2H51A

Crystal structure of human caspase-1 (glu390->asp and arg286->lys) in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-vad-fmk)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
170
structure length
167
Chain Sequence
GSEGNVKLCSLEEAQRIWSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACKGDSPGVVWFKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-1
publication title An allosteric circuit in caspase-1.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 167
sequence length 170
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2006-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h51A00
1RWPA 3V4LA 2NN3C 3GJQA 2WDPA 4QU9A 4QUHA 4ZVPA 3DEKA 1I3OA 1QDUA 2C2OA 3H0EA 3H11B 4AWAA 3D6HA 2QLBA 3D6MA 4FEAA 3IBFA 3K7EA 2QL5A 1QX3A 1K86A 4DCJA 3PD1A 4N6GA 4EHKA 2H51A 4JR0A 5LU9A 3ITNA 5IAEA 4JQZA 2H65A 1RWMA 3PCXA 1RHQA 1SC1A 4ZVUA 5I9BA 3DEIA 1NMQA 1BMQA 3SIPA 4HQ0A 4QTXA 2CNNA 3DEHA 4IYRA 4M9RA 4JJ7A 1RE1A 4QUIA 4NBNA 4PS1A 1CVRA 2CJYA 3R7NA 1RWNA 2C2KA 1KMCA 4EHLA 4QUJA 3BIJA 4FGUA 4JJEA 4N6NA 5LUBA 3E4CA 2Y1LA 2J32A 2HBZA 1RWVA 4QU8A 1NW9B 2H5JA 3V6MA 5IC6A 3IBCA 3V6LA 2FQQA 1PYOA 1JXQA 3KJFA 2XYHA 2FP3A 3GJSA 1RHKA 2J31A 3UO8B 5IBPA 4QTYA 2HBYA 1RHJA 2C2ZA 4I1RA 4NBKA 3R7SA 4D3YA 4DCPA 5IC4A 2AR9A 3H1PA 2C2MA 4QULA 3H11A 4HVAA 1RWKA 3EDQA 3R5KA 4JJ8A 4AWBA 3RJMA 5I9TA 2QLJA 3V4OA 4QUDA 3V3KA 1IBCA 4LSZA 1F9EA 3GJTA 3R7BA 4JR2A 2H4WA 1NMSA 2QL7A 2XYGA 1F1JA 4FDLA 3OD5A 4JQYA 4QUEA 4EHAA 4JB8A 3PD0A 1QTNA 3EDRA 1PAUA 4QU5A 5LUAA 5K20A 1RHMA 2H54A 3P4UA 4QUAA 2P2CA 3V55A 4I1PA 2CJXA 3S8EA 4N7JA 4N7MA 3KJNA 3UOAB 5IAGA 3R6GA 3NR2A 1GFWA 4ZVSA 3S70A 2FUNB 5IABA 1RWWA 1RHUA 2H48A 4EHNA 5IAJA 4ZVTA 1SHJA 2CNKA 4HQRA 4NOJA 4ZVQA 1GQFA 2CNOA 4NBLA 4QUGA 1I4OA 2J33A 4QU0A 1SC4A 1I4EB 5IASA 2QLFA 2XYPA 3D6FA 3NS7A 3SIRA 4D3ZA 2HBQA 2XZTA 3H13A 3KJQA 5IARA 3R6LA 4NOMA 4D3XA 2J30A 3QNWA 4ZVRA 5H0IA 2CNLA 2HBRA 4AW9A 4N5DA 5IANA 2QL9A 3R5JA 1SHLA 3P45A 5JFTA 5IBCA 4IEFB 4EHFA 4PRZA 4PRYA 4NOKA 4EHHA 2CDRA 1RWXA 1ICEA 2XZDA 4NOLA 1K88A 1RHRA 2H4YA 1NMEA 2Y0BA 1CP3A 3NKFA 4EHDA 5LU8A 2C1EA 2DKOA 4N6OA 1RWOA 4PS0A 1M72A 4JR1A 1SC3A 5IAKA 2K7ZA 5IBRA 4ZVOA 1I51A 4QUBA 4EJFA 4DCOA 3GJRA 4FXOA 2H5IA 3DEJA
chains in the Genus database with same CATH superfamily
1YDFA 1DO8A 1YA4A 3IR7A 3C14C 4FNOA 2YWJA 3IB6A 4XB2A 3WBJA 5REQB 1DKNA 1NUTA 1TEZA 4XTCS 1W44A 3N87A 4NE9A 1ULUA 2YXLA 5CXXA 3HFJA 3L0OA 2OOSA 4FEAA 2WKSA 4KNWA 1JHUA 3RD5A 2QL5A 3A1VA 3MT8A 4EZIA 2GSWA 4HDCA 2BEUA 4BNIA 3TBFA 5D3MB 2IU4A 4P83A 3ESYA 1H0HA 1QK3A 2AC7A 4LUCA 3F8TA 4UTXA 3LO8A 3OU7A 4J1NA 1EZ1A 3A11A 5MGNA 3DAGA 1DAPA 3SNKA 4UNNA 3LHDA 4WDRA 3OJFA 2Q28A 3AOGA 1V5EA 1VXRA 3RUCA 3ZIUA 2HNAA 5HZGA 3SQWA 1E4EB 2QN8A 3O83A 2QTBA 3PITA 4C6HA 1ST3A 2QGNA 1QYCA 1XTKA 4LRQA 4XYLA 2VZ8A 3QTLA 4LJRA 2GNAA 1GTG1 5I3CA 1ONNA 2ZE5A 1XZ8A 4CIBA 1ND6A 3LDGA 4BAGA 5TT0A 5I7SA 1XJ5A 4D3YA 1WABA 3HVHA 4B3SB 3NVKI 4CM4A 4BC0A 4OKNA 5LZ9A 2P90A 1ZSNA 3SF8A 1E3QA 1S6YA 5D1HA 3IMKA 1IN8A 1YRLA 1DG9A 1P80A 5LWHA 5JHHB 2ADMA 1AMUA 4AWXA 4FMDF 2OXEA 3AF0A 3RBAA 1L7EA 2CJFA 3HHEA 3QVTA 4TMXA 2RJOA 1S9HA 1L5HA 1UK6A 3H42B 5IFKA 3A2MA 3C6YA 4GM0A 4QA9A 4TYPA 3WHKA 4KIWA 1ZR4A 5PGMA 2E49A 4FFMA 1K7FB 1GKYA 1EZZA 1V4NA 2JAOA 1FCJA 2GRJA 2GPTA 1W0KA 3WIEA 4HRAA 2Q5JA 4BXOA 2IVZA 4NJMB 1Y4UA 3AI3A 2HLHA 2V0NA 3FETA 3QXHA 5DYGA 1EVKA 5E6UB 3LVRE 1VE6A 1MRSA 1WLYA 5IAJA 3ANLA 4D0SA 4YY3B 2H3EA 1TKBA 3HCDA 1AE1A 3BRWA 4Y6RA 1XK6A 2R11A 5T67A 1AHNA 1H2RS 1W7AA 1XWFA 4G25A 2C1ZA 1V4VA 4J4HA 5DWQA 2AXEA 1S4MA 1Y9DA 1ZGAA 3FGPA 2J30A 3H1AA 3LT1A 3HDGA 4PQEA 1MUUA 1NNLA 2HUPA 4N3CA 2GGSA 2PX0A 3RHZA 2ZUVA 4H2DA 3HNRA 1WB9A 1GPAA 1R00A 3ZV6A 1J2RA 1AHIA 5C5DA 2B94A 3FPLA 3SU8A 1JYFA 1TX4B 1ZK3A 2GXUA 5CBPB 5CYGA 1LC3A 3T3EA 1P0MA 1YD7A 4PLCA 3K0CC 4IIGA 4CMJA 1WXGA 4FCWA 4MOWA 2PH1A 3SC3A 2IEGA 1XGKA 5BSKA 2DPYA 2I2XB 4OQZA 4QYWA 2HM7A 4Q02A 3I64A 5CM8B 4BMZA 1KL7A 1UEJA 5JTUA 2CEKA 1KZYC 4DG8A 1ZIXA 3UXYA 4KMMA 1Y4DE 2HCTA 3HBFA 1L1FA 2W37A 3EF3A 2W70A 3RDPA 4TXLA 4Z7JA 4RTMA 2NN3C 5A5GA 1H2EA 2GT1A 2JFNA 4AZ3B 2NXWA 4YI5A 3W5BA 1N6RA 3GY0A 3LCUA 1P1HA 3AHJA 3D6MA 3ZDAA 4BNJA 3IOMA 4M98A 4R8VA 1E77A 3K2EA 1VDZA 1JW9B 1KI7A 5AM2A 2AH5A 3LCCA 3ZUPA 4JQZA 4F4UA 2RGAA 5ALNA 2J0UB 3CGGA 4IH4A 1G0OA 2BGLA 5ENVA 5JS1A 3KJHA 1IHPA 3R5FA 4LRTB 5AW0A 5KJ1A 2PWZA 2O2HA 3EGOA 2FWPA 4EPRA 3GAAA 4BEBA 1ULBA 1WV1A 4MH0R 4R6XA 3ZHUA 4DQXA 3TRHA 4FI3C 3IP9A 4MGYR 4NBNA 2FMUA 3BT7A 2DR0A 3LUPA 1SBNE 1SCUB 1D0VA 2QYHA 4P7JA 4KPFC 4DW8A 1I0IA 1DGQA 4JT2A 1KERA 3UQYS 4FW9A 4K1LA 1IIBA 2O5RA 4N9QA 2PMKA 1BJRE 5JLAA 3E1GA 3S1LA 5HE8A 4IIVA 1RI3A 4QGSA 3U6KA 4Y6SA 1NN0A 3EX7C 4RMHA 1UDBA 3I1JA 2O50A 4DTIA 4KSBA 3SLKA 1KA9H 5CTJA 2QJOA 2AE2A 2FA9A 3HSSA 3KJFA 1USVA 3JS5A 1EQUA 1EJ0A 1I33A 2YXBA 3EBLA 3N39C 4HXGA 5ED4A 1KPIA 3KYJB 5DGCA 3MG9A 4DDUA 2E5LB 3G8DA 4JBYA 4TM8A 5LQMA 1PR4A 5BSMA 3RVKA 1NKTA 3P9KA 4MJ3A 1OX4B 2ZWAA 3MBIA 3WGYA 2HJSA 3KYCB 3S6JA 2QZSA 1JKJA 1KY4A 2XUGA 1N5RA 3JTMA 1X8LA 1FJGB 2IF0A 1DLIA 1C50A 1F1JA 2QQGA 