5HKBA

Crystal structure of the cftr inhibitory factor cif bound to the inhibitor kb2115
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
297
structure length
297
Chain Sequence
AEEFPVPNGFESAYREVDGVKLHYVKGGQGPLVMLVHGFGQTWYEWHQLMPELAKRFTVIAPDLPGLGQSEPPKTGYSGEQVAVYLHKLARQFSPDRPFDLVAHDIGIWNTYPMVVKNQADIARLVYMEAPIPDARIYRFPAFTAQGESLVWHFSFFAADDRLAETLIAGKERFFLEHFIKSHASNTEVFSERLLDLYARSYAKPHSLNASFEYYRALNESVRQNAELAKTRLQMPTMTLAGGGHGGMGTFQLEQMKAYAEDVEGHVLPGCGHWLPEECAAPMNRLVIDFLSRGRHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CFTR Inhibitory Factor (Cif)
publication title Rational Design of Potent and Selective Inhibitors of an Epoxide Hydrolase Virulence Factor from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa ucbpp-pa14
total genus 113
structure length 297
sequence length 297
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5hkbA01
3QBJA 2WG2A 4X6YA 5HQ3A 2IX9A 3AFIA 1F6WA 1XQXA 2WUDA 4MYSA 4WCVA 1YCDA 5ALYA 1DWQA 1LLFA 5T4FA 3I2FA 4BBZA 1AUOA 1W76A 4UBMA 5AKKA 1C7IA 5AK3A 5A62A 3WIOA 1F0NA 3FWHA 3G9XA 1QTRA 4H7IA 1J07A 3OTQA 3EQ7A 5D7BA 1H2YA 4O08A 5DNWA 3E0XA 4DNPA 5EFZA 5CW2A 3F8SA 4CCWA 2XLCA 3SWWA 1IZ8A 4JH0A 4ARAA 2GBFA 1F0PA 1DWPA 5K5EA 3AIMA 4DMKA 5FXMA 5ALDA 4DIUA 2XE4A 2WJ3A 2Y2UA 1AC5A 4P9NA 1VOTA 5CXXA 4RE5A 2VT6A 3G0IA 4LIPD 3C6ZA 1R3DA 3F98A 3QH4A 3H2IA 4UPDA 1HPLA 3I6ZA 4ETWA 1XQVA 3CXUA 5EIHA 4X93A 2X8BA 3UUEA 3M3DA 4JEIA 2XMSA 5FP0A 4IHAA 5HZGA 2OCGA 1J06A 5C7YA 1BEEA 3C6XA 4X3CA 1JI3A 4HRYA 4XJVA 1EA5A 1CUJA 1QFSA 1JU3A 3FNBA 4LYDA 4MEAA 3I2IA 3H0CA 3V1KA 2WHPB 1BU8A 3ZLVA 4GXNA 5FDFA 3W9BA 5AKJA 2WFMA 1X70A 2QMQA 4C4XA 1ZGBA 5K3CA 1B41A 5CTAA 5FPPA 2BFNA 5CT5A 2QVBA 3YASA 3I1YA 4H7FA 2ZJ7A 4XIIA 3NGMA 3CCCA 2K2QB 1EHYA 1HQDA 4H7KA 5JALA 4PW0A 2C5GA 5ALWA 1A88A 4PNZA 1XKTA 1YAHA 4L3WA 2QRUA 4H7HA 3QMWA 4UFOA 3DLTA 5ALVA 5AI8A 2GYWA 4BATA 1FFAA 4HS9A 3WWOA 1Q0ZA 3WJ2A 2UZ0A 5ALPA 2WHRA 3QPAA 2DCMA 4H18A 1QIJA 3GROA 5FV4A 4AX4A 1WOMA 1XZAA 3QMMA 4X90A 5HFAA 2C0QA 4X6UA 2QT9A 4K6GA 4UBLA 3MVEA 4KRXA 3I6YA 2ORYA 3A2MA 4Q1VA 4Y2PA 4BRZA 4J0DA 3WLAA 1XZIA 3R3WA 1MNQA 4DNQA 4DYHA 3JWEA 2XUIA 1W1IA 2ZJFA 1LZLA 2AJ8A 4AO7A 4Q3KA 5HF8A 3O4HA 2RONA 3BE8A 4N8DA 4TVKA 1XZLA 4UHCA 1N5RA 1EK2A 3H2GA 4Z49A 3KWJA 1XRQA 5JAUA 2OAGA 2DHCA 1QGED 5FKJA 3ZPXA 1ZJ4A 4B0PA 3WYDA 1CUBA 5T4HA 4ARBA 5AKZA 1XRRA 1ZD3A 1ODSA 2WUFA 3SK0A 1MTZA 2QOEA 1GKLA 4J0HA 4A23A 1AQLA 4X92A 3HZOA 2WIKA 2OGZA 3K2IA 5BV7A 4G8BA 4E14A 4X95A 4B81A 2OG1A 5H3HA 4INZA 2XUHA 1MX5A 4W1PA 2HDWA 3WI7A 1U4NA 4FTWA 3O9MA 2DHDA 2VAXA 1JFRA 3H04A 3QZUA 4OYYA 3W04A 3G0CA 5HKBA 3G0DA 2YH2A 2Z5GA 4FFVA 4AQDA 5AM4A 1BN7A 1DX6A 1UKCA 1CV2A 4KAFA 4KR0A 2HA6A 4AXBA 3LS2A 1CR6A 4BE4A 4J7AA 2PM8A 4Q3LA 1TAHA 1TKRA 1L7RA 2DHEA 2AJCA 5KWIA 1UK9A 3UMJA 3BWXA 1SCQA 1CEXA 1GZ7A 4MQLA 1H2WA 1VZ2A 3D4LA 3KOOA 1P0IA 2B9VA 1U2EA 1H23A 2XUDA 4G1FA 5AIAA 2WSLA 3KDAA 3VVLA 1W52X 2XB6A 1XZBA 2QXUA 5ALQA 3W9UA 4AB1A 3ICVA 1H2ZA 1TRHA 3C45A 1Y7HA 3DYIA 3C70A 1OCEA 5A7FA 1ZGCA 3D2BA 4MJ3A 4Y9SA 3P2MA 2PVSA 1UK8A 5KBYA 1HBJA 4OPMA 1TCCA 2J4FA 4X97A 4NS4A 4XVCA 2C0PA 3WWCA 1XROA 4HXGA 3O4IA 2ECFA 1EDDA 1YA8A 2X5XA 3L1JA 3Q0TA 1BROA 3HACA 4U2CA 1XLUA 2WIDA 1EVQA 3WK8A 5IVIA 4RE6A 1GKKA 2GBIA 3BL8A 3WZMA 3PDCA 1QTIA 2J3DA 3O4JA 1CUWA 1JMKC 1DX4A 3K9BA 3WK9A 1USWA 3H2KA 1GQRA 3QITA 4FLFA 1SFRA 4Y2SA 1CUFA 5CBKA 1M33A 4W1RA 4Y2XA 1CUEA 2FX5A 4Y2RA 3RARA 3AJAA 4FNMA 4L0CA 2O7RA 3KXPA 5EIAA 4K6HA 1N1MA 3MUNA 1MAHA 2JBWA 4KYVA 1QIGA 1ACJA 2YYSA 1QLWA 3ESAA 4PSDA 4A5SA 1ORVA 3DYVA 2FUKA 3F97A 1NU8A 3FSGD 1LBTA 2HM7A 1CFJA 3WJ1A 3QM1A 5ALEA 4B0OA 3DL7A 4H7EA 3I2JA 2RGUA 1EVEA 3QPCA 1YR2A 1GPLA 5HFNA 2WLSA 1LNSA 3C5WP 2NW6A 4ZXFA 1XRPA 2ZJ6A 3IULA 4HVTA 2XQJA 2Z3WA 3I1IA 5EGNA 3W2TA 2VJBA 2XUOA 1EDBA 5JZBA 4BAGA 5DTJA 1AX9A 4EY5A 4KE6A 5JARA 4H0CA 3M81A 2VQ6A 1C4XA 4QDTA 3R0VA 2QJRA 3WKCA 1P0QA 2RI6A 4H7JA 1YAJA 2HA3A 4KJXA 5HKAA 4RPCA 2WIFA 2OGTA 3AINA 3DEAA 4MEBA 2ZYRA 1MX1A 2DFPA 1QIFA 3I6MA 1SCKA 1MU0A 3NWOA 2DR0A 3IUJA 2H7CA 2E3JA 1CUIA 3PFBA 3STVA 2HADA 2Z3ZA 4UHHA 3SX4A 4FMPA 2VJCA 2EDCA 1CUUA 5ALIA 3EIOA 3EBLA 3S2ZA 4MXDA 3DOHA 5I9IA 2VF2A 3WL5A 4WFKA 1DQZA 4CIBA 1FSSA 3BJMA 4C4ZA 1BS9A 1XZCA 5DYWA 4GHWA 3K6KA 4WY5A 1CUAA 4B9EA 3BF8A 3D5EA 1ZIXA 3WKBA 1W6RA 3GFFA 1CRLA 1G66A 2XUQA 3OPMA 2CMFA 2D0DA 1EINA 1A8QA 1VKHA 1L7AA 2HA5A 3PFCA 4F21A 5LIPA 2BCEA 2WG0A 1E5TA 1R88A 5HF5A 4E46A 4UHDA 2VEOA 2HRQA 3NOXA 3IUQA 2ZSHA 1CUHA 4ITVA 3DD5A 1QONA 4OB6A 5BWBA 2XQIA 3TRDA 1DT3A 1AGYA 5ALSA 4BB0A 3ESDA 2OCKA 2DSNA 4CFSA 1CIJA 1MX9A 4IO0A 5AJHA 5AKEA 4Y7DA 4C6HA 2G5TA 3ANSA 1JU4A 3VKFA 5LKAA 2CB9A 3AZPA 3H1BA 3IURA 1BEZA 1X2EA 1XZHA 4H77A 2BKLA 4JUIA 1CUZA 2PU5A 3M83A 1AMNA 3C6YA 2XI4A 3MGAA 3R3XA 5A2GA 3FSGA 2WTMA 5JD5A 4UBKA 1SC9A 3PF8A 1MNAA 3STTA 1E8MA 2PSEA 5A71A 2HU5A 5LZ2A 2WIGA 4UUQA 1QO9A 4WJLA 2XMCA 7YASA 2DQZA 5LP1A 1BE0A 4AO6A 3G9ZA 3N2ZB 3HC7A 1FFBA 1KU6A 2WFLA 3IIIA 4DGQA 1WB5A 4OD0A 2QZPA 3KSRA 1KEZA 3AUKA 3E4DA 4IH4A 4DNFA 2FJ0A 1S8OA 5LZ4A 3FVRA 1N8SA 1J2EA 3QPDA 4KE9A 3HSSA 4CG3A 4WFIA 4BAZA 1ETHA 1IMJA 2JGEA 