUB 4LI0A 2FDCA 1AIPA 4QHYA 4RFSA 3L0OA 4AIIA 1E3MA 1Z0DA 1Z47A 4GOJA 1KI6A 1O3YA 1KMQA 1K5DA 5FTKA 2HCBA 1G7SA 3ZZ0A 4NYMR 2ZYWX 3QPUA 4NZYA 1YR9A 4Z8XA 4GBMA 1VMAA 3NTUA 2GJ9A 3OEEA 2AFIE 2VHTA 4DDTA 1UDXA 2R44A 3RVBA 2AD1A 2W6JA 5JFGA 1RRGA 3C14C 5SZHB 2NO7A 3MAAC 2CE2X 1P60A 1P4SA 1EXMA 4EDHA 2QN6A 4OQFA 3EPLA 1N5IA 4Q47A 2VO1A 1CLUA 3CRVA 1E9BA 3KKQA 3LDAA 2GILA 1N5LA 4PSAA 1DAIA 1SKQA 3AVOA 3U7GA 2D06A 4MYCA 2R8RA 3OAAA 3QKRA 2PJZA 5JS7A 1SULA 2RGXA 4RSGA 2PH1A 2ZROA 3MSXA 1Q1QA 4OI0A 1QHHB 2KB0A 4Z1MA 2VP6A 5LD2B 1S2MA 3SS8A 4K46A 2FWRA 1MOZA 4LHWA 1BH2A 1AS3A 1MKYA 2WWHA 4JLBA 3LD9A 4BUJA 3LAWA 2ZU6A 3ZVNA 2EU8A 1Q1BA 4M1SA 1P9RA 1ZRHA 1ZU4A 4PZZA 4C0KA 4ZO4A 4FINA 2V3CC 3ZD7A 4OHWA 2P6NA 1COWD 3R9IA 4IFBA 1X1SA 3CM0A 3DZDA 2EWWA 3AF4A 4JVNA 3WNBA 2XZOA 2HV8A 2QT0A 2O8DA 2WWGA 1M74A 1F2TA 1BYUA 2F55A 4QGAA 3KKPA 4BLTA 1G7TA 4NH0A 3VQTA 2ZQ5A 1KDRA 1E9FA 4GZMA 2VRWA 3PEVA 4P31A 4A8JC 4CF7A 3SFZA 1N6LA 1Q12A 2V6JA 3EPKA 2O8CB 3C15C 4NCNA 4B44A 2IX3A 2CCJA 1HV8A 3KJHA 4D0NA 2D3WA 3FFBA 4TMWA 3LNCA 1G8HA 4DSUA 2ZRJA 1DTSA 1XPUA 1PUIA 3I3SR 5BWMA 1E2JA 4QXAA 3TLXA 4M1MA 1P3JA 1P72A 1VDZA 2XGJA 4D25A 3CZPA 3OIUA 4C0LA 4BASA 2VBCA 5IT5A 3EZ9A 1R4AA 1IONA 1Z0JA 2WOOA 4PQYA 3A4MA 1CTQA 2XZPA 4V0KA 1ESNA 2JEOA 3W6PA 5L3SB 1FW6A 1NSFA 2ZR9A 2QU8A 2ZJYA 4B6FA 2XSZD 4CW7A 5JCZA 5CDFA 4DZZA 2R65A 5HCIA 4RFSB 1KIMA 2ZRDA 1ZYUA 1KI6B 4Q1FA 3RC8A 1W5TA 4O0MA 5B30A 2ERYA 4NKRA 3BBPA 3TSZA 1ZMXA 3DMDA 4PPNA 5K8LA 4KVGA 3FMPB 3DOFA 3IO5A 3EC1A 4PPFA 4WIAA 4G5SA 2ONJA 5DH9A 1OE0A 1X86B 1G7RA 1VCNA 4MYHA 1EK0A 1TF2A 4OL0A 3Q9LA 4B43A 1VTKA 4X8HA 4ASUD 1XTKA 1LNZA 3U6BA 4K81B 2ORWA 2ANBA 2V54A 2PT5A 1D2EA 1GRQA 1NI3A 1QHYA 2IXGA 4E03A 1W0JD 1O87A 1G20E 3EWAA 3QKRB 5DO9A 2R6DA 2BJWA 4IEIA 5FOVA 3R9WA 3QJYA 1KSGA 1ZIPA 3KJGA 4Q1EA 2FFAA 2ZSBA 3AGQA 1KO8A 1IY2A 1N0UA 2GHIA 1OFIA 3L43A 3TSWA 4M4SA 2B92A 1YZGA 1NVVQ 4XD7A 4AC9A 4BZQA 2CXXA 4DBLC 4M2LA 5EUMA 2VP2A 1N6HA 4TZ0A 3WNDA 1G1MA 1WA5A 5EJEA 1VCIA 4NU0A 2NO9A 3FVQA 1CJKC 5J4LA 1S9DA 2JLVA 4F4JA 5DNYB 2ZS7A 1P2UA 1E79A 1GKIA 1JPNA 3LXXA 4NCIA 4DDVA 1A1VA 3RABA 1NLYA 2O8DB 1U99A 2GZAA 1F2TB 4HZUA 4LJ8A 5A0FA 2XTMA 2A5JA 4KV9A 1AZTA 3THXA 1OH8A 3Q3JB 2QTVB 4PHFA 5P21A 4D0GA 1R6BX 5LDDC 1XD8A 2BBWA 1U9IC 5CB6A 3M1IA 1IN6A 2ATXA 2NMVA 3GLFE 3ZIAA 1UM8A 4K8OA 1Z2CA 1ZW6A 3GFTA 4UXJA 1JR3A 1OB5A 1NBMA 3IHLA 3IEVA 2QG6A 1KI9A 3VU9A 2DYKA 2BM1A 2GJAA 3B1VA 4HLUC 3OE7A 4A0FA 2B21A 5FI0B 1F5NA 3K0CA 4PANA 3Q7QA 3T1VA 2XJ9A 5JI3E 1E32A 1YRBA 2PJRA 1XMIA 4O3MA 1TQ6A 3WYAA 5L3RA 4B6EA 1VHLA 1KSHA 4JBYA 3TUJC 2W0SA 4WXPA 5TDHA 3EIQA 4A1FA 2IF2A 1CJUC 2HDNB 2ZETA 1DARA 1KJYA 2LKCA 1OKKD 3A1SA 4WW0A 1TEVA 4I1SA 1D2NA 1T5IA 3ECCA 1E1RD 4NHOA 4B47A 4AYWA 1T3LA 2BVNA 4TLEA 5FBVB 2HXYA 3Q85A 4F7WA 5B58C 2YWFA 4QJ3A 4M9QA 1WCV1 3L0PA 1JJ7A 3FMOB 1NLFA 1WRBA 3QBTA 3VR6A 2ZRGA 2ZYTX 1WBDA 1YZNA 3H2YA 4M9XA 3UKDA 1CR1A 1FTNA 2DFKB 4TTQA 5A4JA 2OXCA 3KQHA 5LD2C 4FWIB 2BIFA 2BCJQ 2AKAB 4FCTA 1GVNB 3CPHA 1QDEA 3LW7A 3TNFA 1IJFA 1NVVR 2B8TA 3R8CA 1D8TA 2C5LA 4CEJA 1P2TA 2EFHB 2XOKD 2IYZA 4G01B 2PX3A 5HTKA 2OCYC 3TAUA 1GNQA 1D6JA 3KQLA 3H86A 5FPTA 4BLSA 3GJ7A 2Q9AA 1OH7A 4DRZA 2FMXA 3TW8B 2R62A 4X8LA 1GITA 2MSEB 3IUYA 5L3VA 4Q00A 4L5BA 1XJ0A 4BWYA 5FH9A 4LBWA 5HKKA 1IN5A 3EZ6A 4ZIRA 3O8CA 4F4IA 3A1WA 3H0KA 1NL3A 5JJKA 3VKGA 5AUPB 4C0QC 2Q0HA 2G1JA 1Z63A 1GIAA 4V02A 2WM9B 2WAYA 1II9A 4EFLA 2VQSA 2CNWA 1KDPA 4M1TA 1XFAA 4HZUB 2VH5R 3WBJA 4RKFA 1KHTA 1AN0A 2VL7A 1P62B 2OCPA 1GWNA 2BM0A 1XD2A 4V03A 1Z2AA 4UJ5A 4RFVA 4JVMA 2WOJA 1P9NA 1ZNWA 2RCNA 2V7QD 4Q9LA 1Z5ZA 2WWWA 1GOTA 4TLDA 5DISB 2C98A 3GFPA 4OQLA 5C46F 4YQFA 3SR0A 2ZIAA 4FN5A 3B1ZA 3VU9B 3SZRA 3IKJA 5FOSA 2W00A 2EFCB 1X6VA 2H7VA 1OHHA 4CRWB 2IEZA 1GRRA 1GL7A 5EE1A 1WF3A 2GESA 2GJ8A 1T9HA 1SVWA 821PA 4B2LA 1YR6A 3T1TA 1A82A 2ZSDA 2GCPA 1B23P 1J70A 4M1YA 2ODEA 2OLKA 5EE5B 1ZNYA 2QRZA 1U94A 1G3IA 3ZGXA 2ZJ2A 4EFMA 2A78A 3CLVA 