5DWDA

Crystal structure of esterase pe8
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
215
structure length
215
Chain Sequence
VKLSGPMLPAVSGAAKSLVVLLHGYGSDGRDLIALGQFWRDSFPDTMFVAPNAPHVCGGNPFGYEWFPLDLERDRTLARLAGAETAHPVLDAFLADLWAQTGLGPADTILVGFSQGAMMALYTGLRLPEPLKAIIAFSGLIVAPEKLEAEIASKPPVLLIHGDLDDVVPVIGSETALPKLIDLGIDARLHISQGSGHTIAQDGLDTATAFLREIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Esterase
publication title Structure of esterase PE8
rcsb
source organism Pelagibacterium halotolerans (strain jcm 15775 / cgmcc 1.7692 / b2)
total genus 71
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5dwdA00
4GHWA 1ODTC 3DQZA 1SCKA 2C0PA 1XKTA 5CURA 4B6GA 4QA9A 2V98A 5CT4A 1T2NA 5CXUA 1FFDA 5CT9A 4JEIA 1XZLA 5ALUA 4E14A 1P0QA 4X6XA 4GBGA 1UK7A 2GBIA 1F8UA 4OU4A 2XMRA 3HI4A 2GBGA 3EF3A 4H77A 3DKRA 4OB7A 2G5PA 4MEBA 5EIEA 5C8ZA 2XMCA 3H2IA 1DINA 4KAJA 5ALSA 2O2GA 2QZPA 5ESRA 3FWHA 1GT6A 4QDOA 4IO0A 4W1SA 5LP1A 2WILA 2XI4A 3QPDA 1FJ2A 3DDUA 5HF8A 1MAHA 5AKHA 4LXIA 5HF6A 2XMQA 4TPKA 5SYNA 1TIBA 1ZI9A 1O6GA 4B81A 3E0XA 2C5FA 2EEPA 5ALTA 5LYYA 3STXA 2DQZA 3D2BA 3DL7A 1W75A 3SK0A 2QJRA 3KWJA 5AK5A 1ZD3A 1NU6A 5ALGA 1VZ2A 4Q34A 4WY5A 2PKYX 3I2IA 1R50A 5AOAA 4G9EA 3NGMA 1XQYA 3FNBA 1MPXA 1HPLA 1BS9A 1VE7A 3CN7A 3FLEA 1XZMA 3JYHA 3NOXA 4QDZA 4AZ0A 3ZLTA 3L1IA 2Z3WA 3STYA 5ALXA 1QFSA 4QWMA 4X3CA 2QRUA 1CFJA 1LGYA 2VJCA 1R9MA 5K3AA 4Y2TA 3WK4A 1OILA 4G9GA 3QITA 4B7ZA 1GPNA 1BRTA 2J4CA 2AJ8A 3QMVA 1TCBA 5HK9A 2BUAA 4FLMA 3I1IA 4EHBA 3W2TA 2BCEA 2WHPA 4KR0A 1QIHA 3N2ZB 4BYMA 3C8HA 4MQLA 4ARAA 5K5EA 4XWGA 2WIFA 3EQ8A 3QMWA 3WA7A 2ES4A 1XQWA 1AQLA 4J3JA 1EK2A 3DYVA 3WYDA 2AJBA 1EINA 4BC0A 1UK9A 1CPYA 3R0VA 2WSLA 1SCQA 5CT6A 2G63A 4MQMA 2XE4A 3I28A 1EDDA 4S0XA 3IUQA 4PW0A 3WK9A 1QZ3A 3FBWA 4CCYB 3Q8WA 4H7HA 4H7KA 4OU5A 3DL4A 1G42A 4ARBA 3FAKA 4HXGA 2HA3A 1GPLA 4KRYA 1UKBA 5K3BA 2PU5A 5CMLA 3ED1A 3B12A 3I2HA 1LBTA 2WIJA 4FWBA 4ZGBA 3WI7A 3O9MA 3D3NA 4BP9A 2CKMA 1H2YA 1TCCA 4X6YA 1BCRA 4FLFA 2WG1A 4IH1A 1ODSA 2I3DA 4OYLA 3WA6A 4HTAA 4GLBA 1USWA 3FVRA 2C7BA 3AJAA 1LPPA 1E8NA 1GXSA 5EIHA 4KE6A 5EI5A 3QH4A 5D3KA 2Q0XA 5JAOA 4HRXA 4Y2VA 1JMYA 5DJ5A 1CLEA 4V2IA 2YXPX 1P0MA 4P9NA 4B85A 5CRIA 4RPCA 2OCLA 5FP0A 1J1IA 3LS2A 5D3ZA 2Z8XA 2H9YA 1YSCA 4E15A 4K6KA 1QO9A 2WTMA 4B80A 1CUFA 4DM7A 1U8EA 1XRPA 1W76A 3G8YA 3WKCA 2GBCA 2HFJA 2XMSA 5AI0A 4X90A 3I6YA 3G0GA 3IA2A 5HFNA 2ACEA 1Q84A 3V48A 1LZLA 3PUHA 3BDVA 1IZ7A 3P2MA 1QIJA 1XZFA 3MVEA 5ALHA 2WHQA 1ZD2P 1XZBA 2OGZA 1CUXA 3I2FA 1CUAA 3L1JA 2XQFA 5YASA 2G4LA 1TAHA 2IITA 5DYYA 2Y2UA 3WK7A 5E4JA 2RAUA 4L0CA 4H7JA 4QDXA 2C58A 4UBLA 1BN6A 1I6WA 3TRDA 1XLWA 1K4YA 2VJDA 4FBLA 1LBSA 3RARA 4Q1VA 4J0IA 3I6ZA 1HBJA 1GGVA 5KWIA 4FLEA 1YB7A 3BIXA 3QZUA 1GKLA 2BUBA 1MNAA 4CG2A 3M81A 3BIWA 4AB1A 1GKKA 2B20A 2XMDA 4JNCA 3R3VA 4Y2UA 5I8PA 4P08A 1A8QA 1UT6A 5AM4A 3DS8A 5E4TA 1YCDA 1EB8A 4AN0A 1ZGCA 2XUGA 1DU4A 2CEKA 5K3CA 3DYIA 5HZGA 2ORYA 4BVLA 1HKHA 2VEOA 1BU8A 5A71A 4H7EA 2PBLA 3BJMA 1XFDA 2OQIA 5LKRA 3OURA 5T4EA 5LZ7A 4CCWA 4X95A 4WFIA 1X70A 2QMQA 2PSHA 4DNPA 4XIIA 1NX9A 5AKXA 1EB9A 1XLUA 1Y7HA 3STWA 1WOMA 3VVLA 1JJIA 5JD5A 3WL8A 4UHDA 3T4UA 4UHEA 4OPMA 4DIUA 3D5EA 2J3QA 5IKXA 4X97A 5H3HA 4OSEA 1UOPA 4W63A 1AKNA 3S8YA 4CG3A 5LZ2A 5ALYA 4X71A 3KXPA 1DWPA 5LIPA 2WKWA 4UHBA 2WUFA 4FTWA 2DHEA 1XLVA 3KD2A 4F60A 1E8DA 5KWJA 1L7RA 3BJRA 1KEZA 1K63A 5EHQA 2QS9A 4WFJA 1BN7A 4N5HX 4Q3OA 3AZPA 4GW3A 4AN1A 4C88A 3T52A 1W52X 2B61A 5EIAA 3ZI7A 3VJLA 3ZPXA 4GI1A 1MX1A 3SC2A 1VKHA 5JAPA 1C4XA 1T4MA 3R40A 1WM1A 4EZIA 1YB6A 2JGEA 4EA6A 2JGMA 3O0DA 2WQZA 1ZD4A 3HACA 3G7NA 3U1TA 3V1MA 1ZGBA 4U2DA 4PSCA 4XX1A 1UKAA 3BL8A 1W1IA 4WCVA 4X92A 3M83A 3W05A 4FFVA 2HA7A 2PM8A 1FFBA 5CH8A 4DNOA 2WIKA 4LKOA 1YAJA 2I78A 3PFBA 2XDWA 1FFEA 3WIBA 4DMFA 4N8SA 5JYCA 1LPSA 4J0KA 4B83A 1CEXA 3WKDA 1Q0RA 1TRHA 3V1LA 3JWEA 2OQVA 1EH5A 1ODCA 4X94A 5C7YA 5BWCA 1YS2X 2WHPB 4FMPA 3OOSA 1A8SA 1LPBB 3G02A 3N0TA 5AOCA 3CCBA 2PVSA 2GBFA 3WWPA 2RHTA 5AI6A 4Y2XA 4EB0A 4YK7A 1CUJA 1E89A 2XUDA 5JALA 4FBMA 3WWDA 1JMKC 5BV7A 3WJ2A 1QOZA 2BGNA 1LPNA 4AZ3A 1ZIYA 4HZGA 4L72A 1CUHA 5ALEA 4ETWA 4EY8A 1CUEA 4KYVA 2RGUA 3WZLA 3VXKA 2B9VA 1N8SA 3UMJA 2OCGA 3DEAA 5HQ3A 3V9AA 4QDTA 1PJAA 4UFPA 2BAGA 4U2EA 5AK4A 4JH0A 2CBGA 1XRRA 4AX4A 3H2KA 3F9CA 1QGED 2J4FA 1VOTA 5AKEA 3O4IA 2PSFA 3R3XA 4PSUA 3EQ9A 2BKLA 1AZWA 5ALKA 5EFZA 2PSJA 3UUEA 1DQZA 1IVYA 1GQRA 3R3WA 3C43A 5FXMA 5ALNA 4PNZA 5DYWA 4KAAA 3WQHA 1CUGA 4J0HA 1ZD5A 4YX9A 2B4KA 1EI9A 4FKBA 5JATA 2VJBA 6YASA 1Y7IA 5F4ZA 4QNNA 3IB3A 4P92A 1XZKA 3R3UA 2W22A 4Y2JA 2PX6A 4BVKA 3WMRA 3TEJA 3WK8A 3AIOA 4BC1A 2QTBA 2R8BA 3FYUA 3PI6A 3A2NA 5AKZA 3R3YA 1B6GA 3C6ZA 4DYHA 1YASA 4QE3A 5JADA 2RHWA 5ALVA 3IUMA 2V96A 4FFWA 1WPXA 5ALOA 3TGLA 2ZYHA 1BE0A 3OC0A 2WU3A 3C6BA 3VISA 1ZICA 3DKKA 1SFRA 2DFPA 5IVIA 3ANTA 3K6KA 4UFNA 4FNGA 3A2LA 4NVRA 4FDMA 2WG0A 1DX4A 1CIJA 4X85A 1CUWA 3H2HA 1QFMA 4W9RA 4U2CA 4MYSA 4UBOA 3ESBA 3H0CA 4AO7A 1R1DA 2QJWA 2ROQA 3IUNA 4XJVA 5CTAA 4ZWNA 1CUIA 1EA5A 3WK6A 4I19A 5AIAA 4QEKA 3GROA 3GUUA 3FOBA 3QMMA 3CCCA 3SWWA 3STVA 4X7BA 