4YASA 5C8ZA 1WHTA 3WL7A 1DT5A 4OU4A 3DOIA 5CXUA 4U2BA 5A6VA 1QJ4A 3STYA 5DWDA 4C01A 1K4YA 5ALJA 2OQIA 5CH5A 5E4TA 2V96A 4X85A 2V97A 3HXKA 2H7XA 3ICWA 1SCIA 3TJMA 5CT4A 4HAIA 1DWOA 2C4HA 4UBNA 5LZ9A 1LGYA 4U2DA 4KACA 1O6FA 3B12A 4FNGA 1T2NA 4UFNA 5FPQA 2WKWA 2OLEA 1IZ7A 1XLWA 1GXSA 2GYVA 2WIJA 2QUBA 3AIOA 3ANTA 4PV7A 1IVYA 4UBJA 4WDQA 4Q82A 3OC0A 3BDIA 4CG2A 2HIHA 2B20A 5JD6A 4P92A 4BVJA 1ZI8A 1VXOA 4OUKX 3JW8A 5DLPA 1UXOA 1G42A 1IUOA 4G5XA 3WKAA 4EY8A 3MUOA 2ZSIA 1A7UA 1WB4A 4P08A 3FYTA 4UHBA 5E2IA 3C5VA 4FLEA 1K63A 3GA7A 3Q8WA 4BCDA 5AKHA 1Q84A 1D07A 5BWCA 1T4MA 3FCXA 4KE7A 5FOQA 1CPYA 1AZWA 3FLAA 3DNMA 4YK7A 3ESCA 4QE3A 4G4GA 4WY8A 2PKYX 5KREA 2BJHA 4UBIA 5ALOA 4EZIA 1AKNA 4B9AA 1XZMA 1XZEA 2EEPA 5CMLA 5AK5A 3VISA 4BP9A 4U2EA 1BCRA 2VSQA 4PSUA 3ZV7A 1VA5A 5ALMA 4DMCA 2HA7A 3FAKA 1LPSA 3QYJA 1XZFA 2GZRA 4M0EA 1GPNA 3U0VA 5AI4A 3WKDA 5IKXA 4B84A 5AHXA 5EHQA 1TIBA 5T4BA 2CJPA 3G9UA 1A8UA 3G7NA 4BP8A 1QIIA 3W06A 3LIIA 5HF9A 3O4GA 1E66A 1UK6A 4H7DA 2OAEA 1UOOA 5ALLA 3I2KA 2CEKA 4N8EA 1A8SA 3ILSA 1CUDA 2Y6UA 5CH8A 1MJ5A 2AJDA 2OGSA 2XUJA 5JYCA 1MO2A 1WB6A 1XZKA 3IA2A 5DYTA 3HRHA 1XZJA 4LHEA 3FLEA 3R3UA 5AKXA 4B85A 2C7BA 5JIBA 1KU0A 1NU6A 4OB7A 2ZYSA 4QZVA 4J0JA 4UFPA 1I6WA 3BXPA 1YS1X 3DKRA 3A2LA 4DMFA 4JNCA 1MPXA 1THTA 1XFDA 1XLVA 2XQGA 4CG1A 4X71A 1THGA 2I3ZA 5AKYA 5AP9A 1UKAA 5K3FB 2WTNA 4GEGA 4N8SA 2WFZA 1U65A 5D3KA 3G02A 2XMDA 1CUVA 4KE8A 4X7BA 5DNVA 1UKBA 5AM5A 2Y1KA 4E11A 4G9EA 4M0MA 1E3QA 3I28A 4ZGBA 5HF6A 2OXEA 2XMRA 3O0DA 2ACKA 5F4ZA 4GBGA 3FYUC 3CCBA 1YSCA 3WA6A 4OCZA 3HEAA 1TCBA 3ESBA 5AI9A 2XUAA 1E89A 5SYNA 1WPRA 2OQVA 1ZICA 3WWEA 5AO9A 4BZWA 2XMGA 2PX6A 3IUNA 3VVMA 2CKMA 4UHEA 3STXA 2WILA 3I2HA 2J3QA 3DDUA 4QWWA 5I8PA 1R1DA 2YASA 3WL6A 1XRNA 2OCIA 4TGLA 1N5MA 5K3FA 4IH9A 5LZ8A 1ZD5A 5JADA 1JJFA 1PJAA 1HKHA 2FJPA 4NMWA 3H18A 1UOQA 5SYMA 4QDZA 1CUYA 4DMHA 1GPKA 4X91A 2ZYIA 3FBWA 2HFJA 1RWQA 1QOZA 3D0KA 3C8HA 1WHSA 2J4CA 3BJRA 4J0CA 3OURA 3RK4A 3V1LA 4X6XA 1OILA 4S0XA 2VJAA 3PUHA 1QIMA 5ALZA 5CT9A 1DU4A 2Z8XA 5ALGA 3LIPA 4P93A 3ZLUA 1LZKA 2RAUA 1EB9A 4AMZA 4BDTA 2RIPA 1VXRA 3EQ8A 2P8SA 5LZ5A 2WU4A 1WPXA 2VAVA 3L1HA 1FFCA 4Q34A 4N5IX 5AOCA 2Z8ZA 1DINA 4W63A 1WM1A 1P0PA 1U8EA 5J3JA 2BAGA 2XUPA 5IH7A 2JGIA 3GBSA 1JKMA 1LPNA 2BUBA 2GYUA 2XUFA 2V98A 4D9JA 1R9NA 5CURA 3H2JA 2GBCA 1CLEA 3R3YA 3TGLA 4XWGA 4BRSA 2AJBA 2W6CX 1G4HA 4FBMA 3D3NA 1B6GA 4QDOA 1WCYA 1BRTA 2C58A 3HABA 2XMBA 2Q0XA 3GZJA 3DL4A 2JGLA 5ALHA 2JGMA 4Y2TA 3A2NA 4Y2UA 1YB7A 1R9MA 1Q83A 1UZAA 4DNOA 4G4JA 3F96A 3WK6A 2QR5A 3H17A 4EA6A 2WHQA 2O2IA 4U2FA 3WL8A 5AM1A 3B3QA 4HTAA 4EY6A 4EBBA 4W1SA 5T4EA 3BIXA 2ZYHA 4OYLA 4PF1A 1R4ZA 2AJLI 2G4LA 2WU3A 1CUGA 4J3JA 1GQSA 1FJ2A 2PUHA 3PE6A 4J0IA 3CN7A 3HLKA 2GZSA 2PUJA 1CUCA 3IBTA 1J1IA 5AOAA 1QIKA 2VJDA 5FRDA 3F67A 2Y6VA 5E4JA 1LPMA 4FOLA 6YASA 2H9YA 2OPHA 4QLOA 3F9CA 1XRLA 3WQHA 3V48A 1HL7A 4AO8A 4CI9A 1L7QA 2OCLA 2ZVDA 2GBGA 2IITA 4EUSA 2WM2A 4QWMA 2B61A 4L9AA 2WFLB 5C8XA 5AK6A 1VE7A 1XKLA 1NX9A 3WWPA 4BYMA 5ESRA 5HK8A 4N5HX 5ALUA 1RYYA 4C89A 4C88A 3IB3A 1E8NA 2QXTA 2PPLA 1EXWA 4Y2YA 5LZ7A 1XQYA 1BN6A 1VE6A 2XMQA 1TK3A 5LYYA 3G9TA 2HRRA 3E3AA 3GELA 3R3ZA 4LKOA 3GUUA 4PO3X 3C87A 4OU5A 5EHNA 5HCUA 3W05A 3HYSA 4OSEA 4B82A 1RP1A 3R40A 3N0TA 1MAAA 2HFKA 2EDAA 2G5PA 4EY4A 5EI5A 4G8CA 1YASA 3DS8A 3A6ZA 1H22A 2HU7A 4G4IA 3RM3A 1K8QA 2O2GA 4AN0A 4TPKA 3H1AA 4B7ZA 1QFMA 4M0FA 1W4LA 3KWFA 5AM3A 5ALNA 2JF0A 4Q3OA 1YA4A 1K5PA 4PQEA 4DTCA 4A16A 1MT3A 1HLGA 4Y2QA 4MQMA 1QE3A 1XRMA 1XZGA 1CUXA 3JYHA 5LLSA 4C4YA 2BUAA 3H2HA 1ZI9A 3X3HA 5CT6A 3D59A 4GWLA 2DQYA 1LPBB 2BGNA 4MYDA 3IUMA 1QIHA 2WG1A 4AZ3A 4AN1A 1LPAB 3FOBA 5EHZA 5CT8A 3D7RA 4FWBA 2I78A 1UOPA 5YASA 2ROQA 1EI9A 5IVHA 4I3FA 5AIBA 1OXMA 5C81A 5K3EA 3LLCA 3PUIA 2VTVA 1ZD2P 5FLKA 2ACEA 5DTIA 1XZDA 2HHAA 4UBOA 3RKSA 2HL6A 2VATA 4NZZA 2WQZA 1EX9A 5FUMA 3VJMA 4Q05A 4FLMA 1E8DA 2ES4A 5AKGA 3STWA 3G8YA 4KAJA 4ZWNA 5AICA 1ISPA 4RGYA 1ODTC 4QLAA 2JEYA 2WUEA 2WJ6A 5AI6A 3FCYA 3QMVA 3V1MA 2XUKA 2WHPA 1JMYA 3D2CA 5AM2A 4PSCA 3C6BA 3WK7A 4LXGA 4BCBA 5ALFA 1IUNA 3WWDA 5JD4A 4HZGA 5JZ9A 3WZLA 5K3DA 5AM0A 3EQ9A 5AKIA 5K3AA 3DKKA 4MWSA 5AOBA 2H1IA 4ZRDA 2X76A 5I7UA 3RLIA 1SOMA 5A7HA 4GW3A 4B6GA 2QM0A 3ZLTA 4I19A 2QUAA 1VA4A 2I03A 1LPOA 2XQFA 2PL5A 3TEJA 4DSZA 2XT0A 5JAHA 4X00A 1TCAA 4QDUA 1P0MA 3AIKA 5ALRA 4DM7A 3O95A 2H7YA 4YPVA 2R8BA 3WKEA 4AZ0A 2HU8A 4DLNA 1H2XA 3AZOA 2C5FA 5AI0A 4I4CA 5CH3A 3D2AA 1QIEA 3FYUB 4BTLA 1PFQA 5D6OA 4BC1A 1GT6A 2QTBA 3BDVA 5JAOA 3C43A 3WIBA 2VA9A 2G63A 3OOSA 4GI1A 1DQYA 2QS9A 1VJ5A 5AI5A 5AH0A 2WUGA 4WDRA 3V1NA 4GDMA 4EHBA 3QVMA 1ZD4A 3ZI7A 3LCRA 3T4UA 4BAUA 2PBLA 4LXHA 4EB0A 2ONCA 3IDAA 3WK5A 1JT2A 2CBGA 4RNCA 2BUCA 2BGRA 1EK1A 1G5FA 5EHXA 3KD2A 1UT6A 1AURA 2VT7A 2W22A 1QZ3A 2B4KA 4GLBA 3AZQA 3T52A 4GECA 5IVKA 5CRIA 1JJIA 4HRXA 4WFJA 4KAAA 3FVTA 3WMRA 4KRYA 4J0KA 2JGJA 3FYUA 4ZI5A 1Z68A 1VZ3A 5ALXA 1ORWA 2JIDA 1ODCA 4BCCA 4K2AA 5ALTA 5BOVA 5JZSA 1UK7A 1YB6A 3LP5A 4BDSA 1TQHA 4FBLA 4DSAA 4ROTA 2JGKA 4FDMA 4B83A 1MN6A 4J03A 2V9ZA 3HJUA 4F60A 3B5EA 4Y2JA 1CUSA 5DNUA 3R41A 1GGVA 1C7JA 4BTVA 4BC0A 4U2GA 3R3VA 