5HKBA

Crystal structure of the cftr inhibitory factor cif bound to the inhibitor kb2115
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
297
structure length
297
Chain Sequence
b'AEEFPVPNGFESAYREVDGVKLHYVKGGQGPLVMLVHGFGQTWYEWHQLMPELAKRFTVIAPDLPGLGQSEPPKTGYSGEQVAVYLHKLARQFSPDRPFDLVAHDIGIWNTYPMVVKNQADIARLVYMEAPIPDARIYRFPAFTAQGESLVWHFSFFAADDRLAETLIAGKERFFLEHFIKSHASNTEVFSERLLDLYARSYAKPHSLNASFEYYRALNESVRQNAELAKTRLQMPTMTLAGGGHGGMGTFQLEQMKAYAEDVEGHVLPGCGHWLPEECAAPMNRLVIDFLSRGRHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CFTR Inhibitory Factor (Cif)
molecule tags Hydrolase/hydrolase inhibitor
source organism Pseudomonas aeruginosa ucbpp-pa14
publication title Rational Design of Potent and Selective Inhibitors of an Epoxide Hydrolase Virulence Factor from Pseudomonas aeruginosa.
pubmed doi rcsb
total genus 113
structure length 297
sequence length 297
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5hkbA01
5KREA 3DYIA 4N5HX 5E4YA 3EQ9A 4DLNA 3R3XA 1XRNA 4IHAA 4J7AA 5K3FB 4FMPA 1K6EA 4N8SA 1THTA 3G0BA 3PUIA 5FPPA 4MEBA 2EEPA 2WUEA 4F0JA 2HADA 1JJFA 3H04A 3ZV7A 2K2QB 4ZRDA 4U2CA 5ALPA 1XRPA 4L9AA 4EHBA 1JMYA 5CXUA 3GZJA 4OB7A 3ESDA 3A2NA 1U8EA 5JATA 1VXOA 4QWWA 1CPYA 1WPRA 2AJ8A 3AIKA 4NMWA 4IO0A 1EHYA 3FLBA 2C0PA 3IDAA 5ALSA 1UK9A 1HKHA 1R1DA 1DT3A 3CN9A 3WI7A 4MQMA 1A7UA 1XZKA 4HRYA 1F0NA 1YR2A 4J3JA 3ZLVA 4BVKA 3V9AA 1CEXA 3BDVA 1J07A 4QWMA 2D0DA 3CCBA 4DMKA 1XLVA 3NWOA 4G8CA 5AOCA 4BCDA 4DMFA 1H2ZA 2OXEA 2C5FA 4K6GA 1UKAA 3H2JA 5CXXA 4OPMA 2OLEA 2WJ4A 4WFKA 3EIOA 4E11A 5LIPA 3WL7A 5AOAA 3WWCA 3ZLUA 1GPNA 1VKHA 4BRZA 2WIFA 4EY8A 2WJ6A 5AKIA 3BJMA 3MUNA 5FKJA 3F98A 3WKCA 3NOXA 2VT6A 2WHRA 5K3AA 2V96A 4L3WA 1LLFA 1DT5A 2HU5A 4MYDA 1EX9A 4CIAA 1WCYA 1AUOA 5ALLA 2XT0A 1GGVA 4D9JA 2VQ6A 2RHTA 5ALTA 3O9MA 3RARA 4L72A 3D5EA 1XQVA 1BS9A 4PV7A 1XZBA 3WKBA 1ODSA 2ROQA 4AN0A 3BL8A 2HFJA 3DCNA 5D7BA 4B6GA 2BFNA 5JALA 4HXFB 1XLWA 4AX4A 2Z3ZA 4QLOA 4EY7A 3H2IA 1BCSA 2I78A 5JYCA 4GXNA 3C45A 3I2JA 3VJKA 4BC0A 2HA0A 3C8DA 5FUMA 1HLGA 1K63A 2HA3A 4YX9A 3G0CA 4H7EA 1FJ2A 3TGLA 2QS9A 2XB6A 3R40A 4Y9SA 5HK8A 4HXEB 2GYWA 5I7UA 4DYHA 2I03A 5T4EA 3N0TA 2HL6A 5HKAA 4K2AA 5AKJA 4G5XA 4UBKA 3LLCA 5BV7A 2XDWA 2HIHA 4WY8A 5ALZA 1QZ3A 2JEZA 5JAOA 4IQ4A 1RYYA 4PNZA 5CH8A 2C5GA 5JARA 4PW0A 2YH2A 4X6YA 5A7HA 3U0VA 2OCGA 3EQ7A 4XVCA 5CBKA 5AI6A 3SC2A 2ZVDA 3RK4A 3HRHA 1VE6A 5DWDA 1LPAB 4EUSA 2WIDA 1AQLA 1G4HA 1ZGCA 3L1JA 5A7FA 4MWTA 3STXA 3QZUA 2WQZA 1JJIA 2C4HA 2GYVA 5AK4A 3A70A 1Y37A 5K3DA 5AKKA 3M81A 4GECA 3C43A 4MJ3A 2BGRA 4UHBA 3WZLA 1F6WA 1ORVA 1W75A 2AJLI 1E8NA 2FJPA 1FFDA 3B3QA 1X2BA 3QITA 1TCCA 1BRTA 1NU6A 1QE3A 2RAUA 3MVEA 5LZ7A 2WHQA 1MU0A 2VATA 1BEEA 3Q0TA 5HCUA 4OSEA 3I6MA 1J06A 2PBLA 4BCBA 1GT6A 1J1IA 2H9YA 1VZ3A 2GBIA 3M82A 3VXKA 4EBBA 2EDCA 2HU7A 4WJLA 1TRHA 3E4DA 4Y7DA 4QZVA 2BJHA 1LBSA 3B12A 3WZMA 2PVSA 3DDUA 4LXIA 4G4JA 1YAJA 1MJ5A 2QM0A 3WMRA 3DS8A 4AMYA 1XZGA 3QMWA 4U2GA 1CUYA 4BE9A 4B0PA 2GZSA 4ZXFA 5IH7A 4X91A 1R88A 5HZGA 2HU8A 3WWOA 4X90A 3V1NA 4OYYA 3SK0A 4BTVA 2OCLA 2VJAA 1UXOA 3WK9A 1Q0RA 3EQ8A 3PF9A 2V97A 1ZD3A 2JF0A 1XQXA 4A16A 3GFFA 1FFEA 3O4IA 1UWCA 1QIMA 3I2FA 4P08A 4FLEA 3FYUB 3KWFA 2ZSHA 4GI1A 1TIBA 4DNPA 1XZDA 4CG1A 3KDAA 3WA6A 4TVKA 1EVQA 2WFLA 3DL7A 2X76A 3WL5A 4JUIA 1GKKA 3STVA 5KWIA 3OTQA 4X6UA 3F9CA 2FUKA 3VJLA 2D5LA 4QEKA 3D3NA 2JBWA 1AURA 5JZBA 2UZ0A 3W06A 4E15A 2ZSIA 1XRMA 3MGAA 1CUCA 1B6GA 1ODTC 2JGMA 4BC1A 4PO3X 1EDDA 1JI3A 4BP8A 2HM7A 4LYEA 2QR5A 3BIXA 3WJ2A 2ES4A 4P92A 4PSCA 2XUIA 2WU4A 5AHXA 2WLSA 1KEZA 1K4YA 1QONA 4CFSA 3VISA 2ORYA 3I6YA 1CRLA 5AICA 1JJBA 1BE0A 2C7BA 5ALQA 4I4CA 4EY6A 3KOOA 5AKGA 3LS2A 3STUA 5CT9A 2ECFA 5HF6A 4CI9A 1BCRA 2VA9A 1USWA 1GZ7A 2RIPA 1HDEA 3WQHA 4GHWA 1T4MA 4KRYA 1A8SA 5LZ5A 1JT2A 2XUOA 2Z3WA 1SOMA 2XMRA 2Y6VA 2DHEA 5E4TA 4PF1A 3VKFA 2JIDA 5D3ZA 2JGIA 1S8OA 2WTMA 4QNNA 2XUAA 4GW3A 4B81A 2RGUA 4AO8A 5ALKA 4QDZA 3R3WA 1DWOA 1WB5A 5K3FA 2BUCA 1W52X 5DTJA 1YSCA 4FDMA 3W2TA 4BP9A 3I2HA 5JD6A 4H18A 3STYA 5HKBA 2JGKA 5K3CA 4CIBA 4UHHA 3BXPA 2YYSA 1GKLA 3C6XA 5ALHA 2OPHA 3STTA 1YB6A 3WIOA 1PFQA 3O95A 5AIAA 2JGEA 4MEAA 4I3FA 1CQZA 3PICA 2VF2A 4H7HA 4XWGA 3ANSA 1CUJA 2PU5A 2OAGA 4PSUA 4J0HA 1SCIA 3DOHA 5CT6A 4AN1A 4FWBA 3R3UA 3WLAA 4EY5A 4NZZA 2P8SA 5JD5A 5ALOA 1XZHA 1CUFA 2DQZA 2WFLB 4C4ZA 1WPXA 4GBGA 1CUZA 2WFMA 4X3CA 1VA4A 5DNVA 2QTBA 2OG1A 1ZD2P 4UBOA 4K6HA 4BCCA 4DIUA 1XZCA 4FLFA 4EB0A 3YASA 4KE6A 3O0DA 3QMVA 2DSNA 4FFVA 2J3DA 1P0PA 4CCWA 4KR0A 2XUFA 1CUAA 3FCYA 4W1PA 1UOOA 3E1GA 3O4JA 4CCYB 3FLEA 5LLSA 4UBJA 1WB4A 1UKCA 4C88A 1UOPA 4Q82A 4B9EA 5FRDA 1SCKA 3KD2A 4UFNA 2X8BA 1EB8A 1QIDA 1XFDA 3OPMA 3DL4A 3D0KA 2WU3A 4I19A 2QUBA 4Y2JA 1VLQA 3IURA 4N8DA 1H23A 3FAKA 3F97A 1CUVA 1R3DA 4WDQA 3WL6A 1JMKC 2QUAA 4UBIA 2XMDA 3VVLA 5DYTA 2CKMA 3A2MA 1AGYA 3V1LA 3VDXA 1XZEA 1WB6A 2BUAA 5AI5A 3F96A 4UFPA 3I1IA 5JZ9A 2PSFA 2Q0XA 2JGLA 3O4GA 2ACKA 4HRXA 5HFAA 1EA5A 2G4LA 2CUTA 2VJDA 1QGED 1DX6A 4KAJA 5HF5A 5AH0A 4H7DA 4FTWA 4HTAA 1P0QA 2XMGA 3X3HA 3WKAA 4WFIA 4Y2XA 3IB3A 3ZI7A 1G42A 1VJ5A 4Y2RA 2RI6A 5ALRA 3C6BA 2QOEA 4AZ3A 4C87A 5DTIA 1EVEA 