3CG4A

Crystal structure of response regulator receiver domain protein (chey-like) from methanospirillum hungatei jf-1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
126
structure length
126
Chain Sequence
HKGDVMIVDDDAHVRIAVKTILSDAGFHIISADSGGQCIDLLKKGFSGVVLLDIMMPGMDGWDTIRAILDNSLEQGIAIVMLTAKNAPDAKMIGLQEYVVDYITKPFDNEDLIEKTTFFMGFVRNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator receiver domain protein (CheY-like)
publication title Crystal Structure of Response Regulator Receiver Domain Protein (Chey-Like) from Methanospirillum hungatei JF-1.
rcsb
source organism Methanospirillum hungatei jf-1
molecule tags Structural genomics, unknown function
total genus 37
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2008-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3cg4A00
4YO7A 5FBHA 4RKRA 2MYPA 4RXTA 3LUDA 4JOQA 4N0PA 1EWKA 2IPAB 3TMYA 3KG2A 1A2OA 2IPLA 3URMA 3LUKA 3FGZA 2Q5CA 1Z13A 1GUBA 2R25B 3KLNA 3D8UA 1VRVA 3C3WA 3I5AA 3T6KA 4RXUA 4LX8A 1Z17A 3H5TA 1ZGGA 3TD9A 2A9QA 1QPZA 2O20A 1TMYA 4W5QA 2B4AA 1SRRA 5IX8A 3LUJA 2E4YA 1NATA 5EWMB 5JNUA 3KLOA 4RK0A 2L18A 3EULA 4YS6A 3C97A 1MB0A 3HV2A 1ZESA 3A3KA 4E7PA 1BAPA 4RU1A 3KSMA 4EY3A 4YCSA 2A9PA 2QZJA 4MAAA 4WWHA 1QP7A 4D6YA 3N75A 1DCKA 3SG0A 1ZGZA 3RH0A 3KYJB 4QYMA 3RVMA 4Z4IA 4MR7B 2RJOA 5IBQA 1ZHHA 3EGCA 3LUHA 1ZH2A 4EYQA 2PE5A 3HEBA 1KMIY 3ROFA 5IEJA 1MVOA 5F64A 4G0YA 5FWYB 1AB6A 5KQPA 3CFYA 5B3JC 1QKKA 3BBLA 4Z0NA 3H5IA 2GI4A 2PLNA 2E4XA 3SM9A 3LOPA 1YMVA 4MRMA 1SXIA 2NZVG 3E61A 4MR8A 3A10A 4FB4A 1ABEA 4KRFA 5HSGA 1BA2A 2P9HA 2PKXA 3GRCA 4TLLB 3HJFA 1YVUA 1NXXA 3MM4A 4TN5A 1NXOA 1NTRA 3FFTA 5DCLA 2PL1A 2QV0A 3KJXA 3MYYA 2PUCA 2ZAYA 4NCAA 9ABPA 4ZYLA 3Q9SA 3OO0A 2VUIB 4G0ZA 4WUTA 4EUKA 1JH9A 2OQRA 1DG9A 1QP0A 1QQBA 1PHRA 4RK7A 2VYCA 5T3YA 1YS6A 1DCMA 1M2EA 1M2FA 4L4UA 3BREA 3O75A 1ZITA 4ETMA 2PUGA 4HNSA 4EVSA 3OM1A 4JA2A 1JYEA 1L5YA 1ZDMA 4LDAA 4G0OA 4KV7A 4Z4CA 1Z25A 4O1IA 2CD7A 2JK1A 4MGEA 3H5LA 2FQYA 3GYBA 4XFKA 5TQJA 3R0JA 2GWRA 2LIVA 3OLVA 3IDOA 3DLHA 3ILHA 5TPWB 2R47A 3IPCA 4JB2A 1GUDA 2JVIA 3CG4A 3TB6A 3F6PA 4IF4A 2FMKA 4MQEA 3NHZA 1FFWA 3FDFA 4TLMB 1QQAA 3GWGA 5IC5A 2IOYA 5KC9A 4QICA 4JB0A 5CNMA 2RGYA 1XHEA 3UKJA 1ISSA 5BRAA 3OLWA 2HJ9A 4W5OA 3L49A 1YIOA 2IYNA 5JNWA 3K9CA 3HVRA 4W5NA 1YK0A 2X7XA 1DBQA 3LMKA 4ZPJA 4OLBA 4DQDA 3CNBA 3Q7RA 5EWJB 4W5TA 3OQMA 2F8TA 3DGFC 3HM9A 2QR3A 3OMWA 1RXIA 3H1EA 1EWTA 3JPWA 3GV0A 5TE9A 3HDVA 4RK1A 1JLKA 2MYUA 1QMPA 1Z2DA 5FWXA 5DGCA 5BRJA 4KFCA 3SQNA 1EAYA 2H3HA 4OG2A 4EYGA 2FVYA 4M88A 2WJAA 2VK2A 4MLCA 3EQZA 1NY5A 1QO0D 2ID7A 1DRKA 4S05A 4JASB 2HQRA 3QX9A 2A9OA 4F3TA 4LRQA 4WXEA 4MS1B 3VNBA 3LTEA 2LBPA 4KQCA 4KREA 4IMJB 2H0AA 5TQ2B 2HSGA 4KVFA 1ZY2A 3S99A 3OO1A 3HZHA 1GLGA 3QELA 4H60A 1JFTA 3LUAA 4D6XA 4Z4GA 5TQ0B 4NCBA 5EWMA 5HM6A 4MS3B 1JHZA 1TVMA 1U8TA 2JBAB 2RDMA 2QSJA 2NZUG 3N0RA 4MQFB 4F06A 5D2CA 1PNTA 3N8IA 1PUXA 3CZCA 2IDMA 3D02A 3RVLA 2N9UA 2WRZA 4KMRA 6ABPA 1BDIA 3JVIA 3OLZA 4G0PA 3VNAA 1U2PA 1RZRA 1A04A 4PICA 1GCAA 1NXSA 2QW1A 3N53A 1D2AA 4Y9TA 3HK2A 5CHYA 2M1ZA 4F8JA 1DP4A 1UDRA 1P8AA 1Z2EA 3SAJA 2LUOA 4DADA 1RXEA 1BDHA 3I42A 4S04A 3QLUC 1CHNA 3JS5A 5EWLB 4PEVA 3RVPA 2YHAA 2B1JA 3I09A 4WXMA 1LK0A 4GNRA 4YRZA 3HO1A 7ABPA 3CZ5A 3IP9A 3HXMA 3OQOA 1URPA 4HYEA 4MR9A 3JVDA 1ZVVA 1F4VA 3OQNA 3L6UA 4G0XA 4RY9A 1J56A 3TX6A 4LE0A 5DTEA 2IPNA 2AYXA 3H5OA 4LE2A 4RZSA 4YV7A 1SXHA 2R4QA 4JAVC 1D5WA 2FSPA 3UUGA 4RK4A 4OATA 3O1IC 3MF4A 1EHCA 1LBIA 3LUCA 2FQXA 4RSMA 2PUFA 3CLKA 2A9RA 2GBPA 2WJWA 4ETNA 4EYKA 3A0RB 1NXVA 3JPYA 3LKBA 4RDCA 1Y1LA 4XLTA 5T7BA 3BRQA 3GL9A 3H1FA 3EODA 3OMXA 1JF8A 3DGEC 2PMCA 3SNKA 3O2SB 2L19A 3KS9A 3A0UA 3K4HA 2WY2D 3EAFA 3QLVA 5FBKA 2FEPA 2FXIA 1SXGA 3QLTA 1RPJA 4CBVA 1DZ3A 2PUBA 1R8JA 4MLDA 4XAQA 1ABFA 4MPTA 3NBMA 3O1HB 3RVQA 1L5ZA 3NNSA 1E6MA 3Q41A 3T38A 1DBWA 1DBPA 3QK7A 4KNYA 2RJNA 1YS7A 3HSYA 4RKQA 1Z18A 4F11A 3NNNA 4MRMB 5B3JA 1NXWA 3IP6A 4OLAA 2IKSA 2JCGA 1OXBB 2QXYA 3QEKA 4FE7A 5JNVA 2J48A 3MQ4A 1USGA 1IIBA 3OLYA 3LKVA 1FFGA 1XHFA 2P4UA 1C4WA 4KQ9A 3RVKA 1U2QA 1APBA 4YGXB 4OTZA 3CRNA 5DKFA 4E7OA 4JP1A 4N03A 4ZJPA 4RY0A 3QX8A 4NICA 2L17A 3RVRA 2JRLA 1KRWA 1NXPA 1D1QA 2FMHA 4H3KB 2OENG 2MSKA 5CNIA 3G85A 4Z99A 2AYZA 3FFWA 2PUDA 1CYEA 4RV5A 3Q7TA 4Q7EA 4RY8A 2QVCA 4XASA 4Z9AA 1YTUA 1B00A 2CWDA 1NXTA 3KYIB 1VPWA 3M9XA 3RVSA 5BQ3A 3QEMA 1BDJA 1TLFA 4GPAA 2M98A 1DCFA 3BILA 2FW0A 2FN9A 4WT7A 2DRIA 1DC8A 2HPHA 4LE1A 4Z4FA 2FMIA 3F7NA 4QYWA 3RVOA 2FQWA 3O2JA 1VLZA 3P9YA 1U04A 4MQFA 1WETA 3O2QB 4Z4HA 3CS3A 3CKMA 2QU7A 1ISRA 2GX6A 3GBVA 3FMVA 1W25A 2IPMA 4ZMRA 4N0QA 3H6GA 4FE4A 1YK1A 1A0OA 3LUFA 1JL3A 1QO0A 1RNLA 1F51E 1LJLA 4KK3A 3IP5A 3EQ2A 4G86A 4KK4A 3NHMA 1DRJA 1Z26A 3G1WA 4IILA 5TPZA 5HQJA 5KQMA 2KYRA 1U0SY 1GCGA 1YMUA 5JNSA 4MS4B 4RXMA 4XARA 4ZMSA 4P98A 1RZRD 2FLKA 4YLEA 5JNRA 3H1GA 4DN6A 2MYNA 2TMYA 4MR7A 4LZLA 2L2QA 4UHJA 5IUJC 1USIA 1C0EA 2CHFA 4PZ0A 2JVKA 4KPYA 2BGGA 3C3MA 2NUBA 2MYTA 4HNRA 2NT4A 1E6LA 1T34A 5FWYA 3QELB 5CNKA 4UHKA 5JNTA 4W5RA 1D4ZA 2WWVD 2WMYA 5IUKC 4N47A 4H3HB 1I3CA 3HDGA 4Z9BA 2QVGA 5DLEA 8ABPA 4O1HA 2HQOA 