4QEKA 3EF3A 3NUZA 4BE9A 1W75A 4E15A 1CQZA 5D3ZA 2RHWA 4MWTA 3CN9A 4BZZA 3ED1A 5DJ5A 4IH1A 1FFDA 3WYNA 4AMYA 4CCYB 4HXEB 2HA0A 4QA9A 3WK4A 4XX1A 3ZWQA 3O9VA 1Y7IA 2XUGA 5A7GA 4K5QA 3WA7A 2QJWA 4W9RA 4K6KA 5EIEA 4JYPA 1LBSA 4IQ4A 2PU7A 5ALKA 4QDXA 3S8YA 1X2BA 3IVMA 2LIPA 3VDXA 2R11A 1JJBA 2RHTA 3A70A 2WJ4A 4X94A 4UHFA 3DQZA 2D5LA 3DJYA 1IUPA 4F5ZA 4NVRA 3VJLA 1O6GA 2XLBA 3V9AA 3M82A 2Y2VA 4W1QA 1QO7A 5ISMA 4EY7A 4LXIA 5E4YA 3PI6A 5KWJA 3BIWA 2XMZA 1BCSA 5JASA 3E1GA 2QKYA 3VXKA 4CCYA 5JATA 1ZI6A 3PF9A 2CZQA 4ZREA 4ZV7A 5AK4A 1ZJ5A 1CQWA 2PSJA 2JEZA 3SC2A 3AILA 3U1TA 4BVKA 4JYMA 4G9GA 1EH5A 1CVLA 2JGFA 3H19A 4F0JA 5AKLA 2YXPX 5K3BA 1YS2X 2CUTA 3OG9A 1K6EA 2PSDA 4Y2VA 1ZIYA 1QIDA 1UFOA 5C8VA 4HXFB 4L72A 3UUFA 5LKRA 2PSHA 3I2GA 5HQ3B 4H35A 3G0GA 5JAPA 1Y37A 5IVDA 1XQWA 2XDWA 1PV1A 2PSFA 3BF7A 2I3DA 4J0GA 1HDEA 3FLBA 4G8DA 1LPPA 2IIVA 4FKBA 1ACLA 2HA4A 4YX9A 1EB8A 3STUA 5JANA 4V2IA 1UWCA 1FFEA 1R50A 3G0BA 1ZOIA 2HA2A 5HK9A 1F8UA 3PICA 4ZV9A 4KEAA 2XQKA 4QNNA 4FHZA 2O2HA 3HI4A 4C87A 3DCNA 4OB8A 1DTEA 3L1IA 1VLQA 1Q0RA 3VJKA 3OM8A 4CIAA 2AXEA 3C8DA 5DYYA 4FFWA 2O7VA 4BVLA 4B80A 4LYEA 1EDEA
chains in the Genus database with same CATH superfamily
3HDTA 3PUVA 4JUFA 4KP7A 3TM5A 4A73A 2HLNA 2W9XA 3GN1A 4RTNA 3M4NA 4JITA 4EY3A 2V7QD 1XA0A 3ACCA 2GZMA 2QNIA 2WG2A 3RWOA 3D4IA 1PL7A 2E4XA 2IX9A 4HPWA 4TTSA 3VC1A 1CEQA 4C4AA 1L6RA 4JLJA 4OAQA 4JWTA 2DYKA 1AHNA 1FDTA 1I0ZA 4RK1A 3KPWA 4PPFA 5G53C 3W78A 3LTNC 3UW1A 3HA3A 1IY1A 1NZDA 5LDHA 3NEJA 5HNKA 1PT7A 4R5HA 3ETCA 1OE0A 5E95A 2BBWA 2O8NA 4EIWA 3EIUA 1N2JA 1G3MA 4I8IA 3RS2A 5L4LA 4I5FA 4J1TC 2RARA 3DKIA 4KH1A 4L7VA 4N54A 2VDKB 1OPRA 4RPGA 4DR7B 2Q3FA 1LLFA 4KDRA 5CHYA 3JZIA 4UASA 4E5MA 2I67A 1G3IA 1GU0A 1T91A 3CVWA 3DV2A 3IIMA 1UDXA 2SECE 4JIMA 3TB6A 5JAMA 4CEJB 5A03A 4JI3B 4B6RA 3L40A 3PB3A 2DPYA 4J7CA 1BHO1 1H6CA 1M2WA 2FPPA 2P9HA 3CZ4A 3PEWA 3KAQA 1B6SA 2G1JA 1Y4SA 2R2AA 1CY4A 3MF4A 3OTQA 4LC0A 4Q4JA 4BLUA 5FUBA 3L79A 5L3ZA 5CCXA 4D4MA 3IJPA 4HATA 2OV4A 1R8SA 5DNWA 4CM7A 3E0XA 4DNPA 3U44B 2W2XA 4LS3A 4WZZA 3ZLJA 5CW2A 1HZJA 1Y1RA 3DB1A 1P4SA 1IZ8A 2OAP1 1Y82A 3D5TA 1C50A 1F0PA 1WO8A 1VBNA 5IARA 2CBXA 3RASA 4UM8B 1K8YB 4OLBA 3KEGA 5LA6F 1IXRC 2MINB 2YV5A 3GLHB 3QPUA 2XUZA 3O47A 1MDBA 3Q85A 4G5SA 5EEGA 4DPKA 3WY9A 1XTSA 3EPJA 1LNZA 3GL9A 2ISSD 2F1IA 2G70A 2JLBA 1DPGA 3EVFA 3A1TA 3LT5A 3OE7D 3ZYZA 4KAXA 1WDMA 5ALDA 4DIUA 1PL6A 3HZZA 4OGFA 2IUEA 3GWGA 3K05A 2HWWA 4Y8VA 2QR2A 2ZRNA 1YDGA 1KZYC 2H4FA 3CRNA 4HNQA 3OLXA 1PU2A 4P9NA 4XB6B 1E2LA 1VOTA 4ND7A 2BSAA 1HC7A 4RE5A 5CXXA 4UZEA 2GXAA 2Y1DA 2Q2VA 3QHPA 2PSSA 1GN9A 2YN0A 4RSGA 1M6EX 2QUIA 4BX2A 1OFTA 1YR7A 3WGVA 5DX8A 1R3DA 3A6GA 3EVEA 3NHYA 3UWMA 2EG5A 2OCBA 3EGWA 4EQZA 1QE0A 3G5LA 1QOQB 4X45A 3X0DA 3K5IA 1S1CA 1SUFA 1K5GA 2NTEA 3BXEA 3G68A 4KGXA 4RV5A 4EEZA 1WW3A 2C7VA 3VMFA 4ETWA 2VTBB 4EMUA 5KMGB 3N2LA 1G19A 2OBMA 4LJKA 4B2LA 4PNHA 4W7SA 5EPOA 1E9DA 5TPWB 1KOJA 2HMTA 1UDWA 2AN5A 3MWEB 5EJIA 1IM5A 1Z56C 1ZESA 3D6HA 2AOTB 3GCGA 3WIDA 5L51A 2WF8A 3AETB 3B5JA 3NX4A 2CVZA 3IMEA 2MSNA 2Q3CA 4HQLA 1FQJA 4FFLA 1POWA 5HZGA 5CJJA 3A1EA 2OCGA 3DDSA 4DUGD 3FWZA 2Y05A 5DGTA 5B4VA 5HIKA 3HL4A 3I61A 3D3QA 4FE4A 3TTSA 4JXKA 4BNZA 3SYKA 1Y6RA 4HL6A 1I5OA 1R4AA 1XYVA 4NAVA 4X3CA 4EW2A 5WRFA 1NJ1A 4HRYA 2GN9A 3SN6A 2O4UX 2J3EA 3U44A 4XJVA 1QKKA 1RXEA 3EGIA 3DAGA 1CUJA 2JARA 4DKJA 1TAUA 4FR2A 2IWRA 3PCTA 4DARA 1DRVA 3IJ5A 3N70A 3A11A 3ZJ4A 5E7JA 4AT1A 1QX3A 1FXUA 1ZQ1A 1AB5A 4IGFA 2OM6A 2MINA 1BYUA 3GLHA 3IRVA 3ND9A 3GEMA 4TVOA 2II6A 2MDTA 1V6AA 3E7DA 4C4RA 1P7YA 2NADA 2QTGA 4D9BA 5G1PA 1PRYA 3OF2A 3ZIAD 2R8ZA 4LDNA 4LY9A 1ZH0A 4LK2A 3V7WA 3W9BA 4E3ZA 3H97A 2ZI9A 4C4XA 4XXHA 1ZGBA 2QYSA 5LUBA 2X58A 1YQTA 4Q47A 1S2MA 1G8JA 4Q4AB 1W88A 2E49A 2POCA 2VFAA 4RJLA 2QVBA 3PUWA 1TDJA 3T5CA 4B3CA 1ADFA 4R8SA 5DPMA 1T1SA 4EHKA 4MAMA 4AMVA 1K27A 4XZ3A 3CW9A 2LGJA 5A0FA 4KVFA 2NUPB 2FWAA 2Y0EA 4UE6A 4E5DA 2QRQA 2VTBA 4MI1A 4FI3F 4D4IA 2HK9A 2J0QA 5TPWA 4BKMA 4WZAB 2C5GA 1Z0SA 4Y9TA 1J8QA 3WRXA 5GADl 1A88A 1CS4C 1YDHA 4PNZA 1X1TA 4ARCA 3LFTA 4NBWA 1JEQB 4IG4A 4BOYA 1B0ZA 2E82A 2AOTA 1KAHA 3AETA 4UFOA 2SKCA 2XRZA 2PJRA 3ESRA 3BWBA 2ZRAA 4Q4AA 5EXEA 5K8VA 1QAOA 2BDUA 2YJ4A 1XMQB 1EUCB 1H2HA 3GRZA 2QTFA 1DI0A 2DPLA 3PGVA 5BSMA 4D9NA 2IW1A 2GYWA 1UFRA 3WLHA 4CJXA 1TUIA 2IP2A 4UNQA 2WJVA 2B36A 4X20A 2CN1A 5FO0A 1LI7A 4FMCF 2O1SA 2C2XA 1Y1PA 4UU7A 3D8RA 2V7QA 3DZ8A 4HB2A 4TZTA 4XJTA 5CFMA 4FD3A 3WGTA 4ENPA 2QL5A 3H0EA 1ATIA 1NBIA 1F1BA 1TE2A 2P9JA 3PXDA 2IHVA 4M6WB 4XA8A 4ER0A 5IJZA 1DJLA 4EA9A 3V2HA 3H8SA 1SBQA 1DSSG 1T5DX 4QFDA 1HQCA 3O5AA 4FVTA 4X1IA 5BORA 5GTDA 2QT9A 4EJ6A 1WAMA 4AF6A 4LG1A 4I2NA 4NCBA 3BCUA 1R0ZA 3M4JA 4N0DA 4RVOA 3VPSA 4XTRA 2Q4DA 1VIAA 4HAXA 4KRXA 3EFEA 1U0BB 9GPBA 3A2MA 1X19A 4Q1VA 1PD0A 1RHQA 2FUCA 1UC8A 1WZCA 2O2DA 3CSDA 4PYNA 2PZ8A 2V4ZA 2QM8A 2Y4OA 1N0UA 2GO7A 4NOLA 3BAZA 4B5KA 4I50A 4G65A 5HJ5A 4Z8YA 5B7QA 1M8KA 1HUQA 2VHJA 4YAFA 4DYHA 2P3LA 2XUIA 2FSGA 1JQBA 2NUPA 4OQEA 1W1IA 3IELA 1LZLA 4A10A 2AJ8A 2HEIA 1WVMA 1DTWB 3I5MA 4HUQB 2H2IA 5HF8A 5JROA 2RONA 1WRBA 1YI8A 2A3RA 4B40A 2YL2A 3T3NA 