3CG4A

Crystal structure of response regulator receiver domain protein (chey-like) from methanospirillum hungatei jf-1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
126
structure length
126
Chain Sequence
HKGDVMIVDDDAHVRIAVKTILSDAGFHIISADSGGQCIDLLKKGFSGVVLLDIMMPGMDGWDTIRAILDNSLEQGIAIVMLTAKNAPDAKMIGLQEYVVDYITKPFDNEDLIEKTTFFMGFVRNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Response regulator receiver domain protein (CheY-like)
publication title Crystal Structure of Response Regulator Receiver Domain Protein (Chey-Like) from Methanospirillum hungatei JF-1.
rcsb
source organism Methanospirillum hungatei jf-1
total genus 37
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2008-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3cg4A00
5JS2A 3ILHA 4JOQA 1AB6A 2FMFA 3KKEA 3QK7A 3SQNA 1EHCA 1D2AA 3O1HB 4N03A 4F8JA 5PNTA 2WJAA 1ZDMA 4W5OA 2FMIA 1Z17A 4N76A 5TPWB 3ROTA 5CNKA 2ZWMA 4MQEB 2ZAYA 2QVGA 5FBKA 2FSPA 2FQWA 1DP4A 2JRLA 4Z4HA 1JFVA 2AYXA 3OO0A 5JNTA 1FQWA 3M6MD 1JBEA 3JPYA 2E4XA 4E7PA 2PMCA 2NUBA 2YHAA 4YCSA 2R48A 5IBQA 3QEMB 3HCWA 4O1IA 4LRQA 4RDCA 8ABPA 2NZVG 3TMYA 4L85A 4GNRA 3O1JC 4D6YA 2MSLA 3NBMA 2L19A 3UUGA 3CU5A 2LPMA 4IILA 1A2OA 1PNRA 2PJUA 1L5ZA 2O20A 2VYCA 3N75A 4UHKA 4TLLB 3H1FA 3OLZA 2CWDA 3RQIA 5KWSA 2P4UA 4TN5A 4MR7B 2FW0A 2GI4A 2L18A 3GBVA 3QLTA 1RZRA 3JVIA 4Z4EA 2FMKA 4Z4IA 5KI6A 1KRWA 1U2PA 3RVSA 1Z25A 1U04A 1ZH2A 5TQ0A 4ZJPA 1USKA 2FXIA 1ISSA 1NXOA 4G0QA 4ZPJA 5EWJB 4EUKA 1MIHA 3R0JA 3SAJA 1NXPA 1DZ3A 2FLKA 4LE1A 4HYEA 2PUGA 4DADA 3IP9A 1U0SY 3JS5A 2VUIB 1JFTA 1ZY2A 5JNWA 4O1HA 2XDYA 4MQFB 1QP7A 1R8JA 3I5AA 6CHYA 3UK0A 1FFWA 4KREA 1RXEA 3M9WA 2JCGA 4TLMB 3CS3A 2RJOA 2DRIA 1PNTA 2PUAA 3H1EA 1M5TA 3GT7A 4MS1B 1Z15A 3OM1A 2QXYA 5ED4A 4FB4A 3QLUA 1D1QA 2PUBA 3I45A 2PUDA 4MS3A 4NQRA 3E61A 1QMPA 1GCAA 1LBHA 2LUOA 1H9CA 2P9HA 2M98A 1GUDA 4GPAA 1JWLA 2W42A 4JB0A 3NNNA 4WT7A 2LP4Y 4YV7A 4N47A 3S99A 3FGZA 2WMYA 3DGEC 1FFGA 2J48A 2JBAB 4LE2A 1LJLA 4EY3A 3NNDA 3IPAA 3H5LA 1DBWA 4H3HB 2WWVD 5B3JA 2PLNA 4G97A 3SNKA 1DC8A 1KMIY 3LUFA 4RKQA 3LKBA 4Z9BA 1JH9A 4MRMA 3OLWA 5IUJC 3UKJA 1URPA 4OLBA 1JDPA 1MB3A 4IGAA 4W5RA 3OLVA 5CHYA 1PEAA 4EYQA 4PZ0A 5TQ2A 1BAPA 4EYOA 1NTRA 3C3KA 3NHMA 2HQBA 5C5CA 3LUJA 1ABFA 2QZJA 3CG0A 3ROFA 4DN6A 3K4HA 3HVRA 4RSMA 3C6QA 4WZZA 1SRRA 4G0XA 4XXHA 4E7OA 1BDHA 5CNIA 4KNYA 2R4QA 2CHEA 4G0ZA 1LBIA 4ZYLA 1C0EA 3OQOA 3BILA 2FKAA 4F3TA 3RVKA 1ISRA 1ZVVA 2QW1A 3C3WA 3KG2A 3SM9A 4RK5A 1E6MA 1SD5A 3KJXA 1P6QA 1USIA 1JFSA 3GYBA 4HNQA 1YMVA 4JB2A 4RK7A 4RS3A 3Q9SA 1JHZA 3DBIA 3LMKA 3T6KA 4CBVA 4RV5A 1SXHA 4EYGA 4N0PA 3T95A 3CZ5A 1D1PA 2FMHA 4F12A 1YS7A 3H5IA 1JL3A 1VRVA 1PHRA 3KHTA 2X7XA 4IMJB 3D8UA 4LE0A 5TPZA 2QU7A 3Q7SA 4LZLA 3N8IA 2GKGA 3BBLA 5D2CA 5CNMA 3SG0A 4EGSA 2PE5A 2HQRA 1EAYA 1QO0A 4H3KB 5FWYB 1KRXA 4MR8B 1UDRA 5E3JA 1W25A 3GL9A 3QELA 1B00A 4LDZA 1E2BA 2VK2A 1JF8A 3JY6A 1JX6A 1YK0A 3VNBA 1QP4A 2IKSA 1EFAA 2JVJA 2RDMA 3MQ4A 2A9OA 3I09A 1WETA 4ML3A 4RY9A 1E6KA 2HJ9A 4JP1A 4OTZA 3QLVA 2YHBA 4M88A 5JNRA 5IUNC 4ETNA 5FWXA 3G85A 4WXEA 3F73A 3OMXA 3O2SB 4KQ9A 3N0XA 4MS4B 3RVRA 4RK4A 1LJUA 4ZMSA 4Z0NA 4PE5B 5IEBA 4HNSA 2FEWB 2ID7A 3A10A 3HDGA 4KMRA 4Q7EA 4WXMA 3HXMA 2PUCA 3DLHA 4P1ZA 3FMVA 1M2FA 1YS6A 2B4AA 2FEPA 4RZSA 4PYRA 3RVQA 4MLDA 3MM4A 5HM6A 4LX8A 4DQDA 1Y1LA 1ZN2A 1VKRA 2PKXA 3FFXA 2FQXA 1Z18A 1SXGA 1NXTA 3HDVA 3DGFC 3H1GA 3D02A 3O2JA 3Q7TA 5EWMA 3T38A 3FFTA 3O2QB 5I4CA 3HEBA 4D74A 3GRCA 1DCMA 4Z99A 4RK0A 4RXUA 1K66A 2L2QA 2B1JA 1U8TA 3H6HA 4G86A 4EVRA 4Q6WA 4Z9AA 3RH0A 5TQJA 1NXVA 1SXIA 1DBPA 2E4VA 3OQNA 1BVHA 1A04A 3HSYA 1ZITA 3F6CA 3CFYA 4MPTA 4YP9A 5HKOA 3QEKA 3A3KA 3OLXA 3Q41A 5EWLA 4KQCA 3BREA 2L17A 5T7BA 3HUUA 5IC5A 5TQ0B 4RY0A 3A0RB 4ETIA 1YMUA 3HV2A 1DJMA 2IPAB 3MIZA 3RVNA 1ZGZA 3H5TA 3JPWA 1F4VA 3IP5A 1XHEA 1D5WA 1MAVA 2PL1A 4XFKA 1AB5A 4WWHA 2N9UA 1CYEA 1ABEA 2IPMA 5IULC 5DTEA 4ETMA 3Q15C 2WRZA 3CTPA 2FTKE 3O75A 5DLEA 2IDMA 2MYUA 2R25B 3KYIB 4MS3B 4YRZA 2FN8A 3F6PA 3LFTA 2RJNA 1APBA 1HEYA 4RK1A 1JLKA 2E4ZA 2HPHA 4TMYA 3ILYA 4RK6A 4D6XA 3LUKA 4OBBA 4MR9A 3CG4A 4YS6A 2QV0A 5BRJA 3MF4A 3H5OA 5KQLA 1QQAA 3HK2A 2MYNA 2IOYA 3RVMA 4P98A 2QR3A 1NY5A 4RWEA 1M2EA 2FN9A 2QSJA 1F51E 2PL9A 3OQMA 3VNAA 1A0OA 1DCFA 4Y9TA 2GBPA 2NT4A 4JASB 5IX8A 1NATA 3KTOA 3GWGA 3HJFA 3TB6A 1IIBA 4MRMB 1GCGA 3L49A 2MSWA 1ZGGA 3MA0A 1TM2A 5GOTA 4Z4GA 4G0OA 4OG2A 3M9XA 4ZMRA 2RGYA 3EULA 2WJWA 4EYKA 2NZUG 1TJYA 1BA2A 3LUAA 5TQ2B 4RKRA 3P9YA 1YIOA 4QYWA 3QLUC 2V0NA 1QP0A 1DCKA 3MMNA 2F8SA 5JS1A 1FSPA 1Z13A 5TPWA 1E6LA 2QVCA 3MYYA 4KRFA 2FEKA 3KLNA 4MQEA 1P2FA 3KYJB 3EQ2A 4EVSA 4MLCA 3IP7A 3OMWA 3EAFA 1CHNA 1QPZA 4UHJA 2E4WA 3TO5A 2JVKA 1RZRD 4W5NA 1P6UA 3LOPA 1MVOA 3H6GA 3O21A 3QEMA 3RVPA 4Z4CA 2E4UA 3CLKA 3EGCA 4HNRA 2AYZA 1ZHHA 5B3JC 4LDAA 1QQBA 1DG9A 2WB4A 1L5YA 3RVLA 3Q7RA 5HQJA 1RNLA 2TMYA 3RVJA 3KS9A 4OATA 2MSKA 4XAQA 5DCLA 1YK1A 4QPJC 2R47A 2IPNA 3CHYA 4FE4A 6ABPA 4OLAA 3C97A 2JK1A 4PICA 4MR7A 5GQSA 4Q6BA 5KQGA 3HUTA 2GX6A 4KV7A 4N41A 1DRJA 3DLBA 1BDJA 1P8AA 1XWWA 3OM0A 3KCNA 3CZCA 3QELB 4NV3A 4MAAA 5EWJA 1JDNA 1C4WA 2OENG 