3N5CA 4IJMA 2IW3A 1AZSC 2NPFA 1E0AA 4N3NA 1UFQA 2JJ8A 5CYPA 2EWVA 1VG0B 3A4LA 4OHZA 2IUTA 3ASYA 2QTHA 1UEIA 2G83A 2ZR7A 3I62A 3RAPR 2B7BA 2BC9A 3WMGA 4DB4A 3AF0A 3B78A 4KHZA 4F93B 1GP2A 1QVRA 4LY6A 3KFVA 1TUIA 3ZVLA 4IEEA 2WJYA 1S1MA 4L16A 3ZLJA 4LRWA 2KBFA 2ZI3A 5H68A 2E87A 4D4KA 2BMFA 2WJHA 3VFDA 3D3QA 5GVSA 4GRAA 4L9WA 1ZM4A 3N70A 4Q7KA 3EA0A 4URWR 1XDBA 3RSLA 3LO5A 1WE2A 3B1WA 3NEYA 1GDDA 4FMDF 4CEJB 1LTQA 2QY9A 4BZXA 3QXXA 1D5CA 3MWYW 2JJ2A 3RS7A 1N3BA 4GOXA 2VP0A 4TQAA 1Z07A 1SVMA 2CEAA 2CHVA 5KUTA 1PV4A 4IVRA 2X19A 3ASZA 4OQMA 5J4VA 2GKSA 3IILA 4WOPA 3TR0A 4PQRA 4POAA 3AEZA 3OFND 3UMRA 4OI4A 5BW8A 1EESA 1MR3F 1G3RA 1ZNZA 1X3SA 1QZXA 2ZRKA 3AH8A 4QBIA 4ZIRB 2Q9BA 3NC0C 5CLQA 1QHSA 3RRZA 4XOIA 4ILEA 3W3ZB 4RZ3A 1MO6A 3EZ2A 1SXJA 1VECA 2OUKA 2FG5A 4RD0A 2VIIA 2FGKA 4RD6A 2LCFA 1RFLA 1G19A 2V6IA 3THWA 1P9WA 1E4YA 1PJRA 1ZUHA 4CVNA 1P61B 5JBQA 1W44A 2AL7A 4BFVA 3ADKA 3P32A 3U2QA 1R0WA 2J7PD 2WJIA 4KCGA 5JWRA 3KL4A 1XF9A 3VR5A 1XD2B 4DLYA 2FFQA 3CR8A 1OW3B 1TUEA 3CH4B 4D0LB 3SNHA 3EW9A 4LGMA 4FCVA 4PO1A 1MRSA 2LWIA 4HLDA 4EIWA 3GMTA 2IWRA 3K8YA 4F4CA 2CLSA 1T91A 5LPNA 1PLJA 1G41A 1NNEA 4NTZA 4B73A 1X8JA 4C4PA 2QMEA 3Q8XB 3GLGE 1QBKC 2CK3D 1EFHA 3DVLA 4LYJA 2QNRA 5CIWA 2R2AA 1W36B 3TH5A 1U8YA 4C7OA 4OBEA 3GPLA 4AKIA 3DM5A 2OSBA 3U7FB 5FUXA 5AWFC 1UKEA 4A82A 4GSYA 3QEOA 4JSTA 3ZYCA 1W4CA 1Q20A 3SJBA 3EG5A 5CK5A 2CJWA 3K9LA 5JJIA 3U6KA 1KYIA 4KSBA 2WPDD 1E1QA 1KNQA 1OPXA 5AJYA 1VYVA 4TLCA 1Z0AA 5K8UA 4W5HA 1Z06A 4TLBA 2AN9A 2V1UA 5HE9A 1G3UA 1Y3AA 1AJEA 4LBYA 2DWQA 1Q3HA 4OQXA 3BGWA 2GBLA 2GTPA 5FR1A 4BFUA 5G3YA 5EXSA 1S8FA 4NP6A 4IOMA 2OESA 2J41A 1DE0A 1K6MA 1U0HC 3A36A 3AVPA 2IYVA 1DAHA 2IBMA 3BRWD 1GKUB 4OK5A 4XVQA 2FE4A 3JZAA 2FOLA 3UIEA 2O0HA 2HT1A 2KE5A 2P2LA 1T0HB 4N0DA 4OJKA 1GILA 2RGDA 1AQYA 2XTNA 5EXTA 1BKDR 3LXRA 4LBVA 1ZD8A 4IDHA 2PBRA 3MWLA 5F9FA 3JVUA 4Q66C 1OSNA 2RH5A 2NO6A 3SYNA 3R7WB 3W90A 1NG9A 1IY1A 3VHXA 4B33A 1CR2A 1SVIA 4DJTA 2BMEA 3C5HA 4JS0A 3ZS9A 4US1R 4LJ9A 5EXXA 2CCGA 4QBHA 4TMTA 5D3MA 1GL6A 1E0SA 2G9NA 4J0QA 1G64A 1SXJB 2CVHA 2CVFA 1AM4D 5DI9A 2UZIR 3B5JA 4XIGS 4A0RA 1F6BA 1CXZA 2IYLD 1N6PA 3THWB 4ZCIA 4PPGA 4M9ZA 2C95A 1OB2A 4W5WA 2IUSA 3BAFA 3PUWA 3HU3A 4Q1CA 3TQFA 1WDTA 1NJFA 2VSOA 1TF7A 5BN4A 1NLZA 3EC2A 1ZIOA 3GJXC 3ADDA 1COWA 3CPEA 2VEDA 3NEJA 3KUDA 1GL9B 2UKDA 4JKIA 4Q4AA 1OXVA 3OHMA 1H8ED 4LHVA 4RCZA 3K0CC 2ZREA 3L8YA 4BZPA 1TTTA 1W4AA 4S2EA 3K70D 2IA5A 2V4ZA 2VF8A 4QOSA 3REFA 2WZQA 1RRFA 1GM5A 2AFHE 2QP9X 1A7JA 3LV8A 3RDPA 4LZZA 3AKEA 1E2FA 1R2QA 3RHFA 2CHGA 2FSIA 5SZIA 1QVAA 4C7OB 3CO5A 5FUWA 2K5UA 2H57A 1AA9A 1GFIA 2J45A 5GADl 5HPYB 1NSTA 3ICQB 3TR5A 5DIFA 4V0ME 2Q3FA 1J8YF 2CJWB 5L3QA 2FPLA 2HJVA 5FL7D 2B6HA 1E96A 4NONA 5F2EA 1NKSA 2YKGA 1FUUA 2IL1A 4G5RA 1XTRA 4PC1A 5FI1B 2XSZA 1NIPA 2IYXA 2ZE7A 2J9RA 2GK7A 3GD7A 2FEMA 3QEJA 1E6CA 3U44A 2MMGA 3Q5EA 2AHOA 1GKYA 5FR2A 3IQWA 5GVRA 4L4UA 4C0HA 4OI1A 1XXHA 2W2TA 1FZQA 4PZYA 3B6EA 1HEIA 2OFOA 2Z83A 1NJGA 1P6XA 1G3QA 5JEDA 3WYGA 4GZLA 1PVOA 1CRQA 4AKHA 4Q4HA 3THYA 4B71A 4ASUA 4LJ7A 2X2EA 4KYUA 3L0SA 5J4YA 2WWYA 2Q21A 4KBFA 2P5SA 4M22A 3AKDA 4KXFB 1W0JA 3UK6A 1M1YE 3QUSA 4MYUA 1VIYA 2RGNA 5D3MB 1KAOA 1E2QA 5DE3A 4QGHA 2DCUA 2YNMA 1E2IA 4A0GA 5J5CA 4M1OA 2QP4A 4Q02A 3OEHD 2P6RA 3D6TB 1G6OA 4DLWA 5H8WA 3K09A 421PA 1NN1A 4P4TA 1LVGA 4ITRC 1JR6A 3TRFA 2J0UA 4MRRA 4XWAA 4TZ6A 2Z0MA 2WJVA 2C77A 1QF9A 4D4MA 2GEUA 5AR1A 2G77B 3VNVA 3B60A 3UANA 1YU9A 1Q44A 3CPJB 4ZDWA 1GNRA 2WKPA 1QG2A 2ZJ8A 1W36C 5FPKA 4Q4AB 2ERXA 4AK9A 4IDPA 3HR7A 5KSPA 4HI0E 4KAXA 2G0TA 1KSJA 3HJNA 4D81A 4UXIA 3OF5A 3KJIA 2HEIA 2P5TB 3CH5A 3M4YA 3LVQE 4P0TA 3U5ZB 3CIOA 2FU5C 1FTSA 2JA1A 4JVLA 4KFUA 1WMSA 3PEYA 1HY3A 1T8UA 6Q21A 3SOPA 5GJWC 2W58A 3GP8A 4QFMA 5C18A 1XEWY 3ZZUA 1TU3A 1YHNA 5L3QB 1ZM9A 4FMCF 2FF7A 1FFHA 1KO5A 4IOKA 3KXLA 5CLLA 1S1CA 4AKEA 3VR4A 4GNKA 3NIBA 1RYHA 1KK0A 2A7QA 3A6PC 1NVXQ 1IJEA 2IWHA 4IOJA 1HQCA 1SHKA 3HDTA 3P27A 