4L85A 2E4WA 5ED4A 4B09A 2JB9A 2PL9A 1QP4A 3RQIA 3O21A 3CHYA 1TM2A 2FEWB 2PAFA 1XWWA 3KCNA 1CEYA 1KGSA 1ZH4A 2W42A 3EJWA 3I45A 5ABPA 2CHEA 1TJYA 3JY6A 3N0XA 3QLVC 5JS1A 4YR7A 5KWSA 4Q6WA 2VUHB 1JX6A 1M5TA 4OBBA 4N76A 1E6KA 1FFSA 4RK6A 1EFAA 3MMNA 4RS3A 4G0MA 4Z4EA 3HS3A 3HUTA 4YWHA 3CG0A 3KKEA 1PEYA 4EVQA 3QLUA 5PNTA 4Q6BA 1MB3A 2FN8A 4IGAA 2PJUA 3TO5A 5HKOA 5JS2A 3N0WA 1ZAYA 3DLBA 3JTEA 1JBEA 1MAVA 3ROTA 4MYRA 4MR9B 2HQBA 3DZDA 2FEKA 5BR1A 3N6VA 5KQLA 1BVHA 1Z16A 3FFXA 2LP4Y 3EDCA 1FQWA 5IUNC 1JWLA 3NNDA 5TPWA 5IULC 1PNRA 3B2NA 1QNLA 4HNQA 3UK0A 3ILYA 4MR8B 1Z12A 3O74A 3LFTA 4IMIB 3KHTA 1P2FA 1Z15A 2ID9A 2LPMA 2FKAA 1JDNA 2GKGA 4G97A 2FLWA 5KC8A 1M5UA 4WZZA 3HUUA 3H5WA 5KQGA 2FMFA 3OM0A 1KRXA 4O5AA 5CNJA 3RVNA 1W9HA 2I6FA 5I4CA 1EWVA 1VKRA 3C3KA 3Q7SA 4F12A 5GOTA 4TMYA 1ZN2A 4D74A 5EWJA 2XDYA 6CHYA 3T95A 1OXKB 3W9SA 4EGSA 1DC7A 4PE5B 2FTKE 2YHBA 5C5EA 3Q15C 3BRSA 4KZKA 1S8NA 3OLXA 3H6HA 2PUAA 1H9CA 4EVRA 1USKA 2MSLA 2NT3A 3RVJA 3CTPA 4MS1A 1AB5A 4RK5A 4XXHA 4YP9A 5TQ2A 1K66A 4QPJC 3O1JC 1LJUA 3C6QA 5IEBA 3F6CA 1JFSA 1PEAA 3GT7A 2E4VA 2JVJA 4MQEB 4P1ZA 4RWEA 5TQ0A 3LUGA 1MIHA 1P6QA 4MS3A 1LBHA 2JBAA 3T8YA 4PYRA 1JYFA 4LDZA 3H5VA 3IPAA 4NV3A 1P6UA 3IP7A 1D1PA 3MA0A 3CU5A 5C5CA 2F8SA 1E2BA 3GA5A 3E3MA 3M6MD 4MS4A 2R48A 3GBPA 3SY8A 2PUEA 1DJMA 1JDPA 2WB4A 4NQRA 4G0QA 1JFVA 2V0NA 3H75A 3MIZA 5E3JA 1FSPA 1HEYA 3M9WA 1K68A 3DBIA 5TPZD 4ETIA 5FWXB 3QEMB 2E4ZA 5EWLA 4IRXA 4ML3A 5KI6A 2E4UA 4EYOA 1SD5A 5GQSA 3KTOA 3F73A 2ZWMA 3HCWA 2MSWA 4N41A
chains in the Genus database with same CATH superfamily
2CMFA 2W6QA 5FBHA 1O08A 1WABA 2MYPA 3DBOB 3FPCA 5F3WB 4JOQA 4N0PA 5A2GA 4YP1A 2P68A 5JMTA 2VHJA 2G88A 3TL3A 4EJSB 3RC9A 5JO9A 4AKIA 5JZSA 1J4AA 3PFKA 3RG2A 2R25B 3EEFA 3N7UA 3FHLA 3INGA 3OTOB 3BGOS 4P7JA 4RNDB 1FFHA 4HPJB 4RVGA 1ZGGA 1CR4A 1IHXA 1KIFA 1EXMA 1QX3A 2GH1A 1QHEA 2QTHA 2X40A 3BJEA 4FW8A 1IY2A 4JX8A 1YL6A 1RQGA 2YJ4A 3L9WA 4F1WA 5JNUA 3VA7A 1Q74A 2GVNA 4KC0A 4HUTA 4M1YA 4GEKA 2L18A 4YUWA 1L4KA 3JZMA 4J1SA 4CF4A 5BUZA 2RI6A 4L0CA 1QC5A 1Z7YA 4H1UA 1QP7A 5CT6A 5BN3B 4G07A 4D6YA 2UVPA 2ZULA 3K5HA 4M0DA 4F7WA 2EJVA 4JP3A 4Z86A 3VV3A 3J81k 4FCVA 4PFQA 4TYQA 1GL3A 2OFWA 1JU3A 5A0TA 2BOVA 1KKUA 4X1KB 3N0TA 2RHOA 4EO7A 3GUVA 3SDBA 3FWYA 1DQZA 1N2ZA 3V4LA 3LSYA 1N2HA 1O95C 2BR5A 2P1ZA 4NPCA 3UNXA 5C1DA 5AVZA 4RETA 2FEXA 5AM3A 1S8AA 2DH6A 2O57A 1LPOA 1BCRB 3E03A 4YHHB 3LP6A 1F4PA 4LV8B 2Y1LA 5JTTA 2Y2UA 5I9NA 3HLYA 3CUYA 5LKRA 1S96A 2DWUA 3L1VA 3EZ7A 4Y30A 3ADBA 4V0KA 2C2YA 3OF2A 4A0FA 1XZLA 1ABEA 2VHVA 1JA1A 1X19A 3HSKA 4JC5A 1A7AA 5DNWA 2GZ3A 3WYDA 1BA2A 4ARVA 1LWOA 4DNPA 1VM6A 1DS6A 2GK7A 4R9SA 5DF1A 1SKYB 1SNYA 3H99A 3V97A 4ZZ1A 5U4QA 4NBWA 1UBEA 1AA9A 1Z4MA 2A5GA 5CBPA 1R7RA 1KF0A 2HUNA 5J4KA 1RYYA 3K09C 1U8YA 1HXHA 4NRDA 1U1CA 4UULA 4AYTA 2C7QA 2AG8A 1C0LA 1HDZA 1NQVA 1JNXX 5ILGA 1PFGA 4P0PB 1U0TA 1MDBA 1Q50A 2ARKA 1ZUWA 3UWKA 1W4RA 2PX4A 4WEQA 4AXBA 4AURA 4IZ6A 3MRTA 3PIRA 4IEEA 1VJ5A 4PO9A 3C4QA 4W4TA 2X0EA 2VVTA 4URXR 3GWZA 4FHDA 3AR8A 4U63A 3FNIA 3AH8A 2F90A 4MYHA 3BULA 2R00C 4AFNA 1BGWA 5HOQA 4LYEA 2C2BA 4M0EA 4YUYA 2VP3A 1P29A 1GDDA 1PDOA 2VBIA 3ROGA 4CMBA 2G72A 4YVFA 3FLAA 3TUJC 1JMKC 2P65A 3DBHB 3T7EA 4CM7A 5HYVA 3ZGZA 1PUIA 3A4YA 3BF7A 3I2HA 2IELA 1YQ9A 2HK9A 3Q5EA 4AS2A 2W48A 2E9SA 1YJ5A 5LKAA 1UFVA 4GPBA 4V0OA 1O5TA 2P2LA 2P9TA 2V6FA 3AKEA 1NMYA 4PLPA 4L0MA 3JASB 3SU8A 1Z5OA 3UH0A 3PEYA 3OZTA 2ZTSA 4DQVA 4YEDA 1QQAA 1U0RA 3ZDQA 1THZA 3PK0A 4BWYA 1NVWQ 4EFKA 4U6SA 4CL8A 4L5BA 2C92A 1IN6A 4IL5A 2D1QA 4FT2A 4MHSA 5AVRA 2XZOA 2JIMA 3Q8WA 4XUEA 4IRMA 2Q0QA 3LC2O 2QR5A 3OZDA 1IUKA 1OE0A 2CXRA 3FGNA 2DQKA 2G28A 5CW2A 4E70A 4GP7A 3MGBA 1RRFA 2OCGA 3DE6X 4JXKA 4NMXB 3WAGA 4I19A 1N5MA 2Z04A 3JPWA 3KSBC 1YR3A 4OYLA 2C4MA 4WOJA 1C9NA 2E37A 2G71A 5D51S 3HUEA 3WS7A 4OKIA 1JSLA 4GMXA 4RJLA 1OA1A 1QJCA 2FNAA 3HI6A 3G2LA 4BFXA 1CKEA 4BNDB 2PX8A 2OAEA 3FHTA 1E3SA 1JN0A 1SCBA 2BM9A 4TOIA 3ZCPA 2Q9CA 3N1UA 5IBCA 3L7NA 1NAHA 2TECE 5C7LO 1L1EA 2PG3A 1Z2PX 2WSLA 2X58A 3BH0A 4X44A 5KNBA 3KOUA 2AC4A 2RBEA 3BL5A 4EG3A 5TQ2B 1NKTA 3GHYA 1Z6ZA 3WLJA 1S3IA 1H4SA 3AL2A 3L02A 2DSTA 1UZLA 1E5TA 1XNJA 3SNHA 1VZ2A 2X15A 1DIGA 3QF4B 1Z08A 3A1VA 1DTSA 3K0AB 3CUTA 1E9AA 5F4ZA 4MVJI 1S2GA 1TECE 3P7MA 1UMDA 4LAFA 4MQFB 5KBYA 4HQ0A 4W82A 3MUFA 1T9DA 1OGIA 1XTKA 4KMRA 1NIPA 2NTJA 3WLTA 3F4LA 1I2DA 1JLRA 1RQ7A 3IPLA 2BTOA 5JYDA 2V1UA 2QW1A 4N5DA 3ZKWB 2O50A 1PKEA 4AY4A 2GAAA 2Q3FA 4LNAA 1SVUA 3TM5A 3W5CA 4QLBA 2EGHA 4LSGA 1IPFA 1I30A 4TVSA 4D8WA 3ZQKA 5ICFA 1ANKA 3BCUA 3K92A 3WBKA 4DEVA 5JZOA 2OM6A 1N77A 1Y80A 1KYXA 4DV4B 2IBTA 2ERCA 4QWWA 4CIVA 2XKKA 2Y1GA 4L6IA 2QROA 4NZNA 2CDNA 1W75A 4C2AA 1FQJA 4MR9A 1ZYUA 5JC1A 1HNXB 5AW7A 3WSTA 1ESCA 2QRZA 1R0KA 2FW9A 1QGOA 3A1TA 3P32A 4HGQA 4LK3A 4NV0A 4Y8VA 2BLNA 1OC4A 3QEBZ 4MUAA 1KEKA 1U4SA 5DTEA 1CVRA 1AT1A 1C7RA 3H5OA 3TZEA 4PN7A 3I9OA 4H3SA 4GVXA 2O48X 4JFRA 4WOCA 1XAIA 4JR1A 5C0OE 1ILEA 1X0XA 3AHDA 1J5EB 5THQA 1IPHA 2J4DA 1QC5B 3SYRA 3Q8MA 4Y2GA 1T25A 3CIOA 4PSUA 4C76A 4F6LA 2WJWA 2QTZA 4QFMA 1QUEA 2UVPB 4X85A 3T5MA 4GL2A 1R6UA 3HO6A 2GJSA 4PYOA 2EBUA 