1A9QA

Bovine purine nucleoside phosphorylase complexed with inosine
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
282
structure length
282
Chain Sequence
MQNGYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDTESQGKANHEEVLEAGKQAAQKLEQFVSLLMASI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PURINE NUCLEOSIDE PHOSPHORYLASE
publication title Calf spleen purine nucleoside phosphorylase complexed with substrates and substrate analogues.
pubmed doi rcsb
molecule tags Pentosyltransferase
total genus 85
structure length 282
sequence length 282
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 1998-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1a9qA00
3KVVA 4TXMA 4H1TA 2QDKA 4MARA 2A0WA 1U1CA 2GUWA 4JP5A 5KB3A 1K27A 1K3FA 2BSXA 5F76A 1I80A 1JDTA 1T8YA 4G41A 1YQQA 4QATA 1V48A 3FUCA 5CCEA 2A0YA 1Y6QA 4WKPA 3MMSA 1Z37A 1U1FA 3KVRA 2Q7OE 4QEZA 3BSFA 4QAQA 4EB8A 3ONVA 4LNAA 4OJTA 3FWPA 4NY1A 4KN5A 3GB9A 1SD1A 4LDNA 3OZCA 5F7JA 1A9TA 4D98A 3E0QA 1JDUA 1Z35A 2RJ3A 1PR6A 1NC1A 4QARA 4L0MA 5EFOA 3KHSA 4OF4A 4TS9A 1B8OA 1JPVA 3FNQA 4YO8A 4TXHA 4TS3A 2IQ5A 4L6IA 3NBQA 2HSWA 1A9PA 5F7OA 1TGYA 4MCHA 3PHCA 3LGSA 3UAXA 1XE3A 3EUFA 2B94A 1SJ9A 4DAOA 4ECEA 5F78A 3LA8A 3T94A 3U40A 1VFNA 2OECA 1G2OA 3OZBA 3IEXA 3UAYA 2AI3A 4F3KA 2ON6A 4OEHA 4JOSA 1PW7A 1T0UA 1VMKA 1RCTE 5K1ZA 1V2HE 3SCZA 1TCUA 1U1DA 1ECPA 1RR6A 3D1VA 4BN0A 3PHBE 4GLFA 5I3CA 1JDSA 1OU4A 4TXLA 1A9RA 3EEIA 1WTAA 1V4NA 4UC0A 1JDZA 3OF3A 3KVYA 3P0FA 4U2KA 1T8RA 4OGLA 1JYSA 1RXUA 1PK7A 4OGKA 1N3IA 4JWTA 1FXUA 1TGVA 4E1VA 2AC7A 3UAZA 2QTTA 3NM4A 1YR3A 4P54A 2HWUA 4TTJA 3DDOA 5DK6A 3OOHA 2QSUA 4PR3A 4BMXA 1JE0A 4PNPA 1ZL2A 1B8NA 4F1WA 3DP9A 5FAKA 4QASA 1OTYA 3FOWA 4G8JA 5F73A 5CCDA 4WKBA 1PKEA 1JDVA 3E9ZA 1V41E 3OPVA 1PR5A 3DJFA 5JPCA 5IFKA 1NW4A 1Z5NA 3BL6A 5C80A 4GKAA 5CYGA 4LKRA 4DABA 4TTIA 5EPUA 3BGSA 3UAWA 4X24A 4F2WA 5CXSA 3BJEA 4K6OA 1YBFA 4D8VA 4I2VA 1V45E 2P4SA 4YJKA 1LX7A 1OV6A 4QFBA 5F77A 3ENZA 4FFSA 2A0XA 1QE5A 2ISCA 4WKNA 1K9SA 1PF7E 1PR1A 1PWYE 4R31A 3OZDA 3O4VA 1ZOSA 4MCIA 4M3NA 1OTXA 3NM5A 4WKOA 1RXYA 2H8GA 1JE1A 3OOEA 1NC3A 2XRFA 2AI2A 2OC9A 1RFGE 1RSZA 3KU4A 4YMLA 2PGAA 3PNPA 2OXFA 1Z39A 1VHWA 1TCVA 4DA8A 1ODLA 4TTAA 5IU6A 4RJ2A 1Y1SA 4DAEA 4GLJA 4BMZA 4DA6A 3C74A 3EMVA 3UAVA 3IOMA 1Z38A 1ULBA 4GMHA 3MB8A 1OUMA 4NSNA 1U1EA 1Z5PA 4WKCA 1Y1TA 3P0EA 3INYA 1CB0A 4L5YA 1TD1A 1RXCA 1PBNA 4OY3A 1ODIA 1Q1GA 4EARA 1Y6RA 4YNBA 4IP0A 1U1GA 4R2XA 2A8YA 1YRYE 3FAZA 1T8WA 2HN9A 4DA0A 2I8AA 2AI1A 3EUEA 1PR0A 3QPBA 1PR2A 1YQUA 1Y1QA 3OZEA 1Z5OA 3DF9A 2QPLA 1VHJA 4M1EA 1PK9A 1Y1RA 3GGSA 4D9HA 4G89A 2HRDA 5F7ZA 4F3CA 4LNHA 4TXJA 3UT6A 3PNSA 5CYFA 5B7NA 1ULAA 5EUBA 3TL6A 1SQ6A 3K8OE 3LBAA 5F7XA 1PR4A 2OC4A 3OCCA 1RYZA 1JP7A 1SD2A 3E9RA 3DPSA 1Z33A 3K8QA 2QTGA 4LZWA 4BMYA 4L5CA 1A9QA 4D8YA 1A9SA 4L5AA 4DA7A 1V3QE 1A69A 1CG6A 5B7GA 5CXQA 1LV8A 1A9OA 1ODJA 1LVUA 4M7WA 4TYMA 3NM6B 1OVGA 1RT9A 1Z36A 3FB1A 3ODGA 1Z34A 5ETJA 4DARA 4NS1A 4D8XA 4TXNA 1M73E 3F8WA 1T8SA 1ODKA 4R2WA 1C3XA 3O6VA 5B7PA 5B7QA 2I4TA 4DANA 1RXSA 4F2PA 3KUKA
chains in the Genus database with same CATH superfamily
1G66A 1HFEL 2WF9A 4Y3UA 2G06A 2DHQA 1WDWB 2ONZA 3J81k 3GT4A 3KR0A 4BHTA 4LF8B 1GCIA 1V1MB 2BTQB 2EKBA 2YUIA 1WMDA 1W581 1A9XA 1Q7CA 1V6SA 2JF0A 2XT0A 3BRCA 4D5EA 2IU3A 3ELWA 2C4KA 4UDOA 2QK4A 2REXB 4MEJA 1SUFA 1L8AA 2BFBB 3AJ9A 3GR6A 4KIUA 4RLQA 3FOZA 1GV1A 4QNNA 4N3CA 3RNLA 5B37A 1U4NA 1QO7A 1ZICA 2VPPA 4C4AA 1II0A 3SJUA 1XZMA 2ZDQA 3GT0A 5B3JC 3VO8A 1ORVA 5BR8B 3IV6A 1QHIA 2CV2A 3QXCA 1P7CA 3A06A 3PDCA 2FA9A 1QX3A 4I1OA 1PZXA 1E3WB 1KTVA 1N2BA 2NTJA 1X7ZB 2VA8A 1E2NA 3A3YA 1XEAA 4NATA 4R69A 3HSKA 5TT0A 2G88A 4PVCA 1ZU5A 4BBZA 4EGJA 1G3IA 4NC9A 1PQYA 1IN4A 1BMFD 1Y4UA 2VZ0A 5KKNB 1FTWA 3OJCA 2CLMB 4LOHA 1A5BB 3VU9A 1NNUA 1FFBA 2FVYA 3CMMA 4R40A 2V7UA 5AVRA 1QDEA 4F84A 3RFCA 2F3RA 4HXYA 2F9FA 5CA1A 2OPBA 4GLBA 2I67A 4OAOA 3TZBA 1FSSA 3UF0A 1A4IA 5KVSA 1DJMA 4D9JA 4EGCB 4K2HA 4JP8A 1VJ1A 3KO8A 2HSGA 5C4GB 4HUTA 3L7LA 1QRAA 3HDVA 2MINA 2WSSA 4RJKA 3B20A 8GPBA 2RGRA 1C4XA 1Y63A 2Q3MA 3MMZA 1DJPA 2FMUA 3QJ5A 4L28A 1PVVA 2FW8A 4CWAA 3MCZA 1AZSC 1S5PA 3U7JA 2R68A 2YX1A 3NEJA 3PUIA 3U3XA 3WB2A 1ZINA 1MAUA 5KNBH 3KDPA 4TQAA 1TRHA 1JDUA 2FW9A 4NEQA 3PTAA 3RK0A 4FYHA 4JT9A 4PPNA 4KBGA 2WSLA 2H92A 4WLOA 4QARA 4RC9A 1RACA 3ECCA 4I4TF 2XLCA 3ERCA 2H85A 4O0MA 2D1FA 3H1EA 4NMXB 2JAXA 3V3TA 4EX7A 1KYWA 1K6JA 4JEHA 4J6FA 1T9AA 1XPRA 2WTAA 1Y9EA 4IIXA 4J2OA 3GYGA 1BKSB 4DWOA 3RSFA 1TC1A 4XGKA 4RZ3A 3GYBA 5JASA 4ZANA 3HJUA 1ZIXA 2GF9A 2PAFA 4GI5A 3VHQA 1WQ1R 1L2TA 4GGMX 4LWOA 2QR3A 4GOMD 4LZZA 1IOWA 2O0KA 4AJKA 4B7UA 1E18A 1IPFA 2J9FA 1OI2A 2P9QA 3GAMA 5THQA 5EJ5A 1Y6FA 3CUTA 2VLBA 5BUSA 2GK3A 2VO1A 2XNCA 3RAJA 4D0RA 2QIPA 3PGMA 1JZSA 3MTQA 2PGNA 3UMGA 2VUIB 4CLHA 3HXTA 2DFTA 1MVOA 2HCTA 4YCCA 1E6MA 1USWA 1V5FA 3TN7A 1ZYUA 3S3TA 2B5OA 2QJWA 3VZBA 1AF7A 4KKXB 1VPDA 2Z30A 1C9EA 2VT3A 2NQ8A 4KYTA 3GO4A 5H02A 3THRA 4BZXA 1ATZA 3WY9A 4DQKA 3MBOA 4UNNA 4YJ3F 4IYRA 1GLVA 1VIMA 3D31A 3MC1A 1CQJA 3EJ6A 4J2TA 2FN8A 3FWZA 1ZM9A 4MVXA 2P0YA 4JBXA 