4YMWA 3U3OA 1CR0A 4PXAA 2D62A 3GEIA 4JSYA 5FL3A 1TU4A 3P1JA 4HLQB 3GEEA 521PA 2GF0A 3E1SA 3U44B 3FHTA 1ZM3A 1XMJA 2O5VA 4DCTA 1OKKA 1JXMA 5LB2A 4IHQA 2AKYA 4ZCLA 1XXHB 4L15A 4EJSA 3KTAB 1OFTA 2B7CA 2BHRA 1E1RA 2FH5B 1FOEB 4ACAA 3IEUA 3QIAA 3M6AA 2QP3A 4HSEA 1T6NA 5FBQB 621PA 2IXFA 1CKEA 1LY1A 2FZLA 2RGBA 4Q4HB 3THYB 2OFXA 2RGEA 3U3MA 4GT1A 3QI2A 1SKYE 3T61A 3ND9A 3UWOA 4B3GA 3VHLB 4Q4JA 4MKHA 1BIFA 1SXJC 2HF8A 4DSOA 4TQUS 3E70C 1JBKA 4BRWA 2GEDA 1CIPA 5D3QA 1GG2A 5JJLA 1EFUA 4FMDB 2XTZA 2QE7D 2OG2A 3ZD6A 2XOKA 1S3GA 1G8YA 4FI3C 3REGA 1NRJB 2ZTSA 2NO1A 4CEHA 4ABYA 1G9XA 3NH6A 3CWZA 4RZUA 1CEEA 1TADA 4YONB 2VP4A 2ORIA 1E99A 2F43A 1SGWA 4ZKEA 2ECKA 2J0UB 1GNPA 1G5TA 3O8BA 2VF7A 3J81k 1E2DA 4MGZR 5EP2A 3GLHA 3AF2A 1GRNA 2WICA 2Q3MA 2O8EA 1OH5A 5J4HA 3RSOA 3SJAA 2GXAA 3U61B 4QM6A 1KDTA 2GVZC 2IYYA 5FPYA 4ERNA 4RD4A 1LS1A 5DLQC 1YKSA 2ASEA 3QVUA 4DLRA 2OXRA 2W2VA 1KK3A 3I8SA 4JLJA 4NCHA 3AVTA 4QKQA 3B8HA 4GP6A 2GWHA 2J1LA 1VCMA 3I1FA 1CP2A 3HR8A 4UNRA 3VR2A 4LYHA 4I1UA 5ELXA 4C0BA 3U4QA 4LJYA 1W0KD 2O8BA 1DOAA 3OIWA 4TT3D 2ZRBA 5KHOC 3F5FA 2GCOA 3FMIA 3KDSE 1K5GA 4QC2A 5KTYA 1G7CA 3NKVA 3PQCA 1TX4B 2XNDD 3SHFA 3UWKA 3FPAA 1NG1A 3BH6A 3LX5A 4BFYA 3LH5A 2ZJBA 3D7MA 3GJ5A 4GDFA 2WTUA 1CRPA 1MH1A 2NZ8A 1QG4A 1N0VC 2AK3A 1ELOA 3K1JA 5FTMA 4TMKA 1FNNA 2IYSA 1MO5A 2J59A 4QGGA 4OJQA 2GAAA 3KXIA 2V1XA 4WBSA 2NZJA 1IN8A 2H18A 1F3OA 3EA5A 1JAIA 1R7RA 3L82B 3GJ0A 2GZHA 2CLCX 3TAHA 1SHZA 4BECA 3QPVA 3F0TA 3SDZA 4EJSB 4EKDA 1ZUNB 4RZXA 4OKSA 3B1XA 1U90A 3W5IA 3WHLA 4QL3A 3Q72A 2C8VA 2ZPTX 2AWNA 2QSYA 2WV9A 4A2PA 3LBIA 4WAUA 1SVSA 2FSFA 4Q4JB 3TKLA 1E2GA 3NDPA 1XCPA 1N2CE 2JCSA 3FKSA 1MV5A 3QNUA 4PSKA 1OIWA 3R9XA 1TEXA 1E9RA 3ZZTA 1ZBDA 5KYKA 2E1RA 4Q7MB 5BN3A 1L8QA 1CR4A 4CEHB 2FSGA 3QG1A 1E69A 4JLMA 4DLUA 1R5NA 2X8AA 3GLIA 3OFNA 4DEYA 4IXMA 1ZCAA 2F43B 4AWXA 1OYWA 4DT1A 1FNMA 5FTJA 2YOFA 4TL6A 2XZLA 2PMDA 3B2EA 4NL4H 1N6KA 4XVUA 1L7VC 2REXB 2YYZA 3GLHB 4PQFA 3QG5A 5G3ZA 5JZVA 1WP9A 2O8EB 1I4LD 5CK4A 2IYQA 4TMZA 1KK2A 3UATA 4DUGD 4A9AA 2ZJZA 4NYIR 1OXUA 1UKVY 3B85A 1IBRA 5GJBA 1KO1A 5CM9C 2JLZA 3SHWA 2J7PA 4JBWA 1DAGA 3RRNA 2VHCA 3WXMA 1TF5A 4YMUA 1E9DA 4MUAA 2KWIA 2NTYC 3CRRA 3U4QB 2FPMA 4BEJA 2QM7A 4B76A 2QI9C 3F8TA 1C1YA 3NWJA 3IIMA 4M9SA 2O8BB 1DADA 3DZ8A 2GCOB 3AVVA 4YLGA 1D9XA 1U98A 2WVJA 3BFXA 2PZGA 3CNLA 4RVCA 4W7SA 2CK3A 3HYRA 3TK1A 1D9ZA 2R6AA 4V0LA 1ODFA 3V00A 2ODWA 1UDWA 2MSCB 3CBQA 1DO2A 1R10A 4H1UA 4PAMA 4Q9JA 2RGGA 2CL0X 3TW4A 3MCAA 2G3YA 2GK6A 3BS4A 2A5DA 2VP5A 1UEJA 2H17A 5EE3A 2VSXA 2WPDA 2EFEB 1ZVQA 2AWOA 2AD5A 2CE7A 4B34A 1E0KA 2C96A 1HH4A 1UF9A 1OV4A 3CUEF 3RWOA 4DLSA 2Q9CA 1AS2A 3ND8A 3DPUA 1JB1A 2HUPA 4MA4A 4DLVA 3ZVMA 4B3XA 4AYXA 2JIZD 2N46A 2ZSEA 2A5YB 1UBEA 3KQUA 5C2JB 1BYIA 2DWOA 2ZU0C 2QUZA 5G41A 4UNPA 1R0ZA 2RGNC 3WRXC 1P73A 1E94E 1TAGA 4A6PA 4MDFA 3PV0A 4EPVA 2EYQA 1J90A 1Z6GA 1Z08A 4R7ZA 5IK2D 4EUNA 5KU1A 1M6NA 3LX8A 4LJ5A 4WA7A 1E2KA 1Z29A 3CF6R 5EP3A 5TY0A 4E07A 3K09C 3MJRA 2FSHA 1IOZA 4MKIA 2BEJA 1W49A 4URZR 1E0JA 3AB3A 4C3ZA 1U81A 4EAQA 2ZRMA 2KI5A 4LCBA 5EUQB 1RPZA 3EX7C 3GLIB 2AR7A 2HJGA 4PAOA 2F1IA 1EFRD 4DCVA 4BRUA 5E4FA 4BFSA 4DT1B 1ZINA 4LBZA 4D82A 2A5GA 4BFZA 3AKCA 8OHMA 3H4MA 1G5RA 3HU1A 3KUCA 1BS1A 3N2EA 3K0SA 4JL8A 3BD9A 2V55B 3RS0A 1ZM2A 2PEYA 4MUBA 4BFTA 2ZSFA 1VPLA 2DB3A 1W46A 1GZSA 1GUAA 3L0IB 5IRCD 3PJRA 1ZM7A 3SE0A 3QF4A 2ZUCA 2ZRAA 3WNCA 2OE2A 4DEXA 2OV2A 2QMOA 1FP6A 1TL7C 2BOVA 4URXR 2GCNA 3CRQA 4Q1AA 1RYFA 3QXJA 4PR0A 1H8EA 5AJZA 5CIQA 1MABA 1X8KA 4YDHB 2WIAA 3I72A 3WP0A 2QPAA 4JLDA 5FTNA 4MRNA 1P2SA 5IHPA 1M7GA 3SBEA 3B82A 4OK3A 4Q03A 4TN1A 4AYTA 221PA 4PHGA 4DVGA 3A4NA 1JALA 1B0UA 1KI4A 3X2SA 1OFHA 4D4JA 3AVYA 4Y0AA 3PENA 4EPYA 1FQJA 1OYYA 1W5SA 4HUQA 4CZ2A 3R7WA 4DIEA 2RMKA 1H8HD 4FMCB 2IT1A 1KZGB 1ZP6A 2V8OA 5DI3A 4CYMA 5DHAA 2ZYUX 3PUVA 5FL7A 3QF7A 1JAHA 1VG8A 2DFTA 1UKYA 3ZS8A 4QG7A 1XCMA 3OZXA 3PXGA 3RNLA 2BMDA 5JRJA 1KI2A 4U5XA 1DPFA 1NP6A 2PLRA 