2FSVA 3C3MA 3PC8A 1GUBA 2OC4A 3ABQB 4FPXA 4S2UA 5L3QB 3AR2A 3V5NA 4PN7A 1RJFA 4E70A 1Z3CA 1JEQA 1ZMOA 2UVQA 3K92A 4EYGA 5I5EA 4RZXA 4N8DA 1CXZA 2FCAA 4S12A 1U0OC 1SB9A 4TVKA 4ZCPA 4B3SB 1XNJA 3ACBA 4LJAA 4BMXA 2QDKA 4MGKR 4AIRA 3GH3A 5GZ3A 4HCJA 3NP7A 3H2GA 3SKYA 3EDRA 5HKLA 3CEMA 1GRVA 3UJ7A 3R4CA 4DC0A 1YZTA 2FSUA 1WPGA 4MPJA 5IT9A 4CT0A 1E2FA 3V8RA 3OE7A 4G5YA 3PLAE 1BXZA 4YJHB 1ZM4A 1I33A 3SBXA 5JYBA 5JTUA 1EKXA 1V6CA 3I32A 4TMKA 4JQZA 5FFFA 3SE0A 3T9FA 4C0BA 3AVXA 4ARVA 1M2FA 1W0CA 3AHHA 3U40A 4B0PA 4HT3B 2IZ6A 1OLSB 3C41J 5BMOA 4AKIA 2CMGA 1EMDA 4M6WA 4ZAFA 1S8AA 5FQNA 3AUSA 4NG4A 3U80A 4DZZA 1XRRA 4H3SA 1ZD3A 3ORFA 3RK0A 2MSEB 3S2GA 2WUFA 3FDFA 3DLCA 1YU9A 4PGMA 1J0AA 4XFDA 3C39A 4HB4A 1KVTA 2CXHA 1AS0A 4J0HA 4KQKA 2PLRA 5D00A 4CMGA 2ATIA 4IMRA 3H4VA 4X92A 2GRUA 3HZOA 2A59A 2VZEA 4DFDA 5BV7A 5LP6F 2JK1A 2X3YA 3PVSA 2C2ZA 2W0MA 3HV0A 1MJNA 4E14A 3Q11A 4WCDA 4QJIA 3R9IA 1GZUA 3IPRA 1SUCA 3P97A 3F1KA 4BPRA 5D7NA 1U5BB 1JIUA 4IYJA 5J58A 1JQDA 1DTWA 4DUGA 1DLIA 4MCAA 1V11A 1R5OA 1WY5A 2A7XA 2UYOA 3OKAA 3NJ8A 1RBZA 4QXRA 1INLA 1PG2A 1XQ9A 2OZKA 4QC2A 1KY2A 2FMFA 4ASUD 1YF3A 2ZWMA 3ZH2A 1U4NA 5HM6A 5BSFA 1OTXA 3ETGA 3PXAA 3WXMA 3O9MA 3PPYA 1NXPA 3NIDB 1Z29A 1QDUA 3DZBA 1SHKA 4BB6A 4Y9UA 1M34B 3RG2A 3VV3A 2CYCA 5C1OA 3EGEA 1V47A 4OYYA 3VYWA 3VYTB 5GJBA 3FCUB 1SXJE 4WJKB 1IBCA 3FSRA 3MRVA 4JVSB 4OIMA 4F5EA 4BPBA 4D6YA 2WA2A 3Q3JB 4DQ0A 5FO1A 5K0LA 4KNWA 4YJHA 3ZIAA 3RAFC 2ZRPA 4JLNA 3LKBA 3TNFA 3WFIA 2NQTA 1RI2A 1DX6A 2EBUA 1H8HD 2TYSB 3ESXA 3JQ8B 3VU1A 4YJKA 4A91A 4RZIA 4KR0A 1HRDA 2HA6A 5BQ5A 3SBOA 1QH8A 3LS2A 1OLSA 2HIGA 2PUEA 3DUFA 5KVAA 5CB8A 1F2VA 2JGNA 2PM8A 1TNDA 4Q3LA 1V16A 1M6YA 5AVXA 1GUZA 4ENUA 4FIDA 3FZQA 1TAHA 3DAYA 1VG0B 1P1IA 2PTHA 3ZY6A 1VE9A 1MRZA 2JI6A 2AJCA 4ND8B 4MA0A 4WASA 5ECWA 1JALA 5E9WA 3N86A 6NULA 1V1RA 3UMJA 4B8ZA 4Y6GB 4A6XA 3MAJA 2IV7A 5FWXB 3RDPA 4OF4A 3Q15C 1H2WA 3SBEA 3PRKE 4DLKA 4MWGA 4E5NA 3ZDBA 5TMPA 2VDVE 1GTSA 1VZ2A 4KR2A 5JBNA 1P0IA 2FW9A 2W4QA 4KO2S 3V4LA 1MIHA 1EDOA 3LUCA 3EWIA 4DUYB 1FDOA 3K9LA 4RXMA 1QM5A 3DP9A 3TQFA 521PA 2AHRA 2R8OA 1E2JA 3G23A 3NXKA 3D8SA 4I0WB 1TTHA 5CVDA 5HA5A 1PR2A 1W94A 1KMHA 1P4RA 1U5BA 3QLTA 1FVHA 4HRVA 4P0TA 1RJWA 2XB6A 4BQRA 4I99A 3A4TA 4DDMA 1C14A 1XZBA 2EERA 3F3MA 1XT6A 3BERA 2JHCA 3SR4A 4IFIA 2GM3A 1IPEA 2H1LA 3IAAA 5AW8A 4PZLA 5CYFA 4L0QA 2GS9A 3RBXA 3LDGA 5L53A 5LWHA 2FB9A 4CV1A 1GZSA 1Z35A 1U0SY 4LVCA 2FWRA 3RUHA 3V4OA 1NYTA 1AKQA 2AZDA 1TRHA 5FL3A 5JSYA 1M34A 3C45A 1T13A 1BD3A 3MJSA 3V7NA 3J7AC 2OPBA 1BDJA 1RQNA 3OUUA 4JBNA 1AT1A 5D87A 4M89A 4AUEA 5D8DA 1KA9H 3KG2A 1I1NA 2ECPA 3P2MA 4NDAA 4Y9SA 4EJMA 3DHYA 2ZROA 2PX2A 2QA5A 4K9KA 3AVQA 1RR6A 4F4JA 2VJLA 2C3YA 2EOAA 3IAUA 3GOQA 2HHJA 2W6NA 2C1EA 5CM2Z 4BO9A 4PVDA 2M6LA 5KBYA 3OT5A 4LJ6A 4OPMA 2WE8A 2DAPA 1WUJS 2H2GA 3DBHB 3N58A 2BZGA 3LX4A 4PYKA 4X97A 3NWEA 4XQ0A 5EUQB 3D4OA 2NTVA 4YPFA 1A72A 2HTEA 3WNZA 1WBJB 4EF4A 4B46A 4EGCB 1E4VA 2XF8A 3EG5A 2IZZA 3AKZA 1Q0TA 2PGNA 3F74A 3GCZA 4IS3A 4ND8A 5FI1B 3P96A 1YKFA 1K6MA 2Z6UA 2XXAB 3PQDA 3BKXA 1EDDA 1HE2A 1Q2UA 4GWKA 5FWXA 3ZX5A 2P2SA 3NJ4A 4RLQA 1KL7A 4E4TA 4OHXA 2NU6A 2IEGA 1P18A 3L1JA 4H0NA 4RUKA 1P3DA 2ZETA 3Q0TA 1BROA 3IIKA 3HACA 3RTDA 1DAGA 2DKOA 2DR3A 4U2CA 2AIRA 3EIEA 4N0MA 2AKEA 1H8ED 4S1NA 4BEWA 1TYCA 1GKKA 3BL8A 1PQYA 2WABA 1LEHA 1CLUA 3AU9A 3JSAA 4JD5A 4ZAWA 3WZMA 4Q4DA 2WBLC 3GGOA 1QTIA 2CVQA 2FA9A 4AM8A 1NJ6A 3QVWA 4L3VA 1UFKA 1DIBA 3T4XA 4BQFA 1UMKA 4DR5B 4TLAA 3Q12A 3HE3A 1IMOA 3I6IA 4KDCA 4ZDWA 1Q77A 1JMKC 3CH4B 2JFOA 1USWA 4MUIA 1M10A 1NM5C 4M8KA 2GLTA 1DIAA 4RD0A 4Y2SA 3LW7A 4HGYA 1DV2A 1IG0A 5KNBD 4QO8A 5B30A 5EIFA 1H42A 4BTEA 4YMHA 4ZT2A 4CM5A 1KXJA 4LRXA 1KWGA 3CLTC 3GN2A 2SBTA 4I9UA 2NVOA 4WXRA 3TAUA 3L0IB 1VLHA 3T9EA 3ZJ5A 1CUEA 1HDYA 1L4MA 1WXIA 2APJA 3EVBA 3LHDA 3A8TA 2W2LD 3HB7A 4YR7A 5HCNA 1FTYA 3DBHA 4BWVA 4IY1A 4ETIA 5CFZA 1SXHA 4C78A 1VMAA 2XGJA 2YYYA 3BA6A 3N8IA 4FNMA 1NOJA 4L0CA 4QRIA 5DHSA 5DMHA 3ZWOA 4ESVA 5EIAA 3N7AA 4K6HA 2BBOA 3C85A 5CG1A 3BE6A 3HHEA 2DFNA 3I34X 3LSTA 3IYLW 5F5LA 1D2NA 4XRRA 4GGPA 3B1XA 5HW0A 5CR9A 4K0RA 4H9GA 1MAHA 2PKQP 4TV9F 3MT8A 3SXJA 4R1SA 1MGPA 4HQRA 1G5HA 5F1OA 3BTSA 3CLKA 3GJ4A 3IAS6 4NBTA 3RODA 3GLGE 3HCBA 5TRTA 1ZJJA 4G56A 4PM4A 3Q4GA 1QLWA 3NH9A 3I76A 3V33A 4C1BA 5K8CA 4ASUA 4Z1OA 1FMCA 3H3JA 1JEOA 2DUJA 2FUKA 3PD0A 4KUHA 2OD7A 2AOVA 3AB7A 2ZS9A 3LOUA 4RYDA 3RSSA 4B6OA 2PYDA 1U3WA 5IPFA 4MRVA 2JCGA 4CL0A 1EHIA 3R8CA 1JEYA 4O3MA 4I6JA 4XDYA 1J9GA 1QFJA 3MXTA 3WJ1A 4XVHA 1RLUA 2D8MA 3IVXA 1LJLA 3VPDA 4EWLA 1F17A 4H7EA 2AXQA 4YC7A 3T3OA 3LK6A 3WHLA 1EVEA 4HDNB 2WF7A 3IOYA 4F72A 4M4SA 4XB2A 2OFOA 1OIXA 3GRPA 4RY0A 4DCPA 1EWKA 5HX7A 2ZE7A 1O5IA 4O6VA 3P0FA 1Q7RA 4Z5XA 4KXVA 3CUEF 1H8HA 2PANA 3H75A 3HUDA 3IKMB 4INPA 4YDQA 1EXVA 3QELA 2YICA 3QHAA 5FBKA 3WO0A 1LNSA 4PZPA 4QXMA 1NNI1 4ZXFA 1TVCA 2OSVA 3KVVA 3QF7A 2HJWA 4D80A 1ZOSA 1GR1A 3JQFA 4FWIB 2FXIA 3SYNA 2ZJ6A 1T2FA 3CUTA 4P58A 5HM8A 2AZ4A 5K45A 2M6RA 4C7MA 2Z3WA 1R0KA 1VJ0A 2EFHB 3U4IA 3UAWA 5JOQA 3W2TA 1AQNA 4FI3C 2DR2A 3RB8A 3WLAA 3B3GA 5JZBA 3ZBTA 1DEAA 1AG9A 4MYHA 3S27A 2D0PB 