4BYGA 3U37A 1DPFA 3A26A 3UAYA 3OQ1A 2DQZA 5F9MA 1DQYA 3OZVA 1CF2O 2FP4B 2VXBA 3SHVA 5JZOA 3ED5A 4UEJA 2BRUA 3FYUB 4FQ7A 4JOSA 1PW7A 3ILVA 3RBZA 5BO5A 2P3QA 3NWBA 4JXKA 3GVCA 4QOGA 1G8KA 2EX4A 3G17A 1V39A 5JDCC 1W75A 1YIOA 3ELBA 4JIGA 2DWOA 2Q29A 3A6JA 1LWNA 1TCUA 1YHYA 4YRDA 3VPHA 1U1DA 4F3YA 1JIVA 3UMJA 1G5PA 4R2KA 3ZGNA 2J45A 1OA1A 3KEMA 3VO2A 2FUNB 5LA6A 3SF8A 2VNJA 3NIDB 4HDMA 3N7TA 4URZR 4A8TA 3BZUA 4H27A 3QXGA 5AK4A 3VJKA 4BN0A 2BM0A 3ISVA 2QYTA 3KXIA 2X2EA 2AEEA 3BB1A 4KWCA 5BWNA 1KMNA 1BNCA 1QKIA 2RGYA 4KPUB 1N9GB 4PIVA 4LNUA 3X1MA 3ZG6A 1NRXA 4WKGA 4H1VA 3BXOA 3A2LA 1EI9A 1JHAA 1G8MA 2XTJA 4M8SA 1IFXA 1QMGA 4REQA 1FXSA 1P0FA 1OZFA 2VPZA 4WRRA 4A15A 2IZZA 4H7EA 4LQDA 4KK4A 4Y6LA 3G79A 5D84A 3ZHUA 3GFGA 5A0FA 4G0UA 5KYTA 2ETXA 3E27A 4NZ9A 3RVOA 3R41A 2JIQA 4Q1CA 4IEFB 4TRJA 3HB1A 1DKNA 1FX1A 1XTUA 4MRMA 5BSGA 1XR3A 1JILA 4RL4A 3IKJA 2WT4A 5J2UB 3FF4A 1U7DA 4OGWA 3STWA 3V9PA 4BB0A 3AUYA 1TKBA 2BC9A 4KWTA 4BO1A 5EIAA 5J58A 1UMBA 2PWPA 3KIPA 4N1AA 4V0ME 3RTGA 3T99A 1RS0A 2YFQA 5FI1B 2QUKA 4FT2A 4H77A 5YASA 4UHJA 2YQ4A 3FZQA 3GLSA 5HCNA 2OGTA 2W42A 1JHVA 3E4DA 4ND3A 4P3YA 2IIPA 2OHJA 1B1AA 1KETA 4GPAA 4KQEA 3Q4GA 4N54A 4YAOA 4YDSA 1K08A 4JKYA 4A0SA 1RXWA 2E4AA 4LGCA 1EESA 5ALRA 1Z0JA 4Z86A 1TF2A 2QXTA 2C3YA 1GG8A 3Q40A 3FOWA 1O58A 3QOXA 5B4TA 1X87A 3DYBA 2ZRIA 3FMIA 4GQIA 1C3OB 3LPDA 1QCYA 3OIFA 4X41A 4AJ1A 2E5WA 4B2YA 4C3ZA 2PBFA 4CCAA 5B1DA 2R1VB 3T95A 3TLMA 1V41E 4TWBA 2WTMA 3DZGA 4RKEA 4CFYA 2F7SA 2F64A 3A6GA 3IUQA 4YWJA 5AW6A 4MQ5A 4BKQA 1SC4A 3EGOA 4IMRA 4DGQA 3ZK8A 3TIGA 4NK4A 3QBEA 5A71A 1SUAA 4BEJA 5KOJA 3BVPA 1YL5A 4NCIA 2JBAA 4CUKA 1EJ6A 1BFKA 3V4LA 5K8UA 2GLUA 1E7QA 1Y8QB 2QPTA 5U4QA 3EZXA 2HEIA 4MV7A 2PUWA 5BNFA 2DULA 4AWBA 3WQRA 1RYBA 1Z17A 1Y6GA 2QN3A 3UMRA 1X3LA 3JQ8A 3UCXA 1RXVA 5IDXA 1IBRA 2JDIA 2HRQA 3NKLA 4X7MA 3IHLA 2A4KA 1CSEE 2VH5R 1C4OA 2Z8YA 2QUJA 1GOTA 1OH5A 1GRQA 3FYHA 3MS2A 1NQWA 2AV6A 3NO4A 4XPIB 4BX0A 2WAOA 3LLUA 3RSHA 1VGQA 3OTQA 4ARUA 1MVLA 4WBSA 5ALEA 5I7UA 3HEMA 1AB6A 1XD2B 1XQXA 4PHHA 4AJHA 2I0FA 3H5TA 2KS6A 1E8DA 3R1IA 4J6EA 1SVOA 4R3WA 4C22A 1WIWA 2J7PA 3ZI0A 2WWIA 1E4VA 2IXFA 1QK5A 4UM8B 2FF7A 4HH1A 4EF4A 3HKDB 2FXIA 1SHTX 2J0UA 3P97A 4MVJA 6REQB 10MHA 4RTJA 1VCNA 1HXHA 2XUPA 2HBQA 1AZLA 3EG9B 3FWHA 2IHZA 3TGWA 4PX2A 5T6BA 4CTMA 4JJ7A 4OXKA 4YPFA 1M6YA 3EIOA 1KYZA 1U7PA 3L1JA 3QA3E 3QGMA 3ECAA 4HYEA 4HWOA 4QPDA 1HR0B 2CEAA 3MBIA 4PICA 4Q3BA 3BXFA 2NZVG 3HCCA 3KKOA 4PZYA 3ZQ6A 2C54A 4C7MA 3UTCA 4ZA2A 3ZWXA 2YC2C 2CJPA 4QLAA 1ND5A 4ISCA 1EINA 1OTXA 3NJ4A 3R4CA 4F4FA 2CE7A 4BTEA 2WVHA 2WWHA 1J49A 1YZFA 2GEKA 4DWVA 4L1KA 4L22A 3HSSA 4S3MA 5HJ7A 2XDYA 4MO9A 1YRHA 3LBIA 3R20A 3CF4G 4FFNA 3V80A 3COWA 5LD2B 3WV5A 1VL8A 3ZOKA 3OTGA 4OLFA 5CBPA 2VQFB 3NDJA 4A91A 1EXMA 3VR4H 2F8TA 4B7XA 2Y05A 4M0UA 1I7SB 3R3WA 2OXFA 1OIVA 5SZKB 1M0SA 3OBIA 1YJ8A 4FHGA 3NHFA 1SC6A 1CNEA 1QYIA 4OH1A 4PE5B 1E1NA 4DMHA 1T2EA 3K9NA 4OLJA 1WPRA 1VKRA 4GT1A 4W5WA 3L7AA 4TKUA 4A4DA 1URPA 2V0GA 4C6HA 2JC3A 4GIBA 4Z7JA 5BN3B 1ZI9A 3OA0A 5JXHA 2XCSB 4U2DA 5JAOA 1CY7A 2X0EA 5KDLA 5BSVA 5FT9A 3I2IA 1O9HA 1ZESA 1F4VA 1GZ3A 1FTNA 1U6IA 2VC2B 1DADA 1S4QA 1ZSNA 2Q0HA 3Q98A 5LYJA 1OKKD 3F3YA 5CLGA 3RSLA 4C0HA 1YVUA 4EQZA 3AF2A 4GECA 1N6KA 2HBYA 2OQ2A 3HB4X 2D0PB 4XD7D 1K8ZB 3Q3JB 5H3HA 3WICA 4YONB 2R8BA 2WDPA 3C74A 3EMVA 1YMUA 3K20A 4HLCA 4XM1A 4UZFA 3QNMA 4IVRA 1QJ4A 1WHTA 4ZIRA 2C29D 4YCDA 2GETA 3DWIA 1EWRA 4UCQA 5K0NA 2OBXA 5IJZA 4E5UA 4IKEA 4E1AA 2XWJI 1JSRA 1KDOA 3GLVA 2B35A 1AK2A 2Q3DA 2HHCA 1QKKA 1QIDA 1GHTA 3M6XA 4IS3A 4MITA 4ND1A 4BNVA 5CTJA 2GCOB 2ZU6A 4EB6A 5KYKA 4F6CA 4L4YA 2O2XA 3SYNA 4DADA 1LS6A 5J43A 1W49A 2DEUA 5IEBA 3EHDA 1LLCA 5PGMA 2XCIA 3GIWA 2B82A 3C6YA 2AMVA 5DCYA 4DREA 1KEKA 4BZPA 1J24A 4LAFA 3C8UA 1UC8A 2WZDA 3NVAA 3BK1A 4FOTA 1NBHA 2WTBA 4GWGA 4CIWA 4XWYA 2FUKA 2HMAA 1Q7RA 1Z16A 3CTPA 3OEYA 4H4EA 1KU0A 2W83A 5K2MA 1E6UA 2P4EA 3GJZA 5AI8A 4GYJA 5DMXA 3F6RA 1JHYA 4RCYA 1QHYA 2VDKB 3FDXA 1B74A 2IUUA 4J90A 1XYVA 4FNGA 2C1ZA 1YT5A 1IULA 4N3NA 4V39A 4QYTA 2OCPA 5DN6D 5F2OA 1YBHA 1H2EA 2BFEA 2DUJA 3DMGA 4QEKA 4K9NA 1UEJA 4NJEB 1NR5A 1WM1A 2EKPA 2OM2A 3AV0B 1NJGA 2NX2A 2W4QA 3DAYA 3L5KA 4I46A 4P4SA 3E2IA 1TQ6A 3AFOA 2V54A 5IN5A 5C7LO 1U04A 1UBKS 3QX3A 3ADDA 2YZNA 3HR4A 5DWVA 2O1EA 1A72A 1E0SA 3KKLA 3WTCA 2JHFA 3K5PA 2O8FA 2ZYTX 5EIBC 1BWQA 2BM9A 2JCVA 4O6VA 5L40A 4QL3A 2KE5A 2UXDB 1KWKA 1ETUA 5ALFA 4E5KA 4JBGA 4XCVA 2IKQA 2D7CA 2DBQA 4B0OA 2EKZA 3RU9A 3N2KB 3M6FA 2QRKA 4KQ1A 2A1IA 4LXHA 3WGLA 1COWD 5L45A 1MN6A 3EZ9A 4LFCB 4XR9A 3R6LA 1TYEB 3RKUA 5KNDD 1P2GA 4LIPD 5CVCA 1L1QA 3ANYB 1G8AA 1Z0KA 5DTQA 1HFJA 2HDWA 3CF2A 2Q2NA 1YRBA 1JTVA 1P62B 1W5SA 2P2SA 2J3DA 2QAGB 3EDQA 5A6SA 1XEFA 2IA5A 2OWDA 2UYQA 4R2LA 4XA8A 4O4JF 1SRRA 1EHIA 3TOCA 3W8DA 2A1TS 3ZXUB 1BXGB 4CKXA 2GRAA 1YS7A 2C7OA 1L7EA 4CEIB 4FW8A 2EX0A 2ZYRA 4R6XA 4PPQA 3ROGA 1YJ5A 2ZK7A 3FPFA 2QMOA 1Z2AA 1G3MA 1XLTA 1APBA 4KE9A 3NHMA 2AT1A 4A2QA 1QYWA 2C0PA 2HJ9A 5KKAA 2VNHA 2YZKA 2ADMA 2GAJA 1PIWA 2PS3A 3K8QA 3MS7A 4MWBA 2CL7X 5DWQA 5EWMB 2QX4A 4EBBA 1B76A 1W6UA 1C9MA 4LYGA 2CNBA 