3KXKA 4QM7A 1TMKA 3AVQA 4JLKA 4DSNA 1G3MA 2BCGY 4ZV4A 3ETLA 5AUNB 3RWMB 1TQDA 1MRNA 2NPIA 4Y0VA 5BQ5A 2EFGA 4LOAA 4OYHA 3FFAA 5C4GB 3CR7A 1KO7A 3KX2A 4YC7A 3NHBA 1KY2A 1E9CA 3LY5A 721PA 3WHKA 1IHUA 1GTVA 3VX3A 1LFDB 4TLAA 3AUXA 1GSIA 3D8BA 4PC3A 3TUZC 1XRJA 4US0R 1EFTA 2JDID 1E98A 3EPHA 1HQYE 2KSQA 1W4RA 4EFNA 4F92B 2JATA 3C5CA 1G18A 4H9GA 1EG7A 3EXAA 3K9HA 1Q22A 5FPSA 3P20A 4YMSA 1SZPA 1IY0A 1G8PA 3BE4A 2REOA 4H1VA 4YXWD 1HA3A 4HAUA 4KSCA 1CF4A 3UMSA 4QGFA 3AP2A 3CZQA 2ODBA 1Y63A 4GPTA 3P26A 4G5QA 5CYOA 2F1HA 3BFKA 3JVVA 1CJTC 3PR1A 4B3CA 4Q1BA 2EQBA 3OEHA 4Q21A 5CDFE 4UNQA 2FZ4A 3HYTA 1X8LA 5UKDA 3MFYA 3W3AA 2QQ0A 4EPXA 3QF4B 2ZS8A 1TQ2A 1N5KA 2GAOA 2IYUA 4TYPA 5EE0A 1DBSA 5E95A 2EVWX 3AQ4A 1XZQA 2ZRPA 4HDCA 4P4UA 3RANA 2D4HA 5TXGA 1T4GA 1MABB 5KNCA 3AVWA 1KDOA 3O8DA 4DC9A 4FXPA 3K70B 5M04A 4KYIB 1N6OA 2A2ZA 4LHXA 1UBFA 3D31A 4DB2A 1ZAKA 5JWHA 2B8WA 1AKEA 2X77A 4FCWA 4LSGA 3AVXA 1J8MF 4NE2A 3NC1C 3LWNA 5LB4A 2ZI5A 4OHVA 1U2RA 3B7GA 5H1YA 4HUQB 4MRVA 3OESA 4X8MA 4KVAA 1F2UA 1VG1A 2HF9A 3QKSA 4IOLA 3NBFA 3KQNA 5DI3B 1F48A 4LJ4A 2N42A 3GFOA 1V5WA 3T5DA 4D26A 2IS1A 1Z83A 4NMMA 1W47A 3LRPA 4TYQA 3GJ4A 1FL9A 5BXQC 3W5JA 2C03A 3T1QA 4Q18A 3QSYA 2ZI4A 3CKLA 4TMXA 4PTLA 1D2MA 4QHTA 1G4UR 2VHJA 4KLZA 2WMOB 1IM2A 4FIDA 4M53A 4HAXA 1G21E 4B3BA 2I3BA 2W0MA 3LQQA 5TVKA 4WZAE 3X1ZA 1KMHA 1SKYB 1N5JA 2FGJA 4BE7B 1LB1B 1YQTA 2R6CA 1VKJA 1ZJ6A 2ZJ5A 4V0NA 2WKRA 2GA8A 2CMKA 3ONWA 3TE6A 3S1AA 4IVPA 4JT4A 3AF1A 2JAQA 3GLFA 3T06B 5HR5A 2QT1A 5J40A 5B2ZA 3WMFA 1WBBA 1ANKA 2BKUA 2O0JA 3TQCA 4JJZA 3QENA 3W6OA 3IQXA 1E2PA 3EIHA 2KJQA 4A8JB 4GP7A 4JYCA 1E4VA 1G5PA 1Z6XA 3CF0A 2GXQA 4XSGA 3U7EB 1JR3E 2GEVA 2VHUA 4JKYA 1NBME 3KJEA 2BBOA 4PAQA 2IHBA 2G0NA 5EP4A 4DXAA 4E09A 2ZRHA 3LBNA 2ZR0A 1YE8A 3FHOA 3X1XA 4MGIR 2D7DA 2NIPA 2QE7A 1A2BA 2LKDA 2QMHA 2Y8EA 2QPOA 1R5OA 4HLUA 4JZKA 4YMTA 2ATVA 2RKOA
chains in the Genus database with same CATH superfamily
4PHHA 2ISSD 2Q1TA 2H7YA 5K3BA 4A2QA 4FSDA 3TTYA 2Q9UA 4CPDA 4BVEA 1RWQA 4J7AA 1N2IA 1N3LA 1VDMA 3QM1A 4FBLA 4RQTA 1QK3A 2OBMA 4KUHA 3VRHA 3L7DA 5C7OO 3L05A 3PQ6A 3BRQA 4F8JA 1UXJA 3UWPA 1TO1E 3V97A 2P3SA 3F6SA 2YXLA 4F9TA 1K1EA 2ZRQA 5I01A 2UYHA 2R9VA 2XMSA 3K9BA 3LX6A 4M8SA 2VXOA 3W6NA 4R8MA 2UZ1B 1PFYA 4PLFA 4GVLA 1FLNA 4LY9A 3P0EA 1AGPA 1JG1A 3IIJA 4IHJB 3ETGA 3G17A 4TTIA 9LDTA 1PK9A 1ICIA 3RJMA 2H2AA 4TS1A 4A6XA 2BGIA 4B0PA 3CNBA 1QGZA 4B80A 2PGAA 1CZRA 1YE5A 1P17A 2FAXA 1SUCA 2VJBA 4IIFA 3UZUA 2IS6A 2PSFA 3GT4A 4GMKA 2G67A 4X66B 2HZBA 1XZHA 2ZPAA 3F1LA 1WCWA 3LDHA 3TKAA 1VPTA 3VMFA 5KQGA 1O0CA 3GO4A 1YK0A 2PMWB 4MQLA 1QO9A 4JL6A 3L6DA 4KYVA 3TRHA 4X63A 2G1UA 3UJ8A 2P5UA 2V6FA 1IM8A 4CM6A 3GN2A 4D6PA 5FUMA 2XUHA 2H8GA 3FTCA 1MJGM 1F6DA 3GL9A 4MQBA 4EECA 1SBQA 1F2UB 4KPUB 1T8YA 1MU0A 2JFHA 3K0EA 4PO9A 1ZEJA 3I45A 1VJDA 2QK4A 3UW3A 1NVEA 2XNDA 2GVDC 4UBKA 3VNRA 3KAKA 1G4AE 1Z6TA 1SOAA 4AZVA 4TYWA 1OIXA 4OH7A 2FVYA 1K3UB 2F3SA 4ND6A 1KYVA 4BN5A 4TXJA 1QU2A 4EMBA 3ISTA 1DJOA 2EZ9A 4ON9A 5DF1A 4EM6A 4QELA 4OHRA 1MC5A 4A0QA 2XYRA 5IFLA 2C9YA 2RJ3A 1PGQA 1ZVKA 4ABTA 1GTL1 1UBLS 4KLNA 3IX7A 2VQFB 3ZHBA 4COOA 3OURA 1WY7A 5HJ7A 1W25A 1DQSA 2FLWA 1EQAA 1U31A 2QLLA 1XDSA 2WMNB 4GLOA 1QONA 5DYNA 4RAQA 2BJHA 5AUOB 4FXOA 3S1AB 2ZITA 2HQ1A 3VBCA 4ZT3A 2ZXUA 4E2FA 2NVWA 1SVNA 2H4YA 2X1VA 3U60B 1SVKA 1BVRA 1RLTA 2W6ID 3IT3A 3DBOB 1E62A 4N9QA 4QPCA 1DRJA 1G0OA 4AY3A 1H6BA 2O05A 3AGPA 3SHQA 2HYIC 4IGKA 3SIXA 4MW2A 1RDFA 3R09A 4BP1A 3EWSA 4FOOA 3AXTA 2R5FA 3H5VA 2CXOA 2PGLA 2X0NA 3JV7A 3WIBA 5EQJB 1I24A 1LDNA 3D4BA 3KQSA 3V3TA 4UAGA 5TV2A 3TX6A 5CHYA 5FUYA 1KMCA 1Q14A 2BGLA 2MSNA 3HABA 5DYGA 2I99A 3UYLA 3I5XA 4LHSA 4DZTA 3KPJA 3E03A 1XMSA 2YOGA 5AK0A 5FP0A 2P69A 1QH9A 2PGOA 4GXQA 1MTZA 2DZDA 1NN3A 3OA2A 4AFNA 1HURA 5F1KA 4MWEA 1KY4A 4PFSA 1UJ2A 2NQTA 3GVHA 1JHVA 2AUMA 3ZHQA 3IERA 1SXPA 4UHHA 1QC5A 4HNUA 2Z3VA 1JDTA 3P4XA 1W7AA 2GLTA 3TTWA 1UPTA 4CEIA 4XJSA 3JAWB 1XD9A 3VTFA 1FF9A 