3CG4A

Crystal structure of response regulator receiver domain protein (chey-like) from methanospirillum hungatei jf-1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
126
structure length
126
Chain Sequence
HKGDVMIVDDDAHVRIAVKTILSDAGFHIISADSGGQCIDLLKKGFSGVVLLDIMMPGMDGWDTIRAILDNSLEQGIAIVMLTAKNAPDAKMIGLQEYVVDYITKPFDNEDLIEKTTFFMGFVRNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator receiver domain protein (CheY-like)
publication title Crystal Structure of Response Regulator Receiver Domain Protein (Chey-Like) from Methanospirillum hungatei JF-1.
rcsb
source organism Methanospirillum hungatei jf-1
molecule tags Structural genomics, unknown function
total genus 37
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2008-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3cg4A00
4MLCA 2X7XA 3OO0A 4Z4EA 4PYRA 1Z13A 2AYZA 1E6KA 4ZMSA 2FQWA 2LUOA 4Y9TA 2MYPA 4CBVA 3IDOA 4ZPJA 3W9SA 1EWVA 3RVNA 5D2CA 5FWXB 4IGAA 4OTZA 2QW1A 2R48A 3GBVA 4GNRA 3RVJA 4O1HA 2H3HA 4IRXA 1YS6A 1MIHA 1VLZA 4NQRA 4RKRA 3HO1A 4OLBA 4QPJC 3TD9A 1F4VA 1JFSA 1DCMA 3EQZA 1U8TA 2M1ZA 2PE5A 4D6XA 3MF4A 3M9XA 3UK0A 1KRWA 1EAYA 2WWVD 3UUGA 3BRQA 3RH0A 1JL3A 2LBPA 1J56A 4PEVA 1F51E 4ETNA 2ZWMA 3F7NA 3GYBA 3A0RB 1B00A 3KYJB 1I3CA 4ML3A 3TO5A 5B3JC 4TMYA 1NTRA 5CHYA 4RWEA 3VNAA 3KLOA 8ABPA 2JBAA 1E2BA 1FFGA 3R0JA 4ZJPA 2FQXA 5CNJA 4JAVC 3DLBA 1C4WA 4KVFA 4HNQA 1Z18A 1RPJA 3O2JA 3KYIB 5TQ2B 3ROTA 3RVKA 3S99A 1MB3A 1GLGA 4D74A 2MYNA 2PL1A 4YP9A 4EYGA 2QVGA 5TPWB 4DADA 2B1JA 2CD7A 4G0MA 4FB4A 2JVIA 4B09A 4PZ0A 1E6LA 5JNVA 4Z4IA 4F06A 4N41A 5B3JA 1KGSA 1NXTA 2FEPA 2FMKA 3OQOA 1ZHHA 3D8UA 4RXUA 1Z25A 3GT7A 1ZH2A 3IP9A 2FVYA 3H1FA 3O74A 5IUKC 3Q41A 9ABPA 4PE5B 2PUFA 3CLKA 4MS1A 1NXWA 5ABPA 1JDNA 3GRCA 4HYEA 2IPMA 2FEKA 4ETIA 2IDMA 4NCAA 4LRQA 4G0XA 1ABEA 3ILYA 3SG0A 1YIOA 2JCGA 2IPNA 4MPTA 1NY5A 3KG2A 3QLUA 4Q6BA 1LJLA 1XHEA 4OBBA 4Q6WA 