2Z3ZA 3D8UA 1FLVA 1T26A 2YNMD 3PHHA 5FWYB 1E2JA 2HSWA 4J8PA 3N28A 2DBRA 1GZ6A 2WTNA 3NNNA 4GE0A 3ZWWA 4JT4A 4BO6A 3NCTA 4MKRA 2XT6A 1ZGJA 3GLFA 3OTQA 3AFHA 2PXCA 4D3DA 1UJNA 1JHZA 3SNHA 1LLUA 1RYHA 3RUPA 3GRFA 4GXRA 1J8QA 2GVDC 1EFDN 3HR4A 4BCBA 4QDTA 4QBGB 2GN6A 4AY3A 1S1CA 2PG3A 3RRZA 1WMAA 2P1DA 3RAPR 3PUWA 1M76A 1SXJC 2EFDB 1T2UA 2BZGA 3K0HA 1DX4A 4RKWA 3ZEAA 4CDGA 2WD8A 4NDAA 2Z5VA 3MUEA 2C31A 1PQPA 3WG9A 2ZYDA 4GT1A 3QNWA 2PCLA 3QOFA 4MI6A 5DLDA 3ABZA 5DT2A 5BXYA 1OI4A 3OVMA 1ZAYA 1EJBA 1PP4A 4BFXA 1CUCA 2PKXA 1EHYA 4PO1A 4DY6A 3H2ZA 4ZEVA 3RG2A 5AW2A 2X3YA 5AW4A 1QIEA 4U0KA 1QP4A 3IR5A 1B76A 1N3LA 2XMZA 2OO3A 2RJNA 3EVTA 4S12A 3RH0A 2J7PD 3KZXA 5JNWA 2GZSA 1PV2A 1XV5A 3UHAA 1BD4A 1O96B 2FWAA 1L4BA 1MH1A 3DHEA 5DCYA 3LUCA 2C9CA 4U9HS 2BKEA 2HU8A 1ORDA 3U7GA 1QIMA 1T3TA 1SAYA 2QAJA 3ILYA 2V6GA 5D01A 4HN2A 5DX8A 5CNIA 4CDMA 2AUNA 4BZWA 1UADA 2YQ4A 3NUZA 1HE3A 4YQYA 2WZBA 4JL5A 4UTPA 1QLJA 1UQRA 1SUDA 1QONA 2WYOA 1WW8A 1Y8QB 5F64A 5TQJA 1E7YA 4DVGA 2VZ0A 5C35A 5FH9A 3PK0A 1QQ6A 5KUTA 1GQQA 3GGSA 3O8DA 5K8TA 1SHKA 3LGXA 4F5YA 3DEKA 3IQGX 4HKTA 3D8SA 1FQOA 1TYCA 3SX2A 4NG5A 2ZR7A 3GWZA 5DMHA 2D06A 3WSTA 4GIBA 3KKNA 4XWWA 3A10A 1PFYA 2AFIE 1D4ZA 5GVSA 1YWGO 4P4NA 1C9MA 2ROQA 4F9FA 2B83A 2F3QA 2NQ2C 3N0RA 3DDWA 4MIYA 1NC3A 3FSRA 4K05A 3PFHA 1E9EA 4R2LA 4WY2A 3VHRA 2FR1A 2JS7A 4F4HA 4IIHA 3R5SA 2Q4BA 3IEXA 3KEOA 5C31A 4YPVA 1KJZA 1ESCA 4IFIA 4P3XA 1K66A 5BNFA 3CY6A 4OB6A 3C6BA 2EVWX 3HJTA 1W4BA 2IPMA 3B6IA 4V02A 2K7FA 2XMBA 3D6NB 4JOCA 4D4GA 4Q9KA 4YRKA 1QDEA 2V97A 1KDVA 3TQCA 4XH9B 1T0BA 5BNZA 1FU4A 121PA 1E1MA 1XO1A 1Y1KE 4NECA 4B35A 2VDKB 4BNFA 4D4LA 2PRKA 3TQSA 3UOGA 2O19A 3WNCA 2JGJA 2Z9DA 3AUJB 3EGDB 3ABRB 5AHWA 4I99A 3PXGA 2JLZA 5AVKA 4YREA 1SIBE 4RNCA 1HQCA 3WLOA 1U94A 2DBYA 4BCCA 3I1FA 1Q57A 3VR6A 4CG2A 4URWR 1PTJA 4XYMA 2DJ5A 2Y0CA 4F5DA 3FOZA 2HDNB 2PWYA 3E27A 1SFRA 2H4WA 2HLDD 4GVXA 4LJ9A 4BFVA 1WX1A 5A62A 3KWFA 3VDQA 3KTFA 1SH7A 1IDN1 1L0BA 4RDIA 3PNLA 2I87A 3JZAA 1VE9A 3MJCA 5SYAA 3ZDYB 1IZYA 2DX7A 2I6QA 2R6FA 2WG1A 5TPWA 2GR9A 1IPEA 2W6OA 2VAWA 2EWVA 2OGSA 3DGEC 3CUTA 3K2IA 4AY5A 2VSOA 4CKBA 4JSTA 3PJEA 1RSZA 5H9VA 1QX4A 4DXHA 2R1TA 2UUPA 4P54A 4WXMA 3HBLA 3GNTA 1R9NA 3VTKA 2NIPA 3FDZA 1N2OA 2P2YA 2AN5A 1MG5A 4QBTA 1U02A 5INTA 3KDAA 4GPAA 4QYTA 5AJZA 2EGGA 2ZYTX 1XQ6A 4MI9A 2FRVA 3F90A 3EMVA 3LUGA 3R5JA 4X54A 5F3WB 1X7DA 4RCVA 2DKFA 1ADYA 1LK7A 3B36A 2BTEA 1NXSA 2OFOA 3GP5A 3NORA 3QBJA 1U28C 3U3XA 1ZJJA 2IOFK 5E2IA 4EHHA 4K9PA 2CJPA 3IUPA 1P8JA 2ISCA 1G2OA 2J4DA 1NN5A 3I04M 4GICA 4IX9A 1UZLA 1D8AA 1JKXA 1N6PA 2C1EA 2F3RA 4MV8A 4DHEA 4CTNA 5KVCA 1EU1A 1TA4A 3FF4A 4B84A 4BNHA 2HSEA 5IAKA 3JR7A 3ZXIA 1ORVA 4AXXA 2WU1A 3ZGOA 3IAFA 3U4HA 1BJKA 1PFVA 3IHKA 4CGYA 5K6AC 4RWEA 4CI9A 4HVCA 1GEGA 1GG5A 4G1MB 4G0UA 1X2EA 4WOCA 3GLIB 2VSNA 1GNPA 2R4UA 4MGEA 3S2GA 1XI2A 2E4AA 3TLKA 4TT3A 4IDQA 4FFWA 1AMOA 5CLQA 1R5OA 2Q3FA 3BTOA 3LKBA 4IZOA 4PZUA 1RYMA 3I2GA 3FD8A 3BIXA 1UBHS 2C3UA 3ABSB 2Q8PA 4EY4A 3PA8A 4J7XA 3JPYA 1X38A 4R1QA 1QBGA 3PDIA 2A2ZA 1J5PA 3WL3A 4Z1OA 1MVLA 1ZGZA 1QRAA 4EPVA 2Z4RA 1XLTA 1JHDA 3USCS 4DADA 2NUTA 4ZZIA 1G98A 1J06A 4GKVA 4QDJA 2QD4A 1O5IA 1NRJB 2FX5A 2P40A 2QTHA 4OMDA 1TDJA 1QYWA 4LEIA 3UUEA 3FG9A 1BO6A 2ZI7A 3FNBA 3GRVA 4XIGS 4CTMA 4DLRA 3VYRB 2FWRA 2QX4A 1VB5A 4KFRA 3W78A 4AJ4A 2VBIA 4BATA 2Q6IA 3CEJA 5KNDD 2XCLA 3FNIA 2J3EA 2IYPA 4A0QA 2R85A 3WK8A 4WH0A 4DQLA 1QYVA 1TU0A 2ZYAA 4BFCA 4D0GA 1U3UA 2VNJA 5EQFA 4G1EB 2EGHA 1IOWA 3HDTA 3MMZA 5FPSA 4F1WA 5KWJA 4V0OA 3VM6A 4GX1A 1YBMA 2FOLA 3THXA 1BWSA 1NP6A 1LC0A 2ZBPA 2OGWA 1Z7EA 2WF5A 4BX0A 2XBMA 1E2KA 5F4BA 4AXBA 1Q1QA 2H1CA 4XA8A 1FX0A 1DC4A 4U5QA 4ZD6A 1T1RA 1ZJWA 1T4DA 4WGFA 1FA9A 4KGDA 2NZXA 1C9KA 1GU7A 2VRNA 1KO1A 3GXOA 3HB0A 2EX1A 2J9GA 5ALXA 2ZPTX 9GPBA 3AILA 3IX7A 3L0IB 4OQNA 3FVTA 2BFEA 3L7CA 1WXEA 2YJ4A 4O4HF 9LDBA 4GMDA 4KQCA 4GSLA 1SXHA 2XXAB 2JH8A 4RO0A 4YRZA 1UFQA 1J90A 2ODWA 3NHJA 4Y2RA 2REBA 4ZP1A 3UHOA 1XTZA 2W22A 2VBFA 2CUNA 3TWOA 1TLTA 4CI0B 2NZ2A 3K70C 4H0CA 1RAHA 1U2EA 2VF2A 2CNKA 4ALNA 3CVYA 3DZBA 4RIFA 3HLTA 3I83A 3PJGA 2GERA 4CU2A 3R20A 4MCAA 2QD5A 3W5CA 3EVAA 2Y99A 2W6NA 2A5GA 5AQ1A 4BKMA 3W8NA 4ER7A 2RG7A 4ESVA 1US8A 4K3UA 2YRWA 4KEAA 5F5XA 4ZCQA 5K03A 1OFGA 1UC9A 2ZE6A 3Q7SA 4K9DA 5F1PA 3NWJA 4H4CA 2PFGA 4BQOA 1U3WA 1Q0QA 3BZWA 4ZHQB 4G0MA 4I1UA 4MIKA 3V80A 1KIAA 3N75A 1QP7A 2WC1A 3ZR4B 1ZL0A 1X1QA 3EQ2A 2JFZA 4MRMB 5F9FA 1NF2A 1E6EA 4TV9B 1I10A 2EFEB 2D3TA 1C3OA 2R87A 1IK4A 4X6YA 4DIBA 1W0KD 1XX6A 3FTPA 3RTGA 4CN8A 5H80A 5KNLA 1TO2E 5TRTA 3E9RA 4DCOA 4HCJA 3TBHA 4S04A 1SQ6A 4UHCA 1Z2OX 3OEEA 5TDHA 1NXWA 2JCSA 2FN8A 1XDSA 3BRWD 3L0ZA 4PZZA 3ZDBA 2NU7A 3D5EA 1ENOA 1EWTA 4YI3A 4KH1A 5T8KC 4C76A 3NEPX 4CLEA 4JUDX 3AQIA 4MARA 5JH7A 2NZYA 3OCWA 3QXJA 1AKQA 2GEFA 1U8AA 2XLBA 4H1TA 5CK4A 3U9TA 2RHCA 3UJNA 1PJCA 2FCAA 2BUAA 4YMHA 5KJFA 3GUUA 1XMPA 3QE4A 4M54A 5A7HA 3QX7A 1YQWA 2Y1EA 5JATA 3KPUA 4FEYA 3TKAA 2ZUSA 1E6LA 4QUIA 4M3NA 4WBNB 5HOEA 2EDCA 4R40A 2BBWA 4LOLA 1NV8A 3NKLA 4PGMA 1JXOA 1TM3E 4R6WA 2WFZA 4F6RB 4HMPA 4I55A 3VH3A 3P9SA 5KNDH 5FBLB 1RADA 