1QHXA 1CU1A 1P44A 3SC3A 1N2OA 4I1YA 1YNSA 5FFFA 3ROFA 1SXIA 1V8OA 3H1TA 1XTJA 2FPIA 2P9HA 3H4TA 4F04A 4EF4A 4KTVE 3RS3A 4P32A 2CCKA 4PX3A 3WBKA 4B6PA 1O6BA 2PXAA 3ZCXA 5IWAB 3VO1A 3LPNA 2ZYSA 4P5DA 3SBDA 4C7KA 2AFVA 4LYEA 3DBVO 2A9RA 2NUBA 4C7JA 3ZWBA 2ILTA 4YBZA 2I33A 1L5SA 4MLCA 5LYJF 3USCS 4QNRA 5B1IA 5BQ3A 4IR7A 5CITA 1OBHA 1PBNA 3REOA 5IP5A 5FDFA 2I67A 3DEHA 1CHDA 1HF3A 1Q0LA 4LQ4A 5KX5F 1GTRA 4YMGA 2FJPA 4DBZA 2L17A 4IAOA 4YPVA 1AX9A 2E18A 2IEIA 4O1HA 3BB3A 3F5SA 3KHSA 4YJ2F 1P7CA 4G3XA 5AW2A 1HE2A 1BO6A 1UXOA 1FQOA 3HYNA 3J7TA 5DHFA 4EVQA 3BDIA 2Z1NA 3NPMA 2DE0X 1J56A 2XQKA 1UC8A 1RXCA 4OH1A 2F1RA 3RSGA 4BLUA 4F5WA 1RACA 5C8ZA 3RAJA 3EHEA 1FP2A 1Z22A 2GXUA 3GXBA 4L8GA 3OTQA 5B7PA 1ZJJA 3G02A 4PEVA 1G2OA 1KPHA 1UH5A 4DOMA 3SX0A 4AP6A 1C1HA 1NUHA 4U7JA 1IXZA 1SCAA 1BOOA 1E2NA 2FMFA 2IEDA 1SOVA 1GCGA 1I5RA 2AUNA 2IEAA 3EXHB 3LCMA 3ICOA 3GOQA 3CRMA 4M1WA 2O2ZA 1GQOA 2ZAOA 4G2TA 3RHTA 5MGBA 1F1JA 4PZ0A 5BUZA 1KNXA 3DNFA 4QE3A 1SHLA 1EXNA 2VF4X 4WLVA 4XYLA 5DN6D 4K88A 2C42A 1P6UA 2G8LA 5IT9A 1MBZA 1NE2A 4TL8A 3W2HA 1IWBB 5BQPA 4FNAA 2RK4A 1QU3A 4ZO8A 3S7TA 4EMUA 1VHQA 3REQA 1KJWA 1HE8B 1VG9B 4HUTA 3HMQA 5B3KA 2VJMA 1NBHA 3IPCA 1XL0A 2WJZB 3H4VA 3L18A 3L7IA 3MWFA 4K9LA 4MQ5A 4JLOA 3DDWA 4RXUA 1E3JA 1NWCA 2WWXA 4JC4A 4ZQFA 2BV3A 3H19A 2BUCA 2OZEA 4JUCA 4LSMA 4ETIA 4OHBA 1XUOA 2RKBA 4EB6B 1HYBA 4HT3B 5JCOA 4NYIQ 1ISMA 2TRSB 4CL0A 1JA1A 3QOYA 1IQRA 2PUVA 5E6SB 1QKKA 5EGNA 4OF4A 3FFTA 3RRMA 6ABPA 3FETA 4ZCQA 3K1AB 4WGFA 5LP6F 1JU9A 2GBLC 4UJ3A 2AVDA 1DV1A 2QTWB 3P5SA 3ZOKA 4HMPA 4ZVNA 2FYTA 1RD4A 4FYMA 4C87A 3DO8A 4PG5A 5JXJA 2VQ3A 2BBSA 1H3FA 1QE0A 2R25B 4N8EA 2PXCA 5F51A 1JL3A 2OILA 3KFXA 5DBGA 1YIOA 3RC9A 5CB4F 3KCNA 1OAKA 4E22A 1CSEE 4DN6A 4BY9E 2ZYVX 5CVCA 5HFAA 2DBQA 3KK0A 4LA4A 4Q48A 5D51S 5DK4A 5A5EA 5LOVF 2J5XA 3OPNA 2VYCA 3G85A 4P80A 2W9XA 1KAMA 4RABA 5LKRA 2CDBA 3VHRA 3KYDA 3SCZA 1UBHS 3OP4A 1FNBA 1E6LA 1Z13A 1NVAA 2FSVC 3SYLA 2E49A 3U09A 1H2WA 1J39A 4C0JA 5AW4A 1LDGA 4GXRA 3OLXA 3R5FA 3BT7A 2WYIA 3OJLA 1IZ0A 4PC6A 5K6TA 4XJXA 1T0JB 1CS4C 3TLMA 2PT7A 2IHNA 3MJTA 1ODSA 3SQXA 4PRYA 2XUPA 4PYOA 4CG2A 3C4JA 2F7SA 3JQ7B 3ODPA 2O8FB 4RELA 2WY2D 3PICA 4ESHA 4UNSA 1O77A 3BXGA 2F3RA 4CBVA 3T7DA 4HNTA 1FRFS 2PCJA 1P0MA 1E3EA 2DAPA 5F5NA 2GPSA 1F8FA 2QUIA 4A1FA 4BFXA 4EQ6A 2II6A 2XGSA 4G25A 4TV9F 2FRDA 4TSFD 1V1RA 1EUCB 5LKAA 1O95D 4BLPA 5JJCA 2BFCB 2QAJA 5EEHA 2J6HA 3JYLA 4UE2A 3HJFA 5B4VA 4MDEA 4EHAA 3OQJA 1KFJB 4OQYA 1ULUA 3J7AC 1PZNA 1ZONA 3FCYA 1HYQA 2QR3A 3PEUA 4IGEA 2VOEA 4M98A 3OIVA 3T95A 3AO0B 3I61A 1W35A 2C7GA 2ORVA 4ESOA 1NLMA 5IU6A 4Y2HA 3F5MA 4M9RA 1X70A 2NVOA 2B1JA 3GVIA 3PE6A 4NZOA 4R1NA 2Y1WA 2Y27A 3I9KA 4ZI7B 2HU7A 3JY6A 3VV3A 3ID6C 4ZJYA 2AK2A 1S96A 3DOJA 1CUXA 1LW7A 3COYA 3GLGB 2VHXA 2NSYA 4QPZA 2HRCA 1GZDA 2WBLC 2PUWA 1U8ZA 1Z4KA 1C3XA 1NC3A 1X94A 1H69A 1XTIA 4XGNA 4EK9A 2V96A 4EHIA 3ZJTA 2C20A 4ZI7A 2G6BA 4YO8A 1WSBA 5KYTA 2YYYA 3ZWAA 1YIAA 1YCDA 3ZY5A 1NZDA 4QEKA 2JDIA 4DQKA 5JSZB 2WU1A 5C1BA 1OTHA 2OKGA 3FB4A 2W7TA 4Z0PA 1U4SA 3ZG6A 1I4DD 4W8GA 4AD8A 2QX4A 1WMEA 2FR1A 1M67A 1DT3A 4FVTA 1LS6A 1I6KA 3NHAA 2XTAA 1ZH4A 1JIKA 3STTA 4DBVO 1HKHA 2JHCA 2OECA 1N36B 1E3DA 2GDZA 2QG4A 1GN9A 3ESRA 1JQEA 3MGGA 4MVJP 3H9GA 2PKWA 1T5TA 4TM7A 5HDBB 3VKWA 4BX3A 2J3HA 2Z95A 4IIGA 4P7GA 1T8TA 4UE3S 3E2IA 3CNOA 3BK2A 1V3UA 3IPAA 4DJAA 2KBEA 4LC9A 1POXA 3FPHA 3T12A 2X4GA 5C3MA 3MTIA 4M8NE 1D0IA 5KDLA 4PSUA 4HPJB 3VC2A 1ECLA 1FUEA 5DHUA 1DXYA 1Y89A 1H22A 1KAQA 2XYGA 2QBYA 1HR0B 5KYYB 1PE0A 2JAUA 2VG8A 4IZHA 2V5AA 4AMYA 2X2FA 5H3CA 1KP2A 5FWYA 3EJWA 4WHMA 3O47A 3IJEB 3DV2A 3RSSA 3O8RA 3NTVA 1AHNA 4XM2A 4EG4A 1XXHE 2M1ZA 2OHGA 2B2NA 3DKPA 3EVNA 5F5XA 4ANFA 4BB6A 4ZYUA 4GL2A 2D74A 2C99A 3FFWA 3IE0A 4PX5A 2J6CA 4CT4B 2RGCA 3K7EA 4NPAA 3CPSA 1FX0B 2HJSA 3BXZA 3INNA 3N6RA 2WWRA 3F3MA 4HZGA 3ACCA 1EWVA 1AKMA 1FE8A 4CIDA 1J09A 4IDNA 1MJNA 1H2FA 2QGNA 5JQGF 1GN8A 2Q5HA 3GQVA 1YFJA 1V11A 2P35A 