3IP6A 4B09A 5KQPA 3CNBA 1D4ZA 4QICA 4XLTA 2IPLA 2VUHB 3EQZA 3E3MA 3URMA 4W5QA 4XASA 5BQ3A 4MQFA 1T34A 2GWRA 4IF4A 3IDOA 2JVIA 3LUCA 3HZHA 1MB0A 3QX8A 3LUDA 1KGSA 4MS1A 5JNVA 1JYEA 5FWXB 4G0PA 4KZKA 3HS3A 3IPCA 4MGEA 5DGCA 5JNUA 2NT3A 2OQRA 5CNJA 5DKFA 1NXXA 4RU1A 2E4YA 1Z2DA 1EWVA 3O74A 4XARA 4F06A 3I42A 5IUKC 3SY8A 5KC8A 1J56A 3B2NA 3LKVA 5T3YA 1K68A 4NCAA 4Z4FA 1YTUA 1Z26A 1VLZA 1YVUA 1TVMA 3GA5A 1XHFA 1VPWA 2JBAA 3LTEA 2A9RA 2LBPA 3G1WA 3KSMA 4KPYA 1Z12A 2F8TA 1QNLA 2MYTA 3N0WA 5HSGA 5JNSA 4KK4A 3HM9A 4EVQA 5KC9A 4NCBA 2Q5CA 2PUEA 1USGA 3O1IC 5EWMB 2H3HA 2LIVA 1ZH4A 2FQYA 4YWHA 1DRKA 3CKMA 1GUBA 3RVOA 2PAFA 3FDFA 3QLVC 1CEYA 3LUGA 1DBQA 1M5UA 3K9CA 2FVYA 3HO1A 2M1ZA 3N53A 4YO7A 4S05A 1TMYA 1JYFA 2CD7A 4MS4A 1QKKA 2HSGA 5F64A 5EWLB 2BGGA 4H60A 2JB9A 5TE9A 1RPJA 3QX9A 1TLFA 5FBHA 1PEYA 1LK0A 1Z2EA 1W9HA 3N0RA 2ID9A 3A0UA 1S8NA 3CRNA 4WUTA 4NICA 4O5AA 3T8YA 1GLGA 3H75A 5TPZD 4RXMA 1RXIA 1QO0D 3DZDA 1U2QA 7ABPA 1PUXA 4MYRA 5KQMA 4RXTA 1ZESA 3BRQA 4IMIB 4PEVA 5BRAA 3C3MA 2CHFA 1DC7A 3H5WA 3LUHA 2KYRA 3OO1A 4N0QA 5IEJA 4YLEA 1NXWA 3FFWA 3GBPA 4G0YA 4KVFA 3BRSA 3NNSA 4W5TA 2H0AA 5FWYA 4MR8A 2HQOA 4MR9B 4FE7A 9ABPA 2PUFA 1FFSA 3W9SA 3GV0A 4YR7A 1I3CA 1NXSA 5BR1A 4S04A 2IYNA 3EJWA 4L4UA 1OXBB 3OLYA 2I6FA 2A9PA 4JA2A 3KLOA 2MYPA 3NHZA 4G0MA 4JAVC 4RY8A 5ABPA 1BDIA 4YGXB 3EODA 1EWTA 1OXKB 1ZAYA 3L6UA 4IRXA 3TD9A 4KK3A 3N6VA 2WY2D 5C5EA 1EWKA 1Z16A 4KFCA 3TX6A 2FLWA 3F7NA 3H5VA 4QYMA 4F11A 3EDCA 3JTEA 2A9QA 3JVDA
chains in the Genus database with same CATH superfamily
4WE3A 5B53A 1MCZA 1I7SB 2NU6A 1QR2A 1KYWA 3B9RA 2XCRB 3DTVA 3HYNA 2J4FA 1Z5OA 4EOGA 4FYYA 3LVQE 4GM4A 2G82A 3I2FA 3BMQB 3IKLA 2O19A 2IYYA 3KJGA 3RB8A 1YUMA 1HE5A 1KHTA 1NW4A 3HNRA 4F60A 4OKNA 2GAJA 4MKZA 3TTXA 5FBKA 4BO9A 4R1QA 4KXYA 2FJPA 4KL8S 3QU4A 4IJ6A 4Z4HA 2P78A 2I4RA 2ZPAA 1UXOA 3NHJA 3HUDA 3GI1A 2IVFA 2AI2A 1M8JA 3O7MA 1M2NA 3K0AA 2YHAA 2FQ1A 3O38A 2PQ0A 2G04A 1U28C 4ZO4A 1RQNA 2CV0A 1HE3A 2K5UA 3I0NA 1R18A 2MJLA 1I6MA 4D6YA 4KFSA 3TSZA 4FYVA 1QANA 4RGYA 4TWAA 1R4AA 3ZVKA 4AZSA 3CZMA 4M1KA 4D0GA 4AY2A 4MTCA 1DAHA 1N7JA 5CX1B 3UHOA 4CLEA 2DHCA 3HHPA 2A5LA 2X0IA 1SU8A 4NJMA 4DLPA 4EL5A 4OMDA 4IGKA 2VRCA 4LMAA 2NP6A 3KKOA 3A37A 1EQUA 4Z4EA 1NL3A 3F9CA 1D4AA 3ZXYA 4MWBA 5BVGA 2OE2A 5C37A 4W9NA 3F7TA 1YRBA 3DFMA 3GDGA 4UFOA 3UPTA 4QODA 4GP6A 4KO8A 5JJBA 4AJ4A 2R7KA 4TYMA 1YQ9A 4NU6A 3VSDA 1U9IA 4F1KA 1IC6A 3C15C 2IC5A 3PXCX 2VHVA 2V6IA 4HEQA 4UQPA 4H4EA 3PLRA 1K6EA 3I76A 3NB0A 2B69A 2CXUA 2Q8QA 2ATIA 2R1TA 3CTMA 3B2QA 1OI7A 2C8VA 1R64A 3T61A 1YZ3A 3N59A 2WZBA 5LXTB 2HDOA 5JDIC 2A1TS 2QXYA 4ZREA 3PGJA 4D41A 2OHIA 1J2RA 3D8BA 4J49A 2BFEA 3DV0A 3IVCA 4WNCA 5TGZA 4HB2A 3E61A 4B43A 5KTSA 1T9GR 4AUMA 3KPWA 5JUWA 1GL9B 2DWQA 1YI8A 1KSFX 3UM9A 4JYZA 3P5SA 2Y71A 5CEEA 4NEGA 2NAFA 2P3SA 3AV0B 5EIAA 4GMGA 2G5GX 2NVBA 3ZU4A 1Q0SA 1A50B 4F3NA 3WGVA 5HG0A 5IVHA 1UKAA 2ZFUA 1OT3A 2C04A 4J8PA 1D4FA 3QEAZ 4ZCQA 1ZZEA 3KM0A 2FWJA 4BN5A 4Y6SA 4A91A 5BSVA 3GP8A 2CNWA 4EA8A 4GHWA 4TRJA 1UR5A 4K6HA 1B3BA 4L2IA 4P31A 5MN6A 4ITRC 1G8MA 3OU2A 3AHJA 3QHPA 4BX0A 5LUAA 5IRCD 3K70B 5J4KA 3W7AA 3DDZX 3ZWVA 4MRMA 2OBNA 4ZGBA 1JG2A 3DC7A 4KAJA 2HBRA 3DT8A 5BMVF 4TTAA 5EN4A 4IZ6A 3KQQA 4F1WA 3FNEA 2B94A 3ZIAA 1WB6A 4BGVA 3G5LA 1QH1B 1R9NA 1EWYA 1BEUB 1FUIA 4PYIA 2JFGA 4UARA 2ZUTA 1ZSNA 4DV6B 4GMHA 4MMXB 1PK8A 4FGLA 1C8BA 4CQLA 1TM7E 1CUWA 2JGIA 5CX4A 3LDAA 1BDHA 1V3TA 4KNYA 2UUPA 3AXSA 3DZBA 1U0RA 5AYVA 2FFAA 2OGUA 3RVBA 3UGQA 2ZSKA 1Q7CA 5BMVA 5IJ0B 2Y27A 4OO3A 4R2HA 4C87A 1YXMA 2J31A 1OYYA 4AYTA 5DSXA 1LSUA 4NG4A 4ZEWA 4YNBA 2J6CA 1TZ2A 1MH9A 1U2DA 5LOVF 4AJOA 3UWDA 2VJLA 5G0SA 3LD9A 2C4HA 3JV7A 2XGMA 2ALJA 4DV4B 2HK7A 4IVRA 4HNQA 4BWVA 4MVJF 1DIHA 2PUDA 2OWEA 4YRNA 3K70C 4L72A 1OU0A 1BWQA 4KWHA 1MORA 1VL1A 2EAUA 1YS7A 2IGBA 4GAEA 2ACEA 1PHRA 1RWBA 1HO3A 1XRRA 2G63A 3I2YX 1PTKA 4IHQA 4XX1A 4Y2JA 5LOVA 2O3UA 5AKJA 1Z68A 4UNPA 3QMMA 2VJMB 4QYIB 1PD0A 1OGYA 3O73A 1GWNA 1QYRA 2JL1A 5KOYA 3KQTA 1OZHA 4MVJA 1JA1A 5ECWA 1I2CA 1KJ9A 2ILTA 2VK4A 4L8YA 3AHDA 3T5MA 3AHGA 1US8B 1KZ7B 4XWTA 1E2BA 5ES4B 3N86A 2O8CB 1EK2A 2O2DA 4UU0A 3VNBA 4ER0A 1QP4A 1GU7A 2JVJA 4PZYA 2OFOA 4REQA 5B3AA 2IH5A 4BFYA 4LWQA 1E8NA 1RPAA 2ZXUA 4F5EA 4GOOD 4EHLA 1HMPA 2DBQA 1NVVQ 1E6KA 3N2GB 1XPOA 4JV5B 1NBWB 1ZD9A 3HJTA 3HKBA 4JB3A 4K3UA 4I4TB 3B1FA 1T1RA 4CPDA 1ZIXA 1GNLA 1PFVA 1E1QA 3VKUA 3Q11A 4LXUA 1ODLA 2J3LA 2Y1LA 4CM6A 1OHHA 5K01A 2ZYUX 4HH0A 4ZVLA 1XELA 3P27A 5IEBA 1DAKA 2HWXA 3EZ7A 1UKCA 3WIUA 1YUNA 3SHTA 2GLXA 2QQ5A 3BXXA 3OPVA 4OK3A 2DBYA 1NRJB 1XA0A 1P33A 1Y3IA 1GD1O 3SPXA 3THOA 5FHRA 4QATA 1Q0UA 4TZTA 4MZXA 3VM6A 3ZWYA 8AT1A 1ZUNB 3RO7A 5E0KB 1YR6A 3RADC 1IZ8A 3GRAA 4NFSA 4NU5A 4OSEA 1KBQA 1VKRA 3SI7A 4BLPA 1JVBA 2C1EA 5HMMA 3FZNA 1PDOA 3CLTC 1U0NA 3FFXA 1OVMA 4Q9KA 1VJ5A 5C8ZA 2VPIA 5CXQA 4BBPA 3DGFC 3O26A 1G21A 1UEIA 4IXDA 2G5TA 4MKRA 1OXUA 1N25A 1U0JA 2NWQA 1IBMB 1LNZA 2Q3LA 1KKLA 3R6TA 3GGPA 2GH1A 3TLXA 4EH1A 4RXUA 3ZS9A 5ICEA 2Q2NA 4O8ZA 2IUSA 4HK4A 1T9BA 2HJSA 2JRCA 4PLZA 4UTPA 2UYOA 4CFYA 2HYDA 1B6TA 1HYGA 1Q83A 1T5OA 3KSRA 1L4NA 1M6VB 1L2TA 1XVUA 