2D0PB 2ZPTX 4M0MA 1N6NA 3IA7A 2PMEA 3RG8A 2XAAA 1CV2A 3OQ6A 5KNDH 1Q2UA 1WOYA 3H9QA 1B8OA 2AQKA 2QTTA 2BONA 2V7QA 3DCYA 4Y2SA 5EG5A 2WJJA 3M4XA 4DR2B 2OLKA 2FEPA 5BV0A 3QLTA 4EKGA 1AS3A 2V6MA 2YJ5A 1PFUA 3NAQA 3WL4A 2VPIA 2PVCA 3RVQA 1YS2X 4Q3DA 1EK6A 2GESA 4JLVA 1QPBA 4KX5A 1NT2A 2YVAA 2RI1A 3FOCA 2RJNA 3H8JA 3NP7A 4GIBA 1G18A 4RADA 1A50B 4S1WA 5DM1A 2ZSIA 2YICA 3N2NA 4DIEA 1QF6A 3HG7A 1JALA 5ECWA 5BSVA 1YNOA 3CBGA 4TWIA 5NLLA 1TLLA 5SY4A 5A7HA 1K8YB 2XB9A 3PX3A 1N1DA 1W1WA 4IWNA 1SB9A 3TJZA 4O33A 1T26A 4KBFA 4YGXB 5CBPB 2J41A 4DA8A 4F9EA 2RKBA 2JAPA 4KIFA 1PS9A 5A4JA 3ZTTA 4TS1A 4XLLA 4C21A 2MJLA 1J0AA 1JLLA 1NV9A 3FDZB 2OHFA 5DWDA 3DAOA 4NICA 4DKJA 3CF0A 4LJLA 4GSKA 4FCCA 2WSMA 3VNSA 4Q7LA 2XPCA 4IO1A 1P72A 2O3RA 3AKYA 1BC5A 5C31A 5A02A 2DFVA 4HH3C 3ZLTA 2X0FA 5I7FA 2AJCA 3M81A 4BNMA 2QD5A 4LRUA 1XD2A 1PZGA 4DCMA 1B00A 1VG8A 4EATA 4G2NA 1KMHA 1CVIA 1GITA 3I1YA 3T94A 5CFNA 5AK0A 1DPFA 5E9AA 5BQ3A 1L7AA 2W2LA 4P33A 1IPEA 1XTQA 4IZIA 4M99A 3M1AA 1BS1A 1K3TA 1YR6A 3PUWA 4Q9DA 1ZMOA 4OGLA 2W2VA 3VO2A 2VYVD 1YOBA 2XA9A 4I4CA 4EPVA 2CVZA 3G59A 4M2LA 2X4IA 2AR0A 5AM5A 5ICCA 2FQWA 2M9MA 3FTNA 4F5WA 3DMRA 3G79A 4LY3A 4RH0A 1QTQA 4XIJA 1QUFA 2D7JA 4MQ6A 4QJIA 1RKXA 5DEOA 2V59A 2QN1A 3CKMA 3SSMA 4NYJQ 4ZGWA 3GBVA 2UYQA 1UBTS 2H92A 4R6XA 1DEAA 2IPMA 2Z6QA 1T3LA 4OQXA 2I3BA 3HDQA 4JBLA 2FR1A 3RSZA 5KOJA 4IVNA 5JR3A 3THWA 2DOKA 3AYXB 1VE3A 3G7SA 3IOYA 5B1DA 2RONA 5K4HA 1KEZA 4NG4A 1NGSA 2R5FA 3H2KA 1Q0RA 1KFEB 5G1OA 1Z26A 3LX8A 4K28A 1SOMA 4ZKEA 3LDUA 3LHSA 1D2NA 4CEIB 1IN4A 1KWKA 1WXHA 3DB1A 5JNSA 1LBSA 2AZTA 2J4CA 4QHSA 2X3YA 2I62A 4RA9A 2Y4NA 1EB8A 3H1GA 4DN6A 3MJSA 1U0LA 5C4GB 3ILSA 4PC3A 3RFXA 1SA0A 2FCAA 3HBNA 1AN0A 4NZZA 3TBKA 3LLSA 3MOIA 1GAXA 3ZY2A 2SCUB 1CJKC 1B0PA 2EU8A 1X6VA 3MS7A 4JQCA 4Z53A 3WIOA 1A8PA 1YAHA 2Z2YA 2G1PA 2MYTA 2DCMA 2RE8A 1U11A 2DECA 4P08A 5F2EA 1V16A 3FOZA 2ZR0A 5TRTA 2AXNA 4Q1AA 4HRXA 3PS9A 5IYZA 4H3HB 5DSXA 3RLFA 8ABPA 2DQYA 4Y2QA 4HY3A 4DCCA 4P3YA 3RHTA 1TYAE 3TPZA 1MBZA 1CRLA 1ACJA 1F6BA 4LSMA 5B2ZA 3I0MA 3JWHA 1B3RA 4DGQA 3NI2A 1H66A 1IRIA 4JCOA 2PXAA 5ABPA 2SBTA 3EZ9A 5JUWA 1EQUA 5YASA 3KQSA 3ORYA 3U17A 2IYOA 3H7AA 4FI3C 4O4IF 5BV2P 2EJTA 2V5AA 2ON6A 1Z9BA 3JR3A 4WGGA 4KFRA 5JEEA 3W7AA 3WGJA 3RS8A 1JX6A 3QU5A 4B74A 4NDNE 2YRXA 5FADA 1C7IA 4Q93A 4XDYA 3ORHA 3VYUB 3KVVA 3TQRA 2Q6TA 4QODA 5IVIA 5HKKA 3IYLW 2KSQA 3PHCA 3OQJA 4I3HA 1KQOA 4MSUA 2F1HA 5BT9A 4QUBA 4DCVA 1MAVA 1UEJA 3E2IA 4X8MA 2HMSA 3CM0A 3IPXA 3OD1A 4MR9B 2ZSDA 2HCBA 3E35A 3PFFA 4MVJE 2OKGA 3UJAA 2AN1A 4A1FA 5BR1A 5EJ5A 3GJSA 3TGPA 3IAHA 2R6JA 5EI5A 3NNDA 4IKPA 4HZGA 4W8GA 4YMIA 2ZK7A 5E7QA 3UMCA 2YKGA 1IHOA 1E2GA 1FJGB 2DLCX 2QSUA 3KHTA 3N5CA 5DN6D 1P2FA 4GGMX 2VHYA 3M49A 4YRIA 1FMJA 4B3HA 3B2QA 4EGQA 1FBTA 3CH4B 2VDJA 1NJ8A 4RQAA 1MOSA 4GXNA 5D6OA 2PHZA 2YN0A 1Q7TA 3C5HA 2WTNA 1TGYA 5DHPA 3FI9A 1NI5A 2PPVA 1L4HA 1T8YA 1WDMA 1JQKA 2ODAA 4CLEA 4D74A 1FYFA 5EWJA 5IKPA 4ILKA 3AC0A 3SIPA 2XECA 3AF1A 4IP0A 2I7VA 2W5UA 4OUDA 4Q4JA 3EC2A 3MC1A 4UNRA 2VT7A 3KTAA 2ZIUB 2A86A 4WDRA 1V8PA 4DSUA 1R64A 1MLDA 3AU9A 2RHGB 2WJZB 4IBOA 5C4IA 5GM1A 3TJRA 2YFYA 2A5LA 3T5TA 3AFHA 3R44A 2H08A 3DSRA 1QFJA 3F4KA 2ZCUA 1S8FA 4ZEOA 2C0PA 2QE7A 1USKA 1I3MA 1GRNA 1W2HA 3L04A 5IF3A 2BKEA 3GJZA 2FPGA 3RVJA 1E20A 1WV0A 3CXRA 3W78A 4CMHA 3IURA 1PTJC 4ID9A 5JCOA 3CPJB 3KAQA 2IH2A 3S55A 4I8XA 2R79A 2XUJA 3KLMX 4FUTA 1JFSA 2E4VA 2OBYA 5A0VA 3EEYA 3NAMA 4MW7A 1GP2A 4HGPA 3VISA 2Q7XA 4RHEA 1UFRA 1UPXA 3T8YA 1JLLB 5CVJA 4LDZA 2BY4A 3I0ZA 3RUHA 1BX0A 4CKBB 1V7ZA 1RAGA 1ZL2A 1ZJYA 4A1OA 1MXHA 1QVRA 1X7YA 1Z6PA 3WNVA 1GTZA 4I66A 1F8GA 2YWRA 3LY7A 2NXWA 3IO5A 1E2BA 4JYAB 2D2EA 5F1KA 1QZXA 4W9RA 3GBPA 5JJKA 2Q4TA 4X90A 5SY9A 2ZCJA 5EKSA 4NQRA 3ON5A 3K2EA 2DP4E 1GSHA 3KOWA 3PA6A 3KUKA 3KXKA 3CR3C 3IUSA 3MTEA 4GM1A 4OLHA 5TVGA 1UDWA 4B80A 3Q9NA 2UXCB 2H7XA 3ITKA 3EFEA 2HQSA 2AC2A 1UQUA 3L0SA 5GM2A 1PSWA 5CB8A 1H4QA 3M3HA 5CPBA 4BLVA 5DIZA 2IZOA 4P7KA 2B5VA 3HVUA 3S2EA 3MAJA 4US2R 4A91A 3LT2A 2BZ1A 5C8XA 1VI5A 2B37A 4PPQA 2ZKIA 3USES 4E5DA 1SIBE 1GRCA 1T2CA 1V4NA 1NY6A 1YQTA 3COPA 4IJQA 4XWGA 4DUGA 4B6RA 4E2FA 5J59A 3WBBA 1WLSA 1Z17A 2O2EA 2CLOB 4P3OA 1EHIA 2B6HA 3PWTA 3VC3A 1Q0PA 3ED5A 4IGEA 1P0PA 2B4AA 4UMVA 1Q0SA 4YCNA 5KOJB 1C4KA 3U13A 1A1SA 3AUAA 1XQVA 3KLOA 3OEHA 1SG0A 5JE8A 5T67A 3RS3A 5KIAA 3RT9A 3ODPA 1E4YA 3R6WA 1OGYA 5AVTA 3VHQA 4AI6A 5ER6A 3COSA 4OEHA 2A9PA 4MAAA 2I3ZA 3F3MA 3U6BA 2V7EA 5FPSA 1LVGA 4X6UA 2MSDB 2PQ0A 1BX1A 3SS7X 2OCDA 1LPBB 1LU9A 3EZ6A 2R85A 3LC0A 4Q18A 3RVMA 4DIBA 2HCRA 1MO4A 4U7JA 4GZMA 1T8WA 1YRQA 7ADHA 4U8HA 2QT0A 3QKIA 5AHRA 3P9XA 3SE0A 5C7YA 4TYWA 4KITB 1AOXA 1GZHB 2BUCA 4Y6LA 5THKA 3HEBA 4DYVA 3A1DA 2JGIA 1W93A 2YV1A 1E18A 3K2BA 3E4CA 1G3RA 4RM3A 5F64A 5F2NA 2YHIB 4WY5A 1LPAB 2GUWA 4PQFA 4QASA 4YJKA 2BMJA 2QLMA 3WLPA 5B3JC 4NESA 5JQWA 2Q4RA 1FMCA 1EXNA 2FWAA 3CLSD 1V16B 3D8HA 4E3WA 2PLNA 4PLWA 1QVAA 3O31A 1JSCA 3OZRA 2OPBA 5LQRA 3U4QA 3AKDA 1NRJB 4UNNA 4TYMA 2F17A 4WCFC 4C3UA 1TTTA 2YRFA 4LGVA 3IAFA 1ZI6A 1IK4A 1DAPA 1BHSA 1QWOA 1YB6A 1KHTA 1XMVA 2HBQA 4IZOA 4ZAYA 1P5RA 4XM1A 3HJFA 3CEMA 