3RS4A 1L4BA 3SOZA 4YY3B 5C52B 2UYCA 1C3EA 5HSGA 3L0BA 4MQFA 4E5UA 2O59A 4HVAA 4US2R 5EPEA 5KC9A 2UVQA 3TNYA 2Q5OA 2OBBA 2PKRA 3GRAA 2ZIEA 1CY2A 1OZ0A 2X42A 2QQFA 3LFUA 3R4VA 4IW3B 4E7OA 4Z1OA 4JI7B 3M5CA 4GOMD 5KX5A 3CF4G 5AH0A 2X58A 3Q5GA 4YJ2A 3GPCA 4G8DA 4DLXA 1N9ZA 1ZICA 3V8MA 4C7XA 1SQ0A 3D4PA 3R3WA 4OIMA 4Z8YA 2OYCA 3RT9A 3T38A 5AVJA 4GM4A 2GZ3A 2RONA 1HDIA 5G40A 2TMKA 2XF2A 3S2UA 1EXWA 3FUCA 2FNAA 1ZEMA 4ZVUA 1GT91 2PPVA 4DV3B 1KI8A 2FEAA 2MYNA 1PNVA 4HAYA 4U6NA 4UVHA 3TTSA 4DLTA 3THXB 2D00A 3VOSA 4KXQA 4V1CA 1G16A 3II6X 3JXEA 3NV7A 1P4AA 1C2YA 1CEYA 3ZWXA 2AZ4A 4HQOA 4TMVA 4D02A 5JLAA 3T9DA 4XWKA 1M83A 3LW8A 3O2JA 5HJEA 5AJXA 4IBOA 5EXPA 2H0QA 5TLSA 2AUTA 1KK1A 1BWSA 1NMXA 2FB9A 1Y6JA 2QVGA 4A6DA 1TYEB 1WDKA 3WIUA 3WK7A 1NYTA 2A3RA 2X4LA 2XGGA 1KBOA 2QJTA 2ROQA 4ENPA 4KHPB 1DAPA 4ND7A 3ZXSA 3L7AA 4OU5A 4MW1A 4JUBA 4YV7A 1GQFA 1Q6ZA 3F3YA 1R0XA 3KKNA 2Q62A 4BTVA 1VCOA 1EMDA 3FMGA 1T15A 3AY0A 1PZXA 1NQ5A 2FRVA 3ACDA 1SOUA 3CUVA 4KL8S 5AHKA 4UFNA 3VYVA 4DDUA 4J0GA 4RV5A 1RW4A 3WBFA 4RKQA 4UQOA 4F6RA 1HOXA 2BL4A 4R71A 1XSEA 2BMJA 2J5QA 4FHCA 4F38A 3B9QA 4X8OA 1SC6A 1NMSA 2J3KA 4TTJA 3DCYA 1F0KA 4DWJA 1TAUA 1NTOA 4L2IA 2FJ0A 1B14A 3COJA 4P8RA 4I4IA 5KNDA 2VDOB 2IHUA 2VTBA 4BO9A 5IMBA 5B1DA 2XIQA 4TZTA 3BKWA 1A9OA 1ZMOA 3D3NA 1CUIA 4LRXA 4ILKA 2YRWA 3AILA 4PFQA 1IZ9A 1QYCA 1JHRA 2ZXEA 2P9BA 1CUJA 2Z30A 1FFYA 3OZ7A 3ND7A 4JMLA 3O03A 1NXTA 2HA7A 4RADA 3UH1A 5LP6A 2P78A 5HW0A 2FXIA 3QI7A 2IIPA 1Z34A 2H4HA 3L6BA 5AP9A 3AEUB 4BRSA 3EGVA 2P0EA 3VJRA 2RGYA 1JT9A 2WJGA 3DM9B 1YZQA 1YR2A 3QKIA 1LX6A 3AT1A 2QAGC 1N6IA 5EIBC 5EZYA 1JSCA 3HP1A 1RXVA 2CKMA 2RB4A 2I29A 5L7WA 1C9YA 5AJWA 4B4UA 1V3VA 1ICEA 2O7QA 1TI7A 3PEWA 2P2CA 3L8MA 3PUZA 2O23A 1X3LA 2AMFA 4HWKA 4C22A 4QUEA 2WA2A 3E9CA 5LOVA 4ITUA 1HWYA 2FPRA 2VKQA 3GHYA 3SF8A 1R88A 1JR3D 3OLYA 4QWMA 1QHNA 4HS9A 3MQ4A 1BDJA 5B12A 3LPDA 3BFJA 2HMWA 5FBWB 4RD1A 3HB0A 3R40A 1O94C 1Q0UA 1DEOA 1GXSA 1PF7E 2RAPA 4IIVA 3NV9A 2CXSA 1R12A 4HNSA 2Y1FA 2ZULA 3GWZA 4KDCA 4B2PA 1AKQA 3D81A 3P4UA 1UJBA 4NOJA 5EOVA 4B32A 4Q4CA 1GO2A 2QRGA 5AT1A 2JFFA 1W87A 3FBWA 1L1FA 4GMHA 4B4VA 2DTEA 3UJCA 5K7SA 3CNQS 4YO7A 1M73E 4B8ZA 3OCCA 3Q8MA 3ZKWA 1JLHA 3HA3A 4PLVA 4YCMA 5CB8A 8GPBA 4L1KA 4Y67A 3H5AA 1ISSA 1YTUA 4Y2JA 3PNPA 3EPPA 4GBGA 1UPCA 5AK6A 1N5RA 3TRDA 4ZT2A 4ZU1X 2NWQA 3HDVA 4R2IA 1F17A 4TV9A 3ZGZA 2MWMA 3UYKA 3GDHA 4O4HF 1R4MA 1JJVA 2R00C 2YQ5A 3AESA 5JNLA 4NCXA 5AVVA 3HPRA 2ACKA 3HM9A 5LMNB 2O54A 2OCAA 4DLBA 1M7BA 4UCFA 2CHQA 2H08A 4WZBE 1QH8A 1X80A 1YZUA 3HDYA 2YN2A 4KWTA 3SYKA 1B0ZA 4DC0A 2JIBA 2ZRFA 4R69A 3FYHA 4FFOA 1NJ6A 1YI1A 1K63A 1M1NA 2OGSA 2RHCA 3GLHE 4RA9B 3A6EA 3CKMA 2WJ4A 1XBTA 5AXDA 3DHWC 1G8FA 1QH1B 1CBUA 4K6KA 4NCKA 4FNOA 1KVSA 2GJKA 2VLIA 3BB4A 4LUCA 4JV5B 1KH1A 2HIHA 3OQBA 5BR1A 1CX9B 1BN7A 1QV6A 3P45A 3RRYA 2YZ2A 3MAGA 1HT2E 1Q16A 2HBRA 3O73A 5SZJA 3UOGA 5F7OA 3BMOB 5JXIA 1K6IA 2WIBA 1JQJC 2R7NA 3A1FA 1G8GA 2P40A 4MX8A 2VDUE 5LIPA 3ZH9B 2W6IA 2HDWA 2I66A 2ZIXA 4DCNA 2C7PA 4JVOA 2EW1A 3RBZA 2YWHA 4TMYA 4DDMA 2PUAA 4MKFA 5JSKA 2QZSA 4KQXA 1RRCA 3IOEA 4G67A 4HGRA 2YINC 3KALA 4MGYR 4YREA 1ESEA 1IHXA 1M2KA 1KXJA 1JWLA 4K9QA 4EB8A 4GPIB 5DTMA 2IHVA 1P4RA 2PKXA 2V98A 1L1RA 4HO1X 1PNTA 1H0SA 1U8XX 1FW8A 2BWJA 3CKKA 3DTYA 3EDOA 3KQMA 3PXUA 1W9HA 3QLUA 4OSOA 3FPEA 1IXYA 4CHTA 2XXAA 1A98A 3CW2A 2WWIA 3EBPA 2LDXA 5ILGA 3AF6A 4YCAA 10MHA 2OFWA 2ET6A 3OX4A 4N0MA 5EGSA 5KQRA 2RH4A 1JJAA 3NASA 3DGFC 1RMQA 4X20A 5BVHA 2G9ZA 3KJQA 4AN4A 1RQGA 2FZWA 1H1TA 1EPUA 1Z5WA 4KR3A 4MTLA 5EIXA 2JFNA 3E7PA 1XGKA 4QFBA 3E1KA 2ZBFA 4U9UA 3TEMA 3W9BA 4EYKA 1T3GA 3ZWYA 5J3JA 1WZIA 4CGZA 1MPTA 3AM5A 4AULA 1JE0A 3CE6A 4L50A 3HXLA 4Z7QB 1KJZA 1X0XA 5CH3A 3PT9A 1DELA 2Q3DA 4D9IA 1QRDA 2GNPA 4N3AA 3SK0A 3M6XA 5HQ3B 2UVDA 3HH8A 3QOXA 4YP7A 2V97A 5DP2A 5L3ZA 1GA1A 3I12A 5SY4A 3EZGA 1N2CA 2I3AA 2YV4A 4QJ4A 4X54A 1OHHD 2VZ9A 3M3PA 4KB5A 5LC1A 1EVEA 3LTNC 2E0IA 3CUWA 4LVNA 4RF3A 1PFGA 