3L49A 5DCLA 3T38A 2ID9A 1DZ3A 3JS5A 5TQJA 5IULC 4W5RA 2F8SA 2MSKA 1BVHA 2E4WA 4MQFA 4XLTA 4G0PA 3O75A 4HNRA 2DRIA 1VPWA 1TM2A 3LUHA 1PHRA 4Z9BA 1CEYA 2PUEA 4MGEA 3DGEC 1RZRD 2A9QA 4MS3A 4Q7EA 5KQMA 1M2FA 4E7OA 1BDHA 2FTKE 1ZH4A 2GWRA 5DKFA 4KMRA 5EWMA 1RXIA 5BRAA 4KFCA 4XXHA 3TX6A 2PMCA 3OQNA 2QSJA 3EODA 3NNNA 2LP4Y 4JB0A 5DGCA 4MS4A 1KRXA 3O2QB 3I45A 4KV7A 3KHTA 1TJYA 3SM9A 3KKEA 3KLNA 4MQEA 5JS2A 4WZZA 2PLNA 2FQYA 1JDPA 3K9CA 4EUKA 1W25A 3F6PA 1P6UA 4IMJB 2IYNA 4RS3A 5CNMA 1W9HA 4RK0A 4NICA 2FN8A 4WXEA 4RK7A 1YMUA 4NV3A 5EWJB 2GI4A 4D6YA 1JHZA 3QEMB 2PUDA 3IPCA 4XASA 1P2FA 5KWSA 1HEYA 1SRRA 3LUKA 3MM4A 3QEKA 1SXGA 5T3YA 1WETA 5BQ3A 3CG0A 1BA2A 2P4UA 3OO1A 3N6VA 5GQSA 1M5UA 3QX8A 1DCFA 2HPHA 1DG9A 1EWKA 3H5IA 1U0SY 3BREA 4N0QA 2A9PA 2NT3A 2R4QA 5KC9A 2HQOA 3CTPA 4G0OA 2HSGA 3H5VA 5GOTA 1MB0A 3SAJA 3HUUA 5IBQA 1FFSA 1QNLA 3EAFA 4YRZA 1D1PA 2F8TA 4NCBA 2KYRA 3LOPA 4L4UA 3LKBA 2JRLA 2P9HA 4MR9A 4RY9A 3NBMA 3K4HA 4YV7A 4HNSA 3C6QA 4ZMRA 1DC8A 1YVUA 3JVDA 3JVIA 2E4VA 2L2QA 2BGGA 4YS6A 4EVRA 2FMFA 1JYEA 1Z26A 1JYFA 4RK1A 5FBHA 3EJWA 3LKVA 5KQLA 3JY6A 1QKKA 1NXXA 1M2EA 2JBAB 4N03A 3FFTA 3LUJA 1L5ZA 3URMA 4KREA 3MA0A 3HM9A 2NZUG 3BRSA 3NHZA 4N47A 5TPZD 5TPZA 3GL9A 2O20A 4OG2A 3CKMA 1A04A 4WXMA 3KSMA 1DCKA 4H3HB 3G85A 1OXKB 2MSLA 3C3KA 3OMXA 4LDAA 3RVLA 4XAQA 3CU5A 1A2OA 1RXEA 1Z15A 2OENG 4UHKA 4YLEA 2WB4A 5JNRA 4XFKA 4YGXB 4Z4CA 3QELA 1Z2DA 3DZDA 3Q9SA 4RY0A 4MAAA 4MS1B 5I4CA 5IUJC 3MYYA 3H6GA 4G0QA 5TQ0A 3FGZA 1ABFA 1ZGZA 3DBIA 3FMVA 2MYTA 3IP6A 2FMHA 3SNKA 2MSWA 3CZCA 1JFTA 2IPAB 4Z4HA 1USKA 2RDMA 4KQCA 3E3MA 3FDFA 2PAFA 3CS3A 3H5TA 1ZY2A 2FEWB 4MQFB 2YHBA 3RVRA 1LJUA 3N0RA 3KS9A 4G0YA 3UKJA 3NHMA 3O2SB 2QR3A 3P9YA 1C0EA 1VKRA 3Q7TA 3E61A 2E4UA 1EWTA 4MS3B 4Z0NA 1SXIA 2LPMA 3H5WA 4MR8A 5HKOA 2NT4A 3LUGA 3N0XA 3QLVC 1Y1LA 3OLYA 2TMYA 4RXTA 5EWMB 5FWYA 2ID7A 3H6HA 2PUGA 4RZSA 4TN5A 1BAPA 3N53A 3LMKA 