2H51A

Crystal structure of human caspase-1 (glu390->asp and arg286->lys) in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-vad-fmk)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
170
structure length
167
Chain Sequence
GSEGNVKLCSLEEAQRIWSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACKGDSPGVVWFKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-1
publication title An allosteric circuit in caspase-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 48
structure length 167
sequence length 170
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2006-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h51A00
2WDPA 5IARA 3IBFA 4PRYA 3S8EA 4EJFA 2XYHA 2J30A 4NOLA 1RWVA 3H11A 3GJTA 5IASA 1RHKA 5IAEA 1QTNA 1NW9B 2QL7A 2QLBA 4N7JA 4DCOA 3S70A 5H0IA 4QTXA 2DKOA 4D3ZA 3D6MA 5IBCA 1JXQA 2HBYA 5IBPA 4JB8A 3UOAB 2AR9A 1PAUA 5IBRA 4QUIA 5IAJA 3QNWA 4QUGA 2H65A 3DEJA 4QUDA 2CJYA 1I51A 4JQYA 5LUBA 1NMEA 4NOJA 1GQFA 1RWMA 2Y0BA 3EDRA 2J31A 4IYRA 2H51A 2QLJA 3P4UA 1I4EB 4JR0A 4ZVOA 2C1EA 3SIRA 3R6LA 5I9BA 5K20A 5IANA 2H48A 2P2CA 4ZVQA 1SHJA 4N6NA 4JJEA 2CNKA 2FP3A 3NS7A 3DEHA 4PRZA 1IBCA 3BIJA 4M9RA 1SC1A 4PS1A 4QTYA 1RWXA 3EDQA 1QDUA 3DEKA 2C2OA 3R6GA 3V6LA 3GJSA 3PD1A 4ZVPA 1ICEA 3NKFA 4HVAA 4FDLA 1SC3A 2NN3C 2H5JA 4QUJA 4QULA 3V4LA 2XZTA 2CNNA 3PCXA 2HBQA 4QU8A 1NMSA 4QUAA 5LU9A 2HBRA 4D3XA 1SHLA 5LU8A 3R5JA 1PYOA 4QUEA 4QU9A 2H5IA 4LSZA 1F1JA 3E4CA 4N7MA 2XYPA 1I4OA 1RWKA 3DEIA 3R7NA 4DCJA 2XYGA 4FEAA 4AW9A 3SIPA 4EHNA 1RE1A 3V6MA 5JFTA 1SC4A 4NOKA 5IC6A 3IBCA 1I3OA 1RHQA 4I1PA 5LUAA 2H4YA 4FXOA 4HQRA 4HQ0A 1KMCA 1GFWA 1K86A 4ZVRA 5IAGA 1CP3A 3H0EA 3KJQA 4IEFB 4QU5A 2CNLA 3V4OA 3H1PA 3P45A 5IC4A 3KJFA 2QL9A 3H13A 4EHLA 2K7ZA 4EHDA 4NBKA 2C2ZA 4JJ7A 4ZVUA 3NR2A 1RHUA 2C2KA 3UO8B 2CNOA 1M72A 4EHHA 1QX3A 3PD0A 2CDRA 3D6FA 4EHAA 5IABA 2CJXA 4JR2A 4JR1A 3R7SA 4I1RA 5IAKA 4N5DA 2H4WA 2Y1LA 1RWNA 4NBLA 4ZVSA 3V55A 3H11B 1NMQA 4D3YA 1RHJA 2FUNB 1RWOA 3D6HA 2J33A 1RWPA 4PS0A 4N6OA 4NOMA 4QU0A 4FGUA 2C2MA 5I9TA 1CVRA 3ITNA 1K88A 4JJ8A 4JQZA 3GJRA 3R7BA 3V3KA 3GJQA 1RHMA 1F9EA 3RJMA 4QUHA 4NBNA 4AWAA 4EHFA 2XZDA 4EHKA 4ZVTA 3R5KA 4N6GA 1RHRA 2FQQA 4QUBA 2QL5A 2J32A 4AWBA 4DCPA 3K7EA 2HBZA 1RWWA 2QLFA 3KJNA 1BMQA 3OD5A 2H54A
chains in the Genus database with same CATH superfamily
5BN1A 2IEAA 4DM3A 2IC5A 2J46A 3AF0A 1APBA 4OBWA 3FB4A 3R0IA 1IUPA 1MHPA 4CKCB 3NHAA 1MA3A 1I9GA 3BRWD 2VWPA 4XM2A 3V80A 3DWEX 3KEMA 2XDYA 3ZU6A 4DREA 3MMZA 3ABSB 1MENA 3JZMA 3L04A 1IXSB 2GETA 1WXEA 4UZEA 2V7EA 2ZSHA 4NULA 4TVBA 1OXSC 4ALJA 3P0HA 1HE4A 3WZ2A 2O52A 3ORQA 3SZRA 2C7QA 1NYQA 4UE2A 2ZR8A 1JLMA 3HJCA 3ZQKA 2IBSA 1C9EA 2X3UA 1FBNA 1L8OA 1Z4IA 4ZVOA 4AUKA 1YMQA 4CR6A 1TVEA 4V0NA 3I04A 5KSPA 5KYWB 4P3YA 4NCJA 2ZWPA 3OP1A 4OV6B 3RUEA 3HY4A 2XMZA 5DZSA 1G60A 1FFDA 3B36A 2CMDA 4C30A 4LHWA 4MUBA 1DO0A 4OQEA 1L4EA 2X9GA 1VFNA 2BHNA 4UVEA 3ZWNA 3K70B 1C3LA 1NX6A 1Q7RA 4NJEA 1FBTA 1J21A 1FQKA 1PT6A 1QKIA 3F98A 4NL4H 1XMQB 4O0MA 1ZI9A 3QYPA 1WPRA 1V9SA 3DVQX 1D0VA 3H6HA 3HNOA 4D9CA 2MOKA 4KAJA 2IZOA 3MAJA 4NV0A 1TQDA 1LSSA 4Q48A 1GIAA 2GESA 2GXQA 1RPTA 2WYWA 3LI2A 4HC4A 1SCUA 3HCNA 2WSIA 4U7HA 1TKCA 3GQBB 3SX0A 2JI6A 2R8OA 3DYBA 4IXDA 1M67A 2YS6A 4LSZA 4WBSA 4WY5A 1S1CA 2B6NA 2WFZA 4Z1MD 5A7FA 3OE5A 2ZZMA 1THTA 3AVPA 3FM9A 3JWJA 4O3FA 4IDPA 3IAXA 2G06A 2IXGA 1UC5B 2IUFA 3R5XA 4MQ6A 4RD1A 4LF4B 1PZXA 4B5LA 3DLAA 4ZEVA 2FWAA 1CNMA 3QU4A 4P80A 2QUAA 1JL3A 2G3YA 3EXIB 1ZCZA 2G0NA 3RARA 4RC9A 4WESB 1QRTA 4KFCA 1WB6A 3PKZA 4ZVRA 2AJTA 3N05A 3SOZA 3VVMA 5HVNA 4ARIA 2BFPA 3DOOA 4RIGA 4XPZA 4CCAA 3UB3A 5AHXA 5G0VA 3H8VA 3GN2A 3HJRA 1NVVR 2SKDA 3GNQA 2VT7A 3Q10A 1DC7A 1H4VB 2WNIA 3OAAD 2I2BA 4H3KB 3M3PA 4TLDA 5LPNA 2QTLA 3C6ZA 1WVIA 4GZ6A 3O38A 5H1YA 1M2KA 4D82A 1A88A 4KN5A 4F45A 1H05A 3PE6A 1H0RA 1T13A 2BZGA 2WU4A 3FPAA 5EUBA 2C4TA 2CCKA 2IPXA 3N8NA 1GNTA 2FFRA 2JIMA 4L4ZA 3J7TA 2WICA 3D6AA 1N75A 5G0UA 4EQ6A 1PG0A 5A3JA 1FDOA 4NIMA 1G8KA 2IXTA 4UCFA 3ZQUA 1E79A 3P71T 4N5HX 4A0QA 3FIUA 3OT1A 4OOFA 3H16A 4FCWA 1V11A 2CNDA 4HAZA 2VP6A 2QTRA 4KYVA 2RC5A 5CX1A 4EJSA 4IVRA 1YC2A 4YXFA 3VJRA 5FAXA 1ODLA 1NN5A 1J8FA 4I4LA 4XX0B 1Y4SA 2QPLA 3WKEA 1GPYA 3JQFC 4DJDC 1OXVA 5J47A 3TQFA 3NHWA 4OSOA 4W1RA 4QG3A 2A33A 2GZMA 1W85B 1JQEA 3KYDB 1OAKA 1XAJA 3MINA 1IMJA 4OP3A 4PSAA 2ZYSA 4RZXA 4MEAA 4HDNA 1UR5A 4BMOB 2QORA 3L7AA 1W35A 4G0QA 5IAEA 3R44A 2H0QA 5DWVA 4YREA 1P2FA 4V39A 2WWTA 2AYXA 3OM0A 4ARUA 5IKPA 3LGXA 4CLEA 2GZRA 3DAFA 3DL2A 1WZNA 4BBJA 4NWIA 3OQMA 1DT5A 3EF0A 2RGGA 5LCXA 4D6YA 1ESNA 3VZQA 1DIBA 3INYA 1NMEA 3M4ZA 1G2QA 3W3ZB 2C7GA 3KKPA 2IZ5A 2ZYTX 4RY9A 2VJMA 4F3KA 3M1IA 3PJFA 4HB3A 3W9UA 1Y42X 2WAAA 1TEHA 1U3FA 2VF8A 3PPWA 3A6FA 4BLQA 1YR8A 3FCOA 3FDXA 3JYPA 4M86A 4EA6A 1O9HA 3TJMA 3JQ7A 3GD5A 3VPBA 3WGNA 3AR2A 4RQTA 1JMKC 4WY2A 1RBQA 4BNFA 1T4MA 3V1KA 5AKXA 1DJOA 5LQSA 1VRCA 1UBCA 3GC6A 1RYHA 2BEKA 4MVJI 5JHHB 5A0TA 5ER6A 1WS6A 1ODKA 2YS7A 1Z5OA 3DBHB 4F21A 4KFSA 3ZLJA 4Q9DA 2JIBA 4CIBA 2BJWA 4TTTS 1NMSA 1I6LA 3OFKA 1GVHA 1P4AA 2OHFA 4FZ3A 4GL4A 4N54A 1CHDA 1DRJA 4AX8A 1THZA 2HSEA 