2BWJA 2O3TA 5JARA 1HGXA 1Z6GA 2VQ6A 3M81A 3O8DA 5FNZA 5M5BA 1PGOA 5DGHA 3H1TA 5LB4A 4Z7OB 1OHHD 3DQQA 4RZUA 3ICOA 2JJ2D 2QJRA 3WKCA 2IYNA 1T8YA 1XTZA 3C7KA 4TXHA 2RI6A 1FLVA 3LKVA 5KYXA 3BB3A 4DIFA 1YAJA 4KJXA 4UQLA 2C29D 3Q5GA 4HLQB 4MMYB 5HKAA 2CDNA 3ECCA 5EPEA 3KT6A 4RPCA 1ZIOA 2FSIA 3JQFC 4P36A 2J5QA 3KZNA 1MKYA 2Q99A 1Z12A 3GIDA 1E4YA 3BSYA 2PRZA 3ONFA 4TL9A 4HEHA 2GAIA 1PHPA 1TUBB 2BBTA 1OT5A 1FPQA 5FQOA 1GAJA 3I6MA 3SE7A 4XVUA 1QRUA 1PO7A 2ZJAA 3EXHC 3H1EA 4WIAA 2P2LA 1VG9B 1WXGA 3HA2A 4MA4A 1W4BA 3EGOA 4HADA 3T61A 5IRCD 2PT6A 3MC1A 3PFBA 3VAYA 4AMUA 1Y6FA 4CCSA 2HADA 4XR9A 2NSHA 2AQKA 4CEHB 4LGMA 1NRJB 4L6CA 4FMPA 1S8NA 1U4SA 3CX7A 3OQJA 3QVJA 2VJCA 1P8AA 5K4AA 5DASA 5KSPA 1EGMB 2X3UA 1GCOA 2CL7X 1JTFA 3VV2A 3RS7A 3IT0A 3ZVRA 1L4KA 1O2DA 5FV7A 4TUYF 4CIYA 1RMYA 4HN4B 4IQ0A 5AHWA 2O52A 4RSHA 4GE3A 1BXKA 1KJZA 2ZI7A 3C4QA 4J4HA 5I9IA 4YRDA 3AEYA 3IH5A 5KYGA 4KQXA 1RXWA 2WYVA 2ZS8A 2PZMA 3MQFA 1ABBA 1DQZA 1WU7A 1I0LA 4RV9A 2C20A 2VNJA 3AG6A 2CMHA 2R00C 1T1IA 4MW9A 4F5YA 5KPJA 1O7JA 3KHTA 1XQ1A 2JCSA 4C4ZA 2XE6A 4HWGA 4D3XA 4BLVA 2CB0A 2PS1A 4ZA2A 2DFTA 4WY5A 3HVRA 5BMVF 4Y2GA 2O2CA 3D5EA 4UTNA 3C1UA 1MH9A 1ZIXA 3EHEA 1OVMA 3OX4A 3TL6A 1RWMA 3JWGA 4I1OA 1S4QA 4UAVA 2IUUA 2XUQA 5EJMA 1PYGA 3OPMA 1H8EA 1MO4A 1RAEA 1L5HB 2HTFA 2OHGA 4ZZ3A 3RHZA 2BP7B 1Z8NA 3VNVA 4LDAA 4ENVA 1BC5A 4O33A 1A8QA 4ZI7B 4EVQA 1X1QA 3GRCA 3PXEA 4N3CA 1SUIA 3V4RA 1S9HA 1NW4A 2FWNA 2HA5A 3PFCA 3PHIA 3PNLA 3GAZA 4EG5A 1R88A 1TUBA 3MB5A 2ORWA 3KB2A 3QWAA 4MUHA 1BE1A 2QXYA 1W5BA 2HRQA 3K0HA 3AVTA 3KYBA 121PA 3MSXA 4MLPA 4JOCA 3ZIUA 3HDHA 2FPMA 2VH2A 1E0JA 1IHYA 3HEMA 1ZK4A 3E22B 3F4LA 1SOWA 2XB9A 4Q3EA 3WC4A 4BNWA 1NGSA 1FDWA 1JQLB 5HCIA 1IRIA 1IWPB 1CUHA 2XVMA 3R44A 3TK1A 3TUIC 4BO1A 4D3FA 3WLMA 2PH7A 1QONA 4F8EA 5KNBA 4CEHA 1YJ5A 1NYQA 3N74A 3R7LA 5BWBA 2XZDA 3ABSB 3OM1A 3X43A 2WMYA 1KPHA 1X7HA 2QLNA 3OO0A 4RVGA 3TRDA 3ML1A 2C7PA 5DCLA 3D8BA 1OUMA 3NHLA 1RBQA 2W2LA 5GM2A 4Z8XA 4RQAA 1PSDA 5COQA 2F3TA 3PU6A 5HE9A 4CFSA 2XODA 3WBBA 1Q1GA 5LP6C 1ZH6A 1ZHHA 3EYWA 1IULA 3L7NA 4Y1RB 4UDXX 4U3JA 3WV4A 1R6BX 3ER9A 1GZ6A 1G5QA 1I2BA 1Z36A 4L7QA 1JU4A 4KBGA 1S7GA 2AMJA 1HKUA 4BVEA 3H1BA 1TD1A 1CY2A 3L7CA 3PVCA 4JUIA 3FMIA 3FYDA 5AD1A 1CUZA 3QWBA 1LLUA 1SD1A 5H3LA 2P8JA 4WX2B 3BILA 3AGQA 4ZAZA 5A5VA 1C3EA 2IEBA 3LHKA 1KZ1A 1U9IC 2XI4A 1XTUA 1CB0A 3MGAA 4RU1A 4G2TA 2HLPA 1ZIDA 1PTJA 4HJXA 2K7ZA 4GC9A 3DE0X 1C80A 3TI9A 1T1GA 3SSAA 1VL8A 2G17A 4HSGA 4QTTB 4C04A 1SC9A 2H51A 2BP7A 2OZVA 3CTPA 3PF8A 4FYIA 4Z9FA 1C3XA 3UUWA 4XLZA 4D6PA 4ZI7A 3JU3A 3L6EA 4LI3X 3STTA 3SZLA 1E8MA 1JHMA 1UC5B 1ZL0A 3JQGB 4P3OA 1DGQA 3GLKA 3SKXA 3IHKA 3EIXA 1Y9AA 4DWWA 1IOLA 5LP1A 4JJ4A 3KQQA 4LGYA 2IU6A 5JSHA 2ILTA 3N2ZB 1KZ7B 4LPKA 2GOYA 4BNKA 2ADMA 4N7BA 1DL5A 1HT1E 3RNOA 3OPYA 2HBYA 3LHIA 3M8KA 4TKUA 1QVAA 3QKIA 1G2PA 1LK5A 3IIJA 4O8CA 5L6LB 4OXQA 4BFUA 1GXSB 2QVXX 3CV3A 3AVPA 3ZGYA 3OCCA 3DT9A 3LCJA 3FHLA 3LNTA 4ZFNA 1UJ4A 2DFVA 1WB5A 3FROA 4RGQA 3KSRA 4EVIA 4TYYA 1R5BA 2BMJA 3AUKA 1G59A 4ZVLA 1VHWA 4AS1A 3CR3C 4DC9A 1L4NA 1DEOA 1P4JA 3DWIA 3OI7A 4CLEA 4MR9B 3KKZA 5KX5F 1GITA 5EUMA 4JR2A 3FDXA 4KE9A 3F6RA 1IRXA 3OCUA 2Y1OA 1KQOA 4JP8A 1TZMA 1OHHA 2Y99A 4RTJA 2PT5A 4XDGA 4OXNA 2JJ2A 2A7QA 4BAZA 4ZIRB 5LN1A 3HFSA 3ILYA 1J2RA 3UAGA 1FX0A 1M7GA 4P31A 4QRHA 2P1DA 3ZN2A 2JGEA 2FEPA 4EFMA 3WSVA 3TD2A 1QV6A 1LJUA 5LC1A 1ZZEA 4IAOA 3MQ2A 1GG8A 3ILVA 5DHPA 4C7JA 2YRFA 5DRYA 3UW3A 3WGOA 3EARA 4TXJA 3STYA 3QNWA 1P9OA 1P0FA 2Q1XA 1RPTA 1H2FA 3IBYA 3OJXA 5E4TA 1G16A 2D2XA 2ZSBA 4AY4A 1KYVA 2LD4A 2V97A 3K1TA 3QWFA 2YZGA 3ICWA 1NMEA 1YRBA 4EUKA 1PFVA 2J5KA 4M9CA 1NNUA 3VPXA 1SIWA 4OQDA 3SDZA 1KJJA 4G0WA 2EKQA 1A77A 1Z25A 1IU9A 1Y1TA 1C8VB 3D1LA 3SGLA 2QY6A 3JQGA 2QZ9A 4CMIB 4NX2A 4UBNA 1SR8A 3SJCA 5F2NA 5K0ZA 5LZ9A 2Q5FA 3ZNQA 5L4SA 4ZZ0A 1FYFA 5JQGB 1A3CA 5L7TA 4FNGA 1KBOA 1RAFA 2XRYA 3NQ41 3AKYA 1KEEA 4GQAA 3LECA 2OLEA 1M8GA 1GXSA 4RVSA 5CD1A 1QK3A 2BKXA 4G67A 5SY9A 3AX6A 1JHYA 5JHGB 2QVYX 2P2NA 1T36B 4ZEWA 4C5AA 1SC3A 2X8LA 2VK1A 3K31A 1UZUA 2JFZA 4M9ZA 1WW8A 1RHUA 2I4RA 4KUEA 5CVJA 3U5TA 4MDYA 5DBIA 5ITZB 2W8ZA 2EWWA 2ORED 2QMYA 3Q7TA 4MKIA 4Q82A 4BJ5A 4EUFA 4PRZA 3PXUA 1LK0A 3G2MA 4XGKA 3CR8A 5I4IA 1I13A 1IEWA 3LYUA 2X15A 4PPNA 3KAJA 3GEIA 3AUFA 4BVJA 2KLHA 3MWDB 2X9GA 1FBNA 3ZGNA 2P2YA 1BX3A 1NVBA 1OYWA 2E2WA 3EC7A 3QLUC 1YT5A 3AHJA 4YMIA 4YRCA 3VM6A 3UMMA 2R60A 2ZI5A 4OUKX 4F3RA 3HJGA 1JR3E 2HZ7A 1NPYA 4LY6A 5E2BA 5A0TA 1QHHB 3VPGA 4U2KA 3LQRA 1IUOA 3QGMA 4G5RA 4A26A 3IA7A 3HUFA 2V4MA 3ZWYA 3ZWMA 4DVJA 4YRGA 3BZBA 4EMSA 1TUEA 2CDBA 1A7UA 2TMGA 4J3FA 1ZNWA 4QXAA 3X2EA 3L4EA 1VGQA 3TOSA 1SEPA 4L4XA 1GZVA 1DX9A 1NQXA 4JASB 1UDCA 3HN2A 4JBWA 4UHBA 5E2IA 1W73A 3UK2A 5JRDS 2VNSA 3N0VA 1V1MB 5BSVA 4RK7A 5C2JB 3KUCA 1WCV1 4RZQA 3CG0A 3DH0A 3EFOB 5AKHA 1VLZA 5BWCA 1T8TA 2PS3A 3FCXA 4KE7A 4ZU1X 4KKXB 3RS9A 1AZWA 4LYHA 1ZM2A 1VE5A 5E6SA 3FLAA 3DNMA 3N0RA 1F14A 1L5SA 4QM6A 3ESCA 1YWGO 1NW3A 1CK4A 2XB8A 3A31A 4QYSA 3UA3A 2FW8A 4QE3A 2XV1A 5DYGA 2PKYX 2FHPA 1X6VA 2VTKA 4UBIA 3R4VA 3OJEA 1UAAA 2B1RA 4ALMA 4AS3A 4DZRA 5KJCA 4EZIA 4BGVA 2QSZA 1UIRA 5T6MA 