2J48A 4O1IA 5BR1A 4MS4B 4KQ9A 3C3MA 2LIVA 3O1IC 4S05A 1YK1A 4P98A 4MQEB 4JASB 2CHFA 1DJMA 3BILA 4DN6A 1RZRA 4MLDA 1Z12A 3RVMA 4W5NA 2YHAA 2RGYA 6ABPA 3A3KA 4KZKA 4MR7A 4MYRA 1XHFA 3QLTA 1USIA 3Q7RA 1ISRA 1TLFA 3HJFA 2NUBA 1JH9A 4L85A 5ED4A 1JBEA 3I5AA 1R8JA 4RV5A 1ZDMA 4RDCA 1TVMA 3HDGA 3HEBA 3FFWA 2WY2D 1DBPA 3T8YA 4LZLA 1U2PA 1S8NA 2QU7A 5JNTA 3OLVA 5C5CA 1PEYA 4LE1A 4MR9B 4G86A 4Z4FA 5EWLA 3IP7A 3OLZA 1QQBA 4ZYLA 1JFVA 1AB5A 2Q5CA 1KMIY 4YCSA 2V0NA 1JWLA 1GCAA 1NXSA 5PNTA 1YK0A 2JB9A 4W5OA 1GUDA 5JS1A 3N75A 1NXVA 4N0PA 4YO7A 2QZJA 2OQRA 3H5OA 3NNDA 2A9OA 2RJNA 4WWHA 5TE9A 1UDRA 4W5TA 4IF4A 1JX6A 3C97A 4EYOA 5T7BA 4MRMA 2PUCA 3OLWA 5IUNC 3LUAA 4WUTA 5JNUA 3A0UA 4QICA 3I09A 1APBA 4FE4A 4Z9AA 2FLKA 1D1QA 2I6FA 3OLXA 4XARA 3MMNA 2QXYA 3Q15C 3ROFA 4RXMA 2JK1A 3MIZA 1LK0A 1Z16A 3CHYA 3I42A 4JB2A 1DC7A 1Z17A 3QK7A 4N76A 3EQ2A 4LX8A 4KRFA 4F3TA 1A0OA 1YS7A 1AB6A 1TMYA 3QELB 3HXMA 2VK2A 2FXIA 4O5AA 4YWHA 3NNSA 1ZAYA 3IP5A 2PJUA 1QO0D 4JP1A 4QYWA 1QO0A 5HQJA 5TQ0B 4RK6A 2IOYA 4IMIB 5FBKA 3SQNA 2JVKA 2VUHB 3ILHA 3D02A 4RK5A 2FMIA 5IC5A 1EFAA 1E6MA 2VUIB 3GA5A 5CNKA 1EHCA 4TLMB 1Z2EA 3DGFC 2CWDA 1LBIA 3LUFA 2FSPA 6CHYA 1NXPA 3HV2A 3JPWA 3GV0A 2FLWA 1M5TA 3IPAA 1MVOA 3T6KA 3JTEA 4OLAA 2IPLA 3OQMA 2WMYA 1K66A 3RVOA 2E4ZA 3RVPA 3A10A 3CG4A 3HVRA 1K68A 3HS3A 4JOQA 5CNIA 4GPAA 2IKSA 1IIBA 4LE0A 4MR8B 5FWXA 3RVSA 2H0AA 4QYMA 4W5QA 1YTUA 4IILA 5FWYB 4DQDA 4RY8A 5IX8A 1QMPA 2N9UA 3DLHA 2GX6A 2E4YA 1YMVA 3T95A 2HQBA 3CFYA 2JVJA 5DTEA 1ZVVA 4RKQA 2GBPA 3MQ4A 3RQIA 2L17A 3JPYA 3LFTA 3FFXA 3G1WA 3VNBA 4S04A 1BDJA 3HCWA 1DBQA 2PUAA 3QLUC 1CHNA 3QX9A 4F11A 1PUXA 1QP4A 2HJ9A 1FSPA 3H1GA 4MR7B 4EVSA 2WJAA 1FFWA 3BBLA 5JNSA 5HM6A 3N8IA 5HSGA 1BDIA 3O1JC 5TQ2A 1U2QA 5JNWA 3C3WA 3HUTA 1L5YA 2E4XA 5TPWA 1FQWA 1ZGGA 1QQAA 1T34A 2L19A 1PNTA 2AYXA 3LTEA 2FN9A 5F64A 4ETMA 1USGA 1GCGA 1VRVA 3H1EA 1MAVA 1NATA 1CYEA 3RVQA 3M9WA 4TLLB 