2AI3A 5HXAA 1TUGA 3AR9A 4WFKA 4F11A 3ZLTA 1L4FA 1ZOIA 1ZUHA 3FNFA 3GNLA 4NR0A 4EKNB 2PO7A 2IHVA 1SKQA 2CYCA 2OVBA 4D9GA 1CU1A 2JLQA 3ENWA 4R8MA 4E3ZA 3D6UA 1R8XA 4AKEA 4PXAA 1L5FA 1T9CA 1Z33A 2X6RA 4JJZA 2D74A 1ISFA 1SU4A 2AMLA 2P9GA 2OSVA 3A0RB 2JLZA 3BFJA 1XMPA 1E7WA 4MGIR 1JIJA 1E59A 2E5LB 1ZGZA 1E98A 1Z7YA 1I6KA 2C2XA 2QUJA 3N8HA 3PF8A 4ERNA 2R8PA 1XHEA 2YHUA 5EPEA 2MHCA 4LYHA 4DCPA 3ETEA 2OCDA 1W6UA 3HFSA 1MLDA 3BHMA 3FOBA 4TXNA 1E0SA 2W48A 1S3IA 1XROA 5DJ5A 3RS5A 3VH4A 4DKXA 2W2XA 4F9EA 4ENWA 3ADBA 2QVLA 1DXQA 1QCYA 2HEIA 3BF7A 2DLCX 3OQJA 3P52A 3W2HA 1E3JA 1PT6A 3IB6A 2WRZA 1WIWA 2WP8J 4JGBA 4ZT2A 1JE0A 3J80A 4O0LA 1RPZA 5DBFA 4GXNA 3R3HA 2QROA 3HUFA 2FG7C 2RSLA 5I4BA 1CNEA 1F7UA 1G5RA 1P4GA 1RKVA 4WOKA 1ACMA 4DV1B 4YS6A 3CUUA 4MR9A 3EPHA 4YCBA 3MRSA 5KQLA 4Z8YA 1QQAA 1BRTA 5FBLB 2X40A 3HK2A 1L4KA 2V7BA 1KAEA 2QZZA 1YKFA 3P9ZA 2HT1A 4R2KA 5FOSA 3HABA 3IV9A 2QSJA 4AN4A 4BVFA 2ZVPX 3I01M 1JQLB 3JQPA 1MTOA 3QJ5A 3EIOA 1GO2A 2OAP1 2BKXA 3T5DA 4A92A 2OFPA 2V96A 3A27A 3ZV4A 2ACVA 3KHSA 4R31A 1YASA 4RQTA 1PQ4A 1PR6A 2ZRNA 3BBPA 4YAJA 3C41J 2NO5A 5EP3A 3HV0A 1GEGA 2EL7A 3AFMA 4OM8A 1GRVA 2Y1GA 3NT2A 4K9QA 4BZPA 2XMPA 5I7RA 4IJVA 1UXHA 5B6PA 4LVUA 3DEFA 3OKAA 4KN9S 3DQQA 1JILA 1KJYA 4WFIA 3OJ0A 3BXOA 3E23A 4BNTA 2E0IA 4PZLA 1A9ZA 1GG5A 1OHHD 4CHTA 5TPWA 3VDMA 3QUCA 5LLDA 1CDEA 2XTNA 1U63A 3GQBA 1XKTA 4BJ5A 1Z0UA 4NSNA 4M22A 1NY6A 4NMXB 2VJBA 3L0DA 5A2QA 2E4UA 3AHHA 3LQQA 1S5PA 3FLBA 1CUCA 4COOA 3K0SA 3ZWPA 2E48A 3S2UA 2I9KA 1E3SA 1W5FA 1ZHHA 1IN4A 3ILVA 2I66A 5AMXA 4QUAA 2R7MA 5ULLA 1AHHA 4YALA 1E0JA 1RNLA 3C7DB 3P1JA 1XZEA 3KSBC 2I03A 1ZSYA 3IEIA 2Q6KA 1VRCA 3GHHA 4GF5A 2R47A 2YWEA 4KKVA 4HNTA 1P7ZA 3C97A 4IKOA 4PICA 1AU9A 4MDEA 1Z8DA 5HOEA 3M5CA 5EE1A 4TMFA 3AJ8A 4DA4A 3M8KA 3TSOA 1JMYA 1GDHA 2EX1A 4LRTB 1RPNA 4Q15A 1CUVA 4TKUA 2XYPA 1H94A 2HU7A 3UT5A 3FHOA 4JKYA 4YRAA 1QVZA 2GTPA 2WIAA 3QELB 5EFZA 1KI9A 3R0QA 5JSHA 1LTQA 1XTVA 1TEZA 2Y4OA 3PQ3A 3PQ8A 3WK6A 5H9WA 4G8CA 5K5EA 3E9DA 3QJGA 1GFSA 2Q28A 2Q2QA 4DSNA 1NYQA 1Z08A 4GXQA 4BV2A 2ZUFA 2QYOA 4FN4A 1T34A 1DQYA 4AZ0B 2CWWA 3G8CA 3TEMA 1ECFA 4K9LA 1RLMA 3H9GA 2ISCA 2IV2X 3ZCRA 1WO8A 4OL0A 2ZCUA 1JEOA 1VG8A 2P3LA 2WAOA 2WIJA 3RK4A 5GMOA 4HQOA 3PJFA 4QFBA 2FZGA 2FF5A 2V58A 1CV2A 2FOXA 1YWGO 3CNNA 1JA0A 2B7BA 3T1NA 1K5GA 1MPTA 2OBXA 2WFAA 1QP8A 2XUIA 2UZAA 3DPIA 3E9YA 5HE9A 2H1CA 1KZ9A 3FVQA 3EGDB 3I32A 4HJXA 5KKAA 1Z5NA 3OZEA 4WBSA 3K20A 3HCDA 1CR6A 5JMWA 1Z63A 2WF9A 3O2NA 3GFQA 1S2DA 3SICE 2VJAA 2FRDC 3GFVA 2GZDA 5LZ2A 1RI1A 1WZIA 1XN1A 5B6IA 3WAKA 4R1LA 2IBTA 4H0NA 1BW9B 2MYTA 5K8UA 4TVSA 1UAYA 4HMQA 1MAWA 2IT1A 4IXNA 1WMEA 2BP7A 3BTVA 4FWIB 4G84A 3V3TA 5A5EA 1FTNA 4YMWA 2A9JA 4U63A 1QK5A 1VA5A 4X20A 1VCOA 1Y9EA 2BKAA 2BSAA 1ADCA 3K96A 4ZWNA 5T8KC 4B6FA 1A9QA 5DHFA 5FO1A 3BD7A 4PX2A 5DGHA 3WRVA 2BMFA 3WWOA 4AQYB 4GPBA 2I6GA 2BJWA 4S05A 2E4AA 3DL2A 4Y6LA 4N5NA 1Y6GA 3KQHA 2CD7A 4AWBA 4ZJYA 2ZUUA 3SWWA 3QFRA 4MYCA 4K8RB 1ESCA 4RPGA 1K98A 3L02A 4ZEVA 1N2CB 2YW9A 1ODFA 4PPGA 5LDGA 1JJVA 1QYVA 4LYAA 4O59O 2CZGA 5FBHA 4QUGA 2PX3A 3ADOA 2JGNA 1XMIA 4AWXA 3OIGA 5A6SB 4O5AA 3A3OA 2PZFA 5TPZD 2A8YA 3ESRA 4RXMA 4H4CA 2FPOA 4X1YB 3VZSA 2LZ0A 1OAOA 3FM9A 1YR8A 4IEEA 2IZ0A 3K6SB 1NP6A 3C14C 4A8TA 4DYVA 1XZLA 1XLTC 2YR0A 1QO9A 4MVXA 1KWGA 4DLTA 1NR1A 3C7TA 2IF2A 2JLCA 2VHZA 3OURA 1XVLA 3C6KA 4FNMA 4JLBA 2PSDA 3T4EA 2JLVA 1DXHA 2NZXA 3B78A 3EXHA 3FCCA 3T54A 2ZJYA 5KOHA 3VZCA 1U5AA 1YIAA 1VM6A 3U48A 3RU2A 3AKDA 2PDAA 4XJTA 1P1JA 2CLEB 3ENKA 1N2GA 4ZHQB 4U2BA 2B5OA 3KO8A 3MQ2A 2JAPA 3ROKA 5G0TA 4MR8A 3A1UA 1V39A 2PKRA 5HUQA 4QVIA 3DEIA 1RKXA 3GN1A 2V5VA 4EW3A 4GXTA 3UH1A 3ORYA 4LCEA 1S01A 4FYMA 2B5VA 3KQKA 4CG3A 1PVOA 2V8OA 1QMGA 2G76A 1GTVA 1IHDA 1XZBA 2MSDB 2VLIA 4TGLA 3OZSA 1SZDA 5ALVA 1WMBA 3PXBA 2J9RA 3H0KA 2E82A 2G4LA 1OOEA 4WNAA 4ZP1A 3KR1A 4IRXA 4BFXA 4XGRA 3N6VA 2HHAA 5JH7B 5KTMA 4K1LA 3DW1X 3LQ2A 3WFIA 1OFVA 1RJEA 2VBIA 3S8EA 5ECGC 3IAM6 5T5QA 3AF0A 4RJLA 3RFCA 2BE7A 4KSYA 4B31A 1WF6A 3RNLA 4R84A 2F1OA 1ZSVA 2QM7A 3HVIA 1O97D 4ZXPA 4YRIA 1AX9A 2Z1MA 1TI7A 4N03A 4E6PA 2Q4TA 3KFVA 1XTQA 3IT1A 3O3NB 4HQRA 5EIWA 4XM2A 2XMRA 3OTHA 4GYJA 3RFXA 2GF9A 1Z5GA 4IQGA 2C98A 3AR3A 2FCRA 3FIJA 1T25A 4RIFA 3GLFE 4MQEB 5H82A 3W8DA 1N9KA 1PV4A 1INLA 4BUZA 4BX3A 3QVSA 5E1OA 3ZH9B 3UMJA 4A0RA 3DZJA 2UYQA 4JIGA 1LV8A 3WLHA 5F76A 1D6SA 1GZ7A 3V55A 4EUEA 3RYCA 3R5JA 2HF2A 5EYPA 4UMEA 2HGZA 1UBTS 5LYJF 5J1SB 2I71A 4YBRA 2MSLA 3OE1A 1XAGA 2COKA 4HO1X 5DMHA 1RI2A 1I6LA 4C4TA 2JI8A 1A2OA 1I10A 2QUIA 3Q4GA 5CMLA 5C3UA 3WL6A 1ESMA 2VF2A 1J0XO 2A92A 3WMFA 4P3OA 1T6BY 1RQXA 3PNLA 2XGJA 3CF4A 2YNMC 3OFJA 3QLTA 2RHOA 4CKWA 5H8WA 1RZRA 5DHPA 4EFMA 1KJJA 4UVDA 4HJRA 1KRWA 3I2HA 3RVSA 2W6OA 5LYJA 3MJEA 3EFEA 1FQOA 4LOJA 4C0JA 2JFHA 3CW9A 3F6SA 3PPIA 3LVBA 4TL6A 1XXHB 2FXIA 2ONZA 4KWCA 4M9CA 5FHQA 3JQ7B 4FT2A 4UBNA 1WQ1R 4EUKA 4NPHA 1NW7A 3DBRB 3VSAA 2FFJA 2X4DA 2FPWA 3K72B 4IVNA 5EIHA 3AG6A 2XT6A 1BVHA 4C89A 1G8GA 1ADBA 3ZIDA 3U44A 4F6LA 2VUIB 1EFCA 1P62B 1XB2A 1PL8A 1P72A 3K05A 4KBYA 4NS4A 1IYZA 4EJMA 3PKIA 1GUFA 4BAUA 2IYFA 4LJKA 3BICA 3LPCA 4A7PA 