1MOSA

Isomerase domain of glucosamine 6-phosphate synthase complexed with 2-amino-2-deoxyglucitol 6-phosphate
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
367
structure length
367
Chain Sequence
b'AGDKGIYRHYMQKEIYEQPNAIKNTLTGRISHGQVDLSELGPNADELLSKVEHIQILACGTSYNSGMVSRYWFESLAGIPCDVEIASEFRYRKSAVRRNSLMITLSQSGETADTLAGLRLSKELGYLGSLAICNVPGSSLVRESDLALMTNAGTEIGVASTKAFTTQLTVLLMLVAKLSRLKGLDASIEHDIVHGLQALPSRIEQMLSQDKRIEALAEDFSDKHHALFLGRGDQYPIALEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKLKSNIEEVRARGGQLYVFADQDAGFVSSDNMHIIEMPHVEEVIAPIFYTVPLQLLAYHVALIKGTDVDQPRNLAKSVTVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSAMINE 6-PHOSPHATE SYNTHASE
molecule tags Transferase
source organism Escherichia coli
publication title The mechanism of sugar phosphate isomerization by glucosamine 6-phosphate synthase.
pubmed rcsb
total genus 143
structure length 367
sequence length 367
ec nomenclature ec 2.6.1.16: Glutamine--fructose-6-phosphate transaminase (isomerizing).
pdb deposition date 1998-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01380 SIS SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1mosA01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1mosA02
2CXSA 2DF8A 5FLXA 4JYAB 4S12A 1NRIA 1HNWB 1X94A 2DECA 3BCHA 2PUWA 3G68A 2VF4X 3TBFA 2VF5X 1HOXA 2ZJ3A 3IFSA 4U6NA 3FXAA 4LFAB 3BJZA 2CXQA 4B3TB 4LF9B 4JV5B 2O2DA 4X62B 4DV7B 1N8TA 2PUVA 4LFCB 1DQRA 4DV6B 4LF6B 5LL6P 4B3SB 2UXCB 2CB0A 3KNZA 1JIQA 1HR0B 3OTOB 4DV2B 4LFBB 1VI5A 4JI6B 1IATA 2CXOA 1U0GA 3LJKA 2HHHB 4GKJB 4KHPB 5IT9A 2A3NA 5A2QA 1I94B 2VQFB 4DUYB 3CVJA 4M0DA 3JAMA 2UUCB 3SHOA 1FJGB 4JI1B 3HBAA 4X64B 1ZZGA 4DR6B 4AQYB 4JI8B 2UU9B 4K0KB 1IRIA 4DV0B 4DV1B 1C7RA 4NXNB 4JI7B 2CXUA 1U0EA 2PGIA 1M3SA 2CXRA 1N36B 1X92A 1X9IA 3FKJA 4JI2B 2ZM6B 4DV3B 1J5XA 4LF8B 4GKKB 3HJBA 1TZCA 5LMUB 4NXMB 3J7AC 3Q7IA 2XHZA 2CVPA 2UXBB 4X66B 2ZJ4A 4DR7B 3ODPA 3Q88A 3PR3A 2UXDB 2AMLA 4YY3B 1VI6A 4DR1B 5LMNB 1KOJA 2CXNA 1JLHA 1XMQB 2VQEB 2E5FA 4EM6A 1N32B 1IBKB 3I0ZA 4DR2B 3UJHA 1XMOB 1B0ZA 1JEOA 5I01A 4LF5B 4IVNA 1WIWA 1XNRB 1MORA 5BR8B 3M5PA 2CXPA 3FJ1A 3T1YB 1IBLB 2V4MA 3ETNA 1HNZB 1GZVA 2O2CA 4JI5B 3TRJA 2POCA 3T1HB 1T10A 1Q50A 1VIMA 3J80A 1N33B 1C7QA 3JX9A 4S1WA 1GZDA 4OX9B 2WU8A 3C3JA 1G98A 4LF4B 2PUTA 1MOQA 4JI0B 4DR4B 1X9HA 3FF1A 1TK9A 4AMVA 2UUBB 2CXTA 2E5LB 4DR5B 2XBLA 1XTBA 4DV5B 4JI4B 1XNQB 3EUAA 1U0FA 1VIVA 1HM5A 4JI3B 2Q8NA 2F4VB 1MOSA 4YHHB 3NBUA 3J81A 4LZJA 4LF7B 2J6HA 5IWAB 1J5EB 5BY2A 1NUHA 1JXAA 1HNXB 2UUAB 4X65B 1TZBA 4DUZB 4B3RB 4DV4B 2I2WA 3OOJA 4B3MB 4DR3B 4TOIA 1N34B 2I22A 2X3YA 1IBMB 3QKIA 2YVAA
chains in the Genus database with same CATH superfamily
1M34B 2CNBA 3R41A 2PKQO 3U4QA 4FC6A 3V8VA 2FAXA 4ZVPA 1HE5A 2A84A 3DCJA 3TXXA 3B9RA 5JUWA 4HVTA 3V6MA 2R7MA 1KFKB 2Y1XA 3PE6A 1D3AA 1DIOB 3ACBA 1NVVQ 3BSSA 3ZK9A 3PJRA 2XVYA 3N2IA 3L7NA 3R7WB 4EITA 2E5WA 2JFNA 3ISVA 3QBDA 3U81A 3UTCA 4EY8A 1SXQA 5AJYA 2I76A 2B4QA 4IDCA 4XGQA 4B5KA 2JI4A 2IU6A 3V6LA 1EH5A 3K16A 1Z8DA 2EBFX 3QF4B 2JCGA 3Q7SA 1UAGA 3OCJA 2ACEA 1V3QE 4IUYA 1CZKA 1N5RA 2ZQ5A 1GPLA 2ZVQX 3ND6A 3K9WA 5D6OA 1BKSB 5EKXA 4D1YA 3DBRA 3GWGA 1LNQA 2ZETA 3ABZA 5CLJA 3MTEA 5HKAA 3NU1A 1KDPA 5DULA 4IHJB 1I1HA 4M4SA 4BNDB 4EB0A 4NP6A 3D8SA 3L07A 2QZJA 4ZXPA 4RDHA 5JATA 1M1YA 5JQGF 1ODCA 2HWYA 2YMMA 5JCOA 4DV0B 3HVIA 3PPWA 4NFYA 1WCIB 1K88A 3RSGA 1QF6A 3C3YA 2D2XA 4Y30A 3UANA 4EG4A 1ZI9A 4WBSA 2IYAA 1BIFA 4O4IA 4KFCA 1Y7TA 4QICA 1LFAA 3EJ6A 3TB4A 1PV2A 3OPXA 2LV8A 3DDSA 1QIHA 2F3TA 2W98A 3T5AA 1TD1A 3KEQA 3KSZO 5FLYA 2VJKA 5IKXA 4LYYA 5JHHB 4OTZA 2AOWA 3EAFA 2XD4A 2AI2A 4IX9A 3CZAA 3HCFA 1K92A 4DADA 3GEBA 1QPBA 1DKPA 3NUZA 1HDYA 4MW4A 1VMIA 3KL2A 4JGIA 1ENYA 2FHSA 3STXA 1S1CA 3AYXB 2GRJA 2AWNA 2Q6LA 3OCVA 2X6TA 4OAOA 2IOYA 2TECE 1KOJA 1BDMA 1Y9JA 2Y1FA 1E0JA 4P31A 3Q3JB 3LBYA 3A1VA 3T7EA 2C2BA 4F91B 3OZWA 4JJ7A 3ZJVA 3ER8A 1YVRA 3FVTA 4Q9AA 2DUUA 1J49A 2WJGA 2AR7A 2RK4A 3F6YA 3KU4A 4IIXA 3UENA 1UFKA 4BBZA 4Q9LA 1RRVA 1Z39A 4XTCS 3JQAB 4WY2A 4ZVNA 1OBCA 4KGZA 3DL0A 1NV8A 3I1YA 3OZFA 1HYQA 5F9MA 3LDFA 5TDHA 1FFHA 2OOKA 1SUSA 3RC8A 2CNWD 3LPNA 1ZLXA 3U7JA 2Z4TA 4C7BA 4H2DA 2DEUA 1ZO8A 2R97A 3FAKA 3ITDA 4KK3A 1I33A 1IY0A 1V16A 3PHIA 3RD5A 1WEHA 1ZL0A 1Z33A 3BRWD 4X85A 4YRQA 1F8GA 2C8KA 2VDNB 3OHPA 2GA9A 2J9ZB 3R5KA 4S1NA 3X1MA 4LDAA 2FTKE 3C39A 3U49A 7YASA 5HIIA 4BMNA 1BXZA 1EUCA 1UZUA 3L5OA 1TT5B 4KPUA 3DE2X 3D8NA 3ZBPA 4DGQA 3O94A 1CVLA 3EYWA 4GDMA 4OSEA 5F1OA 3BMCB 1X9GA 1GGFA 2ODBA 3DDWA 5BORA 2WU3A 4PC7A 5JXWA 3HKDB 3ESXA 2R4UA 1E5TA 4RSRA 4AY6A 1DOAA 2HSDA 4MGEA 3E1SA 3RUDA 3T9FA 4EW2A 1GCUA 3C1TA 5E3JA 2ZIVB 2ZJ1A 5U9CA 3O3OB 2EZUA 3SJ7A 2WAMA 3AEUA 5LQSA 3ZWOA 3KJEA 1VCOA 2CFRA 1XTPA 4GLJA 1QSGA 2J33A 5E9AA 4W5OA 4NCNA 3NASA 2H0QA 3R2JA 2XXBA 4EG0A 1H8HA 1S01A 1I7QB 2DBQA 4MKRA 4TZTA 2XYRA 3JYPA 4Y6RA 3LAWA 2RK6A 4LJSA 2WF9A 5HSGA 2FG6C 3VVMA 3C4QA 1G5TA 2EHDA 4C04A 1NTOA 5KMGB 4XUCA 2JI7A 3JZMA 3DFZA 2DQKA 4B48A 4DABA 1J2RA 1WMEA 1KVUA 4ZPJA 4C07A 4KPEC 1M9NA 2G76A 4UNSA 1I30A 1WVIA 3I42A 3X0DA 5KC8A 1FXWF 1I94B 4P4NA 1WUYA 5BMOA 2PL3A 3L8HA 3GFGA 4RL4A 3K2QA 3SHOA 4F3TA 4R01A 