3UHJA 2IHTA 1CRLA 1V41E 2DJIA 2ECOA 1U0GA 2RGEA 2VNKA 4ITVA 5JRDS 2DR2A 4PFJA 1JDJA 2CKDA 5F23A 1E0JA 4DG9A 1ZR2A 2I4MA 4XGIA 3PQCA 2MU1A 1SU7A 4G56A 3HDQA 1KQOA 5BURA 1WB4A 4I2VA 2PX4A 2HBYA 4KE8A 4WN9B 2R96A 3SD7A 1C3EA 2OOKA 4F06A 4RDCA 4HAVA 5F5NA 5ALIA 2WHRA 3ZY2A 4H6XA 4F9EA 4RHEA 5IM4F 3I8OA 1OYWA 1PWXA 3AU8A 1M8FA 1FYWA 2ZYIA 3EXHC 2BY4A 4Z0HO 3Q7IA 5AKLA 1I1OA 2HDHA 3GG9A 3BFVA 4XSHA 5I9NA 1X7ZA 1V0JA 2PKWA 5TLSA 1OZ0A 1R6XA 3U0BA 4JI6B 5UKDA 4LDQA 4ETWA 5LQJA 1HT2E 2QYOA 4JB8A 1X3LA 3LC0A 3WLJA 3A4LA 5DTIA 3E81A 4YCLA 1O6BA 4HTFB 1UT8A 1U6IA 4GI2A 3W04A 5ITVA 5K3CA 2IK8A 4G4SO 3GUYA 3ZBTA 2FG7C 4BGEA 1KMMA 5IVHA 4TS9A 4H7JA 4WEOA 4AO8A 1E9RA 3NHRA 2EZ4A 4NHEA 1BXKA 3N0TA 1HE4A 3JQ9C 3EXFB 1EUDB 1CRWG 2WA1A 5A0FA 4ASUA 4XSVA 3HRKA 3V8RA 2WU3A 4JJZA 4YRQA 4KVGA 5C4IA 1Q7EA 2ZM5A 1LBIA 3D0KA 3DL2A 3NB0A 4NAVA 1WXFA 4HV4A 2XTJA 3E58A 5BWCA 1ECCA 1D2EA 2UV8A 2ODAA 2IQIA 3MWDA 1UJCA 1W8DA 2GHTA 2AYYA 2QZ9A 4P36A 2ZRKA 3MSCA 5DCLA 3DL4A 3ZHBA 4YONB 2C4VA 4WN3A 2I2FA 5KHOC 1EP1B 1T8YA 2ENUA 3ZXSA 2F9MA 1G55A 1RRVA 2Y2UA 4FEEA 3QVKA 1P4JA 3QGMA 3B5EA 1OV6A 4QDKA 3WWDA 1Q84A 5KJCA 2PMDA 3B9BA 3OQNA 1B42A 3BPSA 2VDJA 3PNBA 1M8KA 2X8LA 1ML3A 1DX9A 2WZDA 1TIKA 2ZJ4A 3L1UA 3H83A 3QFTA 3U3KA 4C3ZA 4TMYA 4ALMA 3X3HA 5KJEA 5HGXA 1PJZA 4JR1A 4U7GA 2K7ZA 4D79A 1NRXA 4C7JA 2H2HA 2X5NA 3E3LA 3F5SA 2IPAB 3DLIA 4YIHA 3DLBA 2VLBA 1M6WA 2EV9A 4DXDA 3B70A 2JANA 2JAXA 3DDSA 4ZJYA 5E38A 2HH9A 4JYZA 4TMWA 1GFZA 2PZGA 4H1HA 4YC7A 5CT5A 1XNJA 2ZAMA 1ZS9A 2W9XA 5ADUS 1RIFA 4OHVA 4YCAA 4D0RA 3B9PA 2PLNA 3DDHA 4TKUB 3FW1A 1SY7A 1P45A 1PR0A 1SUEA 2DU8A 1XZNA 4P4UA 5J2UB 3C7TA 4LZJA 2OHJA 4LGMA 1SOUA 3PCXA 3K09C 3TDMA 2JLWA 2FSGA 2Q9UA 4GX2A 4KQMA 3CEPB 2XEXA 1GZ4A 4NZOA 2YJZA 5ERYA 4ZU6X 1YK0A 5I7VA 3ZBQA 2R1UA 5ES3A 1VCIA 4ZYTA 5E0OA 1G18A 1LPOA 2ZIGA 2W90A 3L43A 2AK3A 1XTQA 3N2KA 4WL0A 3L84A 2R7AA 3QF4B 3TAUA 1E5QA 1FU7A 4DPKA 2UXBB 2Z4TA 4E31A 2GVZC 4ZU3A 2RHHA 2WWYA 1KGDA 4BQEA 2VRCA 5LUBA 5CD9A 1BZYA 1SUAA 3FJOA 1KK1A 3OC0A 3KR1A 4LJ6A 4TMKA 3TLXA 4BJ3A 1L4YA 2FLWA 3L77A 4K9SA 5FB3A 5TS3A 4ZXFA 2PY6A 2GNOA 4N48A 3R0XA 3VHLB 4I8XA 1CLUA 1NUUA 3H5OA 1TM1E 5HX7A 2EG5A 4NJEB 4ZEOA 1NXVA 4Q7LA 3N7TA 3M6IA 4HJXA 4MS3A 3NW9A 2ZAYA 3Q88A 4QASA 4RK4A 4XJVA 3HVUA 4R05A 2CBGA 3WXMA 2B6HA 3NTXA 2I71A 5AKGA 3FYTA 3L5OA 5AK3A 1MX5A 2QMUA 5CIQA 2Y77A 3K5WA 4Q3LA 4YT5A 3RJZA 1Z18A 1JQLB 1Y37A 2ZS9A 3ZWAA 4JROA 5EUCA 1QYIA 1WVIA 2H59A 5SYMA 4BKUA 1EGAA 2A78A 2Z1DA 4HAUA 5KNCA 4Q66C 1HX7A 1DZ3A 1GQSA 1MBZA 2CCGA 4NBTA 4HLCA 5D5HA 4CMIB 3IEPA 2PYIA 3NVMB 1NYRA 1BYUA 2TMDA 2ZYGA 4GM1A 4FCVA 3ONNA 4KQGA 4MCJA 3S5UA 3SGLA 3T9AA 2XNDA 3JQAB 1XP8A 3P32A 1PEAA 3W5JA 1W36B 3FSGA 5L8VA 2RGRA 2QTZA 2OUKA 1AQLA 1DDOA 3U4CA 2JZCA 1P9OA 2JJ8A 5L9AA 3DVLA 4FZJA 5AFSA 2Q99A 2IEZA 3I9LA 4X44A 3GMTA 1SVNA 1R3UA 2DVMA 1D07A 2HF2A 3G2PA 3IJ5A 2F4NA 3K9CA 4OJTA 5EHGA 3TQRA 3Q5GA 5KYYA 2PGLA 2Q8QA 3QQPA 4YLYA 5JH7F 2XUKA 4X1OA 4J9UE 2JAPA 4H1VA 2XE7A 3FCUB 4MWTA 3GLIE 1YCDA 1KU0A 1SPBS 1NZJA 3ZDEA 1K8RA 3P8ZA 2VDVE 3RLIA 3HXKA 4M0EA 1UFOA 3G7SA 1A7KA 1OXVA 3JATB 3VX4A 3VR6D 2BEJA 1V9CA 1OLXB 5IM4A 1C41A 5EFZA 3C87A 4XWKA 1AUPA 1PDWA 5H68A 4I50B 1ESDA 2ZJ0A 1OAOA 1OIXA 1N2IA 1LX6A 1E60A 1RXYA 1YR6A 2QTVA 1E3DA 3AR5A 3RFUA 4EY5A 2XVAA 1I94B 3CO5A 3PRYA 3C41J 5DTQA 3MS4A 3DJFA 3NBMA 4UE3S 3TOSA 2JFYA 3HB4X 3OP4A 1JEJA 1LJ8A 1PE0A 2DM6A 4ND4A 5CX4A 3K71B 3D6VA 2BFAA 4B46A 2CNWA 3L6OO 4DN6A 2W93A 3KJGA 5C51B 3H2BA 1HK7A 4BZXA 4GPBA 1R6BX 2RARA 3U48A 1L5VA 1OZFA 4PPGA 1V26A 2BMAA 1NASA 4P5DA 1QX3A 4PC2A 3WQHA 4RY9A 1HMPA 1TJ5A 2XDQB 4L9AA 2UUAB 1ESMA 3QJGA 4FC7A 4ENWA 4RL6A 3OZWA 4JGBA 1Y6ZA 4YRTA 4ESHA 2QD2A 2X8JB 4O5AA 2RAPA 3U81A 4OAOA 3PR2B 4ID3A 4MYUA 2PBLA 4I4TA 4FGWA 4JC5A 5BUQA 4KIJA 4XLTA 2P6RA 5KWIA 4QGAA 4E5VA 1MAUA 1T36A 4G07A 4B32A 2BR4A 3OQIB 1GADO 2GZ2A 2O2XA 4YMGA 2DFLA 1OI3A 1RTTA 2FN3A 2P0AA 2OLKA 1R0LA 5IKMA 2E21A 3GJ6A 4MWBA 3WGTA 3CX7A 5IRCD 4KVFA 1DV2A 3SBXA 4HF7A 2BIFA 3E4CA 3JQRA 2XTNA 3JZIA 2O0JA 3GRAA 5K8IA 4DJFC 3SM9A 4G65A 5AW9A 3LKZA 2ONKA 2JFUA 4K8RB 1XWIA 2IZ6A 3EG9A 3FTDA 3MJDA 5B30A 4J1SA 3VU9B 5MFPA 2DH5A 1P9WA 3FUCA 2PPVA 4EW6A 1RXWA 4IJUA 3NHAA 1IZ0A 3OCYA 3FUTA 2ECFA 2CHUA 2IL1A 4FVTA 2CDNA 5LD2C 4URUR 2SKEA 4TT3D 3D2BA 3KKEA 4Y9SA 2ONZA 1PZXA 2VP9A 2WJJA 4UW9A 1ZNWA 3C3KA 4PRKA 1W30A 5JAMA 1HE1C 2XXAA 4PHFA 1E6CA 2O8EA 1XZHA 2WAAA 4G5RA 4V0MA 4PLGA 4MV1A 2XGGA 2VP5A 3LNCA 3LLSA 3NPMA 4PQRA 1PEDA 3EASA 2F3UA 1SVKA 1W2HA 4TM7A 1EXNA 1NU8A 4WNIA 4XASA 5DYYA 2P65A 3IPAA 2ZT5A 4EBBA 2IYEA 1KC3A 1R4NB 1EWQA 4OUDA 4R3NA 3CIOA 4PBRA 4B8ZA 3D1LA 3KYBA 3FPCA 4B6JA 2JARA 2FZ5A 3FPHA 4RJIA 5FWAA 4C04A 5B64A 4LF9B 5IJWA 1P5JA 3JAWA 1Z7YA 4DBLC 2PBRA 3GG2A 4J6EA 1I9CA 3T7AA 1ZNQO 4EGFA 2FPPB 3M49A 4GMKA 4PQYA 5CTAA 1JF8A 13PKA 4ZI7B 5KPDA 3N6RA 3OHPA 2JGDB 2Q21A 2WWGA 4JJFA 1XPUA 4X8MA 5K3AA 3SC2B 3X1XA 1UBOS 2O6LA 2P8SA 2Y1GA 2QLMA 3UV7A 1CY0A 3IRVA 1Q22A 1OAOC 3PWSA 3ZDQA 5LBTA 4BUZA 4KGXA 4JOSA 3R09A 4BDSA 1UQTA 4YXWA 1Q16A 1YZ3A 4MPDA 1Z38A 4GECA 3FN4A 4L9WA 4RXTA 5EINA 1QNLA 