4J0QA 2HO4A 2CN1A 3FBTA 2V3CC 1WSDA 3ITDA 2Q5EA 2WKWA 2JFOA 1XLTA 3S5JA 3OF3A 5LBTA 4QT4A 2PGDA 3T9AA 2OQRA 1Y6ZA 3QUSA 3TUZC 3D7LA 1XB2A 3RC8A 3M6FA 4A7PA 2YZ2A 1X77A 2C8JA 2VHZA 4B40A 5JQGF 1V6SA 4NE2A 1N57A 2IA5A 3TQFA 4MIKA 2J5BA 4CM4A 2K2QB 1JYEA 1KC1A 1ZDMA 5HA5A 4GYJA 4LDAA 5I01A 2WYWA 1NP7A 1AKQA 1CUYA 3NHPA 4JV5B 4NWIA 1VJ1A 1ZNYA 2AHRA 1YAJA 5A9SA 4MCIA 3D0RA 2NUAA 4R8LA 2CEKA 5FTJA 3A8TA 3QUTA 3ENWA 1CYDA 2QP3A 5L40A 1H69A 1PJLA 2XAUA 3L05A 4PBSA 1I2CA 1WF6A 2LIVA 3GPLA 1J1UA 2R1TA 1VMKA 2CBZA 1H2FA 3R76A 2CCGA 1GNQA 3A36A 3GVIA 4WKBA 4MV5A 1C8LA 1MPXA 2FY8A 4RCYA 5HBGA 3W4KA 2PDAA 2VSFA 3PFCA 3WICA 4GLOA 1FFWA 3FNGA 3MT8A 1QG4A 3FTQA 3ZHBA 1XHEA 2XOKA 4G1VA 4R8RA 3SE7A 4NEGA 1DXYA 5BRAA 3C45A 1BWQA 2ZYTX 4R2HA 5EERA 1J8YF 4AG5A 1N5DA 2AOXA 2NSLA 4RGVA 2BFDA 5ALYA 3FSEA 4PBRA 4ZPJA 5EJ6A 4TUYF 4GRIA 4X6LA 2I7DA 4HYQA 3QVVA 1G5FA 1K7SN 1YT5A 3DHWC 3K0FB 3PQ3A 3MPOA 5EWJB 4EG7A 4AWBA 1EWTA 3H5NA 3VNVA 1WCYA 3GA7A 4UHFA 4D8YA 2YNMD 3FUUA 2B69A 2BI8A 2PZAA 3OT4A 4AZTA 5JFTA 4GPZA 1E98A 3WGTA 3LZ6A 4YB8A 5T57A 5C5DA 4M88A 1DAKA 4TYPA 4JLUA 2HDOA 5BORA 5ALDA 4QFBA 1R50A 1MNAA 2W6MA 3I9FA 4S05A 3EG9A 3BA6A 1U2SA 2C5BA 3VU9A 4RPHA 1YRLA 4UPVA 4KGVA 2CHVA 2CLMB 1SQFA 4YMHA 1DELA 1K88A 1L0BA 3GH1A 2W37A 2W2KA 3KBBA 3LP5A 5DLQC 1IM8A 2RBGA 1FXUA 3P9ZA 3CEPB 3UG7A 5KDDA 2IF0A 2JLBA 2ST1A 2ZAGA 3QELA 1JHMA 2Z8XA 4LHXA 5EUCA 4FP9A 2E6KA 2OLJA 2Z8YM 3HZOA 1NPDA 2Q6VA 1FMTA 1WO8A 4DDUA 4R9VA 1WB6A 5HM6A 1I0IA 1ZW6A 2AW5A 4GOND 3SR0A 1CZLA 1AGYA 1YB2A 3HVHA 1M0WA 3DE0X 4HWKA 1G7RA 1PNTA 1KJYA 1P7ZA 4WZAA 5HRUA 3R9WA 4DA0A 5AW2A 4URVR 1BDIA 4BQQA 5CB0A 3PFGA 4C30A 4S1OA 1JTEA 5HILA 1AKUA 1LLFA 1A04A 4PICA 3NTVA 3VC2A 3WNZA 8AT1A 4YT5A 3N53A 3U19A 4DGSA 3O7WA 2I6GA 3KFVA 1BE1A 1GKKA 4QQFA 4O5OA 5KWJA 1OV6A 1WZEA 3ZCUA 5JBNA 1Z7BA 4ECAA 3T5BA 1UAGA 2PWYA 1PG2A 1YDMA 2E87A 3HBAA 1VE7A 4MLPA 3BDVA 2HU2A 2P40A 2CVFA 4FNAA 2ZBFA 3KHUA 3UT5B 3DV0A 2YHAA 3AL0C 3REQB 2O07A 4EA8A 4II3A 1I5EA 2HD4A 5T6MA 2EARA 2X0NA 4RSGA 4CM3A 2FYTA 3CZ5A 5AXBA 2HIHA 4QC2A 1A4IA 3QLEA 4GRAA 4GWKA 1P5JA 5DLPA 3JVDA 3ZCQA 3D4LA 4ZEVA 1F2UA 4FPXA 1TAQA 4OAOA 1FBNA 3BMQA 1XN4A 3QVSA 1PGPA 2D5IA 2P8SA 2CMGA 2I4IA 3WGIA 3AVVA 3H2GA 1OB2A 1NJSA 2AYXA 3LU1A 3ZY6A 1KP3A 2VQEB 1D2CA 1U0FA 4ZA2A 2KBEA 2H5IA 1HTTA 4KLCA 3H8SA 4KIWA 3AHJA 4EF4A 5D3QA 1Q1GA 3RDPA 1LBIA 2YMQA 3VZRA 5FUWA 1FFDA 3IIKA 3USCS 4B33A 4EFNA 1XXLA 1O95D 3FA2A 4FEYA 5HK8A 1MPTA 3JAWA 1IDOA 4K40A 1MCZA 3A0RB 3ZU2A 4XLTA 2FE4A 4LYFA 5ECGC 2JCBA 3OC6A 2M1XA 1UDXA 4BLSA 1QIKA 2DX7A 2J5QA 1OT5A 3FRJA 1ISFA 1LLCA 3P0EA 3Q7EA 3SNKA 2QD1A 3WOVA 2FWJA 3EAFA 4IIDA 2XXJA 4ND8A 3VPXA 3WJ7A 2H1OA 4DLRA 2UZ1A 3NFYA 5HZMA 1DZ3A 1RVDA 4Y9SA 1YGPA 13PKA 1L5ZA 1X8JA 3Q8LA 4XX0A 4AROA 2SKCA 5LQDA 4IIXA 3HN7A 3DHNA 5DWQA 3QPVA 4HQKA 3CZQA 1C0IA 3EHEA 1KO8A 1R6DA 2OL4A 2C4KA 3WBJA 3RS4A 4UVEA 1E64A 2ZJ3A 2C1XA 2IDZA 3OCCA 4NMHA 2ZIWB 3ME5A 4H1TA 4PG6A 4AF6A 1ZK2A 2Y99A 1IIBA 3GCDA 3MFQA 3EXG1 2XUIA 4PX3A 1FSFA 4HB3A 3PXGA 2WHQA 2XNHA 3AEQA 1JSXA 1DUIA 2JIQA 1EUQA 3ZOZA 1OC2A 2C29D 2YJZA 4HOYA 3CRNA 1KDZA 1X7HA 7AT1A 5MFZA 2DFTA 2P27A 1O4VA 1XMJA 1FQKA 1NRIA 4BTEA 4ZJPA 4O4IB 1QB7A 2Q2QA 4EARA 4RY0A 3CEAA 4XWKA 1OLOA 1YR7A 3QFHA 3TOSA 4DA7A 5C4MA 2ZUFA 4IX9A 2G63A 2JRLA 2B8WA 1UBJS 1T43A 2FMHA 4ZVUA 5IP5A 4QOHA 1P74A 2ZOSA 3GFBA 4DNFA 1CBUA 3TSAA 1FYEA 1W49A 3G8DA 2ZJ6A 3V2GA 1VIMA 3L93A 3F74A 1UMKA 4LHSA 4XYLA 4CTMA 2TMKA 1OIVA 2WSSD 4ZGGA 4OK5A 3TQOA 4OHYA 5A9SB 2NUAB 3ZH9B 3AFGA 3BIWA 3IMFA 3V8BA 4D92A 4JBIA 4J2TA 4Y2TA 5LDHA 1SXJE 3EEBA 3IHWA 1VA5A 4DLNA 2EFEB 1WNFA 5IJ0A 2B2XA 1PWXA 2R1TB 2UYCA 3PGVA 5KNBH 1YQQA 5G2OA 5JARA 2WTUA 1S1CA 1CDDA 4ARZA 3CIFA 4QHTA 2NM0A 4X1YA 4AJJA 4QRDA 3ZU6A 4BJ3A 4ESOA 4EW3A 4GOLD 3TTSA 5DNUA 5LU9A 2XMGA 4BNZA 1Z34A 5BSWA 2FW7A 4GQIA 2P91A 2XITA 1MVLA 3FFBA 1KYVA 3R7WA 3I6BA 3TRKA 5GINE 4KYUA 5D86A 4DMHA 4N0DA 4I1RA 4L0QA 5COBA 1MT3A 1DTWA 2C5SA 4TXLA 1P1JA 2N75A 1UT6A 1T6BY 3Q7QA 3IP5A 2DMRA 4G86A 4KEAA 2WQ7A 1FOEB 2QE6A 4JJZA 2BDEA 1M33A 1GCGA 1VB3A 3QE0A 1VLLA 4QOIA 1JKIA 2QSZA 2IUTA 1H05A 2X23A 5EA2A 4GZLA 4ZDWA 4D8VA 3CLRC 4ZV9A 1I4EB 4UOEA 1BMDA 4KG7A 5T4FA 4ZZIA 4NNJA 4H31A 4UHJA 4XKJA 2FWRA 4RANA 2VJAA 4AG6A 4GRDA 4HPXB 3D0KA 3JQGA 4OLFA 2AT1A 2IK8A 2QGFA 4HB0A 1UL1X 4K6OA 4R2LA 4TRRA 2P2SA 1MJGM 4F4FA 1S5PA 1Y37A 2SKEA 3D6AA 1G19A 2W2KB 6ABPA 5E4JA 4URWR 2GTIA 2DBYA 4BP1A 1FS6A 3PTLA 3QELB 3IMKA 3W8RA 1J0EA 1V25A 1OYOA 2Y27A 4BGDA 10MHA 3Q0EA 5DSZA 2V7TA 2WWVD 4WBNF 1JQAA 1NJ2A 1I3CA 3HKBA 2QVGA 4M87A 2IX9A 2IIQA 5FPQA 1RP1A 2XNDA 1UEXC 2WMDA 5J40A 1UBRS 3QBEA 3GAFA 2RK3A 3QPAA 4N7JA 4OB7A 1QORA 2IFTA 1HLGA 3S1AA 4CMIA 2J3MA 1V11A 1Q5PA 2PAFA 1XWWA 3FF4A 1W1IA 3G8BA 4IOMA 3W06A 2UUOA 4HEHA 5CYOA 1T15A 3ZVRA 1BXKA 1P4GA 4TWJA 5H3CA 2PUTA 3K5IA 2VZ0A 1LI4A 3NYQA 4RSHA 5HUJA 3HLKA 4IDFA 2KQUA 3DKRA 2VUHB 3DWFA 2WABA 1TVEA 3WQHA 1D5CA 4XJXA 4LQCA 4G4JA 2NVOA 1L5OA 5M3BA 4OQPA 3IUYA 3DV0B 1YZGA 2CYCA 1U7TA 1A7UA 1KNXA 1OGJA 4TGLA 3E3OA 4X45A 2C59A 4XR9A 2NSJA 1XCMA 3G0GA 4JVSB 2Q46A 5I7SA 3WHIA 3UPTA 3DD1A 4JUIA 4MGKR 