4B81A 4BRSA 1Y81A 3ZDYB 3EUWA 1M2WA 2LD4A 5ED4A 1TVCA 2DHDA 2J30A 3GGOA 2WJVA 3I45A 2NXJA 1MX1A 4NQRA 2AVNA 2VATA 2LUOA 2KWIA 1F2DA 5C4GB 3NWPA 3JASA 3DYBA 1U5BB 4OQQA 3U39A 1PGNA 2CLHB 3D6VA 5ARBA 1X7WB 2HK8A 1Q0PA 1WU7A 3GD7A 1CS0A 1PW7A 5E1DA 4DSUA 4ER3A 1JWLA 2W11A 3A7EA 4N8EA 3WYGA 1SBHA 1ZL2A 2NTNA 4AZWA 4B74A 4H6XA 4KUHA 5EKTA 1QGAA 2YIVX 4J1QA 2EBWA 5BYKA 3SJZA 1I4EB 4TMKA 4C0XA 3HDYA 3UC9A 1S3SA 3DAGA 3AWIA 4NYMQ 3EGXA 4QO8A 3RUDA 3ZWOA 3HJNA 3TBKA 1CULC 1NQOA 2YJ3A 5BRNA 1YS4A 3OLWA 4TWBA 3TXAA 4CCWA 2IYSA 4RQUA 1JMKC 1THZA 3N07A 3R5XA 4HEHA 4F5DA 5CEJA 5MFZA 4ZI7B 3QUSA 1K7FB 2DFTA 1XLVA 3NHKA 3ADDA 1ENOA 2B8WA 5I8ZA 4DNOA 1A72A 1GPDG 3EIUA 5ALGA 5EZ6B 5JSYA 1V35A 1RCUA 2R62A 5C8VA 1QRRA 1CEEA 1UQTA 2O0LA 1V8BA 3MUNA 3L93A 4BMPB 2F3QA 1TF2A 3KFXA 3NBXX 4OJTA 4W8GA 4JA0A 5IJAA 3U09A 5IWAB 2VQDA 5ERXA 3MJHA 3TLJA 2GD1O 2PZJA 1SRRA 1BFDA 1X7XB 2ZAOA 1AK2A 4G8JA 4WZZA 4XXHA 5FR2A 5I5GA 4NV1A 5CCDA 2R4QA 3JSXA 4O4IF 1IFXA 1FMFA 4ZYLA 2VDJA 1SVLA 3OQOA 3W5DA 1G21E 2HQ1A 4Z49A 5KWEA 3VR6A 1JXMA 2DEUA 3OZVA 3DNMA 2W2KB 3RR2A 2C1ZA 4Z4QA 1D2RA 5JMPA 1RWPA 2AC4A 4TTQA 3D8SA 2RHJA 4RK7A 3NCTA 4B2LA 3F8SA 4PSCA 1LNSA 5M3BA 1MB4A 3H9JA 3LWBA 2OO3A 4DA7A 3ER9A 4CEIA 1HFWA 4O4IA 3E70C 3SZMA 4GKBA 4LSMA 3L7IA 4QVKA 2CMHA 2VSNA 4CU5A 3AB8A 3P9NA 4BO0A 1S6YA 1JNXX 3Q7SA 4JQCA 5GJCA 3VDQA 1TYEB 3ZHTA 3HFJA 5FWYB 1X14A 1JLLA 1VPEA 4CG1A 5JC8A 3JZFA 4YCLA 3KXKA 3K0FB 2D0OB 3HU2A 2GYWA 2EHJA 2VK2A 1JF8A 3BTOA 3JY6A 1R6AA 1RYYA 4FKMA 2FHSA 4ZALA 5A1JA 2V54A 3DKKA 3BRWA 3MQ4A 3BXFA 3R3WA 4RJ2A 4UDOA 2PTGA 4L6AA 4CKYA 2XHEA 4OLFA 2GJ4A 3IURA 2K2QB 2R65A 4F46A 2Q3DA 1T2AA 1DQPA 3CH6A 1J2JA 1HV8A 3GCWA 1RM5A 3PDIA 4JP1A 5AW8A 3O8RA 3S27A 2PJZA 1TA9A 5FNVF 4R8SA 1IQUA 3LCMA 5IZ4A 1CF9A 5FWXA 4PIPA 5B7PA 3TIXB 4J2TA 2BMWA 1UADA 2H4HA 2I5PO 2ZB7A 3IPLA 3RVRA 2VWQA 4EKEA 4Q18A 1V6CA 1CQZA 3A3NA 5CTJA 1FNSA 4PHTA 2QTTA 3QKIA 3C1TA 3WRYA 1HNNA 5J4LA 2PUCA 2J45A 2C2BA 4TZ0A 5KIAA 3PDWA 3B8HA 3BJIC 2B4AA 4QGFA 1F0YA 3IAS6 2M6KA 3SNHA 3RS7A 3NTXA 4NONA 3UAWA 5FNVA 3ONDA 3RVQA 3G49A 9GPBA 1DMRA 4C6RA 5C2JB 2ZI5A 3WRXA 4CV0A 3V97A 1GILA 4DNXA 3HKDA 2WLTA 4JJKA 1U7ZA 2JIQA 3SX2A 4YC7A 1GGHA 3PNKA 5BQPA 1K7SN 2I76A 1GCOA 4X1KB 4FWBA 4OFZA 5DM1A 4J9VA 3QXXA 4JI8B 3FFTA 5FI3A 1ORVA 5CITA 3BGSA 3RS8A 5EJ8A 1AKNA 3HJCA 5KYKA 1QGUB 4G5SA 2NTYC 2NSJA 3IH5A 2AXPA 3JQCA 2OCKA 4J1NA 4KC0A 1NW8A 1RQ2A 2BEUB 3OIFA 2NV2B 4OI2A 1N1DA 2YOGA 3GEGA 4L76A 4NS1A 3C6MA 5EP1A 3VSBA 1I5OA 1QX4A 4HH1A 3WGIA 1YJQA 4L4RA 4MVCA 1N6IA 2IPOA 4X84A 4A0FA 2AMJA 4TWZA 4YAGA 3K0CC 1KVTA 2E1PA 1IOZA 1UJCA 2Q3CA 3LZ6A 4LZOA 1Z2OX 1JDJA 2Q99A 2EVWX 2Q2WA 3IP3A 3HCFA 2BGUA 1UQRA 2QN3A 3JD4A 3LUBA 4FGKA 1J2TA 1XZ8A 5EOVA 3WGOA 4EY5A 2PR7A 1JDUA 5I6DA 1XZAA 2X8AA 2NSLA 2RARA 3ROGA 4KFRA 4GL2A 4UBOA 2NM0A 1R5BA 4FCCA 1UDBA 2WWIA 2D4AA 3N0VA 3PGMA 1T9GS 2PUJA 2QU8A 4FVTA 4L3WA 1NDUA 2JGAA 2LKDA 3IP5A 4TQAA 3W0LB 5HJ7A 2BMJA 3GJ0A 5K3CA 1M8FA 1V7CA 3LUPA 3PJDA 4H18A 3CT6A 3A4LA 4WPGA 5T4BA 2AFIB 1GFIA 3COJA 3IVXA 3F7OA 5L4NA 3UKOA 1M34E 1JJFA 1V37A 3LY7A 4LBWA 1F38A 1BU5A 3AI3A 4NIMA 4DFDA 3LY5A 1X1TA 4NK4A 4UFPA 2EJUA 4MUKA 2JFUA 5E3HA 3O8QA 4TS9A 1YDMA 4IV5A 2DJIA 2O2EA 3UC5A 3I62A 1ZZGA 4QPPA 2OORA 1PF7E 2VSQA 3GLGA 1J49A 1GUZA 1K4YA 2XTJA 2JIZD 4ALKA 1T6YA 4LJSA 4PGGA 3QU5A 3CG4A 4QD3A 3MFQA 2NO0A 2ONJA 4AXXA 3MF4A 1TECE 4RNCA 1PFYA 1NBEA 1JFRA 4XR9A 1SUIA 3KE8A 2WKQA 2WWXA 4MIOA 3RVMA 1ESZA 3K9WA 1ZK1A 1NJ2A 1J8VA 2AQIA 4CQMA 4US2R 1NN0A 1M2EA 3KNZA 5B1DA 3I9OA 3PFBA 4O2LA 4EB8A 1G38A 4JDPA 2PL9A 4YMHA 4XFDA 3QWFA 2DPMA 2GDJA 4M55A 1U1GA 1U1CA 4QT0A 5KX5A 4L0DA 4PYNA 1SCKA 4V0OA 1Z5ZA 1C9KA 2A1UA 2FWAA 2PUVA 1UOOA 1XBTA 1G60A 2OZLB 3ONVA 1PNQA 2PWAA 1ULBA 4HQFA 4L8VA 3KKKA 3T94A 4YDQA 1EWQA 4P4TA 2QE6A 1O95D 1E1RD 1EFRA 1FP4B 1T43A 4IOMA 3R8XA 4MO9A 1NBMD 4OK6A 4RKRA 1S2IA 4IOJA 1HXHA 2FSUA 1XTIA 3U2QA 3FUTA 4K87A 4KX3A 3ZDXB 1EE1A 1OREA 1PZXA 2ZYSA 4X85A 2YOHA 5HQTA 5E8RA 1WSAA 2FNAA 1PIWA 3M0EA 4JJ6A 1U3DA 1FMCA 2QT9A 1PQYA 3WQRA 3ROZA 1KI3A 2V6GA 3DO5A 4F4JA 1YOBA 3BEDA 5KHOC 3EAFA 2DB3A 1OASA 3P2MA 3KJZA 3A9RA 3WZ2A 2EP8A 1KO1A 2HPZA 2PZLA 2XNDD 3NTVA 3OPNA 3S1LA 3WYCA 4DSOA 1JTEA 1QYDA 3QEMA 4YGYA 3G8DA 5K9ZA 2XQVA 3ODGA 1K27A 1AUOA 5D01A 5KNBD 5EXDA 2VNKA 1EBFA 1Z2NX 1OV4A 1UXJA 2DWPA 2WM8A 3RVLA 5A2GA 2H3EA 3RVJA 4J1TA 3CO5A 1YS1X 3UF0A 2PSEA 3PE6A 4V1CI 1Y6RA 1DX9A 2XOEA 4K86A 5JG7A 1II8A 1KS9A 1FFXA 2AE1A 4Q1VA 2I80A 4DMFA 3D3WB 3CX4A 3RFTA 3QZUA 2HNAA 4N41A 2CVQA 1IBKB 1PQWA 1JRLA 1W4LA 2BFOA 2FOLA 4C4YA 2XXAA 4C08A 3QNWA 4YPFA 1Y3BE 1QOPB 2YIJA 2EQBA 3G13A 1XSEA 5A9TA 3IP6A 1UPUA 1C0LA 1LZLA 4RF2A 3URMA 5KNDD 3D81A 3TOCA 3WKDA 4BFVA 4BFZA 1QVRA 2ZSIA 3HB0A 3IDOA 4IIDA 1HR0B 2ZBUA 1F48A 2CZCA 4DHEA 4BRZA 2D7DA 1GSHA 4FMCB 1O8CA 1JIKA 1WV0A 4OHKA 1Y1KE 2C42A 4BBAA 4R5MA 2Z83A 1T6ZA 3OPYI 4BIMA 5AKHA 5I9LA 1ZW6A 3D4BA 3URKA 2YXBA 4C7MA 3B70A 1EFPA 2YTZA 2VDQB 1H1DA 1N5RA 5CJPA 3ZQ4A 2CSXA 1Q1EA 4UZEA 1EHYA 1B6GA 2AG5A 5DN9A 3N7TA 2X4LA 5GVSA 2IQ5A 4XQEA 2I3ZA 3NVMB 1IUKA 3BE8A 3DMTA 1MJHA 2SKCA 1AQUA 2QLMA 3KQVA 