4DA9A 1XOIA 1G291 1JHPA 4JN6B 2RAPA 4B3XA 5C8YB 3DS8A 4RJLA 4WZAB 3MS2A 4Y6PA 1EHYA 3HY6A 5LKAA 2ZPUA 1IZ8A 1ZGGA 5CLFA 2PUWA 1XP8A 4Y6SA 3ZWMA 2GZDA 4Z7OB 3U1TA 4C6HA 1VOTA 3OOJA 1UZLA 3D3EA 1GXSB 3DWIA 4Y2UA 3VSDA 3N5KA 5KTNA 3JQGB 3UUEA 1W44A 3CO5A 5C80A 1VXRA 1GZ7A 3NOXA 3OZBA 4IUCS 2VPTA 2QZPA 5H68A 4MUKA 3KPWA 3HR4A 1X38A 1VSQA 5C4GB 4UOZA 1PV2A 1QWOA 2YRWA 1BHJA 3GG9A 1ZMOA 4QEZA 1KFBB 3WTBA 1VXOA 2K7ZA 4XIYA 5F52A 1W4ZA 4NMHA 3TEFA 1JU3A 2RGEA 3NP7A 2HWWA 2ZI9A 4BZXA 4C3OB 3K8ZA 1JJAA 3H1EA 1XRQA 4AVYA 3LWDA 4RK1A 5DBFA 3EXHA 4OQ4A 2XCTB 3VR6D 3ZXYA 4F72A 2XCIA 1ZPDA 2Z08A 1FC0A 1GG2A 2ZW9A 2DQYA 4L9AA 5EHNA 5KQGA 2LZ0A 4YMWA 4YCMA 4OMUA 3E2PA 4H4CA 4JLMA 5C37A 3QENA 2ZUCA 3DMHA 4FLMA 3ZCRA 4UCXA 3ASYA 2ZSBA 4EY4A 1OU0A 1UT6A 3ZWOA 1Y63A 1Z56C 1YQDA 4EEXA 5KX5A 4MW2A 1SELA 3KSAC 1UM8A 1DKUA 2A1UA 2EKPA 1KI4A 1EM8A 1L3BA 1Y9DA 3PGLA 4EB0A 3QMMA 5KNBA 3QIVA 2VYVD 4OKNA 4U6SA 3JQBC 4A5OA 1J0BA 3HL4A 4CMJA 3X44A 1RZRA 1O58A 1IBSA 5ALKA 2VHUA 1WETA 5BVHA 4DWJA 1DRUA 2FN3A 1PBNA 3CLUC 4S3MA 5C1DA 3NHZA 2PYDA 3UMYA 3GJTA 1MJFA 1T2EA 2BGRA 3GIWA 1XVTA 5DW3A 1NUPA 5FBRB 2FX5A 2C7BA 3LKDA 2VO1A 3OPNA 3A7EA 3PXGA 2W22A 2OV2A 4BQRA 1L5QA 1KQGA 1JU4A 1JSLA 2NO9A 4IIDA 4LXUA 2YMQA 1SZDA 4I7EA 1A9PA 2WJ4A 2JHAA 3MYRA 2HZ7A 3NAGA 2R1VB 5I9IA 1G5PA 4PW0A 2DR2A 1OFUA 2O7VA 5F78A 2R1ZA 4D92A 2G08A 1SA0A 2QRJA 3EY4A 4FLFA 3ZDQA 5EJ4A 4CPDA 1ZC4A 4ZEWA 5COAA 3ENNA 5CMLA 3SHVA 4ARBA 3PNYA 1N5DA 1XYGA 4XXHA 2FN9A 3PFFA 5K0ZA 2V5AA 2QM8A 1GZ3A 3B60A 1W7AA 2DBZA 1HFEL 2GYVA 1YVRA 4Z4GA 1VLLA 2F67A 2J3QA 2G6TA 5D8DA 2ORVA 4AURA 1VIDA 1P33A 4CEJB 2VNAA 3H4TA 4GYYA 2GZ3A 4US1R 1U6JA 3C3PA 1E2HA 2QTHA 2XGSA 2I1WA 4LJSA 3L02A 3UJAA 1P60A 4MAAA 3FNIA 5AVWA 4MV8A 4OBXA 1GNVA 4K5QA 1N2EA 3I9V1 1RIFA 3IESA 4P98A 2PXCA 5JNTA 1TA4A 1JLLA 5C81A 1HZZA 2M1XA 3GLKA 3KL4A 4HVLA 2MU1A 1CUBA 2DWOA 4XPIB 3JYOA 1X1SA 4E5MA 1N2OA 1Y1TA 2QNIA 1RI5A 1HZZC 1EUDA 3FI0A 3W7AA 3N0RA 5AH0A 4BECA 2YMMA 3ZX5A 3K0CA 1E3JA 1PJ4A 4X20B 4BWYA 4RAQA 4FB4A 4TWBA 4IG4A 2JI4A 1PWEA 1VQ1A 1WMBA 2Z2XA 4HNRA 3RO7A 3RU3A 3STHA 4CF3A 2VTBA 3RADC 2IZ7A 2GDZA 3K0CC 3KJQA 1PR2A 1Z2OX 2ST1A 2V7GA 3EC1A 5EHGA 2GVZC 2QTAA 3AIIA 4EARA 2PAFA 4EYOA 3AQIA 1OZ0A 3C5CA 2WKWA 1K2VN 3FBTA 5LB2A 4NCKA 4J7AA 4BNDB 1T0HB 1TW2A 2FHSA 1PJQA 1IRXA 4ZGGA 4EKIA 1FMJA 2EJUA 1A5SB 2O2YA 4IUDS 4AKEA 1L7MA 3SM3A 1XK6A 2W4MA 3FAZA 5IPFA 4XLLA 5CLHA 3LQ4A 3ZVLA 3I62A 4FD2A 1KQPA 1KVSA 3TEMA 1VYUA 2PKQP 1U7ZA 4KPGA 1U63A 2JGNA 1FFCA 2VJYA 1U0GA 3BGIA 3ZE2B 3U39A 1P80A 4IHQA 2CHGA 5I7OA 5L53A 5LQDA 2W70A 2H9IA 4BN0A 3V8RA 2GPSA 3N53A 4R8VA 4LISA 2E4ZA 3L4KA 1WDWB 2IH4A 3WIDA 4UJ5A 4MS3A 5IYZA 2JGLA 1J33A 1X74A 1EZ1A 2FQQA 3ICEA 3OIGA 4Y2TA 1R88A 3G79A 3HUTA 2OBNA 5G4LA 1FOEB 1Z4PX 2CKDA 2V6MA 2EGUA 1LJ8A 1V7CA 2CXPA 1OIWA 2ZUBA 3UMBA 2NO5A 1EUYA 4LCBA 4P0QB 1E4VA 3NYQA 4MVCA 2DPMA 4LQLA 1WB4A 2ORWA 3A2MA 3H17A 5CVVA 4BMPB 4CM8A 2QM3A 2J9FB 2PX3A 4R83A 4U4AA 2PH1A 3L8CA 3RTAA 4ZQHA 1NW5A 4M8IA 2VDMB 3K4PA 4K6FA 5FWXA 1FU4A 1B2LA 3AR3A 3RYCB 3C3XA 1RPAA 5FL7D 1QFXA 1PQPA 3OJCA 2YRXA 3P9NA 1DVRA 4M0EA 4R8KA 2DC1A 2IXFA 3B6JA 3CUUA 821PA 1U3DA 3CZRA 2I3BA 2QTTA 1QK4A 4GGMX 4IYRA 4IZOA 4LDNA 4FCCA 2EJVA 5F77A 5KOJA 4FEYA 1JG4A 1NYTA 4LKRA 2C9YA 1XCJA 2PVCA 3GV0A 3L79A 3UJNA 4M37A 4OA8A 1SMKA 4XLTA 1HURA 5K3SA 4QTYA 1SC1A 1Y1KE 4U8HA 1JEQB 1IATA 4HNHA 2P91A 4U7GA 4KIWA 4A8JB 5LLSA 1ONSA 3TZQA 1YI1A 3ZZTA 2FCRA 2GPTA 2EU8A 1QU2A 3N76A 2HDHA 3NMUF 4F38A 4UDXX 3RSFA 3WIOA 1WD5A 5BVGB 3VYTB 3ZDBA 4XKJA 5JSUA 3N8KA 1EFPA 4LN1A 1LDNA 2PZMA 1IY8A 4I50B 4OHUA 4D44A 3QEAZ 2IDKA 4JJFA 2XF8A 3LKVA 2GFHA 1PQWA 4W5JA 3I6IA 3U17A 3AETA 1KEWA 1GHTA 1NZDA 4J03A 2OILA 2VG8A 2CXXA 1E9EA 4RGBA 1G9XA 1L5OA 5DTMA 5TT0A 1PFGA 2D2VA 3I2FA 3F97A 4C0XA 2QE7A 2IDZA 4YWHA 2Z30A 3H2SA 5H80A 1QHGA 3HQ4O 1WZEA 4K9QA 4G0OA 4R2MA 3ZD9A 1YBHA 4I6EA 4QT4A 2QEQA 1ZS9A 4J0GA 1I5RA 1EJ6A 2JZCA 1WZCA 1Q7CA 4M1OA 3HZOA 3WIBA 3OQHA 3MCTA 1HYGA 2P9EA 5HILA 4B9AA 5IUJC 3FLMA 3KZCA 5KJFA 3MCZA 3ICWA 1KPGA 1VFPA 1N33B 2H1IA 4NICA 5REQB 3AF3A 1SUCA 2Q21A 2RB4A 5EPUA 4BO5A 4FVTA 2ZYWX 5FI5A 3OD1A 2CMKA 3A1UA 4MB2A 3FYDA 3WLRA 4ER3A 3W4IA 5JYEA 3L1HA 4HL6A 1JDPA 1K9SA 1VCNA 2QAGA 4IVPA 4D8WA 1MH9A 1FFGA 1KTVA 2GK4A 2O2JA 3FMOB 3A9SA 2WLSA 1VLVA 4YO8A 4BQSA 3ZS8A 3DA8A 4HDSB 3GYBA 4IFBA 1T5SA 3NIFB 4RVSA 4R3WA 2JGEA 5CM9C 1SVNA 9ATCA 5AVXA 1Z22A 5CXQA 4E11A 4N3BA 5B2ZA 4R0MA 1A7AA 2CXUA 3GYGA 4HZUB 2OQIA 2QK4A 4DRXB 3WLHA 3EQZA 3FPBA 3HABA 3O7WA 1C7RA 1G6OA 4YK7A 4YASA 5F5XA 4LBVA 1SCDA 1ZFNA 3OHSX 4MKGA 4FCVA 3I0MA 4N6GA 3PX2A 5CNJA 1ICIA 2JLWA 4MWTA 5LYJB 4X1IB 2GYUA 4PPQA 2ZSAA 3U7RA 5JJLA 1LGYA 5AUPB 4X95A 4MTLA 3ROGA 1XDDA 2NYUA 3RYTC 3JX9A 2FB9A 3KDSE 4DY6A 4ENTA 3AINA 5DRTA 5JCOA 2VR1A 4X1KB 4QGFA 3R8XA 2PH7A 4NAHA 3QI2A 4CR8A 4KTTE 4YPFA 2ZIFA 5IASA 2BTOA 2JJ2D 4FFSA 1QIDA 3L2OB 2IE8A 3WFJA 1UJ2A 1UZUA 5G0WA 3KZVA 5EPOA 4C5CA 3MB8A 1A72A 5BUSA 3V00A 2DKOA 1W36C 3G3EA 1E60A 1OJ7A 2ZJZA 1ILEA 1TJNA 1P5HA 4U0JA 4JI0B 1RQRA 4AP5A 2XKKA 5FA6A 3T9FA 3VPCA 3PEYA 2JAHA 1XALA 3OC0A 