4YQFA 5CIYA 2X23A 5IM4A 1JQ3A 4RLSA 2W2MA 4ID9A 4MK4A 4XZ3A 7ABPA 5HWSA 2X0KA 2CEKA 2ZJZA 4IS3A 1AG9A 1AVTA 4LJ8A 3DDUA 1J56A 3KYJB 2UZIR 4Q4HB 2I55A 2QE6A 4HUTA 3KSAC 2GDZA 4DLVA 1QGED 1X70A 3GG2A 5COQA 3T4PA 4C0JA 2MSNA 1JHUA 1XN4A 3D4NA 2BKVA 4J9UE 2ZXFA 4O1HA 4JOQA 5GVRA 1KDYA 5HIKA 1UXOA 2AUTA 3C41J 4L6IA 4G37A 2PUEA 1Z5WA 4D4MA 2PT9A 2PAAA 1CR6A 4CV3A 3DT6A 4GX2A 2X0EA 2A5DA 3R0IA 4JT4A 4NEHB 2YR0A 4BQQA 3KZVA 4FYPA 2V7UA 3SSOA 4HS9A 4RD6A 4ZI2A 1Y5IA 1W19A 3L77A 3DE5X 3QHPA 5BRAA 2O3SA 4F56A 5DXAA 1EI9A 4P58A 3QF4A 1KQNA 3DS8A 5JRJA 2N1BA 3C8UA 1JG4A 2XYPA 4F2DA 2JI9A 2OILA 5FLKA 3JTEA 3FI0A 2CXPA 4PLTA 2NPIA 1CQIB 1H2BA 1Z88A 2JCXA 3A9RA 2Q5HA 4R1SA 2Z3ZA 4LTDA 3JRNA 1NVUQ 2XVAA 1G8AA 3FGPA 3FTCA 1XALA 4MS3B 4QXPA 3F7TA 5JU6A 1DUVG 1OSNA 1B2RA 1VI2A 3QGMA 1L4EA 8AT1A 4XJXA 3G2LA 2FX2A 2WUVA 2E3JA 1D9ZA 4I9NA 5AM4A 4YB8A 2FSGA 1M34A 5L45A 1AKVA 1F1BA 2WSMA 1M1YB 1X13A 3F9IA 3KV3O 3ND5A 5FHQA 4F7DA 1CJVC 2V45A 4XWYA 3OZTA 2GWHA 4UUQA 5A5GA 3SVLA 4YT2A 1U11A 2GZAA 4WFQA 4LC0A 1A98A 3BICA 3TE6A 3ZE1B 1NUQA 1T9HA 1IK6A 2EX0A 1OBHA 2Q6IA 2VJBA 3NTQA 3UJ3X 1GQQA 1NT2A 3OQ1A 3A9TA 1WCYA 2H57A 2ZZNA 1AKQA 3ED5A 2XX3A 2IYLD 3KAJA 5IUJC 4P86A 3JRWA 1ZBDA 4MVJH 4O4LA 5LOVF 1NVAA 4PCUA 2A9VA 2K7ZA 9MHTA 3E8SA 4KHZA 2AMYA 1BXRA 4YNBA 3OE1A 4M60A 1X0VA 4NYMR 3UV7A 2GD1O 4EG1A 4G07A 1SBQA 1N3IA 3PE4A 4A0RA 4YJHB 5SICE 1CSEE 1Q0RA 2C7VA 2J3KA 2GEJA 2V6MA 4MQEB 5AHXA 4DRYA 1SIBE 1R0SA 2F17A 3IERA 3RRZA 3D0OA 4D56A 3NOOA 4BASA 3DV2A 1VQ1A 1T29A 4JBXA 3EXG1 3FZNA 1MC8A 3WJ7A 1RQPA 4CM6A 1GQYA 2AUNA 1JU4A 2P3LA 3O03A 3RF7A 1IY9A 4FHDA 3O8LA 3DZDA 4DV6B 2P0YA 4NU5A 5REQA 5E0KB 5IJ0B 3FTNA 1VJTA 1BWPA 5LM3A 1V7CA 3ROMA 1LV7A 2O14A 1EVLA 5B7PA 4G5HA 2BD0A 3GCGA 3Q3GE 3CXRA 4KYIB 1UKZA 3ZD8A 4E4YA 4EQ6B 4EFLA 3L93A 4H6PA 4FGKA 3OO1A 2XYVA 3RSFA 4OH7A 1X1BA 4TTPA 2J8ZA 1L4BA 3RABA 3V4OA 2XODA 3TRKA 5BW4A 2P9HA 1UFQA 3R4VA 4OQMA 4DG5A 1V95A 3ER9A 4OBXA 1VM6A 3NHLA 3EXAA 4XD2A 3NHRA 3KUKA 4CNBA 1K4KA 3ZY2A 2H1LA 4CV2A 2NVWA 1B42A 1R4ZA 3A9WA 5CW1A 3NW9A 2FGJA 2UKDA 2JBAA 3LBFA 1NUUA 1UP6A 4PR3A 3K6RA 2ZM6B 2BI4A 1I4WA 3PZBA 2Q41A 3QOWA 3LW7A 2ZANA 4IDQA 2EJUA 4U9IS 2PR7A 1BHSA 3C7KA 3E0QA 3NG1A 1WU8A 4A2QA 1A9XB 3GHYA 3I1FA 3QFHA 1VG9B 3VZRA 2C7RA 4KL8S 3GUZA 5ALKA 3AI2A 4W6ZA 2JJ2D 4CLRA 4ZI7F 1YZLA 5EPUA 3QTTA 4TROA 3UMBA 4A0SA 5ADUS 2OCPA 2FZ5A 4RD4A 5AM3A 3F8SA 3IAM6 4CM4A 3C3MA 3V7YA 1JQKA 3TYXA 3JWPA 4UVEA 1XVUA 2HCJB 4AP5A 1ZY2A 3VVLA 1ITZA 1JB9A 1XZJA 1W88A 5IULC 4ESVA 2V4MA 1WPXA 4C7OA 2WYHA 2YV3A 4QHYA 2H63A 4EFNA 3T95A 3DEKA 2HBQA 1N2OA 2R65A 3Q0TA 4FBLA 1ISGA 4U2FA 5FWXA 3PFHA 2FZGA 2O3JA 7GPBA 3AF1A 3AOEC 1YS9A 3C3AA 1E61A 1W25A 2C92A 5CFZA 3ADDA 4NBNA 2PGOA 3PHHA 4EUFA 1EINA 1E8MA 4MVJD 1D5CA 3A27A 3MBOA 3G1UA 1ZD1A 2BTOA 5IDYA 4IG4A 1QG6A 1OAOC 2QXTA 1AZTA 1MPTA 1D6MA 2W2OA 4PYRA 3A0RB 3AETA 5C31A 5CFLA 2J5BA 4RH3A 3W8EA 1Q12A 5IDXA 2NO1A 3E7PA 3MWEA 4I46A 2V74B 1E0SA 3P9PA 3RS3A 4MA4A 2MSEB 4FMDF 4GBJA 1YI0A 1KARA 3OX2A 3HGMA 2Q5EA 2C4KA 4ADSG 2V7GA 5D7NA 5NULA 3QG5A 5IVIA 1JQLB 4G86A 5I48A 2W6PA 2NTNA 4HPJB 4YRLA 1ODTC 4LWZA 3CJQA 4IRMA 2FKNA 2G6BA 5EXXA 2VOJA 2WMYA 3O5AA 4UUBA 2C2YA 3UOAB 5B3JC 5C1PA 1WPQA 4P3PA 3X3HA 4J0GA 4ZGWA 3L4SO 1IVSA 1TJYA 4C7OB 3RK0A 1TEZA 4TV8F 2HX1A 3RV4A 2VDMB 4HNAA 3GJ6A 1W46A 1SCKA 5E9QA 3WYFA 3LUGA 1WMFA 4V1CI 5KTRA 4Y0AA 3ZGOA 4ZVLA 5JO0A 2VR1A 2DQ4A 3I9MA 2PNJA 1VXOA 1DJPA 2IEZA 3VR3D 2OK8A 3D4OA 4Q5IA 3NHAA 4AUEA 4RABA 3DAOA 3VBEA 3ZLJA 1Z4NA 5CIQA 2QRVB 3ROXA 3RJMA 1QHEA 3SX4A 2WFMA 5IT0A 2WABA 2VA8A 4CPDA 4L0CA 2W6QA 4MRNA 3ZJTA 1MNAA 3B3GA 3O4FA 3E7DA 5BYKA 2SKEA 3OJXA 3VJMA 3DE0X 3IRVA 4EHFA 4LDPA 4G65A 4IQ8A 2Q9BA 1K5PA 3V8QA 2JFQA 1JQJC 4QO7A 1WXIA 4J1QA 3USCS 3R0XA 3WDMA 5I7EA 4W5RA 1FA9A 3ZU2A 4CIBA 2E4AA 2FR0A 4ALNA 5CLFA 4TV9F 5LDDC 3GCDA 3CLSD 4HGYA 4MKXA 4O5AA 3ZGYA 3HXQA 1YBVA 4KAAA 2B9VA 2WT8A 3BREA 2MSLA 4CCYB 1K9SA 3TOZA 5E1DA 2GHIA 1YZFA 3ZXYA 1LPPA 2QSZA 3G0DA 2HGSA 2G1PA 2VQ3A 1II0A 3L9WA 3LYLA 3RVLA 1T9DA 4LJ7A 4Q1EA 2JHCA 3ZHYA 2PMBA 3W6NA 1SU8A 4FX2A 5F98A 1IM8A 3H42B 4OM7A 4XGNA 1HG0A 1OH6A 3L6CA 4ERNA 3Q3HA 3EPRA 2MT9A 3KE9A 3ZG6A 4GM0A 1KRWA 1YMVA 2Q4TA 4PIMA 4QULA 4NU6A 5DXFA 3WDSA 2VCEA 3DDCA 3LX8A 2I3DA 1RAHA 2Z98A 1S8NA 1OXSC 3BMXA 3ZBUA 1B0ZA 1JEOA 1G41A 2CHEA 2QD5A 1S2MA 1M34E 1DQSA 1E9SA 1VL1A 1LRKA 5E9WA 3ID6C 2HMVA 3IAFA 3ZVNA 1XTIA 2RBEA 2PSHA 3PEUA 3C3DA 1E6WA 5E3IA 4RTMA 1RHUA 5IHPA 5AVWA 1HORA 1W5SA 2E37A 1EIZA 3GFBA 2XZLA 1GGJA 3K1AB 3WGUA 1S8FA 2O20A 2UYOA 3RU7A 1RWPA 1K8RA 2BEKA 4HVAA 3D2LA 3G59A 3ANSA 1IM5A 1KMNA 1ATIA 3M34A 5K2OA 3BD9A 4Q4JB 3LWBA 1CB0A 3HCBA 1RI2A 3KV1A 3NJ8A 3URMA 3DEYX 4KKXB 2HU2A 4YHBA 2JHGA 3ETGA 4PZPA 1XYVA 2PY6A 2FPOA 1P4JA 3KOXA 3M9WA 3P0IA 4N6NA 5G4LA 3TMAA 5CFPA 1H1DA 5ADHA 1LBQA 4B3RB 4QNMA 4RGYA 4G1CA 1AK1A 1UFVA 1Y5RA 3RSLA 2D4HA 3WK5A 2ZYUX 5DHRA 2WJ4A 2H08A 1AQUA 5E4TA 3RIYA 1KO1A 3U3KA 2FMTA 1CV2A 1O5OA 5LXTF 2FOIA 1UXHA 2Q99A 2OESA 1U5CA 1H3NA 3C6MA 4V0ME 1UAAA 4N18A 1JR3D 3L46A 4IXWA 4R1OA 4AKGA 3QLUA 3K8QA 1ZJYA 5ALEA 2HA2A 1XO1A 1KI9A 3BF7A 2FZWA 5IASA 2FZVA 2QLMA 2NNLD 4G4JA 5FTJA 1SC9A 5HZGA 