5FWDA 3ZWQA 3CRQA 5MGBA 5G40A 3BM5A 3LHIA 4RF5A 5TY0A 1YVUA 3UH0A 3LTNC 4IDCA 1A7KA 5JAUA 1JQEA 2SKDA 2P8JA 3FCSB 3KSMA 3LIPA 5TB5A 3JQQA 4P81A 3KL4A 3W4JA 2BY4A 4KK4A 1VLMA 3HM9A 1AZSC 4GYYA 4JODA 2B0CA 1BD4A 2PYDA 3VJMA 1QU2A 1EZZA 1MP0A 4RH0A 4CE6A 2C5BA 2GRJA 1JW9B 1WDLA 2QSYA 4W5WA 4EZBA 3FPHA 4JC8A 4I1YA 3RHZA 5CGZA 5FOTA 3T7KA 2ZJ0A 2AJCA 5HS6A 1MEOA 4E2XA 3LUGA 4PG4A 3NEYA 4P5DA 2I99A 3W5HA 3B9QA 4PNPA 4C07A 4EB6A 1QRUA 4D1YA 4EELA 2Q9AA 1XD2B 2QTHA 3QHQA 1WZEA 2WJ3A 1T10A 4HPJB 3AESA 1KZYC 5FA6A 4EI9A 1N33B 4J0EA 4YXWD 2IXDA 4JMPA 3FIUA 3UBMA 4LTMA 1IHOA 1KQPA 2Q5LA 4LQ4A 3MTBA 1PO7A 2AN9A 4OY3A 1T3GA 4BN0A 1ISJA 1P7CA 1YBHA 1HQDA 1IEVA 2X8LA 1R8QA 3KV3O 3V1UA 3FGPA 5C34B 5K8TA 2AW5A 3TLAA 5LL6P 2AS0A 5EFOA 3WYAA 2GEKA 1MW9X 1Z6QA 4H2DA 1L4LA 1ST2A 1WSDA 2PRSA 2CEKA 2CLCX 2E6UX 2XLCA 2WHXA 2P9CA 3H4IA 4PN3A 3U3XA 3KKNA 2IS2A 1RMQA 2XMSA 5EG5A 4LOLA 1I13A 3DG9A 3L7MA 4OP2A 3GIDA 1G5PA 3EMDA 4RXTA 4RVGA 3UOGA 5KQMA 2Y0PA 2F64A 3BRQA 2NACA 4KXWA 3VR1A 2OXEA 2QQ0A 4Q5IA 4N9QA 3HWRA 1XJQA 1COWA 1XF1A 1ORDA 2CLSA 2C3YA 2VWPA 3OT1B 5K2MA 3RS4A 1SB8A 3JYNA 3PRKE 4HAYA 2PS3A 2Z8YA 2Z57A 1GLNA 4M46A 3VH1A 3T9DA 1E3DA 1K89A 2OXTA 2X3FA 1QIFA 4O25A 9ABPA 4CKBA 1YR3A 1NW3A 1GPH1 1SC6A 5IF9A 1XNQB 4HN4B 1BU8A 3KQOA 3NHUA 3IOBA 1LSOA 3AU9A 2O3JA 3L06A 4L4UA 4KQXA 4GLBA 5BN3B 4R2XA 3R5HA 4XWGA 3WIBA 4J03A 4PHFA 3H11A 3NHZA 1GDDA 3Q3JB 2FP4B 4ZVRA 1Q20A 3MC1A 4NJOA 5GJWC 2FPSA 4HUTA 4HGOA 4XVUA 3QXHA 2HJWA 3BSSA 4QPCA 1NKSA 2ZW9A 4R8VA 4K3VA 2HCTA 1LQUA 1XLWA 2ZJFA 1GCUA 1UBUS 4GRAA 2GEJA 4C43A 3JVDA 3UW3A 3DPUA 3LBHA 3L8GA 4Y0AA 3AHCA 3AVTA 5CB6A 3B6EA 1W46A 3KKEA 2G9QA 3C1OA 3IV7A 1MC8A 2HK9A 1G5FA 1EJ6A 1DWOA 1RBMA 4X93A 2OBMA 1ZDMA 3PS9A 5EY5B 1PDVA 3NDPA 1YQDA 1LK5A 2IXEA 3H8WA 4U1RA 1NC3A 3O7WA 4BJHB 1A9YA 4MUEA 5JCJD 4NENA 1MW8X 3PEVA 2ORYA 3IVAA 4I6GA 4Q3KA 2Z43A 4M49A 4MV5A 1AXEA 1GOTA 1UFRA 3OO0A 1JG7A 4PC1A 1Q0RA 3RVDA 1M72A 1O94A 3H0EA 2XQKA 3LK6A 5FI1B 3TZEA 5IAOA 4F6RB 1GPKA 1GAJA 1EP9A 1N9GB 2R48A 2NV6A 4XX0B 9ATCA 5JRDS 1RXUA 1GZDA 1G6KA 4GNRA 4JBIA 3SZUA 2ROQA 3A58B 3G1TA 2L19A 1TKCA 1P5RA 2OBYA 4HY3A 2JBHA 3UCFA 4PC2A 1K9SA 1FYWA 1V16A 3KZ1E 4D6PA 3O8BA 5TS3A 1KY4A 4F38A 1RBZA 5KWSA 1P2UA 3BSYA 3FRJA 1G5TA 3ETDA 3FF4A 3GBVA 4MR7B 3RROA 1E2JA 4OHPA 4G1MB 4UHDA 3ORSA 1DS6A 2GDZA 1NDQA 4PRKA 4PVDA 4W8OA 4DPKA 4EL0A 4XCXA 2JARA 2WZQA 4O33A 3N87A 4O4HB 5LBTA 4EEZA 5JS7A 2GEVA 1EX9A 5EL0A 5K0SA 2QS9A 1D2HA 1U9YA 3QRWA 5KQRA 5FT9A 1T3HA 1C7QA 2OOKA 4LE1A 4NLLA 1Y3FE 3BXHA 4FNGA 1NNEA 3JS5A 3RDPA 5CVJA 5BV8A 6CHYA 1FFWA 5C5DA 1RXEA 3CH5A 4TLMB 4Q3LA 1A4RA 2H4WA 2C84A 1CY1A 3MWJA 4LCBA 4MS1B 1Y8AA 2V3VA 1T5BA 2VDLB 3FHTA 1FNDA 4K8OA 4FD3A 1DCTA 3EZGA 1D1QA 2ZPTX 4DLZA 2CMKA 3OEWA 4ZQCB 1DC4A 2N1BA 3P5BA 3I5UA 7GPBA 3ABIA 1A76A 2HCBA 1JR2A 4I3FA 4Y2RA 4XE5A 2WFZA 3F2IA 4EHKA 3JWIA 4CCYB 2K87A 4II7A 4Z5XA 3MAJA 1B2RA 5B57C 2Z5GA 2RK6A 3ER6A 2ODNA 3NNNA 4OHFA 3ESXA 4MVYA 5KYUA 5JJ5A 4HAXA 4E5UA 5IZCA 5FQOA 1IBCA 2NYAA 2JBAB 1ZM9A 4UXHA 2PH1A 5B2FA 1L4GA 4DLBA 3GP5A 5FLEX 3ITDA 5CVCA 3F5QA 5LQKA 3RYIA 4ZIRB 1TK9A 4LRUA 1HDXA 3LUFA 3IIIA 3VPSA 1FS5A 2G40A 3UO8B 3L8CA 4W1SA 4BQEA 4KR3A 1CFJA 4EQ6B 3ZR4B 1GQSA 4WMLA 3NPAA 2GJAA 3UKJA 2IYOA 2IP1A 2PS9A 1LEHA 2X1VA 4N8DA 2G6TA 2UZ4A 2V9ZA 3O9VA 2ORED 4Q4AB 4IGAA 2UVPA 5JD3A 3U7FB 4KQWA 1YAJA 1YOVB 2BGTA 2X86A 3ZWMA 4KO2S 4Y3UA 3TQRA 2R5FA 1H2WA 1O4WA 3TLCA 2B4QA 4F92B 3RIXA 3B1XA 4LY3A 2BW0A 3CKKA 4JH0A 3C3CA 3K4HA 4KMMA 1C4XA 1MAHA 1SCUB 3BMOA 3FZEA 4TMTA 3RASA 4JIMA 3KQUA 4KXQA 3GCDA 2H5JA 1LPAB 3TKAA 3W2IA 5I8WA 4J3JA 1LBIA 3GC6A 2WYUA 4L3OA 5H3CA 1I3LA 1EGMB 4B32A 5IJ9B 3FX2A 1II0A 1JAYA 2HA0A 2UZ1A 2LDBA 2X9LA 1ZVVA 1RIFA 5DF1A 2KE5A 4D8UA 3E6AA 3FZQA 4ND7A 1OH8A 3TR0A 2FSHA 3O31A 3DJYA 1CD5A 4L28A 4JQOA 1P1RA 2C99A 3Q9SA 5ALYA 4JR2A 3I4CA 4LK3A 4XR4A 4LFAB 2QJTA 4D3ZA 1OUMA 4UHHA 5F1PA 3OU6A 3AKEA 1KBOA 3G9QA 2IGTA 3TNFA 1D0SA 3V2IA 1RFLA 3ELWA 4B4DA 2FZCA 4KGVA 2ETXA 4KIGA 1BKDR 1CRLA 1KJ8A 3RKUA 1DUSA 3SG0A 1TA4A 3HR4A 3WGYA 2ZJ5A 5CHEA 1AC5A 3DTTA 5ICFA 3ANTA 3JWPA 2NU9B 3T4XA 4MH0R 1BDBA 1CQPA 3QNUA 2CCKA 4OUDA 3OBIA 1NMEA 3E9ZA 4LGVA 4DT1B 1BFUA 2W0MA 5E7JA 4E12A 5ENDA 4MGKR 2OB2A 1GN8A 1XZKA 5KJ6A 3TDKA 4IUDS 4CMKA 1AXGA 1USUA 1Z47A 3BK2A 1RI5A 3QF7A 4D5GA 1W2HA 4Q9NA 1ZQ1A 5IANA 3RLFA 1P1KA 4Q0MA 4OBXA 1YQXA 3PC2A 3QIVA 2J33A 4LRWA 4M6WB 1C81A 1XIVA 3KE9A 5D5HA 3BD9A 1GPUA 4I9UA 4CT0A 3GVXA 1RJ9A 1Q1GA 2H2WA 3D3EA 1G8HA 2NU6B 3E9QA 1QQ7A 3LQKA 3OEHA 2OSBA 4XCVA 3HDGA 3VOAA 2ZBQA 3DTVB 4Q7EA 5IXJA 5K8LA 2FRVA 4JI0B 2V4MA 3FMVA 4D8VA 1BGWA 2O1XA 4XDHA 3GLGE 1U3FA 2GOYA 3BB4A 1A7UA 1IE3A 2PV7A 2Y1FA 3EK2A 5D3MA 5AW3A 2NMVA 3R9IA 3L0CA 1GFWA 2H1FA 4L74A 2YFQA 3K8ZA 2Q2VA 2I2WA 4LX8A 1Y1LA 1FBTA 1HDYA 4NFLA 1NVDA 2ERXA 6ADHA 4N3AA 3DLAA 4ID9A 4LI0A 2QX4A 3D02A 3K0AB 3ZC3A 1Z28A 3K9HA 1N2HA 2BONA 4NZMA 2XW6A 3ZW7A 1W36B 2X14A 2Y92A 1U4OA 5KOJA 1VHDA 3CINA 3ELDA 1OLOA 4P54A 1K66A 4BO8A 5I51A 1A4UA 2I1QA 5IKPA 5TX7A 4Q6WA 1IN8A 2UYYA 4Z7QB 3L0BA 1DZIA 2WU4A 4P8RA 4NJMB 3MT8A 3WP0A 4Y0NA 4RO0A 3HSYA 1JQDA 2RI6A 