3DD5A 3FCYA 1IMJA 2VAVA 4MEAA 3B3QA 1ORWA 2LIPA 2AXEA 1QTRA 1XZEA 2WHRA 3F98A 5EHXA 1W4LA 4MJ3A 2DR0A 2WJ3A 1EK1A 2DSNA 2AJDA 4IH4A 4KE9A 1UZAA 4C89A 4B82A 1DT3A 5CH3A 3MUNA 1OCEA 5JZSA 3E4DA 3EBLA 4HXFB 4BTLA 1XZAA 2WFLA 3GFFA 2ZSIA 5ALQA 2ECFA 4OD0A 4CFSA 1WHTA 3H2JA 1NU8A 1QLWA 4B0OA 1J06A 5HCUA 3WYNA 1LPMA 1F6WA 3JW8A 4IH9A 1WB6A 2RIPA 2CZQA 3RKSA 1X2EA 2JGFA 4H7IA 4H0CA 3BF7A 2CJPA 1EX9A 3B5EA 4DLNA 3WKAA 5CW2A 4BZWA 2XUQA 1CUUA 3SX4A 4KE8A 3R41A 2HA6A 2HHAA 2CB9A 1WB4A 4Q3KA 5A2GA 1H2XA 2EDAA 3QPCA 2O2IA 3HEAA 5ALWA 2VAXA 4GEGA 1MJ5A 5AK6A 1R88A 1JJFA 4F21A 4W1RA 5DWDA 3M3DA 3VJMA 4UUQA 1MNQA 2DHCA 4E46A 4AO8A 5JD6A 3W9BA 1E66A 4K6HA 2XUKA 2HFKA 4GDMA 1BCSA 4DNFA 2PUJA 2BJHA 4G4GA 5ALFA 3WK5A 1ETHA 1IUPA 3EQ7A 2G5TA 1AURA 4UBJA 3R3ZA 4DGQA 4ZRDA 4AMZA 4AQDA 5AO9A 1P0IA 3MGAA 3FCXA 5ALRA 3ESCA 4Y9SA 4B84A 1C7JA 3G9UA 2VJAA 3FLAA 4NZZA 4WY8A 5LZ5A 5AKIA 2PUHA 2Z3ZA 3C87A 5D7BA 4UPDA 1HL7A 2HU7A 4UHHA 1CVLA 1AX9A 4Y2QA 1XKLA 1N1MA 4GECA 4KE7A 4M0EA 1JU3A 4OUKX 4C01A 5A7FA 1A8UA 1M33A 1Q0ZA 4MWTA 2XUOA 2FJ0A 4G4JA 4Q3LA 2HA4A 3G0DA 3H1AA 1UK8A 3PUIA 4BAUA 4OCZA 3WWEA 4C87A 1R4ZA 1RWQA 2XLBA 3AZOA 4LXGA 5K3FB 3PDCA 5HK8A 2VA9A 1CQWA 2JEZA 2XUPA 1DX6A 2NW6A 3G0CA 4BAGA 4B0PA 4BZZA 4K2AA 1MTZA 1BROA 4X6UA 4WFKA 3D0KA 1U65A 2WIGA 3F8SA 2Y6UA 1L7QA 1YAHA 5HQ3B 2H7XA 3ZLUA 1EVEA 3HYSA 3BE8A 5AM3A 5FUMA 3VDXA 1XROA 1JJBA 4Y2YA 3F97A 1CUCA 3KOOA 3RLIA 3VKFA 5DNUA 2I3ZA 2O7VA 3OM8A 4INZA 5DTJA 4C4ZA 5BWBA 2H7CA 4RNCA 1G5FA 3Q0TA 1LPAB 2PPLA 3HZOA 1JFRA 1BEZA 5HKBA 2UZ0A 2Y1KA 3I6MA 5AJHA 3FSGA 4CCYA 2WFZA 2XQIA 1AC5A 4UHCA 4Q82A 2K2QB 5JARA 3C45A 1Q83A 2JGJA 5DTIA 1MT3A 4MWSA 4ZREA 2HIHA 3PF8A 2WUGA 2D5LA 1ZOIA 5AK3A 4IQ4A 4PQEA 1RYYA 3L1HA 3IUJA 2IIVA 2XUAA 3CN9A 4DSAA 5JZBA 1OXMA 4M0FA 5AM2A 3FYUB 4ZI5A 5IVDA 1UK6A 5ALPA 5FLKA 2PSDA 1N5MA 2GYVA 2C5GA 3I2JA 4ZV9A 1QIDA 1QJ4A 3D59A 5J3JA 3PFCA 5ALJA 4H18A 3C6YA 3QM1A 1JKMA 5T4HA 3GA7A 1WCYA 1A88A 3W9UA 2WLSA 2HU5A 3ILSA 2YASA 1XZJA 4BDTA 4F5ZA 1EXWA 2OLEA 5EGNA 1XRLA 1O6FA 4DMKA 1TKRA 5A6VA 2XB6A 2VSQA 5JAUA 1FFCA 2PSEA 3IDAA 4YASA 5ALIA 2FJPA 2Z5GA 5LLSA 3STTA 1EHYA 2JF0A 3FYUC 3G9ZA 1VA5A 2QXUA 3HJUA 4NS4A 5LKAA 4C4XA 1HQDA 4U2BA 3W06A 2W6CX 3WKEA 4AMYA 5CXXA 3O9VA 3H17A 1F0NA 3ICWA 2H7YA 4F0JA 3U0VA 3I2GA 3IULA 2VT7A 5KBYA 1QIMA 1TQHA 4KJXA 1UFOA 5CH5A 4GWLA 3AUKA 4BP8A 2OCKA 3STUA 1VE6A 5JIBA 1N5RA 2VQ6A 1XZCA 1G4HA 4J0GA 5AOBA 5EHNA 3ZLVA 4Y2SA 3WLAA 2O7RA 2D0DA 2WFLB 2AJLI 3W04A 1QE3A 4UBMA 4Z49A 3HLKA 3BF8A 2V97A 1CUVA 2AJCA 2XMBA 5AH0A 4N5IX 1XZGA 5AM0A 2H1IA 1LNSA 4G8BA 4LYEA 3BXPA 4OB8A 3O4JA 1ZI8A 5AKJA 5IH7A 2XQGA 4O08A 4OB6A 4KACA 5JD4A 4EUSA 2DQYA 3ZV7A 4EY7A 1WHSA 1AMNA 5LZ4A 1H23A 5AKYA 2CMFA 4AXBA 4C6HA 4KAFA 5DNVA 4BB0A 3AIMA 1YS1X 4HXEB 1BEEA 3WIOA 3IVMA 3GBSA 5C8VA 3LCRA 2JGKA 2WUDA 1THTA 1QONA 2QR5A 4P93A 5ALLA 2HL6A 3C5VA 2ZJFA 3C70A 4EY6A 1P0PA 7YASA 2XUFA 3MUOA 3GELA 2OAGA 2WG2A 5DLPA 1W6RA 3YASA 5BOVA 3PF9A 3PE6A 2QVBA 4Y2PA 1HDEA 1G66A 4UFOA 5CT8A 3K2IA 2OGTA 4BATA 3WJ1A 1VLQA 4BBZA 4UBIA 2OG1A 3QBJA 2BFNA 3WL7A 5K3EA 2OXEA 2YYSA 1A7UA 4BDSA 2IX9A 5FRDA 4CIAA 4J03A 5ALDA 1GPKA 4JYMA 4UHFA 1CV2A 1SOMA 3D2AA 1VZ3A 4X00A 4RE6A 1LZKA 2QT9A 1C7IA 1ZJ5A 4J0CA 1XZDA 1YR2A 3F96A 4FOLA 2QOEA 2QUBA 4HS9A 4J0JA 4CIBA 5HF9A 5HKAA 3V1NA 1YA8A 1R3DA 2JGIA 1GZ7A 3I2KA 5ISMA 5IVHA 4Y2RA 5FKJA 4A5SA 3GZJA 3G0BA 3QVMA 1H22A 1UOQA 1R9NA 2ONCA 3H04A 3DOIA 2JGLA 1H2WA 5ALZA 5A62A 3D4LA 3QPAA 5KREA 3K9BA 3NUZA 4BE9A 2JEYA 1UWCA 4DMHA 5T4FA 2ZJ7A 2XUIA 3KWFA 3WWCA 2P8SA 5FV4A 3ANSA 1XZHA 1MX5A 1ZJ4A 4EY5A 4B9AA 5ALMA 5DNWA 5HF5A 4L3WA 1XRMA 2I03A 2XQJA 4J7AA 2PL5A 4A16A 4DMCA 1JU4A 1UOOA 1AUOA 3O4HA 1XQVA 5I7UA 3FSGD 2BGRA 2YH2A 3IIIA 4PF1A 1EVQA 4M0MA 1QIGA 4BCCA 1CUDA 4BCDA 4GXNA 3O95A 4WJLA 1FFAA 4TGLA 2VTVA 3I1YA 4U2FA 1RP1A 1QIKA 3CXUA 4QLOA 3O4GA 1UXOA 1E8MA 4K5QA 4G5XA 4E11A 2QM0A 4KEAA 2ACKA 4X93A 4N8EA 1KU0A 3FVTA 2HDWA 3X3HA 3H2GA 5FPQA 5E2IA 2WU4A 1QIFA 4BVJA 2QXTA 4N8DA 5AI9A 1B41A 5SYMA 2ZYRA 1E5TA 2WJ6A 3AZQA 1IUOA 1J07A 2HADA 2BUCA 3ESAA 2XLCA 4H35A 2VATA 3WWOA 4TVKA 5D6OA 1J2EA 3G9TA 1KU6A 3HC7A 4G8DA 3V1KA 4J0DA 1MO2A 3HSSA 4B9EA 1MN6A 2R11A 5AI5A 3D7RA 2JBWA 5C81A 3D2CA 5CT5A 1TK3A 3C8DA 5JZ9A 3LIPA 4ITVA 1XRNA 4JYPA 4CG1A 2FUKA 2GYUA 1PFQA 2WIDA 2X8BA 4BRZA 5JANA 3AILA 4HAIA 4LHEA 4W1PA 3HABA 5AM1A 4KRXA 4BTVA 1WB5A 4RE5A 4ROTA 4XVCA 4G4IA 1MAAA 2XMZA 1DT5A 3FLBA 2WM2A 2ZYSA 3EIOA 1YA4A 5T4BA 3WZMA 1XQXA 1FSSA 5C8XA 2HU8A 3OTQA 4H7FA 3M82A 4EY4A 5K3DA 5AP9A 3AFIA 2CUTA 4NMWA 2XUHA 1UKCA 2WJ4A 4LXHA 4QDUA 1CUBA 3DOHA 2WTNA 3ICVA 5LZ9A 2OCIA 3G9XA 2WFMA 3VVMA 4WDRA 5E4YA 2DCMA 1SC9A 2J3DA 1Y37A 5FPPA 4DSZA 3WL5A 1LPOA 3AIKA 1QO7A 3E3AA 4X91A 5JASA 2HA2A 2Y6VA 4I3FA 4HVTA 1CRLA 1U4NA 4UBKA 2E3JA 5AKKA 3PICA 3DJYA 4UBNA 4WDQA 3VJKA 1QIEA 4LYDA 3ZWQA 4G1FA 1CUSA 2OPHA 1THGA 2ZSHA 1D07A 5IVKA 4LIPD 1DQYA 4DTCA 1H2ZA 1X2BA 3KDAA 4EBBA 4A23A 3H18A 4AO6A 1XZIA 2XQKA 4IHAA 5AKGA 2X5XA 2EDCA 1QTIA 1CR6A 3LLCA 4ZXFA 2HRQA 1EDBA 1DTEA 5EHZA 5AIBA 1K8QA 4BAZA 4W1QA 4L9AA 3HRHA 4PSDA 2C0QA 