4AZ0A 2PSJA 4J0KA 4KJXA 1UK8A 3UMJA 2BUBA 3ANTA 3IUJA 2XMZA 1QO7A 1IZ7A 3DEAA 1G5FA 1TK3A 4BZWA 1ETHA 3I2GA 5EFZA 4EY4A 1XKTA 5AP9A 3DKKA 3FSGA 4YK7A 7YASA 2YASA 1CVLA 4MWSA 3FNBA 4INZA 5CW2A 4BE4A 4UHDA 4H7JA 4XIIA 2XMBA 3DD5A 4AO6A 5CURA 4HAIA 4F5ZA 4PSDA 3F67A 1MO2A 3HABA 3ED1A 1I6WA 3HI4A 3BE8A 5AM5A 2C58A 2XUQA 1TQHA 5ALEA 4FBMA 2H1IA 3QPCA 2QT9A 1CFJA 2BCEA 5AK5A 5E2IA 3DJYA 5FXMA 5ALIA 3WK7A 1XRLA 5AI4A 3LP5A 1Z68A 1GPKA 3IBTA 5KWJA 5AK6A 2W22A 2AJBA 5AKXA 4KEAA 1GQSA 1EI9A 5FOQA 1UK6A 1LPSA 2XQGA 4TGLA 1ZJ5A 1YAHA 5AOBA 4WDRA 1H2YA 2CJPA 4H7FA 1K5PA 2XQFA 4J0CA 2XI4A 4GWLA 4OU5A 1LPOA 5LKAA 4BVJA 1UKBA 4F21A 2QKYA 4UPDA 2G5PA 3BWXA 3GROA 2CEKA 3SWWA 1LPBB 2J3QA 3S2ZA 1VE7A 3TEJA 5AK3A 3V48A 1IUOA 3L1HA 1L7RA 4HS9A 1CUDA 3H19A 2H7XA 1EXWA 3MUOA 4FNMA 1CUIA 2ZJFA 3ICWA 1P0IA 2VJCA 1C7JA 3D4LA 2AJDA 1ACLA 1MX1A 1XKLA 3GUUA 3ICVA 3H1BA 3R41A 1W1IA 3E0XA 5I8PA 5FV4A 4LXHA 3HJUA 2WHPA 4FNGA 1DWQA 5AM2A 4H0CA 4AO7A 4BRSA 3FYTA 2QJWA 1YASA 5AM4A 1XZIA 5BOVA 1QIJA 3P2MA 3G9TA 2O7RA 2WIJA 2XUDA 1QOZA 5HF9A 3WWDA 1T2NA 1ODCA 2G63A 1JFRA 3CXUA 1EDEA 4LIPD 5F4ZA 2ZJ7A 1YCDA 4X92A 3NGMA 4C4XA 2RHWA 2OQIA 1SCQA 1RP1A 1KU6A 5DNUA 3BIWA 3B5EA 5C8ZA 1D07A 1IMJA 1DU4A 1EH5A 4J0IA 1MT3A 4LKOA 1ISPA 4Q05A 4XX1A 1QFSA 3G0DA 1LPPA 4C01A 1A88A 2JGFA 1R50A 1TAHA 4UHFA 3WWEA 5DNWA 4V2IA 4J0JA 4L0CA 5LP1A 2BGNA 1DWPA 1CUSA 4BZZA 1OXMA 5C81A 2HRRA 3FYUC 2WUGA 2W6CX 1H2WA 3F8SA 4FHZA 4M0EA 2HA6A 3I2IA 3AZQA 1MAAA 2ZYSA 4QDUA 3QPAA 5AKZA 1W6RA 1G66A 2PSEA 2QVBA 1MNQA 4B83A 2VJBA 1LPNA 3D59A 3DYVA 4BDTA 1A8UA 4LXGA 1FFAA 3PE6A 2YXPX 1FSSA 1HL7A 3QPDA 1UFOA 4ZREA 2WG1A 2DHDA 4RNCA 4B85A 4DMHA 4KACA 1LZKA 5AIBA 3DKRA 3G9ZA 3IVMA 3SX4A 4G1FA 4RE5A 5AM3A 4DTCA 2OCKA 2Z5GA 4OD0A 2GYUA 1TCBA 2ZYHA 3FSGD 5D3KA 4OB6A 1ZICA 2C0QA 5HK9A 4FBLA 3DNMA 3AZPA 4U2BA 5EHZA 1MNAA 2ZYIA 3R3VA 4AQDA 4JH0A 5LYYA 2BAGA 1WHSA 5ALFA 2H7CA 4H7KA 4Y2UA 3R3YA 1QLWA 3D2AA 5AI8A 3QMMA 3IIIA 5K3BA 2DR0A 3HSSA 5DYYA 3CN7A 1F8UA 4UHCA 2WIKA 5ALYA 1Q83A 4Z49A 5AO9A 3AIMA 1XZMA 2FJ0A 4KRXA 2ACEA 3H18A 5BWCA 1HPLA 3R3ZA 1XZLA 3AFIA 5J3JA 4CG2A 4DMCA 1VA5A 4AXBA 4ZWNA 3DQZA 5SYMA 1EK2A 3O9VA 3QM1A 3H1AA 4IH4A 5AI9A 1E66A 1MPXA 3T4UA 5JAUA 1CUHA 2HFKA 4Y2SA 5CH3A 3RKSA 1XLUA 3OURA 3C87A 4BYMA 2DHCA 4X93A 3U1TA 2ZYRA 3H2KA 4KAFA 5AI0A 1LGYA 4UFOA 2HRQA 3QVMA 4MXDA 1OILA 1XRQA 5EHQA 5ALUA 3G0IA 5EHNA 2JGJA 4E46A 5FPQA 3BF7A 4DNOA 4B0OA 1ZIYA 4YASA 1N8SA 3PF8A 2PU7A 4Y2QA 4QE3A 2WM2A 2CMFA 2XUPA 3C5VA 3FLAA 4DNFA 5C8VA 2WG0A 4FOLA 5ESRA 3M3DA 4Y2PA 1AKNA 4UBMA 2PL5A 1X70A 2OQVA 2XUJA 5CTAA 4X00A 3DOIA 4NS4A 5A71A 3QH4A 3FVRA 2DFPA 4W1RA 1ORWA 2XMQA 4ARAA 3KSRA 5YASA 3W9UA 1L7QA 4KYVA 1YS2X 1MX5A 1OCEA 2XQKA 1CV2A 1EB9A 1ZI9A 5AKHA 1QO9A 3UUEA 1TKRA 1JU4A 4KE7A 4P93A 2Y2UA 3WWPA 5K5EA 1SFRA 5A62A 2WFZA 4LHEA 2WIGA 3G9UA 1LZLA 5H3HA 3I1YA 3HLKA 4OCZA 1XZJA 1EDBA 3TJMA 2PPLA 4WCVA 4C6HA 1H2XA 3ILSA 2O2HA 4CG3A 4G8BA 1ZD5A 3S8YA 4G4IA 3AIOA 3GA7A 5JAHA 5IVHA 4AB1A 1HQDA 4X94A 1C4XA 4C4YA 1GQRA 3QBJA 5JASA 4N8EA 4N5IX 1VZ2A 4OB8A 3I2KA 5CT4A 4C89A 3ESBA 4KE9A 1Y7IA 2EDAA 4EA6A 2AJCA 1WHTA 4RPCA 5ALVA 5FDFA 4A5SA 4DSZA 4ZV7A 2PSHA 3AINA 5ALNA 1ZI8A 3WK6A 2VAVA 2X5XA 1ZD4A 3OM8A 4DM7A 1NX9A 3V1KA 1MAHA 2XLCA 3C6YA 4HVTA 3WIBA 5ISMA 3IUMA 3LCRA 3R0VA 4Q3LA 5HFNA 1ZIXA 3K2IA 3G02A 1MN6A 5ALWA 3I28A 2CB9A 4X97A 2QRUA 2FX5A 3H2HA 4NVRA 3IA2A 2J4FA 3PUHA 2WUDA 2ZJ6A 4M0MA 4ETWA 4BAUA 5IVKA 5AM1A 1X2EA 4U2DA 4K6KA 1IUNA 2V9ZA 3AZOA 4FKBA 4B7ZA 3N2ZB 4O08A 3C70A 1Q0ZA 5JADA 2O7VA 4JYPA 1CUGA 1LBTA 2VSQA 2G5TA 5T4HA 1CUEA 5AKLA 3WJ1A 5A6VA 4B82A 1XZFA 4W1SA 2OCIA 1RWQA 3C5WP 1DQZA 1DINA 2QXTA 1BN7A 2B61A 2CZQA 2O2IA 2PX6A 1NU8A 1QIFA 2E3JA 2XUGA 3WKEA 1F0PA 4KAAA 3G8YA 3M83A 1QIHA 2QMQA 1ACJA 3WL8A 1M33A 3V1MA 5T4FA 5JAPA 1W4LA 3HYSA 3GELA 1FFCA 3HZOA 1HBJA 2Y2VA 1IVYA 5C8XA 4BB0A 3ESAA 1E8MA 4QDXA 1ZI6A 3D2CA 1CLEA 1MX9A 2B20A 4QDOA 3BF8A 4X6XA 5HQ3B 3Q8WA 1Q84A 4XJVA 2QXUA 4X7BA 1QTIA 4Q34A 2IIVA 2WTNA 3OC0A 5LZ9A 2VAXA 4FLMA 5FLKA 3KXPA 1GPLA 2H7YA 4BATA 2CBGA 5FP0A 6YASA 4BAZA 2XE4A 4ARBA 1XROA 4TPKA 2WKWA 1PJAA 3CCCA 4X95A 2Z8ZA 1CIJA 3H17A 2B9VA 2NW6A 5HQ3A 3VVMA 3QYJA 1DX4A 3K6KA 5D6OA 3IULA 2OGZA 4UHEA 4BBZA 2WSLA 3HC7A 2GBCA 3PI6A 3KWJA 2I3ZA 5JANA 3RM3A 4Q3KA 4DNQA 3WK4A 1CUUA 1K8QA 3WA7A 1W76A 3TRDA 3ZLTA 2XUKA 1XRRA 1U4NA 1IZ8A 3A2LA 1N5MA 2DQYA 1DQYA 3LIPA 5ALGA 4Y2YA 3I6ZA 2AXEA 1AC5A 5ALMA 4OYLA 4ZGBA 3HXKA 1O6GA 4G4GA 2LIPA 3W04A 5JD4A 5LZ4A 1O6FA 1UZAA 4W1QA 3FYUA 4FFWA 2VTVA 5JIBA 2XUHA 1SC9A 4H7IA 3BDIA 1CUBA 1YA4A 3L1IA 2OGSA 2XLBA 5CT5A 1E3QA 1YA8A 4LYDA 4UUQA 5CH5A 3WYNA 2O2GA 3H2GA 5AKEA 2VT7A 1P0MA 5SYNA 4Q3OA 2IITA 4DSAA 5EIEA 4RE6A 1E5TA 2IX9A 5EGNA 4P9NA 1BROA 2HA2A 5DLPA 4RGYA 1H22A 4B80A 2HHAA 1ZJ4A 3PFBA 1R9MA 1BN6A 3HEAA 3LIIA 3WKDA 4H35A 5I9IA 3RLIA 3T52A 4OU4A 3DLTA 1UK7A 5CMLA 1FFBA 2WG2A 4QDTA 3FVTA 3G9XA 3FBWA 2WILA 1U65A 3H0CA 4X71A 5EI5A 1E89A 3IUNA 2J4CA 1J2EA 5IVDA 3NUZA 2I3DA 5AM0A 2V98A 1JU3A 1Y7HA 2HA4A 2JEYA 2HA5A 4BAGA 3IUQA 1UT6A 4B9AA 4HZGA 2PSDA 3VJMA 3ESCA 3FOBA 2WHPB 5EIHA 2R11A 1TCAA 1E8DA 4MQLA 3D7RA 