4RZIA 1DEOA 1V71A 2DUJA 3LHDA 3OLXA 3V8NA 4JK3A 2FPPA 5BVGB 4BNXA 2QGZA 4MJ7A 4IFIA 4QOFA 2Y1OA 4Y2GA 4YAEA 5A5VA 3S1SA 1EA5A 3Q7PA 3VR5A 1QG2A 4DV0B 4RUKA 1Y48E 4IDOA 5EIXA 1XNJA 2YZ7A 1MC1A 3UXYA 4RHUA 4XM1A 5AOVA 1FP2A 2B1GA 4XYBA 3E7DA 2VOJA 4U4AA 4EFNA 4F86A 1PR5A 2P6MA 2WA2A 4EENA 3V33A 2J8ZA 2PL1A 3AJDA 2R1TB 1FDSA 4WKNA 2Y1XA 5LB2A 4CLDA 2N9UA 1W2GA 2O6LA 3ETHA 1DKOA 2PD3A 3F97A 3KQWA 1RPTA 4NAVA 5IULC 1G8YA 2IYXA 2APJA 4ETMA 1Z7WA 2C8JA 2WNIA 2OFFA 1Q6YA 5EINA 3WLEA 2BFEB 3DV0B 4WFQA 3CF6R 2NX2A 3QFCA 4WBNF 3ETGA 2HN9A 2IY9A 2J0EA 3PHGA 4L5JA 3SE0A 4EHAA 4GKKB 4AJLA 2C54A 2D06A 4MYDA 3ILYA 4TMYA 4EG8A 3ESDA 5AVQA 4B8WA 3RG2A 1WY7A 3CNHA 3DOIA 3QPBA 4EMTA 3CLUD 5G4KA 2VDWA 2WPNA 3WA7A 3GLFB 3KWMA 4C2UA 1BHO1 2ZIVB 1OFGA 1PSDA 1I1HA 2JKYA 2XSZD 2H48A 3FHCB 5ERGB 1FJ2A 3W8FA 4P98A 4W9NC 3R76A 1GGKA 2J9XB 3ENVA 4JLVA 3P0IA 1HPLA 3F4LA 3ZHOA 2IZ6A 4L2IB 2RG1A 3O4HA 1U9IC 1F9AA 1WHTA 1RVV1 2ONKA 1KERA 2IL1A 4Y9TA 4QGHA 1GZSA 2HB6A 4Y1EA 2X9QA 4NPCA 4TXMA 3EFOA 5FOUA 3VH2A 1IIBA 1NSTA 1GCGA 4L5CA 4MRMB 4TL8A 3HYTA 1M0TA 1RKQA 4NG5A 3DDUA 2Q7XA 2VFAA 4GQBA 2X0KA 4Y7DA 5C1BA 1SURA 2RHWA 3IALA 1UJBA 1CQJA 5KZMB 2ZWAA 3DE1X 1TKRA 5L6MB 4OHMA 5FV4A 3D31A 1P4SA 2IEBA 4GPEA 4KE7A 5AKEA 3TLBA 3V00A 5K05A 4GL4A 2F8SA 2ZJ7A 4NCHA 2CSUA 3CVWA 4IF6A 3O0DA 4PHHA 1D1SA 1WBBA 2IIPA 1MQ9A 4CQLB 3H8SA 3X2EA 3IODA 4MUBA 4K0KB 2VK1A 3IS3A 1L1FA 3RUAA 4EVSA 2D1SA 5BMVB 4URVR 4QRHA 3UAOA 2FSSA 3CUYA 3G59A 3IDZA 3RAGA 1QYWA 3WB0A 4QU8A 3KQMA 1P6UA 4KBGA 1DEHA 1G5IA 4GD3Q 2J3KA 1UANA 4N9WA 4BV8A 3DZCA 3E22A 1PVVA 2ETVA 2C97A 1W5BA 5IDYA 1QQBA 1L5YA 2H00A 3FA2A 4BEJA 2WMNB 1OB5A 5JI2E 5DGIA 2D2EA 3H9BA 5LR6A 5DCLA 2H85A 5AHXA 2IPNA 2HU8A 2P7IA 6ABPA 4K9MA 1WKVA 5AM1A 3VYUB 4EIWA 3A9VA 4F4CA 3FWHA 5EUQB 4G5XA 2GM9A 3NAQA 3N8KA 4DF3A 5LOVB 1SVOA 4G5RA 4M0UA 2QUHA 1O5TA 1NI5A 2NU7A 3AFGA 4GKVA 3SOPA 1OPXA 1YE8A 2FVXA 1Z6ZA 2X9VA 2RHRA 4RHXA 5BSUA 4HMPA 4R1UA 4PRYA 2MT9A 2QSUA 4D02A 4HDKA 2NUAA 3KBOA 1M2JA 1BHSA 4BJ1A 5BQ5A 1HM5A 2V7UA 4REQB 4XLTA 2JA1A 3EBOA 4ZJZA 4H7EA 5KQPA 5IS2A 1XCMA 4ZQBA 1P9WA 1V7QA 3GOQA 5A4MS 5BQ3A 4HXEB 1P0MA 1GG8A 3CUWA 4MQFA 3EPRA 2GWRA 2DUWA 2HF9A 4WZ6A 1B0UA 1TDJA 2OC4A 3QU9A 3HKBB 2YRFA 4X61A 3ZTWA 5JC1A 1BE1A 4XIFA 1O77A 1ZMOA 2AOTA 1M3SA 2XMQA 4MMZB 5FEMA 2KS6A 4QGSA 3H17A 4CL2A 3L4JA 1KOGA 5HJ2A 3WWPA 3VNVA 4MUXA 1WW3A 4EF5A 5JNUA 1AUXA 3BL5A 1PZFA 5IJXA 3R3XA 1JALA 2VHEA 3EB9A 1NF2A 3H4VA 4RU1A 5EI5A 5FL7D 5ITZA 3QKUA 3B2NA 3W5SA 4GFDA 5EJ2A 2P91A 4QPDA 2ZRKA 4QX6A 3H42B 4RJIA 3ZDDA 5F9HA 1N8TA 3KTFA 3EOBI 2IYWA 3A3PA 1Z0ZA 1GVHA 4EA7A 3A14A 5E4YA 3SYKA 2VF4X 1ATIA 1SHTX 1G2IA 2ZB3A 3HGQA 4RPKA 4LCJA 4DDUA 5JMTA 4CDGA 2P2YA 1G21B 1USGA 3SX0A 2BEWA 2LIVA 4BQSA 2ZBPA 2ZWVA 4XUEA 3B3FA 2GHIA 3QWBA 4P53A 4MRNA 3GLHA 4Q12A 1OYWA 2JJQA 3FUCA 1H4SA 3CXUA 4G37A 5E4TA 4BPBA 1D3AA 3MBIA 3R75A 2D4HA 3T0IA 1CEYA 4MA5A 1J4AA 1SHUX 1AOXA 2CE7A 1L8LA 3WAJA 4OHBA 2CUNA 3WNVA 3U9SA 4BATA 3LK7A 4HZIA 5IABA 3CNQS 2W43A 3O8OA 3Q6IA 3WISA 2EZTA 3ISVA 4AF8A 1YMQA 3EPKA 3FKSD 4ZTZB 4K1XA 5K0CA 3KTDA 1N2OA 1PR2A 1WP9A 1YBFA 4H7PA 1YI0A 4N3NA 3SHVA 3W5UA 3DL4A 4LXTA 4N6GA 4RKFA 3FNGA 1NAIA 3M6AA 2XOKD 3NH9A 3TB4A 1P9OA 4R98A 1PUIA 4HCJA 4DA0A 4HL6A 3IAM1 3KK0A 4LWOA 5A6VA 5L3SA 1MPXA 1TZBA 3TZ6A 2JFFA 3INNA 2P9EA 5JSZA 1NVUQ 1J1ZA 5JYCA 1GZ3A 4ZAVA 5J40A 3W6NA 1ZCAA 5F21A 1J1IA 2X77A 4MCAA 4CEJA 4NP6A 2VXOA 3TWOA 4MWTA 5ALZA 4DUGD 2RBGA 1SWVA 1SK9A 2V6MA 1LVUA 3JD3A 2EG5A 3LUHA 4LC1A 5D85A 3FFWA 1G7CA 4KVFA 1VIAA 1GA1A 4ZZ3A 1QPGA 5AVRA 5EUCA 2PLAA 3PQ2A 3R3YA 3RAPR 4E31A 1XF9A 4ODIA 2IXBA 4D4HA 4MR9B 4F45A 4FE7A 1VPTA 2XNKA 4E4RA 1PK9A 1DG1G 5DN6A 4RD4A 1Q12A 1T2CA 2C5LA 1KDRA 4FFRA 1C0IA 1JU3A 3HFRA 1I94B 1MZPA 1IWOA 4JAVC 1U7WA 1IK4A 1ZBQA 1DO2A 3PIDA 4KQKA 3SJAA 4Z7NB 4HVLA 3UXHA 2D54A 1QX3A 2BR3A 1TEHA 3G89A 3MMZA 1WCIA 1TTTA 2EJCA 1P4RA 3C8MA 3TX6A 4BQNA 2VDOB 4BCBA 5J4VA 4RIIA 2PD6A 5JFTA 1A88A 3I1JA 1L5KA 5BWBA 4IX1A 3FLAA 2QOEA 1PJZA 2MOKA 3B3QA 4XSHA 3PFKA 4GSYA 2GXSA 4KN5A 4JP3A 5A3QA 1YQTA 4UNIA 1MT0A 3SKYA 1BC5A 3V4LA 1SXQA 4Z0HO 4NZ9A 3KOWA 4DCCA 1H9AA 2VJYA 1RYZA 5A05A 5TPWB 1A7JA 2JI9A 3TLGA 2DPLA 2HHLA 2JGFA 1SZCA 1LK7A 1SH7A 2ZJZA 2PFKA 1IOLA 1DJOA 2HU5A 3EIHA 3EG9A 2GN8A 1PP4A 1DTEA 3X3HA 3GQBB 1JFVA 2PQ2A 1KMNA 1B8VA 2RONA 2E4XA 2PMCA 2XKAA 5K0GA 2B61A 4DIKA 3CLSC 3DJFA 2VP9A 4RDCA 2VDNB 2HHCA 2FWMX 4LXXA 3E9MA 1EQ2A 4HADA 3FTEA 1H6AA 3HN6A 4GPTA 5EHQA 3KLMX 1MDFA 2OY0A 3CZAA 5CIQA 3UUGA 1GU1A 2WOOA 1KYVA 2XH8A 1I3NA 1DBVO 1M6YA 2AKYA 4K6FA 2P30A 5EA2A 3WDMA 5KMGA 1KQFA 4BNGA 3K9GA 2GEUA 1FSZA 2PMDA 2W8ZA 3OF2A 1RQ7A 2DM6A 2I9PA 2VUSA 5ESRA 4XJSA 5HJEA 2QLJA 1IJBA 3QUQA 1QV6A 2GEBA 4Q66C 4V03A 3RARA 3WMEA 2VCEA 2UDPA 5KREA 3DUFA 1WUHS 4TKUB 1Q77A 3A2NA 1SCBA 3FB1A 4XQCA 3UT5B 4DV2B 4FYPA 4KXUA 1B4DA 4YRPA 5TRTA 4AG5A 4U9IS 3QEBZ 3AY3A 3O4IA 1F14A 5KSYA 3KSZO 1MJ5A 3EEIA 1AKTA 1QKJA 4P84A 4Q4HA 4G4GA 4WXRA 1A8QA 4URFA 4B6OA 3RRXA 5AESA 2R00A 4R3NA 4ZO9A 3V4PB 1Q2UA 2C7GA 2PUGA 1RJFA 3MCWA 1ZY2A 1E6CA 4G23A 1K08A 4R1OA 3ZQJA 1QP7A 1KFCB 3C5VA 4CMEA 1Q16A 4KSBA 