4ZV7A 5CBKA 4RGYA 3H1BA 4K6GA 4MYDA 2XMGA 3HXKA 2ZVDA 4OYYA 3RK4A 4Q05A 5A7HA 3UUFA 4JUIA 2XT0A 2FX5A 4QWWA 1ZI6A 2GZRA 4BE4A 3F67A 4PO3X 3QYJA 4CI9A 3A70A 3IURA 5I9IA 4Y7DA 1ISPA 5FDFA 4MXDA 3DCNA 3DLTA 2HA5A 1IZ8A 1PV1A 2VT6A 3LIIA 5A7GA 4I4CA 4G8CA 1VXOA 1ACJA 2RI6A 4U2GA 1QIIA 2GZSA 1DWOA 1HLGA 5AKLA 5AI8A 1JI3A 2HA0A 2X76A 1LLFA 1ZIXA 1GQSA 1K6EA 1S8OA 3BDIA 1F0PA 3ESDA 1IUNA 3WKBA 4BCBA 4C4YA 1L7AA 1U2EA 2XUJA 4PV7A 2RONA 5AI4A 2PU7A 5AM5A 3IBTA 5FOQA 1XRQA 2GYWA 2QUAA 3C5WP 3NWOA 5LZ8A 2VF2A 4QZVA 1K5PA 2QKYA 3AINA 4DNQA 2OGSA 4BRSA 3BWXA 1E3QA 1VJ5A 4FNMA 1DWQA 1AGYA 2OAEA 4H7DA 3A6ZA 1TCAA 2ZYIA 5DYTA 1MU0A 3TJMA 3OG9A 1JT2A 4QLAA 3WL6A 4HRYA 2DHDA 3G0IA 5K3FA 2Y2VA 1CUZA 1CQZA 5AICA 2ZJ6A 1WPRA 2C4HA 1VA4A 3S2ZA 3OPMA 5HFAA 1EDEA 3C6XA 4D9JA 1ACLA 5AHXA 1ORVA 4YPVA 3A2MA 5JAHA 3H19A 2WUEA 2HM7A 2JIDA 3RM3A 4FHZA 3FYTA 2V9ZA 2O2HA 3KSRA 3E1GA 1Z68A 1CUYA 2Z8ZA 1VXRA 1SCIA 3DNMA 1MX9A 3LP5A 2HRRA
chains in the Genus database with same CATH superfamily
1BG6A 3OJ0A 4QULA 4WTOA 1QZXA 1KFJB 1U5CA 2W6JD 2C0PA 3L8YA 3WAGA 2B5WA 5ENVA 4JBLA 3LK7A 1JBEA 5CT9A 3VR1A 1OR8A 5ALUA 3O8OA 1K7EB 3G79A 3V3TA 2QQEA 3R0IA 3DV2A 4MKIA 1UM9A 2OHIA 4QARA 1W2GA 5EA2A 3PHCA 2WD7B 3AHDA 3PNPA 4X6XA 4GBGA 4ML3A 5AW2A 4BFCA 2QEQA 1N2JA 2CNOA 2QZ9A 3I5AA 3UMSA 1BNCA 1KO5A 4BO7A 3D5QA 3S1AB 3QVVA 1F2UB 2JBAB 3DKRA 3QRWA 2FSFA 1Y89A 4LE1A 4MEBA 1OC4A 1FBNA 1E1YA 3MAGA 1OX6A 3P4YA 1DELA 4MGEA 4PFSA 2XMCA 1V16B 3BJEA 3H2IA 3QLUA 4I81A 1IDOA 5CK5A 3ZHSA 1OSNA 4LFAB 2QZPA 3PVSA 5ESRA 1EGVB 3MJCA 2UVQA 3X43A 5HR5A 1ENZA 1E6KA 3LUDA 1UFQA 3DOCA 1QF7A 1VCMA 3BSWA 4JQYA 2A9VA 5B55A 5JXJA 1MAVA 1N6NA 1V6SA 2D5IA 4MMYB 4W1SA 4BFWA 1YZ3A 5CTJA 1P6UA 2GKOA 1IIBA 4IG9A 4BMYA 1A9QA 2E4YA 3ZXUB 4EA7A 1ZD8A 4KQGA 5CJ2A 3K0AB 4BX2A 3B9PA 3BCHA 4Y9TA 3OPVA 2GK4A 2N47A 1TU3A 5EE0A 4BUZA 3QFSA 4JFRA 3I39X 1GSOA 5I9TA 5I7WA 1YBAA 2IY9A 4NBWA 2W6ZA 1TJ5A 4JDUA 2YS6A 3FMIA 2GN2A 4MMZB 2HDOA 2PO7A 2YWGA 4HDKB 2FWJA 5H3LA 4R1OA 5TMEA 2IQ5A 4IDHA 1D0VA 1O6GA 4B81A 3OUUA 5K6TA 5FFNA 1N7HA 3MAAC 1TGYA 4N65A 4Q6WA 2EFGA 5BURA 3THWB 3H5WA 4ESOA 1U3WA 5C34B 1VGRA 2G82A 5TX7A 4DUYB 4O33A 5JCOA 1I94B 2PK3A 2DQZA 2EKDA 2EZTA 4WUVA 1DBRA 1EFVA 1JEYB 2YICA 1Q7TA 2VT2A 3KWJA 1Z7YA 2FG5A 5T57A 3WY9A 4R69A 3VTKA 2Z2IA 3CKLA 1XJCA 1G5IA 4LWQA 2R62A 2IUTA 1PJCA 1G3IA 3BB4A 3BEOA 3BHMA 5FLEX 1UP7A 2XSZD 4F1WA 4UU8A 2G06A 2XITA 4Y1GA 2IELA 3CRMA 1WY7A 5IAGA 2IH2A 2G0TA 1V39A 3GLSA 2D54A 3HR7A 3I0MA 3ZY4A 2CB0A 3FNBA 1HPLA 3JR3A 3WBBA 3FWPA 4EB3A 4OA8A 1TVKA 3H65A 3JYHA 4IEIA 8ADHA 4QDZA 3FRHA 4ERXA 3L1IA 1UT8A 2DFKB 5EHIA 3TM4A 3IP8A 4TMYA 4QTTB 5ALXA 1EAYA 4OYRA 5FBLB 2BFWA 3EAFA 4QWMA 4X3CA 5B2EA 1KEKA 1UMCB 4INAA 2CNBA 1PT8A 4LNAA 4ABTA 1Q5PA 4U0JA 5C1DA 2OXRA 4MW4A 2R66A 1TFUA 1EA7A 4FZJA 5FA8A 1CFJA 3V8BA 1AO0A 4E07A 2EEZA 3BC1A 4I9FA 1T5SA 5E3JA 1PK9A 4JYAB 1WMSA 3EF0A 5AW6A 3GQBA 2XYGA 4DN6A 4BO2A 2WWTA 1XXHB 3QG5A 4TKMA 5K3AA 4JUAA 2D1TA 4Y2TA 3GEHA 3DHYA 4CIDA 3F5DA 2K4MA 2WR8A 3PUXA 4P80A 5K2MA 1AT1A 1MVLA 2C29D 3A1DA 4DRYA 3RYHB 1C2YA 1SBNE 1GPNA 1U5AA 1Z2CA 3BQ9A 3CINA 3D1JA 2VP6A 2ZEJA 3KUUA 4BKPA 4BWFB 4JXXA 2IEDA 3LBIA 3QUSA 4K81B 1DGQA 2Q3HA 5T3UA 4Q47A 1JEOA 4UQLA 4E09A 5GVSA 2BUAA 4O2BF 3G85A 2O7QA 2XQVA 3AVVA 3RF6A 4XQEA 4P3XA 4MGIR 1W87A 2VRCD 4KR0A 1E1QA 2JAHA 5M2QA 4UDNA 1II8A 4MQLA 1BWPA 1YE5A 3N8HA 1LJLA 3CU5A 3DHVA 4LGMA 4MR9A 1ADJA 1A9XB 4WZAA 4V0MA 1N5JA 1H6DA 1SVNA 1TZ2A 2ID7A 3PA6A 4FCWA 2P9BA 4QU8A 3RFXA 3HV2A 4RTSA 2O5EA 2O8BA 1AQLA 4J3JA 3DMPA 3DYVA 5ED0A 3WYDA 3A04A 2XT9A 4EKEA 3SMQA 2C2KA 1JA9A 2W2OA 1SU7A 3DDNA 2FRXA 4MWCA 1CPYA 1KH2A 3OQ1A 4FYXA 5KCMA 2QQ0A 2WSLA 2D7CA 2G63A 3AHFA 1W19A 1J9GA 1ESNA 3GHYA 4LTDA 1WZEA 2AYZA 2O3RA 3I28A 1EDDA 2QUHA 2XYVA 1RWBA 3KR0A 4KH1A 5K8JB 2WJIA 4ALIA 1RYFA 4M0DA 5BN5B 4JJFA 3BSSA 1JJ7A 1FVFA 4OO3A 2WMOB 4S0XA 3REQA 3SJBA 1CR4A 4URUR 3IUQA 3GY0A 3KHSA 3WK9A 1T4CA 2OZVA 3R9IA 2E7ZA 3FBWA 1E6WA 1J42A 1M1YB 3ADPA 3Q8KA 2GEUA 1Z6XA 2Y27A 3KKZA 1M5RA 5GJBA 9LDTA 2XNDD 1XRSB 1GJRA 2A0FA 2IUFA 4OU5A 2AHRA 2YDXA 4E5KA 2EJTA 3FPFA 4N6GA 3PR3A 4P3YA 5K0FA 2OO5A 1ZRSA 1PQWA 2JHPA 3R1IA 5IJZA 4HXGA 4U00A 5KKAA 3IIJA 5ECGC 4ZI7F 3AHHA 5G53C 4IHJF 4DKJA 5EXEA 3R7NA 2EW2A 1Y8RB 3EGEA 3CJTA 3DAFA 3M1AA 4MTLA 4GKBA 5EWLB 4D02A 3GWGA 1BX0A 5ITZA 4MRNA 3PJFA 3BB3A 3GVIA 1G9XA 5AXBA 3NFYA 3CM0A 1Q0UA 3WYEA 3Q12A 3ZCVA 4PRYA 4BO5A 3NKFA 4EMTA 4EPXA 1E3EA 3A4NA 2IOFK 1IJKA 4ZOEA 4HC4A 4YO7A 1Q1QA 4Z99A 4YONB 5KSYA 4JCCA 3ED1A 4QGGA 5HMMA 1RMQA 3KB8A 4YQEA 1LBTA 5TT1A 4X65B 4RH3A 1BXGB 2BVNA 3H84A 4WXYB 4JP5A 1KDOA 1N1DA 1ZY2A 2O05A 3HYLA 1COWD 2PXAA 5WRFA 1M2EA 4KX5A 4KWTA 4U7JA 1OH8A 2ZSUA 1YS7A 1JYSA 3D3NA 1M8GA 1YS4A 5BV8A 4DLLA 3RE1A 1DQPA 4DC0A 1M2JA 5GTDA 5KNDH 4DV7B 3ROFA 1M9NA 1LFAA 5F98A 2RH8A 1H2YA 1TCCA 4MO9A 1DO8A 2GEDA 2Y4NA 3A6JA 1EVLA 4DSNA 1SD2A 1TAQA 5DDIP 3TLGA 3PGKA 4AUEA 3A9WA 2BLLA 3JS5A 3WA6A 4G07A 2BEVB 2VDLB 1UXGA 4HVLA 3X1JA 3LY9A 3KB6A 3FR7A 3WL3A 3FVRA 4KR7A 2C7BA 3OUZA 1DC7A 4NV3A 3G7UA 5EMKA 4DA0A 2NZVG 1E8NA 1GG8A 1TT5B 