4I1OA 4PQFA 1RYZA 3IUSA 4TGLA 5EAIA 4IMIB 2A9VA 5EI5A 4DLKA 3R7AA 5C8ZA 1PR0A 5E9QA 4R7TA 4WLEA 4E6PA 2JHCA 4XSGA 5J43A 3K72B 4QSMA 4DZZA 3GJYA 4R2KA 1TC1A 2P2SA 4PRZA 4D0NA 3BD7A 3TGLA 1V6CA 4A10A 3L9WA 2A2ZA 1YMVA 4BNIA 4C06A 5KVAA 1J5XA 4L5AA 3R3YA 1N6HA 2FRDC 2W48A 4BC1A 2VXOA 1GNPA 1RYFA 2GPYA 4C0LA 2WSYB 1QK3A 2PMWB 3BA6A 1QSGA 4YTEA 3VSBA 3R0JA 4C3UA 3O47A 3TIXB 5INTA 1R6AA 1TUBA 3NBZC 4CQMD 4V2IA 1N1MA 4XVUA 3B8EA 5BRNA 5DYTA 4I8IA 2OWEA 1GL7A 1RI2A 4G0VA 3FTFA 1QG6A 3X1ZA 1B00A 5JNWA 3E4CA 4OBBA 5AM0A 4L8FA 4ZYLA 5HOEA 1XXHA 5BW6B 2H0RA 4OX9Y 4Z4FA 4F96A 4HWOA 1YBVA 3FHOA 4KUGA 5DULA 3FDZB 5EYPA 1J9GA 2RFLA 4GEGA 2Z8YM 4JBYA 4AJOA 3IEVA 4FOSA 4U7WA 3ZW7A 3AEKA 5FX2A 4G4IA 3FWYA 3CUEF 3MTIA 4XVHA 3JPYA 1VG0B 2IYOA 1VHLA 4NC9A 2D6FA 3I2JA 1E89A 1QIGA 1KQOA 2VP0A 1YS2X 4RQAA 2SBTA 5LOVB 3W5DA 2CXRA 1IEQA 1NF8A 4V1CI 3STUA 3V3TA 1R16A 1QF9A 3NPMA 2R68A 5EJEA 1JIKA 3E7DA 1NVMB 5DASA 1U99A 2IELA 2OAQ1 2DY0A 3BKXA 3MUOA 1CETA 4ENQA 2HUPA 3HKCA 3DGEC 3AP2A 4B4OA 1YFJA 2IYFA 4ZCLA 3VZSA 1M8FA 2OCGA 3EZGA 1CP2A 3G9UA 3IUBA 2HCBA 4MAMA 2UAGA 1N2ZA 1SUAA 5HUJA 4MWCA 1P19A 2X23A 2DTXA 4CKEB 4P08A 1FW8A 5JDIA 1FLDA 3BD9A 3R0VA 4X94A 3IV6A 2VF7A 4WXRA 1H9AA 3H2GA 4QDKA 2A88A 4UVIA 2CLFB 3DUWA 2HK7A 3HJNA 1JEOA 1XP5A 3H1GA 4C20A 4HGYA 3C24A 3ENVA 3GZ4A 5CT9A 4OKIA 4R6WA 5FF9A 3T9EA 1RVDA 1KEPA 4BNUA 4Z3OA 5E4TA 1A96A 3Q9NA 1U2ZA 1BJKA 1A8UA 1JDJA 1M34B 4KQJA 4XX1A 3S55A 3TX2A 4YIHA 1FVOA 3CKMA 1WUJS 5DSZA 4F4HA 2HBZA 2FSVC 2I71A 1GAEO 4PXAA 2JJQA 1NG1A 5FA8A 5IDXA 2VXBA 4HAYA 1MGPA 1BHQ1 1EAMA 1KKMA 1T3SA 2EARA 1VKNA 2QN8A 2QUZA 3PP8A 4NBUA 1O4VA 3RUHA 3O83A 2H00A 5L4SA 4U9IS 4ML3A 4E32A 2F1KA 3QNUA 4OUDB 1XQYA 5HK8A 1GUBA 1VJGA 4R2HA 4IILA 5JAMA 4CKXA 3NASA 3HCCA 3MGAA 3DFKA 4J0HA 1K4MA 4WOKA 3ILHA 2H2AA 2Z6UA 1Q0ZA 1VA4A 2WV9A 5IWAB 4XQEA 5A71A 2VP4A 1TVCA 3KBBA 4AO6A 3PGMA 1FS5A 1S4MA 1QH1B 4KNYA 5FLKA 4MTCA 1YWGO 1E2PA 3PDUA 5G3YA 1O6FA 2BF4A 1SU8A 4P7JA 2P2CA 1KI1A 2BFFA 4Y2HA 3BXGA 3QVOA 3I2YX 1RAHA 5E2AA 4FLEA 5DO9A 2CL5A 2BGMA 3BCSA 4TV8B 5JO9A 3QXGA 3TSOA 1FX0B 2WI8A 1TF7A 2A30A 2AS0A 2IKSA 2R6R1 4GXRA 3IPYA 3I39X 4W1QA 2FG7C 1PJ3A 3OU6A 5AXCA 1A8HA 4JKOA 3TZHA 1GKKA 1DC5A 1VIVA 2PKYX 3RLIA 3WFIA 2Y1FA 1IWOA 1ZN2A 2C4HA 1GZ5A 1K98A 3P0IA 4TYMA 5LJLA 3G85A 1T9DA 1QHNA 2F1IA 4NVRA 3DZ8A 3HO8A 2QT9A 3AIKA 2BEUB 2WMNB 1D6NA 1L7QA 1N3LA 3DV0B 4PLWA 4KACA 4DVJA 1P2SA 5B6IA 4A8HA 1PK9A 2ARKA 4HYYA 4HDCA 5CHEA 2P9YA 1CKEA 1JDBC 1RJFA 3D7LA 3LDUA 4IIJF 3WLPA 4A23A 5JSZB 1YNSA 2C82A 3UH0A 5ES4B 1WXHA 3LPCA 4DMRA 2OBYA 4R1UA 4JC0A 3PBKA 1Z6PA 3FRJA 4H15A 4NJMB 1IVNA 3EAQA 1XCLA 4UU0A 3H1TA 5HJ7A 2ALJA 4LYJA 5GONB 2ZROA 1OCEA 3D5EA 2GXAA 1VSTA 5JVDB 5M29A 4M9XA 1AE1A 1L0BA 3KAQA 2K7FA 1CUVA 2G71A 4PQGA 3TNJA 1QANA 2VZ9A 3RNOA 1I3NA 3DL0A 1KZHA 2GASA 2OV4A 3UFXB 2HCJB 4P3KA 3ZI7A 1E3MA 2QIOA 3M5WA 5IVDA 1YU6A 4TN5A 1NP6A 2DWQA 2CNOA 3BWBA 3CT4A 3HYRA 4G5FA 1NNUA 2I7DA 2H1WA 4Y0NA 4EGJA 1E9FA 2VQFB 2B9VA 1Q11A 4I14A 1A9XB 2JRLA 1ZHFA 1AK2A 4CYMA 1NWHA 4KHPB 2WM8A 3CWCA 4XWKA 1DADA 1BQEA 2G1PA 4ND8B 4PHCA 4KE7A 3I83A 4ZAGA 2B2CA 3QSGA 1JJBA 5C4MA 2OENG 1Z28A 2VH2A 1UMCA 2YDXA 4DV6B 2X5NA 1FL9A 1KJWA 1KVUA 3B8HA 4Q1CA 2Y1XA 3DDZX 4DCMA 1O89A 1R3UA 4WKCA 4Q7KA 1Y8QB 4YUZA 4MYRA 1ZK4A 3CU5A 1PS0A 4GAEA 4OFWA 1MPXA 4KDFA 3KXLA 5CEFA 1UMBA 4OQFA 1GNRA 1TZ2A 3FRIA 2DFLA 2JGFA 2GGSA 5CDFA 2RIRA 2JD1A 1A1SA 3IEPA 2Z5GA 2VSQA 1Z74A 4GO1A 2PK3A 4NOLA 4TYWA 2FA9A 1L8XA 2FG6C 5HG0A 2KJQA 3UTDA 5KNDA 2VJLA 3WK7A 3DXYA 1U2DC 2AHOA 5JEEA 4IGKA 3OJFA 4PAMA 4KSYA 1E0KA 2WWVD 2OV6A 3QLJA 3DAHA 4YAWA 2XB8A 5A1JA 4CQNA 1RRPA 5TT1A 1FXSA 2ZI4A 3A1TA 3R3XA 4MI6A 1YTUA 2Q6VA 3BILA 4OAPA 4YRLA 1XDUA 4B7CA 1QRAA 3K0SA 3QVGB 1H6AA 4FFVA 3WGKA 1E2EA 4F8EA 1HDRA 2W00A 4JI3B 1ZU5A 2IZ6A 2EOAA 2XMDA 4JUBA 4BGEA 3AF6A 4RSHA 4TPKA 2OCLA 4OQNA 4NG5A 1XTKA 2DMRA 4LF9B 2XTJA 3M9XA 1SCIA 4YIKA 4PRLA 2V1UA 3K09A 5IJWA 1LZKA 2R97A 3M83A 4RDXA 4YRQA 1U0RA 1XELA 1XAIA 2YIDA 4GMFA 5AIAA 3ZJ4A 8LDHA 3KKOA 2CXQA 1JHAA 2QUIA 2HT6A 4F9GA 2EWVA 2IHVA 5M7EA 3PRKE 3ADKA 5IVKA 3RC8A 4OX9B 2YWRA 2HREA 5EE9A 1B23P 3U7QA 3RC1A 2EL9A 3H5VA 1VL6A 4EG3A 4RTKA 2CXSA 1YRWA 2XA1A 2EYQA 1M2OA 4K1XA 1P4SA 4OHKA 4Q7MB 2C4KA 2F17A 1AVTA 1VYTA 4J91A 4RY2A 3SE7A 5KHLB 4MKIA 3VPAA 1B8VA 1FYEA 2CL6X 3LP8A 2GBCA 2BEWB 2OY0A 2QMEA 3L82B 3EIEA 1RYMA 3GBVA 5K0JA 1IN1A 4ZHQF 1VA5A 3BH7A 4FMDF 3SBOA 1GG5A 2XIQA 1XU9A 3HYNA 2KPOA 1QVRA 1JHXA 3BJRA 3INTA 3LUDA 3QU7A 3NKVA 2CF5A 4IIVA 3A4MA 3R9IA 3RVOA 4QBTA 2R84A 3LOQA 4D57A 3BD6A 2FGKA 1F5SA 1V9CA 2CNLA 4DWVA 1AUXA 3E18A 4G1BA 5EVJA 3T94A 4HGNA 5CHYA 5CT8A 1TQ4A 4O4LB 2C2KA 2ZBDA 1D2AA 1R4ZA 5ILOA 1KS9A 1AJEA 2FMTA 1ZLXA 2O0JA 2FW8A 3KQMA 4I1RA 5D7BA 1HKUA 2Q49A 5CNKA 3EGXB 4B09A 2HO5A 1BGVA 2FNAA 2FPSA 3IURA 3LY8A 3O9VA 3KLBA 4A0SA 1IEXA 5AVYA 1CR0A 3BMXA 5DTEA 3V33A 3VPHA 3ZGYA 1VL2A 4IDHA 3ESRA 1U2RA 4OIFA 1SFRA 3ZHVA 2JJ1D 1TJ5A 1R74A 1D07A 4HPJB 3PWSA 5SYNA 3ZE7A 2O20A 3WGHA 4FGJA 4WECA 3BREA 3MHPA 4JI8B 1KVRA 2A9QA 4IY1A 4MV0A 2DQZA 2FSSA 4TUYB 1KEZA 3AM3A 1XRNA 2IHYA 2WTUA 