3EUWA 2F1JA 5BYJA 1N6RA 3MS2A 5T57A 1NU6A 3CZAA 2VXYA 1T9AA 2C0PA 4MZXA 4DA7A 3I37X 2OP0A 4I2NA 2GUWA 1V16A 2A5FA 1XX6A 1A2KC 1P5HA 2AN1A 3M6WA 3QYFA 4HY3A 4F4FA 5A3JA 1U9IA 3W3AH 1XKXA 3ZX4A 5IH7A 2ZUUA 4NESA 1EX6A 5DCLA 4H16A 2I7VA 3GLIE 2JFOA 4GI7A 3VPSA 2FPPB 5EZ6B 1T9DA 3G1UA 3C4QA 1OGYA 1T1GA 4Q01A 5DEIA 1P0IA 4GLFA 3SKYA 3ZGVA 4B3SB 4JYAB 1CFZA 3CTMA 4Z4GA 2QY6A 2GN6A 5F3WB 2JLQA 3HB5X 5D01A 4PGAA 1UL1X 1E9EA 4MIKA 4MQ4A 2C2MA 1TZBA 5BN5B 2C04A 1K9VF 4A91A 1UJMA 4C14A 1U0JA 2BR3A 2JCGA 4U02A 3WFIA 4EW2A 1Z45A 2MINA 4WASA 1T5LA 3JYPA 1RXSA 3K0FB 4B46A 3VDMA 4NQZA 2RHBA 5DN6A 3Q7IA 3R6LA 1UC4B 5IVHA 1BOFA 1RYEA 1IHYA 3PVSA 3HJCA 2YQ4A 4YJGB 1KE1A 2R6JA 3DZGA 2YIDA 5HCUA 2JJ2D 2Q3CA 3F96A 1RCUA 1NI5A 3DFMA 4BQIA 2W6QA 1TGVA 2FEOA 2VZLA 1R4ZA 3M1AA 1JWBB 4IJ5A 4MOWA 1UDRA 3WY9A 1ZU5A 1WB4A 1IVYA 5E9AA 1IUNA 1IXRC 1N3IA 2JLRA 3KZNA 1LLQA 1DFIA 2FPSA 1K4KA 4PVDA 4ZXPA 1H9AA 4HH0A 3GCGA 1V7QA 3TW0A 4RHFA 3ZI4A 5MN4A 2JLYA 1QHHA 2EJWA 2Q0XA 4JLWA 1WXWA 5H81A 4Q4LA 3DDHA 4TQ9A 1XQ1A 3JYOA 5JHHB 3SF0A 2FUG1 1Z8FA 2NYVA 3RIHA 3TQOA 3UC9A 1JPJA 1EM8B 5M3BA 4D3YA 4FLEA 2NUTB 4MVXA 3VSBA 2QD1A 4Q7QA 5BURA 3DH0A 1QM5A 4TYNA 4F86A 3R1IA 3UT5B 4CM5A 4WNYA 5G1NA 3IV9A 2OOKA 4BAGA 4HAZA 3Q7TA 5EP1A 5ENZA 2FVXA 2GN0A 3MTGA 5GJVC 4KN9S 1Z26A 1VIAA 1JG6A 4WJLA 4P7BA 1UKAA 3ZWWA 1J33A 1YDEA 3DB2A 2X40A 3BM5A 2FQYA 4FEEA 2JLWA 5EIEA 1EVYA 3AERA 3IDOA 1YQQA 5LJIA 1EVJA 4IHKA 4M7OA 5BSKA 1VXOA 4M0MA 1UMCB 4TKVA 4NXNB 4EGSA 2VAVA 3CC8A 4DW8A 4I2VA 2PUFA 2HQOA 5CGZA 3TXYA 3LHDA 3L4KA 2CNDA 3FHCB 3RYIA 1B16A 2BR4A 2K7ZA 2QNIA 4N6OA 4I4NA 5FIUA 5K4AA 1Z35A 1U0LA 1Z6QA 2CFTA 2OHXA 2Y77A 4LF8B 4Q34A 4KREA 1UDAA 4HLCA 2FR8C 3KZKA 2CL7X 4DDHA 3BULA 3L8ZA 2EW8A 1Z8HA 3I04M 4ZJZA 5FUQA 4YRPA 4AZ0A 1NLUA 3I2KA 2YIMA 1X15A 4HP8A 1NN5A 4JXJA 4W4TA 4MW5A 1XTBA 3AYZB 1JECA 3KLOA 3LS2A 4BIMA 3C41J 4LZPA 3UG7A 3VDNB 1KY5A 4ZYXA 1WTCA 2GZSA 2HRBA 1ZUIA 3AEXA 1RAAA 3A1EA 2FLVA 4DIDA 3DBHA 4DKXA 3EVEA 4DCGA 1EBFA 4I55B 5A9SB 1B1CA 3HZOA 4WECA 2I4IA 5C8DA 5IBCA 1RAIA 4Y7DA 5A5GA 1KZ7B 3QOFA 4TSFA 1UUFA 2OZLB 1EHYA 5GJCA 4E4YA 4E33A 1O95A 4LI0A 3WK4A 3HL0A 4PLYA 5GONB 1ITZA 1EBUA 1RYZA 4J0DA 3C6KA 2R68A 4GYKA 3LVFO 1K5DA 4RE6A 4NABA 1ECBA 4WDRA 4O4HA 3AR2A 3KO8A 1MF7A 5MGNA 1UIRA 2HMYB 4G1CA 3T8YA 1VMAA 1X1CA 3KD3A 1K88A 3NTUA 4IV8A 4CNBA 4L5IA 4F56A 8MHTA 2D3TA 2AFIE 4J43A 3MT8A 4BMOB 4WXYB 1LBEA 2VAXA 3A70A 5JFGA 4D7AA 1QKIA 1VHJA 1LRLA 5JAMA 3MAAC 2CE2X 3OIGA 1P60A 3LWBA 1N75A 1AKTA 3TLGA 3K71B 4Q47A 3ZE0B 4GLLA 4W7IA 3LQKA 4Y7CA 1L4KA 3LDAA 4EG6A 4GWGA 3V8VA 4PZCA 4GUAA 3AVOA 3U7GA 3EGIA 1T0PA 2QF7A 3Q0IA 3QKRA 2PJZA 2YWCA 2W2MA 1Y8RA 4DV6B 1V9SA 2DBRA 2Y71A 2ZROA 3F5QA 1Z88A 4EX6A 1ADFA 3P0RA 4H1TA 3R3UA 3HI4A 3TQRA 5LD2B 2FWRA 1N0HA 1PZHA 4LHWA 3FZGA 1BH2A 1CQJB 1NW9B 3PFBA 2RI1A 4K9MA 4B3JA 4HNAA 2WWHA 3FSRA 2XB6A 3BCRA 3E61A 3FVTA 1RPAA 4RYLA 3ZVNA 4OMFG 1DBRA 1RJDA 1P0FA 2OCDA 3OOHA 1BROA 1C29B 1X7WB 4G0QA 4LK3A 3TZHA 4CL8A 1E58A 1M72A 1EE2A 1AQLA 1PJLA 3ONVA 4CKCA 1GL3A 1WUHS 4FINA 5A04A 4ZJUA 5JBIA 5HNKA 2V3CC 2CLKB 2P6NA 2BP7B 1COWD 3E3LA 3L1UA 2NVUB 3DZDA 1MLDA 3NUQA 2XZOA 2NXCA 1RWOA 3VDXA 5IT5A 4LXXA 1CV2A 4MCAA 2TECE 4G26A 1UMBB 3S68A 2YQZA 1HNNA 4RJ2A 1CT9A 1EK5A 1MB0A 2CHFA 2SKCA 5EJ7A 2PWPA 5G4KB 1G7TA 4HEA6 3NHKA 2QTVA 1NU8A 4EGFA 1KDRA 2JVKA 3MGAA 3QV2A 1MVLA 4GZMA 4OUKX 4W1SA 4WLUA 3SFZA 1Q12A 3L7MA 5IUJC 3MJ4A 3BEOA 4UTXA 2O8CB 5TRTA 3PC7A 3O1JC 3PE3A 2CCJA 3DYVA 3JR7A 5ALFA 3RVNA 3FFBA 2A5LA 3D6UA 3V7YA 3T7IA 2PX8A 1DTSA 1XPUA 4ZA2A 4TKUA 3EWIA 2F64A 3K1TA 3HBAA 5BWMA 2V7PA 3TLXA 3ELWA 4OBXA 4A10A 2C83A 1P3JA 3QZUA 1FMCA 1TKCA 4R9SA 4RF2A 4U2DA 2XGJA 4R8LA 1TVCA 3O2QB 4D8UA 3IUBA 4X62B 1H93A 4RA6A 4BASA 2VUUA 3S7ZA 1Z0JA 1Z7BA 4Y6RA 1YNOA 1CTQA 3A4MA 1UQUA 4INAA 3CS3A 4RNCA 5EWMA 2ZR9A 3BGDA 2VNIA 2QU8A 3B6ZA 4MUNA 1H1LA 1Y1QA 1ZMBA 2Z08A 4I5DA 3MTJA 3Q3HA 4F9EA 2NAFA 1MX9A 2ST1A 3DONA 4H6PA 2WVGA 