2PWBA 3P52A 4Q9KA 1V2GA 2GM4A 5EIHA 4KE6A 1L9KA 3QH4A 3JWJA 3AFGA 1TTHA 5FUXA 1XL0A 1FDSA 2QLFA 5LJLA 2X0RA 3W3AD 1J0XO 1N7JA 2Q0XA 3NOQA 4NCXA 4NZYA 4AY4A 1GGEA 3I4CA 5JAOA 2DKFA 2B5VA 4HRXA 4UNPA 2CNLA 2RGYA 5EUMA 1D1TA 3RUAA 3ANMA 4L02A 3UMBA 1PEKE 1CLEA 4AKGA 4G0UA 1S6YA 2PZLA 3LKDA 1VL8A 1TMYA 2J0EA 1JDUA 1QKIA 1P0MA 3FF1A 5FB3A 2D7DA 3UNXA 2HGZA 1VLVA 4EUEA 4BECA 1UJ5A 5DK4A 2OCLA 3EVZA 1ZMRA 3DNPA 3GF4A 4XKJA 3NG1A 1J1IA 1I7NA 4IO1A 4ALMA 2JLXA 1SKQA 4Y2GA 1RXSA 4YP5A 3C6MA 3D3JA 4TLEA 3DKVA 3OCUA 1HX7A 1J8MF 1T2EA 2D2XA 2Z8XA 3FFWA 4CLDA 4E3ZA 2PRZA 1E62A 1MXFA 3TZ6A 3AETB 4FIDA 4PZ0A 3UK0A 1YSCA 2BZSA 3FSJX 3RSHA 5MGNA 3RF7A 2QTNA 3LDHA 3TRFA 2W42A 5EJFA 2G1KA 3MBIA 1CUFA 3UANA 4DM7A 5IN4A 1G3UA 2CYCA 4R1UA 4EEZA 4OY3A 1NOIA 1IEVA 2CJFA 5HPYB 4LRQA 2Q4BA 4PPNA 1FDVA 5KOHB 2OB2A 4M1OA 3TIIA 1DI0A 1TIPA 2HXYA 3I6YA 3UAVA 4ZN6A 3AONB 3G0GA 5IZCA 3ABOB 5HFNA 1F17A 4BU1A 3B85A 1RRMA 2Q27A 2ACEA 4TTPA 5JNTA 4LHYA 1Y4AE 3V48A 5ARDA 3T0GA 1Q3HA 3T7TA 2AN9A 3IRVA 4IFIA 3HGQA 1V5EA 1V5FA 3EYWA 3BDVA 1IZ7A 2BMEA 3H1FA 3LC7O 4YUVA 2BGGA 3A0UA 1TADA 2KE5A 4DAEA 5DHSA 3AUXA 2AHOA 1QIJA 2FR1A 4TRNA 4M7PA 3FWYA 2ZS9A 2BM1A 1AA9A 1XDZA 1XZFA 2E4UA 1RPZA 2D8MA 4RVCA 3PCXA 5SY4A 1QAQA 1ZD2P 1UMDA 2JS7A 2QRZA 3RASA 1UJ6A 4Z5XA 5KQGA 4JP2A 5KMGA 2BGWA 1EBFA 4J7XA 3BS4A 2Y9PB 4N1AA 5TPWA 4OATA 3BRWD 3ORHA 3RJTA 4S2UA 1EBBA 4ZYWA 3L1JA 3ZW7A 3GFPA 3Q2IA 3EASA 3GGCA 4LXQA 2ZWIA 1T13A 4LDZA 3UWKA 2Y2UA 1K7CA 2LXNA 3QTTA 4JB8A 1PWYE 1R3UA 3GPCA 2O1WA 4BRUA 5BNTA 3IHTA 5E4JA 4ALNA 1PJQA 4NFLA 1SQGA 3KYIB 4L0CA 4EVQA 5ICGA 2Z2JA 1XAJA 1SOWA 4QDXA 5C18A 2OC9A 4H3HB 3A6DA 1Z2AA 1P60A 1TVEA 2C58A 1PWHA 2XKAA 3HB7A 2CDBA 4QO8A 1U7PA 2C5LA 2B36A 4JX9A 3SJ7A 1MAUA 3Q7TA 2B4RO 4KXXA 3T95A 1JQ5A 1XLWA 2YWFA 4I1PA 1G7SA 2ZJOA 1W6UA 2PUBA 3LXRA 3ZGXA 5JNRA 1DOZA 4W4TA 3T94A 4JJZA 1TMKA 4HWGA 4W5WA 3RARA 4G5FA 4XSHA 4RKQA 2OD9A 3QPBA 1HBJA 1GGVA 1USKA 4P0TA 4BS9A 5B57C 5JJ5A 1DBQA 2B1QA 1XL1A 3RFTA 1KYWA 4OAOA 2QTVB 2V7PA 1ENPA 2CE7A 2P6PA 2Q2WA 2FMFA 3EGVA 2WB2A 3FB1A 4GRIA 3HH8A 2NM0A 1K6MA 3M1YA 4KJZA 4NMXB 4Z7QB 2VHCA 4EFNA 3RVRA 2Q28A 1T5BA 2TECE 4KL8S 1JBKA 3RTGA 3S3TA 5AW3A 2WLTA 3NDIA 3C8ZA 2QN9A 1WHSB 3D6VA 2LR0A 2PJUA 1WKCA 1IOLA 2QUKA 1GKKA 1IPHA 1HE4A 3VZBA 1E6LA 2B20A 2XMDA 3DTYA 1UPBA 4RY2A 1N5LA 3R3VA 2FFHA 2DUJA 4QUJA 2E1RA 2IEAA 1VQ1A 2P7HA 1RWVA 1S2IA 3ZW8A 2Q3DA 3DS8A 2P1DA 5E4TA 1YCDA 5C8ZA 4JVSB 4YAKA 4NK4A 3CWZA 5GGYA 3JQRA 4I9HA 4BHTA 1GZ3A 2GOYA 2ZPUA 3L06A 1ULTA 1XU9A 1ZH6A 2PKXA 5K3CA 3DYIA 1R8QA 3FM9A 4MRMB 2FPIA 2RI1A 4ATNA 1KRHA 3RSQA 1BJKA 1FSZA 1RXEA 2ORYA 4M9RA 3KSAC 4OX9B 4FGJA 5E1MA 3WWYA 4H15A 3EWNA 1BU8A 3TQSA 5GVRA 3EZXA 1Z88A 2VR1A 2A7QA 5A71A 3KEGA 3OE1A 2J8ZA 5KOJB 2PBLA 3T8YA 4MS4A 4Y0NA 2GH1A 3SDZA 5H8WA 3BZBA 1DE0A 3OURA 1YRHA 2PUWA 3PQEA 4X95A 4CKWA 2Q9CA 4OKSA 2EFJA 3B8EA 3PUKA 2NQTA 2HYIC 1SIUA 2ZBQA 2E9SA 2QMQA 4FYWA 2B8TA 3CRVA 1KY4A 1QV7A 1AHNA 2BDUA 2NU7A 3OJEA 4IDNA 5CW1A 1GEGA 1XLUA 1DUSA 5A4MS 2J3IA 4PAOA 5REQA 2ZS8A 1E20A 3MWGA 1JJIA 4G5YA 1K3TA 4MKGA 4PCUA 5D1HA 3JQ8B 4YT2A 1KI9A 2OAQ1 4LRXA 2AI3A 4EGCB 3SXUB 1LBHA 3O8RA 4RESA 5ILOA 5KYUB 1XVUA 5GWXA 1NYQA 1UDRA 4DIUA 3T3GA 2ZSFA 5DN9A 4IJUA 3FOFC 3QEAZ 1AQUA 3PEEA 4E1AA 1HORA 4OSEA 4WEOA 4B5KA 5DCWA 2XCOA 3DVAA 1V11B 2FWIA 3UK1A 5ICSA 3ETLA 3LX4A 5KJ6A 5J23A 4BOYA 1QPZA 3BTUA 2D5BA 3I37X 4DV6B 2AG5A 3CE9A 3MTGA 4R2LA 4RH1A 4AXXA 1Z4JA 2CUNA 2DM6A 2IOFA 2ZBRA 5T5QA 5JPDA 1OC2A 5I8ZA 4X71A 3GYBA 4P3PA 1XPRA 4QUEA 3GU3A 3ESQA 4QUBA 4CR6A 1AKMA 1GTSA 3NWBA 3EY9A 2Y99A 4JB2A 3S4YA 4BBPA 2YMMA 2AZXA 1U0JA 3OZDA 4FTWA 4XB2A 3W5VA 2QX9A 3VZDA 2BGIA 2C84A 4YN3A 1USVA 4ZEWA 1E8DA 1WU8A 1Z6PA 2CVZA 1PJ8A 1M75A 2A0XA 3GEEA 4W9NA 3U1VA 2AG8A 1JKFA 1KS2A 1U2PA 2WWHA 4HUQB 2AF3C 4EATA 4ZYVA 3WRXA 4CHGA 3MZ0A 3CUTA 4YRTA 1ESDA 2H4YA 4CLRA 2L18A 5HIJA 2OFOA 1KIAA 1SQSA 3FI0A 3GEBA 1QDLB 5GONB 2IXTA 1U8TA 2C1EA 3KQYA 3TAUA 1W52X 3FDZA 3ZI7A 3MLAA 4GGPA 5D87A 2ZUTA 4EPYA 4EQ6B 2EKZA 1FQKA 3ZWXA 5KHLB 1I4OA 2KX7A 2XW6A 4TVOA 3OKFA 4FMDF 1FUEA 1OLXA 3PQ7A 3VPAA 3ZJ5A 1C4XA 1RLOA 1OYWA 2ECPA 1J8QA 5B53A 4EZIA 4MV8A 2GFQA 3K7EA 4JI6B 2M2IA 1F60A 3R3JA 1EWYA 5C9ZA 5JWRA 5HRAA 2PX0A 5AR1A 1PN3A 2O2CA 4BNWA 4BV3A 3KV3O 1KR2A 1EK0A 4MAFA 4PX5A 4RXTA 1STOA 4WXHA 3U1TA 1QP4A 4QQNA 3PC8A 5D5QA 3ZK9A 1KMMA 3E23A 3D81A 1V37A 4GMHA 4NENA 4QUKA 3BX1A 4QT0A 2PH7A 3V1MA 4NX2A 5CJJA 2ZPTX 3OQJA 3BL8A 1KBOA 4PAQA 4FDVA 1D6MA 1CY8A 4Q9JA 5SY9A 4DEYA 2WAAA 3EIQA 3F6EX 2HHJA 4FDAA 4PTYA 4UMDA 4QTXA 2O5RA 3SJZA 3U4QB 2HA7A 2H5JA 4PZAA 1IZZA 4ZVKA 4CODB 4NYIR 4Y67A 1FFBA 5BR1A 1B43A 3K6JA 3NBFA 4Q21A 4EY3A 4INPA 1X38A 3AY6A 4LKOA 1TNDA 2ENWA 2VJMB 5CDTA 1FFEA 2Y93A 3U37A 2OA0A 1C8VB 2BR4A 1PT9A 3ZHTA 3SVTA 1N9KA 1SKYE 5T64A 3RFCA 4JMLA 1RWMA 1WSBA 3AJRA 3IL2A 4RJKA 3D6MA 4LK2A 2MTBA 4J8PA 5E6RB 4QOHA 4WOKA 3C16C 4B3DA 1HETA 4OQQA 3CNEA 3H5IA 3PZRA 1EH5A 1B0AA 1E1QD 5C7YA 2V7WA 3NKVA 4QNRA 4Q4AA 3FUWA 1HTBA 4NECA 3QSYA 3VC1A 4M0CA 3OOSA 4MITA 3Q10A 1A8SA 5AVVA 3N0TA 2WMDA 3DOJA 4NDAA 2YIMA 2IZ7A 4WNYA 3F7NA 