2QL6A 2G71A 1HURA 1YVDA 4RMNA 1OSNA 3RYIB 4B6FA 1ZM3A 5DW3A 1AHIA 4Q5IA 1RBQA 3OQOA 1M2OB 1LPMA 1SC1A 3MXTA 4ALIA 4G6ZA 1CG6A 2GZDA 3A28A 1JW9B 2QZ9A 3WL8A 3VU0A 1DI0A 4XQEA 1T6NA 3DR5A 1XJCA 3IHWA 1KZ6A 2I6XA 4LOIA 1V26A 2PGLA 4CMGA 3B3QA 5JAMA 4YP7A 2WDZA 3MXOA 3C7DB 2WHEA 3H5VA 3B1XA 1ADYA 4PINA 3DE4X 2RK3A 1VJTA 5EIHA 2X6TA 3TLEA 4W9NC 3BMXA 3KV3O 5CB8A 2O59A 1P29A 2J8ZA 3ES9A 1ATIA 5MGNA 1ILEA 3PGJA 2V7BA 4RZHA 3WIUA 3OC6A 2QLJA 4RKWA 4HAWA 4IOKA 3EA4A 1PKXA 1ZD3A 3JYOA 3N86A 2UUPA 2P1DA 3ZCPA 1F3LA 1CUXA 3PTZA 4NENA 4GGPA 1E9FA 2LE0A 4WD3A 3O8QB 1JHOA 3AKYA 4WERA 2CJFA 1B8VA 2FPLA 2O3RA 1P2BA 1RZVA 1TT5A 4XOIA 3ZLJA 4RBNA 2ZIXB 4RESA 2FPWA 3BSYA 2NUAA 1LCIA 4Z9XA 3GUHA 1PEKE 3IAAA 3K53A 1KQOA 3F4BA 3LT4A 2UUOA 5JY1A 4QUGA 1DU4A 3NWPA 3PDHA 3ROTA 3SC2A 3M5PA 2V7PA 4AZ0A 2QZ4A 3ZDAA 1GL9B 1U0NA 4Y6QA 2VN8A 3JSXA 4BFTA 1N3YA 1Y7IA 3MPUA 13PKA 2QZZA 5TMPA 3OP4A 3OX3A 3HB7A 3SFVA 3WLLA 2PYIA 2BFFB 1BKDR 4QDUA 4CEHA 1BEUB 3H18A 3N8NA 1Y4SA 2A58A 3N53A 3E2MA 1YONA 4Q9IA 2LDBA 1FP1D 3ZNPA 3BQ9A 3OEED 3MIIA 1PCXA 4PS1A 3R40A 1BHJA 2OZEA 2X0NA 1JZTA 3MGCA 2RHRA 5TDHA 3F8TA 4B43A 3IDFA 4GF5A 2NO6A 4XFDA 3TL2A 1NM5C 3BDVA 1UZUA 2P2NA 2R8OA 4W5RA 1N6PA 1Z73A 4ZO8A 1VHQA 1C7ZA 3NOOA 3IAUA 1EVJA 1E7WA 1VSVA 1RDFA 3CYFA 4WESA 4D6XA 3ZIDA 3A6DA 4C1BA 4N01A 3T7CA 3U81A 3OF2A 4WCFA 4BQRA 1FF9A 1X70A 1MTOA 1ZJJA 4ARZA 3DZKA 4MP8A 4MHSA 3HTXA 4M0PA 2B4QA 2AQKA 1C9NA 4K0KB 4TN5A 2VTVA 4MLZA 1LF0A 3A1VA 3IJEB 3QYFA 3ZV6A 3DE0X 5F52A 4WUTA 4Q7QA 1G6OA 1N33B 3RV3A 2W2LD 1JKXA 3D3EA 4HDSB 2WT8A 3KZ1E 1GIAA 4GXQA 4Y2GA 5IJ0A 4R81A 2RGNC 2WJIA 2ZRBA 4YJGB 3H5OA 2CHUA 4MQEA 5HBRA 2XB8A 3WLNA 4PCUA 1WHSB 3LKDA 4HLDA 5ALLA 4FUTA 5JCJA 4DG9A 1JJAA 1WXWA 1DBIA 2HFKA 2XJ9A 2YYYA 3MJTA 4LS3A 4RETA 5D5QA 1AE1A 5T41A 1KE1A 4UBLA 2QVYX 2O48X 1B3BA 4TLMB 4JJIA 4RCZA 3GEDA 1QRTA 3QX7A 3CLRD 4AKGA 2D5AA 1TCAA 3EXG1 4BZZA 2KSQA 4MMYB 5DH9A 2C4UA 5BRJA 2YIDA 4XYBA 3W5AA 2J85A 2O8NA 3LQ2A 4LJKA 2H52A 1GKYA 4MR9A 4RZXA 1DKQA 2ZYVX 2GJKA 4MUYA 5IUNC 5JJIA 3NBMA 3RIYA 4EHIA 4JCOA 1R6UA 3GZTB 5ESDA 5I9NA 3VTZA 1XTBA 5EXEA 3OE7A 1H5NA 2QVCA 3OAAD 4GOLD 5F98A 5KVCA 1AGYA 3KFXA 4YUWA 1UJ6A 3SOPA 3TD6A 2PUDA 4NZZA 3MJCA 2AN3A 3TIXB 2IP4A 3RHSA 5FWYA 3UPDA 1VDZA 1WW8A 4YQZA 4B3BA 3CJQA 5FPYA 1GRVA 2EYQA 5J5VA 4AYWA 5B6IA 1KJNA 1CS4C 2P3OA 4ZI7A 5IFLA 3ZBUA 4JKIA 3AF6A 1V37A 3AH8A 2Y1DA 1KVTA 5KWIA 4TS1A 4GYWA 3M5WA 2WUEA 4LQLA 5FTWA 3LL7A 3U40A 2B0JA 5HGXA 3QMWA 1NI5A 4R05A 3H65A 2OECA 5J4VA 3OZBA 1UR5A 3ZZUA 4B40A 3CPEA 1E7RA 3FUUA 2YTZA 5LDGA 4WLEA 2P6OA 3DKPA 1BS1A 1ZL0A 4Y2TA 1TXGA 1L8OA 3MBKA 4I4TA 1T0UA 5HHTA 4IG4A 3D81A 4DUZB 3D5QA 4NQZA 2A9PA 4ZV4A 4NYJR 2UU9B 4FCVA 3MM4A 2Q2VA 1DZ3A 3IP1A 1IN7A 2YJNA 2CK3A 4L08A 3N5KA 3WNZA 1J00A 2QE6A 3DFKA 3E82A 3LT2A 3TINA 4CF3A 1T6ZA 1L4KA 2AX4A 2VJCA 1PQPA 2ODEA 4UULA 3HZHA 2QL7A 4EPRA 4BXOB 4BB6A 2B5VA 3H5LA 1TL7C 1ESCA 2AK3A 3KEOA 1V1RA 3CQ9A 3GJ0A 4XQGA 1B43A 5K6TA 1L1EA 4AN4A 5B2FA 1SXJC 3G2PA 3BB4A 2P8JA 1JR3A 4C7VA 1T0PA 4EF5A 1JPNA 2FPXA 2BPOA 3WXMA 3A1NA 4XCQA 1MG5A 3T7SA 2ZYGA 3A4NA 2VWGA 4ZJYA 1K6EA 3G85A 1BVHA 2LWIA 3RSGA 1IY0A 4FI3F 1P3Y1 1EEHA 1W6RA 1XZNA 4K8OA 1EXVA 2EZUA 1WB6A 2ZWMA 1NZDA 2PKWA 3HNOA 4MIKA 4YJ3A 3ZX5A 4E1VA 1PS9A 2OXIA 4WLNA 1XEWX 4TWZA 4AIIA 5KTOA 1G2PA 1G60A 4YLEA 3LY5A 2ZE8A 1R37A 3BILA 4MLPA 3VDQA 1XCPA 2YJ3A 3P2KA 4PPFA 4Y9SA 1WCXA 2I55A 4DNOA 4HR7A 2AEMA 2WJPA 4IM7A 3FNRA 1AK9A 2RB4A 3SLGA 1TQHA 9ABPA 1Z28A 5CVEA 5D85A 2IH5A 1DX9A 2VP5A 4OU5A 3VYWA 3U5TA 2H2DA 4JT2A 4L9AA 1GCAA 4B3CA 1RE1A 2A59A 4ZVKA 4MS1A 3RAEC 3AOEC 5DTIA 5JFTA 3IJPA 1ZONA 4PC6A 5SYMA 2H06A 4DCPA 2ZSJA 1V3TA 3G68A 4WKBA 5EP1A 1UMDB 1YQXA 1XCLA 1YI0A 2JD0A 2VP0A 2R8RA 2HWWA 5KYXA 3QNUA 3N58A 2PH1A 5GJWC 4MVJP 1UKYA 2EERA 1Q3HA 4C6SA 4EPXA 4OV6B 4RZUA 4FFWA 3U26A 2MSEB 5E7IA 4G37A 3THSA 4P5PA 1U8ZA 1HX7A 1EVZA 1F4LA 1RRMA 1USIA 2OHOA 4KRYA 4KQWA 4TKLA 4DR6B 5CA0F 4YASA 3ZVMA 3KOWA 1PP4A 3A1FA 4LTMA 4TTIA 1KI1A 4Y9DA 3JZIA 4H7DA 5KOHA 3L7JA 2CC2A 3BGSA 1CVLA 3U44B 4PHFA 3A9VA 1AN0A 2VNIA 3TJMA 2ZI7A 1J99A 2VJKA 3A11A 4B6GA 3F3MA 3I0NA 2HH9A 1X8KA 2REOA 2AG5A 3IBGA 3IBTA 3T4UA 3V4FA 1Q0HA 3AP3A 3B2NA 4YUZA 3VOBA 1V45E 1I5RA 2P4SA 1E2BA 1ZUIA 2YHUA 3DLTA 4KUEA 4ZO7A 1TYBE 3MJVA 1SG6A 5KYYB 5FI5A 4MWDA 3OJWA 1DC8A 2H16A 1PUIA 1OU0A 2VYFA 5BV7A 3V9AA 3UWDA 1EK6A 3T5TA 4K9SA 5REQB 1SVLA 2FJ0A 1I3KA 3LLCA 4CPDA 2W6QA 5E6UB 1VL0A 2C98A 1TAQA 3L4BA 4GP7A 3CO5A 1C2TA 4MRSA 4EJSB 1MH9A 1PBTA 2B4KA 1HDCA 1C7FA 3TKAA 4A0RA 1AXGA 2D6FA 1X42A 1E3JA 3IV7A 4XM0A 3JYHA 4E11A 2F43A 2QBYB 1HQCA 2REQB 5EKDA 1UANA 4YRCA 4EABA 1U80A 2EEZA 4UZSA 2BHSA 1AKYA 5EXSA 3TQFA 3LRTA 4NFHA 4QPNA 4OVKA 1KDYA 1TYAE 1NYQA 1EFCA 2XA9A 3B12A 1JFVA 2P4QA 1ORIA 1PV1A 1WXGA 1IHPA 2NYAA 1FQKA 1YB4A 2O7RA 5TEVA 4G63A 4A6EA 4O4LB 1Q0LA 1Y33E 4NV0A 4KFTA 3SLRA 5EIEA 4AU1A 5KQPA 2AOWA 4QFCA 2R4UA 2DETA 4AWXA 5KQLA 2MSKA 4FFBB 3VISA 3KQNA 2IYPA 3TTVA 1B7GO 3HB0A 4IGEA 3BEDA 2G25A 3MS4A 3W4KA 4D4JA 4YUXA 1JALA 5A03A 5FEUA 3E35A 4F5YA 3CLTD 2OY0A 2MJLA 3HMQA 3P5BA 4CMKA 4RNDB 3CF6R 2FUCA 