2PNJA 3W8EA 2DU8A 4Q12A 4YXWA 4O3MA 1NF8A 1BVHA 3WB2A 1JAHA 4UUAA 1X1EA 2HBYA 4RKWA 1FLDA 1EDBA 4ZFNA 1ZEJA 1XPRA 1PNRA 2GBFA 1CXZA 3R3SA 4K46A 2D8AA 3IOCA 2JD1A 1ULTA 5LLDA 4OBWA 5IF9A 2YV3A 1VYUA 3O74A 5NULA 2RHLA 5K3FA 1P77A 1XA3A 1YR9A 4JKYA 2FLWA 1VSQA 1M5UA 2XI4A 4UE3S 1M8FA 3QNWA 4LQ4A 2XBMA 2FZ5A 3DDZX 4F60A 4ZOQI 2JLCA 2AHOA 1TZMA 2DT8A 3IVGA 2AB0A 2HU5A 3JAWB 4CWAA 2JZCA 2HREA 4OGKA 1OTHA 3HKDA 3DO5A 4ND2A 5BN5B 1FNCA 3H9BA 1JAXA 3GDWA 4BB6A 3CVOA 1Z68A 4YN3A 1ZN2A 4BO2A 4X66B 2VJOA 3LNCA 4M1QA 5CIWA 3MHTA 3AJRA 1B0ZA 1DC7A 1ZZGA 4QGSA 4MKXA 2EFCB 4LJ5A 2UZ1B 3T5PA 1JDJA 3I01M 4QEZA 5FQOA 3E3AA 4Q7MB 3A37A 4XX0B 3FNBA 2IF2A 4X8HA 5CLQA 3W9UA 3K71B 3ZGNA 2ECPA 1KDYA 2WEKA 1N8NA 2OHJA 3E70C 2DFKB 2V9ZA 1QIMA 3ILVA 3K70C 3P71T 2WT4A 3GZNA 4KIGA 5JXWA 1ZUIA 1F48A 1Z6GA 2JC3A 1B6SA 1E3TA 1CUDA 3PUJA 4B73A 1NI4A 4JXXA 3FSGA 3AEQB 2OSBA 1EM6A 5K1ZA 4LOJA 5TQ0A 2I29A 2REQA 4QGBA 4RLFA 3LA6A 1PNVA 3AM1A 1ZNXA 2VKTA 3THRA 3OOJA 2BCGY 4RF2A 4D96A 3TIXB 1ZBQA 4JT8A 1NW6A 4ZHSA 2WF5A 3E5HA 2ZREA 4WOKA 5E7MA 5K0ZA 4LCBA 5CT8A 1OZHA 5JQGB 1LRJA 1K6XA 3FDJA 3N76A 3IAM6 3W6UA 1EBUA 1Z6XA 4XYGA 4FMBB 5AW0A 2GF2A 3UB3A 3EXEA 1S3GA 4XYBA 1GG8A 3WLOA 3RYIA 1M8KA 2L82A 4XVQA 3FPFA 5BQ5A 5JS6A 1JFVA 1XVVA 2GCEA 4ZHQA 3W5AA 3EMKA 3N8NA 1JG4A 3BWYA 1HI9A 2QTRA 3H1AA 1IEVA 4DQLA 4ETIA 3P0IA 1M0TA 2PL5A 3PUKA 1T2DA 1A77A 5F98A 4ZVKA 2B8NA 1WIWA 4XTRA 4G65A 3A7EA 3MMPA 1GAWA 1ZC3A 4QG7A 3HJGA 2WR8A 2RGXA 1G9TA 3OU2A 3HCWA 1VHWA 1JIKA 2X8WA 3H5RA 1X14A 4ARZB 2QL7A 3LUDA 3UBMA 1NKSA 2BE7A 4ENQA 3KG2A 1CP3A 1U5AA 3TSZA 1XEWY 1PEKE 3MGGA 1Q3TA 4ZQFA 1KPGA 4BVKA 1OWOA 2CNDA 2XUPA 3C3AA 3LP8A 1D0SA 1RPNA 3PIDA 4RHFA 3R7WB 3SJAA 3JQ9C 4D25A 1FRQA 1TMYA 1KAEA 5JAUA 5EWMB 1B8PA 4O4HF 4YMSA 2ODNA 2PSHA 1VLVA 3E5NA 2J09A 4BJ6A 3CKLA 4TUYB 5F3RA 3VZSA 5CURA 1N7IA 4YRMA 5BW4A 3NC0C 3PJEA 4PRZA 3WK9A 1XA0A 2BDTA 1C2TA 2I80A 4IXTA 4PNZA 5DYWA 2CJFA 3TCKA 2NUPA 1DCKA 3LOUA 3QVGB 3LW7A 2QRQA 1BS9A 4X7PA 3UH1A 2DETA 1U90A 3R23A 2JJ8A 4OK3A 1N2SA 2PQ6A 3I28A 3O4RA 2ZRHA 4ENSA 9GPBA 3TKAA 1E7SA 4D82A 1TFRA 1GLNA 2RJOA 3QU9A 3IUBA 3QP9A 4LVNA 2QX4A 4GU5A 4YJ3A 1GVHA 1PZEA 4B6EA 5B64A 4IIJF 3WHKA 2C8KA 1C1HA 2VPWA 4IFIA 4J0GA 4RIIA 3GLFA 4AKHA 2PYIA 2ZJFA 2BISA 4GEGA 1KP2A 3A9SA 1KJJA 4ZTBA 1RXWA 2CV2A 5IANA 2FGKA 1TW3A 4Q1FA 4O2LA 3D54D 1CZNA 3ZHRA 1VSTA 1QTRA 1VGQA 5CEJA 1NQOA 2OXCA 1Z4QA 2VJMB 2ZIAA 2C4UA 3VDQA 3O9VA 2ISQA 1IUNA 1YMVA 3QOFA 1Z4OA 2NZVG 4MR8A 3V1NA 4EY4A 3CH6A 3HKBB 5AJTA 3LHIA 1HF3A 1N3BA 5L8VA 1Q95A 3P2JA 3REOA 4AUNA 1Y5RA 1Q22A 1WMFA 3TE7A 4ENRA 3EEQA 1TTQB 4KMOA 4CMIB 5DP2A 4D43A 1V11B 4N0MA 4BLWA 1L8LA 2G6BA 2QQEA 1T9GR 2GJ9A 2ZAYA 5DVZA 4TVKA 3CKKA 3FHCB 4I55F 2R8EA 3N59A 3Q9SA 1Y9DA 1KEPA 3WYGA 2BEWA 4W6QA 1IZ7A 2X2EA 1A2BA 3X1ZA 1ZD9A 3LW8A 3F6EX 2BGLA 1YKFA 3DW3X 3MJFA 2GNPA 3LF1A 1T1RA 3OZAA 3PWKA 3IE2A 3QFTA 2HMTA 4NSNA 5A4MS 3NDJA 5KPDA 1NSYA 1HDGO 5AQEA 5E6SA 1JQBA 2J85A 5KX5F 3P19A 2PUGA 1CRPA 3EPJA 3EGEA 4R2IA 3LLVA 3GGPA 3I23A 4MYSA 1C81A 2G08A 2W2OA 1XTUA 3BXFA 3S1SA 2VK4A 3HYSA 2PIDA 2ZIVB 4GPEA 4U2CA 1XYYA 1QF7A 2JG3A 3GN2A 1R2QA 4FBMA 3KEGA 1Z25A 4FDAA 4FDLA 1KORA 4O1IA 4BB0A 4CE6A 4HAUA 1YI8A 5EPEA 1V7CA 3BWVA 5DGXA 4EI9A 4WZAE 3EEIA 4LFBB 1JVBA 2JCYA 1BG6A 3WLQA 1XDDA 1BEZA 2F3PA 1NVAA 3FKSD 2GWRA 4PF1A 4IICA 4UBJA 3VPDA 2IHVA 2VRNA 4RF5A 1CNFA 1ST3A 2IYPA 3UATA 1NVUQ 1SM4A 2IZ6A 5K3BA 3THWB 4J1NA 2DWOA 3B1JA 4J7XA 1N3YA 3GWGA 4BO9A 1ECCA 2VAMA 3L0IB 4JB0A 4YAUA 4QX6A 3RTEA 1SVNA 1L7BA 2BF4A 3GQBA 5DN6A 1ZIDA 1BW9B 1E9BA 3WTBA 2BEJA 4PZ9A 4C6TA 1JEEA 3KB6A 1XJWA 4HGRA 4WW0A 4CDRA 4BE4A 1UAYA 5DNEA 4W5NA 3FYSA 1TQ8A 4LOHA 1G4AE 3L6EA 4BV2A 3Q7RA 2F8TA 3M6XA 5FPHA 2V0CA 1TUEA 1CP2A 3F7MA 3OMWA 3H9EO 3EGXA 1ECLA 1X1RA 3MN1A 4A8HA 2GEUA 2JFZA 5JDIA 3EN0A 1Z2DA 1AKRA 5FWXA 3UMGA 3FM9A 2H3HA 4F5ZA 1ETUA 1HSZA 4C3VA 4H4EA 3OCVA 2GPJA 5IM5A 1ZM9A 2JFHA 4N65A 1QH9A 3TL2A 2VJPA 3TDMA 3FLBA 1KOLA 3BB3A 1BJRE 3ADOA 2E3JA 2HQRA 4U2FA 2AWNA 4RJJA 1Z5GA 2DWCA 1ZP6A 2P9CA 3Q5DA 5LD2B 4MI3A 1W5BA 4DIDA 1PT6A 4ICIA 3UFBA 4N0EA 1SIWA 1GGNA 4QSMA 3VR3D 1NI4B 1CRZA 3GD7A 2H5EA 4LY6A 2WM3A 4FJ1A 3MUNA 2ZYGA 5TQ0B 1EM8A 2WD8A 1U7DA 2PWPA 1RIFA 1HFKA 3FR7A 5AHKA 2P9YA 2QSJA 3K72B 4PYLA 1NLUA 2V55B 3AR2A 3JARB 4XIYA 4E94A 5KVSA 4WASA 1K98A 5TS3A 1YASA 8ADHA 4RBNA 3OCUA 3SPXA 2ZCVA 3K9LA 1CY0A 3L4SO 1XZDA 2IBSA 1DWPA 3T15A 4W9NA 5LP6F 1NXSA 3EXEB 1Y3AA 3L07A 3V8EA 2XH8A 2Z1NA 3A1EA 5CLLA 3RYIB 2ZZNA 4BMVA 4NPHA 3WISA 1XJQA 3QIVA 3IO3A 4QQKA 1FDRA 4PG7A 1S8OA 3K35A 4PO3X 5DRYA 3ROQA 4BIIA 1UBMS 1MA3A 5BNIA 1KBZA 5A4FS 2Y05A 2IXEA 3OEEA 1QYRA 2A8YA 1NE7A 2Y6UA 4Q39A 4UFOA 3GRVA 3UTDA 4MDFA 2BE9A 2CXPA 5FBWB 1O5OA 1NRWA 3PXAA 1PT9A 2GPWA 5I7VA 5AOVA 1VKNA 1XZCA 3TFOA 2CNWD 4G1MB 1KZ4A 1U9ZA 2OAQ1 2RGNC 2YWFA 3DW1X 4HT3B 2CKMA 2SECE 3U40A 4YASA 3ZDZB 2D1SA 2HYIC 3Q3HA 3DWEX 3O1LA 1E5QA 3X1XA 5HOEA 5FHRA 1E1YA 3QFSA 1H2BA 1WHTB 3FCXA 3V7NA 1KFJB 4M54A 3DZ8A 2Y0DA 1WUHS 5DHUA 4YAKA 4PTZA 1F8FA 4JLSA 2ZS7A 3DONA 3UC9A 4WK2B 1K0UA 1YDHA 4NU8X 2XRFA 4P5PA 4YV7A 2EP7A 5IBPA 1D5WA 1PVVA 1SEVA 3CWCA 