4WA8A 1WETA 3CCBA 4JI1B 1DCTA 4O5OA 2DWUA 1LKZA 2GBFA 4MVJP 4ZK6A 1WMFA 1XIVA 2QRVB 3DNFA 3EVTA 3KVNA 1BWSA 2R751 3NEJA 3LUCA 4YK7A 2FKAA 3W2FA 4EPVA 4GWGA 3LFUA 1E89A 3W2EA 1CY7A 1Z0FA 1EXNA 4QYWA 3HBAA 4O4HF 1Z33A 3ZS8A 2PGLA 1Z08A 1V4NA 3A06A 5JH7A 3KYCB 4JJ7A 1UC9A 3L4BC 3ECCA 3VPCA 4QOGA 2BEWB 3BIOA 3B1JA 2OMKA 1JMKC 1OWNA 1PWEA 1QOZA 2VDWA 4GC5A 2UUOA 4WZBB 4Z0TA 5HBGA 5BV7A 4HDOB 4W99A 1BQEA 3P4XA 3HRIA 4HZGA 4DRZA 2JIMA 3KTDA 4WV3A 4KYVA 3T7DA 1Y63A 4M49A 1TL7C 3VXKA 1SAYA 1N8SA 3UMJA 4ZFNA 3ZR4B 4M1WA 4G63A 2YV1A 4QDTA 4UFPA 3V97A 1IFXA 1CRWG 3FIJA 1MQSA 4PLVA 5LWHA 4PX3A 2LBPA 2YFHA 1VYTA 1FY2A 2VP9A 4IX1A 3H2KA 1QWOA 1RXIA 1CQJB 3HLYA 3SVLA 3ABQB 5LD2B 1E6UA 2Y0PA 1GNQA 4RV4A 3JTEA 5AKEA 3IRUA 3O4IA 3QYPA 5A9SA 4EWLA 2OM2A 3DW3X 3SX0A 4ECAA 2A7XA 4I6EA 1GAWA 1V45E 3EQ9A 4Y6RA 3PEYA 3AWDA 1DG9A 1ZVJA 4P7BA 3UV6A 2UDPA 4BWVA 2H52A 4J1QA 4YP7A 3I05A 2PSJA 5KVVA 1O9BA 1M2WA 1DQZA 3O3NB 1Q1ZA 4OQNA 3V00A 4FONA 1GQRA 3R3WA 4O8ZA 3GZNA 2NUPA 2JRLA 5ALNA 5IH3A 3OAAA 3RRMA 3RUDA 3NALA 2ZROA 4ZVVA 2YV5A 3OBIA 3WQHA 1GNRA 2NZ8A 1RI3A 1A9YA 4MKRA 3AJ8A 4CGZA 1EI9A 1M2FA 2P6OA 1HT0A 3CZAA 2IS1A 4CU5A 1C1HA 2QX6A 3RUIA 4F6RA 5EIBC 5FWYB 1IXRC 1OBFO 2JIRA 1E5DA 3INTA 1P7CA 2FUEA 5AUPB 5IU6A 5JATA 4TUYF 4EJ0A 2VJBA 3CLKA 1JIVA 1RHJA 2P11A 5LCXA 2EAUA 3L9XA 3WJAA 4YMLA 5F23A 2A4MA 3H8WA 3MWJA 4QNNA 1E9AA 1C3VA 2HLNA 5ELXA 1GYQA 3PI7A 3FUCA 3UT6A 1TIKA 3FMOB 9MHTA 3K5WA 1E0DA 5IZ4A 1AVTA 3CZ9A 3D43A 1IRXA 3HA7A 4FDTA 4GNKA 5DHPA 4BVKA 4PN7A 4UU7A 2WAOA 2ACWA 2CF5A 4D9KA 4WKCA 2YKGA 1IATA 4JELA 5A2QA 3KZVA 5COBA 4B6SA 2VHYA 3AIOA 3IV6A 4BC1A 5CIWA 1SWWA 2YQZA 1P1IA 2L2QA 2Q62A 3AUSA 3NRBA 3PFWO 3FYUA 2CHQA 3GJ5A 3PI6A 3A2NA 3ZWDA 1TZBA 4UHFA 4EABA 1I10A 1V25A 2HV8A 2RBGA 1M6HA 3R3YA 3TSWA 1FMTA 3C6ZA 4CEIA 4HDRA 5K3OA 4DYHA 3OT4A 2FSSA 3SDSA 8ATCA 5IJAA 1KZGB 3SBOA 4EMSA 5ALVA 5G0WA 5H4GA 2ZWMA 1T9BA 3QLJA 1N2XA 1Q1EA 3CGWA 4BO4A 1JYEA 1UBLS 3ZKWB 5HFJA 2GUWA 2P9TA 2IVZA 3FX2A 3S68A 2OBNA 1OXSC 1JNXX 1K7XB 2IXEA 4A03A 1ATIA 3WNCA 2ORWA 3DBIA 4HGZA 5BRNA 2VQEB 4R8KA 3GLHA 4D3DA 3FHJA 2A9KA 4N7RA 3JWIA 4QGHA 1PFWA 4YJHA 5F2EA 2RMKA 3JVVA 4YJDA 2B3DA 3UJPA 1UXJA 3PKZA 4Q12A 2W37A 2Y0BA 2ZJBA 5IVIA 3SNKA 2ASVA 2KS6A 2O3QA 3DMHA 3PIRA 3D2LA 1JPJA 3QXSA 4E30A 2YOFA 1XU7A 3I30X 1G4AE 1Z6GA 4MQ4A 4FDMA 3CZMA 3F90A 2WG0A 1DX4A 2XH8A 1OZGA 3K15A 4R7TA 1DFIA 4AG6A 4MLZA 5HQTA 1FF9A 1B6TA 1CUWA 3LRPA 4W9RA 1G5TA 2YIJA 3OFND 5HJEA 1J20A 1HE2A 3D8UA 3KOWA 2X15A 1THZA 4IDQA 4MJXA 4RVOA 2JHFA 1US8B 4WLNA 2ZRKA 1CHNA 3OHSX 1OD6A 2R8OA 5DNCA 4EUFA 3EIXA 3GJ6A 3MC1A 3PTZA 1P2FA 4RLFA 1L4YA 3PPIA 4UUPA 1X7GA 4CL2A 1Z62A 1P5ZB 1Y5NA 3AQ4A 3BWYA 3ZGZA 4IXTA 3L0CA 1S9DA 4UASA 1KXJA 4J75A 3EOZA 3UY4A 1T8WA 4L73A 1DV1A 3LKZA 2Y3IA 1DIRA 2N75A 3T9FA 3AV3A 5CG2A 1M2NA 1NSTA 1X1TA 1MF7A 2ZRAA 1A96A 3NU1A 1NPTO 5GP1A 4ZWNA 2EIHA 3USZA 3V7WA 5LJIA 5AIAA 4GYJA 4RVGA 4QEKA 3GUUA 3K0FB 5TGTA 3OCCA 3CCCA 1JXOA 3HZZA 3SWWA 5BUSA 5G4KB 2Y1EA 2HRBA 4Z7OB 2W93A 1X7YA 1PR4A 2WHEA 3STVA 1YHNA 1HDOA 2JJ8A 3OKPA 3QJYA 4MB6A 3T7JA 4E31A 3ZDEA 1KI6A 3FCYA 1NJGA 4ER3A 2FPPA 4LBYA 1TF7A 4NCBA 2OE2A 4CQLB 1NW4A 3TOSA 4QYIB 2UZ1B 2LIPA 2A57A 3MT9A 3ICPA 1LCIA 1WQ3A 1J5PA 4OHPA 5JS2A 3NAGA 2CDNA 3AEZA 1EP2B 3OLYA 5E7JA 2NP6A 1KWKA 4TSKA 3H2ZA 4BLQA 4XGQA 1XZEA 4WMLA 3QBVA 3SE0A 5DF1A 2MSDB 3DDHA 4L22A 4PY2A 4X8MA 2RKBA 1YBFA 1MMFB 3WLMA 2WJ3A 1WSWA 1HUQA 3I92A 4LBWA 5LMCA 7REQA 2CV0A 5AYVA 3HUDA 4F2WA 2JHGA 2DSNA 5BQ3A 3N8KA 4L4ZA 3QLTA 3QUTA 6NULA 3A3YA 4IH4A 3T15A 4D3SA 4DR4B 2IYVA 2ORIA 4C89A 5A5DA 3MTQA 6REQA 2FOIA 4I4TA 3I8XA 2ZT7A 4HX2A 1DT3A 4O4JF 2AFIB 3VRHA 1Y6GA 1XMIA 2FYTA 2VP5A 2PVCA 2VDUE 3LCCA 2GPJA 2XX3A 4HXFB 4B40A 1C0IA 1XZAA 2B9EA 2R44A 1QKJA 3B7WA 4TSRA 4YAIA 1XHFA 7MDHA 1JQ3A 2X8AA 1VIYA 4BN5A 2HHHB 2OPBA 4MRSA 2FE4A 3L79A 4YJGA 3UMFA 4A8JB 1P2BA 1A9RA 2GAFA 4RD3A 1HO3A 4V0OA 3SZRA 2XGOA 3QWBA 2AN3A 1IWPB 1HYGA 3AXTA 3QTBA 1PT6A 2J7PA 1BMTA 4QPDA 2AKYA 4MIEA 4MMXB 5JSZA 1O8BA 3WSWA 3HVRA 5J4YA 4D96A 4B0OA 3CS3A 3R77A 2W2MA 1J06A 2VRWA 4MCJA 4QOSA 5D86A 2IYNA 3PFNA 1U6JA 4IRUB 5FUBA 4PZUA 1NBEA 3MJ4A 1FSGA 2DPYA 2H1LA 4EHHA 3VDMA 4AC9A 5FH9A 2WPNA 2XYHA 3P96A 4I0WB 3OPNA 5FTKA 1H05A 1MC1A 4ND2A 2VSFA 4H7IA 3OU2A 4AK9A 3JR7A 4MGHA 4RKWA 4DAOA 4HEQA 3PFFA 4IDCA 1JDBB 1VC2A 2X0IA 1Q19A 2CJPA 3BF7A 1C0EA 3K73O 3OM9A 2MCFA 1VCIA 3B5EA 2YHSA 3SEZA 1AUPA 4DB2A 1JSXA 2Y8EA 1UIRA 3B2EA 4DREA 1GZ6A 3I6BA 2QX4A 2XUQA 3AFNA 1GFZA 2IYQA 4IHJB 2I2WA 2YHBA 1RWPA 1V8OA 3ZJYA 3GLIA 3R41A 3OE7A 1S2DA 3G2HA 3HADA 2JZNA 3IV9A 3L6BA 2HA6A 1U8FO 4C4TA 2XNSA 3DXFA 4C7KA 5H82A 3OECA 1HR0B 2JL1A 3OT1A 4OUDA 4I1YA 1GG9A 3CEMA 2EDAA 3CEAA 2O2IA 2DPGA 3HCRA 3MFYA 3PRHA 2HWWA 1FFGA 1X6VA 1Y3HA 2E18A 2QZJA 2E49A 2VAXA 2UAGA 1Y9ZA 1GPAA 2RGRA 2E48A 3EOBI 4F21A 2ODNA 3MNFA 4W7SA 3KG2A 4W1RA 2IPXA 2QA5A 5DWDA 5FADA 3RVOA 1JPNA 1UJBA 3M3DA 5IKEA 4UUQA 1MNQA 2UXDB 1I2AA 2VH1A 5ICFA 3PNMA 1I6MA 1N2CA 4H17A 1V8FA 5I7FA 3ET5A 4HY3A 3M9WA 4DADA 5JD6A 4V0NA 3TK1A 2Q6IA 3K2BA 4W8OA 3VAYA 1R9GA 3DGFC 2VTKA 4RZQA 5K8VA 