3PFCA 2QZPA 5AKYA 4DGQA 4OUKX 4H77A 3ZPXA 5CT8A 2GBGA 3GBSA 1XQWA 4GEGA 1C7IA 2Z8XA 3FWHA 4BTLA 4F60A 4PQEA 2PM8A 2BKLA 1R4ZA 4EZIA 4S0XA 4UBNA 4A23A 1XQYA 1N5RA 4Q1VA 3AUKA 3O4HA 1CQWA 1QFMA 4JEIA 4E14A 1GXSA 4G8DA 1YB7A 3WK5A 1QIGA 2XQJA 4AMZA 3OG9A 3OOSA 2XMSA 2R8BA 2B4KA 1KU0A 1L7AA 4WFJA 4JYMA 3WK8A 5EHXA 4U2FA 4J03A 3AILA 1THGA 3PDCA 1YS1X 5ALJA 1WOMA 5HF8A 1A8QA 4QA9A 1AX9A 4W63A 1WM1A 2GZRA 1U2EA 3UUFA 1VXRA 5AJHA 1BEZA 4GDMA 3C8HA 4HXGA 2Y6UA 1CUXA 4X85A 2HDWA 4ZV9A 1EINA 5A2GA 3BJRA 1IUPA 5ALDA 1N1MA 4BVLA 2DCMA 4JNCA 5LZ8A 3JWEA 1AZWA 3G0GA 4K5QA 5BWBA 1DTEA 4CCYA 1QIIA 4QLAA 2Y1KA 4G9GA 3W05A 1MTZA 5KBYA 3AJAA 2WUFA 5ALXA 5LZ2A 4GLBA 3HACA 4M0FA 4ZI5A 2OAEA 2PUHA 4ITVA 5EIAA 2XQIA 1JKMA 5LKRA 3C6ZA 1BU8A 2QJRA 1AMNA 1XZAA 4WY5A 3EBLA 3FCXA 1B41A 1ZOIA 4BDSA 1LPMA 4IH1A 3JW8A 5JZSA 3JYHA 5A7GA 5T4BA 4B84A 1CR6A 4G9EA 1PV1A 2VEOA 4Y2TA 2PUJA 2ONCA 4W9RA 5E4JA 1LNSA 4KE8A 4U2EA 4J0GA 4UBLA 5CRIA 3WYDA 5K3EA 4ROTA 5IKXA 1CUWA 3K9BA 2OGTA 5C7YA 3E3AA 1QIEA 2RONA 1R9NA 5DYWA 2WJ3A 1QIKA 2HA7A 1QTRA 2PKYX 3EF3A 1EK1A 1VOTA 3STWA 4IH9A 3ZWQA 4J0DA 5DJ5A 4MYSA 3D2BA 1UOQA 3A6ZA 4YPVA 2XMCA 3W9BA 1ZGBA 1QJ4A 5IVIA 2GBFA 4Y2VA 3G7NA
chains in the Genus database with same CATH superfamily
3DYIA 3PQ6A 3RVPA 1HNWB 4N5HX 4AURA 4E3ZA 2VTKA 1K3TA 5B6JA 1LWOA 4DLNA 1M2HA 3R3XA 1TGYA 3LA6A 1KEEA 4TYYA 4N01A 1FYFA 1C81A 3UJ3X 1PWHA 2FZGA 1FMCA 1RXVA 4GWKA 3G23A 3WSTA 3K3PA 4IWNA 2UXCB 1QE5A 3AEKA 3H8JA 1K6EA 1SXJB 2P5YA 4RD4A 1IONA 1KI8A 5FQNA 3VOTA 5J2UF 3DWFA 3F78A 4OQZA 1NXVA 3OIDA 2GEDA 3FDZA 4QNMA 3U4GA 1B6TA 5JC1A 1YR6A 2QSJA 2V9CA 2ZKLA 3ZK8A 2Q3EA 3BCSA 5K2OA 3Q41A 3ZWKA 2QLNA 4I5DA 4XOUA 4MCAA 3X1YA 3IAAA 3ZV7A 4UEQA 4ZRDA 2PT9A 1NAIA 3P71T 4UW9A 1MJHA 3P0JA 2P2ZA 4V0RA 1XRPA 5FTLA 4M55A 5FQOA 4TYWA 1QLJA 3CNHA 1IOVA 4A0QA 2V1XA 2W8ZA 4IXMA 3ZZ1A 5JATA 1VXOA 2JGNA 3SSOA 4EMTA 1M5RA 2EXXA 4ZEMA 3ZOZA 3IT0A 2BZ0A 4POOA 5BV1A 1ZH4A 1WPRA 1YD7A 2AJ8A 2QQGA 3K8ZA 5FUXA 4ZYZA 3AIKA 3ND8A 4LZPA 4V3BA 1MGOA 4WAUA 4ND6A 1TMOA 1EHYA 3A3PA 2XRZA 2HRZA 3L7OA 1SOWA 2MYUA 3ZY4A 5IDQA 2GGSA 1DAOA 3ONWA 4GPD1 4X1YA 1RACA 1CDOA 1PR4A 5IDVA 1S3IA 2OO3A 4KX3A 3V8NA 1QRSA 1XPRA 4CDGA 3M4XA 2IHZA 4J90A 4KO1S 5TT1A 2QTAA 5I7HA 4B87A 3VMMA 1HKHA 4AJ1A 3FN4A 4G0WA 4TMFA 2R44A 3KQKA 5B58T 1SVSA 2ODEA 1FRNA 1XZKA 1YR2A 1O7JA 4J3JA 4NK4A 1WXHA 3ZLVA 2RAVA 5FOVA 1BHO1 2ZITA 2O0LA 4HUQB 5M2QA 3L79A 4QWMA 3OZIA 3RJZA 3SQMA 3FCEA 4MPPA 1W4RA 3M1IA 1JVBA 1S1MA 1XLVA 4E5KA 3AL3A 4DRZA 5T3YA 3EDRA 4I3HA 4HT3B 1RHRA 1CJSA 2IXBA 1OYWA 2BHTA 5DHFA 1H1LB 3ZHVA 4DHWA 2O7SA 1H2ZA 2I1LA 3T5PA 3OT5A 4X62B 2C5FA 3VZQA 4Z3OA 3BTUA 1YR8A 4K6GA 1UKAA 3O83A 3HJFA 2FB9A 2QN3A 2WJ4A 3DZFA 4L0MA 2XTZA 3EIOA 3T4XA 5CYFA 1VHQA 2E5FA 2OYRA 4JGIA 4YUAA 2DPMA 1J97A 5DM70 4AK9A 2WIFA 1Z2DA 2KJQA 3LXUX 4XWWA 5J5VA 3WKCA 1HYBA 5EAIA 5FKJA 3NOXA 2ZANA 3HBMA 3NTVA 4G81A 3FGPA 3IERA 4F91B 1FMFA 2BV3A 2YMPA 4GPZA 4M83A 5F7ZA 2OSBA 4NL4H 2V96A 4ZOAA 4EUFA 4KO8A 1QQBA 1MORA 1WHTB 2P2YA 2W6ZA 3OM0A 1AKYA 4L3WA 4LVOA 3RSCA 1LLFA 2C7VA 1BA2A 5INTA 4D97A 2HU5A 4KGZA 4MYDA 3SZMA 4PAOA 4JU8A 2HB6A 4CEHA 2KQUA 2QM8A 3ADOA 1WCYA 2ONYA 4IDNA 3H2BA 2AE1A 4OMDA 2FSHA 3K1TA 4IX1A 3DEHA 4R1SA 1MHPA 2G3YA 4NMXB 4B3DA 4Z7JA 1AJEA 4JYBA 1LXCA 2IODA 3SYRA 3TRHA 5HE9A 1PFVA 4B6RA 5J4KA 3ZIUA 1RZUA 1WMEA 4GYKA 1OZGA 1YVRA 3QUQA 1EFHA 4FS8A 1Q3TA 2IYZA 4PZZA 4Q1BA 1YDHA 1P2FA 3N0VA 3O9MA 4WOPA 2Q4RA 1RFGE 1RRMA 1TC2A 4YAOA 1U2TA 1UP4A 3O8QB 1XZBA 1NLUA 2BBOA 2JFUA 3PYXA 3V1YA 3ZG6A 1VTKA 3KSZO 3EHDA 3WKBA 1LF0A 1P61B 4QYMA 1NBIA 2PIDA 3OKPA 1K89A 3QKWA 5IFLA 1HEYA 5C0OE 1ZIDA 2YNMD 4NXNB 4PO9A 1O77A 3VKHA 1BGXT 1DEKA 2Z2JA 4AQ7A 1B6RA 3I58A 3S2EA 3U80A 2VF8A 1DV1A 3WLHA 4HXFB 1QBKC 4XGKA 8LDHA 4C3VA 2X86A 3WLNA 1M34E 2RJOA 3E7PA 3OLCX 4TUYB 1G9TA 1QANA 1K92A 1X7YA 5CJPA 4BJHB 3J81A 3PZRA 2EZTA 121PA 1XCJA 2CLDX 2FI1A 2F1IA 4GXNA 3WB2A 4DCJA 4LF7B 5E6SB 4RTRA 1VBMA 4R1TA 3ICOA 3NBUA 4BL5A 3C45A 4PC2A 4CQMB 3CWZA 4AJHA 2HA0A 4CV1A 821PA 1XSEA 5HJEA 3DF9A 2ERYA 4RPLA 5G1NA 4H31A 4LGMA 3I04A 4HADA 3G0CA 4KXXA 2NXEA 2IPLA 1FJ2A 2WI8A 4LTDA 1IVSA 1RI1A 2BGLA 2C4UA 3LH5A 4RMIA 5I5GA 3KKPA 1JFFA 3KT8A 2CYBA 3EXIB 3NVDA 3TSYA 2DX7A 2QS9A 2VHXA 3SS9X 5MFPA 3EA0A 5ITWA 1H6CA 1JR3D 2FEXA 1M0TA 4UU8A 5HK8A 2JAUA 5FD8A 4RETA 4HXEB 3AP3A 4QODA 1USVA 5E1BA 4Y6PA 4EG0A 1O97C 3DEJA 1KI7A 1H3FA 1JNXX 1VL1A 3L8ZA 4YGXB 4XDZA 1MAUA 5HKAA 2JBAB 5CPBA 3TF5A 3FNIA 3H1PA 1YDWA 2FJUA 2DFTA 3LLCA 4LJ4A 4R7GA 1W0CA 3PBKA 4QUGA 4E5MA 5HIAA 2BEUB 1QZ3A 1Y5NA 1FXWA 1Y63A 3A9UA 4LE0A 1QGOA 4ONEA 4Y6RA 4NCAA 1L7DA 3VR6H 1Z26A 1QCYA 3BHJA 1TE2A 4PNZA 3OF5A 2HXYA 3V3KA 5FHQA 1PW7A 1A50B 1CBUA 1EP3B 1FDWA 2PBRA 2ZT7A 4ND5A 1ZN2A 1IWOA 3WGQA 4B6QA 1VHJA 3MEQA 1DX9A 2VDKB 3HS3A 1V6AA 2RHBA 1RCUA 4HC4A 4X6YA 3D1JA 3HKEB 4MVJD 1DWUA 4BQFA 1V47A 4FB5A 1E3IA 2Q3FA 1ENYA 3C3WA 3CSDA 3EULA 3EQ7A 3IALA 4I5EA 3QXHA 4P4LA 4P98A 5BXYA 5CBKA 1M1ZA 3LUKA 4NV1A 4WGFA 2O2CA 5KHAA 1E2EA 3JZFA 3SC2A 2ZVDA 1UC9A 4B1FA 5BNWA 3PCRB 3B52X 4L08A 1DAHA 3CU5A 1NUUA 2PGLA 3EDOA 1L5ZA 4LJKA 3S28A 5IUKC 1JT9A 2X8LA 