4DCGA 3EWAA 1GPKA 2Q50A 3L82B 4YR9A 4YP6A 3EEFA 3QMVA 2IELA 5BURA 1VLHA 4YCLA 4EAQA 3EVDA 3PRYA 4MUAA 5EXEA 4DPLA 3IDOA 4IJUA 3SLRA 5DBGA 1QK3A 3HZRA 1RZRD 1QAQA 1WCWA 4B74A 5HBGA 1RAAA 3SX2A 4AF6A 5IYZF 4M1MA 2UDPA 5AKJA 3GGCA 5C80A 4OLJA 3AU9A 2YNMA 4RE6A 1LDYA 1IHYA 2JLZA 5C5DA 5E6RA 1DC5A 1JX6A 2ZUSA 4V38A 4URXR 1UP7A 4NEQA 3FX2A 1E96A 1X7GA 3DAGA 3EHEA 3EZYA 3L40A 4OUDA 1IQ0A 4XOUA 2GVZC 1YJBA 2WJVA 1OGYA 1M1NB 1N9GA 1WNFA 3DZKA 3EGVA 3N8NA 2ZR8A 3PC8C 4FEAA 1P7YA 4I7EA 4JVOA 3VYTB 1C0KA 4PYMA 4B2LA 4CEJA 3RUIA 4JWKA 1EFKA 2UZ1A 5IX8A 5AYVA 5K05A 1TF7A 4MWCA 1BJRE 1L7BA 1Y3AA 3D4PA 2ZRGA 4KWEA 5F5LA 3UPDA 4EP1A 2BMJA 4FI3F 4LRQA 4U63A 4P2GA 1Z34A 4BCCA 4E07A 1WZ2A 1MA0A 3O4JA 5COAA 4G5SA 2X0IA 2YQ4A 4EDHA 2IRWA 4QO8A 1ULZA 3NUQA 2WKWA 1PNOA 1X7DA 2PNFA 1AQYA 3BJEA 1JV2B 3L4EA 3N0TA 1GZ6A 3OCXA 4MIOA 2QK4A 3L1HA 4Z9XA 1FQOA 3NEJA 2XHEA 4BAGA 1JHAA 3W1VA 1BS2A 1CD5A 4CM8A 3ME5A 4Q1BA 3HU3A 4Q15A 2FFBA 2WWFA 3ODPA 2BH9A 2IZ0A 4UE3S 2R3SA 3V4LA 1MPXA 5DNCA 5TGTA 4EJSC 3LHKA 3IA2A 4HX5A 1VRVA 3GW8A 3IQFA 5J2TB 3OY2A 1RZ3A 2D54A 2J45A 1QGYA 1JW9B 3OTIA 5D6NA 1OREA 5BNZA 5L3ZA 2GM9A 4NMXB 4GMFA 1GPYA 3FOWA 3QP9A 4BX9A 3WGMA 3IKVA 4PICA 3FSJX 1VHTA 4I4NA 4Z0NA 3S1SA 4H6VA 3TVDA 4EGCB 3ODGA 3THWB 4E7OA 1PNVA 1QZUA 4LE1A 4UREA 3SYKA 3AM3A 4AU1A 121PA 1WB4A 3WQBA 4E13A 2JAPA 3RC3A 2AG1A 2NUTB 4CQMA 1FFDA 2BFDA 3FIUA 4MJ7A 4WN3A 5JDIA 2OSBA 3IYLW 2RGRA 2MU1A 1VA4A 4N3AA 3UYKA 4E0BA 5EMNA 3K9QO 1LDEA 1BX0A 1UDXA 4UAVA 4EJFA 2QMOA 4ZANA 5A9SA 3MLBA 4LKOA 4X24A 1KO5A 4JUIA 1Y1TA 5BYAA 4TLDA 4DLBA 3KEMA 1A27A 2HMTA 3TZHA 3D02A 3ZE0B 5AJZA 2PGAA 4JLDA 4EQZA 1KOGA 1P1CA 1L5QA 2ZRHA 4OF4A 1PR6A 1YS1X 3KT0A 3VRHA 4DHWA 4CEHA 5C7LO 3N8KA 4QAQA 3RUPA 4QHTA 3FWYA 3GFOA 3AW9A 1KWKA 1DBIA 3BERA 2Q4DA 4DCSA 2QP3A 4DJEC 2OVFA 4OJYA 1T2UA 3BB4A 5AW0A 1A97A 3E15A 2WIAA 4WESB 3PWTA 3B1XA 3C16C 2NV2B 3INRA 5E4JA 1E79D 3QE0A 2XUFA 2XIQA 2AZ4A 5AW2A 1KEPA 2FWMX 4X8LA 5TVGA 5IZ4A 2NPFA 4O3MA 5KOHB 2P6UA 2IHBA 1E8DA 1PW7A 4N39A 2C54A 4F6CA 4E30A 3AY7A 5JCJA 4GLOA 3TSCA 2HJRA 5A7GA 1MB4A 5HQ3B 4D3XA 1RWWA 4L8WB 4RZ3A 4TTRA 4JBGA 3VR6H 3GLIA 4CMKA 1THMA 1ZL2A 1JH9A 1EDZA 1FBTA 5EJ4A 1WDMA 2BGTA 1Y4AE 4KI7A 3DXFA 3N5KA 1HT3A 2ZWMA 1G63A 2RC5A 3AEQB 3EJWA 2VJPA 2CXHA 4DCVA 10MHA 4OKSA 2NYUA 3KD2A 2QORA 4KR0A 3ABRB 3HO1A 2C5GA 3AR7A 3CY6A 3NH9A 4COKA 1JPVA 1V8ZA 1NT4A 3ORQA 1OJLA 4GMDA 1HYBA 5ULLA 1KIAA 4Y1EA 3PX3A 3GZNB 5CT4A 2GSDA 2O59A 2YH2A 3U40A 3WYAA 3D7NA 2B99A 1JIJA 2VATA 1UMDA 1ARZA 1HMPA 2FQ1A 3CTPA 3BT7A 1NPDA 1ZD3A 1UK8A 4HAUA 2HSEA 3SEQA 3HCPA 5CB0A 2J08A 3JYOA 3IEXA 3UPTA 1MIOB 3EEBA 1KQOA 3QI7A 4UTPA 1KR2A 4FDUA 821PA 3UHAA 2J46A 4D2IA 4H35A 1WXEA 2QTFA 5DYNA 3A6JA 2RHGB 3FVQA 3H87A 5I7FA 3JD2A 4GLBA 5FBKA 5CCDA 2JIDA 1J07A 4H3KB 1RXYA 5LBIA 5F9FA 1IZ9A 2ZRJA 3B3FA 4HFMA 3N3AC 1XJCA 4BRWA 3JQBA 3S5UA 3JWIA 1Z0ZA 2HJ9A 2I7CA 4ACAA 5KX5A 4QYXA 1ZGGA 3R5HA 1C81A 1XNRB 4WINA 3WHPA 1XP8A 2WNHA 3U4CA 5K3AA 2Z5GA 3SICE 1R00A 1Q7GA 3QWHA 4HAYA 2A88A 1ZN9A 1E62A 4NCJA 1J9ZA 4Y67A 1HA3A 1KVRA 3DL7A 1XXHE 1A4RA 3HUDA 4HDCA 1U5BB 4LZNA 1W36B 2ZWIA 4M7PA 4EZIA 4JS0A 4LJAA 4CRWB 1JAYA 2L82A 3AF4A 2QVGA 3PQ8A 2AEJA 1X3LA 1C7FA 3PF9A 1B8NA 4HB2A 3KYBA 3ZS8A 2V0CA 2GK6A 3OFKA 4IVQA 2ZYTX 2I6QA 4QUKA 3WLMA 2XTJA 1O8CA 1OI7A 1UJ2A 3B5JA 5IDVA 3SSAA 2ZYAA 3AT1A 3EGIA 3P2JA 2BMEA 4MQBA 4JJ6A 3PE3A 1Q20A 4QXQA 3IKLA 5H80A 2H7VA 1PLKA 3UKJA 3NBUA 2X0JA 5IT5A 5LB2A 1DB3A 4OXNA 1XKLA 2ANBA 3E23A 1UP4A 1NY6A 2PMCA 2QJWA 3GJYA 4O33A 2IYSA 1DUIA 1RCTE 4F72A 1A8HA 1DS6A 4HKTA 4RAOA 1YU6A 1OQAA 3PUYA 4ER0A 5B64A 1SD2A 4TOIA 5B57C 4H7KA 2FGKA 2B0JA 3HU1A 4PC6A 4Q7EA 2YVAA 3ZNPA 4ZCSA 4ZYUA 3WGYA 1L5NA 1LFDB 3L1UA 3SFZA 3FUXA 1JECA 1BKYA 3QV1A 1NLMA 4IDEA 3F0TA 2Q5LA 4G1UC 3MMZA 3V1LA 5KYXB 4QXMA 2WA1A 3FDZB 3I5MA 5DKFA 3HBFA 1NXXA 1OFGA 3TVTA 1NN3A 4LOIA 5A5DA 3AHHA 1GUFA 4KTVE 1MHPA 1JKXA 2CLLB 1EK5A 1R88A 5AJUA 4YRGA 1KP9A 1XRPA 2Z2YA 4Y2XA 1XGKA 5CG2A 1TUEA 2FPIA 1OBFO 3L0BA 3Q0EA 3S81A 2X22A 3DOCA 5CLGA 4GLFA 1KYTA 4MYSA 3IKTA 1AV6A 5BUZA 2AZDA 2ODWA 2HMSA 3I6QA 3PFCA 3NANA 1IUKA 1THTA 2WF6A 3FWPA 3H65A 4EHNA 4X8HA 1OAAA 4M0DA 2VKQA 3SHTA 3T38A 3OJFA 3RU2A 2AKYA 4AULA 1MA3A 2IZ7A 3FFWA 3MERA 2DHEA 1EDOA 1WM1A 3BIFA 3DC2A 3KRTA 4LBYA 2AXNA 2W90A 5FOQA 5C4IA 4M54A 4FYJA 5B3KA 3A70A 1M0TA 1E3EA 4IGIA 4P7BA 3WL3A 3ZX5A 4F9TA 1W73A 4N0PA 5JISA 5CDGA 3AHFA 4N7MA 4ETIA 3DTNA 1QOQB 3I0MA 1HV8A 3NTXA 5CVJA 2AJBA 3VKFA 2HI0A 2YY7A 4LDJA 4GF5A 5L3VA 1FYVA 2AVNA 3IDAA 3R7NA 2VH1A 3KQQA 3WMWA 3BMOA 3NV9A 3RBAA 1YMUA 2OFWA 4QFBA 2QY9A 2ZSIA 4L76A 3IUMA 1T9KA 2HK8A 4V02A 5DCYA 3AVXA 2HIHA 2V0NA 3N0VA 3RS4A 5TX7A 5KBYA 3C8DA 1KAQA 2KSQA 1ZC3A 4I1YA 4H0NA 3C5EA 4X7BA 2JJ1D 4BFYA 1NVEA 3LC0A 2DWPA 3BKXA 1AMNA 1B0PA 3TXYA 2P9EA 1TIPA 4AS1A 1XE3A 1Z0JA 2LDBA 1K75A 3HKEA 4BX8A 5ALWA 3TAUA 2WVGA 3LCJA 1D07A 1N2IA 4YRJA 4ENQA 3D1LA 1E2IA 2ODEA 1C30A 2PCLA 4FR5A 5DPMA 2XCIA 5B3JA 3ZE8A 1E2FA 1TDJA 3E18A 3OE4A 4XGIA 5DLPA 2BDUA 2OHVA 1D9XA 2ARKA 3ZQ6A 2ISCA 3I23A 3QEJA 3OWHA 3AVOA 4XDYA 1R9NA 3MS7A 4B80A 1NFQA 2H48A 4WLVA 2ZUUA 4F4JA 2F00A 1S2IA 2J1LA 2NO0A 2QAGB 3N2GB 3QLJA 4KBYA 