2WQ6A 1G18A 2JEOA 2CGEA 2H8KA 3PUXA 1R88A 3K1TA 1WD7A 1EM8A 4GQAA 2CDRA 1RCUA 1M5TA 2AOTA 4G24A 5TV2A 5KTKA 5KYWB 1TU3A 4DUYB 1W85A 1CUBA 4YMVA 1LDNA 2RH4A 3V8EA 4ZTBA 2PRYA 1BN6A 2IPAB 2PMKA 4LRYA 4IPTA 6NULA 2BSAA 1I3CA 3LNCA 1N2CA 1ZIDA 2H9IA 2P9JA 5AKGA 1YB6A 1E4EA 3LK7A 5LQKA 4DCNA 1MIOA 3RS0A 3E5NA 4V24A 1I6WA 4RHTA 4IHAA 4KACA 3VR5A 4G56A 2EG9A 4FPXA 4WY8A 3WLAA 1UQTA 3D1JA 1O6BA 1JVNA 1K7FB 1KBOA 2R8PA 2C07A 1TVKB 3IP5A 4OHKA 3UT5A 1CQXA 1BCRB 3N2ZB 4I19A 5E9JA 3RT1A 2O3JA 2ZG6A 1IMOA 2CB9A 3TMYA 3VR6H 1M7HA 3SPXA 4E4TA 4Y7DA 4BNDB 3U5ZB 3UOGA 1Y1TA 1IHDA 4DM4A 1GV0A 5CDFE 1KI6B 2QD4A 1NIJA 2Q3LA 2B21A 2XOEA 3A4IA 3HCNA 3KR2A 3RO7A 3V42A 1KZYC 3K8ZA 1PBNA 4R0MA 4M76B 4G0NA 2P3LA 4PSKA 1IRXA 1V3UA 3PNBA 4DRXA 4RJIA 1K6XA 1W5BA 1I3MA 3D6FA 2XYRA 1NXVA 3K2IA 3NOVA 2Q41A 3TXXA 3OPYB 4U8HA 4O4IB 1ISIA 2GYUA 1T5BA 3R23A 4B0PA 1NPYA 5ECYA 1P3DA 2VAWA 4NCXA 4RJLA 2PS1A 4OMCA 4Z1MA 3RB8A 1CUUA 2QNIA 3HUTA 4GZMA 3X0DA 5JI3E 1MQ8B 4BO0A 5DCUA 1XCMA 1M2HA 1QC5B 3P0RA 4FSXA 5D3KA 4BV2A 2O14A 1NN5A 1P77A 3OZRA 3VC3A 2UVDA 4DCCA 5DYYA 4FC7A 2CJWA 2O0LA 4BGUA 3RK1A 3EGIA 4B8WA 4X62B 4PPYA 5BNTA 1SXJD 1EHCA 1P80A 2DWCA 1P4HA 1XRSB 1P1BA 3LT0A 3P5SA 4UHEA 5JR3A 2B8WA 4O4JB 2FUG1 1Z4IA 2FK7A 4CU2A 4NI5A 3WO0A 3BH6A 4QHSA 4EW2A 5JMOA 3JQAD 2QZJA 4EUHA 3AU9A 2CBXA 3DF9A 3AVOA 3GUYA 3SXUB 1UQRA 4JITA 4KXLA 1FX0B 2AWNA 5A3SA 1H3FA 3NTXA 3VOTA 1L4HA 5LWHA 5I01A 3O8BA 3A04A 1B73A 1S8FA 2CD9A 2HSDA 3QLVA 3SEQA 2JGJA 3ZWBA 4V0RA 4O2BF 2JLVA 4KLCA 1DRVA 1CC1S 4RF4A 5F7ZA 4BRZA 1EG2A 1N57A 1YCHA 4Q39A 4I66A 1WBBA 1KEWA 3DKIA 4RNCA 5ECGC 3S2GA 3WHPA 5BR1A 5JYBA 3PE6A 2F8SA 2Q1SA 2VDLB 1V8PA 5FP0A 4DKJA 3LJKA 4XR4A 1FTQA 2W6NA 3MSXA 3OLXA 3A1SA 3QIVA 3AHJA 3ZY2A 3O7MA 1L5HB 1G3UA 2JIZA 4ARBA 4RK6A 1D7AA 1ZBDA 2QU7A 4BJHB 3FG9A 3LECA 4CCYB 4D4KA 2XB2A 1EIZA 1KMHA 2BMJA 3WGZA 2B1RA 3O3CA 3T6KA 4A5OA 4QIHA 2CFCA 1R8JA 4DZZA 2HWKA 4L73A 3N2GA 4KDEA 2ONJA 1NBAA 4I14A 1PE0A 2HOQA 2ATIA 5DT9A 3UBTA 2PRJA 4Z3DA 1G59A 4HDRB 3OX2A 1SD2A 4DT1A 5IT9A 4HN2A 1U9IC 1QX4A 5D7NA 1QUEA 3MTIA 3VC7A 5JQGB 1U3TA 1IAQA 3ZIAD 1O96B 4LHZA 1M54A 2CZQA 3DM5A 4M1MA 2AJBA 1VLJA 2QEQA 2PJZA 4IV5A 2BP7A 3DZJA 2VPWA 3EG5A 4K03A 5AHKA 4U39A 3WG9A 1VE7A 3PX2A 5JJKA 1DQNA 3NTVA 3UV7A 4MIOA 3I58A 2X2PA 2ZBRA 3STTA 1CF4A 1I4WA 1R0KA 4N0PA 1P45A 4HEQA 3CXUA 1H93A 1Y37A 1FP6A 3IVAA 3KAQA 4X20A 4JJZA 4XGIA 3D3WA 2UZ4A 3C8DA 1LDEA 4B3TB 2HB6A 3N8DA 5DF1A 4JVLA 4LI3X 4R6WA 3HBLA 2JKVA 5A0TA 1Z36A 2P7HA 2PX4A 2YZGA 3CEPB 5JW6A 2RDMA 3EVCA 3HZRA 1YK0A 2WIAA 5CVJA 3OIUA 2ZSIA 3GAAA 1YDHA 2NU9A 1B3RA 1R4NB 1XNHA 3AEUB 2VTKA 3MG9A 2P9ZA 4G1BA 5EE9A 5DCLA 5B7PA 1GZUA 3T3HA 1NNI1 1D0VA 1X86B 3F96A 3IXMA 3GDHA 1NF2A 1QQ7A 4FILA 4FYMA 4FYIA 4AXXA 1Q0ZA 4D57A 1IG3A 4WNCA 2E4YA 2I62A 2ECPA 4FDMA 2Q4RA 2FSIA 2XQFA 2IVZA 3GJ3A 5H3CA 3RU3A 4Z4GA 4A0FA 5KNCH 2RG1A 4JLDA 1SHJA 3CUUA 3VR0A 2B4YA 4N5LA 3DFZA 4ARAA 5E4JA 4WXHA 4YP9A 3HQ4O 1J8VA 1BOOA 1HYQA 1EAMA 4OJQA 4DC0A 5HRAA 2BMEA 2IDZA 3U7QA 4E5DA 3CO0S 3ECSA 2IJGX 3UMVA 3DBVO 4JYZA 1KC1A 3INTA 1EE1A 2BZGA 1WS6A 1Z45A 3L49A 2V4ZA 4O4HA 4QATA 2NT3A 2VQDA 3P4YA 1U0JA 4PGGA 1QCDA 2HGZA 6Q21A 4M83A 2DERA 3O8NA 2CNKA 3E7DA 2ZRJA 3QIAA 4U9IS 3PSHA 3SC6A 1GCGA 1KI7A 3SU8A 5KQRA 5T64A 3R7AA 1O97D 4MQ6A 4JHXA 3KVRA 2ZJZA 3CRQA 4IEIA 3UMBA 2V97A 1FLAA 3H11A 1I3LA 3I45A 2ZJ5A 2R85A 5TC4A 1BOFA 2E6KA 2FDCA 4PX3A 2HSEA 4TVSA 3IA2A 2KJQA 4B4WA 3N0RA 1CQIB 1T4CA 1Z7GA 4C1NA 4EATA 3AR7A 3L7YA 2BR4A 1HTBA 2CUZA 1JVSA 4GUAA 3EWNA 1F0YA 2O07A 4KN5A 1M8GA 1GZDA 4YCBA 2EBHX 2WJHA 1HDOA 4BX2A 2OUKA 3BGDA 1OGJA 5EHNA 5HRCA 2XDQA 3WAGA 2Q3JA 1Y7HA 2QX8A 1SELA 1EMDA 4M9CA 4BBPA 3MVEA 4GMGA 3Q3GE 2RJ3A 4AVYA 4R1LA 1GNVA 3LQQA 2X8WA 3FNIA 3MYYA 2QV0A 3RUIA 4H15A 1RMYA 3BK2A 3Q1LA 5FWXA 4ZEWA 1EXNA 1VMDA 3HCEA 3ROFA 3D7NA 2X2FA 3VZPA 4QU9A 2H2IA 2H5IA 1OVMA 4Q03A 4F4JA 1A98A 4YRNA 2QTZA 1Y9DA 4XDGA 3RF6A 5JS2A 4ROSA 3VR2D 4BV9A 4K86A 1HT0A 1N0IA 4FZVA 1Q7BA 3UK7A 2C5EA 2B98A 2ZXUA 2B3TA 3TQSA 4B3DA 1BX0A 2BUAA 2Q8NA 2HU8A 4MS4B 3ID6C 4IJ5A 2AN9A 3RSCA 2EATA 5CITA 2HA7A 4CMIA 2I65A 4K6FA 1ZHHA 1K7SN 2D2IA 5JPIA 2CUTA 1IATA 2IY8A 2YNMD 4JA0A 1Q1QA 4TM8A 2FMHA 2IGBA 4LJ7A 1JLRA 3WQBA 4OLAA 5HIMA 1UDWA 1XYYA 3AX6A 5ALWA 2CT8A 5TQ0B 3PHCA 3IELA 4BVAA 1GUDA 3UAXA 1ISMA 1SCKA 1BJKA 1T9HA 4O5AA 1UJBA 4IGAA 4NNJA 5D01A 4BNGA 1FNCA 1IZYA 1MNAA 1J8FA 1G1AA 3EEYA 3LBHA 4IUCS 1E1CA 1O89A 3A36A 3MWEB 1II8A 2AW5A 4M8KA 1OMOA 1F12A 1GA1A 2E1PA 3QUBA 4MQBA 1J39A 4WV3A 2HLHA 3WK6A 1Q77A 3ZDCA 2XWQA 4AUNA 2YFKA 2OG2A 2KBFA 3C4QA 4AF8A 1NQTA 1Q1ZA 3C0KA 4YFYA 1EZ1A 1K8RA 5JD5A 3MUEA 1D2EA 3MJ4A 5C8ZA 1VE5A 1M6NA 4B75A 2GSDA 5J47A 2B9VA 2G7MC 3HCWA 1H9AA 5FF9A 5FYQA 1A88A 4BKPA 1YAHA 3ZGVA 5C53B 4D5GA 2IDMA 2AR0A 3A6PC 5DTRA 1T4MA 2WU0A 1F2UA 1YR1A 1QQBA 4DZRA 1KQNA 1WU7A 1N5LA 4PZ9A 2X5KO 5HA5A 3AKDA 2I34A 1ECPA 3DDNA 2PV0A 4HWRA 2CHEA 3TDKA 3BCRA 2W6MA 3DOEA 3G9XA 2A7XA 2JATA 3KYCA 4MGIR 3D1VA 4NU6A 3VC2A 3G2KA 2DUUA 4PYOA 3L6OO 3UHJA 3C3AA 3HKEB 5T8KC 4WLVA 1WCYA 3GGCA 1J56A 3T54A 3BGOS 4FFOA 3EQZA 2HEGA 1VKZA 3DBHA 