3GJZA 2UUCB 2Q6OA 3HJNA 3F6PA 3DC7A 2H52A 3NV7A 1LPAB 1WZCA 2O2JA 5LQNA 2RGGA 3HJTA 4EX6A 2A0KA 1YJ8A 2WIDA 3H6KA 1T1SA 4Z4CA 3I52A 4URZR 4BU1A 4DZZA 4TS3A 1HH4A 5LYJA 5B37A 5EJ4A 1ZYUA 2QN9A 3R6TA 2IV3A 1FNSA 4MWTA 4I55F 3B1XA 5A9SB 1D6JA 1NR5A 1Z2EA 5KNDA 3LBNA 1Q0TA 3UY4A 5DYGA 3UN1A 2ZVPX 3IX7A 5J43A 2NV0A 5B2FA 2BHLA 2HLNA 2C4HA 2GYVA 1YA6A 2O5CA 2H9IA 1MF7A 3UG6A 4EHKA 2NUAA 4QXRA 2Q5LA 1M2NA 1YBAA 5BSEA 5JMOA 4AJEA 1NR1A 4GECA 2X14A 4RH1A 1JH9A 3DAFA 4E4RA 1BTOA 1VE3A 2BHSA 3B2EA 3NW9A 4UHBA 1UMDA 1AF7A 4F6RB 5EJ2A 3B9QA 1GPUA 1S8FA 1W1UA 2QI9F 1ORVA 1XN4A 2WIAA 1JDUA 3DXZA 4M7WA 4TVOA 3TLKA 1J0EA 3EIHA 3Q6MA 4F3CA 2QTVB 4QVIA 3FY4A 3QITA 2VJYA 1MB9A 2CLKB 2J31A 1RT9A 1BRTA 1EWYA 3OMXA 4FYXA 1RXSA 2AKEA 1G98A 2JNWA 4TZ0A 1T8SA 2I55A 2BFFB 1K5HA 3NRJA 5LA6F 3ZD6A 5LUBA 2FE4A 5LZ7A 3DOOA 3RRFA 1G59A 3NP7A 4O4JF 4HQOA 1BEEA 2F1OA 2JFZA 2MR5A 4GWGA 4QBIA 3N2GB 5D01A 1GKYA 2WF7A 1L4YA 2NO7A 2WU0A 3AHGA 3OTGA 4J0QA 3X1WA 4A0SA 3HJAA 1GUFA 3PWSA 3N8IA 4CMIA 1JFSA 2ZIVB 3LQ2A 3TOXA 1ZCZA 2PAAA 3T5CA 2QVCA 2F00A 1XYYA 1GT6A 3BTOA 5JSFA 5ADWA 3EEYA 1G3QA 1P17A 3CWCA 4HNHA 5UKDA 2ZCJA 2WJYA 1JKXA 1Y3DE 2GBIA 2J0EA 1QRDA 2IPXA 3LECA 4XM0A 3RUEA 3EG5A 1L6RA 4HNAA 1PK8A 2NTYC 2R4QA 4QJBA 2HU7A 5TPZD 3TRKA 1J6UA 3G5TA 4DJAA 3AHIA 3GLQA 2OMKA 4Y7DA 1AQJA 4MITA 1WXQA 5DH9A 5K3SA 4ENSA 1NXWA 6REQA 1RRGA 4XPIA 4QZVA 5KU1A 1LBSA 1XMXA 3B12A 3GUVA 3GJTA 4YWJA 3T7SA 3THXB 1MR3F 2VP9A 3OJOA 4LDQA 4QPJC 4OMFG 3B6JA 1YBVA 4M8LA 1F06A 1MJ5A 3FJ1A 1K86A 2V3VA 1KOGA 3NM4A 3BMOA 3PKZA 4IAOA 2R85A 1MT0A 2C77A 3QVKA 1C9MA 3AUSA 1DBIA 4P4UA 3CG0A 3L5OA 2O3TA 4B6PA 3C7CB 3THXA 4Q39A 2DUMA 1BWPA 3C1TA 3RSZA 3W5IA 3BORA 3ZIAA 4BE9A 1XNHA 3ENWA 2UXDB 1JFLA 2ZJYA 5ELXA 3H5TA 3E9QA 2VZ0A 1DMSA 1SRRA 3K2EA 4N9WA 1W7AA 4V38A 3OSUA 4HNAB 4CT4B 5HZGA 4YLEA 1L8OA 4F6CA 4ZCTA 4TSKA 4XB1A 1RC8A 1GILA 5JJCA 4KXQA 4KP7A 4NRDA 4X90A 5L3ZA 1WXWA 1PQPA 3GGGA 3NBAA 4UKDA 3TL3A 2L19A 4B35A 1SXHA 1R37A 2FG5A 3QLEA 2IIBA 1B8VA 2QX6A 1NOJA 1XMJA 5CLHA 4DKXA 5JZVA 3NLLA 2FPLA 4HNQA 3FTQA 2HCBA 5FWYB 1P7WA 4PN3A 3HYNA 4M46A 5ENZA 3E3LA 3JQBA 1B8UA 4I6GA 1EJ2A 4KVFA 1Q0RA 2VOJA 1FUUA 3OZFA 2GF0A 2ZTVA 1ZD3A 3CBQA 4TMKA 2CD7A 1G8KA 3B3JA 4JCCA 4A16A 3IP8A 3QKRA 1J7KA 5EPOA 3WRYA 4OJQA 3EY4A 4DRYA 4L74A 5CVEA 1ZOSA 4Q7JB 4MHTA 3IKTA 1DBVO 1HSOA 4P08A 4PX3A 3FYUB 3HWSA 3KWFA 5K4HA 2BM9A 1IIRA 4F6RA 4CKWA 2FQXA 5DLQC 2ZSHA 4GI1A 1W49A 2ETXA 3EJWA 4Z4FA 5GJCA 1ULZA 1WZIA 2O23A 2PL9A 2R6JA 3FVVA 4KV7A 4MRPA 4CF6A 5C4MA 2VUSA 1ZL2A 2VXYA 5EINA 2DBQA 1XZDA 4DNPA 4CG1A 4KIJA 1EWQA 3NKFA 5AW1A 3DL7A 3BFXA 1Y34E 2CWWA 3OUUA 1VCMA 2CLCX 5KWIA 1RWVA 1A3CA 1WUKS 2BTEA 4HDOB 4X6UA 4BO5A 2FUKA 1F51E 3F46A 2Q7XA 5ULLA 3GJ6A 2HJGA 1XPOA 2HSGA 3UC9A 2VG8A 4U39A 4DCMA 4KWCA 4REOA 4E15A 2ZXEA 5DN6D 2Y05A 1ECCA 1HZZA 3QUBA 3ZZNA 4JBNA 5CA1B 1XHLA 1JQAA 2HAEA 5HILA 3I3SR 3TPFA 3N8GA 3F6EX 5K0GA 1B6GA 1EG2A 4YRRA 5BN5B 3HQ4O 3CVXA 1TTPB 2JGMA 3IIKA 4YXWA 5DSZA 4BMDA 1EDDA 1JI3A 1SUEA 1U28A 2C9CA 1EBFA 4HDRA 3BHMA 4OJYA 5BV2P 4RTOA 5JDCC 1KJQA 2EZ8A 3U4QA 1NVKA 3PHCA 4FIZA 2ECKA 1BCRB 3BIXA 1ILEA 4ZGGA 3URKA 4WN9A 1PN3A 4QULA 1I7QB 5C51B 2YFQA 1V45E 2ZT8A 4QU5A 2XUIA 4LTMA 3FF4A 3ZJUA 2DHQA 2WLSA 2QENA 1C1HA 2XF2A 1U3UA 1QONA 3IVAA 4AJOA 1TRKA 2ZRKA 4BNDB 2GCPA 4C05A 4CFSA 2APJA 2OD7A 2RC6A 2GM5A 3F8TA 1OTHA 3ROGA 5E8RA 3EGXB 3DAPA 1OQAA 5A3JA 3FWYA 4UUNA 2J6CA 1L1RA 2ZZNA 3DFIA 1QM5A 3MRTA 3V7WA 1C3JA 2QUJA 2Y99A 1RWBA 1LDMA 2ADOA 3D0OA 4MUBA 4P4SA 1TW3A 2A14A 1S4MA 4BKPA 4DVGA 1SCAA 3VKGA 3G68A 3JYLA 4TV8B 2NPOA 4B80A 1KO1A 2VJOA 5CT9A 5GM1A 2ZBFA 2JIPA 3P8ZA 1MP0A 2C4VA 1TYBE 3BD6A 2HZBA 2VA9A 2QAJA 3TCNA 4XOIA 4YJ2F 1O94D 4D9IA 1GZ7A 1C9JA 1NSTA 1VLJA 1R6TA 2FGJA 4DJTA 1HDEA 5EJMA 1AB5A 4B3FX 3WQHA 2WE8A 4BOYA 2OMEA 3W5DA 2VNJA 1X3SA 4LYAA 1JFVA 5C1OA 4UJ3A 4LBZA 4XRGA 3T3MB 4DRXB 2AFIB 3N2LA 2YR0A 1I24A 1SD5A 1O5OA 1T9GR 2HEIA 3QMPA 3R7LA 1NW3A 2HMSA 2J08A 3HKDA 4PIPA 2ZFUA 5D51S 1ZMTA 1I1OA 3DNFA 3AR8A 1B0AA 1ZA1A 3D4OA 4Z8YA 5C5DA 5CD9A 1R5OA 1IBSA 5C2JB 1CLUA 4TLMB 1XPJA 1R27A 1QO0A 2LVBA 1IDN1 2Z3WA 3SYMA 4E2ZA 5KQGA 3KCNA 1YTLA 1WIWA 5E4TA 1YDGA 1OPXA 4M89A 2QUHA 4NQZA 2Y1OA 3JQ8B 4V1CA 2ZUEA 3QFHA 4R1LA 2A8YA 2C31A 1D4ZA 3ORRA 7AT1A 5AESA 1RKXA 2JIDA 2ZTMA 3C98A 1LDYA 2JGIA 3DWEX 2IFTA 3FHJA 5AJVB 4YT2A 3DLHA 3I9MA 1WCIB 1D8TA 1UL1X 4HEA1 4INOA 4MWCA 2WZQA 3WQBA 1QB8A 4B81A 4Q4JA 5C52B 5ALKA 3IJ5A 2J6BA 2VPXA 3KKQA 2JJ2A 1P9OA 4G5OA 5K3OA 5I9TA 4QDZA 4IEFB 1QUEA 3LUJA 1Z28A 2AN9A 1CQPA 5CB6A 1RFLA 4U6QA 2ZSKA 1B0UA 5AVJA 3T95A 1CT9A 1EFVA 3Q0EA 4MZXA 3I8SA 4GFDA 5DTJA 1ABFA 2Q9CA 3PGXA 1TZKA 2PD3A 1KEVA 2BHRA 4O4HF 4A8JB 5NLLA 4AKSA 1H8ED 3I2HA 3UK1A 4NSNA 5I4IA 1GL7A 3OA0A 2GJ4A 4H1HA 1JHMA 1M6VB 2AHRA 4RVOA 5FTKA 5K3CA 4BUZA 5HKBA 3GJ8A 2W6ID 1ORRA 3WGGA 4EZBA 1J42A 3DBHB 2AG0A 1FNCA 1GKLA 5AQEA 1JKJB 3KM0A 1IXYA 1H5NA 1ZSVA 3V4PB 2UUAB 1WF3A 1O9HA 1GPMA 1ZG3A 5CUQA 5FPHA 5BQOA 3HBNA 3GUCA 4G3XA 3JQ9A 4X5OA 3SR3A 3GUZA 3A26A 3G2QA 2EGUA 3MJ4A 1NVEA 3SHFA 3WR5A 2QMHA 3TDKA 4B2YA 2ZRJA 1S2MA 3RYHB 1RYNA 2Q5IA 3ZWMA 4HAWA 4KN9S 3IP6A 2MYNA 