5B7NA 5C7OO 5LWHA 1J1ZA 1HZZA 1XNQB 4TKZA 3H3XA 4RCYA 5GP1A 2HRZA 2DFDA 4KN8A 2AEMA 5KQMA 4D97A 1GTZA 2X58A 3QVGB 3EFBA 1WCIA 3FCXA 1PQPA 4HRXA 5EESA 1Z73A 5TRTA 1TM2A 3OCYA 4MV5A 5BXQC 3VNBA 4OIMA 3KETA 1KFEB 1PUJA 2B8TA 3BGIA 2KM1A 1TJPB 3EQZA 4FBMA 5K3CA 5T57A 1JEQB 1NWHA 3LUFA 4INJA 2TRSB 1BDJA 1NVVR 2NZUG 3QYFA 4CLHA 2FEMA 2QVZX 1TYBE 4G5FA 4RL6A 2QPLA 2GTIA 3IOEA 1Q1QA 1U65A 3ZWBA 3I05A 3IILA 4BV8A 4EHIA 2B25A 4MYTA 4CQJA 4URVR 1Q77A 2CJXA 3LL7A 1HEUA 1PEYA 2GR9A 5CURA 3ZHRA 1BN7A 5JLJA 3QWFA 3MSCA 1GUBA 2QMYA 1J1UA 1WMAA 2PWZA 1IJKA 1MQSA 5EP3A 2J9FB 4NCAA 5JNLA 1W0KD 3EGEA 1XA0A 2V9CA 3GNTA 3PGLA 1M6WA 3G8YA 3T7JA 4PZZA 3VO2A 4X1KB 3AY0A 4WKCA 5KVQA 2NU8B 3JD3A 4BQEA 1AGPA 1SBNE 3UJ6A 3VYWA 3F90A 3PHLA 2P2CA 1NP3A 4AKTA 2IE8A 4KG7A 3M3HA 3STYA 3V46A 3WNZA 3IL2A 2OZKA 2VUIB 1U7UA 4TUYF 1SNYA 2VP3A 1MIOA 1CZOA 1KP3A 1M2HA 1LI5A 2R2AA 3DVRX 1ODSA 1GR0A 2X42A 4UM7A 1ZIYA 5EIEA 1EVJA 2WT4A 4NV3A 4QEZA 3TQSA 2CVFA 1E3JA 1V5GA 1JFSA 5FPPA 3KJHA 4CLEA 4WBNA 4OK5A 5F7ZA 2I2AA 3ZHVA 5FTMA 2XGJA 4KZKA 1CDDA 3LZCA 1EG7A 4C5CA 2HRCA 1OT3A 5TS3A 2OYSA 3ZCXA 2UVDA 3LY9A 5IAOA 1I4EB 4J94A 1S02A 3FI9A 1P73A 4PCLA 4BNMA 4JHXA 3NFYA 1ESCA 5SZIA 1VCHA 1UWVA 1RPAA 2I4OA 3K15A 3AZPA 4S04A 1O0SA 4O29A 4DS3A 4YGYA 1ZXXA 2V59A 5DM2A 4RFLA 4KWIA 1EK0A 3EMBA 3HJGA 1O08A 5FKJA 3GLFB 1A2BA 1OZHA 1NJ2A 3TJZA 1EESA 1JR6A 4RC9A 2NU6B 5LIPA 2Z6QA 1U2QA 2YRXA 4KPUB 2DWOA 3GBVA 1C3VA 1OGJA 1GIAA 1NXVA 1P5RA 2WG0A 3F5QA 3GT4A 3TDNA 3IELA 2H7XA 4GLLA 5CVUA 3FMVA 1C9MA 2D0DA 5D2CA 2PKXA 1Z7YA 1U9ZA 4YPFA 3U7EB 4E5PA 2O2JA 1LH0A 1HH4A 3HSYA 4X20B 2XRZA 2Q9UA 1STOA 3NHSA 4LJ4A 1U31A 3H9JA 4JT2A 1U0SY 3G02A 2B0CA 4MKGA 4KUEA 2CBXA 2QGZA 4RD2A 4MARA 3UA4A 2AIRA 3EMKA 1K8XB 2A1TR 2CDRA 5JARA 1Y7LA 5M5BA 2JKYA 1OE0A 3KJNA 4RA9B 3MHPA 1M1NA 1N9GB 4XM1A 1JNYA 5EUCA 1NURA 3S2GA 4DWJA 3UC5A 4C4SA 3LKDA 2ZI9A 1PQWA 3FPFA 3IBGA 3P45A 4MUNA 3PEEA 4URHA 4BQIA 3S5JA 3OD5A 3IQWA 4EAAA 3GLIE 1FFYA 3LH5A 4B6SA 4R2IA 4DJFC 1QRRA 2VBIA 3R6LA 5A1JA 4B8WA 4KRFA 1J2EA 1VIVA 3CLSC 3I2GA 4AP9A 4UNRA 3C2QA 4PX9A 4CR8A 3PUJA 1H2XA 4P7FA 3EGOA 1KVTA 2RBKA 2V5UA 3A6LA 3H11B 4UJ5A 4YWHA 3UT5B 4G9EA 4QJ4A 4RY0A 4X41A 3TIGA 2UUAB 3EHDA 4HDQB 5CW2A 1JRLA 1UDAA 2A9KA 4IOMA 4DLRA 3O73A 3UBMA 1RMYA 5F1YA 1RSZA 3EODA 1Z5VA 3S8MA 1WV1A 4H15A 1V5IA 3G2MA 2I22A 3SDZA 4JH0A 2I6GA 2TYSB 4JXZA 4CV0A 2BBSA 3PQ5A 5CXUA 3LC7O 4FT2A 1EWYA 4ZJUA 4UBIA 4YONB 4R2JA 2XECA 1RJDA 2VF4X 1N4AA 2VDWA 2X76A 4PGHA 3KFVA 2BGUA 1R27A 3U44B 3X44A 2D62A 1PYGA 4LFCB 4E4RA 1MX5A 1ACLA 4ISCA 1Q44A 3KYCA 3O91A 2ZSEA 5ALQA 2XOKD 4EW6A 3ADOA 2OGUA 1W76A 3H5LA 3VHQA 3P0HA 3DTTA 5KWVA 1RQGA 1DBVO 4JR0A 5CNJA 1NN0A 4N7JA 4G41A 1BO6A 3ND8A 4QUEA 2OHJA 4A27A 1K89A 1UKYA 3OLWA 3PNBA 3PPXA 1A5BB 4HN4B 2YBDA 2A59A 2CNKA 5BSMA 2W2QA 3G9QA 3LA6A 4QARA 5FBRB 4CM9A 4I66A 4U7HA 4ZT5A 1T6ZA 4LHSA 4OQZA 2DWQA 3C97A 1TADA 4YCJA 2QQFA 3QUBA 4CKWA 3H9EO 2IPAB 2PLAA 2PM8A 4JIMA 3WYCA 3SQMA 4YBZA 3DBLB 2NUPA 4US0R 3LT2A 1F20A 5C81A 4JVLA 1IOVA 3ZD9A 2ZI3A 2V6FA 1KR5A 1SHUX 4LS3A 4M1OA 3MBKA 2IY9A 1R12A 1KJIA 1YTUA 2G04A 3DZJA 4JR1A 1TUGA 2PKYX 4X00A 1J2YA 2F1KA 3UO8B 5LP6F 1O97D 1PWEA 3AYZB 3K1JA 3W1WA 4H1WA 3IIMA 3KUCA 1W48A 4I2NA 1UIMA 4A7PA 4DZRA 1U5AA 1THGA 2VSNA 1EQAA 1E2PA 2NVUB 3RT9A 2CYBA 3NYWA 2ZJ4A 3WIVA 1BU8A 4PNEA 2SKCA 3WLIA 2XA2A 3FYDA 4B3JA 1SWVA 5BWMA 2H1VA 3AUFA 1JQ5A 1EFVB 2RHCA 1KYXA 2G9RA 2WVHA 2J3HA 3VC3A 1DKMA 2Y71A 2ZB2A 4G0NA 5CLHA 1YB5A 1JWAB 1KKUA 2CNLA 1KZHA 2W4IA 4KJZA 4V24A 3F5DA 3QXHA 3HFSA 1EDEA 1DFGA 3NKVA 3ZHOA 3JAWA 2PSSA 4O4JF 2XNDD 1GKLA 3EH2A 1WOYA 3CKYA 3I4LA 3NB0A 1EM8B 2Q45A 1QHIA 4XEUA 3C3EA 5EKTA 1Z37A 4YQEA 5FH9A 3L79A 4OHOA 1JH8A 3RJ5A 3TZBA 4XW2A 4GFDA 4A10A 1YA4A 4UMVA 5EFOA 1B41A 4AL4A 5KYYA 3DTVD 3Q85A 3LCVB 1GT91 1NIPA 1RXUA 5FPYA 4EIWA 5K03A 5A4KA 3ZDDA 2ZYVX 1T2DA 4H27A 1SQ6A 2XMBA 1FYXA 5CXXA 3S2SA 3W5SA 2UZ0A 4DCCA 4DB2A 3SEAA 3L0YA 5EZ5A 2DPXA 2RGUA 3JQFC 5TQ2A 1RLTA 4XJSA 2F67A 4OMCA 2VFAA 3E9YA 4JB3A 2H3HA 1KZ6A 1Y82A 4A82A 5IYZA 1ADGA 1CQJB 2BDEA 1ENOA 4TVOA 1YJXA 2DGDA 3GQBB 3U3DA 2GA8A 1J25A 2WZDA 2QWXA 2FP3A 3FPJA 4Z4QA 1PK7A 1CCWA 1PR9A 1EFPB 2I3ZA 1BA3A 4IICA 4W5QA 1M33A 3QX3A 2G72A 4IJMA 3ELDA 1WHSB 1X0XA 4JVMA 3K8ZA 3Q9SA 5CNKA 1YFKA 3SXUB 3THRA 4E2YA 3HDGA 1A1VA 3QKIA 3MWDB 2IPOA 1P7WA 2XUDA 3EQ7A 3JR7A 3OIUA 5EIAA 4YR7A 3U4GA 1D1QA 5IK2D 2Q2QA 1QJCA 3CVXA 2MYNA 3THXB 2D00A 2YJNA 1QTQA 2CSXA 3BDIA 2WWGA 1FLDA 1IN8A 1B8OA 2PVPA 2Y4NA 3KL4A 3MRVA 5KYWB 5KQLA 3TTUA 2A1UA 1RC0A 3OJEA 4PZEA 4Q7KA 1PF7E 2RJOA 3OOHA 4AFNA 3MWEB 4QLOA 4LV8B 4OYYA 1E5LA 4CG2A 2QRVA 4LF6B 3K5HA 1UC8A 3B13B 4FZ3A 1U3UA 4RGBA 4H0FA 3R3HA 3ONEA 2D13A 4ANFA 1OPXA 2E85A 1WXGA 2Z56A 3CRVA 5CDSA 3T1OA 3UK6A 3EXFA 3QBEA 2F43A 3QVOA 4IMIB 4LRYA 3B6KA 4II7A 3T7TA 4BZXA 3IMKA 3QKUA 1Y6GA 1Y8RB 3RT7A 4WKOA 4I50B 4CN8A 1DFHA 4FR0A 1FTYA 2X7JA 5GAJA 5JS7A 1OWNA 2PUBA 3DKKA 4YRCA 4D9MA 5B4UA 4B7UA 1WSBA 2QQEA 3UJ8A 3R3UA 5JSFA 3F4KA 2HPZA 4IV8A 5AVVA 3H4TA 3I5YA 4TVBA 5TGDA 4GZ5A 4CDMA 3ZLUA 1WBDA 4BVEA 4XSHA 3Q11A 2ZVPX 1I4OA 3QELA 4G4SO 4K6OA 4R2WA 3G5MA 1XDWA 1DOHA 4MV3A 3Q40A 3DQZA 4PC3A 1XVVA 