4IZIA 4PG7A 1XEWY 4V0QA 2E1PA 1G9TA 1BG6A 3NGMA 5EP2A 2VL7A 3SFZA 4BP9A 2IYFA 1OPXA 3IILA 3LUJA 1B0AA 2WIGA 2FJPA 3Q9UA 2BFBA 3VPDA 4CLDA 2H2DA 3GARA 2GZ3A 4G0XA 1OV4A 4PVCA 4QG7A 3I45A 2XF8A 4BLUA 4EHDA 5IT0A 2ZUBA 1T2VA 4ZKEA 4RIHA 4OGWA 1YHYA 2ESRA 5KTYA 5DK4A 1NNUA 5COAA 3GJ8A 5EWJA 2HRBA 2R5WA 3WNVA 3T3IA 1EFPB 2HFJA 1KZ9A 3COYA 4FXOA 1DADA 1CX9B 3DZFA 3RYCA 2DETA 4UUAA 1V43A 2X4GA 1L5GB 5JYDA 1I3OA 1E2BA 4Q48A 1M8PA 1P61B 2H1HA 2FEAA 2C4HA 3QV1A 5JZ9A 5TIIA 4E2WA 4BL5A 3MLEA 3TZHA 3JALA 6NULA 3FPBA 1B2LA 3BQMB 3NDRA 4CIWA 1SUCA 3GIDA 2HNKA 5FQNA 4F5ZA 3EC1A 1A9RA 2D1SA 4EYSA 4X20B 4EJ6A 3S2ZA 3LZCA 1Z8DA 1L7VC 3M9WA 5I4BA 2MOKA 2PWBA 3BGOS 1ZK4A 2GEDA 4MVWA 1CC1S 1ZPDA 2I6UA 5BSEA 1R0WA 1DARA 2DH6A 3Q3GE 1VE1A 4LVUA 4XR9A 2V74B 1VHDA 3FVQA 5L51A 1K7XB 3HDHA 2ZJ8A 3LTEA 3B7GA 3H3XA 4RTOA 1DUVG 3LYHA 2OPHA 4V24A 4FN5A 2A1UA 4WMLA 1FDUA 1G63A 3DP9A 1KMHA 4LHXA 1YR2A 2PKYX 1SNYA 3AB8A 4B83A 5JWHA 1ML4A 4CEIB 1WW2A 3E35A 3FLEA 3KOXA 4Y9TA 4RA6A 1JLLB 3LD9A 3OEED 5KDOA 1T6NA 4LNAA 4YRSA 3DBVO 1DJPA 3H1PA 1N6HA 4NCJA 4CM3A 5FHQA 1XMJA 4RSHA 1KEEA 2AQ8A 1JG4A 5D5QA 3EEFA 3RK0A 1ZD5A 1LQUA 4EGCB 3AEKB 4ENTA 1VFNA 4HDSB 1Z8FA 1YRYE 4PYLA 2EEZA 3UCFA 2ZTSA 3FPJA 1NW5A 4ENSA 1A9XA 2XW6A 2RKBA 1RPAA 3F8WA 4ZT7A 4DDKA 4DABA 4N9WA 2WYHA 4HLUC 1KJ9A 2RK3A 3CF0A 2ZVQX 1CS0B 4WOJA 5FBWB 1T8WA 3UOWA 2J59A 3VX3A 4EB0A 5AMXA 1PLLA 2AF4C 3BE8A 4Y6GB 1X70A 4EJ0A 1G66A 4CF5A 3ZQ6A 2QI9C 4E6PA 1BE6A 3ZKAA 4URVR 3C85A 1YVPA 1V96A 3KCNA 5D5PA 4EHNA 1MIOA 3PLRA 4Q4HB 4BFUA 1ZXLA 3PQEA 4KOAA 1E98A 1T43A 3GJZA 4XJSA 3X1KA 1CUUA 3P20A 2QR2A 4D9CA 1A4IA 1I4OA 3DOHA 1BVYF 5HR5A 1JFTA 2G17A 4PXSA 1CFZA 1H1DA 3MTAA 3L2OB 3Q9NA 1J97A 3KB2A 2X0KA 4V03A 1X9IA 4Q1DA 1QHXA 4LWPA 1J33A 3AERB 1WP9A 2KLBA 4BV9A 3MAGA 1PFUA 3D0QA 1K5GA 3QQ5A 2B4KA 4II2A 3WWZA 1BWRA 1YGYA 3GEBA 4F4DA 4Z4QA 1HOXA 1PZGA 1Z5WA 1JSCA 4YFYA 3RJ5A 4E15A 2YXDA 1KJNA 4LE1A 2CN1A 4LDAA 4XGNA 4JB0A 2V7QA 1CZLA 1G4UR 1W9HA 3CLUC 2IOYA 2V59A 3M7IA 5DHTA 3W7BA 3WI7A 1KI3A 1P2DA 2CXPA 3H87A 1D09A 1N2ZA 1UDWA 3OTWA 1GR1A 2A4MA 4J2OA 4LHZA 3HWRA 1MRZA 4IRXA 4Y1FA 2FW6A 5H81A 2GLTA 3B2EA 4BLVA 3IYLW 1WNTA 1HRDA 1O97C 3ROEA 1P7VA 3HB1A 4MHSA 2VWQA 4GKAA 1FVFA 2P9GA 4OXIA 4RETA 4CL0A 5IMSA 3D3QA 1EWYA 1ATZA 4RGYA 4C7OA 4RANA 1WAMA 3PNMA 2V7XA 4IJKA 4U9IS 5JD6A 1RLUA 2NYUA 3INYA 3TL2A 1RC8A 4LV8B 1GDTA 1RWPA 5HF6A 4HXFB 3LPMA 3TNJA 2VQDA 1N5MA 4ASUD 4CQJA 5AXBA 3ODGA 4J0KA 4PC1A 1BGXT 3NV7A 2C0PA 1SZPA 4M9SA 2PFSA 2JFWA 3N3BC 1AH2A 2Q9BA 1BXGA 2IPLA 4RD4A 3GOQA 4F3CA 2QXTA 2EATA 2ID9A 2R6ZA 4TTJA 3ND7A 2EFGA 3E9ZA 3V00A 4HGYA 4UU1A 5CM9C 2J9FB 2IY9A 1DTEA 1UMDA 1V7ZA 2GTHA 2ZU0C 3D4IA 3AJ8A 4IWYA 3KQHA 2X58A 4OJNA 3ES9A 1S2IA 2TRSB 3KLMX 4LDPA 4L5JA 5HRCA 4EI2A 1OH8A 3KZNA 5TGZA 1B8UA 4FCTA 3N59A 4YASA 3HH8A 2B1QA 3QSGA 3VTZA 1JEQB 1W8IA 2BJVA 2G7MC 4HUQB 5AUOB 4EW3A 4KKXB 4WVFA 3SJAA 1EM8B 2V54A 1EEHA 4ICIA 3DV0A 3H1TA 5EGNA 4L0DA 4RZUA 3A6KA 1JLRA 1XMVA 2FQQA 3WQRA 3WB9A 3BBLA 1QCDA 4A8PA 5L95A 2WU0A 4J0QA 2O2ZA 4RZ2A 5LIRA 1JALA 2NSJA 1Z75A 2Q0QA 1H2FA 1P7CA 3VKHA 1TT7A 2JHGA 1VLZA 1HQDA 1UT5A 2OV6A 2VYCA 3C1OA 3LUHA 2D1YA 1FLAA 2OG2A 4MDHA 4MHOA 1NVGA 4HH1A 2V7VA 5SV2A 1W1UA 4ENRA 1H9CA 2PZLA 2O8FB 4TQ9A 2FXVA 2LWIA 1TI7A 3MD9A 5DDIP 4PN3A 1WCV1 3VGJA 1C9YA 4NEHB 4G37A 5EFOA 1MA0A 2W8BB 3OZVA 2OBNA 3MCUA 4F92B 3OFKA 2J4FA 2AKYA 4Y7CA 4DV3B 5KREA 1JJVA 3QLVC 4YN3A 1M1YA 1CUFA 1HEIA 2JC3A 1T1GA 4A8HA 4GSKA 1A4RA 5CPBA 2I1VB 2L69A 4G24A 3U0VA 3M34A 3JAMA 1UKYA 2PUHA 2PGOA 4QPCA 1GXSA 2DBZA 2R8OA 2YWHA 1JIVA 3L05A 4NZYA 5KMGA 4MRPA 2VRCD 4MUGA 4YCSA 3FA2A 4JITA 4GI5A 3KEFA 4JUCA 4PGAA 5K9ZA 2HV9A 5JXWA 4XR4A 2VDNB 4BQIA 4UDXX 4RTJA 4NYJQ 1T13A 3C3XA 2H4HA 1Q5PA 3AESA 4NBRA 3OQMA 3S4YA 4KMOA 2OHVA 3EFHA 3G49A 5TQVA 1JWLA 3ENNA 1MO5A 2IOQA 3Q85A 1A8HA 3E18A 1PL8A 4O3MA 5JS6A 1WW3A 3G9TA 5DX0A 1GP2A 4G1UC 2AXQA 3TCKA 3VISA 1N5KA 5AHOA 3OH8A 4KO4S 3X1MA 3OY7A 4UTNA 3ISTA 2OXRA 2UZIR 4W5RA 1LVUA 2BGGA 2MHCA 5KAPA 4M9QA 4BV2A 4LI3X 4OHBA 1KE1A 3IUJA 1SB8A 1W52X 4J43A 5LZ8A 3B85A 2DUMA 4J3JA 4JGIA 1NA5A 5KNCD 2H9YA 1FMFA 3WJAA 4U2DA 4OBXA 3NHYA 1PK9A 2X9VA 5CT9A 3W2HA 2CUKA 2Q3LA 2BHSA 2WRZA 1WHSA 3B3JA 4EMSA 2B34A 2FSVA 2XNDD 1K08A 3AOEC 4IGEA 3UUGA 4CCAA 8AT1A 3VZBA 4EJSB 1ZHOA 1EDOA 1R2QA 4Q4CA 3I6IA 1NP3A 5BW6B 5CBKA 2FY8A 4I9GA 3RC9A 3VZDA 3H0EA 4Z6KA 2UZ1A 2YJTD 4IOMA 4KCGA 1KYXA 2ZJOA 4UXJA 4MV5A 2QAGA 3ZVRA 4DCMA 4HN4B 1DLJA 5CRIA 2FB9A 5GMOA 3ZE1B 4YMIA 5BW5A 2OBXA 5HG0A 2WJGA 3D4BA 4MVJF 3WNDA 1XFDA 2HK9A 1Z8HA 2SNIE 4ZRNA 5LR6A 3OE4A 4K9LA 3L1JA 5I47A 1NMQA 2OZPA 1QJCA 1SC6A 1SCJA 1SXIA 4RVUA 1P2UA 1RXCA 2OHIA 3X1YA 4XIJA 1PBNA 3DS8A 5FTJA 2ZR9A 4PS1A 4U7HA 3WGJA 3UCEA 4DDTA 4H16A 3A1UA 1KMQA 4OXXA 3HK2A 1CKEA 3HR8A 3M3PA 1JEOA 3VO9A 3VSCA 4O6VA 4N6NA 1T5LA 2IHUA 4Q6BA 5BY2A 1U0OC 4IIBA 4ZCTA 4WX2B 4Q3BA 2PSHA 1NW9B 1M5RA 2JJQA 3S81A 4BV3A 4ADSG 3BSWA 4QTYA 4QQFA 3VNBA 3OE1A 2CNWD 2IZ5A 2YY6A 4AP5A 1XL0A 3HVIA 3WX0A 1G9SA 1CVLA 1MLDA 1N7GA 2Q46A 1Z3CA 4DSOA 1Y80A 3GDFA 5B1EA 1ZMTA 3EVNA 5IUKC 1XAHA 4EYGA 4MEBA 