3N7UA 2Z1NA 4KB5A 4TV9A 4BE7B 5ERYA 4FWBA 4GOXA 4LK2A 1Z5GA 3E1SA 4DIOA 2JK1A 5L4NA 3K35A 2P2DA 2JS7A 3IDFA 4GXTA 3S70A 4B7AA 5CFNA 3IQDB 1ZJJA 1UC5B 1ZVMA 2JFNA 1PD1A 4JENA 3SXUB 3MJRA 3K8YA 1CEYA 2CNWA 3AVXA 3BMXA 1HGXA 1HETA 4EEZA 1RI5A 4A2WA 1DPFA 1J25A 4D9BA 1D4AA 2ECQA 2W2LD 2XAAA 1KF0A 4QUIA 3RQSA 1U7HA 3ZQ4A 2GK6A 3NGLA 1NIJA 4W7HA 3E9CA 1AHNA 2YINC 2HJVA 2C03A 3GCDA 3ORQA 2VZ8A 4GBGA 1TAGA 2WFMA 5JADA 1H85A 5CVDA 3OEEA 4KPGA 2JZNA 5DNVA 4UCQA 2G71A 2Y67A 1A95A 5IN5A 4KHZA 4WKCA 4F93B 4EA9A 3JAWA 3L8YA 3CV3A 1ZD2P 3MG9A 4MB0A 4ZI7F 1C1DA 2B5OA 1VL0A 4QOFA 4RPIA 4BCCA 1XZCA 1D7AA 2DPHA 3D5QA 4HNGA 3PRJA 2F3UA 1IM8A 1G0NA 4LOIA 1WW2A 4C9BA 1HURA 5JTUA 3OOYA 3UAOA 4YDRA 1SQ5A 3PNLA 5C32A 4KPEC 1DIAA 4P54A 4PSAA 1PJSA 1W5BA 1Y1QA 3NT5A 4Q21A 3OLYA 2NV2B 4ZO4A 1I4EB 2Z5LA 2BISA 1Y48E 3NQ41 4OFBA 3F90A 2ZRGA 1WY5A 5K51A 1KS2A 1JSXA 4OP3A 1G8FA 4RHYA 4E5DA 2XE6A 3QFFA 2XUFA 5ESXA 2QTLA 2RDMA 4UMDA 1U0HC 2HBRA 1OZAA 3FCYA 3IVCA 4W1PA 2PMEA 3WNQA 3WLSA 3ZVLA 5JMTA 3RAPR 1SR8A 1W5TA 5JWRA 2ODWA 3WNZA 1ZR2A 1RPZA 2CDRA 3CZRA 1NJGA 1QH0A 3D4PA 3IEMA 4YAJA 1DAMA 2FH5B 1MJGM 3F3YA 3H83A 4KQEA 5EWJA 4C88A 4Z7NB 1SBZA 4Z4HA 5B3LA 2FU5C 4FEEA 3ZWYA 1QS0A 4K6CA 4XQCA 3S27A 4EKDA 3FR8A 4NJMA 5I9MA 2P6PA 2XUZA 3SYTA 4DG9A 5C80A 1YMUA 3KQSA 1P7PA 2C9OA 4NCNA 4RFSA 4H17A 3Q7SA 1Q7GA 1U11A 2PANA 3SFVA 3OPMA 3WYEA 2Q5OA 3DL4A 3PC4A 1T4CB 4G6ZA 3LVFO 4MW0A 1KZ6A 1M6NA 3CX6A 2FSSA 2VZEA 3TX6A 3LAWA 3KTOA 2BRUA 1C1YA 3N2IA 5BRJA 4LOAA 3GPLA 2F2TA 3OQIB 4LBWA 4Y2JA 4I9UA 3TAXA 1ZHOA 4FXOA 1X7DA 2HPVA 4N8DA 4Q9DA 3GEHA 2AR7A 5CB4A 1T10A 3PJDA 4G85A 2X3YA 5J5CA 4UQLA 2C2ZA 3KEGA 3OA2A 3NHUA 3KHKA 3CEMA 1JMKC 1J8VA 4U9IS 3RYFB 1JQEA 2WMNB 2QUAA 4OAQA 3DCYA 5JO0A 3F73A 2M6LA 4CEJB 3A8TA 1ZW6A 3CM0A 2E4ZA 2GHIA 3ENVA 3M5CA 1ML3A 1GU0A 3VVLA 4EI9A 1G8YA 2CKMA 2YWDA 1NQTA 1JVSA 2XCRB 2RB5A 3F8WA 5EHGA 1H5QA 3G89A 2XHEA 5A3QA 1GRCA 4H2DA 4EABA 4XB6B 2Q41A 1KYWA 2PGXA 3KXIA 3THWB 2ZUCA 1ESMA 3I1IA 4LQDA 4MYUA 3L0BA 2PSFA 4UPVA 3W1EA 3U16A 2IZ1A 2OL4A 1SIBE 1G7CA 1GRQA 1GZVA 4REMA 3LPNA 1WXIA 5JUWA 1GIAA 1PK7A 4G0QA 2IYTA 3O4GA 4D41A 3KKOA 2HQRA 1EA5A 1RBMA 2X22A 4JZYA 4DWJA 1WCWA 4MR8B 1K6XA 1GEGA 1R5BA 4AROA 2PUDA 1XMVA 2P3QA 4FN5A 3SSMA 1NQ5A 1ARZA 2C2KA 3E18A 4FUTA 4J43A 4KQKA 4LUCA 5LOVB 3M6FA 2CV2A 4KGVA 2D62A 2QQ0A 1Z39A 4K26A 4OBXA 5CLFA 1A1VA 1Y3BE 3HYTA 3IIMA 1VIYA 1QGED 5CIYA 3ILXA 4KAJA 2AS0A 4RFVA 3AWIA 1NMQA 3IIEA 4EW6A 4H7DA 4FTWA 2V8OA 4HTAA 1P0QA 2PMFA 1U2GC 2GLTA 2OGWA 3O03A 2RK6A 2YXDA 3Q8XB 1U63A 1GPDG 3HUDA 4PTYA 2BEVA 1T4DA 4XTRA 4QQ8A 2JH9A 2E4VA 2NVWA 2W48A 3PKJA 3PRHA 4MDHA 3ZI7A 3KQTA 4MYTA 1SBIA 2ZLBA 1VJ5A 5JZMA 4W7SA 1ADGA 4IQ0A 1TQ4A 1WO8A 4N3AA 4ZQCB 2AQKA 1W5SA 2FHSA 1CJUC 4I9FA 1N5JA 1C9NA 1W581 2ZSJA 2A6PA 2VTEA 1SEPA 1EVEA 2VP5A 4CKEB 2PSJA 4J0KA 4ZC1A 4JJ7A 3LW7A 4YT5A 3H1FA 4F2GA 2C78A 2QRMA 2CVHA 1MOQA 1T34A 2Y1DA 2BUBA 3IUJA 2DWPA 1JQ5A 2XMZA 4BWFB 4RORA 1W30A 2RKOA 1KOLA 1ETHA 1W8DA 3NH6A 4EY4A 1XKTA 4MA4A 1UEXC 4P3XA 5AP9A 1WPGA 1UMCA 4DPKA 1OTXA 3LYLA 4AY6A 2ZYGA 3L5KA 4UMEA 2HQ1A 4IV8A 4KFUA 4O2AF 3R77A 1CE8A 2H5JA 2OR3A 2WTEA 4UMVA 3KOZA 3EZ2A 4CV2A 2HHCA 4V0KA 3FYSA 1OLSB 3CVOA 3SQXA 3GLHA 1BEUB 3AFMA 2AN1A 3MYYA 1BS1A 1I4LD 2EGGA 4TWIA 7REQA 2D3TA 4LC1A 1JXMA 5TV2A 5M29A 4TWRA 3GYBA 4M99A 4XIIA 4G07A 3RTAA 2FR1A 3VSDA 1M1YB 1W9HA 2X4DA 2C7QA 5E0KB 2IHVA 3KZXA 2WTXA 5CA0A 2H57A 3LBIA 1QGAA 1MOZA 4IRXA 3RU7A 2YHUA 4NCIA 4PSDA 5IMSA 3GLIA 2F64A 4GG1A 2JZCA 1YJXA 1BW9B 1OKKA 1PKEA 3BE8A 4G23A 1QVRA 5AM5A 1X9HA 2C58A 4ALMA 1FMLA 421PA 4F84A 4Z86A 2RHDA 2K87A 1U0FA 4FBMA 2H1IA 4RCVA 4YQFA 1CFJA 1YZ3A 1CFZA 5AK5A 8GPBA 1NVUQ 3JAKA 5L53A 3ZCTA 3JWPA 3DMDA 2IQ5A 1T3TA 1RABA 3FUUA 7REQB 4HCJA 1EEHA 4CN9A 3ZHBA 3JTMA 1XRLA 1A76A 1P5HA 4OHMA 2WSSA 3G2PA 5F76A 1XQ6A 3TNDA 2ANCA 3KOMA 1PJTA 1GPKA 1WAMA 3IBTA 4WVFA 3T1TA 1PR1A 5BN4A 2AJBA 4D9MA 5AKXA 2G04A 1Z3CA 4W5QA 5K8UA 1EI9A 2XADA 3D8NA 3VR4H 2NN3C 3IP1A 4WCFB 4F2PA 1KQNA 3A04A 1LPSA 1M8GA 3K15A 1ZJ5A 3H5AA 2ZWPA 4ZJPA 4MZDA 4WDRA 4H7FA 1K5PA 2XQFA 3BFVA 3TTSA 5AW3A 3COSA 4EMBA 1VJGA 4J0CA 4GWLA 4EHNA 3S1LA 2HXGA 3QLVA 4RHEA 4AWXA 5LKAA 2GKGA 2YV1A 1K8XB 1G60A 3S1AA 1EM8A 2QKYA 4V0QA 1M7BA 3PRKE 2CNBA 4PG4A 4TKZA 3WJ7A 3CUTA 1NW9B 2HRCA 3EN0A 1LX7A 2DCUA 3ESRA 3I5XA 3GWZA 3HN7A 4GPIB 3SG0A 4WLFA 1W2WB 2QE6A 3AF6A 1GCAA 2PGDA 3HR8A 1IQRA 3QU5A 1HE5A 1WRBA 5A4AA 2BR4A 4ZVMA 2AD5A 4TRMA 1IUOA 1HV8A 3NAZA 5IDWA 1KE1A 2QLBA 1E1QA 1A27A 3H5WA 3CH7A 4XDGA 2VCYA 1CUDA 2C9YA 2XT6A 3H19A 1Y6FA 3A1TA 4JLKA 2BVNA 4AT1A 1NPYA 1NQXA 2CUKA 4CEJA 1DEAA 4FNMA 1SMKA 3VGJA 4M6WA 4WWHA 2X6QA 3FPFA 1CUIA 1MTOA 2C3YA 3EFHA 3NS7A 3O9ZA 5DTQA 2R68A 1QCDA 4HYYA 1FLDA 3A1SA 4IF6A 5DK4A 3UV3A 3VC1A 3ZUPA 3KTFA 2I9KA 2WYHA 1IC6A 1TMYA 4EFMA 3UJ8A 3K2BA 1SC1A 2C8VA 1XKLA 4G63A 4E33A 5LLDA 2OLJA 1J00A 3H1BA 3SZ3A 1LRLA 3SJZA 2CLFB 3QEJA 1S3SA 5LXTF 1U1CA 3F1KA 1R3UA 1T5IA 2B3DA 1HDXA 3BK7A 1CDEA 3Q7TA 1A9XA 2WHPA 3QU9A 5KC9A 5IJ9A 4B73A 4H0CA 4YAGA 4FS3A 5HJ7A 1T29A 4NDZA 4WUVA 3A3YA 1YZUA 4P7BA 1L5YA 2JL1A 4AO7A 4DSNA 1YASA 4OXNA 4DV2B 4E1BA 5H59A 