1WV0A 1DAGA 4ZYZA 1Q15A 3HL4A 1ZUNA 4RTRA 1SU6A 3OHMA 4P3XA 4XX0A 1NUTA 4FCTA 5I51A 1U63A 4PSDA 3OZUA 4MQFB 3FVVA 2WG1A 1U2DC 2HPHA 2N3ZA 2GB4A 2YTZA 1KFJB 5L3SA 2IT1A 2IVFA 1TA0A 2XWJI 3C5CA 3E9RA 4MA0A 3ZGLA 4BHTA 3T1QA 4DCPA 1C3OA 1T9BA 5AK4A 5HE8A 4JVSB 4BLUA 1EHYA 2DH5A 4KO4S 1X87A 3FHCB 1Y80A 4ZEOA 2AFVA 2FOLA 2VLBA 1PD0A 3N2KB 4AF7A 1ULSA 3MA0A 1IUPA 3K5PA 4RTQA 4NJMB 4D44A 4QAJA 4EY6A 1NJ6A 2IHVA 3I1JA 5EIHA 5DNUA 1IULA 2J31A 3DGFC 4FNAA 3B70A 1QHNA 1JE0A 3T1HB 3QVGA 4DM3A 1G19A 1LUAA 4KXMA 2QBYB 5BRNA 4WERA 1VSUA 1V47A 2DBRA 1W0JD 1P1FA 2HV8A 4Z54A 5BUCA 1EDDA 1A50B 1U28A 2BRUA 3KQVA 4NENB 3EQ8A 4ZQFA 4GYJA 1IMOA 3CYFA 3R20A 4JL5A 2ZG6A 1JU3A 3RKUA 1NI4B 4IDNA 1U4SA 2B5OA 2ZVDA 3P9NA 1WVMA 3VI3B 1RM5A 1E4EB 1H6CA 1T4GA 1NLUA 2F7SA 2LKCA 1G4HA 2P9ZA 2QY6A 1IBRA 2VCYA 1G8JA 1TX4B 1LD3A 1NQTA 2GH1A 1CUJA 2O07A 2V6JA 5FOXA 2GBFA 2O7NA 2ZIFA 3ZU4A 1QXSA 1L5FA 1EKXA 1IOZA 2QN6A 4QQKA 1KI3A 1TYCA 1ZGHA 3ZY5A 1P9NA 1UQRA 3N7TA 5C8XA 3OX1A 1YU9A 2OBNA 4JQOA 4PHCA 5EMHA 5FF9A 1T8TA 2G7MC 1GG8A 4QX6A 1A9RA 2PBRA 2ET6A 3GNLA 3OPNA 2P8JA 2VDQB 4C6SA 2P91A 3EVCA 4I9GA 4WEOA 3C3XA 1KYWA 1CEQA 1DC4A 2YUIA 1UEJA 1AUPA 3ABQB 2B1JA 2C0CA 2JI8A 2DKNA 1HE3A 3CUWA 3R5FA 5DEOA 4UOZA 2FDCA 4S3MA 2IPXA 3BJZA 2OP0A 5DW3A 1NHWA 4IR7A 5KTOA 4RJJA 3R9XA 5KAPA 1U2GC 3U31A 5LL6P 3K0BA 5EGSA 1NR7A 2HLDA 3OSUA 3NEAA 2OP1A 1CS0B 3BWDD 2Z43A 4F5DA 1T6BY 4GPAA 1YASA 1P0QA 2P4UA 3M89A 4P5PA 2NX2A 3BTUA 5ITZB 1NU6A 1D8TA 4DNXA 1FTNA 1CB7A 4P36A 1U5BA 2IQ5A 4OIFA 5IEBA 3BA6A 5IJAA 1Y48E 1VSQA 4LG1A 1TTPB 2O0KA 2PGLA 2B5WA 1JZSA 4RMIA 4X3OA 3R77A 3HB7A 4MO9A 1GZSA 3MGGA 3QLVC 4O08A 2W2KB 4GX0A 1X42A 4PZCA 2IZ6A 3D5QA 3KJIA 3RTEA 4H16A 4IL5A 2ZTMA 4B3BA 4B8YA 4YRKA 2VBCA 4NYMQ 2G8NA 5EIWA 1FDRA 2Q1WA 3CLHA 4NV0A 4E6EA 1J0EA 2BKLA 2VPXA 2AYYA 2AFRA 2B5VA 4MJXA 5DWDA 3SF8A 4B6OA 1GTRA 3TPCA 1AHIA 5I3CA 3UB2A 5PNTA 3A28A 1LLDA 2B6NA 3HYLA 1JTVA 4ECEA 1MTOA 3SI7A 3ZOZA 4INPA 1CZNA 1Y34E 3PDIA 4KLRA 3LDHA 5FI5A 5BV7A 2HMUA 1XPJA 1A88A 2ZPTX 3C8HA 4IZHA 1RI1A 3AV3A 5F3DA 2Q4EA 3VU9B 4DIDA 2VZ0A 1P3DA 1N9KA 1KDTA 4WCFA 4D9KA 2IYYA 4E1VA 3ET5A 1G5FA 3QX8A 3M6LA 4X71A 3OFVA 3NBFA 4ZTZB 4PYKA 1RJEA 2R9VA 2F3PA 4OMUA 1P5ZB 5FBWB 2NSHA 1JLRA 3BBLA 1X6VA 2JLAA 1Z6PA 4KGDA 1ECLA 5C34B 3WWYA 1PJ8A 3BXFA 4HQ0A 1MFZA 4G25A 1XDSA 4C0SA 4Z0HO 5GZ1A 1OFUA 5JSQA 4YJHA 4G9BA 4MRSA 2VDKB 3S1AB 2XGMA 4R1QA 1G8SA 2CDCA 1YH3A 3AGPA 4L5CA 5H5JA 3PNPA 5DOZA 3RSCA 1R3UA 3IJPA 3OCUA 1QJ4A 3CZMA 4MA5A 5LZ2A 3LKBA 3NTUA 1NZFA 2XUQA 1MFPA 3AR5A 1JAXA 5IF3A 3VKGA 2D1TA 4KXNA 2ZFUA 4LBVA 1GTMA 4RD0A 1NW3A 5ALYA 5B1SA 3VSAA 2OB2A 4F3NA 1I1NA 1B0AA 2RG7A 5KJEA 2O8EA 3TSWA 5CFNA 5K3EA 1OC4A 2PAFA 3JXEA 3EVZA 3U09A 4MHTA 2JAQA 3VU0A 5KUTA 5FWXB 3VNUA 3MMNA 4KK4A 4P4UA 5M34A 1R4NA 2VXCA 3DMFA 1A71A 1BDHA 5K3FA 2E87A 4HR7A 1ZESA 4XDGA 5CM2Z 1C9JA 3DUWA 1DPGA 2OHFA 1UBHS 2Z1DA 3HU5A 1PZFA 2QENA 4OHRA 5G0WA 3NS7A 5THQA 4TLLB 3JQCA 2AG6A 4IIJA 4MW0A 4PPQA 5CDFE 2XMQA 1U7WA 2VSYA 1O58A 2P1DA 1LSUA 5BNWA 3U37A 5JYDA 4EF4A 2HK6A 2HDOA 4MINA 1RLIA 4BQRA 3EWNA 2HOQA 3JQ8A 1J22A 1AQJA 3P9YA 1MBZA 2COUA 3I2FA 1FW6A 2J85A 3E70C 4JFAA 3SMQA 5LD2C 3ON5A 3VZBA 3VOBA 3HXOA 2ZBUA 3LW8A 2GM3A 3D2AA 4NYIR 2PKWA 1UFOA 1BJTA 1SVIA 1F0YA 4IX1A 4K6KA 3H5WA 1AXEA 3SOZA 3BFPA 2ODPA 3QYJA 2VRCD 4X7MA 3GLFE 3SGLA 2F3UA 2ZW9A 4IOKA 3DTVA 2V7VA 1N8TA 3TLKA 3EDCA 3B1VA 1GPDG 2QT0A 2XH8A 4GPEA 3BL5A 4BUJA 1HTBA 1M7BA 1UT8A 2ZJ5A 4HEA6 4PLWA 5LR6A 1ONNA 1USUA 1SBHA 1TI7A 1DELA 2GNAA 2F8SA 2GMWA 2FRXA 2VQFB 4YI3A 4G81A 3NFRA 4LISA 4Q3AA 4RTOA 4IS2A 4KB5A 2A30A 1AKUA 2YV4A 1TAQA 3UV6A 3A58B 4OBEA 5B1YA 3TW8B 3I92A 4FQ7A 4AZ0A 3NVKI 3DEZA 3HCNA 5K01A 5ICMA 4BLQA 4DEYA 1J39A 1ZIOA 1FVFA 2D3WA 4KMSA 1ZK4A 2HH9A 3IO5A 1AKRA 1XZPA 1U1GA 4KXUA 3H75A 4C2UA 3AUUA 2WB4A 1Z83A 4RQBA 4B6GA 5BR7A 4KIFA 3JATA 3OC0A 3GLIB 4OFXA 1ILWA 4Y0NA 5CT8A 1H42A 3I01A 4FCCA 2M6KA 3UK7A 3IOCA 2ZT7A 1C1YA 4R71A 4YV1A 5JG7A 1M76A 2COKA 2XLBA 4LGYA 3EF0A 4N5MA 3WWEA 3BFXA 1QF9A 3MILA 1SRRA 2EX1A 1O9GA 2IXAA 3I9OA 5G4KB 4ZHQB 2PYIA 4EYQA 3G0OA 3WKBA 3K5WA 3L18A 5DISB 3R9KA 2G5GX 1GNLA 3PUVA 5DI3B 1UBRS 3TAXA 3VR6A 1ZGZA 3C8ZA 3W3AD 4DIKA 5HW0A 4LOLA 2VZ9A 5AICA 2H5EA 3NBYC 1UJ5A 2EFGA 2GCEA 3UW1A 1XMQB 1YR7A 4UEWA 1ZITA 2QG6A 1LY1A 1OW3B 1YQGA 1EZZA 2I3AA 2ZU6A 3HNPA 3L2OB 4RVSA 5FCDA 5IBRA 1GGNA 1MVOA 4XWTA 2VXBA 4FR2A 2WWXA 1N6PA 1RHRA 2OD9A 3AW8A 5DYTA 1NR1A 1NZJA 2PH5A 3CTMA 3QXSA 4MV8A 1P1IA 4QTYA 1EE2A 2PR2A 1XEWY 4MR9A 5BSRA 2P5SA 5COBA 3V2UA 1IB6A 4IHJA 4BNDA 5BN4A 5K9ZA 1LLUA 5TF4A 4I08A 3VQTA 3OH8A 1NASA 4MCAA 5CM9C 3WLTA 4NCBA 4PV7A 5GONF 4F86A 4D9GA 3WLHA 3ZWVA 4PLVA 4KSCA 1SUEA 4HVLA 3PD1A 5GONB 3KR2A 4OYRA 4LJLA 2OUIA 2NO7A 3QK7A 2DCUA 1I2DA 4HMPA 1RTTA 1GGMA 4OHBA 4X1YA 4ALJA 2W6ZA 3IALA 2WNSA 1NI4A 4GOKA 1NN1A 3TQRA 4ER3A 2PXHA 4D4KA 2ZUEA 2NOAA 5EKDA 3ZWQA 2X5NA 1LJ8A 4NMMA 2A1IA 1VKRA 4UBMA 4DJJA 1MKYA 2ZZKA 4ZVMA 1XJ5A 4BX0A 3ASVA 1ZN8A 3PF8A 4PLCA 4AMYA 1QIFA 2WJYA 5C8YA 1KA9H 3IBSA 3AR6A 4HLNA 1YBFA 5BT9A 1E79A 1IG3A 4HDRA 2JIPA 2ST1A 1T35A 4AO7A 5JZVA 3JARA 2C9DA 4HXEB 3LRXA 2Y0CA 2D5AA 3G5TA 3EEIA 4I3FA 4JP8A 4KLCA 