4ZI2A 3BXPA 3JRWA 4F92B 2JFBA 1O0CA 4KFRA 5C8XA 4N3GA 1JDZA 1IRIA 1DSSG 2JRLA 4IZHA 5HF8A 1VMAA 1ZAKA 2IYSA 1QVZA 2I2WA 1CK4A 4FFMA 4HQRA 4EFKA 5AK3A 1JB1A 1Z22A 3FYTA 3G6WA 4U2KA 4RA9A 5AXDA 5AVVA 5IJWA 3PC4A 2XMGA 3CFYA 4C0XA 1GM5A 5E6RA 2H2HA 4QYSA 2COKA 3QA9A 2VF2A 4B3RB 1YQWA 1HSOA 4J16C 3SYTA 4A8JA 4KTVE 1XLWA 1DFHA 4CIYA 4K9RA 2C2BA 2AF4C 4BBAA 5ECDA 4QBTA 2YXNA 1TGVA 3WTBA 3KELA 3QSGA 4JENA 3UJCA 4XIGS 4MW6A 1WE2A 2QTTA 1XVIA 3NOXA 4R84A 1Q91A 4P54A 3RVBA 3SBDA 2QA5A 3UOAB 3K0EA 1B0UA 3IKLA 1LNSA 4TM7A 4GG1A 4BVGA 1QQ6A 2NU6B 3K0FA 4ENSA 2E85A 5CFLA 1JA0A 1U9YA 3ILYA 2RK6A 2R7KA 2VDRB 3BCUA 3JD1A 3PVZA 4RANA 2J41A 3FCAA 4DMLA 5CA0B 1PT9A 1J1UA 1V7QA 4P3NA 1T6BY 4IX9A 1BQEA 2FFRA 5EL0A 5EXTA 5LQSA 3ZKWA 2XUZA 4RTMA 4YMHA 2XMDA 1RQNA 2HJVA 5GZ3A 1KO7A 1W46A 4QT0A 4J76A 221PA 2CWDA 1XPUA 1XVAA 1ENZA 4RDXA 4QASA 4CTOA 3TO5A 2G4CA 3W9UA 4F93B 4LZJA 1SA0A 4WFIA 3M4JA 4D3ZA 1S1CA 1XJWA 2D0DA 3NWJA 3GBPA 3O8RA 2GAOA 1ZH8A 2I1QA 4MX8A 3S2YA 5IXYA 3A7EA 2BEJA 2BONA 2JZOA 4FBLA 5CB6A 4QICA 4V0SA 2IXGA 4C0JA 2J67A 3DDSA 3DC2A 1M1YA 4TKZA 3N6RA 3R9XB 2ZPAA 2R3SA 3GEBA 2M9MA 2FH5B 5K51A 4B85A 3TX2A 1BVRA 1RLMA 3GCXA 4QFMA 4DBVO 1JWBB 5F21A 1XZEA 1G21B 4XRRA 1DCKA 4HS9A 2CHGA 2WJWA 3KVNA 4R8LA 3UJPA 2YC4C 3UAWA 3U80A 5CCXA 1V5EA 1N34B 5FO1A 4CN8A 1FTYA 1XZ8A 2QV7A 5IMSA 4FD2A 2V5UA 1ZXXA 4KHZA 2QUBA 4P2GA 3A4MA 2XKKA 1I6LA 1ISJA 2BFDB 4ODIA 1UZNA 3KJEA 5I9MA 3TLGA 4QO8A 2PTHA 4UXJA 3H8VA 2RJOA 4GD3Q 2D7DA 1WABA 1JZQA 3B5IA 3MEQA 1U2DC 3BA1A 4U7HA 5IS2A 1PQ4A 3PNMA 3I0MA 1KC3A 4Y8VA 4KP7A 5CW1A 3F90A 1ZVMA 1G20B 3P9ZA 3THWB 1HUQA 1IN5A 4ZPJA 2FR1A 3VPCA 1W4RA 1YZTA 1G21E 2DWUA 4XARA 3TLKA 4XEUA 4U7DA 5FUVA 3AESB 1T25A 3IRUA 3EMKA 3UH1A 3KT3A 3X2SA 4KWEA 1Z9BA 3GMTA 4MR8A 5EXDA 1VBKA 4R7ZA 2IV7A 2QMHA 3QH4A 1Z13A 4FKBA 4Q1DA 1KVSA 2VNKA 1MC4A 2XMRA 4R31A 2VK1A 1N8KA 3I52A 1S8AA 4YV2A 1ZR4A 1F2TA 4EDFA 3O8DA 3CH4B 4EGQA 4AG5A 1QIEA 2PIDA 1W4LA 3DTVD 4ZCMA 1L3IA 2ARKA 3CVYA 3NEPX 3RQIA 2OKGA 1G20E 3S2IA 4E46A 1I9GA 3PX7A 2F67A 3ANNA 5KYUA 5EQTA 1M66A 3KR1A 3DCNA 1ICEA 4A10A 3AILA 1M34B 3L46A 1WU8A 2L42A 1E77A 5DV9A 3ZWKA 1HLFA 3Q7PA 4YK7A 4C7OB 5ALKA 1IY9A 1DBSA 3PFNA 2FPOA 2YN4A 5FOTA 3FOCA 1BN7A 3CKYA 4MCJA 4DNPA 1PJ8A 5JVDF 2Z3ZA 3A4TA 2E9SA 4WGFA 3CLVA 4L8YA 1IL0A 2HMYB 2PL9A 4KDFA 2HCBA 4N0EA 3EHEA 3Q8WA 1AKTA 1F8FA 1LBTA 3IULA 3NNNA 4Y2XA 2R00C 4R7TA 5AK5A 2XUFA 1O94C 3SDZA 2FLWA 2AMYA 4U0JA 3IL2A 1OE0A 4K7JA 2J6HA 1U65A 3LHDA 3OZTA 4KXQA 2BAGA 5IJ9A 1Z8NA 3OO0A 1M8KA 2AUTA 2TMYA 2EJTA 4PZLA 3RWOA 4H17A 2WD7A 4D8TA 4EG4A 2C2XA 3QY0A 1G6HA 4GRAA 4IIDA 1IONA 3HI4A 4F8JA 1SKMA 5AVYA 2XUGA 1BMTA 4LJ6A 1HZJA 4UHHA 1UBNA 2VBCA 2IHBA 4PBSA 4U7TB 5IDQA 3BWVA 4ZWNA 3LUCA 1A5TA 4XUDA 1S0UA 3G1WA 4C87A 2OLJA 5JXGA 5D5PA 5TMBA 3LZCA 1Z5GA 2GPYA 3AF1A 3ZE6A 4LF7B 4B3XA 3MPOA 3E53A 2MSCB 5A05A 2WLTA 5H80A 2IXDA 2G1UA 1P4RA 2HF7A 2BELA 4Q4JA 3IUSA 3WWEA 2ZRFA 3PDWA 2OFFA 3UXEA 5A1JA 1SPBS 1P0PA 2R25B 1YS1X 1SBYA 1ZOOA 3IQWA 1G7RA 4RWZA 4OI4A 5HQ3A 3D4OA 2ZUVA 2B1GA 1RXCA 3B9RA 4GH5A 3PC8C 4BQFA 1C8LA 2A4MA 4FVTA 4EB0A 2AZXA 2GDZA 1CUHA 3IT3A 1Z6QA 3QE2A 2I3AA 4QVIA 3G0BA 4AC9A 5GIPE 1DAOA 2ZWIA 4FOPA 3RVNA 5IAAA 1PTKA 1SUBA 3EULA 4L51A 2EYUA 2NVUA 1Q1GA 4RH3A 3TW8B 5CCBA 2FRXA 1AD2A 5PNTA 2PG3A 1FFGA 4R2XA 5TE9A 2IIQA 2VYQA 3AXTA 1GLNA 2VHJA 5HJEA 4EJ0A 3EDCA 3TK1A 3JVEA 2SKEA 4OQQA 3R5KA 1Z7EA 3M4ZA 5I7HA 1R12A 3K5WA 5I48A 2ZM5A 4A82A 4M6WB 1B23P 1NHWA 2AI1A 4UUBA 2ZPUA 4MAAA 1L5VA 4P86A 3O2SB 1WDTA 2JANA 2R6FA 2A88A 3L8HA 1N7JA 2XCLA 2X4GA 1VMIA 2BGRA 5H7XA 5ITZB 4G8DA 1Y1QA 3PHHA 4LSZA 4C9BA 1Z2PX 4R1QA 2I2BA 5BYKA 4LF9B 5BV0A 2G0AA 4BWFB 5ICCA 3TF5A 4PU0A 2A5GA 3VSEA 3NT5A 3HU5A 3BIFA 4LSGA 4FLEA 9GPBA 4M9SA 3E9EA 1KO8A 4RD2A 5G41A 5IYZB 4YT2A 4ASUD 2TECE 4B7CA 4DV2B 1JB9A 5T5QA 3OJ0A 3ZLVA 3MWYW 1BWRA 1V1MA 2HL6A 2W8BB 5JFGA 4ZEXA 4KYVA 5IDVA 4CDGA 1OQAA 1I01A 2XMQA 4D9MA 5L3QB 1OX4A 3T1TA 1QU2A 4QDJA 3BXHA 4K81B 1X1EA 4QEDA 1OV4A 4C3OB 1W7AA 4WNYA 4MV3A 1U2PA 4ZC1A 3DAOA 3EWSA 3QV2A 3LBAA 4BS9A 5IHXA 1H6AA 2JL1A 5K5EA 3CR8A 5CK5A 3A10A 3QPUA 5H5JA 1MB2A 2QLLA 3EN0A 1UFRA 3K1YA 3O4IA 5BMVF 4IIHA 4MZXA 1ZN7A 4O2AF 4DJFC 3A9WA 3IP7A 4U2GA 3NC4A 3B5EA 1GWNA 1MC5A 1SBHA 3IAS1 2FR8A 2HREA 3M6VA 1XLUA 5KTNA 1IVSA 2FWMX 1SK9A 1YKSA 3I8OA 3KSUA 3LBYA 3OWXA 3Q5EA 4P22A 4L15A 5CNIA 4B82A 3QWBA 1EZZA 3FOFC 2CB0A 3ROPA 3OIYA 2P2ZA 1P5RA 1ZN2A 1NJ6A 2VAPA 3DBRA 3GV0A 1XF1A 3L2OB 4I5GA 2NPFA 1GGVA 1QAQA 2ZJ0A 4JL6A 1AY0A 1V11A 2ZAMA 2ZYAA 2QJTA 3VKWA 1NMYA 1C1XB 4I7EA 5JXJA 4U0KA 3T9AA 4PQGA 1SCBA 5FA6A 1K97A 1R6XA 3V1YA 2ONYA 2PLNA 5F3WB 1LQUA 2B99A 3GJTA 4UM7A 2AX3A 4UMFA 1MRSA 1YVRA 3SQXA 3AEQB 3BXXA 4RKRA 4PRLA 1P1IA 1QE0A 2X3FA 2HXSA 2X1HA 3NRJA 1IQRA 3GRUA 2HJRA 4MUMA 1MIHA 2QW0X 3S8EA 4X5OA 5WRFA 4O2BA 1VKHA 3EARA 3F8WA 2YHSA 4JI6B 2VI5A 5DGTA 5KVAA 3SZ3A 2BHRA 5HZMA 1U0TA 1FNBA 2H5EA 3GUZA 1S2MA 5KHAA 3ZJ5A 4FEEA 4U2CA 1E8NA 2BM8A 2A84A 4GEKA 1Q57A 4OJKA 4CUZA 4DANA 1FDTA 1X8LA 1PI3A 2PO7A 3SQMA 3KQOA 1S3FA 3KP1A 3K09A 5FRDA 4QUKA 3B13B 4CIDA 4F4HA 4K9QA 1PJBA 2G9QA 