2ZSJA 2RH4A 3CWQA 2WG1A 1JG6A 1UMDA 2HNKA 4EEZA 1AZSC 5EESA 5PGMA 3NOQA 3NTLA 2ZIEA 3EFOB 4FFWA 4UE6A 3GJ0A 4WCDA 3CWZA 1Q83A 5NULA 3UK7A 5D87A 4DQDA 2WHXA 2YVUA 4NPHA 1Y6FA 1ZCBA 5A06A 1FTGA 2NUPB 1YRQA 4CN9A 1NY5A 3T8YA 1SVIA 2D0OB 3GLIB 1GDHA 2ZSFA 4D96A 1E1CA 2VEDA 1P0CA 2JAUA 2REQA 3E70C 3KKQA 1Z88A 3IOCA 4IRUB 2BP7A 4BMZA 5KYTA 1UODA 4Z7QB 2Y0BA 4BAUA 5JAZA 2AWNA 2LW7A 1DTEA 2FZLA 3F7TA 4QQKA 2O8VA 4CGYA 4F5DA 1JLSA 2N75A 1LU9A 1SK8A 2Y99A 1T0JB 3GUCA 4GLOA 1NDHA 1SQSA 4TZ0A 1ODIA 1KH3A 3H9CA 1DEHA 4OGWA 4ZOBA 2OC4A 2JAPA 1QKKA 1G16A 3K1AA 4ZQEA 3DZFA 3W6NA 1P3Y1 1UKBA 3GT0A 3IO5A 3EH1A 3RUIA 2VYND 4RH0A 1PZGA 2REBA 3NWOA 1WKVA 2D5CA 2OT3B 3KP1A 4L73A 4L8YA 2X40A 4JBXA 4OFBA 5JBIA 2QU7A 5IM5A 2LWIA 2WTXA 3L0DA 4AKIA 2VPWA 1P39A 2C2HA 2C0QA 4CUZA 1Q15A 4BLRA 1GKIA 4GRAA 1YMUA 3VU1A 1EFUA 1T9GR 4A6PA 1V47A 1KJJA 1QIKA 2O07A 3BMOB 5C7LO 4YMTA 3CKYA 4RDIA 5THXA 2QM7A 3T35A 1WNFA 5CLIA 5D5PA 2ZDGA 2R7MA 1VJ1A 2QQ0A 3CPSA 4MCAA 3NEYA 4G5QA 4FDMA 4X1YA 5AM1A 5NLLA 3RRXA 4BNWA 4EO7A 4Z4QA 1V43A 2BHRA 2PRKA 3OE4A 3PHCA 5AVUA 3TXYA 2H18A 1RU3A 5IF9A 3LLVA 4FEEA 4RBNA 1E1KA 4Q37A 1XCMA 2Q9AA 3I6YA 2W6OA 3NONA 1KJIA 4NH0A 3F4BA 3HRIA 4WDQA 5SZIA 3QA3E 4AG5A 1GRNA 1PQYA 4J0JA 3DLPX 1DAIA 4L75A 1ZBDA 1XZAA 2P0EA 2WFLA 1BVUA 2XSZD 4HH4A 4DT1A 3HXMA 2HCTA 5EP2A 3FYHA 4ZXPA 1OLSA 3GP5A 1G7RA 5H70A 5JISA 3C5HA 4MMXB 4MW6A 5SZHB 1TQ2A 1J99A 2YVKA 1O6GA 1T6YA 2ATXA 4IFIA 4KQGA 4RLHA 5D5QA 5L7YA 3IQGX 2GBIA 4RSRA 5ITWA 1EDBA 2WG2A 3PD0A 4BBPA 1C80A 2QS9A 2NVUB 1Y7LA 3HGMA 1QO7A 1M1UA 4HD8A 5IUKC 4BGUA 1ECLA 1PJZA 2RK4A 2MYUA 1DAMA 1CUDA 2Z8YA 1DKLA 4C0AC 2OPHA 2R6CA 2QX7A 5B7QA 3IJPA 4PX9A 4TS9A 4WN9B 1N9KA 3OESA 3RTBA 1IHUA 2IEGA 3BWYA 3RJZA 2NU8A 1IDOA 1X1QA 5BSRA 2CMGA 5C1OA 5DHTA 2G09A 3REGA 3RJMA 3OZGA 4H7IA 5IKMA 4EYEA 1B8PA 1DB3A 3OLQA 4TXNA 3CONA 4WGGA 4ZVTA 1X1BA 3CPEA 4AS3A 2HQOA 2GPBA 3P2JA 3L0BA 3QU2A 4IV0A 5FYDA 3L6EA 1A9ZA 1VHQA 4RK0A 5FEUA 3AOEC 4II7A 3ETHA 1BDJA 4UAGA 3IDQA 3IUEA 4HNAB 1UBNA 3OOSA 3FWHA 3E0QA 4YDQA 5IN4A 1XI2A 1YZUA 5IUNC 3Q8KA 4HWPA 2WM9B 4KR7A 4MEJA 1Z37A 3RAJA 1VJTA 2ON6A 4KYUA 5TJ9A 2ZYGA 2ZM6B 4D8VA 1K0UA 2FW0A 1P61B 3AESA 1CJKC 2BEVA 4O4IA 5E3JA 4DUGD 4M8KA 1EVQA 2ZU0C 2CYBA 1Z8HA 2I87A 5HGJA 2JIRA 3BHNA 2A0XA 3LX4A 3S6JA 4W63A 3TLGA 3BQNB 4J7UA 5TLSA 1QORA 2ZVPX 2D4HA 3KKNA 3UK0A 2WLTA 5LBUA 4XH9B 3KR2A 4E4RA 3A11A 2WZDA 5DYWA 4DQXA 1PGPA 3WV4A 3L7BA 1CZUA 1AHPA 3X43A 4BBAA 3COSA 5EKDA 1P17A 1Y9AA 4KPUB 4U2FA 3MWDB 5CG2A 1TKBA 2WU8A 3SS7X 5BR8B 1ML4A 1IWPB 4WFQA 2KLHA 2V7WA 2HMSA 1QCZA 3B5IA 1Z39A 4W7IA 3LHKA 1VE7A 4D25A 3Q8LA 2HIAA 4ILKA 2GPJA 4LMPA 4GP9A 3Q7RA 4M0DA 2GHQA 3FDFA 4M0MA 3U4GA 3KQHA 4G2NA 4H6WA 4JX8A 3EQ7A 2QN2A 4XWGA 1E77A 5ICEA 4TN1A 2AZ4A 3USZA 4DOMA 1J0XO 4NZPA 4MW1A 3ZIAA 5M34A 2QD2A 3D8NA 2MSCB 2A8YA 1F3OA 1TM7E 1Y37A 2Z1DA 2PZLA 3GCDA 2HSZA 4Q3NA 2HSDA 2I2AA 4HJRA 1X9GA 2RJ3A 4HQNA 4QFCA 1JQDA 4L95C 4XWWA 4DGQA 2QN6A 4CU5A 1LDEA 4L5CA 4MYTA 2PRJA 4QECA 5CH8A 1YDHA 5LQUA 4O08A 4ARZA 3DOEA 3JALA 4NQZA 5AJWA 2BI4A 4B6GA 3OWHA 1B4DA 3FF1A 2J7PD 5EMLA 3U62A 2X1MA 4RKQA 3GR6A 4UTNA 1N34B 1E66A 5DP2A 5E2BA 5IAGA 1M3SA 2VDKB 1P2DA 3QBVA 2GZ1A 2R1UA 3WSVA 3AHDA 4B76A 4FW9A 3DYVA 2IBMA 1Y5RA 3NKLA 4JC4A 4KO2S 3MUEA 1Y6QA 4YBZA 1M10A 3WVNA 2XAUA 1BJTA 1OWNA 1DCKA 3BFVA 3QKTA 4JT8A 5K3FA 2QTWB 1JTFA 5JZMA 4R68A 3OCCA 1AB5A 4DAOA 1M5UA 2C3YA 3LUFA 5C5CA 3AL2A 1U31A 1A9YA 5E38A 2P41A 2NAFA 1RRCA 1IY1A 3PFIA 2OB1A 1RPJA 4BFXA 4YUYA 4NSNA 1V7PC 3VTAA 3PVZA 5JBNA 5BURA 1T35A 2V5VA 3T4XA 1PR6A 1ZK1A 1IEVA 2YZNA 5HA5A 4EY5A 2W0SA 1PV1A 2YCLA 4AECA 1V11B 2R00A 3T15A 2RI6A 1PL6A 3EVGA 4BDSA 1LBHA 2DHQA 3HP7A 4AMZA 1IZ0A 1SPXA 2V6GA 4CM1A 3N0TA 4XYMA 1D2EA 1CJCA 2R00C 2YJ6A 6REQA 2Q99A 1JFFA 1UXGA 3HA2A 5AKEA 3W9YA 5CBKA 1DDOA 4HNTA 1CF9A 1EP9A 3VISA 3E82A 4LOLA 1QB7A 3G0OA 4TLLB 4C4AA 1V1RA 3FAKA 4DIDA 4Y1EA 3H4IA 4JOBA 3FNGA 4DNXA 4HDNB 3X0DA 3H11A 3LSYA 3WGYA 4X84A 3ZE0B 4RX1A 3ST7A 1I0IA 4DLYA 3BZBA 4QTXA 3L8YA 1GM5A 2HHJA 3DLIA 3RCBA 5EHZA 1NVKA 4Y2YA 5B36A 3IT0A 1KYTA 2NOAA 3E3NA 5AD1A 4JYCA 4XR9A 1RAGA 1RQGA 5J2TF 1ZA2A 1UF9A 1ZG3A 1QZTA 1EXMA 4FYMA 2IFTA 4LDRA 1NRXA 4HUJA 4FHCA 4NOJA 4EL0A 1OR8A 2CFCA 2I65A 2TRSB 1J8QA 2G70A 3BWCA 1OTXA 5BUQA 2HXYA 4AF8A 1C9KA 4E12A 3V1YA 1OX4B 1XEXB 4CEHA 2H1RA 3QWBA 3RSOA 4X6YA 2XD4A 3RG2A 3AJDA 3LLMA 4C88A 3UPUA 1XRJA 3NHRA 4FFOA 1CYEA 3V8QA 1U3VA 2AI3A 3RF6A 2Y0PA 3EGVA 2VCEA 3GDHA 5KJEA 4F4JA 2C58A 1CY1A 2A9OA 3QKSB 1IMOA 1EDDA 2P1DA 4XD2A 2ZQZA 4REQB 2WWYA 5E1BA 1DJNA 1LQTA 4RMJA 2CJFA 2QGNA 1HA3A 4IJ6A 1T3ZA 2CZGA 2IYTA 1PF7E 3RIHA 1ZEJA 4IIGA 3QEMA 4REMA 4EI8A 1W96A 4EZEA 5KYUA 4B3RB 1F2VA 3IIEA 3FGOA 4WXEA 5LP6F 2Q9BA 1YRBA 1H2AS 5TS3A 1UDRA 2H8KA 4PSCA 1II9A 3ICCA 2HK8A 3OE1A 4QTUB 4W4TA 5FTLA 1XLTA 2O1WA 9MHTA 1N7IA 2ISCA 3NH9A 3PIRA 4EVQA 3ZBUA 2QD1A 4TWZA 1ZGAA 4PPGA 4OHOA 1U0FA 4N9WA 1YACA 2KW5A 1KYQA 2VEOA 1NXOA 1XLTC 4UU1A 1GZVA 3LE8A 5FADA 3VH2A 3L06A 4J3JA 3BDVA 3DMNA 3CT6A 2P77A 1GO2A 1IJEA 3A25A 3ICVA 2X8AA 4ZYZA 3VSEA 1O95A 3RWBA 1T34A 3F96A 3O8QA 4DABA 3JRWA 