1QGOA 1C29B 4DMRA 5CVTA 1P7WA 2QNBA 4DCOA 4KDCA 3STWA 3D8TA 2HJVA 4K81B 4NE2A 5JRZA 4FXOA 4TUYF 1A71A 3HJGA 1COZA 3LLCA 3OJFA 3OX3A 4KRXA 4QGBA 3WYFA 2GGSA 2D3TA 2Y05A 5I7VA 3M1AA 2J5RA 2I55A 4QTYA 3E05A 1YU6A 4B71A 2XV1A 3YASA 2JIBA 3GFBA 3HACA 5A4KA 5JXGA 5LKRA 2JGJA 2Z56A 3JU3A 1ADYA 4U8HA 1CEXA 1ECGA 4RTOA 1BX1A 2B82A 2PWPA 1DIBA 1UFKA 3UMYA 1SQSA 4TUYA 3DE4X 3S99A 2P75A 1QCCA 3O03A 5GZ1A 1P60A 1A4XA 2JDIA 1Y4UA 2EFHB 4WACA 2JLYA 2X9NA 3H5LA 1CTQA 1ND6A 2WW8A 1NAHA 4FZRA 4KLNA 3RANA 1PS9A 1VTKA 5A62A 3A1CA 2VQEB 4PF1A 4JI3B 1AUQA 1F12A 3Q40A 2NTJA 2BP7B 3HB5X 5G41A 2GJSA 5H4HA 5FUWA 5A4FS 1VG1A 5CLQA 4X20B 2DFPA 3CBQA 3PXEA 1GNVA 3DEYX 3M6VA 2IH4A 1MABA 2HMUA 3DHWC 3B51X 3TJRA 2CDBA 1RXWA 3MTJA 1UMDA 2QTCA 5EXSA 2WVAA 2PGLA 3LU1A 4WRRA 5JXWA 2IHKA 5EMNA 3UUEA 4W5RA 4DHWA 2I0FA 3KD3A 3NALA 4YRFA 2Q2OA 1NTRA 2VZEA 1RKUA 4E08A 3EUFA 1Y7PA 1FEZA 4P6VF 3COWA 1ABFA 3ZCUA 2CLIB 1EXWA 3AH8A 1QE0A 4DN6A 4PNEA 4K88A 5I45A 1EZ4A 3C6QA 2Q3HA 1JT9A 1C1HA 1U0HC 4REMA 2EDAA 5GTDA 3G7NA 5FF9A 3P2YA 4GW3A 1M8KA 2WOJA 4FSDA 3RYFA 4BP9A 1ZD8A 4K6MA 2WU8A 1MXHA 3GJZA 3RVKA 3NEAA 4FMPA 3U5ZB 3OP1A 2XUQA 2Y9MB 3PXUA 1Q1BA 3BERA 3JQAD 3H9CA 1AY0A 4RABA 3VU0A 3S68A 5HKAA 4V24A 1JFSA 3DHVA 4ZV4A 4M8NE 2C9OA 2X2PA 2DT5A 3IE2A 5CG1A 4LUCA 4X0EA 1ARZA 3THXA 1J07A 2PNJA 3IAS1 5TEWA 3UHJA 1X1EA 1R0BA 3ESZA 4N54A 4EYGA 1R7RA 1K7YA 3EXHB 4D0NA 3VVBA 3QEJA 1N2BA 1SXJD 3BCHA 1U1FA 5KOHB 2X7XA 4JELA 1XALA 3OCXA 4I8XA 2PHZA 1JZTA 2P2LA 4LOKA 3AGPA 1XU9A 4XB1A 4I0WB 1MF7A 4YMSA 3S81A 4MR8B 1PEKE 2D3WA 1E9SA 2C5FA 5CCBA 1J0CA 1PT9A 4R69A 1PWEA 1G0OA 4RD6A 4D9IA 4ACAA 1VL8A 4DLNA 1EFAA 1KOJA 2J85A 5EXPA 4WKPA 5L3QA 2Y0DA 2WJYA 4D0LB 5JS8A 1L4HA 4G1BA 4HNGA 3T7DA 3RAEC 4YR9A 2GZMA 2IY7A 4OTZA 4WNAB 1EVLA 1RWXA 1Z82A 1UMKA 2HZBA 4ROSA 1UIMA 1PSWA 3EVNA 5H02A 1A5AB 3TM5A 1NJ8A 4GBGA 1VDZA 5BPFA 1OAOC 1VB3A 2JI6A 1NHGA 2QF7A 3OMXA 2XRMA 1OB2A 1OFIA 1ZIDA 2Y6VA 2EJTA 2PGDA 4N0EA 1ZJWA 3DO8A 2CLOB 3SC2A 4RA9A 3HXMA 1GITA 4KPFC 4WXMA 1GQYA 1K92A 1Y98A 2P11A 2QLBA 2R1VA 3GPBA 1EEHA 1YO6A 1VLQA 1VCMA 2CMFA 5EMJA 3EXHC 1ZLXA 3ZD6A 5AW5A 2Q9BA 4CWAA 5C7OO 1A8IA 2VPWA 2HREA 2IYRA 3PC8A 5CLIA 3OOHA 3Q85A 4RZUA 3SGLA 1UDAA 2P6UA 3Q9LA 2YMMA 4M0CA 5AXCA 3T1VA 1L7XA 2OVFA 4DZRA 5I4KA 1H8ED 4UE6A 4WINA 3VBEA 5EZ5A 6REQA 1W9MA 2YWRA 3OFNA 1ECCA 1LI7A 3MOIA 4C5BA 1T3ZA 5BQXA 3T38A 2JFWA 4R40A 4R4JA 4W9RA 3RYCB 5EYPB 4A27A 2YBDA 5KTTA 2CF5A 2AJLI 2JDID 2OCPA 2PT5A 3EDMA 3JD1A 4ZARA 5KJEA 1UAGA 1X9GA 1U8TA 6GPBA 1PT8A 2VF8A 3FNIA 1A77A 1O03A 1LLDA 1FK8A 4JVNA 1L7PA 4Z9AA 5I9BA 1YE5A 3V8MA 5B4VA 5ALLA 1Q1AA 3I6QA 4FJ0A 4JJAA 1KK0A 4C05A 3KSAC 4K9SA 4D26A 5IC6A 5HK9A 3M1YA 2VAPA 3HO8A 1BH6A 4CKWB 1ID8A 1DEAA 1MC5A 4GE3A 3K7EA 3DDNA 2X42A 4MOWA 1MRNA 8LDHA 4GR9A 1HKUA 2HBQA 3BREA 3R4CA 5LYJB 4Q3AA 2OCGA 4W1QA 5ADWA 1TW3A 3LDUA 5T7BA 4FSXA 2BUCA 2EX0A 2QMQA 2JFVA 4PSUA 1WVIA 4DDHA 2ZSAA 4WOBA 4D3FA 1DKMA 2IPAB 3T5PA 3MIZA 1L0BA 2WNSA 3KR9A 2JGMA 1NJFA 3AFIA 4JI7B 4URHA 5AVXA 2PS0A 3AUAA 3U44B 4L8GA 4OIMA 2J3HA 4WVLA 2IODA 4XFKA 4MB6A 1JHQA 1MENA 1U3UA 3PIRA 3RAFC 3UK6A 2W2LD 1Z4NA 4YP1A 1T4DA 2IX9A 4H27A 5MN5A 3FI9A 3O84A 4B3GA 1ZM3A 1EVYA 4IJUA 4CEHA 3DV2A 5FA8A 1JA9A 2FUEA 3EVTA 4BVHA 2OCLA 3VZPA 3ZU3A 4L4XA 2IOHA 3ZZNA 3OWXA 4N4AA 3NOQA 3JASB 2PGOA 4BKRA 4EHNA 4KCGA 1ZRHA 2CF6A 3G2KA 1CS0B 2FZWA 3FPLA 1OFUX 2O2ZA 2Q1UA 2C9DA 3CUKA 3DHYA 1NQAO 4EG7A 3MTIA 1POWA 1NOKA 2YJTD 2BOVA 1ZEJA 4FOSA 3G3EA 4DCGA 4X45A 2OBLA 1NY5A 2TMKA 4I99A 3ZWDA 4HF7A 3LDFA 3S2SA 3I04A 1G19A 2UVQA 2YV3A 3C3BA 1DCFA 3MMSA 1CJBA 3EGXB 5KJ1A 2O23A 1ZCZA 5IX8A 1YH3A 1QM5A 1Z73A 3LQRA 4MQBA 1KP9A 3MA0A 2GZSA 3Q7QA 4RS4A 4Q00A 3ZCPA 2FFQA 4BDSA 4EABA 3UPDA 1L4UA 2J3MA 3U31A 3UXMA 1SY7A 5BSFA 2ORWA 4DXHA 1CRPA 5K6RA 1GRNA 3E0QA 3TZBA 5BW5A 2WPDD 2QTLA 3H5RA 3I8OA 5IFKA 3ZZMA 2QM0A 4XTCS 4I81A 5D1HA 2OHOA 1DMSA 4YAFA 2WAXA 3D3JA 4LYDA 2FE1A 3EXG2 5AJWA 4ZN6A 2SNIE 1SC3A 1KI4A 2R5WA 4IJMA 5LIPA 3V1YA 4RVFA 1PFWA 3BE4A 1L7RA 4GMDA 1QV9A 1NVGA 2ZTUA 1QGYA 2EJBA 5FPYA 4QFMA 4X64B 3D7LA 1RP7A 3GDHA 1RAGA 4Z4CA 2ZT6A 2IS4A 1JR3A 3L7OA 4IXTA 4IGEA 1KEEA 5DPMA 1NJSA 4R01A 3GLHE 2H52A 2OO7A 2C0QA 1XZQA 1M2GA 1Z56C 3ITEA 5LZ8A 1E94E 1N5KA 3GFFA 3ZVMA 3KS9A 4UQOA 1D7AA 2MSKA 3W77A 1GQRA 3FOEC 3LWZA 1XMVA 1XWIA 1P7VA 4O4IB 4PZAA 4CEIB 1Z4QA 2R8ZA 3KEQA 1NULA 3EPPA 3KOOA 2VCYA 4NNJA 2QL5A 2P8SA 4L6IA 4UBLA 3WHLA 2YBEA 5TF4A 5FUBA 3SP1A 1GA6A 5EJEA 4AICA 3VR0A 1JLLB 1G55A 5ELLA 1MAUA 1Z0AA 5JARA 4Y2TA 4NV3A 2Z6QA 1DRVA 3DZKA 1UPBA 2OYCA 4E5SA 5DTQA 4UD2A 2WYOA 2QW0X 4ZAGA 3L41A 2HW8A 1HX7A 3P19A 4QGAA 2COUA 3GYGA 1C8LA 3CNBA 1M10A 5DGTA 1IATA 4QM7A 3BH0A 1VSVA 1BVYF 3I64A 1EMDA 3KB6A 1FMJA 4RETA 3BH6A 2W93A 1YZFA 3PDIB 4HS4A 1CNMA 4IF4A 5EHNA 3LUCA 3SQXA 2O59A 1NVBA 4C20A 2YFYA 3SSMA 2RB4A 2QVBA 4L8LA 1J8FA 4CNQA 3BQ9A 5CB8A 2V3WA 4HNAA 4J90A 3DS8A 4XIYA 5FWXB 2ZU6A 4GRDA 2A0UA 4HDRB 1QC5A 3CC8A 5F3DA 3GRYA 4BAZA 1E7SA 4KWIA 5DLQC 1C2TA 1NV9A 3BE6A 5F98A 1CUIA 3QPAA 4PLFA 5DTIA 1HE2A 1T8SA 1Z2DA 2BBTA 5CJJA 1QE3A 4JEMA 4OQFA 2PZ8A 3UAVA 1RM3A 2X22A 4KJZA 5FNVB 