2CE2X 3UFXB 4K6GA 5FORA 1JL3A 1TU0A 2B83A 2A0UA 2IYEA 3EE6A 3LX8A 4TV8B 1KFCB 2Y3IA 2ZS7A 1U1CA 1CNFA 2FE1A 3ADKA 3CLSC 1Y5IA 4CKBB 2XWBF 2ZW9A 5BYAA 3H6HA 4DLTA 3L1KA 2FX2A 3WNCA 4R8VA 4YRLA 4AQYB 1DAEA 3GLRA 1NKVA 3PP8A 2O2IA 2Q5EA 3QQ5A 1KJWA 3D2CA 5TX7A 5B12A 3ICPA 2AFVA 1TYCA 2ZR8A 4U5QA 4UBMA 2IH4A 1ZXBA 5E7QA 1PV4A 5HS6A 1FMJA 3GAZA 5LM3A 4Y6GB 4MAMA 5GONB 2XOXA 3MMSA 4K9PA 2HU5A 2WMDA 2QI9C 5FOSA 4B73A 3PX3A 3BFVA 1EUCA 4NCKA 3Q7QA 3RS5A 3CLHA 5HMMA 1CJBA 2PJDA 4LNAA 4Y9UA 1QOZA 3O82A 4LHEA 1FVHA 2BR5A 2ID4A 4IDHA 1X94A 2PK3A 1YJBA 4NH4A 5HS4A 1HM5A 1D4ZA 2C58A 3NAQA 1AO3A 4YPOA 5IC5A 4Z4EA 1I9CA 2R62A 2R87A 3VHRA 1R9GA 3HBMA 1JQKA 3VKUA 1TQDA 4IFBA 1CR1A 1KL7A 1IBSA 4X1YA 4IRMA 4PTYA 3DO8A 4YLGA 1G3RA 4YV1A 2NXCA 5FEMA 2QD5A 4OHVA 4YAFA 4ZAZA 3SDSA 3A0RB 2UYHA 2HO5A 3ZCQA 2FN7A 1TI7A 3I5UA 3P71T 3PC2A 1XU4A 1MZPA 3ZWVA 2C04A 1Z35A 3MLAA 2O9JA 2Z98A 3HYCA 2EGGA 1I3OA 4YRZA 3FMFA 1ECFA 4GLLA 5EHIA 4BO3A 3A1WA 2WWRA 2WHXA 3ETGA 1HZZA 4M54A 3VPBA 4PYLA 4UMVA 4ZARA 2D0IA 4JCCA 2DRIA 3CZMA 3KHSA 3NWEA 1UJMA 4EVQA 2IV2X 2QLMA 4HNRA 4QE3A 4U2BA 4I8IA 4JNCA 4D45A 1F0KA 3NAMA 5C0OE 3VH1A 3BKXA 3CNNA 2BM1A 2X7HA 4OI1A 1U8CB 4M1ZA 4R9UC 5EE0A 3WRYA 5EKXA 3U2QA 1P9LA 4OQZA 2CVPA 3QUCA 1D2HA 1VG1A 4ND4A 5H4HA 3TSYA 3TZLA 1Y8ZA 3K6SB 4N48A 2J0QA 3MWGA 1ULTA 1DBQA 1H23A 1Y0BA 3OHMA 3WNVA 2FPGB 4KXYA 4X7RA 1Z82A 1N0WA 1LF5A 1E79A 3DVAA 3QX9A 1ESNA 3S44A 4CL0A 1T2FA 2N46A 3BFKA 5C1DA 3RUHA 4M7OA 4LJ4A 5CGZA 2PX5A 3ZZNA 4U6NA 4S1WA 1HOXA 1KDVA 3KALA 1YB5A 3M6UA 4K1XA 1P61B 3D9QX 3EUFA 1G16A 2B94A 4IHJB 3S8YA 3QVJA 3SEAA 1CEEA 2LCFA 3HN2A 3OT4A 4LPKA 4C0AC 5F78A 1WZ2A 1WVGA 3E81A 1ZOLA 3ESZA 4L5IA 1DC4A 2YVAA 4BEBA 1QHHB 1H1DA 1CY8A 1T91A 3DOCA 1V2GA 5ILOA 2O8BB 1G5QA 4LQ4A 3KEFA 4KMSA 2MCFA 3G13A 4PR0A 1QVWA 3RVRA 3CWQA 3BSWA 2QYSA 4P98A 3DMYA 1H22A 2OORA 2WU4A 3Q10A 1TCBA 4HYTA 4L74A 3ZTTA 1BXZA 3BJZA 4UU1A 2FWBA 3V48A 4A92A 2PQ0A 4BQEA 3OSUA 1W59A 5EE5B 2XCTB 4Q3LA 4PZPA 3BWEA 1V95A 2GQ0A 5HBGA 2V3CC 2I71A 2RHGB 2AD5A 4CCWA 4V0QA 3DXYA 3NYIA 3HY3A 2F2TA 1RR6A 1UOEA 4ZAVA 5E4FA 1VL1A 3E0XA 2D06A 2BRUC 3VAYA 2YWEA 1KYQA 1XDDA 4QYWA 4L8LA 2XNDA 2PTGA 5EGNA 1GVNB 1OXUA 4HJRA 5TR9A 4EMBA 1OHHA 1TMOA 2FFBA 5JYEA 4AKIA 4K40A 4YS6A 3RUCA 4ES6A 4RQAA 1MPTA 1Y3AA 1H4VB 1YSCA 2IP1A 3EZGA 3FOEC 2F1KA 3L0PA 4I6GA 3OF3A 1ZHOA 2C4WA 2QTMA 4UCXA 3ZDYB 1B6GA 5J4KA 3HCOA 1Z15A 2V3VA 5FXMA 4IDPA 821PA 3M81A 1KAHA 3F46A 5HX7A 4PF1A 2WKPA 3OCJA 4WCDA 2Q45A 2LVBA 2OK8A 4JQCA 3ZHBA 4YUVA 4C07A 4P7GA 1PK7A 4CKCB 1DWPA 1QP0A 3LWBA 2DCMA 4HGNA 4YIHA 3OP1A 3U17A 3VYSB 1XZGA 2BGGA 1AIPA 3ANTA 3UGQA 5KTSA 2QM7A 1K6MA 5KPDA 1YC5A 3HKDA 1GLGA 3PWTA 3O94A 2FVXA 4MMXB 2PX3A 1OFVA 4AULA 5JH7B 2GGSA 4Q34A 4Q4AA 1THZA 3TI9A 3ZX4A 1WXIA 3EG9A 2AYXA 3UY4A 1LPPA 1CIPA 1JEDA 3HPQA 3PQEA 2OK7A 2A5JA 2HRBA 3DLAA 2C0CA 1ZD1A 4INJA 3VHXA 4DLWA 4OQMA 1SG0A 2GX6A 3PGKA 1RQGA 4UHDA 3LX4A 1G8FA 5E6SB 3PQ8A 4LZNA 5T4EA 4BKUA 5KWSA 1X6VA 1CJUC 4D3XA 4CDNA 4EI7A 1MO3A 3VYTB 3JRXA 3G6KA 3X44A 2E82A 3DZFA 3JQ6A 5C46F 1P33A 2AR7A 2CNWA 1NNSA 3K16A 4ZOAA 3ZCSA 2BVNA 4CKEB 5CPBA 5ALVA 3SHWA 5D3QA 3T7TA 3QXHA 3PRKE 1X7HA 2G5CA 3GLTA 2Q8PA 4NV3A 1E9CA 1KYXA 2AVDA 2ERCA 2B7LA 2ODPA 4H6PA 2H1FA 2YH2A 4OGFA 4QUBA 2IQIA 3WYGA 3D5TA 4JC8A 2GPWA 4WNIA 3KE9A 4ALLA 2EHJA 4DIBA 1MT0A 1VIDA 1WAMA 2JARA 2OSBA 3AONB 4LKRA 4OP3A 4DABA 1AH2A 3ZWCA 4X71A 1BE1A 3FSEA 1KP3A 5BN4B 3WB0A 2I78A 3WRVA 7AT1A 1EJBA 5HMLA 1LRKA 1SZJG 2W90A 4D4MA 5C7OO 1XEWY 2CVFA 4ZT2A 3HV0A 3B51X 4X00A 1UEIA 2WI8A 2O1SA 3ROMA 1H42A 1C9YA 2POCA 1ZI6A 4KUHA 1BS2A 1LBEA 4I8XA 4E3WA 1GFIA 3HVRA 2JLUA 2Q5LA 3RIHA 4B45A 1KH1A 4BL5A 1ZGBA 3AB7A 2IEDA 4YBZA 1WSBA 4R7GA 3I34X 1Y3HA 2Q5JA 4UFNA 2NXJA 2YWBA 5EIXA 1E20A 1Q7GA 1R0ZA 1YQ9A 1YNOA 3CRVA 1J7KA 3VDXA 5IRCD 2M6SA 2ILVA 1XDGA 3J80A 5AW0A 5JLJA 5JVDB 1T9KA 3JASB 2BGIA 4N0MA 4KX5A 3B1YA 1JDJA 5KSZA 1XC7A 2LGJA 5DI3B 5FPQA 2OAP1 5K09A 2JFZA 3QMVA 4I5IA 1AS2A 2EW2A 4G26A 2YIVX 4BMNA 1Y8CA 1KAMA 2FEMA 2VG8A 3GDWA 3OHPA 1UKCA 1VG0B 1GKUB 2BEVB 1UEXC 3FVQA 4Q00A 2B4RO 3T06B 5AVTA 1T0BA 3UGTA 3QKSB 3LUFA 5AUOB 3SXPA 4AO8A 2FNAA 2H1LA 4LJLA 1KK2A 1WUTA 3ER6A 3NM5A 2WSSD 4QPPA 1E3SA 1RXYA 5JNLA 2G5TA 1E0AA 5CTAA 4Q9NA 1DJOA 2H8GA 1JE1A 1GY8A 1X7WA 3EXIA 1KPGA 3KUUA 3OIVA 2AVNA 3OQBA 3EQ9A 1RLUA 3CY6A 3QKRB 4NOLA 5JSKA 3UYKA 3JD2A 1CEYA 3NHJA 3O95A 4R2HA 3LUPA 5EWLA 4B4VA 1LVHA 3ZDDA 4P33A 5G4LA 2OD9A 2F1IA 5FL7A 3ZWNA 1VTKA 3VNRA 4UHCA 1E9VA 4EUNA 4F4UA 3WLJA 1PR3A 4NZOA 1JIKA 1UBUS 2V03A 2J3IA 3W6OA 4JA2A 1I3NA 3ZD8A 4E70A 4EKYA 3VFDA 1VHWA 5ISMA 3HS3A 1TCVA 4UTPA 2PNJA 4QBHA 3UKDA 2F8LA 1BU5A 2XIJA 1CR0A 1HNZB 4H7IA 1N2GA 2IIVA 3BFJA 4RE5A 3OZGA 2XUJA 1ODLA 4H3HB 5DGIA 1SCUA 1TZCA 4E14A 5KNDH 2O7VA 2P77A 2XNSA 2YHIB 3MT8A 3R8XA 5DM70 5AVSA 1G9SA 1A8UA 1P4AA 3CRZA 2A94A 2D8AA 3JPYA 1H8HA 3W05A 2HDHA 4HQKA 5BXYA 1Z0UA 5B6PA 2OLKA 4US2R 3LVQE 2QMEA 2GFIA 4WASA 5B3JA 1T3LA 3E3NA 2Z95A 3K4HA 3SKYA 3T8YA 4MVJG 4AMVA 1Q1EA 1QAMA 1NUSA 4BQQA 4FIZA 1XXHA 3HUDA 1Y8RA 1ZD9A 4H08A 3ACDA 2IS4A 3C6KA 2ICAA 4WN9B 2O8DA 3AG5A 