4D7AA 2C83A 4HB2A 4DEVA 3AGPA 2EZTA 3ETDA 2O3JA 1LVGA 4INAA 3V4OA 1UZUA 2PV7A 2WPDA 5ICSA 1MJ5A 2CKMA 2JAHA 1ZGGA 2QUJA 4RVNA 4OQYA 3B8EA 1QFZA 1ZXXA 1H2ZA 3H2KA 5J5CA 3ZE9A 1ZH8A 3ZZ1A 4DA8A 2P77A 3HY4A 5FOXA 4Y0NA 1D6JA 2KS6A 3KD2A 4UD2A 3RUDA 1QTNA 3NWPA 4QU5A 3T3MB 5LUAA 4W5NA 2XTMA 3P4YA 2YINC 3LX8A 5IH3A 4GOOD 1ACMA 5I4IA 4LNHA 1OLSB 2GKSA 5FEUA 2P79A 3JQFC 3IAHA 5A02A 3QFRA 3I01M 5FEMA 3HYLA 1M67A 3TM5A 4UEQA 4PC7A 2O7SA 1A0OA 1GEEA 3ON5A 4ZIRA 5CCEA 4HQRA 1QUFA 2PZKA 3UTDA 3NFYA 2V7UA 3TJRA 1P39A 1J24A 1NLYA 1QMGA 1C9JA 2A5JA 4Q1CA 2V03A 4IHAA 4OLFA 2W6IA 4HAXA 1DI0A 1JDNA 2HEGA 1IC6A 2VC2B 3TLMA 1DOAA 3WWEA 3DB1A 4BB9A 1RW4A 4I2NA 4IDNA 2OA0A 3OKAA 4ODIA 3RRMA 3U4QB 1A71A 3C24A 2WT9A 5E1MA 5M3BA 3OQ6A 1T1IA 2YWRA 3MIIA 3OECA 4QBFA 5GAJA 1VSTA 5IXSA 3ADBA 4EFNA 3T3OA 3OBIA 3IP3A 2FOXA 3L0DA 2ZRFA 3LGAA 4WGGA 3ZDRA 3JRNA 2B7CA 1E61A 3KVOA 4RA9A 1UBJS 1JFLA 4HH3C 3CT4A 1TKAA 2ZB3A 4Y3UA 1VSUA 4M6WB 1L5OA 4RELA 3SLRA 1O08A 2QXUA 4TL6A 1RHRA 2B4TO 4KK4A 3G9ZA 3T3DA 1TO1E 1X1EA 2H5EA 2TMGA 3DBLA 2G25A 3RVLA 2IXBA 2PNJA 1XTBA 1MEJA 2K4MA 4AIIA 4ZJPA 3WQBA 2PAAA 5C81A 4DC1A 3QYAA 3FNEA 4DDHA 5AI9A 3RYTC 5WRFA 1ZWKA 3RTDA 1LLCA 4UAGA 4ZZ3A 3K4HA 2VT7A 4K6GA 4K2HA 1TF2A 1XN4A 1KY5A 2AG0A 2IXGA 3AQ4A 4MV9A 3VH4A 2PMCA 1CUSA 2R97A 1LD3A 4PO8A 1GPWB 3D3JA 1Z26A 3D7SA 2QKYA 4DIMA 1MZPA 1AGNA 1MXFA 5ERXA 2VDQB 5A1JA 1C1DA 1HQYE 2PQMA 5HJ2A 2FN4A 3ESRA 4RVHA 1P0IA 4L02A 2XUFA 4WEQA 2GN8A 1EYZA 3C0KA 3CC8A 5A4KA 1XZJA 5J23A 2GWHA 2PVSA 2BKAA 4GLJA 1DKPA 4HWPA 4A0SA 3RJMA 2JIMA 4C3VA 4DJAA 5C18A 3CZRA 3MCWA 3BULA 3EEQA 1YIAA 4FR0A 4YXWD 1BW9B 3CNHA 3QE2A 4KLAA 4L75A 4XVHA 4DGQA 2BE7A 1FYEA 1YZKA 2LKDA 4C88A 3DPUA 1A4UA 3HJRA 4PX9A 1KTVA 2GEUA 2B1GA 4MUHA 3OT4A 5CH3A 4DS3A 1DTWA 3N2EA 4GX0A 5F1YA 1EK1A 5KVQA 5B4VA 2ZRQA 4N8DA 1YUNA 3NYQA 3F46A 1H4VB 1H23A 1ZFNA 3PA6A 4EK9A 1ZONA 4OQQA 1JHYA 1WXXA 2HW8A 5ALUA 3QW2A 4QODA 1AVTA 1WHTA 1XDZA 2ZI5A 1TPYA 3MWEA 4YPOA 1XZFA 2ODBA 2GZDA 4QE3A 3P96A 5AVQA 2VAMA 3GN1A 3HV2A 2ZWOA 3WYDA 4D4KA 4PLYA 1E1CB 2FMTA 1QP0A 4DLZA 2J5RA 1JKMA 1KORA 3VVBA 4OQXA 3P9PA 3T7CA 3BRCA 4ARZA 1B15A 4EA6A 1FDWA 2M1XA 3JTEA 3IRUA 3CN7A 3HPRA 1GKUB 4RZQA 2PYDA 2PUGA 5JAPA 1E0KA 4GZ3A 4I9NA 2QL7A 8OHMA 3FNQA 2AX4A 2XUOA 3FJ1A 3IC5A 3FOCA 2IYZA 4MVJA 1TQ6A 4NNJA 2MYUA 3CG4A 3V55A 3AJDA 2NLOA 4XDZA 1QZTA 1L4LA 1UPFA 3UN1A 3KJEA 4WOBA 2DTXA 4ETMA 1PQWA 1GNQA 2BGTA 2EJVA 1JR3A 2GZAA 1Q1AA 3A3NA 3IUQA 3L8DA 4XVRA 1LW6E 1E6MA 1SUWA 4PO9A 2VTDA 1C8VB 4MW5A 1DC5A 4QUGA 3K2QA 4M1TA 4TWRA 5DZSA 1XTIA 3HZHA 3QIAA 2C4NA 5J1TB 1ODCA 1R0SA 1EXDA 4G01B 3P0JA 2MSLA 4LIPD 3TX2A 2FPLA 2OCYC 3T35A 2JLVA 3DO8A 2FQXA 4LWZA 1I5OA 1LZLA 5EZ6B 2NO4A 3VJLA 5AOAA 3WGZA 3RSHA 1NMZA 4KX5A 4WCFA 1B93A 3SYRA 3B82A 4AW9A 5CNMA 2IHBA 3QLUC 3EZ2A 4DMRA 3ZWDA 2ZLBA 4B6SA 3ANTA 4KXMA 3HU2A 5LA6F 5LOVF 1L4FA 3P5BA 1KR2A 1MZVA 5ALMA 3WP1B 1LSUA 1RJ9A 3AL3A 3M5PA 2ECKA 3CXRA 5C46F 4YJDA 1FNNA 2OC9A 4DE5A 1KDOA 1YS9A 3NKFA 4JEIA 4O2BF 1MNAA 2D4HA 2O8CA 1CQJA 3N05A 4I66A 5IDQA 2IUTA 3MHTA 3JU3A 5FR2A 1PR3A 1H2WA 2AUMA 2I34A 2NU6A 3E1KA 1Z4MA 4UUMA 4LF7B 3DOIA 4X84A 2Z04A 1WBDA 1UZMA 3GEHA 3EPPA 3T95A 4Q4JA 1DQZA 3NP9A 2POCA 5DYWA 3WMFA 1MHPA 4CM4B 2ZWIA 3CLRC 4MO9A 3THRA 4BGVA 1W59A 1XZQA 2IIVA 3A4TA 1GWNA 2ZBUA 1ZL2A 3IP1A 4FR2A 4M0LA 2YYZA 4KE9A 4OFWA 1C3VA 3SF8B 4BNTA 3MINA 4IDEA 4WZ6A 3K2BA 4L5CA 1ZRNA 4P84A 3D3EA 2PVPA 2F3PA 2IYWA 5JC8A 3CX6A 4BQRA 1E9AA 2Q2OA 2VRBA 3CPHA 3RW9A 1ZNYA 2QG6A 1SU4A 2QN9A 2YY7A 4JB3A 5FTMA 3O4JA 4D3FA 3FR8A 4NQZA 4DLKA 4R2IA 2HZBA 1Z37A 3EHDA 1ZMXA 2V7QD 3WNQA 5AKZA 4ED9A 3R3ZA 2BFCB 3G85A 1GRVA 3CCBA 2JEZA 4BXOB 2PHZA 3KXLA 5EIWA 1PT9A 2A0FA 1N8KA 1MX9A 2FP4B 2OCDA 2GVNA 3OOHA 1NV9A 1SA0A 2XV1A 3DUWA 1JJBA 5IVDA 3SOZA 2W2VA 1E4OA 2A1TR 1VL0A 2GDZA 3CRNA 3EGEA 2CE7A 4G41A 4NFSA 2ZUTA 1B6GA 3TYXA 4MPJA 3ZE6A 2I0FA 4L72A 3ZHRA 3KWJA 3ODPA 2HSGA 2I6SA 4A2QA 1PYOA 2PRZA 3B1VA 3LBAA 4E14A 5DX1A 1RZUA 5KNBD 3ZI7A 1FEZA 5JCOC 1X1SA 2A0XA 3E8XA 5D00A 3OZRA 3F7TA 3PC2A 5DKFA 3NAZA 5HPYB 4TXJA 4U6NA 2B4YA 3ERCA 3DBHA 3RSOA 1N2CA 1F7VA 3ZGXA 1DKLA 1JDUA 3AVTA 3FDIA 4ESEA 2DT5A 2I3DA 3K73O 1VKHA 4AI6A 4H4EA 1XD2A 1KIFA 5G53C 3C4JA 5T3YA 4E22A 1XQVA 3KFLA 1ISPA 4OHMA 1BKYA 3GZNA 4QPPA 3RAGA 4JA0A 3TMYA 3UEOA 1WF3A 4NDNE 4G4JA 4MGKR 3RVPA 1W46A 5LWQA 3TD2A 4QFCA 3FY4A 3UK0A 1TXGA 5JJIA 4JI0B 1LPMA 5C1IA 2ZRHA 3WWOA 2A9RA 3KKMA 1CCWA 1TMKA 4XDGA 3EZLA 3DZGA 3RT7A 2H0QA 3HZRA 4DANA 1MPXA 2MSEB 2OCKA 3ZI0A 1H5QA 4XWTA 1DBSA 2C5SA 4TQUS 3GDOA 2VQFB 2BDEA 4UVGA 3F3SA 1YQTA 3C7DB 4KQXA 2ZK7A 1ZIOA 5EY5B 2IUEA 4GL2A 4PNEA 1G5RA 2CVZA 1VCOA 1UXIA 3TLYA 1X0XA 1XNQB 2JA1A 5GZ1A 2HGSA 3BSYA 2XB6A 4MVYA 4NEGA 3ENKA 1A77A 1U4SA 1PCXA 4NMHA 4QATA 1ODLA 2H63A 2VUTA 3JQBC 4NU6A 3L1IA 3MMPA 4W7HA 2ZKLA 1SQGA 1M5UA 4EHFA 3RYIA 2QS9A 4XE5A 3D6UA 3DMPA 4R68A 5I7HA 3MCZA 3H4MA 3ELYA 2LR0A 3R24A 4S1VA 1WDLA 3M6MD 1F2TA 2X2FA 5DXFA 1VMEA 1GUAA 2WAXA 1H0SA 2D5CA 4GKKB 1J99A 1I3KA 3ZWCA 3EBPA 5HFJA 2ILVA 3D9QX 1LW7A 3HDJA 2VQSA 1HKHA 4QYMA 4ZVKA 1IZ9A 5KSWB 3HM9A 2PWAA 3E1SA 5K3FA 