4G25A 5A0VA 1F9EA 4MLCA 3I6IA 2IHBA 2N75A 3PWKA 4IXDA 4RVSA 1JP7A 1ISGA 4G0XA 5H81A 2E18A 3P2OA 3P2MA 2O5RA 3JD1A 4OGWA 221PA 1T3HA 2D74A 4OXYA 4QL3A 3JALB 2VNKA 3ZWPA 1U9CA 5FEMA 1MEOA 1QGZA 2VYCA 2FLVA 2H1OA 2LTAA 3JQDA 3ZXYA 1NKVA 1Z75A 1KORA 2I6SA 5HF9A 5FTMA 1NJSA 3MAAC 2Q2QA 4Q3EA 2M9MA 1DCFA 4BNVA 1TJ5A 1K9SA 3BGDA 1T43A 3K0CC 3MRVA 5EXPA 2CLMB 2AOUB 1ATZA 3B8HA 4K81B 2I9PA 1QK4A 1ODCA 1FSFA 4HYQA 3CZ4A 3TLXA 1JFRA 3BXFA 4KNYA 1EDEA 2VZLA 3ZV4A 4JBLA 1YU6A 3L7KA 4H3SA 1N7IA 4JT2A 4BNNA 3VU9A 3BICA 5TJHA 4X92A 1DOAA 1NMSA 1B0PA 1KZYC 1TGVA 3BKWA 4I1SA 4UUPA 3RG2A 3SLGA 2NV6A 4X0EA 4DGSA 1DC6A 1SCQA 1BJRE 1VMKA 4XAQA 3Q7QA 2Z2ZA 2QN2A 4OYHA 4NWIA 1VLMA 3BIWA 4G89A 2YJGA 3B5EA 5C8ZA 4JUFA 5A9RA 1CR4A 3KRTA 2ZPUA 4H0NA 3TTXA 1DU4A 1K7CA 1EH5A 1T2UA 3V7UA 1LV7A 4FDUA 2QYHA 3EIQA 3BZBA 2FOLA 4XX1A 4EH1A 1LI5A 4FQ7A 1VDZA 4M0KA 1LPPA 4XUEA 4C01A 2G25A 2X3UA 2WWVD 1BQEA 4YRMA 1OXUA 3I05A 1QHXA 1FS6A 4NCHA 4O29A 2X5NA 3MGKA 2QNRA 5IBRA 1I33A 3MTBA 1KYZA 1V25A 1C29B 2FPIA 3OX4A 4D56A 4KXMA 2P4SA 3WLJA 1YE5A 4D82A 1R6AA 2D2FA 3RAFC 1J5XA 1T1JA 3JZIA 3GDWA 2GTPA 3N76A 5K8VA 4CTKA 4HX2A 1X13A 3TFOA 4I1RA 3K5HA 4GZ5A 3R3SA 3L02A 4K9KA 2HRRA 2VDRB 3LX5A 3RD5A 3T94A 3UGTA 3TZLA 3ZHRA 4CLEA 5JRDS 3JD4A 2GPYA 2NOAA 4X1IA 3JQAA 2IIQA 2W6CX 3X2EA 3OZDA 1U02A 4A0RA 1AVTA 4AP5A 1UPBA 2FSVA 3O4VA 4FHZA 4E94A 4IKOA 2NU9B 1V35A 3OJFA 4M0EA 5E7JA 2RCNA 1F2UB 2V6FA 3PNBA 2DUNA 1UT5A 2HLDA 2PKXA 4TL7A 4RQAA 5JCJD 3L4KA 4GEKA 4PX5A 3I2IA 1CQJA 1KKLA 2OBMA 3A1EA 3AZQA 3MQ2A 2AZTA 3RKRA 4GL2A 1JB1A 1VPEA 1XAGA 2P68A 2I3GA 5BYJA 1Q12A 1A2BA 1AY0A 1V3QE 1J2RA 3N6RA 1E9CA 3I72A 2GN9A 3M5WA 2PKQO 1EX6A 4B83A 2RBKA 2VIIA 1I3MA 1CQXA 1IK4A 3ZKWB 2VDWA 9ATCA 1X1CA 2WMDA 1A8UA 4Q4AB 1BX3A 1XJ0A 2WV9A 1FFAA 1N5LA 3CUVA 4M53A 3CRW1 3FPHA 4WA8A 5HP4A 1Z0JA 3I76A 2FP3A 1QVVA 2VHVA 2DKFA 1U3CA 2NUTB 3N8DA 4L4UA 4C7VA 1CY2A 1UFOA 1JS1X 2V4MA 3KKMA 3OWXA 4ZREA 3RSFA 1V4BA 1Q14A 1JHPA 5AJUA 2JCVA 4N3BA 2GNOA 5B58C 4BVEA 1V9CA 2G40A 2ORVA 2PCLA 2DBYA 3G9ZA 3IVMA 5BUCA 2YW2A 4IS2A 2VSNA 4G1FA 1GGMA 1D2AA 3GG9A 2B83A 2W6NA 3SIRA 3H9CA 1EDZA 2J9GA 2Z5GA 3IRVA 3B36A 3PPXA 1GU7A 1TCBA 2FWMX 1B93A 2WWHA 2X4LA 1I7NA 1UP7A 3Q8KA 2QVGA 4HWPA 2VDJA 2ZREA 3O1IC 1YOBA 1YXMA 1NE2A 1XNGA 3D6AA 2WF9A 1ZRMA 4U2BA 3G8CA 2I91A 5EHZA 1MNAA 1OBOA 3EGCA 2REQB 3HB1A 3KFVA 2ZBVA 1ZM3A 3K2QA 4Q18A 4FC6A 4MWZA 3TECE 2CXUA 1TQ8A 4IJQA 5KSZA 2Q49A 3R3VA 5CFQA 5HZHA 4O4HA 4MOWA 3A25A 4JH0A 3EAGA 3GFSA 5BN3A 3D6UA 1HX7A 2VAPA 2B6NA 4KODA 1AN0A 1WHSA 2OEPA 5ALFA 1KNXA 3SQDA 4IVRA 3IOYA 2UVDA 3FSEA 1SUSA 4Y2UA 5IXYA 1X9GA 1QLWA 4N49A 2VWGA 5FORA 4BV3A 4DIBA 1ULSA 3CB2A 3A6PC 3MINA 4DEYA 1N36B 5A4KA 2HPAA 4JHXA 3WFJA 4DUYB 2FN9A 3P97A 4D2IA 2GB4A 2UYYA 4A4DA 2GARA 2QTRA 3GRUA 2AC4A 4H3VA 2ZRQA 5EVJA 4HQRA 1IHUA 2FZCA 5DX1A 5ALYA 5IJZA 2GM3A 3IAM1 1P81A 3G2KA 1RXWA 1NTRA 3EFBA 3N2NA 2LNDA 3NUQA 2FOIA 3CPJB 3H18A 5BSRA 3QX7A 4JL5A 3PD0A 1OB2A 1U8FO 1VECA 4ZQGA 4AULA 4YRNA 3CVWA 3AFIA 3INTA 1XD2A 2DFVA 1MO3A 2FKAA 3DONA 4IOLA 2NSLA 4BX9A 5J3JA 1QHGA 5K6AC 2BSQA 4N4AA 2FDRA 5FFFA 4LG1A 1J2UA 1HNXB 1N2CA 4IH4A 1YR7A 4PZCA 4L4YA 5DM4A 1E66A 3TVYA 3HCRA 3T0FA 5KINB 3T4UA 4EAQA 5JAUA 1FXUA 2GK3A 2HFKA 4HDMA 3DEZA 5AD1A 4EHLA 5LQCA 4KR2A 2QQ5A 2QSZA 1VJTA 3JQRA 3QEMA 3EVCA 1PZGA 2AH5A 2OM6A 4UM7A 3QU2A 1F60A 3HV2A 3PUJA 3KPJA 4BYMA 1Q6ZA 4RQUA 4DE5A 2NTEA 1YDFA 2FPMA 2J9YB 4X41A 2DZDA 1V9LA 1F3LA 1KOJA 1UBRS 2ZS9A 3QW4B 2OPBA 2JLCA 3L4JA 4N0QA 2R7LA 2LKCA 2IU6A 3QVMA 4MXDA 1NW6A 1OILA 3HU1A 2I2AA 4GBJA 5HRUA 1R6DA 4OHWA 4IEIA 3GLGA 4YUZA 4RK7A 4XD2A 1WBJB 4A03A 4HWRA 4FYIA 1AGXA 2R8ZA 2EKBA 1GPYA 1ORIA 3EWAA 3G0IA 2X42A 3KR9A 3BMCB 1H1DA 3CX7A 5IAGA 3WADA 4YV7A 2IZ7A 4L1KA 3HCEA 1WXDA 2I3AA 2E1PA 3GGDA 4ZDKA 3CNQS 4JLAA 4O63O 2ZIEA 2EZ4A 4WXHA 1QR6A 3PUZA 4LV5B 2YZNA 4I9GA 1N8SA 2ON6A 2YHBA 2BFOA 2OBFA 2GD2A 1NRXA 1STOA 4UAGA 1XHFA 2WABA 3FLAA 1UBLS 3IEIA 5CW1A 4YO7A 3L9XA 3MBIA 1G18A 3EW7A 2D2EA 3H4IA 2IY7A 1P9WA 4B4VA 3QLJA 5C8VA 3OU6A 2Q46A 3B82A 3HVIA 4GAEA 5ESRA 1AKNA 1T9BA 1EHCA 3M4JA 5COQA 3EMBA 5EL0A 3ZQJA 3PIDA 3LO8A 3QIAA 4GR5A 2OQVA 1QVZA 2XUJA 3Q5GA 2HK6A 4BKMA 2CHVA 1HFWA 3DBRA 3PHGA 4NC9A 1PR0A 5A71A 3OUTA 3G8BA 2BGWA 1ZQ1A 2XMQA 3LM8A 4ARAA 3KSRA 1M6HA 2PYZA 4XIFA 3L0YA 2P5TB 2V3CC 4DDMA 1CJBA 1JEQA 2FZEA 2YMMA 2CVOA 3LT5A 4FR5A 4KGXA 4RCZA 3F0TA 2D0OB 3TQFA 4YNBA 4EWLA 4GVLA 4GP9A 4D79A 4A0HA 4W8HA 1OCEA 2P27A 2XCTB 4MS4A 2IF0A 2HJSA 2MR6A 3BHNA 5EE0A 1ZU4A 2LW7A 4OI4A 3T6KA 1EB9A 1P2GA 3G0HA 4KPUA 4R68A 5AKHA 5GIOE 2R84A 3HCNA 2FSUA 1F7VA 2CJYA 1OSNA 1MCZA 1ZO8A 2BKUA 1EWRA 2I6XA 2W6QA 3AUYA 3MELA 4KE7A 4KU4A 4P93A 3DM9B 4U9UA 1YS4A 1UBNA 1D1QA 1RNLA 5EWJB 3VPGA 4A8JA 5BWMA 1QYIA 3K32A 4NEHB 5D6NA 2ZYVX 4BMPB 3A9TA 1O97D 4EI8A 5K5EA 3JPYA 2WFZA 2PZMA 3E7DA 3PZBA 4FYKA 1IU9A 3UHAA 1U0TA 2J0VA 1YBHA 2WVAA 6REQB 2SCUA 5M7EA 3CX4A 1XZJA 4P1ZA 2DFKB 1P8AA 1WXFA 3AYXB 2MSDB 4OQQA 1A4XA 3G85A 3WB1A 1UFQA 2C98A 3HB0A 2IKQA 2XMPA 3JVVA 2CE7A 2QP4A 4J76A 1YOVA 1FQOA 4PQRA 4ZZ2A 2IOFK 4UE3S 3FB1A 3KLBA 4CG3A 4G8BA 1QVAA 3S8YA 4RF2A 2JBHA 1XTUA 4G4IA 