1YRAA 2EZUA 4LXTA 1TU3A 4EA9A 3E2PA 4L02A 3R3WA 4ENUA 5JD6A 3LUCA 1JU9A 1I3NA 3IAM1 2LCFA 3L4KA 5EPUA 4YP0A 2NUPB 5K2OA 4J1TA 1AE1A 1R9JA 3HVIA 3UOGA 4DVGA 2ZATA 3OJLA 4BVAA 1ZRMA 1AURA 1YJCA 2PMCA 1S6YA 3K4HA 3MXOA 1KFBB 4YJ3B 4E08A 1RPTA 3GEPA 1SBYA 5G0TA 3ZEAA 5KNDD 3MSCA 4ZU3A 1Z82A 2WD7B 4HNAA 4KE8A 4D8XA 4C3OB 1G8PA 1Q11A 1W6RA 1ZU5A 2YYZA 3VU0A 5JRJA 3TGLA 1J2YA 1HLFA 4NTZA 2O8FA 2NXCA 4WXPA 4KQHA 2QQ5A 2NG1A 4S1TA 4RHUA 2BSXA 4DLWA 1GOTA 4ZI3A 1HE4A 3ADPA 4IHJA 1W29A 1UBNA 5ICMA 4WBNB 3A1SA 1E4EA 1XMIA 1HE2A 3D8SA 4HRAA 3K2IA 2IKSA 2ZU0C 1OXBB 3DFFA 3Q8KA 2DUMA 3DXXA 2JKVA 2KI5A 1USGA 3LF2A 1IU9A 1QANA 3ES9A 3MB8A 3NV7A 3B85A 1DFHA 3VX4A 3TTVA 4ANFA 3FHJA 1BCSA 1U2QA 3NTLA 1NBME 1JDSA 2Q0SA 1VJDA 1U0EA 2FHPA 3JQFA 3V7FA 2BEWB 1EK2A 1P17A 1XZMA 2UYGA 4NZMA 4KPFC 2C9YA 3BAFA 4RM2A 3RV3A 1NQXA 4JC0A 2PKWA 2CUNA 2ZS8A 2LVBA 2PMWB 4M38A 4M7OA 1VG0B 2JLRA 1KU6A 2PKYX 4M9ZA 4XYMA 1NXPA 1V5GA 4D4LA 5KX5A 1R8XA 1PFQA 2AA3A 1LBEA 4QAJA 4RGQA 2JBWA 3FFWA 4R2JA 1QHSA 4C4PA 1AZWA 1LVHA 2KLBA 2WINI 3BMNB 4XLZA 2O14A 3MCTA 5PGMA 1LH0A 3ZWYA 5A5VA 1JDVA 3AOEC 1S2LA 3M6IA 3OY7A 4KO3S 1CY6A 1F5NA 3BHIA 3PC6A 5LQCA 2W6PA 2ZT5A 3OZFA 3ZE6A 5AUNB 4NFHA 4EKNB 1N0HA 2OZPA 4QBFA 1DGQA 3TOCA 3G49A 1J23A 1JWAB 2B30A 2IU4A 4WFKA 1M7GA 1TW2A 3GOQA 2A3NA 2F1IA 2XYQA 3UC5A 1FC0A 4YUVA 2GD2A 3FPEA 3VJMA 3G8CA 1T2NA 3U4IA 1BMTA 1C7EA 2VTDA 3OPYB 2C3UA 4L15A 3RUIA 2PMFA 1L1QA 2BJWA 1H8EA 3C1OA 3VSDA 4XRGA 2OQ2A 1ZS9A 2CFRA 3GQBB 3BJMA 3NJRA 4IDCA 4JZYA 1DWOA 3E53A 4GH5A 2W7TA 1N6OA 4JEUA 4E15A 1HEIA 2GYWA 1JQLB 2IHZA 3AW9A 5ECYA 2UV8A 1FYDA 1A0OA 3FVTA 4JN6B 1WUYA 2HRBA 4TS3A 2QV7A 3F8WA 3AOGA 5EZQA 2QZSA 2JD2A 3Q7PA 3Q7IA 2X1HA 1Z5WA 2PR7A 4KXYA 4LGCA 3EGXB 5AKHA 3A2LA 3HFGA 4GKJB 4ZARA 1AHNA 4UDOA 2OD7A 5A03A 1G16A 1UBOS 1U99A 3HA3A 1FS4A 3PVZA 2ADMA 1W0JD 2L2QA 2OORC 1XPUA 4N6GA 1ZCZA 3L7CA 3N2GA 1PR0A 2FA9A 1PSDA 4QPZA 2NZJA 1U1GA 1PR2A 1U9IC 3DT6A 2J08A 4TWBA 4IOLA 2BGGA 3T4PA 1W5SA 2MR5A 5IU6A 1VPDA 3FRHA 1B6RA 5IT5A 4C7KA 2IYTA 1NBEA 4JU9A 4UM8B 4URFA 2RI0A 2R6HA 4CM6A 1AU9A 3W8DA 1V5FA 1XZ8A 4CQMA 2ZRPA 3GFVA 1SC3A 3O0DA 1EM8B 3HDGA 3W5IA 2CXHA 1KJIA 5ESWA 3AUFA 4B3MB 3AVXA 4M60A 2ODTX 3SD7A 3KPVA 5C35A 1UBGA 4KR9A 2Y9MB 3ZHXA 3TIFA 2HLDA 1MUUA 3UANA 1OILA 4CV3A 4IH9A 1YZLA 3LH5A 4ZI2A 3LQQA 1U8CB 2CGEA 3DC7A 3ONVA 4IQ4A 3KLPX 3RU3A 5LP6A 3DMDA 1XDBA 2KE5A 5CVDA 3SI7A 1X39A 1JHQA 2GILA 1K75A 3GRPA 1VFNA 4FMDF 3CGWA 4G9GA 4Z0TA 2FMUA 1DWQA 4MV7A 4MHOA 1YRYE 2P6NA 4BGVA 5A6SA 1VE1A 3R4CA 5ADWA 2VT6A 2J59A 1LJ8A 3NM5A 4EY5A 2AFHB 3BDAA 3CV3A 5JMPA 1LPPA 4RS3A 5JCXA 1VG9B 1M2OA 1Z07A 3FXAA 1WCXA 3A6JA 2WWRA 1HYBA 5B6IA 4H9GA 4L5YA 4O29A 1SMKA 4R81A 3F7TA 2GB4A 1RAFA 3MLEA 4INJA 3V1TC 5DYTA 4QXPA 3QG5A 1T36A 4ERXA 2A1IA 3D4IA 4IAOA 3QITA 5BNFA 1FTSA 1UT5A 1TT5A 4X1OA 3WHLA 4C7BA 5BN3A 2FDCA 4Q48A 1DKNA 5DT9A 3FFXA 1T2UA 5B4UA 5GZ3A 3OZGA 1UK9A 5KTNA 1MD9A 2E5FA 2GQ0A 3BPSA 2W43A 1JAZA 3GRUA 4IOKA 1TA9A 2MWMA 2Q0HA 3AV0B 4G1UC 4C0LA 3L82B 5LYYA 3PXXA 4O4HB 2QX6A 3FNFA 3BYZA 4PCUA 3A6PC 5AK3A 2LPMA 3IXLA 1Y3BE 5H16A 1KFCB 1RYZA 5U1PA 2CSUA 4HQRA 5K09A 2H8GA 2I5PO 2ZROA 4N5IX 3RS9A 4D26A 1SBCA 2VP2A 4LI0A 3OUUA 4X20A 2PD3A 4G8JA 2KM1A 4R05A 4WAUA 1NW7A 1BWRA 5CCXA 5HE9A 4E2XA 3QSYA 1PK8A 3C3KA 2A88A 2I1VB 2XSZD 2JATA 2ZTUA 3IALA 2CCJA 3I2FA 4PQGA 4Q9LA 5JSQA 2DULA 2YZNA 2NN3C 3DMGA 4L4YA 1AK1A 4RVCA 3ND6A 4EGSA 2O5CA 2YHBA 1ZGAA 4HQNA 3SZ3A 3IV6A 5IMSA 1ECJA 3IMCA 1OHHD 3TNDA 2R44A 3DJYA 1H9CA 1V1RB 5A4AA 3GA0A 3M0EA 3HWRA 3NLLA 5C3UA 2ZUBA 3Q5GA 2FN3A 4MVCA 1W5TA 3GVHA 2GF9A 2GBCA 4JROA 4XXHA 3C98A 1K66A 2VDOB 1R5NA 4ALJA 3L2OB 2VFAA 3OFVA 1HTBA 3GVCA 4I6EA 3C6QA 1PT8A 1BCSB 1OLUB 2QX7A 3DOHA 2IEBA 4I55B 5EP1A 1X1TA 2HKIA 2PIAA 1DEHA 1UP7A 2A4MA 4G8CA 1P6QA 1U8AA 3L6RA 3EXIB 4Y6SA 4PYRA 3ZUPA 2OBLA 5CA1F 5FOQA 3BA1A 3GLFE 1CJTC 2WA2A 1JG3A 2CNOA 1EK1A 1X9HA 2QLLA 2IHNA 3DMFA 2WUEA 2Y1WA 4RNCA 5CFLA 1T8UA 1LTKA 3HFRA 3FJ1A 2AK3A 5KX5B 2F8SA 1DL5A 2PR2A 1GWNA 3LUBA 4YAFA 4A2QA 2R6CA 2PUEA 1DJMA 3X0DA 3PLAE 3SEQA 4EENA 2Q4EA 2VP4A 3TUIC 4YHBA 1NJ6A 2ZXFA 4IDHA 3I0NA 4BKMA 3KX2A 2OQIA 3L8MA 1UFOA 5TPZD 1I3OA 2AOWA 4N3NA 4CODB 1N8SA 2E4ZA 3CMMA 2C4NA 2A58A 1LSOA 1CUUA 2QP4A 2C3OA 1R9MA 3WO0A 1RYMA 4LWOA 3WWEA 1TOAA 2Z95A 1A5BB 1U8EA 2JHFA 4ZEMA 2OO5C 3BGIA 4JBXA 3DA8A 4K9PA 1SXPA 4C5CA 3ACCA 3VJKA 2APJA 2ZSAA 3IQZA 5KREA 1IQPA 4KIUA 3RIEA 1IH8A 5L6MB 1CUEA 3G0CA 3D8UA 3MCZA 4E5SA 3SJCA 4JP8A 4UATA 4ZDIA 2XJ9A 3TD9A 2AQIA 2JF0A 2OZLA 3L4BC 3P9PA 4FT4A 5AD1A 1SRRA 2CNLA 3CLRD 3G0IA 4BVBA 5LZ9A 1CIJA 4AMGA 3UYLA 2P5SA 4TVBA 3EIUA 4OBXA 3O4IA 1PYGA 3RC1A 4B85A 2BGRA 2XMDA 4WLUA 1IONA 3UWSA 3T1TA 1GPJA 4RU1A 4KVGA 3TNYA 4DLBA 4OSOA 4YJGA 4DV7B 3R0IA 2NUTB 3WLRA 4A0RA 3C14C 1PR3A 3B8HA 3GAZA 3LPDA 5CAEA 4GE0A 1AGRA 4NK5A 1ZIYA 2XT0A 4E03A 1R15A 4AWXA 2PQMA 4NFLA 3DOUA 4G4GA 3CURA 2ZWPA 3N2GB 1Z4JA 2BBWA 2EGUA 1T6NA 1HDIA 4WNCA 4KRXA 1CEXA 4MW2A 4E13A 4RHXA 4OXXA 2X14A 1T6XA 5KTPA 1N5IA 2ZSFA 2REOA 4G0YA 2K7FA 3U62A 3JYLA 3HB5X 5BR4A 2YW2A 1PFVA 1YZVA 3AWIA 1ZGJA 2GI4A 1Q6YA 3PC8A 4GUAA 5ICSA 4CQMB 