1SBHA 2W2TA 5T57A 1V7PC 4LSZA 1FDVA 1KQPA 4BO6A 3J80A 2ACWA 2G06A 4IGKA 3IL2A 3LVRE 1XZMA 4AKEA 2IQ5A 4QUBA 1YD7A 5JISA 1QYDA 4F6RA 5M29A 3VAAA 4B7AA 1FA9A 2H8KA 3TLBA 3THXA 2EJBA 1O58A 4GKAA 4TQUS 1A9SA 1RWVA 1Z0AA 1LKZA 1TMGE 2Z5LA 2VHEA 4DW8A 2F9MA 3MPUA 5CVCA 3P5SA 3S5JA 5GPBA 2XKKA 4DLPA 5I6DA 3RIGA 2R1VB 4OQ4A 1NP7A 3MWDA 1QG0A 3W2FA 4JP3A 4PSUA 1VA5A 5L8VA 5ALMA 3GAMA 2EQBA 3Q3VA 4LBWA 5C3UA 1IBLB 3FAKA 1SC4A 4P8RA 5BV1A 5JNSA 3AW9A 3PC4A 2BTOA 2UVDA 4BX8A 4WNIA 3DOEA 3KEFA 4ACAA 5F35A 1QHHA 3PJFA 3ABZA 3WKDA 5JPDA 2I9KA 3FDIA 4YRTA 3LK7A 4B84A 4MQFA 1JLRA 2G1UA 3ENQA 3OE5A 3PENA 2CDCA 5T4BA 1XWIA 3OQOA 4KQHA 4URFA 3GJTA 3UHAA 1A8UA 2QRLA 3A25A 5CLQA 1RC0A 2VBGA 4J75A 1W4AA 4NK5A 2OEPA 1OSNA 3F78A 1V4NA 4M21A 4JT8A 3AQ4A 4RTLA 1J56A 3RC8A 2ZSKA 2HD4A 3C7AA 5HMMA 3JVIA 1B76A 2PGLA 3T7SA 4YP1A 2BM0A 1H0RA 2WWRA 3PXCX 3NXSA 1M3SA 1UOOA 1QH1B 1VI5A 2BR4A 3WIUA 2AJTA 3I2KA 3ZDXB 1X38A 2I71A 3DBRB 4P2GA 3V46A 4EI8A 1C0IA 2PG3A 4EYOA 5IJXA 4C2AA 2R6HA 2X8JB 2CVOA 3BORA 1QCCA 5TMDA 5IXYA 5DTQA 3CIOA 1U7TA 1E64A 3CVOA 5DBGA 4EKNB 1ID8A 4U00A 1YQXA 3RI3A 3LI2A 2AJDA 2OGSA 1ECBA 1M7BA 3O1HB 2ZIZA 3DWFA 3IESA 1WR8A 1OXSC 2ANBA 4K6OA 1MO2A 1RQ2A 1V71A 1U7UA 1WB6A 1QQ7A 1XZKA 1NRIA 2JNWA 3FTCA 3REQB 3QU4A 3ZWNA 1N77A 2ZE6A 2FRDA 2IU4A 2IHJA 4HOYA 1BGVA 4CMHA 1P4HA 4N7MA 4TROA 4MB6A 3FLEA 3CPEA 5ILGA 1Y98A 5F7ZA 1CDOA 4V1CA 4B85A 3DAFA 4ZVOA 2C7BA 2OLKA 3UJAA 2YWHA 3EG9B 4EELA 1E69A 2PO5A 3ITEA 2R1VA 4J0JA 5JCJA 3T38A 3G8BA 1UQUA 3NT4A 2Z30A 1CP3A 1EG2A 2YX1A 3KXIA 4DV3B 1X74A 1MJGA 2WWTA 3ND5A 2D59A 3VYUB 1I6WA 3BXPA 1IZ9A 3DEZA 2I6TA 3KPYA 5EIXA 5DKFA 3PRHA 3ZOKA 3DZGA 4ZMBA 3WNCA 2NZJA 5ADWA 3DKRA 1RTKA 5BP7A 1E6MA 5BW8A 4DR2B 3AKEA 1YVDA 4DBLC 4LW8A 3O95A 1I10A 1XLVA 4PBTA 1XB2A 2XKJE 4BX0A 3I4CA 1THGA 3BGIA 4MW0A 2P40A 5AKYA 2CT8A 1YTLA 3OQBA 3TOXA 3T9DA 1UKAA 2D2EA 2CNDA 4KYUA 3FHCB 1H9AA 3WGJA 3RE1A 3A14A 4FYXA 5KDLA 4GEGA 1QH1A 3COPA 3VPCA 1IXYA 2H6EA 2V0NA 1G98A 2G36A 2ZUDA 3DBRA 3MJ4A 3W3AD 2DJIA 4MPPA 5FI3A 4B4OA 2HXGA 1VHJA 5IJ0A 2H2HA 4PRYA 1G5TA 2X5NA 2SKDA 2XMDA 3U3KA 5E38A 3ROGA 1E92A 4IHQA 3K1AA 4HNUA 1KVUA 1SVOA 3SHTA 2NYRA 3RU7A 1N6PA 1OLXB 3NO4A 2QTNA 4IMIB 3AKDA 1AGPA 3ZQUA 3IDOA 2WVJA 5IDWA 1DZ3A 1ST2A 1YXMA 4R9RA 2H5EA 1MG5A 2FMIA 4HDQB 5EYPB 3I28A 2HF7A 3DMTC 3WRVA 3NTOA 2VAWA 3NHRA 5TB5A 1OWLA 3A9WA 1UJ2A 3BHJA 3F3YA 5IM4F 4GBGA 3EG9A 1J1UA 4NEQA 3VNQA 1XUOA 2Z5FA 1US8B 4FKMA 2BDTA 4WXYB 3ZI0A 5F23A 3NIGB 4PIPA 2QTRA 3ESBA 3O1IC 4ABYA 1P1JA 1P6UA 1PP4A 3I04A 3ZE8A 1VL0A 4CKBA 1E89A 1DAOA 4AF8A 2BH9A 5SYNA 5FFNA 2B6HA 1D7OA 3WWEA 4MVJI 1L8LA 4L2IB 1Z17A 4Q24A 5AO9A 3AP1A 3RBZA 2P7IA 1UBGA 4L95C 4RJ2A 5EESA 2RJ3A 4E1AA 4EM6A 4QELA 1DC5A 3BT7A 2W6ZA 2VZ9A 4U7GA 4FNOA 5LIRA 4GOLD 3STXA 2WILA 1ZA2A 2J3QA 2ATCA 1HDGO 1JIQA 1JHAA 1NASA 1ULBA 3KJGA 1GTL1 1AKUA 3KP1A 3PHHA 3GDFA 1JHQA 2OHVA 3BZUA 1Q19A 4ZQIA 5JSZB 5FUQA 2Z2IA 4B5LA 4DQVA 1ZD8A 4S04A 1XRNA 1CZHA 2REQB 2HOQA 4R9UC 1AKRA 2GZDA 3TLXA 2X6TA 3GFBA 1OH5A 1K88A 1CB7A 1BNCA 1TIKA 1ZXBA 2BE9A 1H1LB 1KAMA 2ZUBA 4IXTA 1K68A 4YJ3F 5KYUA 1ABEA 2QZSA 1NYLA 2F1OA 1A5BB 3K09C 9LDBA 3ZZMA 3HGQA 1FC0A 4IR7A 1T4BA 1PVDA 3L8MA 4NMWA 3H18A 3NORA 2YJZA 4N1AA 4RIIA 3VZCA 4B6QA 3CY6A 1UOQA 4ML3A 1E61A 1LW6E 1Z2OX 4HSEA 4OJTA 2J0SA 3PIIA 2WWIA 4DMHA 1P5ZB 1GPKA 4FDAA 1TI7A 1VQ1A 2CJWA 4X91A 1YULA 3TSOA 2ZYIA 1DS6A 4OHCA 3JRNA 2BDEA 2WUVA 4NNPA 4ZZ2A 4FJ1A 1ULZA 1FRQA 2PK3A 2CXNA 2KS6A 4TX1A 3SU8A 2AG0A 2VPYA 5C1IA 2X2FA 3R6TA 1RC1A 4RF5A 3RIHA 3X1YA 1SNYA 4B73A 1F48A 4M37A 5FWNA 2I62A 4HG2A 1BA2A 4DA7A 2BI4A 3RK4A 3NRCA 2WB4A 1YUNA 2VG8A 3W2HA 3R77A 3UHOA 1RAGA 2P77A 2ZCUA 4GXQA 3PXGA 1EEXB 2WPNA 1ESMA 3BEDA 3GT4A 1EM6A 5PNTA 3O03A 3IKJA 3WLOA 4V24A 3ET5A 4BQSA 3OTOB 5FUXA 2VJAA 3PNSA 1QIMA 2WHEA 4NC9A 2QQ0A 3OE1A 3WYAA 4IIVA 1PBTA 1RWOA 1F2TB 4QJ5A 3R6DA 3EQZA 2P68A 1FFXB 3LIPA 3ZLUA 1CEEA 4I55F 4LMBA 3F46A 1UPAA 2A4MA 1EB9A 2ATXA 4QJBA 4ZI3A 4L28A 3FYCA 5A06A 5G41A 2NQ8A 4XLLA 2P8SA 1ZLXA 2PMFA 2WU4A 2DMRA 2A8YA 4TVBA 4REOA 3RNLA 2GNOA 5IJ9B 1EFUA 1FFCA 2ZB8A 4IFEA 5JSZA 1U2DA 2OHOA 1RLTA 1FJGB 2QL7A 1TGYA 1WUHS 3ZZ1A 2HREA 1DKLA 2REQA 5BVGB 3BUSA 1CZLA 3NHPA 1CERA 2EVWX 3EVZA 1Q1AA 5K05A 1U8EA 2MSDB 3QFHA 1H1LA 1B1CA 2HMAA 2P2ZA 1I3CA 3KPJA 3L8GA 4PS0A 5AJWA 4ER7A 3AEXA 3GQVA 2D5AA 4TS9A 3ZDDA 1CFZA 5EHIA 1N6NA 1XDBA 2QM7A 2DUMA 3WNBA 4CQJA 3D8NA 5BXYA 1D2AA 5EJ4A 1UJCA 4V3BA 5DXAA 4OSPA 3T94A 4BXOB 2FQYA 2CCKA 5IZCA 4MKXA 3GBSA 4JUDX 1JKMA 4N4AA 2FCRA 3BFXA 3U09A 3IODA 3TDMA 3EF1A 3N9IA 7REQB 5HRUA 1LPNA 5JADA 1A5SB 5IBQA 3BBLA 3TLYA 2WKQA 5A5GA 3OX3A 4R1PA 3O83A 1IWBB 4WHMA 1KI7A 2PV7A 4CEJA 3BD9A 1R9NA 3D6MA 1HLPA 2I2CA 1QMPA 3UT5B 3GRUA 3LBNA 2Q5OA 3L4KA 3A3YA 1JLSA 3GZTB 2BZ0A 4GRDA 4WI1A 4F2DA 1IY0A 5AHKA 3ZV6A 4NMXB 3TGLA 1ORIA 3ZVNA 5EWMB 3OKFA 5LLTA 4UD6A 1B8OA 1EG7A 3ORHA 3PQ2A 4RTKA 1WCXA 1LV8A 1RLOA 1WSBA 1XP8A 5I4BA 2HLHA 1O54A 5C8YB 1B6GA 4L9SA 1G8KA 2Q1TA 4N01A 1BH6A 1F2TA 2AT1A 2X9NA 1U4OA 3MOSA 1FFXA 3CJTA 3HP7A 3DB2A 1ZKMA 4QDOA 1TQDA 5IAAA 3M9LA 5IABA 4XARA 1BZYA 1QK5A 5FA8A 4B09A 3A0RB 3HABA 