1JDTA 3KEFA 1DV2A 3MWLA 2OK7A 3HKEA 1DARA 1TVMA 3LH5A 4HLUA 4TLCA 4TLAA 1U6JA 2H0QA 3HKDB 3Q3GE 1XAIA 1V8ZA 1BWRA 3BJEA 3I2GA 3MBKA 1GEEA 1TJNA 1RTTA 2ZUVA 2GFIA 1DDIA 4HWSA 3VJRA 4X7RA 4ZCSA 2WT9A 4PYQA 3SC4A 4E94A 4Q7LA 1E79A 1YNOA 2AFHA 5M04A 2DBZA 2WAAA 5E9AA 3WFZA 1E0AA 2QTFA 3BWMA 3LYUA 2I67A 1MHTA 2YDYA 4PYMA 4G4IA 2BJVA 4IQ8A 4F9TA 1OD6A 3CH7A 1O9BA 2JD1A 3DZIA 1Z0IA 1ZAKA 5KYYA 3HWSA 3E1GA 5LJLA 3PPVA 2QRPA 5KS2A 1LF0A 4BQPA 3NIFB 2BRUA 1JYFA 1SZJG 5MGNA 3AV3A 2WU1A 1C8KA 1T2DA 1SVWA 2YJ4A 2KPOA 4DTIA 1DI0A 3ISTA 5KCMA 2VSOA 4UXJA 4BB6A 1UM9A 1LQ2A 4FJ2A 4H60A 3WRYC 3L0IB 2GILA 3E9CA 3TIVA 1VKNA 1OQAA 1W9HA 4OQ4A 1AGRA 1O87A 3A0UA 3WXMA 3HKCA 2M6SA 5JDCA 3OI7A 3IE1A 3NBAA 4OXXA 1RI4A 3PD1A 1PJ4A 2NSYA 3RABA 2XUAA 3WRXC 4X8LA 4AM8A 3FYCA 4ZZIA 4X8HA 2OMKA 1OPRA 3H05A 3RHTA 3TNLA 1NLUA 4LQCA 1TU4A 4EY4A 1JBQA 1TKBA 2EFGA 4NDAA 4XSVA 5HX7A 4RV4A 1DIAA 5DM70 1JPUA 2F67A 3DM5A 3UB4A 4IMIB 1LX6A 4NNPA 4BNIA 2G0NA 3G2OA 4GE0A 1OU4A 4LJ5A 4LXIA 3O8QB 3TVYA 4QJ3A 2CV2A 1YA4A 1YFKA 2FF7A 3QU2A 4Z1MA 4NDNE 2EXXA 3IMGA 5JALA 2ZAIA 1I01A 3GLGB 4IHAA 1H2XA 1UKYA 3PA8A 1RIIA 1G8AA 1SM4A 5B4UA 2LRHA 1MFZA 4Q3BA 3W9SA 1ADFA 3TQHA 1QYCA 1V1JA 1EX6A 2YX1A 1W88A 1FFYA 1C7JA 2HMAA 3EQ8A 3AUSA 3EF3A 3BXZA 4CQMB 3FWPA 2I6FA 3R3JA 2ZYIA 3L7DA 1DJPA 4YCJA 5D87A 3BGOS 3MXTA 2AK2A 3LQ4A 1V5IA 3K2QA 4V0ME 4D4KA 4D96A 3SYTA 4G0VA 3UN1A 2WY2D 3GVIA 5C5EA 1EWKA 5JU6A 2Q5OA 4BBZA 2ZR9A 1WTCA 3IC5A 2AB0A 1HQKA 5ALTA 1WJGA 4CDNA 4DQKA 1KO7A 3OCCA 2DXIA 2A1UB 5JS2A 2ZJ8A 1T6NA 2CXPA 1BROA 2QXTA 3W04A 3U4MA 2H8GA 4MWDA 4C7KA 1MG0A 2WJAA 3H99A 2ZB8A 3WKAA 4AJ9A 4F0JA 4RHFA 1CUFA 1JNYA 1ZLYA 1U8UA 1WNTA 2BPOA 2J5BA 1VP9A 2D7JA 3DC2A 2QAGB 3NC0C 4UM8B 3QOWA 5KHAA 5KCZA 3PUVA 2OORC 5CNKA 2YRWA 5HIMA 4YH1A 2FQWA 2PGIA 2JRLA 2JIDA 1O1YA 1WBJB 4A1OA 1YAHA 4BKPA 3U0VA 4R1TA 1MV5A 1ES9A 2Q3MA 4MQ6A 3NJRA 5FB3A 3CLVA 4EMBA 2GJ9A 4IL5A 4K40A 5FUVA 1H8HA 1ZRSA 3KJNA 3QEMB 3K9NA 5AJVB 3CONA 2Q5JA 4TMXA 5EZSA 5BYBA 1X80A 1Z88A 2IZ1A 4FS8A 4H17A 4KH0A 4JR1A 1V41E 3NBFA 2ATEA 2IUFA 4BZXA 4G3XA 3AB3A 4FB5A 2XDQA 2GVZC 2EKQA 3OJLA 4QA9A 5C7IO 1I4WA 3UK7A 4QDKA 1IM2A 5H81A 5LLSA 2LPMA 4R16A 4W6ZA 3CCBA 2YV5A 4B34A 4EARA 2VYCA 2O20A 4JNCA 5A7GA 1XAJA 3N75A 2EZUA 4NRDA 2DUNA 4CM7A 3RQIA 3RSGA 3KYDA 2ZTLA 4L22A 3I53A 1AKUA 1II8B 2P4UA 1FFXB 2PKWA 2ZWIA 4Q1EA 1TUBA 2Z5VA 1X87A 3EZ2A 1FYFA 1QGZA 4R2WA 1E7MA 3GOHA 3E84A 5MF6A 2OBFA 3F96A 4LKRA 1U0TA 3WK8A 1PJ3A 3ZHRA 4CM9A 2XXAB 4ASUD 4U3JA 1J0EA 4J0CA 3SXUA 3VR4A 9MHTA 2JHPA 1XDBA 1Z34A 4AN1A 4V1CA 2IW3A 1HORA 4PX5A 5K3FA 2VHJA 2P41A 1N5OX 3IP9A 5KTRA 1XWFA 1RE0A 1XX6A 1U7UA 2OCXA 5D00A 2BM0A 2P27A 2OZKA 3SQOA 2F00A 4QXAA 4JOBA 5B58T 3TLMA 3PHHA 1EEXB 1NJ1A 2CUZA 5EHZA 1N3BA 5AKLA 1DFHA 3EASA 3Q2KA 5EJ9A 2WA1A 1Z15A 4TN1A 4IDHA 3WLIA 4N5DA 4KUGA 1F06A 4HB3A 3PXDA 4B85A 3GN2A 4BRWA 1QMPA 4DQUA 3OCYA 2QM8A 4J1TC 4C7XA 2RC6A 4BQIA 1OBFO 2VHYA 2WV9A 1Y5LA 5AW7A 4F3RA 1KJZA 3P9KA 3UMRA 4QOJA 5J9FA 3TG8A 2B5WA 3NHWA 1O6GA 2QYTA 3B5EA 4N5MA 1RWKA 5TF0A 3RC7A 1F17A 4N47A 2A5YB 3ZDCA 3P2EA 2HJRA 3DGEC 5BOSA 3UGKA 1VL6A 3NNDA 1ZNXA 3OCJA 1YJCA 3VOSA 3ETCA 1JFFA 4QLOA 1S1CA 4DA6A 2ZYWX 4ABTA 1IZ0A 2QRJA 5KO2A 2A1IA 5KBYA 3T4PA 1ABBA 2YN4A 2RE8A 3GDWA 1O08A 4DR2B 2O06A 3AC0A 3GZ4A 2YC4C 3IAXA 3IHWA 1IHUA 1KI2A 3V4OA 3HJUA 2Q3EA 3CQ9A 4U00A 4Z51A 3HGMA 1MVLA 3D6AA 1E6WA 1CRQA 4TKZA 1TFRA 1XU4A 4CCAA 4RLSA 4EB6B 3T3PB 4OHUA 4I14A 1BAPA 1POXA 3UWPA 5BY2A 1ZNZA 3AESB 4OOFA 2HXSA 5FQNA 2QUAA 5C5CA 3PV0A 4OI4A 3C4VA 2J0UA 1M75A 1IHPA 2QAJA 4MTLA 4BVEA 3CW2A 5JZMA 1PYOA 3NAZA 2FPGA 3L7YA 3D5QA 1AKRA 1HH4A 3RU9A 4G0ZA 2I7VA 3DMTC 2YIDA 1IY0A 1OKKD 1SBZA 3I2IA 4FDAA 4V0KA 1I32A 1ISRA 3AVXA 3J7TA 3AONB 4JSYA 2HUNA 4X8OA 3PENA 2X1HA 2P62A 3FB4A 4WJLA 2PX6A 2PRIA 4RV9A 3MXOA 2OZPA 4JJ4A 4A16A 2J32A 2WSIA 1JZQA 3AR5A 4MI9A 2GR9A 4ZT5A 4DAEA 4JYBA 3T7RA 3THSA 4J16C 1MOPA 5BN4A 1DL5A 1JL3A 1T29A 4R05A 2XLBA 2REOA 2C2OA 13PKA 3NTOA 1MVNA 3OKPA 1K3FA 1MH1A 2CHVA 2OP0A 1Z5UA 4H6WA 4KGZA 1XAHA 3M9LA 4CHGA 4GBJA 1SAYA 1QIHA 4JT4A 4CKBB 1P4JA 4MUYA 4CETA 3RIHA 4ZPXA 4OI0A 5E4FA 4RULA 1G9TA 1KR2A 2TMGA 1HFKA 2RDMA 4JUIA 3VR4D 3H11B 1TM4E 1FW8A 5K0LA 2FB9A 2JFNA 1CUHA 3HPQA 2HJ9A 5AKXA 3GJYA 1O58A 3OUZA 1WR8A 1K75A 4AROA 3ZNOA 3ZPXA 1YL7A 2DH5A 4LDJA 4EPTA 1LVGA 3MMPA 3FYUA 1T1IA 1WUIS 5EMMA 4JBWA 1SPBS 3O2SB 3P0EA 1W48A 1NHWA 1G3IA 2AQ8A 2IPXA 3CPJB 4UMVA 2ZBGA 2Q0XA 1CRWG 2X0NA 4JJGA 4GGOA 4AMZA 4Q3OA 2BMAA 5TMBA 3AETA 2A59A 3EVFA 1XCLA 3BFVA 1BE0A 1H22A 3NVDA 3AUYA 5BYAA 3SIXA 4A8JA 3QBJA 4BVAA 2AD1A 1OTXA 4P2GA 4NENB 3IBSA 3U1BA 3W06A 2ZWPA 5CFNA 1IU9A 6PFKA 1PJRA 2HHJA 2CVPA 1FLAA 2XNJA 2YYZA 4HKTA 1KQNA 5FRDA 1ZJYA 2C9YA 2JFBA 2WQZA 2FGJA 5F9FA 1JG6A 3D0OA 4E5PA 4J7UA 5EJ6A 1D8TA 3EW7A 1P0IA 3UAZA 2WE7A 4C9BA 3E7WA 3QGMA 3IHTA 4UVGA 1SUSA 1T1EA 2AN5A 4B3IA 1MQSA 1PGOA 1BFKA 3GJSA 1WSWA 3AF2A 5TXGA 1V16B 4D81A 1Y5IA 4C6TA 1CZUA 1LPNA 3Q0EA 1JGTA 1HL7A 2BFCA 3IUBA 5CEFA 1GLVA 2O07A 3ENNA 2ZT5A 5H70A 1IM5A 5BSTA 4Q7QA 3AKZA 5HKBA 2OTCA 1GL7A 3I6MA 4CMIA 5JYEA 1SK8A 4PPFA 5FKJA 4C2TA 1WQ3A