4IDEA 3VHXB 4AF6A 1V1JA 2AF3C 1G6HA 4A73A 3K9GA 5L7WA 1CNFA 1DAFA 3BRCA 3E6AA 3GOHA 4IY1A 4P3NA 4PSVA 5HPYB 5JAHA 1WUJS 4S35A 5CGZA 3RHFA 3TMAA 2IGBA 3R0XA 5K0JA 2JK0A 1HQDA 2X9VA 1DBRA 2H0AA 4I1OA 5EA2A 4AG3A 1KAEA 2CNLA 3RREA 4FU0A 1C4XA 3MINB 3W6PA 1Y5MA 1B2LA 3Q9UA 5TPWB 4JKOA 1BSVA 4UU7A 2WFAA 4Q1CA 1W87A 2H07A 3SC6A 1GG5A 3QBJA 3QX3A 1TKAA 5ILOA 3RVOA 2BSXA 2HMTA 2VH1A 3H7AA 3NETA 1E77A 1FFXA 2WAYA 5BW8A 1ENZA 2E48A 4P80A 4C89A 1GCUA 4RVFA 4KE9A 4G0ZA 4IILA 3DV0B 2BFCA 4PQYA 3O7MA 1KFCB 4QTUB 2YIDA 3MYRA 4OI1A 5B2EA 5J23A 2G6TA 5E1MA 1Y1PA 3EXHA 5AQ1A 4RPCA 5ALVA 3GX1A 1BKSB 3LVRE 4KQXA 4PNHA 4TXJA 1NUHA 2Z56A 1FDIA 2GRJA 2SKDA 4EX7A 4H6WA 1N7HA 1Z6XA 4GMDA 2IPNA 4YONB 5BO5A 3T8YA 5JBIA 3I92A 3WMXA 3H99A 4EKGA 2RGXA 4ZV7A 2QL5A 3VR2A 1BDBA 1U6KA 1V96A 3QA3E 1TIKA 1KI9A 1E5XA 1L6IA 1RPJA 3MXOA 3W34A 2QNBA 3R8FA 3WK6A 2FR8A 2VAVA 2X5XA 2YCLA 3N07A 4PZYA 2AE2A 1VKNA 1ZD4A 4DA0A 4YRBA 1ZITA 1U2QA 1JDNA 1DCMA 2CKDA 2I5PO 3HBJA 2FZLA 2LUOA 4KMMA 2B5WA 3N0RA 1B4DA 1NDHA 3MCWA 1GN8A 2O50A 2XLCA 1GEEA 1Z25A 3OIGA 4V0ME 3KC2A 4JXZA 3NASA 2JAQA 1JEJA 3A6FA 3T5AA 3SNHA 3VR0A 5ISMA 3LCRA 3EASA 2CLHB 2HREA 4MGYR 3FF1A 1AH2A 3I6BA 4FYPA 4M86A 1YU9A 1ZIXA 2B37A 4JJAA 2QZSA 2ZE5A 3G02A 2X23A 4N9QA 1JXOA 1MN6A 5ALWA 1KS9A 1PGPA 3ECAA 1LLCA 3I28A 5CA1A 2BTQB 2C2HA 3MOSA 1ZM9A 1WETA 2I2XB 4BJ3A 2QTTA 5JCOC 4B09A 3D54D 1DBSA 2O07A 1Z8DA 3BM5A 4PPFA 3IA2A 4UM9D 2ZIAA 3HSYA 3QTBA 2NVOA 4JCOA 2J4FA 3LY9A 4OHBA 1J1UA 1AMUA 2JG3A 3PUHA 5JR3A 1JEYA 1Z33A 2ZRHA 1JG6A 5KYVA 1VCIA 1DADA 1K9VF 1DQNA 3RVRA 4C7KA 3DXXA 3T3DA 4C6TA 5IWAB 2Y0CA 4ZU1X 2F3SA 3UB3A 1WJGA 2Q0HA 3UWOA 3JASB 1T36A 4Q93A 3P9CA 1RP7A 4U2DA 1RS0A 1ECJA 2R9VA 4U7PB 3HBAA 4OLHA 1M1NB 5SZJA 4OXXA 4YMIA 4ND8A 3U9SA 2V9ZA 4TMWA 4U8GA 5F1YA 1ZJWA 1QF6A 4LHZA 3AZOA 3BA1A 3JAWB 3PEVA 4LSMA 5K9ZA 5EEGA 3BWYA 2QUIA 4GPTA 4N6OA 4NNJA 1XK6A 3H75A 2PZBA 4ZVOA 3AF2A 2PUBA 1VLVA 4EMUA 1Q3KA 2H3HA 3GJQA 2OV3A 2W42A 2FEKA 2FGKA 2O7VA 3NNDA 3O91A 3AF4A 3TQOA 4DMGA 4XTCS 3AJ9A 1KMNA 3S44A 2I8AA 4M21A 2G5TA 1A2QA 3GGPA 5MHTA 2PGAA 1V48A 3CNEA 2ONZA 5AKLA 1DG3A 5EPEA 2AG1A 1CJVC 4U7FA 4V0SA 4JT8A 3NBYC 2HT6A 3F1LA 2H5IA 2ZQYA 4R54A 1D6NA 4W1SA 4ESVA 4KIGA 4NR0A 4GMHA 3C5WP 3WOVA 4TKVB 4DSUA 4ZK6A 4PC1A 1NUPA 3GRYA 4ZOLB 3UXEA 1DINA 5DSXA 2VDVE 2PS9A 4ND3A 5GGXA 4IGKA 2VQ3A 1L4BA 5BN5A 1VKZA 4TVBA 2HNBA 4P32A 5EWLA 4EYEA 5HRAA 4HRVA 1IVNA 4IMIB 4KAAA 1YB4A 4XLLA 2SKEA 2XYQA 1QIHA 3DZBA 3RS8A 1Y98A 1HO3A 1JSRA 2PV7A 1YRQA 3BH0A 3GEDA 3OI7A 1N8KA 3Q3CA 3RC3A 2CXOA 2PWZA 4E88A 4DCTA 2EU8A 4XR9A 2X6TA 5IEJA 5CBPA 5T4FA 2XZLA 2XRYA 4FT2A 3SHWA 2CUZA 1RQPA 5JAPA 4ZTBA 4P7FA 3NIGB 3EQ2A 3IEVA 3K0KA 2NSYA 4B2IA 1DIGA 4ENTA 1IVYA 1FQJA 3HDJA 3K9QO 1DHRA 4HFRA 4CM4B 5AW6A 5JROA 3EG9A 1F17A 1HTTA 1CR0A 2O1EA 4I36A 4BNHA 1C9KA 1CS0B 4DIDA 1P73A 4YMWA 4HSGA 5E6RB 1ZI6A 4P22A 3A6EA 3D2CA 2AYXA 1MX9A 4QDOA 1OGIA 5DNCA 3T1NA 3PQ3A 4FW8A 5BV8A 3ICQB 5IBQA 1XMPA 4B3JA 4X6XA 1GJRA 4NYMR 5HQ3B 4JC4A 5JMWA 3GN2A 3M3HA 4HG2A 4M8KA 3QHPA 4XJVA 2OZPA 3KZ1E 3MCUA 4X7BA 4KXYA 1FP6A 4RHFA 3PPVA 3MM4A 3EFEA 2JKZA 3AFOA 4ZOLA 1YJQA 4RS4A 5AT1A 3EX7C 2JPDA 3QE9Y 1E18A 1RQ7A 2VAXA 2J0UA 2G9VA 4JJKA 1VHLA 2BD0A 5DN6A 2H7YA 3FPBA 1KL7A 1XP5A 3L0SA 3QVJA 1U8YA 4LWZA 4Q3CA 3ZXUB 1DC3A 5F51A 4S1TA 2Y93A 6YASA 4ARBA 4YAUA 1JA0A 1YZYA 1WULS 3KOYA 5EP4A 4FFDA 4D8WA 3D5TA 3MTJA 3JQ8A 4V1CB 1KC3A 3H17A 4QGFA 4RPGA 1JR3E 3HVKA 3ZQKA 5K8IA 3OAAA 4EJ0A 5HHTA 1F0KA 4ROSA 1P45A 3JWIA 3U3KA 5EZSA 4Z0TA 1ZUIA 2Q3CA 1P6QA 2P67A 3O21A 4QYIB 5D6OA 3IULA 1FC0A 1RQ2A 2J7KA 2WSLA 1N7GA 3KWJA 4L2IA 3RAGA 2AUMA 2LV8A 2IOFA 5JANA 1SHJA 1LW7A 2KB0A 4BB9A 3NX4A 4CN8A 4GR9A 5EE1A 4OY3A 3WK4A 2J1LA 1GLNA 3ETEA 4QVKA 2X9QA 2Y1LA 2F9FA 1PTJC 4OTZA 4QYXA 1LY1A 4YJHA 5IH3A 3H9EO 5CHEA 3WA7A 4DV3B 4MUHA 4P83A 3LLMA 2ZJ3A 4GNKA 3L8CA 5GQSA 5C5IA 5FAKA 1U4NA 3MT7A 1NURA 3UKOA 2AEJA 2L69A 2GN1A 1KYYA 2FPXA 3WRVA 4WL0A 2DQYA 2B7CA 3JAKB 3LW8A 1SWWA 1EIZA 1ONNA 2YHIA 4W9NC 5DI3B 5C5EA 5ALGA 2X13A 4C7OB 3KDPA 4FZ3A 3E2IA 1W0JD 3ENZA 3IV9A 2VF7A 4F04A 4ZXPA 1OA0A 3A05A 4KRFA 4LY6A 3CLRC 4FI3C 1YI0A 2UUPA 2OHJA 3WVNA 3CYFA 2B69A 2R2AA 2R65A 2ZQZA 3GLTA 1COWD 3NOQA 5H80A 4DIEA 2LIPA 3M2TA 2IW1A 3BTVA 2E6UX 5EQJB 1WBBA 1PQ4A 1Z6PA 5LZ4A 4HDNA 1UZAA 2HJHA 3OIFA 3E4CA 3C5HA 1P0CA 3KXKA 3NUGA 1XKQA 2V7QA 3DBLA 3RTEA 2E2WA 1U6IA 4NHEA 4C5CA 5JFGA 5LQMA 1I0ZA 4LC0A 2GWHA 4RZHA 5JIBA 4B3SB 1Y8RA 3OD1A 5U1PA 4JJZA 4H7IA 3FXAA 3U5TA 1CUBA 1YA4A 3L1IA 1UMDB 4G97A 1KE2A 3LTEA 3TIIA 1V9SA 4J16A 4HGPA 1P8JA 4WV3A 2P4UA 5IG2A 1PSDA 3P9NA 2BWJA 2P9BA 4JKYA 4RABA 5COAA 3C7TA 2I1QA 3RBXA 3TZEA 4DABA 5BUQA 5CDHA 4E5PA 3EZXA 5KYYB 2F6RA 4BNTA 1QG0A 3A14A 3C97A 3N0WA 5FLEX 5CH5A 3UATA 1J23A 4KREA 4G5QA 1HY3A 2YUIA 3OF2A 3Q3HA 2O2GA 3RKUA 3W4JA 3WYNA 1T8WA 4FJ1A 4OI2A 2BGJA 4P5EA 4PYLA 2ZJZA 3RE1A 3OQ1A 3GHHA 3PFWO 4LOHA 5EGNA 3VC2A 2OB1A 1TMGE 3COYA 1QFZA 4P9NA 1JEEA 2YN4A 3CZMA 3NBKA 4Q4HA 3CVYA 4ZANA 3BXHA 3LO5A 1M2WA 1BWRA 2O7NA 4IJVA 2HHAA 3I1FA 3W7VA 1PFKA 3FIJA 1I1NA 1KAQA 3FSRA 3IUPA 2P3LA 3LXMA 4PGAA 4NBRA 5TEWA 4AG6A 1MFPA 3T3GA 1DPGA 