3FUWA 4WN9B 1C7EA 4X95A 3WADA 3VPGA 2F8MA 1QRUA 3LHIA 4TPKA 2YVLA 5B1DA 3WNBA 4EHHA 3SVTA 4BJ3A 1C3OB 1SC1A 2MMGA 2NGRA 3K53A 1A8SA 1Z35A 3LDGA 5JEEA 2B1GA 1JIQA 3KAQA 5ILGA 1G7CA 1O96B 4MZXA 3PGA1 3I04M 3GG9A 4BNKA 4DMLA 1ULTA 2HA5A 2JRCA 3R3WA 3MVEA 1DQPA 3UKDA 1T1IA 3D3NA 4F6RA 3UMFA 2XB2A 5DCWA 1P6QA 4ZZ0A 1ES9A 1SBZA 2HGZA 1VHWA 1EE1A 4IKPA 1IZ7A 2BFFA 2BKXA 3BIOA 2EWMA 3I61A 4MVJG 2RC6A 3OZDA 2WHPB 1NW8A 4BRSA 4CR6A 4ZZIA 1UC5B 3OF5A 4E2ZA 4XI9A 2E4VA 1ESNA 1PW5A 1W85A 1QFXA 4HJXA 1CQPA 4I50A 1BGVA 1ZSNA 4O2AB 1TLTA 3BH7A 1IEQA 3BTOA 4NXMB 3MCZA 5DMHA 1UC4B 3IIEA 4C21A 4EBBA 3D0RA 1SKUA 1KSHA 2XVZA 4UE2A 5CVCA 1JEYA 1QVWA 5HUQA 1SZPA 3CEHA 3EBLA 2VWPA 4R98A 3SJCA 1YKFA 2QE7D 4XYLA 1F2UB 1OYWA 1YE3A 1J0XO 3GVHA 1O94D 5KSPA 1M8FA 2QJOA 4PANA 3T34A 3ZWYA 4AJLA 1L5VA 1XN1A 4B3GA 3R0QA 3LO5A 1TM4E 1QE3A 3EY9A 2AJTA 3TRHA 1IIRA 4EJSA 4I6EA 3SPXA 3IAXA 1RRFA 4QYIB 3PRKE 4HNVA 4BXOB 1LPBB 2IC5A 3RSSA 1ULAA 3WZLA 5HZHA 1U2RA 2ZUBA 3C0KA 1EX6A 1GQOA 1ADFA 3NOVA 4H1UA 4RVOA 5FFMA 5H4GA 4BGUA 5KYYB 2FKAA 13PKA 1BD4A 2QM8A 4LJ6A 1G38A 1QH9A 3EZ2A 3IT3A 4UNQA 3KTDA 1KK3A 1ODIA 5PGMA 3NR2A 2GTPA 4B3XA 2NO4A 3CH7A 3PFGA 5SZJA 3RUEA 3IT1A 1A9YA 2A0YA 3N05A 3MMXA 4BBPA 2YBEA 1A7KA 2Q5CA 2GAJA 3GP5A 5JE8A 2IVZA 4U7DA 1VSTA 3MOIA 4J7XA 1D2RA 1M2VA 5B1HA 3GUCA 3RGGA 3SFVA 5AXAA 3KJZA 3BGSA 2FMXA 2BMWA 3U9TA 3U4HA 2P30A 4E2XA 3ZQKA 3EB9A 1BDBA 4RSHA 4KI0A 1FP6A 2JGIA 3OX3A 1S2NA 3FHLA 3LX5A 4IOLA 4MQLA 5DVZA 5F5XA 3RUAA 1TB4A 3VHLB 4C78A 4EB6B 1C1HA 1S8OA 4BGVA 1O2DA 1TZBA 2BR5A 4RM2A 2IYNA 4BP9A 4DBZA 4RLHA 3ENWA 3V2GA 5BSHA 1BXGA 4I3HA 3ZWXA 1KWGA 3UUEA 3W4KA 1PR2A 3A9CA 2H52A 3HEBA 3M1YA 3W90A 2FRDA 2H31A 3NWJA 4Z5XA 4TXLA 4CL8A 2VDRB 4HDNA 2EIHA 2C3UA 5FL7A 2DFLA 1RBQA 4IM7A 1U0RA 5KHLB 4K9QA 1RP1A 2FX3A 3EFEA 3VA7A 3ICPA 1LKZA 4C2AA 5JS6A 3AHEA 1LLQA 5DE3A 2DUNA 4A5SA 4EHLA 3HEAA 4UFOA 2EQ5A 1ZUHA 1Q57A 1HKHA 2O8FA 3WY9A 4FW8A 4B84A 1W6RA 3B36A 2EKPA 1ZP6A 2PUVA 4FYMA 4JOBA 3SDSA 2C2KA 4FS3A 4P35A 4UQPA 3I5UA 4M8NE 5LNK6 1H9CA 4JGBA 4FC7A 3ZCVA 4NFSA 1QIKA 4LZAA 4BEJA 2H4HA 2JFZA 1MT0A 3GROA 2FK8A 3NKLA 3D8RA 3F67A 4WV3A 2H4FA 4B34A 3FKSA 4IIGA 1T8YA 2R48A 4JX9A 2H8GA 4ZTBA 2DHDA 5EZYA 3FNQA 1DVRA 3COSA 3T99A 2OECA 2VQDA 2QNBA 1JSZA 3L0IB 2OBBA 1QH0A 3N76A 3ADBA 1HLGA 1SUCA 4L08A 4MLZA 3K94A 2DH6A 2G25A 3G8DA 1ZK2A 3PHBE 1RFGE 2BHRA 4IGFA 4LNAA 1CY0A 3RWBA 1G2OA 4NG4A 2QT9A 1JYEA 4EI2A 4U8HA 4L5AA 2R00A 1X9IA 1E6UA 1PJ4A 2KBEA 2C94A 2OCKA 5EHXA 3KS9A 2VDUE 5LNK1 4ZARA 1LWNA 4QEDA 3HY3A 1OGIA 1ZMRA 2ORYA 3DBIA 3Q9LA 1LNSA 2UUOA 4RH1A 5DO9A 1KE2A 3GP8A 4TX1A 4XH9B 2H17A 2MMCA 2XTAA 4J16C 4WXHA 1L5LA 5DASA 3PTAA 1SZJG 4AO8A 5LQUA 4QATA 3PR3A 5EHZA 4HX9A 3RYFA 3OT1A 4XB1A 2CUKA 3LUAA 5AK0A 4IZ6A 2ONKA 2QUBA 3H9BA 3ICWA 1WPRA 2WMOB 1XCPA 5K09A 4V0NA 2VQSA 1G4AE 3O2JA 3UMSA 1QYXA 1RXCA 2Q28A 2X77A 1WD5A 2M6LA 1MX3A 4LY0A 3HN6A 1QLHA 3CUSA 3WLQA 2JIZD 2R5FA 2AC2A 4RA9A 2UXDB 4G5YA 1CG6A 4KH0A 4AN4A 5EERA 2YV5A 3I2IA 2QRHA 2CL7X 2L42A 1FDUA 1EQUA 1M73E 3N0RA 1XIVA 2R1TB 2VHUA 1NW6A 3IHKA 2IEDA 4YUWA 3NYRA 1UPAA 4WLUA 5ERYA 1P1RA 5JW6A 3QXXA 3FDFA 4KX5A 3DVAA 3TNDA 1A7UA 4BUCA 1GRVA 1DT3A 1ETHA 1J00A 5JSYA 3LFHA 2GEFA 2XW6A 5CHEA 3R5XA 4MYUA 1SK9A 4RJIA 3IPRA 2BP7A 3WK9A 5D01A 2H06A 2ZUWA 4JLNA 2V0GA 4KFUA 4UZSA 5AM0A 1YQQA 2AN4A 3BRWA 3EGXA 3HLYA 4HTAA 5J5VA 4UOEA 5HKBA 1IN4A 1X1TA 5FUMA 5FLXA 4OQNA 4KQFA 1WZNA 3IEKA 4R5MA 1E63A 2IUTA 1JLKA 2CL6X 1UQUA 4XM0A 2BFAA 3A6GA 4X3PA 5AW6A 1FYFA 1UQTA 1E3QA 1PUIA 3WMGA 4F60A 3H9CA 1UCFA 2IUEA 3LQKA 1ENZA 3K1YA 1RWOA 1DG1G 1EVYA 4I4TA 5LZ5A 3T5PA 1D6SA 4BLWA 3R3XA 3DAYA 2XUJA 1Q1BA 4IUCS 3AF5A 4XFKA 5BW8A 3K70D 1F2DA 4PRLA 3VOTA 5HF9A 4ZK6A 1ID1A 4RQUA 1F06A 4BO1A 3P9QA 4ARIA 1FS6A 3R75A 3AM4A 3O9MA 2VYVD 4C6RA 2QGNA 1U7HA 4UULA 1RR6A 4AYWA 2DKFA 4I4CA 4QGFA 4S0ZA 5J2UB 3TK1A 1W4CA 3D3KA 4FGZA 4OHMA 4IZIA 2R8OA 3LSTA 3X1ZA 4S1VA 5A2QA 1OAOA 3R3ZA 3KDAA 2NMVA 3GPBA 2O9JA 4QUJA 4NJEB 4C3OB 1EGVB 2CKDA 4LBWA 3MT7A 3AERB 2JFOA 1RYNA 4Y2HA 1XEWX 1R6UA 2Z8XA 5BQOA 1J2TA 1SUBA 2YASA 2F2TA 1QTNA 2E0IA 3WGZA 1NLZA 4CG3A 1U8FO 2E4YA 6LDHA 2PVCA 5K0SA 2P3QA 1LBIA 5T4HA 1VMKA 1JKMA 4BKOA 4LXIA 4CCSA 1AURA 1XD2B 4DWVA 2ZUTA 3UF0A 5C37A 1DC3A 1AT1A 1KSJA 1OXTA 3GOQA 3KWLA 4CKYA 2AQKA 5HXAA 5IHXA 4LJ9A 4YJFB 4H7IA 3TB6A 4JY7A 2OXEA 2GD6A 3NKFA 1FRQA 4QDTA 2QYHA 4F45A 3GH1A 1Z0IA 1XZHA 1F6BA 2J6CA 1T8RA 4MB2A 5CMLA 5FWDA 3BTSA 3WDLA 1GXSA 3EXEA 3KZOA 4CQLA 1XA3A 1JDTA 5GJBA 3CM0A 3FGNA 3DCIA 5TARA 3U0BA 1DJMA 1QWSA 1ML4A 3SEZA 2BCJQ 2ZSUA 3AJDA 2ZOSA 4LSWA 4OKIA 1ABFA 4WLNA 3DD1A 1UBTS 3TD9A 3HYCA 3R0ZA 3DEAA 3HXLA 4RF3A 4XUDA 5EP1A 2CC2A 5LUAA 1M0WA 4KRYA 5T6MA 2FCRA 4JI0B 1WCXA 1D2HA 1EFLA 1XHLA 5K4GA 1V9SA 2ISSD 4KXQA 2OQRA 1BOOA 4LDRA 2JI6A 2PZEA 1G291 4RYLA 1AKTA 4IJVA 1SIWA 3LQFA 3QIAA 2V8OA 4QU5A 5KTSA 3FHJA 4MW1A 3VSEA 4BX2A 2B1QA 3BULA 5KREA 3HLKA 1FW8A 3NZEA 4DMFA 3TUIC 1ZR2A 5KOYA 1U3TA 2D1SA 2VF7A 2KJQA 4WXRA 1D04A 2VPPA 2RIRA 2NQ8A 4BAZA 2VP0A 1TZJA 3U3OA 5K7SA 1GVNB 3MCTA 1ODJA 3RS5A 5TEVA 1F2TB 1I1OA 4ZAVA 1TTTA 1BCRA 3CJRA 2YXNA 1T2NA 1N25A 1L7QA 3HKDA 4INAA 4RENA 1T4CA 3B1JA 4BDTA 