3OCUA 5EQFA 3L8CA 4UREA 4L5YA 2H1HA 4F8YA 1CNMA 3F5FA 3S99A 3VNQA 2ZATA 2XBUA 3L7CA 5HK8A 1MGOA 3FTPA 4XVUA 1VCHA 1OX6A 2O8EA 5KYNA 1Q3KA 3NHRA 1L4EA 1Y9ZA 2PSFA 4WK2B 1TYDE 5EWMA 5I8WA 4OB6A 1NBWB 5KUTA 4G5SA 4IQ0A 4WZAB 3KDAA 3C6XA 3F98A 5LIRA 3KV1A 5FPKA 3ETHA 3R3HA 4RPLA 5DRTA 4R2MA 1NUTA 2AEJA 3IO3A 3RYIA 3JXEA 2QQGA 1UDCA 1X2EA 2ORED 1BRMA 1MVNA 3I3SR 3MJHA 1SR8A 3WLFA 3R6WA 5HE8A 1J33A 3FZEA 5DM1A 5SZJA 1YS6A 3D6NB 2QX9A 4DJJA 4E4RA 3HO6A 1E63A 1CDDA 4JQOA 1GRNA 2P68A 3DTTA 3PV0A 3W5VA 5EZ6B 3DZDA 5KJEA 2WNIA 1JQEA 4XW2A 2IZ1A 4RTQA 1N4DA 5ES4B 4LF4B 1RAHA 3LXXA 4YI5A 2CUKA 2XXAA 1RVV1 2VQ3A 4AX8A 3M33A 3R2JA 2N47A 4WZAE 1ZJ5A 3ROXA 2ZIEA 4QWWA 3P2OA 1WJGA 4GXTA 3BA6A 3U4HA 3UAGA 4C29A 2ZUEA 2AOVA 3BUSA 1SGWA 1GTZA 1XN1A 2M1XA 2PANA 3U6BA 3PA6A 3PDUA 4QUHA 4UAGA 2VHWA 4Q9KA 3ZC3A 1JG7A 2GCIA 3UZUA 3KDSE 3G88A 1NRWA 3SY8A 3ZWAA 4E5PA 2HRDA 2CFTA 4NOKA 3BIOA 3T41A 3WK8A 4M46A 1A2BA 2Y4OA 3L41A 5EUMA 5HM8A 1SZPA 4WXRA 1KU6A 3UWOA 2IHUA 5CYFA 4K26A 4QPZA 2IBMA 3ZZ0A 4W9MC 3EZYA 2H4FA 1ADGA 4S05A 3RYHA 2B2NA 2DLDA 2OZKA 4EGSA 4HRYA 4NBWA 1Z8DA 1Y5LA 3ABZA 4JLJA 3TM4A 3EF1A 3B6JA 1OREA 2GARA 1NQUA 3K8OE 4HJXA 4LN1A 2WABA 4HNTA 1U9ZA 1VJRA 3H2ZA 2Y0CA 3HC7A 1L5NA 3C8HA 5H0IA 3GJ5A 2D62A 3I61A 3BRSA 4IS2A 1F48A 5IANA 1RWPA 4V02A 3LBFA 1RYZA 4HAIA 3CZCA 1LK7A 1ZG3A 1CS0A 1HK7A 1L1FA 2GB4A 5KJ1A 3IQZA 4MV6A 5DM4A 5TGTA 4C3UA 4KHPB 2QG9A 4BMYA 5H16A 4LF6B 5ESRA 1EXDA 1YZNA 2FW6A 3O1LA 4TLCA 3G1UA 2W58A 4KVAA 3BMNB 1XNGA 2ZPTX 4QO7A 2CNLA 2ZOSA 3I62A 3EXHB 4I08A 4D82A 4OPMA 1OY1A 2IUYA 2XQKA 4Y2YA 2WKSA 3OT5A 5I9IA 2PUCA 1FRZA 4FDUA 1S02A 1TEVA 1O5TA 1WX1A 4GI3A 4M1WA 3TZEA 2VQEB 2XUIA 4CLEA 4BN4A 3EGWA 4FWIB 3ZN2A 8ABPA 3BT7A 2G77B 4QUEA 3VTAA 2X7JA 3G2LA 1SNYA 1GUYA 3GAFA 4KRXA 1FDOA 3T0IA 4C88A 3M2PA 4ZMRA 3NEYA 4AKHA 3BG5A 5M5BA 4C7KA 1QS0B 2HCFA 2JDID 3EODA 2BF7A 1VLMA 1KORA 1QTNA 4FGUA 4MV1A 4YJGA 3UOWA 4EKGA 2INGX 2E1RA 2HU7A 3M3DA 1X7XB 1U8XX 1PDWA 2G1JA 1J09A 1L9XA 1H4TA 4EVRA 1DC5A 1GA6A 3LH5A 4UTRA 2QNRA 3GXBA 4F2PA 5DIZA 4V38A 3L1HA 2QUZA 4ZRNA 1CY6A 1GQ2A 1DAHA 3GUUA 4Q6WA 3A9RA 3MAJA 4BC0A 3H9EO 3ZU6A 4ZDKA 1ECCA 3RG2A 5TS2A 2BDEA 5BMVA 2VH1A 1W35A 2I4OA 5IZCA 4F72A 4AO6A 1E7MA 1W88A 3BREA 4O2AA 4UM9D 3PJGA 1ZNQO 5IMBA 3GJ7A 4MVJD 1E62A 1FE8A 3VDMA 4WZBB 2B37A 1N2IA 2AC2A 3GFQA 4ZCRA 3QVGA 3Q72A 2C78A 4IMPA 5KOIA 2V6FA 1ZS9A 4BDTA 4EUSA 2PKCA 5E3HA 5KVVA 4IIFA 2A0YA 4NMHA 3QU2A 5C4MA 4JFRA 3OPYI 3PQDA 4HB3A 3DL4A 3T3PB 1A77A 2UZ0A 4ZQEA 5IF9A 2GVDC 5K20A 3JQEA 1C3EA 4OD0A 1JFLA 4RXTA 5CDYA 2LRHA 5AKIA 1EBBA 3K6KA 1GVHA 1GN8A 2VDQB 4YYZA 1JN0A 1PZFA 5M7EA 1VRWA 2RARA 4OH7A 2V1UA 2FQXA 2V7TA 2VT7A 2WFLB 5MN6A 1QBKC 3ONVA 3E1GA 2VBIA 4TSFA 1KJYA 3W1VA 2PZFA 5A5GA 3RHTA 2HUNA 3N0TA 1T5LA 5JWHA 2WAYA 3HCRA 3LQ4A 2CWWA 2TMDA 2BGNA 2EWMA 1UXOA 4WOCA 5K9ZA 3EF0A 3IQEA 4LK2A 1LZLA 4EOGA 1JAZA 1M2FA 3PXAA 4NE7A 3QWIA 4PZUA 5B4VA 1WXDA 3D7MA 4JLBA 2HV8A 1FDSA 4BQPA 2GT1A 3BULA 3BB3A 4XWOA 4EO4A 1G41A 1D5CA 4HDNB 2FFJA 3OM1A 4WOJA 5I7EA 2Q6OA 1OWLA 2Y68A 4IOLA 3N28A 4MQ4A 4CMCA 3V8MA 4DMFA 1OJLA 1U8FO 3DLBA 2VCHA 4KPGA 3WDMA 2X8AA 2WU3A 4GBGA 3EFOB 1OFTA 4LY9A 5DM60 1N77A 4QXMA 4RU1A 4RV4A 4YJFA 4A2CA 4OMFG 4R9RA 1XDSA 3UO8B 4QXRA 3SYMA 4C4OA 2PL3A 5CDGA 1C81A 1BJRE 4R83A 4ER5A 4ND5A 3K0SA 4QPJC 2A30A 2IEIA 1E61A 4EMSA 2FP3A 2MSDB 2N9UA 2PKEA 3NV9A 4CMBA 1T24A 1L5SA 1JPVA 1MX9A 5ILQA 3ND7A 3OEHA 1UMCB 1ZSVA 1ZVQA 3JARB 4CZ2A 3CLKA 2JA1A 3G49A 1DBVO 4KQHA 4G0QA 4AURA 1C0KA 3NJRA 1D8TA 2I7CA 3GHYA 3SX4A 4AJLA 1DTEA 1Z2NX 2H54A 4NOMA 2AOXA 2E2WA 4WFKA 4YRJA 3BRWA 3NUZA 1ZJ6A 3S55A 1MFZA 3ZXYA 3SMVA 2FZLA 5TQ2B 3VR3A 1UF9A 2J5RA 3PFKA 4ALNA 2H51A 1CRZA 3D64A 1XN4A 1U7XA 3CVJA 3PHJA 4X8HA 1TADA 1M74A 3L7BA 3E5RA 1FUKA 1CF9A 1QO0D 1SJ9A 3GMSA 3K35A 4JJ4A 4S1PA 4DJEC 4PZZA 1YV9A 2QWXA 2YS6A 3HADA 1WZNA 9ATCA 3IEPA 4E08A 5JCZA 4ILKA 3T94A 1HORA 3NAZA 3ICOA 1K4KA 2Q1YA 3PD7A 4KXFB 1TM7E 2N1BA 4PANA 2V3WA 1KTIA 3ESXA 1E2KA 2O2CA 2R96A 3MA0A 5AXAA 1DKUA 1DIOB 2CEKA 4B3HA 2ODBA 5BUZA 3FNGA 2FRDC 5KTYA 4X1KB 3C1TA 4UMEA 2OCLA 4KDRA 3DXZA 5LOVA 3TNDA 2V58A 3W4IA 4Z4IA 1VOTA 3I23A 3I42A 4RADA 3PSAA 3VOSA 1SVWA 1RWXA 2PSSA 3IR6A 1KYYA 2WUWE 4U7GA 4NPCA 5K1ZA 3BDAA 1CWUA 4PLWA 1ZK4A 4DLLA 1U3UA 2W0SA 3NGLA 2VP2A 4MJLA 4HB2A 3WA6A 2RONA 2NPIA 4LMBA 2VHXA 4X8MA 1WXXA 5DDIP 4Z9YA 4HPJB 4EA6A 2YV2A 1N7GA 2CFSA 3AWIA 2ZQZA 2EL7A 4DMKA 3DLHA 3QLEA 2FDRA 3QTBA 4C4ZA 3EA5A 3PENA 1GILA 1HE3A 3RSOA 2QJRA 3TDNA 3T7DA 4HLUA 4TZ6A 5ALSA 4C4RA 1V4NA 4GWKA 1GDDA 3P9KA 2WILA 3CW2A 2I8LA 2Z5GA 3IOEA 3P4UA 3VI4B 4HH4A 3M2TA 3KVYA 4I50F 4D9FA 4G0ZA 1Q0QA 2IODA 3OFKA 1E3MA 1KY4A 4MRNA 3MTGA 5B64A 4YQEA 2CJXA 5AJZA 2MTBA 5IUKC 3CNOA 3BXZA 5DNWA 3WAJA 1Y3CE 4IL5A 2BV3A 1SM4A 1JG6A 3LOQA 4KH0A 1M3SA 1TIPA 4UKDA 4B3MB 4EYGA 1C1HA 1B2LA 2C1XA 2H1VA 3IIJA 4DXDA 1PYGA 5DI9A 2XCRB 2VRCD 4F4DA 1EX7A 4P35A 4D2IA 1U2GA 4IZOA 1WNTA 2HWUA 4AJEA 2PKXA 4D1YA 2PUFA 4JVMA 1YUBA 4EIWA 1EM6A 1PNQA 2QSUA 1V3VA 1CPYA 2GZHA 2QTRA 3Q3VA 4GXNA 1PD1A 5IT4A 5GPBA 1M5UA 3JWIA 1W30A 1ZUD1 3DEIA 3DMHA 3THXB 4M99A 5JMPA 