4CW7A 1ECCA 1PL8A 1YB4A 4Y98A 4DZZA 5HCIA 4IIJA 3IV6A 5BSTA 1XZBA 1KIMA 3V46A 1KI6B 4TSKA 5ITZA 4O0MA 3TOZA 4GPD1 4HYQA 3IQHX 1KOLA 5B30A 2ERYA 3TSZA 2QD3A 2BMVA 3ZIDA 2C2WA 4PPNA 4KVGA 1ZL2A 2WFLA 2P9ZA 3EC1A 4G5SA 4PPFA 5CA0B 2K4MA 4QQKA 5DH9A 1OE0A 4MTCA 4OQPA 2WDZA 3EIFA 5TSDA 3RE1A 1X86B 3AX6A 2UVPB 3CLUD 2F2TA 4LWOA 3Q9LA 1GPDG 2HU5A 4B43A 3NEPX 1ZI8A 2DCMA 3IVXA 2NT4A 3D3WB 1JF8A 1I5OA 1ZNQO 4R1MA 4XRRA 4ASUD 1XTKA 1GFZA 3WSVA 2VXCA 1LNZA 1JHUA 4KQFA 3F3KA 1K6EA 2V54A 3SIRA 3B89A 4RL4A 1GRQA 4CU5A 1EGVB 3MBIA 1RS0A 2AXQA 1U2DC 2IEBA 1QIIA 1R9JA 3LDGA 1G20E 4PXSA 3RLIA 2NLOA 4BMCA 1ZGBA 3KPUA 3NCHA 1I1QB 1KHHA 1R16A 3HS3A 4I4TA 4X1KA 5CMLA 3KJGA 5FHQA 3OM9A 3RPEA 3UK0A 3ZY2A 4CLOA 2BEVA 2AYZA 1XA4A 3DVSX 1ADCA 1P4HA 3JQBA 1FTYA 2ACVA 4HXGA 1IY2A 3ITDA 4PIMA 1OFIA 2VT7A 3E9DA 1T36B 3ED1A 3JS5A 2AG8A 2CJPA 1H2XA 2B92A 5T41A 2WM8A 2XT9A 2QZZA 4QDJA 4HNVA 2VQ6A 1NVVQ 4GKBA 4DBLC 1DWPA 1V47A 2WD9A 4LTMA 3H04A 3K1ZA 5G4LA 3WNDA 3QK7A 4OQZA 4I9NA 4EG5A 2R8OA 4G0OA 2UUPA 2DFVA 1HLDA 4MVJH 4NU0A 2NO9A 2YXDA 4ZEWA 3R5HA 1U2ZA 3RU7A 4F4JA 5EEGA 5EKUA 2OFPA 5TQ0A 1OOEA 3KQWA 1TJ4A 1GKIA 2A94A 3HVHA 1EJ0A 1U99A 3UVEA 3AW8A 3NVMB 1F2TB 2JGMA 3FZQA 1WNTA 2VDPB 3U81A 5A0FA 5PGMA 5AOAA 1GV0A 1J1ZA 5KCMA 4XXHA 2QVBA 3GZNB 3PRHA 2BSQA 4PHFA 5P21A 4FIZA 1ZDMA 3T9EA 1ADGA 3EDMA 3IAHA 1EQ2A 4TXNA 2H9AA 1OWPA 4RH1A 4ENWA 4A03A 1JHMA 1YACA 3EVCA 5CB6A 1E2UA 1V39A 1L7XA 2XUFA 1T0BA 4G86A 2WHQA 3N0XA 2HRRA 4UUBA 5T6MA 2QX8A 3P97A 5K3AA 1ZW6A 2JK1A 3GFTA 3GGJA 4O8CA 1JR3A 1OB5A 3A0RB 1Z7EA 1KI9A 2GBGA 1RWPA 3N6VA 4QEZA 3VR4D 4ZC8A 1ISIA 5EMMA 1F5NA 1UPXA 2I7DA 3PD7A 5DBFA 1L7MA 3OF3A 3RT1A 3T1VA 3ZY4A 1KZ6A 3DVAB 2VPXA 2X6QA 1XMIA 1EJ2A 3RJTA 5TS2A 3FPFA 2WE8A 1VHLA 3L6UA 3ZV3A 1KSHA 3O75A 3R0IA 4BVAA 3VZCA 3PWTA 1QZUA 3ONFA 5TDHA 3EIQA 3U49A 1JU3A 1CJUC 1JFVA 1HETA 1L5QA 1NUQA 1PDOA 2HDNB 2ZETA 3DEJA 4RORA 4UBOA 4E94A 5LFAA 1I8TA 1JW9B 1OZAA 5LZ8A 1D09A 1Y42X 1JHOA 1Z0ZA 2LKCA 3ENWA 3WDLA 2YS6A 3RVJA 1QIGA 4D0SA 4C1BA 3VZBA 1EGMB 4DAEA 2BFEA 2O14A 1WG8A 1GPNA 3HJGA 3U4DA 2FP4B 5BP7A 4AYWA 1TQ8A 2CLMB 2C58A 4QUGA 1L7PA 2A92A 4HWRA 4F7WA 4BPRA 5EIWA 2WSIA 3KEMA 1RI2A 4RY9A 5JE8A 4EZEA 2GEFA 4HEA1 4Z3OA 1ISGA 2RIRA 1JJ7A 2A1UB 3FMOB 5JAQA 2QTRA 1S7CA 2ZRGA 3BWXA 3SXJA 4CF3A 1CR1A 3HA7A 4I46A 2DFKB 1D4FA 1W8DA 3KQHA 2BIFA 1OFGA 1SURA 5K3DA 1GVNB 1W1IA 3CPHA 3M34A 3UV6A 2B8TA 3KUXA 4FNMA 4AUEA 4DV0B 1XZFA 4JJ4A 2C5LA 4UHKA 5DSTA 4E30A 4EKEA 3LOQA 4CEJA 4FT2A 1DGQA 1VJ0A 3EGEA 1BHO1 1MH9A 3AOGA 1PZGA 3KXPA 3PQFA 3UT6A 2ZB8A 3KQLA 4YRJA 1OH7A 4DRZA 5AW5A 3WIEA 1JHPA 1A2QA 2XMPA 3SQWA 3MCUA 3NYRA 4X8LA 2MSEB 1PS0A 4JKOA 4MQUA 1CZLA 2GN8A 2HLHA 5U1PA 4Q00A 1JH9A 1XJ0A 3G3EA 4RQAA 4QG3A 5FH9A 5AM0A 1P7YA 1L5RA 2H7CA 3RQIA 5K0GA 4KLRA 3EZ6A 4P7KA 3O8CA 3A1WA 1NL3A 3PD1A 3VKGA 4QDZA 1JPUA 3KXDA 4XWGA 4X71A 1GQYA 1YC5A 3FR8A 4RLQA 3ANMA 4HX2A 4IH4A 5EMHA 5J2UB 2Q0HA 2PKYX 2J9FA 3RIGA 4L9AA 4ND8B 3TM4A 2WM9B 1Z63A 4I3FA 4EFLA 2VQSA 1G38A 5AM4A 4M1TA 1XFAA 3ITEA 2CD9A 4LWQA 3HCWA 3ZHSA 1KHTA 1JYSA 4OL9A 4B6SA 2OCPA 4KV7A 1URPA 5HKBA 5GOTA 1FDOA 1GWNA 2BM0A 5BR4A 2WZDA 4L0DA 1PS8A 4UJ5A 1O97D 2PBLA 3HMKA 1QXSA 4GXNA 4RFVA 1P1HA 4KO4S 4WI1A 2ENWA 2IU4A 1LWOA 2XUZA 1CYDA 2H1FA 4ZT6A 4IXDA 1KBZA 4F2WA 3GFPA 4WEQA 4DPKA 3SSMA 1GZHB 1IXKA 2ZIAA 3A2NA 1PJTA 3AUSA 5EJAA 4DUZB 1OQAA 3P9ZA 4JENA 4ISCA 4KW7A 1EJ6A 4OXRA 3UXEA 3VHQA 2R47A 3EK2A 2EFCB 2JLCA 3AFHA 2PZ8A 3WDMA 3DZCA 4DEVA 3K5HA 5KIAA 3WGKA 1OHHA 4Z9BA 2FEXA 2M6KA 3DOIA 2YV3A 5DTQA 2HWUA 2G1PA 2V3VA 3PNYA 1OA0A 1DB3A 5D1HA 3GWGA 1YR6A 2GA9A 3QWIA 1NQTA 4B2LA 4DNQA 3VOTA 2GCPA 3LA8A 1R74A 2OTCA 3ZKAA 1GT6A 2J9XB 3M49A 2IZ7A 1KU6A 2ZUVA 4TS4A 4A16A 1DBIA 1KEPA 1PGOA 2XUDA 5FNVB 5DTEA 3NORA 3CLVA 4OQDA 2P0YA 3N5CA 3JRXA 2O9JA 3FCAA 3W4JA 2NPFA 4GBED 1UFQA 3O9ZA 4OHZA 2EWVA 3MJSA 1PL0A 4R0NA 3WZ2A 1NVFA 1PT7A 1BJTA 2HU8A 2ECFA 2IUTA 3AOEA 3GUVA 3PWSA 4EUEA 3FI9A 3GA5A 1AUPA