2X4GA 3PFBA 3K0FA 1G21E 1BN6A 3LK6A 1IHDA 2CJWB 4MCIA 5GJVC 4AP6A 4DS3A 3LIIA 5A5FA 4IPTA 3NO4A 1N6RA 2ZQ5A 4LY9A 5A04A 3TOZA 5TS3A 4EM6A 4DDWA 1H9AA 2GRAA 4IV0A 1KPIA 1WU8A 3I04M 5ICFA 3RLIA 3RFTA 1UIMA 2HD4A 4K9DA 4DV6B 3DLTA 1A9YA 1A9XB 2JLAA 5CMLA 4HQ6A 5FPTA 2O2EA 2OCXA 5DKFA 1UDXA 1T9CA 4C5AA 3MMPA 4DT1B 1C0EA 1W2HA 2IYNA 2X8WA 3CSUA 3E81A 1YK0A 4C7OA 1PS8A 2HF9A 3UUWA 2G36A 3BMNB 1XN1A 4G86A 4H27A 4JLUA 3SSNA 3PR1A 3OQOA 1EUQA 1U7PA 1CG6A 4GU5A 3WC4A 3CA8A 1OLUA 1ONOA 3IUNA 3KNZA 3OEYA 3SR4A 4CT5A 3SXJA 2J4CA 1J2EA 1DCTA 2JGAA 3ORHA 4LAFA 4MQUA 1G64A 5JISA 1MZPA 5JU6A 5AJXA 5FBRB 4DRXA 3BRWD 1DDIA 2J8ZA 3L46A 2RHGB 3BMOB 1ECLA 2CDNA 3E35A 3KT6A 4RJKA 1VBKA 1M76A 2V98A 1MUUA 3OP1A 2LDBA 4F8EA 1SUCA 2JEYA 1OLXB 2HA5A 1G5HA 1RJ9A 2X8AA 3A9VA 5AWFC 3TI9A 4ECEA 1D09A 1DQPA 1UT6A 2AFVA 2EQ5A 3E22A 4I0WB 4LQ4A 1G4UR 3QJ5A 1VYTA 3FRIA 3QE4A 3NRCA 4DQDA 2ENWA 4FMCF 5IJWA 3VJMA 1Z36A 3ZH9B 2PLRA 4WZAB 1WMDA 5F5LA 4Y6LA 1R2QA 3HHPA 1SG0A 5D86A 3ZZ0A 1F8XA 4XWOA 1A9OA 2R11A 1TCAA 1CJKC 3Q8LA 3JYNA 3AB7A 3BUSA 5BYBA 1SBNE 1SBHA 2Q4TA 2CFCA 3C3EA 4E31A 1T0JB 2ZI3A 3PFNA 3PFCA 1R4MA 4IIGA 4DGQA 1Z83A 1FVOA 1OFHA 4OUKX 5CP8A 1L3BA 2GA9A 3P9ZA 5K0TA 4H77A 4H7PA 3ZPXA 2GD0A 1J0CA 2C83A 3ULKA 1US8B 1FCJA 2B8EA 5CFMA 3EA4A 1RE1A 1XQWA 1ZP6A 1LK7A 2BMDA 3K96A 4O2RA 4GEGA 1C7IA 2Z8XA 5G40A 4PEVA 2K5UA 4JLWA 3KHUA 4R2WA 3WBKA 2IELA 3UK2A 3V4ZA 2PQ2A 5GVRA 4N1AA 1MABA 1MVLA 2WWIA 2UYOA 3C74A 4AUMA 4YMGA 3ME5A 1NXPA 2MT9A 4UCXA 1GV0A 1M74A 5B1IA 1BXKA 1SQFA 2NO1A 4XCVA 4B34A 1IBKB 1TM2A 4WOKA 4X20B 1XCLA 4OBEA 4RJJA 1FTNA 5KYNA 3K0SA 1JDZA 4Q1VA 2QRQA 1KVUA 3O4HA 2N42A 1M34A 1QFMA 3PGKA 1GXSA 1UIRA 4ZVVA 1IE3A 2O48X 1DOZA 4NU6A 1TT5B 4UNSA 1OFGA 5EXDA 3O3OB 1YB7A 4L9SA 2Z95A 1MPTA 1R74A 2JI9A 1N6PA 1L1QA 1DELA 3BPSA 2INGX 3Q12A 1IXRC 2UYGA 1UH5A 4R1NA 2CDCA 3EQZA 4AMZA 4F2HA 5KDOA 2RJ3A 5BUSA 3A7EA 1VDMA 1VPLA 2R8BA 4CLRB 4A82A 1V39A 1QFJA 4LCEA 3LF1A 2B0JA 1I3NA 1KU0A 4ALLA 1L7AA 1HLDA 2IS2A 1GCIA 2X5KO 3WK8A 3U6KA 5B53A 3T15A 1TW2A 1YCGA 3LT0A 3QXSA 3O2QB 4MARA 3TBFA 4F11A 4H1WA 2C95A 2EERA 4MDFA 2FCAA 2XWQA 2HDNB 4IOJA 4I8DA 3TI7A 1BXRB 4UVGA 3R9WA 1YS1X 2OBYA 3UW3A 1M34B 5JG7A 1T35A 4WEOA 4H3KB 4RJIA 5FPSA 3FWKA 2BFEB 1U0LA 1A8QA 3PFFA 3AL0C 3LLVA 2NXCA 4TN1A 4W63A 5AVXA 4DC9A 1WM1A 2GZRA 2QL6A 5EVCA 1Z45A 1H8EA 2G1PA 4M7RA 3UUFA 1Z56C 3WRYC 5CNIA 3A6GA 3IS3A 5J5AA 4DB4A 4G1BA 5AJHA 5DHTA 4UARA 2C5EA 2ODQA 3ZJVA 2VYVA 4MQ5A 2VPWA 4IWYA 1XNQB 1OJLA 2PKWA 3C8HA 3NDJA 4WCFC 4INAA 5ARCA 1I2DA 2RGRA 1D04A 2Z8YA 3AETA 1NC3A 3UFXA 4NJEB 4OLFA 4TMXA 4EDFA 1POXA 2Y6UA 4ZVQA 3U7IA 2FKNA 2YW9A 3BJIC 3INRA 1D2MA 2IPAB 4REQB 1RZ3A 2ZROA 1KMHA 1GPJA 4R1OA 1LLUA 3QA9A 1RLOA 3JWGA 1SCNE 2XYPA 4DV5B 2GJ8A 1XA3A 3BJRA 1KJZA 2PFKA 4Z3KA 2I22A 1IUPA 2NAPA 2FPOA 2MCFA 5KOJA 2YQ5A 3CR7A 2PHZA 4Y0NA 1TNDA 4L51A 3HFSA 4JNCA 1WL8A 3MFYA 4L78A 1W44A 5LFAA 2A5DA 4FQ8A 4QBFA 4YP6A 5LVAA 5C7IO 3JWEA 1OHHA 1YOVB 1TU4A 4N39A 4E03A 3L4EA 1MIHA 2FPSA 1C30B 4JP8A 4ARZA 4JY7A 2B8TA 3CEAA 3OEHD 1WLYA 4XH9B 5F1PA 2GSDA 1DTEA 4G0MA 4B2LA 3WGTA 3ZN2A 1XL1A 4CCYA 4MW9A 3QE2A 3GEPA 1OAOC 1IMOA 1CB7A 2P6NA 2PWAA 1MTZA 3W05A 1EXVA 2HNKA 4EITA 5ALXA 1AQ6A 4KMSA 4CL0A 5LZ2A 4OQMA 3PENA 4WQMA 4J3FA 4KBGA 4YV0A 3N87A 2JLYA 1CYEA 1M8JA 1DNPA 4M0FA 3AXSA 3I53A 2AQHA 2IYLD 4MVYA 3ILVA 4CNBA 2OAEA 2GZMA 4YRQA 5AW5A 3REGA 4C1BA 3SHVA 3NT2A 4YFVA 4GLJA 1WVGA 3O3MB 3TZHA 4EO9A 1UQUA 3PQ2A 3DLAA 4HVAA 4K3UA 1U9IA 2IUYA 1JMVA 3VV3A 3FNGA 2OKGA 1OX5A 1HNZB 5AVZA 1YKGA 2GM9A 2QJRA 4RFLA 2ZI6A 1KP9A 3W5HA 1XZAA 2F62A 1AMNA 2FG7C 2QMEA 3U7QA 1E2BA 3C6KA 3OQIA 1B41A 2ZIXB 1LB1B 3HL4A 1K98A 3PSAA 3MCVA 4BDSA 2XVYA 2QD1A 5KYXA 4D25A 2ZTHA 2OHGA 2ECOA 3UJ7A 1DEOA 1Q7BA 3EGXA 5A7GA 2C2OA 4NFYA 2VK4A 4NOJA 4JA0A 1PJLA 4ETIA 2NYRA 2P30A 1PEKE 3U13A 2PNFA 3A0UA 5HVNA 1BWSA 1SQ6A 2GR9A 4R1MA 4YRAA 3TQHA 4CFYA 3JRWA 4OQFA 1G20B 4CMBA 4QPNA 4OKSA 1YGYA 2QLTA 1PQWA 1T2DA 4ETNA 3IOEA 3L0DA 3L8GA 4KVGA 1RQLA 4NNOA 4KE8A 4U2EA 1T1RA 5A4FS 5AVRA 3B48A 5TY0A 3OTWA 2B99A 5IKXA 2OAQ1 4HL6A 2OGTA 3T7CA 4TT8A 5FX2A 1GUZA 2AYYA 2ZCUA 4YRGA 4PCAA 1R9NA 1BH2A 1UDBA 1QIKA 2HA7A 2O1WA 2PGJA 5CU7A 2B0CA 4PZ0A 4BQQA 1GVHA 3H8VA 5DYIA 5JH7A 3EVFA 3I37X 4V2UA 5EG5A 3GFPA 2PKYX 5ELMA 2HJWA 3EF3A 1N5DA 1XGKA 4IQGA 4ZDJA 2C2WA 3R76A 5JS2A 3B78A 4EB3A 1VLZA 3FNRA 5DJ5A 4IQFA 1K06A 2VDLB 2NVUB 1X7XB 2ZYAA 1I2AA 4GUAA 3SC3A 4MYSA 1U8ZA 4GSKA 2PMCA 4IUCS 4PS1A 5DXFA 3UPDA 1DV2A 1DRKA 3IQZA 1N9KA 1JKJA 3A6ZA 1Z6TA 3MTAA 4XZ3A 2W8BA 5SICE 4B3BA 4YN3A 2GBFA 2V4ZA 2FRDA 2G1KA 1M3SA 1TCVA 4HDMB 5KJ1A 2G08A 5D00A 4FILA 5DVZA 3ZZTA 4WK2B 4X8OA 1T8YA 4FOPA 5CDFA 3IBSA 3PUWA 5HJ2A 3EQ9A 4GR4A 3H1TA 1QK5A 3OZGA 2OP0A 1R0KA 3AESA 4HGQA 1KP3A 5CA1F 4IG9A 1KZHA 2PG3A 5KTNA 3CC8A 3K4QA 1CRWG 4FFNA 4CKWB 1IM2A 4BECA 1P7ZA 3WBJA 2VCEA 3H11B 5A5GA 2NZJA 3X1MA 4PHTA 4UUMA 5LM3A 1ISIA 3FPEA 4HNRA 5AW2A 3HPQA 2GLUA 2NYAA 3UMVA 2AZDA 1U0NA 1T5SA 2HPHA 3C8ZA 3JVUA 2BMWA 4IJUA 3ZV5A 3UK0A 2DFNA 1KZ1A 4F0JA 2RI0A 4LJLA 4MRMB 1GM5A 4TQ9A 1JJFA 2HBQA 2XKAA 3IC5A 5BP7A 1ESEA 2IL1A 1SZCA 1NT2A 3SOZA 3RUIA 4X64B