1KPGA 2XMBA 4HNAB 3GZJA 4JLKA 3DHNA 1RXYA 2F1HA 2VR1A 4Q37A 4YTEA 3W3AA 4D44A 2JGLA 3GLFE 1WSDA 5DI3B 4XYLA 3OTIA 4TRRA 4GP6A 5IJ9A 1WP4A 3A2NA 4Y2TA 1PLLA 3SJZA 3BD6A 3A7DA 3W34A 3ZDZB 1Q83A 2D2FA 3FTPA 1H0KA 1NP3A 1LLQA 4QIHA 5BVGA 3FE2A 5E3JA 1ZJWA 1NI4B 2HQSA 1L5QA 2IPOA 3CZMA 2WHQA 4J8PA 3FFXA 4L6AA 5IAOA 1NY5A 2E6KA 2BGWA 1NJSA 1YZGA 2QN1A 3B3QA 4AJKA 4DCVA 2EZ9A 3G85A 2AD5A 2ECOA 4BVGA 3OQNA 4EBBA 1GP2A 5CLGA 4YIHA 1JT9A 1TEHA 4OJMX 4WOJA 4BMDA 4MDFA 3I8SA 3JQ7B 4PF1A 1MV8A 5BWMA 3BX1A 3HMKA 2ADFA 3PC3A 5FTMA 4RS3A 1GLVA 1E6EA 4PZYA 1VSBA 3DNPA 2R48A 3OAAD 4TLCA 4J3JA 3G0OA 2FKNA 4YRJA 5TQ2B 2CFOA 5EMJA 3K2EA 4RZSA 3U4AA 3RLFA 3MINB 5P21A 3NANA 4PNEA 3LPLA 2VDNB 3KYDB 3UFBA 3WLSA 3C3XA 3UT5A 4MP3A 3CN7A 3GMSA 2GHTA 1XK7A 3FPCA 2H00A 3ZYCA 4IJ5A 4XRGA 5IKOA 2FSSA 5FNVB 3GGCA 1YNOA 3O3NB 5A4IS 1X7YB 5AOAA 2BCJQ 1QIKA 3D6AA 4PINA 5CDGA 4B8YA 1BXRA 2A86A 3GJ0A 3KAKA 4KC0A 4ND3A 4NPAA 1F7UA 1T3LA 6YASA 1EE1A 1UM8A 2CF5A 1GUYA 4KJZA 2OPHA 2WYHA 3TXXA 1CEYA 3A4MA 1JAHA 1JDBB 3WQHA 2PGAA 3NBQA 4AO8A 1W93A 2IYWA 3PFHA 4EF6A 3OQHA 1G5PA 4MV9A 4YNBA 2GBGA 3OLCX 4HNAA 1JDSA 4M1ZA 5DK4A 3IPXA 4QGAA 4MV3A 4KPYA 2IITA 3RIXA 3C7CB 1CJUC 1E2QA 3NATA 4QWMA 3R7DA 1K7YA 1Z28A 5B58C 1YGPA 2WFLB 1RE0A 4R0NA 4FZ5A 5AK6A 3LOPA 4JLBA 1KDZA 2F64A 5CGZA 5ER9A 3I0MA 4EYEA 5IF3A 4OH7A 1KMMA 2F1KA 1UPCA 1J90A 1D8TA 2IEYA 4N6GA 3TZLA 1ZNYA 4EYQA 5G0WA 5KTYA 1T6ZA 1Y3AA 2QUZA 2WKRA 3I53A 4OGKA 5ESRA 2DCUA 1E1QD 4QGSA 2GKGA 4KGZA 2RG1A 1XAHA 1HH4A 1V8DA 4DCSA 5A9RA 3V34A 4NBNA 4BFSA 3DPIA 4KMRA 3KTDA 2O8CB 1P17A 3LZCA 2CUNA 3JQ7A 1A4XA 2GPJA 2O7QA 4AMBA 2Z2KA 4C89A 2I4NA 4A0FA 3VA7A 2P6UA 4UMFA 3MMZA 4M8IA 3GAFA 4YMLA 2QXTA 1E5XA 2A9VA 5LZ7A 4O4LF 5KVVA 2V58A 1AV6A 2O2JA 1XD9A 1XQYA 2VCYA 2YWRA 1I14A 3KYDA 4B3XA 3PWTA 4PAOA 1N5OX 4CLDA 3UHJA 3E61A 3C3KA 1VE6A 3PR3A 4MV5A 2I6UA 4CXMA 4KMOA 3BOSA 3G9TA 3OESA 1FNBA 3PNMA 3QP9A 5FNVA 1TU4A 4QUHA 1VFPA 3R3ZA 3SP1A 3VZSA 2IYAA 1CYDA 3DBOB 4PCVA 2J6CA 2K5UA 3AF0A 3ABRB 4PO3X 4YROA 1ZH2A 1R8QA 4OU5A 1FE8A 3OFKA 3C6QA 4OLJA 5EHNA 3TG2A 4A27A 1NZJA 1UXJA 1GNQA 4NBVA 4Q3AA 4FGKA 3WISA 4B82A 4PN3A 5KSZA 3ICQB 2QI9F 1PR6A 4N3AA 1JG6A 2XVZA 1SXGA 4M87A 4MKRA 4X61A 4BV2A 1WOYA 4ZDKA 3FUTA 4OHPA 4HEA6 5AJYA 2EIXA 1MAAA 3E7WA 4ONEA 2HYDA 4TZKA 3EGDB 1PR0A 4MWBA 5BNWA 1TM7E 2EDAA 1NNSA 4M1YA 2R1ZA 3JQ9C 2FXVA 3Q3HA 4ILKA 3RYCB 3CZQA 1SXPA 4RWEA 3UYLA 4AQYB 3B13B 3PEVA 3A3PA 5BYJA 4G8CA 1J9EA 1KEKA 3CKMA 1FK8A 1YASA 1L5KA 4NBUA 3ZGVA 4NCJA 4QHYA 3G1WA 5K2OA 1QNFA 1N6RA 4LSGA 2CV1A 1CY8A 3WYFA 2YMQA 1QK4A 2QL6A 3HZRA 1Y3HA 4ON9A 3S2UA 2BEKA 1TOAA 1K8QA 1ZGGA 3B6MA 1YZ3A 4JBIA 4YXFA 1C3LA 3ROTA 4ER3A 2ILVA 4R6XA 5FBVB 5KU1A 1N36B 2V74B 3RK1A 2IPXA 5LMCA 3DR5A 3L0PA 4NDZA 2O8CA 1A2BA 1BGXT 1RQXA 3OQVA 3HS3A 2O54A 4KSCA 5A4DA 1DOHA 4YXWD 4MMXB 1Z62A 2WMNB 2ZZKA 3QVVA 1WPQA 5CVUA 3SXUB 1IEXA 1H66A 1HE1C 2B5VA 3AP3A 4MV6A 1A8IA 5KOIA 2PQ6A 4IXWA 1S3IA 1DFIA 4XUDA 3FIJA 5F5XA 1F8XA 2D06A 2M1ZA 1ULUA 1ENOA 1NUAA 1QP8A 4MKHA 2FN3A 4JU9A 5LWQA 3S44A 1HLGA 2A84A 2RMKA 3E3LA 1EEHA 4EGQA 4GMGA 2V3WA 1FUEA 1QE3A 3K1YA 4UMEA 5IM4A 3JYHA 3ZJTA 2X0DA 3E1KA 4LWPA 2VPPA 2M1XA 4YDSA 4E7PA 2F3SA 3FOFC 1X86B 2BUAA 4P33A 4GNRA 1H0SA 4W8OA 2C9ZA 2HJSA 2OV3A 3L2OB 2EFDB 4FIZA 2FR8A 4GVPA 1II8B 4ITRC 1OJLA 3E05A 5CDFA 2V54A 3JYPA 3R8XA 4OKNA 4EHJA 4X1KB 5CT6A 2LUOA 3O2NA 3QOFA 4FZ3A 2P6RA 4OMDA 1JKJB 3EEBA 4IIYA 4RS4A 4WRRA 1K97A 4CYMA 2F8SA 2JFPA 1ZM3A 2FGJA 3EXG1 4JMPA 4R1MA 2P9FA 1QIHA 5C1PA 2DBZA 1C0EA 3EGDA 3QF4B 3PYXA 5GJWC 1K86A 4AN1A 4MGHA 3E58A 3LQQA 1LPAB 3M9XA 5KJ1A 4PY2A 3RYCA 1T5LA 4IDQA 1ARZA 2RFLA 4NE9A 4ZQCB 4NSNA 1B0PA 3V4VB 1Z0DA 2Q8NA 2ZW9A 2A0XA 3U7QA 3UKJA 1UOPA 3GLHE 1J20A 3OIVA 3HB9A 4L9WA 4I3FA 5AIBA 3OAAA 5DNDA 1FNNA 2IZ7A 4NYMQ 4PPYA 2Q0HA 4ENTA 3LLCA 3VOAA 4MV7A 3IHTA 1S3FA 5BQ3A 3EIHA 2CXOA 2C4UA 1JRLA 4CKYA 1W8DA 1MMFB 2ACEA 2V65A 2Q3EA 4CKXA 1ES9A 2A3NA 3UMFA 5DM4A 1AZLA 3SM3A 1ECFA 1AN9A 2Q6LA 1O6BA 4BMNA 4E12A 2YXNA 4R5MA 2XZTA 2WQZA 1EX9A 1XP5A 2AOUB 3HYTA 3KSMA 3N76A 3GY0A 4KLCA 5ILQA 3WGNA 1DO0A 1XRJA 3OC6A 5MF6A 3HKBB 1Z73A 2I2BA 1GNLA 3SXUA 3DHEA 2HHLA 4ZK2A 3ZEAA 5AKGA 3N39C 3LC0A 2XCUA 1EA7A 1R10A 2OMEA 5AW5A 4LJYA 5AICA 5JH7F 4OOEA 1Q5PA 4CU5A 3DZCA 4K9MA 3KKMA 3P19A 1SOUA 1SHUX 2H18A 3ZUGA 4OHFA 3QKSB 1KFEB 4BNYA 3X1KA 2V6BA 3AUYA 2QTVB 2BCGY 3LUAA 3WGMA 5JNRA 4WMLA 2IBSA 3E3OA 3IAFA 1D0VA 1PV2A 1X1CA 1XTJA 2PX3A 2YVUA 2XT6A 3AEUB 2QMZA 4QLAA 4ZCIA 2JEYA 1II8A 2R1TB 2WJ6A 4AZ0B 1YZHA 3LVQE 3FLMA 3LGAA 2PNJA 3D3EA 4MHSA 1GQFA 1J0EA 4OJKA 4TTIA 4BKPA 4BEBA 4RKYA 1JKJA 1Q7EA 1U8XX 4RD1A 1JMYA 5AM2A 3PNYA 2GFQA 2XVYA 3OM9A 5LKAA 2P69A 3ZZNA 3C6BA 3AHIA 3MGKA 4G41A 3QF4A 2AQ8A 3L92A 5J2UF 1E1QA 3KJQA 3FN4A 4HZGA 3NDBB 3WZLA 3D7MA 1HRKA 2WSMA 5AM0A 3OQMA 2XWBF 1JXMA 2C00A 1N8TA 1TYEB 1P7WA 5JS6A 2PKCA 1NAIA 5ENDA 2CLLB 4EI9A 3R6WA 2X76A 1MQ8B 5DMXA 1EQ2A 1LC3A 1F5SA 2R751 4KQEA 2FUG6 1Z39A 3MZ0A 4GD3Q 3TOZA 2G25A 2E55A 3NS7A 4GW3A 3GMDA 3PITA 4TWJA 1O0BA 4NCAA 4WY2A 4I81A 1TJNA 3HM9A 3AUJB 1VA4A 3DEJA 2YWFA 3C8MA 4WQMA 3RVRA 1LPOA 4ZT5A 4EZEA 2XQFA 