1II0A 1E66A 3ESYA 4K6HA 4HYQA 1W36C 3THYA 2O07A 3QY9A 4GDMA 4CMAA 3KUKA 1SXJE 2EP5A 5ALFA 3SSOA 4M9UA 5CB4B 3JAMA 3ZHOA 1LVHA 2PUTA 4O29A 5DWVA 1IUPA 1BTOA 2OK8A 2YJ3A 3EQ7A 2EZ4A 4LF9B 4KLCA 1G98A 1K27A 3OZ7A 2OXCA 4B44A 5JS8A 2FZLA 1L4UA 1B16A 4Z3KA 5BMVB 2N0SA 1NYRA 4POAA 3ROPA 4QT4A 4KGZA 1GN9A 2Z2XA 1QH8A 2ZJ2A 2IBSA 4PM4A 1H3NA 1SVOA 4UAUA 2H0QA 5AJZA 2ZUSA 3PV0A 2NU9B 4DGQA 5J58A 1GL9B 3NCTA 4OV6B 1WV1A 3LDFA 4RLSA 3CTPA 1JWBB 3GH3A 3MTDA 4KKXB 1P0IA 1N32B 1N5OX 4DLBA 1QOPB 2IXBA 3MGAA 1IDN1 4WOPA 3LP6A 3PNOA 1C30B 1WE2A 1I1OA 3KELA 4TT3A 4HT3B 4EW6A 4W5QA 1YRBA 1JP7A 1PZNA 5ALRA 5F7ZA 2IV3A 1G1AA 1F4LA 1LSOA 2B34A 3PP8A 1GADO 1C3JA 1YL7A 4Y9SA 3ZHQA 5KNDD 3ZDDA 4LF5B 4DC1A 1UBHS 2DECA 5CVEA 3FYSA 3E84A 4YHBA 3FLAA 3CLRD 1VPDA 3QHPA 4OGWA 2VDNB 2HO4A 2NTEA 4F97A 5KNCH 3QUCA 1BHSA 3MWKA 4MULA 3E8SA 5B12A 2OLKA 3AEQA 1TQ8A 4MQBA 1LD3A 3O8LA 4YBZA 1RYHA 3U3XA 5AKIA 1VHQA 2PUHA 1QFYA 2Z3ZA 3C87A 3DA8A 4JP1A 4TL6A 2BF4A 1KOLA 4PR0A 1OU4A 2FN7A 4DBZA 1MG0A 2FMIA 2H29A 2A33A 3LLVA 2PJDA 4LPSA 3QF4B 5ICMA 2GEVA 4C2UA 1XLTA 2P4EA 3CNQS 1OH7A 1N1MA 5D6NA 2YJ4A 4MI9A 4BUJA 1ZQ1A 2PT6A 3HEMA 3KAJA 1JN0A 3OM1A 1LDYA 1SCAA 4ER0A 2AMLA 1T0HB 1A8UA 2ZAGA 3NDJA 1ESZA 2CYAA 1EYZA 2Z0MA 4TV8A 3RVPA 3HCFA 5B1DA 3E27A 4ZU1X 1E1LA 3IXMA 1YKGA 2ZT8A 4Q3LA 2YV4A 3H1AA 4ESEA 4JWTA 2OD2A 4UULA 3NUGA 1P73A 3PUIA 3L46A 1CZRA 3WFIA 4CTOA 5JFGA 1H9BA 2IDKA 2JI7A 4MWEA 4A36A 4AF8A 4OCZA 5JH7F 2IYXA 3C3WA 1R4ZA 3OPYB 4A4DA 1IN7A 2O6HA 4GUDA 3KQVA 5DNAA 2EL9A 3UOWA 3TGWA 4DA4A 5C80A 3ZVKA 1XAIA 2Q7OE 2XLBA 2HBRA 3EDOA 3JQCA 3O4RA 2M6LA 3ZX4A 5ABPA 3JASB 3IKLA 4OXQA 4PYKA 4YMWA 3BH6A 4LXGA 3UQZA 3PDCA 2GZAA 2VA9A 4L4YA 2PS0A 3WLFA 4JI0B 4HZIA 1ZDMA 1IQ0A 4WBXC 1DX6A 3DEIA 1FL9A 2NW6A 1DEXA 1CXZA 2N42A 1ZW1A 4EL0A 3G0CA 1CDEA 4B0PA 2ZWOA 1YC5A 2E1PA 2HJSA 3D1VA 3FW1A 3GUCA 1MB3A 2IBTA 1M1ZA 1YRQA 1IXZA 1MTZA 2QLNA 4LOLA 4X6UA 4NXMB 3FOWA 2A58A 4RPGA 5L7WA 3TRJA 3DGEC 5ITVA 3C4VA 5LP6F 1UJCA 1MJNA 5IYZB 1Y6RA 2Y6UA 4GLLA 4MUJA 1H2RS 3S2IA 1Z5VA 5KJFA 1RQ7A 4HQRA 2JLSA 4OF4A 5CYFA 1OAAA 3RSLA 1U2ZA 1MR3F 1VJ1A 1WEHA 2FEMA 3N0WA 4GI5A 3UJBA 5CB0A 2PWZA 4AW9A 4BVGA 1Z25A 3TFOA 1YR1A 5KSWB 1X7WB 3I76A 1VGVA 2P79A 3DBLB 3OU6A 5LBTA 2IFTA 3EA0A 1E1KA 4J4TA 4S0ZA 3SOPA 4W9MC 1TEZA 5EUCA 4ENVA 2JFQA 3QE4A 5LLDA 3V4RA 1WU7A 2BSQA 3F97A 1PWZA 2AMYA 5THQA 1JFFA 4JGGA 1PWXA 4H3VA 1EVIA 5DNUA 4U02A 1YC2A 2O7VA 3OM8A 3QU7A 4INZA 4DIFA 2P65A 4KN6A 5DTJA 1WVIA 3GARA 3CUYA 1JHAA 2IYPA 3M89A 5BSMA 1YUBA 4Z8XA 4C4ZA 4CIYA 2R8PA 5JXIA 4KDRA 4RNCA 1EHIA 5I9MA 2B1JA 3K0CA 1H6BA 1G5FA 1LPAB 3THRA 3OAAD 1JFRA 5K99A 2EYQA 4OFWA 5HKBA 5KWSA 1Q0QA 1ZKDA 3WHKA 5I6DA 2UZ0A 2Y1KA 3BGDA 1EUDA 2KB0A 4UCQA 4MDFA 2B30A 3PXAA 5EAIA 2O59A 2GSDA 3DZBA 4FSHA 5IC6A 4BQIA 2WFZA 3N75A 3O8OB 5C32A 3GH1A 4A26A 4Q82A 2HEIA 4JHXA 1UM9B 1ECPA 4ZD6A 5JARA 2AOVA 1Q83A 1UMBA 2JGJA 1MT3A 2P75A 1ZWKA 2G88A 4H4CA 4MWSA 3UZUA 4BP3A 1KMQA 1T6YA 4LXTA 1PVDA 2WJYA 4RK1A 4BKRA 4ZDJA 2Z6UA 2ETXA 3T7AA 2V6IA 1L3BA 4KK3A 2VHJA 8AT1A 1I30A 5CCBA 5CDFE 1RM5A 4DT1B 1BA2A 5CR9A 2I2BA 3T3IA 2ZRHA 4MV9A 5I7OA 5JQGF 3FCOA 1OYYA 5JBNA 4QQRA 2IDMA 2NZYA 1VHDA 3AF1A 3QX8A 1KJ9A 2XUAA 2QVLA 4YCNA 4KWHA 3QVKA 4MLPA 5KQMA 1KKMA 4P98A 4I5GA 5CM9C 2V58A 2AZMA 1GTJ1 1SCJA 2FEWB 4JZKA 3T61A 2VUUA 4D5GA 4IKPA 1U80A 5AM2A 4XGIA 2C5EA 5L3ZA 4RTNA 2OGWA 4PIVA 2JD0A 3PXCX 1OOEA 4MICA 3VA7A 3AT1A 2B8JA 2EJCA 3CW2A 4GRDA 4M89A 2BM0A 5A9TA 2Q5LA 5ULLA 4X54A 1A04A 4DZRA 3E0QA 4PYIA 4HXYA 4RTMA 2VTEA 3I8SA 5CVUA 4RZXA 3CUVA 2C5GA 1Z6ZA 1PFYA 3ET4A 3I2JA 4RAOA 5HOQA 2DBRA 1XEWY 3GG9A 2H8GA 4LC9A 1GQ2A 1QFJA 2XVMA 5IANA 4Z9FA 4GZ3A 1W0CA 5DCUA 4Z9YA 1ZVKA 5ALJA 3K05A 4QBKA 3DE4X 5IABA 16PKA 2WJZB 1U98A 2FSIA 4TKLA 5T4HA 4C1NA 3TMKA 1WCYA 3EDCA 2DERA 1KHTA 1SIWA 1GU7A 1M2KA 2CV1A 4FQ7A 4EHFA 4LYAA 1YRAA 2EL7A 2WLSA 3WLEA 1SKMA 4CV2A 1SHZA 1UOEA 1EFVB 1H5UA 2PMKA 1IBMB 3I09A 1V3TA 4G89A 1IBCA 1HZZC 1F14A 1ZFNA 4IPTA 1GQQA 1EXWA 1SBTA 3PQ4A 1JG3A 2F43A 2QSYA 1O6FA 2QHXA 4AJNA 5CB6A 3DSRA 5HJ2A 1FQJA 3GCWA 3H7AA 4AURA 1LI7A 1KVUA 2HI0A 2XYPA 1Q11A 2A35A 2PTHA 4ZARA 2GCOB 3T3EA 1MV5A 4UPEA 4IJQA 4WK2B 5AVXA 5JAUA 1YJ5A 3FPBA 4ZDWA 5HS4A 2YBEA 3IDAA 4GC9A 2D00A 3TD9A 1ND5A 3EUAA 3JZMA 3KALA 4ZP1A 3UJ8A 4DR2B 1GAJA 1TVKB 4LFBB 1A76A 2H1HA 5LLSA 3STTA 1LX6A 4FMDB 5EYPA 2WYVA 4L08A 5G4LA 4QJIA 3KCQA 2PA3A 3AERA 1I3KA 4L8YA 2ZTUA 4IJ6A 3QUBA 1UWVA 5FWXA 4QTZA 1AHIA 4M9XA 2A5FA 2V9PA 4KXLA 4EEKA 4AKTA 4YO8A 3ZWKA 5LKAA 3G2PA 5HIMA 3UYLA 1HQDA 3DR5A 5I4KA 4LZAA 4AVYA 2BONA 4CKBA 4ZOLA 4AMYA 1GP2A 3TPZA 4J6FA 4KRGA 1ULBA 5EJ8A 1ZNZA 3O9VA 2ODAA 3H17A 3OF2A 4KHPB 2JA2A 1ORHA 1F0NA 1HYHA 3EQ2A 3P7MA 2VVTA 2WM9B 4F0JA 4CLHA 2EHJA 4MDHA 2QW0X 1IJFA 4YT8A 3FTNA 4DWJA 3AI7A 3F3SA 4N9QA 5JMWA 1NUAA 3KZNA 4JODA 4WECA 5FTMA 1QIMA 3TTXA 5AXCA 5F9FA 1RYEA 1U0HC 1SHLA 2Q9AA 4A3SA 3PD0A 1R6TA 4GM0A 4MCHA 1DIBA 1YQUA 1DCKA 4ND5A 3F5MA 3JD4A 1OBCA 4CFYA 4EGSA 2BRUC 2XA9A 5EE3A 3CA8A 4OQDA 4D4GA 3DE6X 1T9HA 3LX8A 4GWLA 3UGJA 1II8B 4HLCA 2VAPA 3T1YB 1KXZA 2CMDA 3M6VA 3ZG6A 4MR9B 