8OHMA 4MWSA 3BD8A 1DP4A 4I36A 4C2BA 2DZDA 3IP7A 4BX3A 2EGUA 2JLYA 2ZGVA 4BNHA 2VPIA 2MDTA 4BWVA 3OSZA 4O02B 1F5SA 1OI3A 1I32A 1VLLA 3ZTWA 4A0GA 4H7HA 3HP1A 3DO5A 4RZQA 3MWYW 1WP4A 4PHTA 1C5KA 1C50A 1VCMA 2HWWA 3RVBA 5HR5A 3B6MA 3I37X 3THYA 1DAHA 2O3QA 3RARA 1OXBB 3FMPB 3DNMA 3FLEA 3LUDA 1XJQA 2PGXA 3MTGA 3NTLA 4RKFA 2FQYA 2P90A 4RV5A 4JT8A 2GCPA 1W96A 3GZJA 4A15A 4X20A 1VLJA 3DUFA 3VM6A 3FNGA 4PINA 1Y4UA 2X2OA 4LYAA 2Z9DA 4MR7A 5JD6A 5IWCA 4M1KA 1YQEA 1ZR4A 1U8EA 2JLQA 4D3DA 3NDBB 2XNHA 3WJAA 3VZPA 2F62A 4UTRA 4QOIA 3VKUA 5LA6A 4IDOA 2Q3EA 3Q2KA 2PLFA 3WB2A 2GPJA 1TYEB 3NXKA 3IT0A 4L27A 1J1IA 1K06A 4L8LA 3QZUA 2EKZA 2OBFA 5EJ7A 5M7EA 2ROQA 1G1AA 1SG0A 2Z08A 3M2PA 1PR4A 4IHQA 3K0EA 1B6RA 2C5LA 4KNYA 2BHLA 3GNQA 4O4JA 2GBGA 5J2UF 1IB0A 3L8ZA 3W8NA 4TT8A 3LXUX 4TRJA 2HBRA 2FPWA 3LPAA 4PLZA 4ZT6A 2BKUA 1IZ8A 1W29A 4Z7NB 1G17A 3L8MA 5AP9A 1WX1A 5THKA 3TW8A 3TFQA 5DU2A 1UDCA 1SEPA 2X8JB 4EHAA 1T5OA 4REMA 4GWKA 4W6QA 4HAXA 1H3FA 3CUEF 2FR8C 3Q5DA 1A04A 1MRZA 3HRKA 4OBWA 3CBQA 2CNOA 1BGXT 5JI3E 1LPNA 5HQJA 3HVRA 5TPWB 3OKCA 3GL9A 4DMGA 2WHPA 3VAZA 1EMDA 4D41A 1MH1A 4RY2A 2GPWA 1TQ6A 1RFLA 1X14A 4GG1A 2PWYA 2OHOA 4OD0A 1FX1A 5B55A 3Q9NA 4LOHA 1UF9A 3KCQA 1YOVB 2C99A 1KORA 2EVWX 3BIWA 4WSOA 4BO2A 3PVSA 3D3WB 5EI5A 2IBMA 2QIPA 2OV1A 1Z7WA 2BTQB 1ZONA 2YHIB 3F47A 4BEVA 4ZCIA 4B4VA 1L5OA 2GBIA 1T3TA 2F9MA 2WF8A 5DRTA 1K4MA 4L16A 4ZQEA 4CTMA 3DZFA 5DV9A 1YR6A 2CF5A 1EK1A 2D1RA 3C3BA 3JRXA 3AUTA 1GV1A 3F98A 3OIWA 5JO9A 3EPKA 1S7GA 3ZV6A 2Q7DA 4YIHA 1ZC4A 5GZ6A 1M2OB 4OYLA 5ILQA 2YOFA 1FJ2A 2Z2XA 1E0DA 3DHEA 2R00C 2XT0A 4GYKA 3T9BA 5AESA 1OKKA 1PYDA 3LPDA 3OURA 4Q1AA 5DSZA 3U4QB 2BCGY 1FFXB 1T91A 2H4WA 3DW3X 1YZVA 2Y0DA 2GK7A 2Q4OA 4L4ZA 3SYRA 4JYAB 5CVEA 4HWTA 4LRXA 5I5EA 3N1UA 2DECA 3N74A 1PAUA 3O9VA 4FFLA 3VR2D 1JSXA 4CMBA 3PDIB 1Y6ZA 2B8JA 1PL8A 2G9ZA 3AQ4A 3QTBA 1PWZA 1K0UA 3KR0A 4I1PA 5GMOA 2V9ZA 4EHJA 1ZKMA 5KX5B 4R9VA 4C3VA 4OHVA 1W94A 1HXHA 4JBIA 4DSUA 4V1CB 2DBYA 4KOAA 2ANCA 1TVEA 2EFCB 3UJBA 5DNVA 4NZNA 1ZHFA 4INZA 2HSZA 4D46A 2JASA 5B58T 1JHRA 2DMRA 1Y4ZA 3DT8A 1G6KA 3FBTA 2WPDA 3PU6A 5I9MA 3AKEA 4PHGA 4EMTA 3TXAA 3MM4A 5GINE 1IHXA 2VP2A 3U6BA 3AVYA 1T0JB 1EUCB 3L8DA 2YS7A 3MQ2A 3NIFB 4KQMA 4U3JA 5GPBA 4MDEA 2ZR0A 2G77B 1H9AA 2OAQ1 1M7GA 3ANMA 3DMNA 3DPUA 3CR3C 4JL8A 3UFXA 4A3SA 4AC9A 5DM70 1U1EA 1ESZA 2FQWA 3P9CA 3DMDA 5HTKA 1COWD 3RNLA 3QUCA 4G8CA 4NZ9A 2J3QA 4FLFA 1AU9A 5ALXA 3TOSA 4TL8A 3D6MA 3ROTA 4CKXA 1FJXA 3AMVA 1T0UA 4ME6A 1KFBB 1OIVA 4U8GA 4CQLB 1QCYA 3K30A 3OLYA 4N4AA 3QXCA 2QZ4A 4NWIA 4H7JA 3ZH9B 1XFAA 1BXKA 2VTDA 4CU5A 1X15A 1W75A 3F6BX 4XD7A 1Q2UA 4XAQA 8GPBA 2HXYA 3G7UA 4KV7A 5KTTA 4OXYA 3RVKA 3R0JA 3HDJA 5H8WA 3X43A 3ILYA 4PYIA 3RNOA 1IEWA 1ZDMA 1QYRA 2HA3A 2XTMA 4QTZA 4TMYA 1K68A 4UU7A 4ESEA 4UCWA 3A7DA 1Z4KA 1FYDA 4BKPA 1AH2A 2RGXA 3ZV5A 4DKXA 3TLXA 1X1SA 1W2GA 1UJ6A 4TSKA 5BV1A 1QPGA 5EZ6B 1ZNQO 4EMSA 2CVQA 3VPBA 1L4MA 3ZW8A 4KMOA 3FE2A 2Z57A 4L4SA 1CUUA 1DIGA 2JJMA 4MPDA 3N70A 1GSHA 1B8VA 4YLEA 5DEIA 1N6OA 1KJJA 1T2AA 4Q4LA 5HA5A 5CDHA 1DAOA 1GZ3A 5SV2A 5BR4A 1ZHOA 1GPWB 4EUSA 5HJ7A 3DAPA 4B7CA 4R68A 2C4TA 2PUTA 4WK4B 1ZRNA 2R5NA 1PG5A 3A05A 5DGHA 1ZVVA 2R4TA 5HCNA 2W2VA 3BDAA 2XBLA 4GRIA 2JH8A 3GRYA 3HL0A 4OHKA 5LLSA 4IDGA 4TWJA 4DSAA 4C5AA 2VCHA 3VC7A 2WQ6A 3P5SA 1USKA 3BMCA 4HLUC 4R3WA 4A8PA 5BWNA 2HJSA 4QBGB 1XCMA 4RIEA 1U1IA 1VZ2A 2RGNA 5FNZA 4M1WA 5EJ6A 1XOIA 4EPXA 4DUZB 3FD8A 1L1RA 4FMCB 4OYHA 5U4XA 2G9VA 4DYHA 1T15A 2RG1A 1UMCA 2AXEA 3QXGA 1FP4A 4Y9SA 1QR2A 1HSZA 5AKZA 4I4TB 4D9JA 4TT3D 4QGGA 3W5IA 4NATA 4N1AA 4K9DA 1IVYA 3SD7A 4HL6A 1PR3A 2FWNA 2WDZA 4TWRA 3CRNA 3STVA 4GX5A 3GI1A 3PLRA 5FQOA 4M6WA 1G21A 3GFQA 2K4MA 3ZW7A 4BC0A 5LOVB 4FX5A 1P2FA 5L9AA 3NNDA 5C5CA 4Z0PA 4QU0A 5BNFA 2EW2A 4HF7A 1JBQA 3GEIA 5T64A 2GEVA 3RUFA 5BOSA 1WW2A 3H99A 5C5EA 2BR3A 2C00A 4JVNA 5SY4A 5BV2P 1IH8A 3U1VA 1N1DA 3QFSA 2CL0X 4HNAB 3UIEA 1AX9A 5JJBA 5K0EA 3RYTC 1GQFA 2P2YA 4N6GA 3CS3A 1M1UA 2NAFA 1Z4LA 2WTXA 3ABOB 3HC7A 4GR9A 4J0DA 1DBWA 4K05A 1UUFA 5K2MA 1Y3HA 5L4LA 3RSQA 3WYEA 1XYYA 4EVSA 3OQMA 3WB0A 4LJKA 4Q7MB 3GBPA 4CF5A 5KTMA 2G5PA 3MQ4A 1X1RA 4LNUB 5AVRA 1QVAA 3UK1A 4DIMA 5IAAA 1X7XA 1C4XA 1CBUA 2XB8A 5F73A 5A04A 3HBAA 5LD2B 4LQDA 5GZ3A 3O3MB 4NS4A 4URUR 3C6KA 3MJVA 4UU8A 4Y6SA 1G4UR 1C7RA 1ZGJA 4R69A 4ECAA 2XQJA 1C0LA 3BL8A 4QXAA 2DUMA 3U61B 5F33A 4LQCA 4J7AA 4AZTA 1PZEA 3WG9A 1OOEA 5FORA 4DA7A 1KEZA 3I8SA 4F5ZA 2L0XA 5BMVB 4JI2B 1R8XA 4EECA 3QKRB 5JCXA 1RWBA 5I4KA 4Z2YA 5JANA 4D8TA 5DHFA 1DO8A 4D92A 4GBED 5LYJB 2VYNA 3QEBZ 2XZPA 4NNOA 3ICEA 2HMAA 1YTLA 1BH6A 3ZPXA 3KJGA 2JBHA 5IP5A 1VYHA 3BL6A 1YB6A 3M4XA 4W1QA 1OXXK 3EY4A 3HBLA 4YRPA 5EJ5A 1AY0A 1UZMA 2OCLA 3PQ7A 1Y81A 4KIWA 4BIIA 4GL4A 2E6UX 3L92A 4HP8A 3MZ0A 5LMNB 4ZKEA 1Y4SA 2BFPA 3EA5A 1Z7BA 3EXHA 4UC0A 2LCQA 4R8LA 1N2HA 1G9TA 1BRMA 1XMPA 3ROKA 2D2EA 2Q3LA 3ILXA 2AI3A 2UV8A 1JEDA 3D6FA 4EVQA 2JW5A 1MAAA 4AF8A 1W2HA 2JFWA 5JROA 4ZJPA 1AKWA 2QTMA 3NWEA 3OCCA 5DYGA 3H2IA 2IYXA 2EU8A 4YJ2A 4M9QA 2IZ1A 2XKBA 5TPZD 2GZ3A 5KJCA 1KMIY 1WUIS 3DHVA 2OLJA 3KUXA 1GRNA 1ADBA 2JFUA 4LCBA 1Q7CA 2VTKA 2DBZA 5DNYB 1HL3A 5CCBA 1IXSB 4CVNA 1FQJA 4HVCA 4L9AA 