1JBQA 2D7CA 4QBIA 1NXWA 1T5OA 1TZMA 1DWUA 3QPUA 1PNVA 1HC7A 1FK8A 3IR6A 4J0DA 4JR2A 1FLVA 4GR5A 4AJPA 2ECFA 4YAFA 1NAHA 4PAWA 4D0LB 4X7RA 4DCTA 4TV9F 4L78A 1HH4A 3UAVA 4FYWA 5EIFA 1W4LA 3KVOA 5K5EA 5ICSA 3KKEA 2FUNB 1YCDA 3PSAA 1X3SA 4PSKA 4XSVA 5AHKA 4C05A 3TL2A 4EBFA 5EJ9A 1SHUX 2YJGA 4GWKA 4V0MA 5JFOA 1ZP6A 2DPGA 3PHGA 5EP4A 2NO1A 2EG5A 3RRFA 3MK31 3GJQA 3BL5A 4BNNA 5HCUA 2GSWA 2ZIZA 3PFHA 1ORRA 4FE7A 2A1UB 3CXRA 3EVEA 4L6AA 4NBSA 4YLEA 3U09A 3W5CA 4KFUA 1JFTA 1FYVA 4ZTZB 1T25A 4FILA 1WDKA 1LDMA 2V58A 1GJRA 5AUOB 1RMTA 4Y2QA 2Q3EA 4P22A 2DB3A 1GWNA 1KERA 4ZOEA 3VTKA 1U8YA 2WUWE 4YUAA 4DR1B 2Z8ZA 3SYKA 2DWCA 1KKUA 2CNBA 5ALDA 5BVHB 4PYKA 4UHBA 1F5NA 2DWPA 1A2QA 1HEYA 2X86A 3KJZA 3Q72A 4AKGA 4GI5A 4ON9A 2JVKA 4E33A 1XDZA 3QUCA 2PUFA 1QC5A 4RPCA 3R9KA 1GSHA 2HWUA 2Q5CA 4PF1A 4IM7A 1HO3A 4WINA 5IH7A 4X6UA 4FGKA 1VL0A 4LY0A 2OL4A 4QO8A 1PT9A 5T64A 3SZLA 1RRVA 4XJXA 2QX9A 4H3SA 3QFRA 1UXHA 2D0IA 2EQBA 2Z83A 1EGHA 3SKXA 2Q6TA 4M3NA 2BRUA 3IAM6 2H48A 3HPQA 2HW8A 4Y1RA 2RK3A 1IOLA 3KTDA 5AM3A 5BNWA 4NCAA 3QQPA 2GWHA 3WLFA 1IY9A 2OHGA 2QTMA 3I0ZA 4NONA 4XE5A 3W2TA 5BMOA 4W5NA 1Q14A 3QWFA 3RIEA 3BMCB 5HUHA 1WY7A 1AURA 1OGYA 2BSXA 2D1SA 1KYWA 4L7VA 4YRTA 1DCFA 4MJLA 3BC1A 3R41A 4UTOA 2CW5A 2IEBA 3G9TA 3IP3A 4YVFA 3G2LA 1P9OA 1FDWA 3O0TA 5CB4B 4HPWA 4BCCA 2TMYA 2VBGA 3IODA 2R66A 4H27A 3TZCA 1GG8A 4DGSA 3H9QA 4YJ3F 1RZ3A 2PH5A 3HWRA 4PYJA 5TE9A 2QVXX 4ND5A 1N6OA 2X0RA 4FMPA 4W8HA 4UQPA 2JLUA 2ZJAA 3ISTA 2ENWA 2WM3A 3ANLA 4XIJA 4KWTA 1BDHA 1XSEA 4DPMA 3MOSA 4U6QA 4JOSA 4UQLA 3DHYA 3MQ2A 3TW4A 4PNEA 1E63A 3Q6NA 1V0JA 2FPPA 3ZQJA 1ST3A 2CLDX 4CCSA 2HRZA 4Z4CA 2PKEA 3OTGA 3FZQA 1FRVA 3FHJA 3ZDRA 3H9EO 3VR5A 1HMYA 4ND4A 2WJYA 5DJ5A 2AUTA 4DTCA 2YIVX 3SSMA 1J0CA 5ISMA 3RD5A 1G8YA 3O95A 4NENA 4S35A 1ZMXA 5K3OA 3NETA 4Q3CA 3FUCA 1PHRA 3IDAA 3G2MA 2QRMA 2F3SA 3MM4A 3H9JA 4MITA 5A7GA 1R6DA 1DHTA 2UYOA 3TCNA 1QHHA 2I4OA 1M72A 1F20A 3I1IA 4FHFA 2L17A 1KJNA 4R51A 1WULS 3PUJA 2NU9B 1NLMA 2JHFA 3H75A 1TA9A 1ZM9A 3HSKA 4MP6A 2OORA 2ZWOA 4Z7NB 3WRYC 4FE3A 5BSTA 3U7GA 2D5AA 3RVLA 1RM3A 2ZVJA 3S1LA 4FHEA 2BBWA 4HTFB 3S99A 3T7TA 10MHA 2WTEA 1Z5NA 4PZUA 4YCNA 1EK2A 5FPQA 3OZAA 5TJHA 4IUYA 1Q20A 3KPJA 3CNHA 4BLUA 1K88A 2YJ3A 4HRXA 2OCDA 4ZI5A 5BSKA 3F74A 2H17A 1IY0A 1P9NA 2VAWA 4L9RA 1G3UA 1LZLA 3UMFA 2ZRQA 1RW4A 3GZNA 5ARCA 1R27A 5F3WB 2QMHA 2XMPA 2D59A 5D7NA 2OTCA 5AJZA 4ZAYA 3SVTA 1MIOB 1E6WA 3SYRA 4C2UA 2E3JA 4UTRA 1YU9A 3O75A 2MCFA 1GCGA 3EOAI 1X94A 4ZD6A 1UOEA 1YJ8A 3ZZNA 4CM4B 1G38A 2ZTVA 1O3YA 3A04A 4W7SA 1SN7A 4U8GA 1RHKA 4QBKA 3LHSA 5IWCA 4RTRA 1DRVA 1VPVA 4INOA 2HC9A 4IH9A 4WJZA 5D01A 3RHZA 2XEDA 3BXOA 3LXMA 4PTYA 4N47A 3C3AA 3FMGA 2X0DA 2FN4A 2OUKA 5BN5A 5HZMA 2UUBB 4ZA2A 2X9QA 4RE6A 1EJBA 3ME5A 4A9AA 3I6QA 1WNTA 4KJZA 4Y67A 1XLWA 3RAGA 1Z4NA 1SBNE 2XNKA 3U4IA 2PLAA 2P0AA 2V7QA 4LJ4A 4BZQA 5K45A 1OB5A 3QRWA 2XXJA 3SIRA 4I5IA 3PTLA 1O0SA 2QT0A 2HNBA 1UC4B 1KO4A 3VXKA 1D8TA 2LCFA 3ZWQA 1JHDA 1R2QA 1Y3CE 2C1ZA 1ISMA 3DM9B 2WNHA 1ZI6A 3GK3A 4PWYA 3PLAE 4B82A 5LWHA 1PZFA 4RACA 1WL8A 3DM5A 5I7RA 1N2CA 1P7WA 1T8TA 5A1TA 2P5TB 3NP9A 3PFBA 1PYGA 5FNVF 1MFPA 2H07A 3AY7A 4XGIA 4Z8XA 2ORED 3RS3A 3D0QA 1WSDA 1X7XA 4IO1A 4NBTA 2RGRA 5DTIA 1XMIA 4I2VA 3BM5A 4D9BA 3T1OA 3Q98A 1ECFA 2WJZB 4RD4A 1GCAA 3ZW9A 2A0WA 3LYUA 4MMYB 4LA4A 4BZWA 3KQKA 1EFPB 2B1QA 2HK6A 4NNOA 1F8FA 2ZI3A 4HWSA 2X0JA 2D13A 3CKLA 1JGTA 2Z04A 4NECA 1ZR4A 3TAUA 4M53A 4F71A 3HCFA 2JRCA 5CDHA 1FP6A 3AETB 1SXPA 2VDJA 3Q3GE 5HKAA 3V8PA 4HB4A 1XN1A 4CF7A 2NQ2C 2Z2KA 3CMMA 3EOBI 1BE0A 3TFQA 3U0VA 3SS9X 5EPEA 3ICOA 5H16A 1ZCJA 3IUQA 3K5HA 5MFZA 1Z2AA 4LVOA 1Q92A 1GUZA 4ZGWA 1NLYA 2PGAA 1T6BY 1YR1A 3RK4A 3SDBA 2PLNA 2PRSA 4P86A 4DVGA 2TMKA 1QAOA 1R0XA 2J07A 3DOUA 3GJ3A 4JP2A 4XQ0A 5G4KA 3VI4B 4BMCA 3DDWA 5JJBA 3OZEA 2MINB 2D1TA 3IELA 3SYNA 1LK0A 3I8OA 1RRMA 4EHHA 1XFAA 1E5XA 3QOWA 3L0SA 2QMUA 4WWHA 5AQEA 5TEVA 3A58B 5JQGF 1B6TA 1UBMS 3BEOA 4K0RA 4AMYA 2VBIA 1YZLA 2XWPA 3HU2A 4ZGBA 3U4MA 4Z49A 2AN1A 3NHJA 1UJ5A 2GZHA 3FCEA 4FN4A 2ZJ5A 3IP7A 1O7JA 1U9IA 5CK4A 3UGKA 4I55F 1VCIA 1Z8FA 3CG4A 2CSXA 4KVFA 3ZCTA 2YNMD 4XM1A 1Q0HA 2YWXA 2IQIA 5K0CA 1VRWA 1EZZA 2H3HA 2ZTLA 3M4XA 3GP3A 1PR5A 1U9IC 1V4NA 1Y3IA 3B6IA 2FI1A 2FPOA 1ZD5A 5JJKA 1DMRA 1KJYA 4QPJC 2QUKA 2PNJA 3RABA 3OA2A 4YAGA 1YZKA 4BYGA 2IE0A 1CVLA 4XR4A 1Y5LA 3AV3A 4Y7CA 3DUFA 2NXWA 1BKDR 4OXNA 2QLFA 3G5TA 1E1QA 3OZTA 1JVBA 2RHBA 4DM7A 5LVAA 3UAOA 2FK8A 3AKYA 4EECA 4O4JF 1BS1A 3IXQA 1HSOA 4JLWA 2J3HA 4DL9A 1YOVA 3OSUA 4MQLA 3PVSA 4OO3A 4Z0HO 3TO5A 5JBQA 1W36B 1Z0UA 2GTHA 3G5LA 3EWIA 3OVMA 4KO3S 1HNWB 2ECQA 1TL7C 2Y76A 1TJ4A 3KSZO 1WRBA 1IC6A 4M1ZA 3T9CA 4PLTA 4V2UA 1GT6A 3RYIA 4CGZA 4P7KA 3HYLA 2CVZA 4JB3A 3DJYA 2X1VA 1E3TA 5J4LA 5B7PA 3F73A 4Z9YA 2ERYA 1YJCA 4CCYB 4KZKA 4O4HA 3SZOA 1QHEA 3PTZA 2GD6A 2QMOA 3RUFA 2A67A 3X1DA 5F9FA 1S3SA 2JLQA 5A5VA 1V16A 3MMXA 1DXOA 2B8JA 4YRCA 2HYIC 3AVWA 2FKNA 4TTJA 2QXUA 1C0KA 3NYRA 1QQAA 4KB5A 1PEAA 3SDSA 3EW9A 3UWMA 5E8RA 1XBTA 1VJRA 1SG6A 4M8LA 3RTEA 4HUQB 1ICEA 3PQDA 4MVJH 2AK2A 3KQWA 1O94D 2OB2A 3KJGA 4QREA 5AYVA 3S28A 3A9TA 1E69A 