1NKVA 3PFKA 4Q9NA 1E6KA 1MB4A 1LY1A 2YWGA 3I58A 3LY5A 3L7KA 4LFCB 2OM2A 1U3DA 3DE2X 3TLGA 3D6JA 2C4MA 1QTQA 4AKIA 4HYYA 3GCDA 3E3OA 5AK4A 5A7GA 4UBMA 3WYEA 3AVWA 2Q3BA 1FUEA 3EFEA 1J2EA 1AN0A 3HMQA 1JKJB 1YRWA 4QOSA 3RQSA 1YI1A 1IVYA 3L8GA 3L9WA 5FO0A 5IT5A 1GOTA 2AJCA 5IPFA 4OIMA 3KLOA 3N58A 2UUCB 1S96A 4JS0A 2Z56A 4RD1A 1BU8A 2HF9A 1LNSA 5CDYA 3MAJA 5LMUB 3NIDB 1STOA 3K1JA 1NVEA 5ALWA 1RRCA 2RGNA 4GFDA 1OTXA 4G0OA 3GLFB 4RZXA 4INPA 3L7OA 1K97A 1BFDA 2W11A 2GAIA 1QVZA 1KK0A 4FLEA 5K3SA 5K0ZA 1JU4A 3S8YA 3H4VA 3L7DA 2OYRA 2HO4A 1A2KC 1GPNA 2J1LA 2FSPA 2J09A 1FFGA 2ZT8A 3FOAA 2O2EA 4DREA 4QU8A 3Q1LA 3AF2A 5F21A 3VV2A 4Z3OA 1W29A 2X6TA 2P6PA 3LDUA 4HMQA 1Y6RA 2RGCA 4ZOLF 2FPGA 2R3SA 5IC6A 5EJ8A 3SI7A 1RKVA 5FPYA 4O2BA 1FU8A 3NLLA 1OC4A 3SJZA 5JSUA 3GFQA 2QN1A 3A7EA 3IH5A 2QX8A 3H11A 2VPZA 4MW2A 1HYQA 2XUIA 4IV0A 4Y6OA 3DBOB 1M5TA 1ZP6A 4DJTA 1KAEA 6AT1A 1MQSA 4MR9A 3RASA 1K5HA 3T7TA 3ONDA 3NC0C 5THQA 4CDRA 4I08A 4UFOA 1JPNA 3H9QA 4Z9YA 2GJ9A 3R0IA 3VZRA 3F4BA 2BWJA 2GXAA 2F8TA 4B47A 1N2SA 3LY8A 3MGKA 1EK2A 1BFUA 4JSRA 2BR3A 1Y5LA 2BHRA 1UODA 3NEJA 2O8CB 3KU1A 1G8SA 3O4HA 5T7BA 3AFIA 3WMXA 5D3QA 3WGOA 3FFWA 3VMFA 4O4IF 5AXDA 4YYEA 1JQEA 4EB6B 1O4WA 1R27A 4LRYA 3RKUA 3S70A 5CW2A 4UC0A 4E12A 2HXSA 3HDVA 1V1MA 3CR3C 4KJZA 3IOYA 4RXUA 5KWVA 1H3EA 3ORSA 2EJCA 5JJLA 4ZQIA 1XCJA 2DXIA 5FUMA 2RHRA 3TAXA 4LTMA 1XOIA 3M82A 1OD6A 2EZ9A 3C1AA 1G6OA 4URHA 2GAOA 4EY3A 1IEWA 2GNPA 1RXVA 2AI2A 4OMFG 1PJRA 2A5LA 2YOHA 3QEKA 3E3MA 1RMQA 2EBUA 4M1WA 1UBFA 2P41A 5C8VA 2JLSA 3R8FA 1J56A 2WJZB 3F8SA 1PU2A 2KWIA 3UVEA 1U3FA 2R86A 3QH4A 4II7A 2NYVA 4RPHA 4TTPA 1PJAA 4MGIR 1TF7A 2JIOA 3JYPA 3FSEA 3A2LA 1P5FA 2HLNA 2PJZA 2WPDD 2YQZA 4C4RA 4E4TA 5JNUA 4YR7A 4EX6A 1E2MA 1E94E 1KSGA 5IF3A 3FSJX 3IVRA 4K1XA 3HEMA 4I6EA 1NXQA 2H08A 1IN7A 4LVCA 1U7XA 1YB1A 1NN1A 2JD1A 3FZQA 3V1YA 5CB0A 4YRFA 1G41A 4TROA 3IIJA 3SC4A 2X0DA 3X2EA 2YC4C 5J3JA 2BDTA 2RHLA 2TMYA 3NBZC 2DLNA 5CVCA 1XEXA 3TRJA 2VCEA 2KW5A 4CFYA 3V33A 2Q5OA 3ABQB 4EHBA 1X42A 1PJQA 4XARA 3DEJA 1SRRA 3BD6A 1YKSA 3PNPA 2AZ4A 2YMPA 1O5TA 1U2GA 4RH0A 1YA8A 1ZVKA 5EJ2A 3ZYZA 4FGJA 3H4TA 1YRHA 1SM4A 2W6ID 2QNRA 5E9QA 2CCKA 5FI5A 4BNNA 1IRXA 5HJ7A 1C7ZA 2A5FA 1USUA 1OXBB 2HQOA 3CCCA 2E4VA 4P3NA 4HZIA 3OTGA 5AOVA 1RMTA 3NVDA 1D6SA 1K3TA 1ZK0A 1RRFA 1G3UA 3GGOA 2REQA 1EUYA 3WGQA 4DMLA 1E3IA 4G0ZA 3U31A 1AM4D 4WA8A 4IDAA 1YTLA 3L1HA 1L4EA 2VT6A 1YL5A 4L7QA 3TJMA 3TTUA 5C3UA 1L9XA 1AQ6A 3DFFA 3OQOA 3VDXA 2V6MA 5EEGA 1GPYA 3PC4A 2WKRA 2G8LA 1QOZA 1JAHA 2VSQA 3FMFA 3G2NA 3LM8A 4CKBB 1G42A 4LYFA 4KK3A 3TVDA 4H60A 1RR6A 4M7WA 3LS2A 4QIHA 2QSJA 4CDNA 4EOGA 2R1TB 4G84A 1BGVA 3V2GA 4EFMA 1K0UA 2ASVA 3AU9A 3K5PA 3FDZB 3SDBA 3CBGA 3JD4A 2C96A 2QSYA 1PG2A 3FUWA 1NF3A 1P6QA 2WAYA 3ANYB 4HH0A 4IVQA 2HDOA 4ZV7A 4F38A 4TRMA 4QFBA 2J0SA 3AL2A 3WOHA 2VA8A 3BWYA 2O6HA 1T9KA 4HG2A 4L08A 2HLPA 4AQYB 3KR0A 4QYXA 5DGXA 3LC1O 4M49A 1NW4A 2WKWA 1ZEMA 4QDOA 4X95A 2VEDA 3N8KA 4HQOA 5FBZA 4JI7B 1UOQA 3CLRD 4JQYA 3IKMB 4OO3A 1WDTA 4XUEA 3MRXA 5ERGB 1U7ZA 4JVMA 4LJKA 3RFVA 3AP1A 4GP7A 2ZTUA 2H54A 3L7MA 4JASB 4DKJA 1KOGA 4LISA 3EA0A 2MSDB 5ALZA 2QT9A 1WMDA 3FGNA 1E7QA 2JKZA 2PMBA 4RS4A 5CLGA 3RADC 1LF0A 1Y33E 2XYRA 1Q91A 1O2DA 2F00A 3JQ7A 4ONEA 3B6KA 3NIWA 1U6JA 1BE8A 1KP9A 3SR3A 3JQDA 2WUWE 1JB9A 4OHFA 5JDIC 1DRJA 1PW7A 3L7YA 2JBWA 2BF7A 1OI2A 2W2TA 3I3OA 3QF7A 4DLAA 6GPBA 6Q21A 1JVNA 2Y9MB 2ABWA 2W8ZA 4CL3A 3T61A 3BD9A 3IKLA 1CETA 2FMFA 2GK3A 4YO7A 1G8YA 1NURA 1R4AA 2MTBA 4CMKA 4MWZA 2HMUA 2C00A 3PDIB 1XL1A 4PXAA 1X7WA 3OD1A 1BMDA 4R8RA 4Y2YA 2H52A 5A4AA 3NHWA 5EJ5A 3IIEA 3G6WA 3QOXA 5JPCA 2NUTB 4IBOA 4K9MA 3OQBA 5EPUA 2UDPA 3W6ZA 4BPRA 1QG6A 4GMGA 3DH0A 1K7CA 1PGPA 1AKNA 4F7DA 1RXUA 3C5EA 3A4MA 4ECEA 3BIFA 2PIAA 5DB4A 4AKTA 5EP1A 3RS9A 1JBEA 1WZ2A 1WCYA 1VL8A 4MVJD 4IMIB 1U2GC 1YDHA 4R16A 5AM4A 5TE9A 4LKOA 4FUTA 4M1YA 4F8YA 1SBHA 1MF7A 2E3JA 1Z82A 2QMYA 3OU6A 5DN9A 3T1TA 1N5LA 2GBFA 4PLZA 1THZA 4MVJI 4CKCA 5CT4A 5A3QA 3TF5A 1JR3D 3NHLA 4OEHA 5J4KA 1W49A 5HP4A 4BNMA 5J4LA 3GJQA 2FX3A 2WDPA 3MGCA 2I4OA 3DTVA 3P2KA 4O4IA 4FDTA 1H4TA 3NTUA 4AWAA 1PO7A 1Z35A 4YJFA 3THXB 3PJFA 3UIEA 3BWCA 2R6DA 1MP0A 2BM1A 4EG0A 1HLPA 1MB0A 1LV8A 4DZTA 1XTSA 1BMTA 3GJ5A 3F7NA 5FLXA 3YASA 4KLZA 1VG8A 1Y3DE 3PX7A 4EI9A 5IM5A 4D6YA 1QRUA 4LJ7A 5BWMA 3Q87B 2XQVA 2FE4A 2IYRA 4BWVA 1HDZA 2H16A 4D9GA 1F48A 2BFEB 2P0EA 4JC8A 1QTIA 3VU0A 4C06A 1U8EA 2EF1A 2R8BA 2XNJA 3IERA 3OWXA 1DBWA 4X41A 4NV3A 3K0FB 5LQRA 3D6AA 3TE7A 3HXLA 3VO1A 1OA1A 4IS3A 3KKPA 1QIIA 1CR0A 4GU5A 4MP6A 1OBOA 3VOBA 3FVRA 3WADA 5AXAA 4EVIA 5I7EA 1F2UA 1BNCA 2XMGA 4QAQA 1Z2EA 2IV2X 4F71A 2J3HA 2C20A 2KM1A 1ONBA 1VJ5A 4FHFA 4Y30A 5DNDA 1T2DA 4RJTA 3L6RA 4DR1B 2DCMA 4J1QA 2DAPA 3ZS9A 4ZICA 1GTZA 1TAHA 1OXKB 3TVYA 3AETA 4ZT5A 1ABEA 4FN4A 1NY5A 3PYMA 2QTGA 1JJFA 3AR9A 4CMAA 2Z8XA 2C2MA 1GGFA 3HADA 4ZTUB 3BXPA 1US8B 1NG9A 1Z0UA 4KZKA 4DRYA 3VPHA 1BX1A 3OZCA 4JJ8A 4MR8A 3OZFA 2W6QA 1I1QB 4JLOA 4YRLA 2AA3A 4AJ2A 3AH8A 4IP0A 1Y5RA 2WJ6A 1S2MA 4RORA 1O4VA 1Y3CE 5IJ9A 4OIFA 3F7OA 5BN3A 1LQTA 4N5IX 3A6PC 2E82A 2OILA 5CJ2A 3HO1A 