4YN3A 5CFPA 1FNDA 3F5SA 3HKBA 2BM8A 1Q7TA 2PX4A 1YR6A 4BP1A 2FWJA 5AVJA 4RHYA 5EJ8A 2BFEA 4F8YA 3SHFA 2YHAA 4EHAA 2OFFA 3I5XA 1T8PA 1R00A 1V3UA 5CIWA 3AVYA 4CUKA 2VYQA 1MV5A 1V43A 1BJTA 4KDFA 4DSZA 3NGXA 4FOOA 2GEDA 1UJNA 1P0MA 2I6SA 1CVRA 3GFTA 3I45A 3IEUA 4MITA 2UDPA 1KRWA 4GC5A 5B3JC 2C7RA 1PR3A 1UADA 4NH0A 3LM8A 4OH1A 4YPVA 3UAOA 5IDXA 4G63A 5K0CA 1KYYA 1EUQA 2J3KA 2QTVA 4NE7A 4JCCA 2D5CA 4ZYWA 1H4SA 2XGMA 3AEUA 1E9AA 1TLLA 1DO2A 1ZINA 1T9KA 1W4ZA 2RGYA 1TEXA 2R1TA 4AZ0A 5JSUA 1E0SA 3OZXA 1HWYA 2NXJA 3RIMA 2HU8A 3DPUA 3FPAA 4R2MA 1GG5A 3HPQA 1XDDA 4EGSA 1MAWA 3ZV4A 5A4JA 3ZTYA 1SHZA 2AUTA 4HH0A 4QOEA 5DM0A 1X80B 3TFWA 1E7SA 3DV9A 3FD8A 5JCPA 5KJFA 1NBHA 1SBCA 4ZYVA 2DOKA 1XTQA 2Q3DA 3EH2A 3WX0A 1IHUA 4BTLA 2P65A 1R7RA 3TNDA 4AY6A 1AY0A 3FOCA 4OFWA 5AVYA 4YS6A 2JATA 4N47A 1X9GA 2GHQA 4M8SA 1ZMRA 2XT9A 5HIJA 2M32A 3GUVA 3VH4A 4DJJA 4J4TA 4U1RA 4E4YA 4V02A 4A0HA 4LF7B 2PRJA 2VA9A 1Y7TA 3GWZA 5JFGA 3OOSA 1PL8A 4FFOA 1ZH8A 4MV8A 2QS9A 1VJ5A 1FTGA 3EEFA 3UPDA 4D81A 5HS6A 3B70A 1ZW1A 2HYIC 2IHYA 5D5HA 1MQSA 2EKZA 1NVVQ 1ZUHA 2BGJA 3PTLA 4FYMA 4QBIA 1NWCA 5AVOA 3SOZA 3QVMA 5KOJA 5L3SB 4YBRA 5LA6B 4BNDB 1LDYA 1QANA 4HDKB 4UVDA 4HKTA 2VHQA 2FR0A 5FJIA 1IK6A 3NAMA 1H9CA 3K4HA 4V0RA 3H5VA 5K3SA 1UFQA 3LX6A 1JT2A 1WEKA 5F3DA 5U1PA 3MIZA 3VI4B 3AYXB 5EJ6A 3KWLA 1CZKA 1TYAE 2ASVA 2BGRA 1AZSC 1KAGA 1KSHA 1DADA 1EK1A 2PKXA 3CLHA 4MROA 3R7AA 2R97A 1UM9B 3DZFA 1QZTA 2A9PA 5EHXA 2PYIA 3SG0A 2ZAOA 3KD3A 3BHNA 2IHTA 1UT6A 3DZKA 2VF5X 1E9RA 2X19A 5GJCA 2WNSA 5E0OA 1NBMD 4TMTA 1EK0A 3SF0A 3TIGA 5ED4A 2Y0BA 3I58A 4L5IA 3AZQA 5C8DA 1GGEA 2JBAA 3VR3D 1ZVVA 3KQOA 4RTQA 3IS3A 1TADA 4RKEA 2FV8A 1RQLA 1FMLA 1WTAA 2FZ4A 3T52A 4OLFA 4YP5A 4Z6KA 3ADBA 1XPRA 4RELA 1OU4A 5IVKA 2C4NA 3EDOA 1X42A 2GN8A 4KAAA 4V0SA 1X80A 2OV8A 3WL3A 2ZGVA 3MJVA 5CU7A 2E5FA 2JAWA 5CLLA 5FYDA 2OILA 3ZCXA 1T5TA 3ZE7A 1ADYA 3QOWA 3GNQA 4YY3B 1NMSA 3CBQA 4ZI5A 1Z68A 2XYRA 3JQPA 4L5CA 2ZRMA 2HQ1A 1NF3A 4WH0A 5REQB 2JANA 3P0EA 2AEEA 1SUEA 3A1DA 3FKSD 3AU8A 1NTOA 1I7PA 4QFBA 1G5RA 4A92A 2AEMA 5ALXA 3M6XA 4G01B 5CA0B 2VP6A 3C48A 1ODCA 3G6KA 2FOXA 3T5DA 1RCFA 3N8HA 5JNWA 4YLYA 2NXWA 2DB3A 5KYYA 2AQHA 5K03A 3A4LA 1PFYA 5BOVA 4BKOA 3UB4A 1NBEA 3L6UA 3LP5A 4F4UA 2JHGA 3IQGX 3AM5A 4JI4B 4TV8B 2R7LA 4V0LA 4ZARA 2ZZNA 5L3SA 1TQHA 1J21A 2EBWA 3UJCA 1YDFA 1C9NA 3NWBA 2VK8A 5JHHB 1A7KA 3P9CA 3E2IA 4FDMA 1U81A 5GIOE 1KYTA 2V3CC 4AL4A 1MN6A 2WJHA 3I01A 3O3OB 4J03A 3AI3A 3VGPA 4CT5A 4I9NA 3HJUA 2RH5A 3KZVA 1XBTA 5EL0A 4Y2JA 4XGNA 3FTQA 4Q9LA 3RTBA 4YDHB 2QRGA 4DKXA 4FHFA 4QPZA 3U4QB 1E2NA 2HY7A 1YL6A 2Y1XA 1LJ8A 4JP5A 1BDBA 2JFXA 5JO0A 3A1UA 1UM9A 1ZN8A 3NBYC 4Y67A 1QH9A 4F84A 3NUZA 1XTKA 4TQAA 4GL2A 1NXSA 4OHYA 3PD1A 1UPTA 2LIVA 2AKYA 4HDCA 4P22A 1H6DA 1W5TA 1W75A 1YJQA 1SZJG 2H3HA 1KVSA 5DYNA 1QGDA 4W7IA 3NNNA 4WXMA 1QX4A 4L50A 3ABIA 3UC9A 1YIOA 4JCOA 4C29A 1M34E 2O5VA 1AMUA 2W6QA 1Y6GA 4YT5A 3P0IA 3DTVD 1A9OA 4LYAA 4RMGA 2IEAA 1PZXA 3KKLA 3LQKA 1PG5A 2QHXA 3OFSA 1KQ3A 4RPHA 2O7NA 3ED1A 2NNLD 3LVFO 4U5XA 4Y1FA 5DF1A 3IFSA 3HUUA 3GZ4A 3H4MA 3LDUA 5DJ5A 6GPBA 5KYNA 1FW6A 3BMOB 1P91A 2FW6A 3LY5A 3QV1A 5CJ2A 1SQSA 3LBAA 3IAXA 2CE7A 4MAAA 3T1VA 5B4TA 5EJ9A 1GGFA 5EJ7A 4I2VA 5REQA 4XSGA 4K6CA 2CD7A 3I0ZA 4MIEA 2OTCA 4TLDA 3ZHYA 3V3KA 1YK1A 4HEJA 5K0NA 4C0HA 2FEOA 4G1VA 4R41A 5IF9A 2HSJA 1KSGA 3VU0A 1ECCA 2ZR7A 5CA0A 8ADHA 2XUGA 3P1JA 4AY5A 3WA7A 2GERA 2O4CA 4W9RA 821PA 4RHFA 1MFPA 3TXYA 4K6KA 1ACMA 1GFWA 2N75A 3UNXA 1U7PA 2QI9C 5H68A 3OM0A 1WU8A 1U2GC 3SM9A 2W8BA 3IOEA 3SLRA 3DD1A 5EE5B 1B23P 1DELA 2RGEA 2FPWA 2I2FA 4P0PB 4J7UA 4HGPA 4TV8A 4FGUA 1NMYA 1JVSA 2BGUA 1KY5A 4JL8A 1GAWA 4QDXA 4WNYA 1RKXA 5FI5A 3IVMA 2N47A 1N2ZA 1YOVA 5ICFA 3T06B 5I4KA 4KI0A 4DCNA 3ZQKA 4I1RA 2C2BA 5IK2D 4MRMB 4YUZA 2AE2A 2NYVA 2RHGB 4HLUA 4FYWA 3DMRA 3TQIA 1V7CA 2FPGB 5K6TA 1K8XB 5GV8A 4E6EA 4YRMA 3COVA 2JLCA 8ABPA 1VMIA 2YMPA 1NSFA 3LGXA 5DLDA 3UMRA 1KZHA 2D5LA 5EJ2A 2C4KA 1N25A 4EECA 3VJLA 1O6GA 2JC3A 4J29A 4FEGA 3N0WA 3CLRD 4Q9IA 3OWXA 4K88A 5C4MA 1RKVA 2IIQA 4IG9A 3LTEA 3GEEA 5TV2A 3AI7A 1OWOA 4MRNA 4CKWA 1D2MA 1ZIPA 2Y2VA 4BU0A 3IJRA 4AJOA 1PDWA 1DQPA 1QO7A 1XEFA 5ISMA 3KEQA 1EE2A 4LXIA 1GFIA 4DV6B 3DEIA 1GN8A 3KSDO 3U1VA 4Q15A 5KQLA 5KWJA 5HKOA 3EEIA 3LPDA 2DFDA 3F5QA 5C7LO 1SCAA 3NPAA 2QG4A 3E5HA 3BMOA 1BCSA 2R65A 3A6DA 5JASA 2IYEA 3E1GA 2QKYA 4LQCA 1RJEA 1X1RA 3UANA 2JZOA 5AUQA 1GADO 4UMDA 2M6KA 3KZ1E 1DAPA 2EF1A 1FBTA 1S96A 2X1VA 4NEHB 4ZREA 1EFLA 2K7FA 1Q0PA 3JD2A 1L4BA 1NA5A 3TCNA 4TZ0A 1E1DA 3IHLA 1VL6A 1FNMA 4L8FA 4X6LA 4D3DA 2QRJA 1I24A 4OQYA 5FUWA 4DCGA 1HF3A 3KTAB 4GIBA 1WD7A 3BMXA 5ES3A 4CGYA 2GNPA 4JROA 2BEVB 4MUNA 1YCFA 3NG1A 1KFKB 4JJAA 2DH6A 4RETA 1VLJA 4JYMA 4IHKA 1XDZA 3R7NA 2ZT8A 1BS1A 1EH5A 1PVVA 1ZHOA 3QUTA 4Y6QA 1JEDA 1RVV1 1CVLA 5EMLA 1O97C 4V0KA 2IEZA 4LNUB 5AKLA 3IR5A 1NBMA 3BM5A 3DONA 5K3BA 1VGRA 2O2YA 1TEVA 4MRMA 4LE0A 3WAGA 1K2WA 3VR3A 1F2UB 1GNTA 1YBFA 1RI3A 2Q29A 2FPGA 1K6EA 2ZQZA 4FZRA 4LJLA 3DTVB 3DDNA 4NE2A 3W0LB 4EO7A 3K9NA 5C8VA 5ITWA 4L72A 1F51E 3NYRA 1SK9A 1TT5B 2IX3A 5EPUA 2Z3VA 2C83A 4L85A 4RBNA 5DX1A 5AJZA 5LP6B 3LHFA 4P35A