1GADO 2J0VA 2ZB8A 1NVXQ 1XTRA 3KJQA 2RSLA 1P5FA 4PYIA 2PZ8A 1U9YA 2BHTA 3X1WA 3C8MA 4KFTA 2FPPA 3C6XA 3IERA 1EZ1A 5CX4A 4G1EB 2P9ZA 1NXXA 3STYA 3W9YA 1PIWA 5DP1A 3QQ5A 1TMKA 2WJGA 2XWQA 1Z8NA 2H31A 3TTYA 2ZXUA 9ABPA 5LP6B 2WYUA 1RVV1 1YZHA 5KVVA 5JAQA 1JH9A 4JL8A 1XSEA 5A6SB 2OTCA 3CO5A 1O6ZA 3FCOA 3ZG6A 5IN5A 4YX9A 3AY3A 4YCLA 3QBTA 1XK6A 1OD6A 1YQGA 2PLRA 3OM9A 3FLMA 2H07A 1CY1A 3NX4A 5FP0A 2W6IA 4LHYA 4TSFD 1NBWB 2B92A 2WU0A 4KZPA 1UDAA 3W3ZB 1W76A 1D07A 1L4YA 4WLVA 4FLMA 3GGSA 4OB8A 5DBFA 2I6XA 2H06A 1RFLA 1JG2A 3IJEB 4US0R 2C31A 1T36B 2ZRKA 4QUIA 4Z6KA 1Z0KA 3DLCA 1S0UA 1TT5B 1HDEA 4X0EA 3EY4A 2RH8A 1DC6A 3DG9A 2FCRA 1NW3A 3COVA 3OLVA 4HCJA 4HPWA 1PL6A 1E5XA 1NVTA 2HU7A 1GR0A 1O8BA 3ORRA 2GFHA 2M2IA 1OAKA 1WU7A 5HZGA 3QEOA 4MQEA 2GVZC 1M9NA 4CMEC 1MAWA 4OAPA 5EIWA 1I7QB 1XI2A 4Y3UA 4KOEC 5HRCA 2WMNB 2I55A 1A71A 1L4LA 3B38A 1ILWA 3LSTA 2FZLA 3I8OA 1MV8A 2EVWX 4Z3DA 1WZ2A 3MJRA 4GI3A 4X20B 5FXMA 2AN3A 3L49A 1YIOA 4ECEA 4DLPA 4HK4A 5BN4B 3OOHA 1SC4A 2BEVA 5EE5B 1NMXA 5FOTA 3AVOA 3EE6A 1BS2A 4IXMA 2ZEJA 4DQDA 4QUAA 1P1KA 1RRCA 2NU9A 3DGFC 3GRRA 3R5FA 3I1FA 1L7XA 3FSJX 2P90A 1DWUA 2Q07A 3LWDA 4MUYA 5EXDA 1TCAA 3MIIA 5DGCA 3UCXA 4KFCA 2I33A 1ZIPA 3COJA 3FH0A 3AM5A 3UJHA 1ZHFA 3AWDA 4MLCA 5L3RA 2QZ9A 2AOTA 1K9VF 1VC2A 5LWHA 3AHGA 2VXCA 4UTNA 1VLQA 6Q21A 4JASB 4AU1A 3AVWA 1T24A 1E9RA 5D00A 3UJNA 4J7UA 1VIYA 2IYUA 4ZN6A 5C1OA 2X4GA 4FGUA 3RYTC 3GP5A 4M36A 5C32A 5KYGA 4JI2B 1Z29A 2D00A 3ZBTA 1B3BA 1R0CA 3ECAA 1UFQA 1WUIS 2XW6A 3D5TA 2GN4A 4BKQA 4NCBA 1E61A 4C29A 4BVHA 1TD9A 1L7DA 1JHZA 2O8CB 3CPHA 2VP6A 3GP8A 3H2IA 2IEAA 1E2QA 3N8IA 4W5TA 3KJIA 4CGYA 1V6AA 4QDJA 1WDKA 1NR1A 1M67A 1TCVA 1QRDA 1Y6JA 2JGDA 1XFDA 2BFWA 2WRZA 3AMVA 3F49S 4K26A 4LZJA 2BHRA 4B0PA 3AG6A 1RABA 1FP4A 5M7EA 2NPFA 3IAS6 3MLAA 1FRFS 1KJ8A 3RS5A 4BL5A 1Y1QA 3GLKA 4LYAA 2ZWVA 5JCZA 3EWSA 4AM8A 1YJAA 1DT3A 2YUTA 3BCSA 3AHHA 1U28C 4U2GA 3NDRA 4UE2A 4F7DA 3C43A 4S04A 3PC3A 4YUZA 1VMAA 4H1VA 4KN5A 4LW8A 3ICWA 1JHOA 3D0OA 5G40A 2PH1A 1ADJA 3U3KA 1JSZA 1AKNA 1HPLA 4M1MA 2QPLA 1OI3A 1RWWA 3ZXIA 2R97A 4CV2A 3WSWA 1PLKA 2G1UA 1OWLA 1MJHA 2CT8A 4AJPA 1PJTA 3VR4H 4QNNA 4RY9A 1L5HA 3EPLA 1DUVG 3H86A 2IPNA 2NZYA 1BH6A 4EOGA 5AUOB 3A6DA 1H23A 4KLZA 4R51A 2H1SA 4NZYA 4RTQA 3H84A 1NFFA 3AJAA 5JMOA 4NCJA 4RAOA 4RLSA 1P2UA 1EHCA 2VA8A 1G1AA 3FUCA 2K6GA 4FHCA 1R0BA 1YBAA 2C1ZA 3CLKA 4KUGA 3TLAA 1RM4A 1C0PA 1Y33E 4QOSA 1T91A 3R74A 1A96A 2W6JA 5EJAA 4JLBA 1CR6A 5IAEA 2XXAA 4RVDA 2NVUA 4DXHA 1XAJA 3KTDA 4PGFA 4D9KA 3GL9A 3HE3A 4YP5A 3I9KA 2C07A 1II8B 1GFZA 2Y1EA 3JQRA 1VMIA 5I9BA 1SOWA 1XCBA 3TX2A 4OQZA 4BCCA 2WWHA 4EZBA 3ELUA 3L0BA 4OFBA 1WB5A 1L8AA 1FU7A 3D4OA 3KAPA 1A69A 3M34A 3QFFA 4TTAA 5CTAA 4GOOD 2HXSA 3FF1A 1E6MA 1UWKA 3OF5A 3WK7A 4KDRA 1XX6A 1M6HA 4G0NA 1G8YA 3RADC 1KI2A 2XF8A 1WUKS 5BVHA 3IVRA 1RWMA 4RKQA 2VJDA 3HXKA 1FTYA 3BK7A 5CJJA 4EUFA 1LLQA 1SHTX 5FOVA 4UTRA 4Q1EA 3AVPA 3VH2A 4P3KA 3RHSA 3S1LA 2C61A 1GG2A 3B5EA 3I72A 4FE3A 2Q5LA 3L1UA 4P4SA 1L4EA 5A3VA 2NMVA 2WE8A 2GSDA 3RPEA 4NHEA 4GGPA 4IJKA 4FMDB 3ENQA 5JYBA 5T64A 2QTNA 3PWSA 3OOWA 3FTDA 3VVLA 3ZHQA 4EFDA 4OMFG 3WKDA 5HQTA 3ENNA 2YCLA 1V41E 5FJJA 4ATNA 3O8DA 4GW3A 2WKRA 4EPRA 2QF7A 1OPXA 1ZSVA 3OUZA 3PI7A 4PS1A 3QUCA 4V0NA 4EJ2A 2FLVA 1QOQB 2AZDA 1Z0IA 2X8LA 3KZCA 1NA5A 1Z22A 2EZTA 4MMZB 4K9KA 4F9GA 2I4OA 3LGAA 3MSXA 5EUQB 5FYQA 5ADVA 2XKBA 4IINA 1E2LA 4C07A 5KTYA 1IM5A 1CLUA 3OOEA 4W5HA 4DMLA 1L7EA 4DJ5X 2I2FA 3QU4A 4RESA 4AIIA 2N3ZA 3HDJA 1KVQA 3DMTA 2ASVA 5TEVA 4HN4B 4Q3CA 2VUSA 5E8RA 2M98A 1WV1A 5AXCA 5EIOA 3IIEA 3SZOA 2UKDA 3FROA 4JLWA 4DM4A 4E3ZA 3B1ZA 2GPNA 3C1TA 1KIMA 4XVCA 4Y9DA 1RQRA 3NCTA 2GAIA 3U44A 3BVPA 5K01A 2WW8A 4H3VA 2PXCA 3EXAA 4D3ZA 3HXOA 4B4VA 1DKQA 4Y0AA 2M6KA 5LQJA 1U04A 3KEQA 4E21A 1LSJA 4QT0A 3AF4A 4Q7KA 3ZK8A 1GGKA 1ZNQO 4CIDA 5KOHB 1YFZA 7GPBA 5DCWA 3WZMA 5ALLA 1FVOA 4R9UC 2OOKA 5JSHA 2YRWA 3B1FA 4A0QA 1I1QB 5C3MA 2BEVB 3WLFA 4AQ7A 4KR6A 1OFGA 4PG5A 2CLIB 5ANRB 1FVFA 1YO6A 1L4FA 1LJLA 4UU1A 4OMDA 1KQNA 5EQFA 1EE9A 4EH1A 3DUFA 2VA9A 4FIZA 2CHUA 3DYIA 5DYGA 4PX9A 3KZ1E 1EEXB 6LDHA 3SKVA 1JAYA 4U7WA 1BEUB 2B34A 2AOTB 3NH9A 2PZMA 1PE0A 4PXSA 3ACDA 5AM4A 3SSAA 1SBZA 2GKOA 4B2IA 5IUJC 4PZ0A 3B8EA 2FSSA 2BFCB 3NBQA 3T99A 3FOFC 4AICA 3ETGA 3C24A 1KKLA 4MEAA 1RSZA 4FEEA 4GZ6A 1E6LA 4FYVA 1HZZC 3SIWA 4GI1A 1TZJA 3AEKB 2QZ4A 1ZK3A 2EJBA 2RGUA 3HKEA 3I30X 1MN6A 3NJ4A 1GLVA 3QMWA 1CJCA 3AF6A 3GI1A 3G2HA 4L85A 4UE6A 4ZT2A 1Q1ZA 5CA1B 3THOA 1NDHA 1LX7A 2AI2A 2KB0A 3EIXA 3GJ5A 1TYZA 3QU7A 5BWNA 2PA3A 3HJRA 2ZIFA 4MI6A 2JGDB 1N9ZA 1SCDA 3ZWNA 1OZFA 1GZSA 1M8GA 4LJ7A 1FP4B 3IKJA 4BHTA 1Z0AA 1SBNE 1GA1A 1BZYA 1TM1E 2GSWA 3WJ1A 1TJYA 3ICOA 4RIHA 3QLVC 4IGFA 3KFXA 1Z3IX 2WJPA 2H1CA 3M4ZA 1KOGA 3HBFA 2H2IA 1WB4A 4Z0HO 3JQPA 3GELA 5LA6F 2JI8A 1MC1A 1U2RA 3NBAA 4TWZA 5IWAB 1C50A 1ENYA 4D02A 2C04A 5BYKA 2XOXA 1PEYA 1ZOSA 2CLHB 3PR1A 2XNJA 4AJ4A 3EQ6A 5FNVF 1G38A 4EABA 1ORHA 3MCUA 2JFPA 1ZHOA 2LRHA 2IOQA 4FC7A 1PFWA 1KAOA 1DIHA 3WDMA 1EBFA 3N2KA 2HQBA 3C6ZA 2XVXA 1E4OA 4HDSA 4I1YA 2ECFA 3SBEA 4E09A 4A23A 1L5HB 2MSEB 1CJBA 3D7NA 3R7DA 4U7DA 4PYNA 3N86A 