2PXAA 1PUXA 5DLDA 1M5TA 1JDPA 2J7PD 1M74A 3FWKA 5CYGA 3U7QB 5KWIA 4N7RA 2JBAB 1Q3HA 2G40A 1IN6A 2H54A 2QLJA 3M6AA 3GLKA 3IPCA 3MWDA 1Z36A 3MIIA 3OZAA 4QSMA 4UEQA 4E22A 3OFSA 3FBWA 3UVEA 5K8LA 1WMSA 4JBLA 4EJMA 1XD9A 2A86A 2CLKB 4KFRA 4W5WA 1Y6FA 5LSAA 3F7OA 4G6ZA 1BS9A 2P6RA 3FMOB 3R6WA 4ZEVA 2CV2A 3P7MA 5DN9A 4D3FA 2Y05A 3GCXA 4LKRA 4D45A 3G5AA 4G9GA 4P92A 3OAAD 1F4VA 3H8SA 4RD3A 5K45A 1SVWA 4ND2A 1JFLA 1NBEA 1SAYA 4K87A 1VLVA 4OP2A 2HEGA 2OV3A 2Q29A 4W9NA 1C7IA 3CB4A 4M0EA 2WFAA 4M98A 3DDNA 4PONA 4Y1RA 1IWOA 1WDTA 1XYGA 1CETA 3DV0B 4RELA 5MN6A 1LPOA 4PG5A 5B6IA 2AOUA 1AF7A 1NMQA 2FPSA 5LYJF 2W6MA 1APBA 5JZSA 1ONOA 2EEPA 1PBNA 4UJ3A 3BB3A 4H3VA 1TO1E 4M53A 1KTIA 2Z6VA 4YMSA 4YLYA 4RO0A 4OBBA 2L2QA 4MYRA 1WNTA 1FRZA 2GRUA 221PA 3C6QA 3G9XA 2A3NA 4P93A 4X63A 1ORRA 3F49S 4UD2A 4CMIA 1XRRA 2GCIA 2SBTA 2C4HA 1AIPA 1TZ2A 4QODA 2AZXA 2G1KA 3BMNB 4BNWA 1RM3A 2R11A 4FDLA 3L7AA 1IWBB 4K0KB 4CUKA 3K0CC 5ITSA 1Q3TA 2WHQA 3IVRA 2GLTA 1D4FA 4QUAA 2ZBPA 1XJ0A 4FDVA 1Y37A 2OHHA 2L19A 3GOHA 2WYWA 4PAQA 2W8BA 1QDUA 1HDGO 4ZCTA 5DHPA 3ML1A 4JODA 3A6DA 3CF4G 1MGOA 1OXMA 1K63A 1ULUA 1E60A 4KTTE 2KYRA 2QVLA 3E84A 4UDXX 5G0VA 2O1WA 1XU7A 3CIFA 3V1YA 2HYDA 2UXBB 1L8LA 2R8PA 2ZULA 1YB1A 4K9NA 1EFDN 5BV8A 3UK2A 1L6IA 3EPJA 2BUCA 3ITEA 5C9ZA 2EKLA 5E3HA 4HZGA 4I1VA 2VL7A 3VH4A 4PZYA 4X1YB 3LK6A 3H3FA 4NYJR 3LM8A 3IBTA 3K70C 2WRZA 4HDNB 3E9DA 4MI1A 1N3BA 1RLUA 4ZQCB 3COVA 2FEAA 3X2FA 3P32A 2OPHA 3B3JA 1JKJB 3S1LA 5EJMA 2WSSD 1OXKB 4CUZA 4IMJB 4TV8B 4I8DA 4OXIA 3SS7X 1SUFA 1TC2A 3FY4A 5IJXA 2FEKA 2IFTA 2V58A 4TGLA 1KO7A 4JSYA 2O8VA 4ZYTA 5KNBH 3DFFA 2RGYA 1O97C 4JKOA 3REQB 4L22A 5JMOA 4G84A 2G9QA 2DYKA 1DAMA 1UJMA 2HTFA 1VP9A 3IB3A 3JSAA 5K1ZA 4DQVA 1C4KA 1ENPA 5KJ1A 1P18A 1XTTA 3PLNA 3BMOB 1IVNA 3FTDA 1P9WA 1MQAA 4CLDA 4PVCA 4LXHA 2FQQA 1PO7A 2IZ5A 2EJWA 3M2TA 1QS0B 3MJSA 1F9AA 4EA8A 1K3TA 3F3SA 1GO2A 1LVGA 3IUYA 5JPIA 2O5VA 2JGKA 1TT7A 3WBKA 4ARUA 2OAEA 2XDYA 4NDAA 4CNQA 1N34B 3ZLTA 1H65A 4AJEA 1Z0UA 2UYQA 1P7VA 4QU9A 1ST2A 1K4YA 1Z0FA 2LE0A 3LQRA 5I7WA 2IOFA 3KYDA 3VR0A 3R3YA 2WQ7A 2HT6A 2ZJFA 1NVWQ 1YA8A 1YZYA 1PT6A 1M2WA 2ABWA 3CR7A 4H60A 4BKRA 2VHEA 1QZ3A 3CZ4A 4PYLA 1UBKS 2YZGA 3LY5A 4J6FA 1ZRHA 2FNAA 1XZKA 2J07A 1E92A 3B52X 5K0NA 1NVDA 2QX8A 1V5FA 2V55B 4YUVA 3ZCPA 4CM4B 3FJYA 2BGRA 1ESDA 4YH1A 4BLTA 4B35A 4FYWA 3FOBA 3ZUGA 1LPSA 4HB4A 3NGXA 1OBOA 5J5CA 3SS8A 1EEXB 1NUPA 3RKSA 1A77A 3UAZA 2QSYA 3KTAB 1LB1B 2HF2A 3UGJA 1CQZA 1GQRA 1U0GA 5GIPE 4P3KA 3ZHQA 3P97A 2FW1A 1GFZA 1AC5A 3B53X 2A7XA 3FOCA 3MS2A 5CLLA 3M6XA 3RVSA 3VPAA 2VP6A 1EP2B 2Q27A 2W6ID 1BS1A 1F4PA 3PCTA 1E9DA 4PSUA 4BMDA 2PS9A 3ENKA 3SBDA 4ZAZA 3TF5A 16PKA 2ZWOA 4MS4A 4XB6B 4MQEA 3R4CA 4U0KA 4QYIA 1KTVA 3VPXA 4MITA 1BX1A 5JAMA 1LBSA 1VE3A 1VSBA 5KQSA 3G17A 1EEHA 2WIGA 3N8IA 3CURA 4G0ZA 3AETB 3B82A 5TT0A 2ID9A 4P81A 3K9GA 1CUZA 5BPFA 2JFYA 1X1EA 4PGAA 4YC7A 1RLMA 4DVJA 3WSWA 2QW1A 4QRHA 2XCSB 2CK3D 2CVPA 2I80A 4AJ4A 1UOPA 2CD9A 4CFSA 4QQ8A 4CEIB 5E1MA 4M76B 2CJYA 2YRFA 4E2FA 1CVIA 3HN7A 5ALUA 4YAGA 1S2LA 2X7HA 1SVMA 2JA2A 2WWRA 4URYR 4WN9A 3EC7A 5KNDH 4G24A 2HPVA 2WD9A 2B3TA 2QL5A 2L17A 1QG0A 1JA9A 2H1WA 1QBKC 1YR1A 1GFIA 3SM3A 1NJ8A 4RLQA 2FWIA 3T4EA 3MD9A 3H1FA 3ASZA 1N5MA 4IEIA 2X2FA 4IUBS 2R5WA 3DXXA 1NHGA 3KK0A 3OF3A 3NP7A 1NE2A 4GH5A 3BXOA 1C0IA 2JFBA 5JY1A 4J2OA 1FUKA 5BOSB 5BVGB 1UT6A 5DHQA 4HNTA 4DLLA 3WA6A 1F7VA 2EOAA 4OHPA 3IQIX 3RG8A 2DBVO 3F9CA 1JN0A 3E2IA 3OP4A 3H5RA 1UWKA 1VYTA 2OBLA 1LJUA 1V26A 3E27A 1CK4A 2FLWA 4KN6A 2CVZA 2W4QA 2WD8A 3AR3A 1FRVA 5AUOB 4DC9A 3E5MA 4DR4B 5HTOA 3E5NA 2QTRA 4ZVKA 4XUGB 1FMFA 2APJA 3CNHA 4H7EA 4S1PA 1Z47A 5EE1A 5EP4A 3VR4A 2Z5VA 2WD7B 1P2UA 1QIDA 4JQYA 3DR5A 1T0IA 4C7MA 2QI9F 4CHGA 4GSKA 4L0DA 4E03A 5CFOA 5DSTA 4ZK2A 3WMRA 2XZOA 1KERA 5AI4A 4U2GA 5G40A 4DMCA 1Z63A 1IBSA 3KKNA 5DLQC 5ALZA 1DI0A 1XEXB 4XGRA 3MFYA 1EB8A 2ZRAA 3HI4A 5L40A 4YDHB 4FHCA 2G0NA 3DZIA 4PTZA 4CKBA 2UYCA 4YAWA 2YN2A 3M49A 2I7TA 1J5PA 2YIJA 1HT2E 1T26A 2PA0A 2KI5A 4Q4HA 1DSSG 1GILA 3G9UA 2VNAA 1TVKB 3GLUA 4RZIA 4ZJYA 3QH4A 1GKYA 4OGLA 1UXIA 1IIBA 5DI3A 4FFNA 5ICCA 4JP3A 4QTUB 3L7IA 4EH1A 1E5DA 4UD6A 4DCTA 3H11A 3UT5A 1RCFA 2KLHA 2Q1UA 1HLPA 2AG5A 3T54A 2A5GA 3I32A 1XDUA 3FBGA 4RFVA 1WPGA 4LVUA 1O95A 1II8A 3GDFA 5J59A 2XMRA 4AS3A 5ES3A 5CU7A 1Z17A 1K5GA 1YQXA 5F2EA 4MRMA 1FFXA 3I30X 4TV9B 4B6FA 2BFWA 2Q0HA 2R6HA 4GD3Q 1EUQA 2AFIB 3QEKA 4L51A 2Q7OE 3S2YA 2QRNA 5DBFA 1MG5A 1P17A 5LDGA 3EASA 4FE3A 1AO3A 2G71A 3ZZMA 1KY5A 3R7FA 1MW8X 2C3OA 1XRNA 3I3SR 3UT6A 3DNPA 1V43A 4GMKA 3AEUB 2J67A 1KMCA 4WI1A 1E1MA 1F0KA 1KPGA 3G2KA 2GNOA 2O2XA 4RD1A 5JD4A 1DARA 3OM8A 3WYNA 2VK1A 1I9CA 2BJWA 2FW0A 2AMVA 2WIKA 3QPVA 4P9NA 3LGXA 5IJ9B 3GN2A 5H59A 2X40A 2FWBA 4NFLA 4G5QA 1PGPA 2I4LA 4PNPA 4RNDB 3GJSA 4B3IA 4BN5A 1H66A 1IHDA 3Q3EA 4TTQA 2O2YA 4TXMA 1WDWB 3OQIB 3AJAA 4B71A 4YAKA 4NTZA 2ZB4A 4H3HB 4TMVA 2RD2A 1WG8A 3CWQA 1B93A 4YBRA 3V3TA 2EFEB 2FSFA 4FXOA 1U0LA 1AOXA 3PGXA 4QJ3A 1Y33E 2FP4B 3LWDA 1R5NA 1EJBA 1U6KA 2DPYA 2VT7A 3NHPA 4KSBA 3SQDA 1SY7A 5GM1A 3B12A 3U2QA 1ZK0A 3IE2A 3TEFA 3DE3X 1SOUA 2NUAA 2OD2A 3DL2A 3LZDA 4JGGA 1O94C 1P2SA 2A0FA 1MENA 1WD7A 2B4YA 4BNVA