1V1MA 3VAYA 1KSGA 1DTWA 3N5CA 2DOKA 4M21A 4BTEA 4K3UA 3TM5A 1MNAA 4MQ4A 1DBVO 3K0AB 4WCFA 1ZJWA 3V34A 3ZEIA 5LU8A 2G04A 5EMKA 1GQOA 2DWUA 1BCSA 4L4XA 2HJWA 4JWKA 4RZSA 3OCXA 1KMHB 4YAEA 4A91A 4N7MA 5EMNA 1QMPA 3ROKA 3USCS 1NUAA 3L7IA 2DBQA 2CXOA 1RE1A 2BMFA 4LVNA 1OBHA 5DGXA 2WIGA 1UM9A 4BNXA 3EB9A 4QHSA 1NUSA 3WDMA 1A8SA 4F3RA 2VT6A 2W2OA 4DUZB 2K5UA 3SJUA 3YASA 4BNGA 3FCAA 4MKRA 3EISA 3FHCB 1YFLA 5ILGA 5EZYA 1SVOA 1N3BA 1P6XA 1AKWA 3RJ9A 3ZG6A 3GVXA 1D09A 4KRXA 2QYOA 2WF6A 2WPDA 5JMOA 1VZ3A 2GD2A 2OGSA 1BA2A 5AUQA 5A03A 2GBLC 4KI0A 3W8FA 3WHKA 1Y3FE 1CJMA 2B7BA 5FUQA 2P6RA 3CB2A 5JXHA 4HGQA 1ODFA 3DFZA 1TYDE 3CS3A 3ZHBA 3ZQ4A 2GEVA 2WT9A 3KQTA 3AERA 3PPIA 3ZYCA 1M66A 1A3CA 2WJHA 2ZBEA 3T3PB 1CB7A 1NE7A 3NHYA 3UVEA 4DR3B 3K5WA 4NBLA 1ZWKA 4KK3A 3I9MA 4WQMA 1W9MA 4ZCSA 3ZDCA 4E94A 1ZEMA 1CY8A 2ZRHA 3INNA 1C3OA 1RHJA 3Q5GA 3LBYA 4INPA 3SC2B 2FWPA 1BU5A 4C6RA 1WF3A 3GZJA 2SCUB 1V45E 4N0DA 2PA3A 1JB1A 4HZIA 1CS0B 1WQ1R 2ZIXA 3PNBA 1SY7A 3TBKA 1RHMA 1WG8A 2O06A 1G21A 4BNYA 4QQNA 5F2KA 2EBFX 2L82A 2IHJA 5L45A 1KK0A 5AKZA 1HMPA 1GZUA 2C29D 4D1YA 2QBYA 1S2DA 2MSNA 2VHQA 1C1XB 2W90A 5H82A 4RK6A 2V97A 4DWOA 4BQQA 4NX2A 5KTPA 1EH5A 1TTHA 1QONA 3TSYA 2QZZA 2HPVA 3MPOA 1XZEA 5LQJA 1V8OA 5LA6A 3TSZA 5M5BA 1O77A 1ATZA 4LE0A 3C7DB 3TRJA 2B5VA 4JT9A 3L01A 1J42A 2P6UA 3I32A 3M6IA 1Y3AA 2HJSA 4FYYA 4K28A 4M46A 4EJ2A 2IKQA 4P3OA 2AZMA 2GM3A 4HDRB 4K3VA 3GJXC 1SBYA 3CUWA 4G2TA 2QJTA 4R98A 5CB0A 1QTQA 4WBNB 1E2DA 3WOHA 3T95A 4IHJA 2WHPA 5B64A 2YBEA 2NT3A 1KC3A 4Q82A 1SXIA 2G4VA 2O2HA 2FPKA 4YR9A 4MK4A 3QP9A 4GLJA 3K20A 2FPRA 3OLZA 4RYLA 3KFXA 4MV6A 3C6XA 3K35A 4CF4A 4M99A 1IN8A 3V4ZA 3FIJA 1IZ7A 1G2IA 3MRTA 3R4VA 2DTEA 4KWEA 2YFQA 1RXWA 2VJKA 1AK1A 3T7EA 1MVLA 1E20A 1VC2A 2AFHE 2BMEA 2C0CA 2VNHA 3AIOA 3LHFA 4PZLA 4S24A 3KD3A 5TB5A 2CZCA 3NTVA 4AQYB 1UP7A 1Q1EA 3IMKA 3N70A 4ZCRA 1ULZA 4XYGA 1YL5A 3Q7TA 5K3CA 2F00A 4OJNA 1V3VA 2KB0A 3DMPA 1M8PA 3HB0A 2XQGA 3MJ4A 3ROTA 1FSSA 2A78A 1VI2A 2VSXA 2I33A 4B43A 1DIHA 4EPVA 3ABOB 3GVIA 1CVIA 1WXGA 1ZD9A 1V5WA 3UK6A 1JDBB 4F4UA 2DGDA 5I6DA 1EP2B 3L1VA 1HTTA 3QELB 5L3ZA 3NVKI 2HH9A 2Z2JA 3K6KA 5K8IA 3JAMA 5AXDA 2VK1A 5L51A 3PF8A 1DUIA 3NXKA 2ZWIA 3L41A 2P3SA 2GEKA 2ILVA 3DEFA 3MJCA 4YRMA 1OXTA 2JLAA 5BMVA 3ND6A 3FJOA 4DA6A 5E4YA 4QJ4A 1Q91A 3T7AA 4LYGA 3U7JA 1IRIA 2XBLA 3FYUA 4MJXA 1WBBA 1TVKB 4HRVA 1K8XB 4QIHA 1H9BA 2CXTA 1JA1A 1TI7A 2MR6A 2VHYA 2PBFA 3CNNA 4I4TB 5CCBA 1ZISA 3N8IA 1MC4A 4D56A 3EXG2 2J4FA 3MGGA 1XTQA 1X2BA 1JAXA 1AT1A 2BH9A 3AJRA 2B9EA 2ZRNA 4DCGA 4HWGA 2VDQB 4NFHA 4QYIA 4JX9A 1X86B 3GLFE 2JLSA 4HH3C 3LG2A 5B1EA 3S81A 3GRZA 4XD7D 3W34A 2FMXA 1ZINA 4BX9A 3EWNA 1RXUA 1PUXA 4G5GA 4P7FA 4QX6A 4UFNA 3TXAA 4BNMA 1Z45A 3HUDA 1KJZA 1OBCA 1PK7A 1SXGA 1KZ4A 1WE2A 1Z5UA 2UZAA 2FMUA 4Z0TA 1IY2A 4R40A 3EPJA 2XEXA 3EXFB 3FN4A 5JEDA 4NDNE 1RJ9B 2PFGA 3ET5A 5J3JA 1V71A 4JI7B 1NP7A 1PG5A 1IUNA 1W4RA 4K8RB 3ZGZA 1XTJA 1WW8A 2ZB3A 4ZP1A 1NVXQ 1X13A 5JCZA 1KWKA 1YTLA 1VBKA 4J29A 4Z86A 3P4XA 3OX2A 1G4UR 4LVUA 2MIIA 3PEFA 3B1YA 5CGQB 3ZLTA 3OD5A 3T4UA 3ZDEA 2GOYA 5FL3A 3OEWA 1SZPA 1B1AA 4MV1A 4B80A 5C9ZA 3DVRX 2QX8A 1JVSA 2RHLA 1EB8A 5GADl 1T2DA 1XD2A 3LCRA 3LLSA 2YV5A 3GELA 4QOJA 5IDVA 1YA8A 3U7IA 3UCFA 1FSFA 3UFBA 5JASA 2KLBA 2Y2VA 4A1FA 5L3QA 3TQHA 5LIRA 1L4UA 4OYYA 4DLAA 2FRXA 1Q16A 2GCOB 2FFHA 3NM5A 3QHPA 3WSTA 3GGSA 2Y66A 3H5LA 3IUNA 4WV3A 5BORA 1XQ1A 4LXXA 4ZI2A 3VR2A 2P9ZA 1BX3A 2ZUVA 4KUHA 3LKBA 4TKUA 3NVDA 2CLMB 3QNWA 2H65A 3D4LA 4ND3A 4HGRA 1GU7A 3PRHA 5AOBA 3WLIA 4B4UA 2I6UA 1QIFA 2OGUA 2B94A 3EIOA 2GHIA 1PEYA 1ZZGA 4XTCS 5AXBA 5EIWA 3ANSA 2OSBA 3R7DA 1E3EA 1KETA 2F1OA 4WERA 3STYA 1Q0RA 2DPXA 1U8CB 3S8MA 1B3BA 3OBBA 1HE5A 2OK8A 2BFEB 2ECOA 3OZSA 3DE3X 4ZVQA 4LF8B 2PZAA 2F55A 4IDEA 1Q3HA 2ZOSA 4BAGA 1V2GA 3LX8A 2Z3WA 4ME6A 3WHLA 5LWQA 1Z2DA 2C94A 3PHBE 4JQOA 3VR6A 4QODA 3V4PB 2ZU6A 4B3TB 1T3TA 3GFRA 3DDOA 4ZVPA 2QW1A 2H16A 1BE8A 1WV0A 3H8SA 4EAAA 4BRZA 1V35A 2PD6A 1LFDB 1FUEA 2BBOA 2Y8EA 3D2AA 3QH4A 2X77A 1QXSA 4KSCA 1NKVA 1V2HE 2C4NA 5KTKA 1XO1A 3WGQA 4V1CB 3LQYA 3S5JA 1XZMA 5B2FA 5JZ9A 1A76A 1ZN9A 3C8HA 3EVDA 4ND6A 4X62B 2PMFA 3DR5A 5FQOA 5CFRA 1PFQA 4KL8S 1ZQ1A 2XRMA 4YGYA 4JVMA 3HTXA 1I3KA 5DCWA 2C2BA 1W4CA 1SHTX 1TOAA 1N57A 3E9QA 1XVLA 1M7HA 2GBFA 3PXBA 4MWBA 3WMXA 1ESDA 3U61B 1CW2B 2G9RA 2VAVA 2SHKA 2ZAIA 2XNJA 3ENQA 4M8NE 4D9JA 1R64A 3P9KA 2HZBA 3DDNA 4E3WA 4MS4A 5HWSA 2CLIB 2XMQA 3RYFB 3C3CA 5FOVA 4ZOQI 4GOLD 1USIA 3SZUA 3N0XA 3IKVA 4MV4A 4LS3A 4QDJA 1W93A 1NVGA 4MUAA 2OZVA 5AIBA 3PE3A 1CS4C 2C7PA 1R0ZA 4OCZA 4WXPA 1PNOA 4BQIA 3KFLA 5DOVA 2VLBA 2XTNA 3ND5A 1BX0A 1P5JA 5F5NA 2X4IA 4R5MA 1GD1O 5JSFA 3PKIA 4EMBA 2I66A 1JXMA 2HWKA 3HM2A 1JV2B 4HSGA 3N2ZB 4OQLA 2V55B 3CF4G 3IBYA 1XLUA 3NWJA 3OIYA 3QPCA 4NPCA 1U8TA 1FSPA 3AUUA 3LVRE 2ZWAA 3O1HB 4Q3DA 2QXYA 5G1OA 3IH5A 2NUAA 1EDEA 3HVUA 5BOSA 5I7EA 1IK4A 2ZE7A 3GEPA 1C30A 3DE6X 2I6XA 4N65A 3VZBA 1RXCA 5I9TA 3Q9SA 1V25A 2Y92A 1J90A 3ECSA 4QOHA 5EWLA 4EZIA 2V4ZA 3UQZA 2F4NA 1UZAA 3HVKA 2DVMA 4B0PA 4D3FA 3D4NA 3PQEA 1TLFA 1H85A 5JSYA 1TM5E 5KX5F 2BPOA 3BMNA 5K0TA 2GVNA 