1N1MA 2C54A 5BQXA 1G5QA 1C3OB 4LF4B 2FHSA 2JB9A 3LI2A 4NMMA 1HI9A 1Z9BA 2AMJA 3T5GA 3TD6A 1YFZA 1NUQA 1NYLA 1OA0A 1DWOA 1VE3A 1WDKA 2FYTA 2QRZA 3B9RA 3OJEA 1OFUX 2ONYA 2RKOA 4M1KA 4UEWA 4UXHA 2A35A 4RFSA 4Q9AA 4JBXA 1LPSA 8ABPA 1T2NA 2FGJA 1X74A 3DPSA 2NU7B 5BV0A 3WWPA 2R25B 3ETGA 3R5TA 1QHHA 2WICA 5CT8A 3GHYA 3SFVA 4M99A 3KSAC 1GKIA 1XP5A 2ACKA 4ZMRA 3DCIA 1G19A 3N2YA 1YC2A 4JWTA 4LY6A 1GZ7A 2AJLI 4BLTA 1Y9ZA 3LPCA 3SQMA 2VKTA 1CR1A 1SKMA 5G40A 1L5YA 2Z2IA 3FZYA 4NICA 2A1TS 4B6PA 5HWSA 4UCQA 1OGJA 2KLHA 3ETLA 5DM1A 4CF3A 3RV4A 4LC1A 4EY7A 2I9KA 1LXCA 4LJSA 2EHJA 3WO1A 1N2BA 4NH0A 3E2PA 5HKOA 4TL7A 1KO4A 1VXOA 1Y4SA 4URFA 1HEUA 2GJSA 3RUFA 2VZEA 2J9XB 3CTPA 3KOZA 2GF9A 4I55B 4J03A 4UM8B 2CLIB 1AC5A 1MOPA 5D1NA 3WV4A 4B2IA 1KAOA 2H1IA 4U7FA 5BO5A 2Q7DA 3VO2A 5AI5A 4CT0A 4DT1A 2AKAB 1EQ2A 3L8CA 4MK4A 4YJHA 1XR3A 4FHDA 4P3PA 1JP7A 1R6DA 3UPTA 3GLFE 5CDHA 3I01A 2QRHA 1OF1A 2CXUA 3B2QA 1G291 1NIPA 3L0PA 4NV1A 5KWSA 4ZVPA 3SVZA 4MUNA 5FA6A 1OPRA 1Y4AE 3V46A 1P2GA 1ZM9A 1DAMA 2GAJA 2VJCA 3VKUA 4YROA 3OQVA 5BPFA 2PS1A 1KQFA 1CY8A 1OYOA 4WIAA 3UJCA 1X7GA 3ZWVA 3R9KA 1X7ZB 5AVXA 4IO0A 3TGPA 4KO1S 1J2TA 1VIMA 1XA0A 2VPQA 4PIVA 1YBFA 1R0CA 2WUVA 3IT0A 1D1TA 5J5VA 3FHOA 4Q05A 1VYVA 3QUCA 2KBEA 5F2EA 3SLGA 3HUTA 5MF6A 3SXUA 3GLVA 2ZJZA 3A70A 2XQKA 4XTRA 1KVTA 3DZHA 1FVHA 3T1NA 1RI2A 2IU0A 4CHTA 3O8BA 3DOJA 4LY9A 2AW5A 3FM9A 4XGRA 1JJIA 2B2XA 4RY8A 4S0ZA 2D59A 1IZ8A 2PVCA 2J5KA 1A5AB 1QPZA 3ZK8A 4LV5B 3QELA 4MQFA 2NYRA 5GP1A 4KI0A 4OXKA 3W2IA 4CBVA 2EIHA 2Z2YA 3A3YA 1I4DD 3B3QA 5JZVA 3GJXC 1A96A 2J07A 3LWDA 2ZB2A 4COOA 4CLOA 3U7EB 4R31A 3U4DA 3AJ9A 5IUNC 3GV0A 4W1RA 2CMGA 1ZSVA 4CHGA 1L2TA 5EG5A 3R75A 2LDBA 5EGSA 1T8RA 2ZB8A 3UANA 5ESWA 5F1OA 4F91B 4YTEA 1Z0DA 4UZFA 2AYZA 4QYIA 1BQ3A 3LX6A 5A3SA 4FDLA 4XOIA 4DRXB 3Q98A 4RLSA 1U1EA 3V5NA 3QUSA 4U8HA 5B2ZA 1H94A 2XBUA 4OLBA 3VSAA 4D6XA 2PR2A 1Z33A 1BE1A 3RYFA 3ZZNA 3L7AA 1F8UA 2I4NA 3HYCA 3JV7A 4GW3A 4EDFA 5ELLA 1FB5A 3A2KA 1CWUA 1KP3A 1GGEA 2OCAA 1ZRSA 3I9V1 4H9GA 1MT0A 2LV8A 2W5UA 1HZZA 4P86A 2OXIA 3VU1A 2LE0A 1CF2O 1J70A 3OUTA 4DLXA 4WY5A 3TI7A 4DXAA 2WF8A 2Q2WA 3EVFA 1HDIA 3KBOA 1PYDA 2EARA 2RHJA 4DUYB 1F8YA 1I4EB 3CURA 4FJ2A 3W34A 3WGMA 4P7BA 1W581 2FEKA 4YACA 1JNYA 4EI8A 5LLSA 2NTYC 3R6LA 1I7DA 5JRJA 2CBXA 1YQDA 2E7ZA 2FOIA 2EKZA 2HBRA 4P93A 4TWJA 3RRBA 3FWZA 4D43A 5IWAB 3O47A 4EPXA 4LDJA 4AKEA 2P9YA 1QM5A 2E4UA 2D7JA 2WFLA 3DGFC 4OGGA 1BN6A 3FAZA 1R66A 2NOAA 3LF1A 4KV9A 5IZCA 2IX3A 2DFPA 3EPRA 5L45A 3N2KB 1EX9A 2ZFUA 1P4RA 2D2IA 3ZQ4A 1FFXA 4IDPA 4O1MA 1ISFA 4U2EA 5MHTA 1TD1A 1LSJA 1R9GA 5HRAA 1E3JA 1AUOA 3FIJA 1YZLA 2FTKE 2CFCA 5HIJA 5GQSA 2X9NA 1EWRA 1TB4A 3B1WA 3SIWA 2ZJ6A 4RSRA 2OL4A 4HH4A 4MS3B 1V6SA 2FQYA 2J5XA 1DB3A 4NFHA 3SOPA 5JPDA 1B00A 1XZEA 1JPUA 1PFGA 3DHNA 2SCUA 5KTMA 4AF7A 1ZUD1 4EFDA 2WF6A 4Y1RA 3K4QA 3QPDA 5KINB 1RM5A 2QOEA 1NOJA 4GZLA 4JYAB 2R8PA 4NCIA 3ACDA 3NZEA 1ABBA 4E1AA 3ZC3A 2FZKA 2P75A 3T34A 4KQFA 4PYKA 2I2CA 1GPLA 4TVBA 3T3HA 1H5NA 1MX3A 1MJGA 4ENVA 4CQMA 3K1AA 3G2IA 2V6JA 2O8BA 1X92A 3MLBA 4G09A 3JASB 4IRMA 2FPRA 4X8LA 1QYDA 2J3LA 2HBZA 2B7LA 3HABA 3A06A 2G6BA 4C14A 4Y9UA 1ILWA 1EA5A 1E4EA 1X0VA 2GCGA 3GPCA 4MPRA 3VOSA 3DHWC 1UFRA 2PLAA 2DC1A 4MAMA 2EHDA 2W4MA 5DXJA 5KYYB 2ZWVA 3FBWA 1YQXA 4UDNA 5DNEA 4QULA 5EHIA 3K8QA 1M2GA 2ZBFA 5FI0B 1E7WA 5KHLB 4KN9S 1BFKA 4TXHA 2XY4A 1G3IA 4C03A 5EPOA 1IK6A 4RMJA 1HO3A 5K3BA 1G6Q1 3U26A 1ISHA 1Q21A 1G5PA 3RARA 2V45A 4C29A 4NU5A 1GRCA 5LQNA 3SS8A 5SZHB 4LFAB 3G68A 4I4CA 4QFMA 4CL8A 5CMLA 5BOVA 2FPSA 2OVBA 1RBQA 2QTVB 3DCJA 3DNFA 3GHHA 2G4VA 4OG2A 4C9BA 2UUBB 5DNVA 1PSZA 2G4LA 1LK5A 4P33A 1WCIA 4IJWA 1WUYA 4ETIA 2BGJA 1T1EA 1TVKA 1Z5UA 2EYQA 4B87A 5A3JA 4CF7A 3KDSE 4IQFA 5BYKA 2BN4A 1KVQA 3PNSA 1M8GA 3EVEA 2HXYA 2YZ7A 4MJXA 4IHQA 4W9MC 5KPJA 2XVMA 4C87A 1WY5A 3E23A 5H3LA 4RZSA 4MUEA 1Z15A 4JDUA 4MKFA 3RVDA 1AV7A 1MA3A 4B5KA 3G8AA 4XVCA 1N6NA 1XF1A 3OE7A 4DMCA 3AJEA 2QD3A 1EEXB 3EW7A 4O63O 5AJUA 1Q3HA 4MKGA 4C78A 4C01A 3K9FC 1XZPA 3FI0A 4FFOA 4Z8XA 1A9TA 3GLHA 1E2LA 2QV0A 3WK9A 1I8TA 1TQ8A 3A9UA 4I4TB 2IP2A 3NONA 1QFMA 4IKEA 1JEDA 3NQ41 5AW7A 1WB6A 1T36B 2MR5A 2ODPA 1SIUA 3VTAA 2ZAOA 3GLKA 1S3SA 2VA9A 1XMIA 1W2WB 3OM8A 2YV3A 2AJDA 1ZICA 3UW1A 4ZQEA 1AGXA 2XMDA 1VL5A 3M4JA 5EVJA 1SU6A 1WZEA 3H6HA 3U3RA 3FPSA 1S89A 2YCBA 3BFXA 4MLDA 3FB1A 2PKCA 4B3FX 3EODA 1LEHA 2WMYA 2D0DA 4JJAA 4PSCA 3EG9B 4YVFA 2PUDA 4E0BA 2DQKA 3MERA 4DDMA 1VMKA 1FNDA 1RYFA 1V8ZA 1IB6A 2IITA 2WWTA 3AI7A 4FYJA 4WY8A 4CFSA 1KRHA 5H4GA 3AB3A 5EJIA 3TLEA 1JBQA 4RIGA 3HGMA 1OR8A 2ISQA 3GJYA 4KWHA 1VBNA 4B73A 3KFXA 2HB6A 1NW6A 2GO7A 1XPRA 2ID7A 4GEGA 4Y2PA 4IKPA 2GPSA 2ORIA 1KJQA 3D8NA 1FNMA 1JPJA 4BZPA 1VFPA 2BUCA 1K06A 1NJGA 1NNSA 4KACA 1ZD1A 3RAJA 3N5KA 5EP4A 3TO5A 1HT1E 1E1YA 5IJAA 1I1NA 1YJCA 3ZNPA 5AYVA 5ITZA 1ZK1A 3OZEA 2KMLA 3VUEA 4BNKA 1VJ1A 3DL7A 4GP9A 2V96A 3BMNA 2JF0A 1YNOA 1HL7A 2Q1SA 3FPGA 1JXMA 2XDWA 1YE5A 3BSSA 3KXKA 4OUDB 4J4TA 3X1WA 4V2UA 1KZ6A 4TN5A 1NNEA 3WJ2A 2I6GA 2XNKA 2YV4A 4B6FA 4YQZA 1CU1A 5I8PA 1DBQA 2IT1A 2CD9A 1OXTA 1Y42X 3OIFA 3P2IA 2F9LA 3X44A 