4WZAB 1G63A 3V2GA 1Z4PX 3GA0A 1RT9A 3KVVA 10MHA 4QUHA 3VPDA 1U7UA 3B5IA 2O8BB 1NF8A 1VGQA 1ZM2A 2O50A 4Y7CA 4JKYA 2VQ6A 3HGMA 4PZZA 6ADHA 1JMVA 3E6AA 3NTLA 1S8FA 3OJLA 4IIYA 2EBUA 2XZOA 4FN5A 4IP0A 1G4HA 2O0HA 4W7IA 5BYJA 4CMKA 2J30A 1QB8A 4E22A 1Y33E 3QV2A 5KYYA 3IDFA 2YVAA 1NNUA 4YJFA 3T9CA 2EWWA 4ZDKA 2QIOA 2WFLB 2AJLI 3ONNA 3EG9A 3TPCA 3REQB 4ZTZB 3HLKA 5M34A 3PJDA 2QN3A 1PFGA 2J7PD 1TM4E 1WY5A 2A94A 3NIFB 3N2LA 4ISCA 5BW4A 3IMFA 2YMLA 1EP9A 3OE5A 3SHOA 5HGXA 3BCSA 4R2JA 3GLKA 5AM0A 4QJBA 1S2GA 1YUNA 1ZH0A 4BGIA 4DJAA 1IZYA 2HZBA 3MWEB 4IICA 3PTLA 4IR7A 1EIWA 1JAXA 2VQ3A 4DVGA 5HG0A 1GOTA 4ARCA 5D8DA 4NZPA 3KAQA 3ETJA 4RGVA 1NJFA 1RZRA 2VP0A 1KP9A 3C4JA 3OFKA 4D3YA 2X0EA 1XSEA 3HJCA 4AKIA 3S0JA 2FK8A 4F3NA 5ITZB 3ZW9A 1YQDA 1G7TA 2G0AA 2QTRA 1XTJA 3O1HB 4FUQA 5AW9A 4IV5A 4WY2A 2OL4A 1NPDA 1T36A 2D62A 3GWZA 3HRKA 4KQXA 2ZJZA 5E9WA 3EEQA 5AVWA 2DQYA 3ZV7A 3RT9A 3TB6A 1AMNA 2W8ZA 3VI4B 3OE7D 5LZ4A 2XB8A 2QRMA 4AMZA 2NXCA 3IDOA 4E7OA 1O95D 5KPDA 4AXBA 4JLSA 2C5AA 1Z0AA 4M55A 3F71A 3CVWA 2WE7A 4L51A 4OK5A 3ZY3A 2CXOA 4RZ2A 3ZGNA 3HXPA 1RI2A 1UDWA 2NLOA 1MFZA 4IOKA 1XMJA 3VOSA 1QM5A 4AJIA 3KQWA 3OF3A 5DNVA 1TOAA 3UMCA 3I9LA 3W9YA 4KGDA 9LDBA 4MVWA 1NBOA 1YQGA 2GYYA 1PG2A 5HCIA 3FWKA 3L7YA 5T67A 4HXEB 3WIOA 3IVMA 4P22A 3DDOA 5C8VA 4IM7A 4MS3A 4MVCA 4NDNE 2AG0A 4HQOA 1Z07A 3ZY5A 4BTEA 1RI4A 1ODFA 2OHXA 1J4AA 4LJAA 2QR5A 1GA1A 4P93A 1QMPA 3VU9A 4QNMA 1W44A 2BFAA 2P9ZA 3GCDA 3O4FA 4I4LA 3ZI0A 1CP3A 4QPCA 3HWWA 3NXKA 1USUA 2P2LA 1SHUX 2ZJFA 1TJYA 3C70A 5GADl 2WOOA 4JR1A 3UWPA 3LSYA 1GKYA 1EE1A 1P0PA 3FKQA 4MUGA 2YY6A 1OASA 2XUFA 5HM6A 2OAGA 1L5LA 1QGYA 2JGRA 4JLOA 3KTOA 2YXBA 1KERA 1UPCA 5JXHA 4X1KA 5CLGA 3PF9A 4JWKA 4LSMA 3H9BA 1AV7A 2AL7A 2BIFA 3CY6A 3EGIA 3NVDA 2R7KA 4MRAA 4D57A 1FTSA 2FP3A 4DM3A 1YA6A 4US1R 1J8VA 1AZTA 1MW9X 3SC6A 1U7OA 4G1EB 4M88A 1JE0A 1N6RA 3EIHA 1E7RA 3Q3EA 3L18A 4BATA 3I04M 2Z3VA 4KKVA 1KDYA 1N33B 1V2HE 4UBIA 4YJ2F 1A9PA 5EQFA 5C8DA 5MDHA 3G68A 2OG1A 3AK4A 4E2XA 2AZTA 1ZRHA 2A5DA 2BFNA 5C4IA 1WV0A 2JDIA 2BSAA 3BPSA 4Q01A 2FWNA 2OXEA 4XGNA 5K3EA 5DHAA 4D9GA 5LQMA 3W7BA 4M7WA 3GW8A 4M38A 4UARA 2QMZA 1R64A 3O74A 5ALDA 2CXNA 1S9HA 4C4RA 1S8AA 4G5OA 1PLJA 1M6YA 2AW5A 4LDPA 4ZT3A 2XKKA 4RTQA 1S3FA 2ISCA 1PE0A 3KJXA 3NAZA 4J4HA 1CV2A 1SOMA 2PXCA 3R7DA 3GK3A 3ZXSA 4AP5A 1JSCA 3VH2A 1ST3A 2I4LA 3PGXA 4Z0PA 3ELWA 5LBIA 5JDIA 3V8QA 3HEBA 2Q3EA 3P9RA 4QGFA 5LQKA 3BUSA 1SOUA 2CFCA 3EMVA 4PQFA 2DXIA 1MHPA 2I2DA 4JUFA 2XCQA 2R1TA 4KGXA 3RC7A 1GWNA 1Z4MA 2F2TA 4M8LA 2C8JA 4J0CA 4PPFA 2GD1O 2QYHA 1LK5A 4ZVLA 4FD2A 3DE0X 1E69A 1QQBA 3W5UA 1TUIA 5DTEA 4FOLA 4JC0A 3UV7A 2G4VA 2QUBA 1WCWA 1Y1LA 1UMDB 2XEXA 3CR7A 3GDFA 3SFVA 3DLAA 1PZHA 1RWXA 1V0JA 1GZ4A 5HKAA 2WJHA 3O2NA 1W581 5TPWB 2CL6X 2VXCA 1A0OA 4L85A 3TLEA 5D1NA 3RNOA 1R3DA 3G5UA 3ZNQA 4BFUA 5DSTA 2WD8A 1QQAA 2HW8A 3EXFA 2V6JA 5DXJA 4ZHQF 4KWIA 1QV9A 1S96A 3FZYA 3GMSA 4PLTA 1NXVA 3DPIA 3P94A 4HF7A 1L7VC 1MCZA 1WCIB 3ASUA 1JLKA 2OO7A 2VG8A 4ZAXA 4BJ5A 3NPAA 2DAPA 4J6EA 4ARSA 4GPD1 3NIDB 4GOKA 5DHUA 1SVUA 3CPSA 3GEGA 3KYDA 4NJEA 5CJPA 5FKJA 1NJSA 3X1ZA 1O3YA 3O4VA 2W71A 3HCNA 5GM1A 3BH7A 3A9CA 3M3PA 2PQMA 3QVOA 2LZ0A 3TQQA 1B00A 1C7FA 1NE2A 4M54A 3IJ5A 5DB4A 3W3ZB 7GPBA 1QHGA 4BZXA 2R2GA 1U0LA 3H4TA 2RGNC 2JFYA 1BIFA 3D4LA 2P1RA 5BSUA 2VP3A 4D2IA 5LR6A 3G2IA 1KZHA 2DPHA 3NUZA 3OVMA 4GFDA 2GAAA 1YK1A 4LYJA 4MWOA 5KHOC 2W43A 4GS5A 2VSXA 4UTXA 4F5YA 2FNAA 5T4FA 3R7BA 4M1ZA 4YEDA 3RV4A 1BH6A 4W5JA 2XV1A 3FUVA 3GAAA 4TZKA 2GFHA 2VAMA 4MJ7A 3H8SA 3RYFA 1FC0A 2OUIA 3FRJA 5J2UA 1U2QA 1XZHA 2DFNA 2ZRNA 3SZMA 4IJVA 2C83A 1KTVA 5B58T 1D4AA 3A26A 5ARCA 1IVNA 4EG0A 3LI2A 2GEJA 4IG4A 2BEKA 2YQ5A 4O1IA 2YHIB 3I23A 4G5GA 3LTNC 1WBBA 4M8NE 3AV0B 3D4IA 2I03A 3F7OA 3ZBUA 2JLCA 4WK6A 4DIDA 4GD3Q 4I2VA 5JVDF 3ONEA 4NS1A 4LX8A 1FLAA 4M4SA 4YDHB 3RTDA 4KR6A 1JU4A 3QK7A 1TO6A 2JVJA 5BSHA 5CD9A 4OEHA 2HQRA 4YCAA 3RYTC 5I7UA 4YV1A 1QHIA 4FR5A 3U3RA 3QIAA 4QOJA 1EEHA 2NV2B 1CC1S 4BQQA 3OWXA 2VH5R 3WMEA 4MS4B 1AKTA 4DR7B 4V38A 3CZCA 4Z53A 4NESA 4KQJA 3CLVA 4CKWB 3A1SA 3AKYA 3RNLA 4M0MA 5JECA 2LP4Y 4BCCA 2O48X 4OI1A 1WPQA 3GJTA 3C1OA 1IAVA 3GI1A 3IBYA 4KBYA 2NU7B 2VNHA 2PL1A 2SCUA 1FFAA 3KQTA 4QTUB 3FUUA 4H3SA 4UZFA 5A0FA 3RREA 1V1JA 2CXXA 4PFJA 4RXMA 3TVDA 2NG1A 2FDRA 4AULA 1QDUA 4NEHB 2GO1A 1L5NA 5CUQA 4G1VA 3EGWA 4RTRA 1UXOA 2A9PA 3KZ1E 2QN2A 4HQ0A 5J2TA 4HO1X 4WASA 5KYGA 4P83A 5H1YA 2WVHA 1E7SA 4KAXA 4CYMA 1V5IA 1V4BA 1IBSA 2AXNA 2QM0A 1Z8FA 4G5QA 5DMXA 3T54A 4X93A 2RKWA 2HJHA 4TV9A 4O63O 4AJ2A 2RBEA 3E9QA 1UBFA 4RDCA 4ID3A 1J21A 3UB4A 1QO0A 1Z18A 1F3OA 1YZYA 4PSAA 1YQ9A 1L5GB 4ARZA 1TQ6A 1X7XB 1JFSA 2DF8A 4JL6A 4K86A 5I9SA 4IILA 4BJHB 4A2PA 1ESMA 3EB9A 2IHYA 4LMPA 2BR5A 2HCRA 1HC7A 3CW9A 4BVJA 2JD1A 4KVGA 3TLMA 3CH4B 4CM5A 5JNWA 1HT3A 5HNKA 1T0IA 1E0KA 1PW7A 4N8DA 3L6DA 4JK3A 4WKNA 2DVMA 1KOGA 1AH2A 1GRVA 1WS6A 4PC3A 1ST2A 3JQ9C 3AJEA 1EHCA 2D3WA 1UBNA 4DIKA 2OBYA 2ZYRA 4LWPA 4DS3A 4YT4A 4ZAGA 4AMBA 1QYRA 4TRMA 3NIWA 4Y0VA 5CEFA 4B3GA 4FR2A 2AEJA 2BUCA 4EHLA 2CLHB 2XLCA 3H5RA 4CLRB 1EWTA 4D80A 4YV2A 4JLKA 3K9CA 