3KLMX 4X91A 5B1IA 3IAM1 2Q46A 1LDBA 4N39A 1GSAA 3ORFA 2ZSDA 2A9KA 5JH7B 3A3PA 4V0LA 5BUCA 3VFDA 2J30A 5KYYB 4YJ2F 3NOOA 4UMDA 5EIXA 2HRDA 1XA4A 1XDWA 2NO6A 2OCAA 2EZ8A 5DP1A 5IS2A 4FBLA 1NW9B 1UWLA 4GZMA 4N7JA 4P93A 5EJ2A 1JMVA 1IK6A 3CA8A 3FCUB 5FR2A 2PGJA 3CCBA 1FUKA 3I28A 4V38A 4JB8A 5EIHA 2IHKA 1YJQA 3GRCA 1IAVA 2ZBQA 3PVCA 4HATA 2WJPA 4JXKA 2ODAA 1Y4AE 2WWGA 1R5BA 3H5TA 1RJDA 5KQRA 3NAMA 2BP7B 5C8DA 4Q3BA 3DT6A 3IP6A 2WV7A 1AF4A 1NW3A 3LOPA 1SOWA 4JLOA 1FUIA 1QO0A 4GX0A 2PKWA 4Q1EA 5P8WA 5BQ5A 4PBRA 1Z5ZA 2KMLA 4Q4AA 1NVBA 1WMEA 4OMCA 1GAXA 4B87A 4ZYTA 1IBCA 3WBKA 1FNCA 5JXJA 3UMSA 3PL5A 4B3IA 1J7JA 1TU0A 2R7KA 2IF2A 3K1AB 3DF7A 5ULLA 2IYRA 1I13A 4HAOA 4F5WA 5ICGA 5CYGA 3GJ6A 2VC2B 2JFPA 4C89A 4JL5A 4C6SA 1YJXA 4DNQA 5IAOA 3RRMA 4MHTA 1JPNA 3WGLA 4CV3A 3DO6A 4K6HA 2X6RA 5DFAA 2AR0A 3FZGA 2DECA 3UEOA 2PTHA 3TS1A 3GXBA 1UBFA 1KKLA 3GGGA 5KTRA 1KDYA 1XTVA 3H4VA 3KFVA 1R4MB 1YFKA 1QRRA 4L74A 1W73A 1ZMBA 2RHDA 1BNCA 1PJRA 2UDPA 2YHIB 4BP9A 4NBWA 3F7NA 1CJSA 2AEEA 3O3OB 1ZXLA 1A9TA 1I4OA 1JG1A 1U94A 3DEIA 1SR8A 3UV3A 4M1SA 4EK9A 2H7CA 2XYVA 5HKOA 1ND5A 2VP9A 4MYHA 1MD9A 4LOKA 3KSRA 3PQCA 3ZZUA 1I3OA 3QFFA 1X2EA 4YMHA 4IIHA 3SJBA 3VR4A 2CCGA 2I6TA 3FPGA 3BK2A 2NXNA 4GQBA 4NQRA 2OZKA 4BB0A 1WV1A 5KU7A 3GUVA 1ZK3A 2X0IA 3AHGA 4YWJA 2VCYA 5B3JC 5JAOA 3C1UA 3L7KA 2XCRB 3FR7A 5IXJA 3JQPA 3JWGA 1R0BA 4V02A 3I6ZA 4EUNA 5JAPA 1EWVA 1U90A 1IIBA 2I7XA 2Q9UA 1LLCA 2R62A 2QN3A 3CLVA 3DBLB 1THMA 4PFSA 2JBAB 3E3AA 2YICA 1I32A 1H66A 3MQFA 4RJ2A 4XVRA 4DEYA 4LJ5A 1DC6A 2FZ4A 1Z07A 2Q5EA 3ETEA 1Z34A 3WQBA 2BGKA 1R9NA 2AX4A 3GPIA 3IEUA 4XDZA 3V97A 4C03A 4W99A 3CLKA 1U8FO 2C4VA 1A9SA 4PLFA 3MTJA 4D4IA 4DMLA 3TG2A 1MLDA 2XWBF 2YXBA 1XYYA 2ZKLA 1TF5A 3TOSA 2N42A 3R77A 3URMA 3W5VA 5EHXA 2EGGA 3HCBA 1NXSA 2D4AA 2FW6A 5AESA 3ETGA 1IH8A 3LQFA 3P26A 2H9YA 3O7MA 2NU8B 5KWVA 5LD2B 2PR2A 3NNDA 1E2QA 3QSYA 3SVLA 3N75A 4KNWA 1MB2A 3A28A 1NN0A 2R48A 3RKRA 1I3LA 3LWBA 1L5ZA 2X4DA 4LYYA 4D5GA 2BGGA 3MFYA 3IDZA 3DZBA 3FNBA 5FPSA 4DCPA 5GOZA 1RLTA 1SUWA 2W2KA 3C5EA 3KJNA 3ADBA 4OVKA 2FPGA 1NVFA 3PNSA 4MEBA 3FD8A 5I9MA 2W6PA 1WUIS 4G0ZA 2QJOA 5IYZF 1M1YA 1RWQA 3P8ZA 2XOKA 3SR3A 5MN4A 3VH1A 3IJ5A 3N0VA 4MP8A 4BO6A 7REQB 1CUGA 5KNBD 3CHYA 2D54A 2QKYA 1CXZA 1YJ5A 2YC4C 3C98A 1NQTA 5GWXA 3AESB 4F2GA 2FHPA 5K8JB 2EXXA 1KDPA 3KYBA 2OKCA 4ARAA 4Q6BA 4HCJA 1RZRD 3C2QA 3GPCA 3ICPA 3JQ8B 2ZBGA 3MJFA 4YEDA 3CUKA 1T8WA 1GGVA 2R87A 3ANTA 3PT9A 4R1NA 4G26A 2P5UA 4NZYA 3TLGB 5L3SA 3DZIA 1CE8B 2X5JO 3FHLA 3EDRA 1JKJA 2CVPA 2M98A 1NFFA 2XWQA 3UZUA 3VDMA 3UMGA 5BSHA 4EGFA 2PKRA 3IHWA 4ID3A 3ZV6A 3G17A 1FLNA 5ALPA 3NWBA 4C07A 1E6LA 2A1IA 2WVHA 4TXJA 3AM5A 3VAAA 2G1JA 4CODB 1A95A 1P4RA 1C8VB 1YJBA 4N7RA 2PL3A 5DXJA 4LOAA 3OQNA 2KS6A 1QGZA 2QTNA 4TTQA 4CMIA 1SVUA 4HFNA 2O3TA 3FSRA 1IM2A 4UU8A 1MO4A 1BKYA 4P34A 1HL7A 4WH0A 5DNWA 4B35A 3WWPA 3LUBA 3QA9A 1LRJA 1T4BA 3UWKA 1G8PA 5DM60 1I3CA 2QI9F 4RTMA 3CRNA 4MKHA 3LP6A 4RS3A 3SYMA 1XZJA 4YYZA 1Q21A 4RLFA 1QS0B 3Q11A 2AZXA 1GT91 3LT0A 4ZJZA 4B17A 1T9AA 3B9QA 3EMBA 3EVCA 4HS4A 4Y2PA 5ALZA 1GPLA 3HCEA 4NMXB 4ODIA 1TAHA 2ZUUA 1LX7A 5ED0A 3AUFA 1JQJC 3WX0A 4MWSA 3KRTA 2VBFA 4CEIB 4PSVA 3KJIA 3THYA 1EBUA 1VMEA 4IQGA 4MKZA 1FMFA 5B4TA 2BI7A 3LHDA 2H4YA 2BFDA 3FA2A 3LXXA 3WZMA 1R9MA 2GEFA 2GPWA 1AY0A 3NBMA 4B6JA 5DHUA 4AS1A 5LC1A 4DR7B 4L5IA 1E5VA 1HGXA 2M6RA 1OXMA 1WO8A 2BZ0A 4IIUA 3SX2A 1TX4B 2JJ2A 3GRFA 3TOXA 3ZHRA 4G8CA 1JQKA 3GT3A 1XUOA 2BFAA 5KQPA 1W0CA 2PGOA 3LUAA 4WZAE 4GX1A 5ALNA 3VA7A 2DHDA 1ZO8A 3EN0A 4PG7A 3PJRA 3CLTD 5IEBA 1RBYA 3VYSB 3TLBA 4EZBA 1YRYE 2VUTA 3AVOA 1BMFA 1ENPA 3B5EA 4HRYA 2C20A 3SK0A 1HQDA 4IQFA 1JKMA 2ZS8A 1UFOA 3IOBA 4NU6A 2O8CB 3JR7A 2VN8A 3KWLA 2NPOA 3W6PA 3I3SR 3P9IA 5J59A 1GKYA 4HOYA 2HIGA 1BROA 3N8HA 1F6BA 1ODJA 3AKEA 4P3NA 3QV1A 4P7GA 1FJHA 3GW8A 3P4YA 2ZSKA 3AB7A 5BSWA 5I48A 1G8JA 3KXPA 3IVAA 2IYWA 9ABPA 1OXUA 4BVHA 5HIAA 5K3DA 2JFGA 3R24A 5ICFA 5JAQA 3RVJA 5KIAA 3T5CA 2NQTA 2NU6B 6REQB 1BMQA 1YQEA 2QN9A 3E8MA 3EDOA 4L27A 1AMUA 5EKSA 1FVHA 2BH2A 4PQYA 1H23A 1H2RS 5JCXA 3T5PA 3NC1C 2YJ4A 5EWMB 3KG2A 5TS2A 4A92A 5ECDA 4C87A 1RWVA 2A0YA 4PGFA 4MS1B 3SWWA 3D3WB 1KDTA 3V4RA 4H1WA 2WINI 4LF7B 2M6SA 1T2UA 2G8NA 4HXYA 4DSUA 2Y27A 2CL0X 2OR3A 2VWGA 3ZGOA 1ZJ4A 1EGAA 3QI7A 1NHWA 3REQB 1A9RA 5EZQA 3WB2A 4GE3A 4U2BA 4FGWA 3AVQA 4EL5A 1OIVA 1KEVA 5ALTA 1Y33E 3CR8A 2ZB7A 2YWEA 5IJAA 2P2GA 3EEIA 5H5JA 4BVFA 1ZCFA 1B3RA 2UUPA 5K0GA 2XZPA 3PHIA 1ATIA 1SBTA 4ZIRA 3E9EA 1KFKB 3JYNA 1LW6E 3HCPA 3SBEA 4A26A 5J2UF 4PIPA 3I6BA 3KV1A 3QLVC 3BYZA 4F0JA 1P5FA 2O1SA 4E7OA 3SOPA 2FRVA 1O6CA 3JQQA 4UBKA 4ZQBA 4F6LA 5HYVA 5IHXA 3T5MA 5EINA 5GVSA 1I9CA 4P3XA 4QASA 5HR5A 1XX6A 3RV4A 1BS2A 4QVKA 4PZYA 3ZDYB 3QWIA 2W6NA 3O93A 3HN6A 5LL6P 1YUNA 2IH2A 4E4YA 4NNJA 1ONPA 3WC4A 5E1OA 4C1BA 1OPRA 4LV6A 4WPGA 1NR1A 1DZIA 5GMOA 2X0NA 1QZXA 1UEJA 4NH4A 4XQGA 4TYQA 3C3EA 3PGXA 1KBZA 1UBRS 3LFHA 3OLVA 5K4GA 4BKRA 5KOIA 1E2JA 3ZE6A 4UM9B 1ABFA 3I9JA 3SKVA 3SMQA 1G2OA 2J0UA 4M9QA 2X9LA 5B4UA 4NYIQ 1I5EA 3OFSA 3WJAA 4OJTA 1P18A 4BFUA 1DIRA 5C34B 3ZUGA 4FJ1A 3R3VA 2G88A 1YONA 