3T1HB 5DHRA 1SCUA 2ZZNA 1MB9A 4QQNA 3GRKA 1L3CA 2QG9A 3HB7A 5EUMA 4I1RA 4LJ8A 5FPKA 2GUGA 3C97A 2JGKA 2YYYA 3PC8A 3TGWA 1FPQA 2DPMA 3UZUA 3GPBA 4JYMA 3JYOA 5BYAA 1RWKA 4JT8A 1IN6A 4AULA 2OORA 4TKLA 1E4YA 4Y98A 2BSXA 1M6HA 3B1ZA 3FGZA 4OF4A 1N1GA 3V3KA 4CM7A 1JGTA 2Q6OA 1T8SA 2VBGA 1CZKA 3BK2A 4MW7A 1NN3A 4R9SA 4RHUA 1DBRA 5A6SA 1YIOA 1PS8A 5DRTA 2IYNA 2IZ7A 4JMPA 2BFBB 1L4UA 1R9JA 2GRAA 2YHAA 3M1IA 4LJYA 1ZH4A 2C1XA 3O4GA 5AJXA 1XKXA 3KYCA 1F20A 1PUXA 3LOUA 1DAFA 1GARA 3H3JA 3B7WA 1A3CA 3OZXA 1V45E 1SG0A 3A0RB 4FX2A 4ND1A 1ZVJA 4C7VA 5FX2A 1EAYA 1I6MA 1W4RA 5EWJB 1F4PA 1IMOA 4PANA 1KDPA 3O4VA 5I9IA 1OY1A 1E4VA 4IDBA 3NRBA 3DFMA 3K3PA 5BUSA 5CFPA 3QV2A 4RK0A 3GN2A 4GF5A 3DMRA 2WU8A 1K1EA 3K9QO 4POAA 1R0XA 1HFJA 4FQ8A 4B3IA 3ZWKA 3V4RA 1M2KA 4ZOEA 5KOHA 1Q95A 3JALB 3Q3VA 1DC6A 3WRYC 5KQPA 3IE1A 2CNLA 1WWKA 2ID4A 3I5MA 5ADWA 1KR5A 1PNTA 4EKDA 1U0SY 1PL6A 2I3AA 3EPKA 2DPLA 1DT5A 4WK2B 2ADFA 1XDUA 2VTBA 1L5FA 1A95A 5I01A 5LN1A 2YN0A 1KJWA 4CF4A 2FXIA 4KHZA 4QARA 1XK7A 2P8JA 1F9AA 1HSZA 3II6X 3PC3A 3OMLA 2VOEA 4JI3B 4ZO8A 4CUZA 2UYYA 1RCFA 3BHJA 4LX8A 5AW1A 2A1UB 5JS8A 1F1BA 3R0QA 3SXPA 1GPH1 1KMHB 4BMPB 4M53A 2YRXA 4RKYA 1J23A 5LQSA 2CDCA 3FCSB 3VR2A 1O96A 1AA6A 3I6BA 2NXEA 1AQJA 1ECBA 3FYUA 4OKSA 1SVLA 2Z5FA 3KQKA 3H2JA 4LZOA 2BV3A 4YAUA 3CSUA 3F6PA 3E5HA 3BK1A 3VUFA 3P94A 2YHIA 1KEEB 3MWLA 1SUPA 3GEIA 2AIRA 3ICCA 4OAPA 3V4VB 2OBMA 4NK4A 1JDBB 2RGUA 2DQYA 1OFTA 2KPOA 4UE6A 2V5VA 1NQWA 1DIOB 1CUHA 3F3KA 4MRRA 4WOPA 4DZRA 1XN1A 4O8CA 4UTZA 3QPUA 2DP4E 3M5WA 1A9XB 1RQXA 2YZ2A 2IV3A 1T8UA 4BP8A 3AM5A 3H99A 3LFHA 4F8JA 4G1FA 3BQNB 1IM5A 2RI6A 4JJKA 1I30A 4PSKA 3OZAA 1DSSG 3NVAA 3QYJA 4TTSA 4WLFA 3IVXA 3LCRA 1KMCA 2BTOA 2YMMA 3K6JA 2WP0A 2HJRA 3O7WA 3ROGA 3RRJA 3W5HA 4YP1A 1MIOB 3H0CA 3WE7A 3I76A 3KPWA 4P82A 1F38A 3E22A 1N7IA 1CDZA 2GK7A 5JBIA 2AN1A 1U2SA 2H1FA 2LUOA 3FYSA 5FUWA 3F98A 4DWVA 4WZBA 2WMOB 3DDUA 4F1JA 3JQ6A 3RBVA 2JGMA 1JZTA 4J0GA 5HE9A 3TM4A 1VIDA 3LKVA 2UYCA 2HWKA 2VNIA 2WD9A 3QXCA 5EMKA 3PP8A 3KUKA 3DNMA 3DMTA 5CEJA 5TQ2A 4BNZA 4W9RA 4MV7A 4QELA 1IBCA 1A9PA 1JBKA 1PHRA 1S8AA 5DCWA 4ZHQF 3UJBA 2VEOA 3IUYA 2BVNA 4X1YA 5LP1A 3JAKB 4J94A 3CZ5A 221PA 3ZZTA 2BYTA 4L15A 2A0WA 1VKRA 3DO6A 4PPQA 4Q0MA 5FOQA 1RP7A 3O74A 3ME5A 4JXJA 4TV9F 5F7XA 3PQFA 2WNHA 4ZVNA 2AYXA 3ZJ4A 3B60A 3BVPA 4GZ6A 4C7OB 1X8XA 2JEYA 2NUPA 2VO1A 3PHJA 3RAFC 2Q5IA 3MT0A 2JFGA 4KXXA 3KV3O 3BMOB 4BTEA 3O4IA 2PZJA 3ZD9A 2XGJA 2WJYA 3KQSA 1Y3HA 3PQ8A 3DEZA 3HBMA 2WM3A 4LOHA 3JYLA 4L4ZA 3ZE0B 1Z6GA 3A9VA 5AICA 1Z73A 2Y4NA 4D96A 1WPRA 1BSVA 4H3KB 5E95A 3LBFA 4QXOA 1KI8A 3C7CB 5F2NA 2FE1A 1BXGB 3K1ZA 3O3OB 1N9GB 3UGKA 4PZDA 2WWHA 8MHTA 2QP4A 3O8LA 3RVBA 1ELOA 2PLRA 1TJNA 1UJ2A 3FFTA 5IUJC 2AN4A 1UMDB 2JVKA 1P9LA 2C9DA 2EQAA 2ZWMA 4W63A 2WTUA 2XWPA 1QB8A 1XZIA 3A1TA 4O2AA 1VMIA 1T35A 4WBNF 1QG2A 2N1BA 2OAQ1 5C8ZA 5L4LA 1M1NA 2I3GA 3E7FA 5TMDA 2G1PA 4KE6A 4B9EA 3E7DA 4BWYA 3TECE 1FTYA 1PGNA 2HA6A 3BIOA 1EPUA 2X9GA 3HR7A 3MOGA 1NJFA 3NUQA 3UV6A 5SY9A 3T94A 2WIJA 2IYAA 3DV0B 3NKVA 1ZKDA 4ZVOA 4WI1A 5H83A 4WA7A 5C8XA 1XHEA 2QW0X 1C0LA 3H5RA 5K1ZA 5TX7A 3ZVNA 2V1XA 3M5CA 2A7XA 2H57A 4IO1A 3WYCA 1VHJA 2PGXA 5KSOA 2NZJA 5E2BA 2C2OA 4FLMA 1U7WA 4KX3A 2EQBA 4US1R 2DKNA 1U2TA 1XVIA 4UU0A 5IVKA 2OQRA 3NT4A 1QVAA 4EHKA 3UK1A 2GN1A 3ZU5A 4MS1A 3SBEA 2R0QC 1SC1A 5TT1A 3EEIA 4KXUA 1Z2DA 2Q1YA 1HNXB 3IHTA 2QA5A 1M1YB 3B5IA 4XPZA 1SR8A 2QN7A 2BGKA 2HYIC 4LYYA 4RJJA 5EEHA 4S0XA 2FG6C 1QNFA 4F60A 4J7UA 3ECAA 1GXSB 2IIQA 3M33A 3CKMA 1E1QA 1HURA 3PL5A 4NZPA 5DSZA 4EFLA 5KMGB 4M0KA 2RBGA 2QTWB 3CSSA 3STVA 4RF2A 4DR7B 1RVV1 4IV8A 1H3FA 4MI1A 1QGOA 2ANBA 3PGLA 3KRTA 3PGMA 5JQWA 3AESB 1IPHA 2NNWB 2H7XA 2MYPA 2A3NA 2GS9A 1NHGA 1VTKA 4D9IA 5B2EA 2O8NA 2ES4A 3DA8A 3LLUA 4KBGA 4A03A 1YFLA 1E5VA 2C29D 1EBBA 2WWXA 3PSHA 1HWYA 3ACBA 4FXPA 1YFKA 2BEVA 2RDMA 2SICE 3ILVA 4M76B 1O94A 3BE4A 5TPZA 1BA3A 4WFQA 5CCXA 2B8NA 4M9ZA 4DDVA 4G9GA 3B1XA 4B7XA 3KHSA 3DWIA 4Y9RA 4FD3A 3LXMA 3GVPA 3QPAA 2A86A 2DWPA 1R3DA 3QI2A 1UK8A 1L4KA 1Q20A 4UXIA 2PRYA 1ID8A 2O3QA 1MVOA 2HAEA 1ZG3A 1W35A 1Z0FA 3A05A 3TL3A 4G4SP 1ZW1A 4R8SA 1WHSB 1DOHA 3AHFA 1VGRA 4IDGA 4QOGA 2DRIA 3O0DA 3WKDA 4AMGA 1LDGA 2JL1A 4BOYA 5DM70 1FBNA 1ZMBA 2EG9A 1BXZA 3KG2A 3UUWA 1L3IA 3PKIA 4R1NA 4X6UA 2YL2A 2L42A 4S1NA 2ODEA 4C0QC 4C4ZA 1W85A 1AXRA 2P4QA 3GBSA 2P4EA 1A5BB 1BXRA 3G0HA 2UZ1B 4RNDB 1V9SA 1AKWA 2QAGB 3PICA 1REQB 3O1LA 2M6RA 4ARUA 1KWKA 5EMLA 5CH5A 1X3SA 5B1IA 2PJUA 4ND7A 3I3SR 1UEXC 3DONA 4WHMA 3VAYA 4D3XA 1H0RA 4FFRA 4QGBA 3EOBI 1J1UA 4HRVA 1W94A 4ZGGA 4L50A 1XZGA 1I13A 3GCZA 5HMLA 5CM2Z 2I4TA 5JAZA 3PWTA 4JLWA 1XRQA 3OCCA 4LJLA 3OT1A 3VVCA 1AGPA 4DIDA 1K4YA 1J21A 3G2QA 1PR1A 3H17A 2O2GA 1R88A 2DQ4A 2WLSA 2XCQA 3BB4A 1Q0TA 1TW2A 2ZSUA 1ORRA 4V0ME 2I8AA 4NCNA 3WV5A 5AUNB 1E3EA 3GK3A 4V3CA 4DA7A 2VYFA 5K09A 1M6EX 3QEJA 1J0BA 5BT9A 1SZDA 4B09A 3A1DA 4C43A 1NT2A 3ZVMA 2WWWA 1YKGA 1SELA 1TW3A 3PIDA 3WAJA 1P74A 4TV9A 2I1LA 1TIBA 2WTAA 4TMTA 3KZCA 4TWZA 1L7MA 3M3DA 3WGVA 4DWWA 3BL8A 4MWCA 5IKPA 3EVGA 1SVOA 2BFPA 2GTIA 5DIZA 4EQ6B 2WG0A 1DBVO 1XDGA 4DCJA 4N5MA