4RMHA 1H1LA 2JGAA 4M60A 4ZQBA 3H5TA 2C92A 4LS3A 4HLUC 3ZE0B 3FDZB 1DRUA 1E5QA 1I1QB 2GF0A 2IPOA 4IF6A 2HSZA 3EWSA 4U9HS 4KUGA 1N36B 4KQ9A 2A9FA 1OLXB 3IAXA 1V35A 4J0DA 1K6XA 1Y6QA 1N0UA 1MO2A 1PSDA 3CVJA 2HTFA 2AOXA 2CL5A 1OXXK 3NB0A 3R5HA 3UGTA 2G04A 2R11A 2XGGA 4B9EA 8OHMA 4XM2A 2V7XA 3CIFA 3H4MA 3TIXB 2BWJA 2WK1A 4J0FA 2G0NA 4MAAA 3N5KA 3RS4A 3E2PA 4LF6B 2QYOA 2VQDA 2YWRA 5TVGA 4HGNA 1PG5A 5SYAA 4BMOB 2WP8J 1JR3E 3N5CA 4CKZA 3LIPA 1OFHA 3IAM1 2AOTA 3IV7A 3IPAA 3ON5A 4CG1A 4NENB 4RJIA 1TU0A 2O8FB 1A72A 3CURA 3IP9A 1PFQA 3H3FA 2WF8A 2HCBA 3QTLA 1YHYA 2WIDA 4JP3A 1JV2B 1XNHA 4PNPA 2X8BA 3TNJA 1FU4A 3HUFA 3R0QA 1B0UA 2IYWA 4US0R 2NV6A 4KQIA 2E4WA 2I4NA 1UQRA 1W5EA 3AILA 2XNJA 4HAIA 4M8IA 5HZHA 1QRSA 1YDEA 2B8EA 2BKAA 3DEFA 2PO5A 3I42A 3QYFA 3OBBA 3K4QA 1VPVA 1NUSA 4N39A 3SF0A 4A27A 2R5FA 4CEHA 3SDBA 3ORFA 2W4IA 4KRXA 3EXHB 1R0LA 3WAKA 4ODIA 4BTVA 1YUMA 3F0TA 4Q9NA 1HQYE 1EM6A 4ROTA 4UMEA 3THXB 1D4ZA 4YMGA 1ABBA 4XVCA 3RUCA 1XAGA 2R85A 1NG9A 1Q7BA 3DF7A 1MBZA 1ZCFA 3FLBA 2WM2A 4N4AA 4XQGA 2AC4A 3Q85A 1DB3A 4Q4AB 3RCBA 4RZIA 5I4BA 2X1VA 4BFYA 1YI1A 1IQRA 4YI5A 3RB8A 1RM4A 5BW5A 2E85A 2FB9A 1N8KA 2XE6A 3I01A 2FRVA 4TOIA 1L7EA 4UJ3A 3WZMA 3WC4A 5IHXA 1U0NA 3GHHA 1P8JA 2QN8A 2Q9BA 1XCGB 1NDQA 3R6TA 2V7EA 4FSDA 4XWTA 2A0KA 3KB2A 4I8XA 1CF9A 3RS3A 2COUA 3ITDA 1Z4NA 3ADDA 3NOOA 5HZMA 4V1CA 5K3DA 4AG3A 3E35A 3U62A 5F5NA 2CUTA 5FHQA 5DULA 5GAJA 2MOKA 3IJEB 3OU7A 1JQJC 1IY2A 1JEAA 1F8FA 3IBFA 5JH7B 1VIDA 3T12A 1N6IA 4QDUA 4DV2B 5FOXA 3U61B 2BEUB 2ZFUA 2O8CA 1JXMA 1E2DA 1MJGM 1S7CA 5PNTA 1VFNA 2VDWB 1E2PA 5A3QA 2GJAA 3WAJA 4GKVA 3VVMA 2D5CA 2HNAA 2HWYA 3L92A 1JG7A 5C1BA 1O7JA 4CF4A 2ODEA 1SC9A 3DF9A 2OO3A 4DWWA 1KKUA 2BTQB 4QXAA 1NR7A 3GN2A 1Z8HA 5DLDA 1FDIA 1LPOA 4N7BA 5HA5A 3CLUC 3LY8A 5KYNA 4TQAA 2ZTMA 5DBHX 3AUYA 5FEMA 2YTZA 4G9BA 3NPMA 2ZIGA 1M72A 4HDMA 4TN1A 4X91A 2HREA 5TQVA 5C7OO 1YB2A 4I3FA 1P7YA 3E3NA 1CRLA 1U4NA 3V8NA 5IFLA 1HFKA 3W2GA 3PICA 3ETHA 3BYZA 2FF7A 3VJKA 4C04A 3QPVA 4BLWA 5A9SB 4G1FA 5KNBH 1FUIA 3NBZC 2XPCA 3M4JA 4QDKA 3NVAA 3TTVA 2DPLA 1CLUA 1NR1A 2DLNA 3ZDFA 3EFOB 4DLXA 4S1OA 4B7UA 1ZNWA 1Q50A 1F0YA 3UM9A 2GJSA 3B1YA 1OVGA 4D3ZA 2V8BA 4ZU3A 3QU2A 5IVKA 1Z47A 5AK0A 3BXOA 1YL5A 1JVSA 4YRAA 4YR9A 1EP1B 4AKSA 4RDHA 4MNTA 2Z2KA 2NUPB 2EBHX 4LQCA 1J9ZA 1JWAB 2PXXA 1H2AS 3VNRA 1P3DA 4ME6A 4N3AA 1U9IC 3PC3A 1Z0ZA 4KFTA 1U5BA 3NEYA 1GLNA 1LXCA 3DOUA 4KPYA 2RKOA 2XHZA 2IIQA 3OX4A 5K0ZA 4AO6A 5E3HA 5KWEA 1T5DX 2XOEA 4L07A 4GE3A 2V6MA 1L7OA 4IMIB 1M2OA 4NHOA 3E1KA 5AHKA 1EG2A 4J1SA 5F4BA 2JLQA 5AKGA 3I9JA 2FPKA 4HNSA 1XWFA 2X5XA 1N25A 5KCZA 2ZCVA 3IQEA 4Q7JB 5JCPA 3CJQA 3LLCA 1B6SA 3NFRA 4N3BA 4DCUA 1JDZA 2F8TA 4GKAA 2C03A 4IDPA 3KVOA 1Z29A 4QUDA 3UA3A 1QCYA 1JKJA 4MB2A 4WOCA 4B3XA 3WNVA 4B8ZA 3CH5A 1KEUA 3QPUA 4YMHA 1WP9A 1YR6A 1BS2A 3WDLA 2C3YA 4W1QA 2V5UA 4IUDS 3ZXXA 3KEMA 2FFJA 4L9AA 5JCJD 2RHOA 4CEIB 4HDRB 2YY5A 3KBBA 1FNBA 1ZCBA 5DNDA 2BZGA 3KJEA 3DL0A 3UK7A 3GAFA 2J87A 4A82A 4ZV7A 4DJFC 1KMHB 2PGAA 3N59A 1RBQA 4RGYA 3D4PA 5E7MA 3AEXA 4JEMA 4ER7A 5CBKA 3V8RA 3H1BA 4K6GA 3RYCA 1BFKA 4KVAA 3VZCA 4D26A 1ONNA 2Q5JA 5EC8A 5JLAA 3NNSA 4ON9A 3HXKA 3A37A 4JBYA 5D5PA 3HJAA 4ZAYA 1CWUA 2C04A 4HMQA 2E87A 3R8FA 1D03A 1P7PA 2QUZA 1HF3A 4FHDA 1M54A 4K9KA 4K40A 1XNRB 4Z51A 3GLGA 3WR5A 1OZAA 2ZBDA 3MINA 3AR9A 3ER6A 4P5DA 1O89A 4OMFG 2R1VA 4XGRA 1JXAA 1LNZA 4YCDA 3I58A 4HMOA 2XZPA 1DC6A 3GJ8A 4P53A 2FX5A 1A50B 1W2HA 1NVDA 2GWHA 1Y9AA 4CIVA 5I7EA 4ZOQI 2XZDA 1JG4A 4YRPA 4JFAA 3AX6A 2QT1A 4C7JA 3F67A 1OJ7A 2XGJA 1ZNXA 2OCYC 3BTSA 5DOZA 1GZUA 4KYUA 2G1JA 3A6GA 4Q3NA 5K05A 4CI9A 2OCDA 3C39A 3QIVA 3T3DA 4RF5A 1Y1RA 2CLLB 2PCJA 3IDZA 5I9IA 3OLXA 4KB5A 4MKXA 3HV0A 1C3EA 1QVVA 3L49A 5COAA 4KR3A 3INYA 5IM4A 1ISPA 3MPUA 3S1LA 2LCFA 4S35A 1MB4A 3FCSB 4RORA 3ESZA 5LSAA 4MXDA 1AKYA 1FS5A 1MEJA 3TIGA 2J9XB 4MJLA 4DE5A 5HUJA 3K8QA 2RARA 5BWLA 2VT6A 1VDMA 1DKQA 1VXOA 2QSUA 5EP4A 3W8NA 1EFHA 1X7YB 5C8YF 4U2GA 3UAZA 2BD0A 4XWKA 4ZCIA 1DWOA 3NH6A 5EJ9A 5KX5F 5LPNA 4EO9A 1KI6B 4WJKB 3FPLA 3ITEA 3RIYA 2HA0A 5KUTA 1ZIXA 3I4LA 4LMBA 4PBTA 5K0LA 2ZTHA 2C4MA 4OTZA 4U7WA 1S8OA 1A5ZA 1NY6A 3BDIA 3IE0A 1F0PA 2ZWVA 3MTEA 1YQWA 4UATA 3M6UA 5LM3A 1LSJA 2PKWA 4JZYA 2DOKA 2A0UA 3CPJB 4URHA 1MW8X 2PU7A 1G5QA 1QR6A 3B1ZA 4DCTA 1JQDA 1N2EA 3ABSB 2PGXA 4YCCA 1Q95A 5FOQA 4R41A 4WNIA 4WX2B 3QHQA 5EMHA 1TTQB 3I5MA 3LK6A 4NBUA 5LZ8A 2VF2A 4COOA 4QZVA 1LLCA 1TLFA 1K5PA 1DJOA 2Z8YA 3GJ4A 3KQQA 3OMXA 5FL3A 4A2CA 2X4DA 6REQB 4DNQA 3ZGOA 1KQNA 3CRRA 4C14A 4DWVA 5EZ5A 4I4TB 5T7BA 3K70C 3MJSA 4KIUA 1IONA 4MX8A 4AKHA 3W5SA 3BWXA 2FW6A 2O3TA 5C1PA 5AVYA 1F9AA 2X7XA 2QPOA 4LQDA 3S29A 3W4KA 2ARKA 3LOQA 2A0YA 2ZYIA 4FUTA 1WL8A 5SZKB 1WXIA 1VLMA 3LQ2A 2YC2C 4FKMA 5ILGA 1LBEA 1GPMA 3R6GA 1ZP6A 2G9QA 4LYGA 4YAEA 3WL6A 4CI0B 4HRYA 4B2LA 2VK2A 2DQKA 3CBGA 4G3XA 1L5RA 2X14A 4MVJH 5DKFA 3FVWA 4D81A 5K2OA 2BFCB 2W2KA 1OPRA 4WEQA 4RNDB 4OYHA 4LI0A 1JVNA 3FXAA 1PR3A 2ZJ6A 2WF7A 4ABYA 4D9CA 3LPNA 5JSZB 1BJRE 1RJDA 1ZWLA 2P9QA 1NDUA 2NUBA 3DHNA 2V0GA 1YGYA 2NAFA 2DTDA 2W2XA 1YE8A 5GPBA 4RJ2A 1YRYE 1IQPA 2P35A 2YZ7A