2O8EB 1GFWA 3B3JA 4GWLA 3E1SA 4FM9A 1NYRA 3DEZA 2QVBA 1YZQA 2R44A 5BQOA 2WWIA 1FU8A 3WLKX 3JQAB 3LA6A 2OLEA 3GFSA 4JLVA 5JYCA 3D31A 3EVNA 5I51A 5LZ9A 1TIKA 3M70A 3VBEA 1VKRA 2QE7D 3NIGB 3KZMA 5KAPA 1NUUA 5AI5A 4ERXA 1SUSA 4TTVA 3NDBB 1TO1E 5ANRB 3WI7A 3O8QB 2VBCA 1GG9A 3H0KA 5FO0A 1OGIA 3WYBA 4JGIA 1EWRA 3KOWA 1FSZA 4W1PA 1FTYA 3LVBA 4KR9A 1KZYC 3MFQA 4DXDA 3BGVA 3HDYA 1JFVA 4FZ5A 1RZUA 2QUHA 2PWPA 2VHTA 1U1DA 5GM2A 3RUPA 3WMEA 3CX7A 2HGSA 4WAUA 2Z3ZA 1YZYA 1KK2A 1XIVA 2RAFA 2J33A 1N6KA 3CUYA 3D54D 3GDOA 5AKIA 5ADUS 4ZARA 4AG3A 3OUZA 6AT1A 1CEEA 5CBPB 3LRPA 2C57A 1RLMA 2IOQA 1XKQA 3KPYA 4HX2A 5KMGB 3MTBA 4NU5A 1F14A 3CSDA 4KXMA 4R01A 3EPLA 1DFIA 1SKQA 3ROFA 3DHVA 1X39A 5K0EA 1IE3A 1WB5A 5TVGA 4NK4A 4JITA 2HU5A 5EG5A 2WHRA 1JIIA 2ZI6A 3GEGA 3P96A 2BM0A 2WY2D 3TJZA 3UJ6A 4XYLA 4PWZA 2BMDA 3HKBA 4JL6A 3LVFO 1U81A 4RVFA 5FFMA 5CYPA 1KORA 2BGLA 4NABA 5LBIA 3S2IA 4J6EA 5CITA 4K7JA 4D80A 2V0CA 3K6JA 1F12A 2QG6A 4EY6A 4WASA 1XL0A 3VZRA 2HF8A 4LHXA 3CYFA 1V48A 1G3QA 1F2UA 4BJ3A 4LRQA 4FHGA 3EJ6A 5KYXB 3AJ8A 4JI4B 1HZJA 1JHZA 1JU9A 4WI1A 3E1GA 1DQYA 4JXJA 2RGCA 3DF9A 5DEIA 3CUTA 5GINE 2WIFA 3BMQA 1C50A 4EM6A 4F4IA 1WY5A 1R6XA 4FZRA 4L08A 4AJ1A 4CLDA 4PFKA 1PLKA 2R6AA 3C3BA 3PLRA 4PAOA 5H7XA 2DBVO 1TT5B 2BDTA 2XWJI 3F6CA 2AH5A 4GXTA 1DEAA 3ET4A 2I4NA 3O26A 2BHLA 3E23A 4GQAA 2OV3A 1EG2A 2E6KA 2ZYRA 4D9MA 7ABPA 5CA1A 1ZVJA 3IKTA 4M87A 2J4CA 4H4EA 5JZVA 2PJUA 1P9LA 2ANBA 1DUSA 1N5KA 2Z6VA 1LBQA 1P7CA 4EITA 1SWWA 4CW7A 4P33A 5LBTA 3KEFA 2Z4SA 1T9ZA 3HWSA 4M22A 3VMMA 5DK4A 1HK7A 5TQJA 1NOJA 2ZJ6A 4RZIA 1P75A 4Q4JB 1IZYA 3GEBA 1LS6A 5A9SB 1PRYA 1L4GA 4R7ZA 3O4FA 2PCLA 1NAIA 2OECA 2YVAA 4B4KA 2HF7A 2YASA 1THGA 1TM2A 4PGGA 4GXQA 1R0CA 3DKRA 1E0JA 3MWEA 4WOCA 3UHPA 5DRYA 4OB6A 2VF2A 3OO1A 1E4EB 4IFTA 3UOWA 5CCEA 2A1TS 3NC4A 4RMNA 1NR5A 4L51A 4QPPA 4E15A 3WNCA 5BN4A 1JHQA 1BDMA 3R20A 2NYRA 3V8NA 1MR3F 3MBOA 4YRGA 1B16A 2QF7A 5A4IS 4KN9S 9LDBA 2ZCJA 1QUFA 2I6QA 3RS0A 3GVHA 4H0FA 4HFJA 4RHEA 1Y5IA 1R12A 1REQB 5CFNA 1DBPA 3U3OA 7MHTA 4KX3A 1QCDA 3GBPA 1F8GA 5B3LA 4IXMA 3C16C 1Z6YA 1EEXB 2AT1A 4GGPA 3QUQA 4BWFB 3EIFA 3W3AH 1LF5A 3BDAA 4QHYA 5L6MB 3LQQA 1Y48E 4BZZA 2INGX 2MT9A 3FX2A 3K9BA 1L1FA 3QMPA 1GDDA 3JSAA 3C6QA 3KELA 1Y89A 3RFCA 3B1KA 1XVIA 4LYAA 1ZICA 3AIMA 3PXXA 2OA0A 4JBWA 5HOQA 1U0EA 1AS3A 1I7QB 3K0EA 1QGUB 3VR0A 2F62A 2P65A 3F5FA 5A9RA 5C8XA 1Q1NA 3RTDA 4B8WA 1FYFA 1K27A 5BR4A 1GLNA 2I4IA 3DBVO 4X71A 2VUHB 5DBEX 2ZYHA 4GOND 3U7HB 2GJ4A 3EHDA 3BFPA 4QOFA 4RPGA 3V5NA 4AWAA 4S1WA 4Z7JA 4ZMRA 1QIMA 1PJSA 2CLSA 2FEOA 3HMQA 3MUFA 2EBHX 4HLDA 4FYPA 3TQOA 1WCIB 4JUCA 1KTIA 3FYCA 3L8HA 4JLDA 4DIUA 3A1EA 1JKXA 4LPKA 1RLIA 5FBLB 3TLKA 1Z13A 5BNFA 1ISGA 1N3IA 4DLTA 5MHTA 4CLHA 3CNOA 1KQ3A 3BTVA 1PP4A 1VLQA 2QMQA 2JI8A 1DFHA 4WLFA 3BL6A 3SEAA 2H2HA 1MTOA 4R54A 1X8KA 3VH3A 4MNTA 4P92A 1QR2A 3GDWA 3Q3VA 1NLUA 5ILQA 4FJ2A 3NTRA 5HCNA 5BN5B 1M2FA 2OO7A 4NDZA 2FPXA 3ZY2A 1SKYB 1DKPA 3ZCSA 1DP4A 3T7JA 1ISFA 2OLKA 3PNVA 3UA4A 1CDZA 1QZUA 2HF2A 2QJRA 4O2AB 4YUVA 3TXXA 5C1PA 1LSOA 1JEEA 4G9BA 3R7WA 1ZIDA 2A35A 4M83A 3RC7A 1G66A 2NQ8A 2IHTA 2V6IA 4LKOA 5FTKA 4A2PA 4KE9A 5JWRA 3Q6MA 3ED5A 3OPVA 1MEEA 1LPAB 2PUGA 5CTJA 4J0FA 1XRRA 2F8TA 1YKGA 1ZH4A 2IODA 1LI7A 3UKOA 3VTZA 4H31A 3BE4A 2ZITA 4U5XA 3HEBA 2IYUA 3F71A 4J16A 2Q6OA 3CLHA 4HYEA 1KDZA 2RGNC 2AJ8A 5ARDA 3CGWA 1JNXX 2EIXA 2FLWA 2O50A 1NT2A 1X7XB 3O8OA 3RVBA 4FUQA 4J16C 3TZBA 3AI3A 3EGIA 3NRBA 3OFVA 1N2BA 4JV5B 1XGKA 4QTTB 3HHPA 2NXEA 2V8OA 1PYOA 1W8DA 2VFAA 5C7OO 4KKVA 3RT9A 2ZRAA 3PIIA 3WWDA 4ZC1A 4MQFA 4HFMA 4KZPA 4EFKA 2J4DA 4MPPA 2GCPA 3FTDA 1UJNA 3GFOA 5C5IA 2PWBA 2B7LA 4F3NA 1P5ZB 3NH6A 2JGDB 3KJHA 4MYUA 2DSTA 1KNXA 5A0FA 4TKMA 4CKYA 4KQXA 3EYWA 4ALIA 2H1VA 2AOWA 2JI7A 1NQWA 3UJ9A 4R2LA 3HWWA 3L7CA 4G5HA 3HZZA 1ODCA 1Z33A 3D8UA 2XQJA 1JG7A 5KUTA 2Z43A 3EPPA 5JATA 1SO8A 2Z4TA 4WX2B 3PV0A 1LDGA 2VYFA 5KC8A 2FFJA 4ECAA 4TL7A 5CYOA 4DA8A 4AKHA 1X7ZA 1NXTA 1DAGA 1WP4A 2A5JA 1OFUX 3CZCA 3OT4A 4CIXA 3G0IA 4PYQA 3PRYA 1S2OA 1X87A 4KQCA 3WBBA 3EMVA 3LZDA 4PAQA 2UVPA 2PEZA 3EBLA 2K87A 4HGPA 1ISPA 2YC2C 1GKLA 2AFVA 1R66A 3QLTA 1SM4A 2FMHA 2Q28A 4YJHA 1H2EA 5GJBA 1T1EA 3OJXA 3FNEA 2LIVA 1C1DA 3D43A 2LV8A 3NTUA 2VUIB 2A6PA 4CHGA 4ZDKA 2IP2A 1L1EA 4AY3A 5LMZA 5DHRA 4DDMA 2VOJA 4EPYA 4PFQA 3BT7A 3ITDA 1H8EA 3E81A 4XCQA 1J0EA 1NFRA 4WFKA 2OKGA 2G9VA 5KQSA 4KNVA 1XZLA 2XDQA 1W9HA 1ZUIA 3KWJA 3HA5A 4YY3B 5F2OA 2VYNA 1OC2A 4CTMA 5CFMA 2FK7A 2NZVG 3DE1X 3GEMA 3MW8A 4V0OA 5HK9A 3TMAA 3HLKA 1PSDA 3VNQA 2OAGA 4G5RA 1EBBA 5ALHA 4C78A 2DKFA 4RABA 4YA6A 1OAOC 4BIIA 2IXEA 1OPXA 3M81A 1IHXA 5HZGA 2OCBA 3GDGA 1QDEA 2P30A 3WRXC 4UBLA 4O29A 1DDIA 1VLHA 2R65A 2HEIA 2V0GA 4EJMA 5L7TA 2YZ7A 2GM4A 3A6DA 4AUNA 2XRYA 1GYPA 1YZVA 4BUCA 2L2QA 4MR9A 4F91B 1RJEA 3AVTA 2W6CX 4UXHA 5GP1A 5I8PA 4G1CA 4Y2RA 4ZHQA 2GKOA 4O4HB 3VO8A 2IEIA 4IDQA 3IJEB 4RIIA 3DT9A 4LYFA 3TE6A 4IKOA 4CWAA 5B58C 5IANA 2XGMA 1W5SA 2XUJA 4NATA 2CUNA 1E3LA 3MAGA 1VSVA 3W2IA 4Z3DA 4B6OA 2DG2A 5EP3A 5J9FA 4ZVMA 3MBIA 2C00A 2P9TA 3P9YA 2Y77A 3QYJA 4I99A 3OMWA 1JIVA 4MSUA 4RK5A 1PT7A 1CF2O 2CVQA