4G0PA 4UTOA 5GOTA 4JL8A 3GOHA 3GL9A 1HL7A 4ER7A 1DS6A 4Z2YA 1R18A 2H18A 3ZD9A 2QD2A 1H2WA 1T15A 2B3DA 5B53A 4X65B 4QQNA 3UEOA 4WWHA 1L5ZA 2G9RA 2JFWA 5FFMA 3S68A 3C41J 4QGAA 1U6JA 4CM7A 4RZQA 1KSHA 4Y6SA 3M9WA 3CSUA 3E22A 1OCEA 1UC4B 2RHCA 4J0KA 1Z0AA 1WMAA 1JR6A 1E9EA 4ZU3A 3D3KA 4CM5A 4JL5A 3QTLA 2AGVA 4TGLA 4WH0A 5BURA 3HVJA 3WMXA 1HL3A 3C85A 1HE2A 3DKRA 3DHNA 2AA3A 4D9EA 3KZKA 1CVRA 5JQWA 3QWAA 3MSCA 1JSLA 1Z5NA 3O8OA 3SZGA 4A27A 5E3IA 1Q1AA 2NVWA 3A6HA 4KAXA 2D4AA 4TVBA 4KI7A 4CE6A 2QXYA 2WEKA 4NZYA 4EEKA 4XXHA 2BBTA 4DMCA 4HLQB 1A2KC 1B0AA 4QJ4A 1JEQB 2I33A 1ZH0A 3ZZ1A 3VKGA 4G4SP 1QMPA 4H18A 2Z1NA 3HP7A 2ZITA 3M70A 3OT1B 1YA8A 3RLIA 4ZFNA 2WVJA 3FTFA 1M76A 1FNMA 5JCOA 2VHCA 1CUZA 2IHJA 1AA9A 2WIGA 3AI2A 4YP6A 4WBNA 1FDVA 3LMKA 3EQ2A 3H8JA 1T5TA 4HGOA 4B76A 1PQWA 4TOIA 3U3OA 4AF6A 4DJ5X 1IWBB 1TNDA 2VWPA 3S2SA 2HLPA 2BY4A 4E7PA 4F21A 2J0EA 2X6QA 4L4ZA 4GEGA 4HYQA 4D4IA 1TVKA 4Q7LA 3S27A 4A0QA 1NR7A 4MEBA 2IX9A 4D42A 3W7AA 3UW1A 3GN2A 5DP1A 4OA8A 3JQ7A 4GAEA 2M1ZA 1AB5A 1X7YB 4BAUA 5AMXA 1GAWA 3RROA 5B36A 1QE5A 3AY7A 1W2GA 1K9SA 1U9JA 2BTOA 1VM6A 2GKSA 2C3OA 3G9ZA 4M37A 1R0RE 4WPGA 4Z8YA 3FCCA 1E66A 2PMCA 3VTKA 4RULA 1N0UA 3LV8A 4EVIA 2UVPA 3M8KA 1O87A 4BUCA 3PUJA 5KTPA 3K72B 3G5UA 4G07A 5AOVA 4Q9HA 1T5HX 4LMRA 5A7FA 1KOLA 3RPEA 4JOBA 4D3FA 1RRFA 3AEKA 2ZBDA 3L4BC 2WJ6A 1YOBA 4ZI5A 3IUPA 1LW6E 1JXAA 3TRIA 4CMAA 2G04A 3JV7A 3IGFA 2VYNA 2AJ8A 1LA2A 3JCZA 3ZGYA 2IGTA 4UPEA 2V6GA 4HNUA 2NXNA 3TTXA 2JVIA 3SC4A 5JNUA 1GQYA 2UUBB 2Q4DA 1CUJA 4BP9A 3DSRA 2YMMA 1E2DA 3OA2A 2XRFA 4Z9BA 2YOFA 4GE0A 4WBXC 2PX0A 2OGWA 3L18A 5AI0A 2P67A 3DCJA 4L2IB 1IZ8A 4W9NA 5ERXA 4F3RA 2JLYA 2Z2YA 1CUDA 2NSHA 3LFHA 4UNIA 1XP8A 2G9NA 2CZCA 2VRWA 4OQ4A 3PJDA 4XPZA 2LIPA 3TQRA 1Z39A 3TTSA 5JCJD 3K9BA 5U9CA 4CQNA 5U4XA 3TZQA 1BO6A 1D2NA 1EJ2A 1IZ9A 3FNHA 3QY9A 1V6AA 2GH1A 4PZDA 1CE8B 1JHDA 1I1OA 1B1CA 1OYOA 1GR1A 2BKEA 5DXFA 4LYYA 2RAVA 5JATA 1ZGGA 3AP2A 5LPNA 3KLPX 3AXSA 4BLUA 5ITSA 2SCUA 1SO8A 3F97A 4BLWA 2IOFK 3VXKA 1QKJA 2GN6A 5KU1A 4OHMA 5I9LA 1KNXA 2V7EA 3C3BA 2C2YA 5G1PA 5E7JA 4X84A 3LDAA 3UATA 1MD9A 4EAQA 3N2LA 4UNQA 2DWQA 4R8KA 1AO0A 4WXMA 1R50A 2G9UA 3GLGA 2GA8A 3OE7D 1KMCA 1E2UA 3PDIA 4QXOA 1K68A 2NZ2A 4P0PB 1BVYF 2B4AA 2FF5A 4HN9A 5K0EA 3MT9A 3MB8A 2EC5A 3I01A 4XUGB 3KQUA 1GEGA 3A4YA 1ZUHA 1Q84A 5HDQA 5KS2A 3FR7A 1PFVA 3HDTA 5ADHA 2GXAA 4I0WB 2O05A 1J8YF 2VPYA 4E2FA 3O7WA 1IC6A 2B5WA 1MUUA 3SZLA 1XALA 2I6UA 1DRKA 3F3SA 1HDGO 1SC9A 4HTFB 5FA8A 3VR6A 2Q6LA 1G5HA 5EZQA 1ZBQA 2XGJA 3VPGA 9MHTA 1QYCA 4LJAA 4CM8A 2BKAA 1LPBB 1Z47A 2R2GA 3IUJA 3HUEA 1I2DA 4FINA 2FW1A 1H3NA 3SJAA 5AVKA 4G2TA 2PCJA 3AC0A 4RYLA 5HVNA 1ZU4A 1IVYA 4Y6OA 1OT5A 4HAYA 5AVJA 1FFXA 2RKWA 4A8HA 2AWOA 3I30X 1E2HA 4RIFA 5I7FA 3CR3C 4JUDX 4TWIA 3IILA 4V0NA 1ICIA 3NHPA 4EO7A 4IXWA 2AJDA 3AW9A 3NPAA 1SXJB 1TF7A 2GM5A 1NE7A 3AUKA 4PSVA 4PYRA 4FONA 4CKYA 4FIDA 2EKDA 1C1DA 4LY3A 3S7ZA 3GCGA 1X1SA 3LFTA 3NHBA 2HK6A 3I04M 4M21A 3K96A 1T8PA 1E3QA 5EZSA 3IALA 2DKFA 2WG2A 4JLNA 3ANLA 4LC1A 3URKA 2VR1A 5JMWA 1JAIA 2IYWA 1K5DA 2D7JA 3MQ4A 4I36A 3IAFA 5BVGA 1Y42X 5C9ZA 1JF8A 2VBFA 5L6LB 2IT1A 2PH7A 4BVBA 1HDRA 3X1JA 3NCHA 4URHA 3V55A 721PA 5K05A 4IJQA 1BZYA 4JJ6A 4WCVA 1JR3D 4ZAXA 3HUFA 1P7YA 1XJ5A 2NQ2C 1O5OA 3EZ2A 3R7NA 2VDWA 3R3SA 2FMTA 3KQQA 2PZBA 4N5MA 1Q50A 1OTHA 1SXJE 1UC9A 5SY6A 4C03A 3GNQA 3MTEA 3AG6A 4IBOA 2NTEA 4QX6A 1Y5RA 1BS9A 1Z7YA 1HEIA 2FW7A 5CYOA 4F3CA 1GTSA 1CR4A 4NHOA 2EAUA 4ZREA 3UT6A 3U7GA 3IPXA 4U2EA 5AW5A 1GNPA 1WVMA 2EFCB 3B3AA 3HVUA 3M6IA 4Q21A 4EQ6B 3ZNOA 4LDPA 4KE8A 5K01A 2RHDA 1OOEA 2V59A 5T7BA 1T10A 3CM0A 1KDTA 4IW3B 3MCAA 2ZT6A 1DE0A 2PQ2A 2ZBFA 1FU7A 3GEMA 1SQ6A 1YQGA 2L17A 5AI4A 5EZYF 3NONA 2XA1A 3P4XA 3LP5A 4CLOB 3ZI7A 1D4FA 1KJZA 4NBSA 1X8JA 2WAXA 3QELA 3WS7A 5C81A 3T52A 4KVFA 4RY9A 3WXBA 1Y4AE 4UFPA 1S2OA 1XWIA 3L8FA 1XO1A 2AOUA 1QYXA 1QFXA 2QYHA 4PWZA 3UWSA 2VP9A 1Q19A 2W00A 3BRQA 4FT4A 4Q1AA 5CUQA 1QH8B 5HKKD 1V7PC 5C7YA 2Q1UA 1EQ2A 2IOFA 5SYAA 1W8IA 1F6DA 4HAVA 1HDXA 5DP2A 1P4GA 3KQWA 4IJ6A 3TKLA 2OGSA 4G5RA 5CYPA 5THKA 1G8SA 3QHAA 3IEUA 1FSZA 4ESOA 4ZDIA 4ITRC 3ZV4A 1CW2B 2HIAA 4G2NA 2X3YA 2XGMA 1SVSA 4L5AA 3UYLA 3K0HA 4O3FA 3UA4A 4GO1A 2PUEA 4TMKA 3SM9A 1ZD5A 3Q6MA 2BBOA 3DFUA 1I24A 3QXSA 4L57A 4Q3KA 2HYDA 2DECA 2FCAA 3A2MA 3Q9LA 4YP0A 3SWWA 4I3FA 1T34A 3ZVNA 4RD3A 4OXIA 1NPDA 2PT7A 3HB9A 3PGVA 4DQDA 3BWMA 3BSSA 5JJCA 5DNYB 1ZCBA 3JTEA 2Z2ZA 2AXNA 1AKVA 2ZRPA 4GNRA 3FNFA 2FPPA 4R1PA 4PLGA 1Z08A 3RI3A 3LY9A 2H31A 2X41A 4LECA 2RGXA 1XTIA 5EC8A 5KU7A 1P2SA 3H2IA 3ZE1B 3UUFA 3HA3A 1VP9A 4RENA 5BW5A 1UOPA 1XP5A 3IPLA 1S01A 3EGCA 5HR5A 1P2TA 1DB3A 2B8NA 3G5TA 3WBFA 2C2OA 1QGUB 2I6SA 4GW3A 5AR1A 5LXTB 1SH7A 4LHSA 1ZDMA 2I4IA 3G2QA 1SOMA 1JSXA 2VDMB 2V0CA 5A9SB 1N9ZA 1FPQA 5GINE 1Q44A 4BVKA 4AROA 3QKUA 3O4RA 1MZVA 3ZGLA 4G0OA 4Y30A 1MT3A 4ETNA 1E3TA 4W7IA 1DAIA 1NJ1A 5J1SB 1FQJA 4G1UC 4YY3B 4B47A 1K3FA 3Q0TA 4ZV7A 1XVVA 1L4FA 3A2KA 3KB8A 1YGPA 4GVLA 1YR2A 2YJZA 1I80A 4OM7A 5KNCA 4ZT7A 4BGEA 2ZULA 1L6RA 2WM8A 1T8YA 3DWGA 4ZDWA 3TTWA 2FPKA 3DZ8A 1W5AA 5I4BA 5JRDS 1EIWA 1N5KA 1U0FA