3ER9A 2X3FA 1YU9A 2XWPA 2LXNA 2XA2A 4HYYA 4R01A 4DIKA 1DEKA 1EGVB 1OW3B 4R83A 4RVOA 4BC0A 4DANA 2VHWA 1EA5A 4GBGA 1STOA 3UEOA 1JDNA 5KC8A 1G3MA 4QRIA 1SQ6A 4JZKA 1Q7GA 3VTZA 2XXAB 5EIAA 3JR7A 3IEVA 5HKOA 2NVUB 1H22A 5E95A 1OFHA 4MP8A 4FFLA 3LFHA 2BGKA 3P5BA 1G1MA 1JUDA 3I73A 3ZVKA 2GDZA 3F6BX 2GYVA 3GT3A 4XD2A 3Q7SA 1WXWA 1U2ZA 1YRWA 2DPHA 2ZLBA 3W2FA 1ZEMA 1SVSA 1OXKB 3P97A 4Q82A 3W9SA 1G6Q1 4E12A 2B0JA 2XCQA 4H2DA 5K0JA 4IX1A 3BRSA 2ZDHA 4JA0A 1O03A 1S8NA 2X1MA 3EOBI 4MIYA 3ZXXA 4CQJA 1DQSA 1H1LB 1JEDA 2GZAA 4JMLA 2XE6A 4F04A 3C3EA 1NX6A 1WXQA 4GLFA 4HAVA 2O5RA 1Z6QA 3TAHA 2HT1A 2H17A 4FNOA 1GPKA 4C4YA 5JVDA 2I99A 3CTPA 1FMLA 1C7ZA 2INGX 2J3IA 2W2LD 4L8VA 2QNIA 1Y4AE 1ZNZA 2ZR8A 1X1BA 4H7KA 4JODA 5ALUA 2CFIA 1IY0A 1K7XB 3FPBA 3KV3O 2GZRA 4H77A 4DR1B 2VRWA 4C0QC 4MROA 4GMKA 4QPPA 3B6IA 4YTEA 4HBZA 2ZW9A 5ENVA 1YBMA 4RWEA 1SXQA 4HC4A 1RI2A 3WP0A 4ZCMA 4A8JC 5K6TA 4HZUB 3EXFB 1DRVA 1QLJA 2GPSA 2JH8A 3JYOA 3WLHA 4DMKA 1EFRD 5EHZA 2Q9BA 1EWQA 3CVJA 4PAGA 2OV1A 4Q4HA 4R9RA 3DEJA 4U2BA 1QYDA 2PUVA 2ZT7A 2P78A 1A88A 5CFQA 1I14A 1NVEA 2C8VA 3OZBA 4OGFA 1GTRA 2Z1MA 2V03A 2VYVA 2GK4A 3BXHA 3DKVA 3EG5A 3CH5A 4R1SA 4HVTA 4PYMA 1FSPA 2XQIA 1XEWX 2EF0A 4DUPA 4Q0MA 4B44A 4A73A 4NAUA 3QFCA 2X76A 3E23A 5EQTA 5ITZA 4L3WA 5KI6A 1MC5A 3U37A 4C6RA 2AR7A 2BHLA 2NSYA 5LBIA 4A6XA 4C43A 4RKRA 3E8XA 4P58A 5A7GA 3U44B 2CJWA 4OPMA 3URMA 1T35A 1MMFB 5DI3A 1SCKA 4L76A 3CF2A 1Q1EA 2FG5A 3BGDA 4AWAA 4BNVA 3C7DB 3DM5A 1GA4A 1VJTA 3AIMA 4OIMA 4RAQA 1NLFA 1O9BA 2A9QA 3EF0A 3NTUA 3DEAA 3O91A 3S2IA 2F8LA 4KRGA 5IX8A 1E0JA 4NC9A 1OLSB 4DILA 1KQGA 3WYFA 4DJJA 4XQ9A 5BSEA 2VDNB 1BAPA 4E7PA 1W4CA 1PW7A 1MEOA 3DUFB 3N75A 2C9CA 2OM2A 4X93A 5CGQB 1BDBA 4CCSA 4KOAA 1EBBA 2AWOA 2CZQA 2RGBA 2C9BA 3NU1A 1JW9B 3GJQA 4HN9A 5DBGA 3EWNA 3FX2A 3L8DA 5F4BA 3TF5A 5FA5A 4R0NA 3X1JA 4C01A 1B7GO 2OECA 2CL6X 2FOXA 3CGGA 3SXUA 4DABA 4YPVA 2WFAA 3ZCTA 3C3YA 1ZHHA 3GFQA 1KH2A 4LF8B 3K8YA 3BWXA 3AZPA 1S7CA 1OCEA 1Y8CA 4B3CA 1GAEO 2B4QA 3HRIA 3PE3A 4X91A 1YC5A 3JATA 3U1TA 3URKA 3QY0A 3DCNA 1PJ2A 2YWBA 2F43A 3BBLA 3TNJA 1KMQA 1SCUA 1Y6QA 1JA9A 3HKEB 4IDBA 2VNJA 3NP9A 2E4XA 3MAGA 4H6VA 3LOPA 2R0QC 2P0EA 3WB9A 4KLNA 4FNGA 2ZE7A 5LM3A 4E2WA 3NM4A 2HJWA 2QWXA 2QD4A 1J20A 3RRZA 4RIEA 4PW0A 5JISA 4TLLB 3SYKA 3S5UA 4JLNA 4IS3A 3NWJA 3A3NA 1G6KA 1K4MA 1JTVA 2WDZA 1FFXB 2W0MA 1R0XA 3UYKA 2I87A 1VP3A 3EVDA 1DIRA 4QELA 2XZTA 4G0ZA 3EIOA 4BNKA 2RIRA 1NHWA 1DT5A 2P5UA 2BAGA 3DLAA 1EP1B 2R3SA 4GOMD 1NLMA 1J2UA 1FTGA 1V9CA 4EKDA 3QSGA 1M1YE 5EINA 5FKJA 5U9CA 2DE0X 4LISA 5J1SB 2YOHA 1ZRSA 2F6RA 2WHXA 4NMWA 1CRQA 4EVSA 1KYZA 4K81B 3TLJA 4QJ5A 2O6LA 3FYUA 5ALRA 1A9ZA 4BEWA 5KVAA 4BMSA 4B3IA 2VPYA 1PDVA 5H4GA 5IZCC 1XYGA 3EF1A 3MINA 1UXIA 2O7RA 2CD7A 3PPYA 3OJFA 3UA4A 4P5DA 4PG4A 1XR3A 1U5BA 4WKOA 3A25A 4PQYA 4N5LA 3A1UA 4HDSB 2IYSA 3I3SR 3JRNA 2W11A 4TL9A 1CB7A 2VAWA 1ADGA 3LYUA 3IDOA 1IN1A 2G77B 3VKWA 1QRTA 4LF4B 2PLAA 4EJSC 4RTOA 1X7DA 1GUDA 4PLFA 2ATCA 5H3HA 2JVIA 1CUZA 4DMUB 4BVJA 2JJ1D 3SYNA 1QHHA 4EO9A 3OPNA 1I94B 4L57A 3PKJA 4L9RA 2JL1A 5F21A 3PP8A 4IIHA 5CNMA 3WWOA 1EFCA 4FOSA 2QKYA 4QTTB 1CZOA 3JYHA 3ZD9A 5JTUA 5B30A 1ENZA 3JZDA 1KJQA 4LYHA 4TTQA 2EBFX 3AF0A 1H3NA 3DE7X 3SDSA 4NDAA 1KTIA 2FMXA 3WGMA 1B0UA 4ZYWA 4DCNA 3T1NA 4D0RA 4BWFB 1W5EA 2AD1A 2FSIA 3ONWA 4KR0A 4RPLA 2HNBA 3ESDA 4XGRA 1G9SA 3NOQA 3BRWA 4QXAA 3ZWDA 3MJ4A 1IE3A 4DV1B 2P9EA 2QLBA 3AXTA 3WK4A 2H2FA 2IPXA 4P7FA 1JKJA 5K3AA 3SQNA 3SFTA 5BXYA 1UAAA 4MYTA 1HH4A 1Z06A 4KYVA 2R8OA 4HMOA 1XZNA 1DBSA 1XQ6A 4ZQGA 1F9AA 3TRHA 1QO0D 5CEFA 4ND3A 2W0SA 4F93B 3CZPA 3MMXA 4GG1A 5E1OA 3D3EA 2QVZX 1OXSC 4IMJB 5B4VA 5CFPA 4YNBA 4FWIB 5G0UA 2DQ4A 5HX7A 4MXDA 1NZFA 5ALVA 4S1VA 3JX9A 2ZRCA 2QQFA 1TYDE 3WRXA 4A27A 4NONA 5AI5A 3KALA 4WFQA 4D9HA 5E1MA 3I76A 4FYIA 2VDVE 1OV4A 4P93A 5IWCA 4TLEA 3OX3A 1RRPA 2HW8A 2EERA 3A7DA 3PZBA 1PS0A 3T9DA 5JY1A 3ISVA 3OLCX 2CZCA 5H81A 5BWOA 3NGXA 5E6UB 1QGUA 2P3OA 4BPRA 4MZDA 2EIXA 2D3TA 2FN7A 1GGVA 4U2EA 1DJQA 1M2WA 3OEHD 3CINA 4L8FA 2QB5A 3K0KA 3ZC3A 1ITZA 1RXEA 5DLDA 3HM2A 3L7JA 1E2FA 1BDHA 1ZONA 1CHNA 3HN2A 4ZYUA 2YCBA 4W99A 5I4IA 2YYSA 1BU5A 4IKEA 5ITZB 4C06A 2E4AA 1UT8A 2Y1OA 1E32A 3NASA 1MFZA 3PHJA 4O2AF 3KDAA 5CG2A 2HF2A 1H65A 2VLIA 1YBVA 1YD7A 1A9SA 1WSWA 2PX5A 2YINC 4N8DA 3P9SA 4OP3A 4Y2JA 4DS3A 4YT2A 4HYEA 2Z6VA 4PZDA 2B83A 5DI3B 1ZK1A 4R5HA 4C4OA 4KDEA 4EMUA 3AVTA 1SBHA 3EA0A 1EDDA 4ZICA 4F91B 1B4DA 5AOBA 4BLUA 4GC9A 5EEGA 4ZYXA 3DE5X 3NRCA 4B5KA 1BHQ1 3T1HB 3UKDA 3BM5A 3SYMA 3OZSA 3RTGA 1B8NA 2VLBA 2ZI4A 3K53A 4GX5A 4LE2A 3V8NA 1MFPA 4JAVC 4JBGA 4FB5A 1O2DA 2HRDA 3PQ8A 1WS6A 3JQBA 4ITRC 4CUJA 1AS0A 4I2NA 4AW9A 5K0BA 1U7XA 1YQUA 3CLTD 3S3TA 4KWIA 1F2VA 2PUFA 2GBPA 4C0HA 5LFAA 2ZRDA 1XHLA 2PTHA 4JL6A 4Y18A 3STWA 5CX1A 2A7QA 2WTMA 3KEFA 3O3MB 1J00A 1TJ4A 2BMDA 4I46A 2R62A 4XWTA 4DV0B 2G0TA 3WSVA 5T7BA 2ZT6A 5CFZA 3SC2A 3ADDA 1TL7C 2BFBA 4MRNA 4E32A 1P60A 3DCIA 2HL6A 3QBDA 2DPMA 3O93A 1UMBB 2O8VA 3RBVA 3DLPX 5BRNA 2EQAA 3E7WA 1R8JA 1DOHA 3BD8A 1GKIA 4MPTA 1R8YA 4FDUA 5BSKA 1USUA 1HDXA 1SCUB 3S7TA 3DEYX 1NT4A 1S02A 1C4XA 4H0FA 3GLIA 3PUIA 4JIMA 2F2TA