4WT7A 4UHJA 2A9RA 3HDVA 3QLVA 1D2AA 3O1HB 2W42A 5KQGA 1RNLA 1D4ZA 4Z99A 1SXHA 3HZHA 4RK4A 7ABPA 2CHEA 1URPA 2ZAYA 3GWGA 5C5EA 5EWLB 4H60A 3B2NA 1DRJA 4Z4GA 4LE2A 1QP0A 5IEJA 5KC8A 5DLEA 1D5WA 1SD5A 3GBPA 1GUBA 4P1ZA 1DP4A 5IEBA 3H75A 3L6UA 4EY3A 3KCNA 2WJWA 3KTOA 4JA2A 4F12A 2PUBA 1NXOA 3LUDA 1OXBB 4EYQA 1P6QA 1ZITA 2R47A 4MRMB 2GKGA 3TMYA 2QV0A 3OM1A 1QPZA 4RSMA 3OMWA 2NZVG 1QP7A 2B4AA 1DBWA 1PEAA 3OM0A 2WRZA 1ZESA 3H5LA 3KJXA 2QVCA 4G0ZA 1P8AA 3CRNA 1ISSA 4M88A 3EGCA 2R25B 4KK4A 1XWWA 3LUCA 3F73A 4F8JA 3O21A 2FKAA 4OATA 4KPYA 4PICA 2M98A 1DRKA 3TB6A 2HQRA 3CNBA 3SY8A 4YR7A 4RU1A 2MYUA 3CZ5A 5KI6A 1LBHA 1ZN2A 2PKXA 3Q7SA 5BRJA 3EULA 1JLKA 2PL9A 2VYCA 4G97A 1H9CA 1JF8A 4KK3A 4H3KB 2XDYA 3HK2A 3M6MD 3F6CA 4KNYA 4FE7A 3HSYA 3EDCA 4EVQA 5KQPA 2RJOA 3N0WA 1PNRA 4EGSA 5EWJA 3QEMA 2FW0A 4LDZA 5E3JA 1U04A 4E7PA 4EYKA 2L18A
chains in the Genus database with same CATH superfamily
2QY9A 4URUR 4BIMA 1NI4B 4HAXA 3CUSA 1WCXA 2WYVA 4XQEA 4YRSA 3R0ZA 3MWKA 3DVQX 4DNOA 2VT3A 1UFRA 1OH6A 1AUQA 2NO4A 3R6GA 5EHGA 2VHCA 4ZAGA 1EWVA 1VE3A 4PZEA 1HNZB 1G21B 2OM6A 3QPCA 5DTQA 3WWYA 4BXOA 1XQXA 4Q66C 5L4LA 5CD1A 2YOGA 4H7DA 4JVNA 3QXJA 4WK0B 2H4JA 1P9RA 1SUBA 5CM2Z 1Y98A 4DMCA 1L5VA 2JATA 3ZG6A 1G59A 1IBKB 4POOA 2VP9A 3LGXA 3MK31 3H0KA 1YJAA 4L4ZA 3ADOA 3WNQA 3WOVA 4PSCA 2DC1A 4B3XA 5G3ZA 4GWLA 4LKRA 1B00A 4OSEA 1Y1PA 4RPCA 3GFSA 3AKDA 5DCUA 2VAVA 1CQZA 4C3UA 4YC7A 3ILSA 4ZK6A 4LMRA 4NYMR 2NU9B 1PE0A 2P2LA 3U3DA 4KIFA 1QYXA 2DQYA 3LVRE 2Q45A 3K1AA 2ZLBA 3KLBA 5I7OA 4HNQA 4JB8A 3O2JA 4FZJA 2HLDA 1EQAA 2H7CA 4KGZA 1J7JA 5CUQA 5DTRA 5FOWA 3V7FA 3E0QA 4D74A 2ZS8A 3M9LA 1LDGA 2B1JA 1Y8RB 4G0MA 3NQ41 2R68A 3VPAA 1KVRA 5CX1A 3CMCO 2J9YB 2DKOA 3DQQA 2H2GA 4D3YA 5LWHA 4YR9A 1IVYA 4TXJA 3DFUA 4CXMA 5DM1A 1IHOA 2IEYA 2Y76A 3C39A 4ZJYA 3TFOA 4P35A 4RGQA 2ZBQA 4B7UA 3UG7A 2I9KA 4HYQA 1PBTA 1BD4A 2IV2X 2CE2X 1R10A 2X0JA 1WS6A 4XSVA 4ZVQA 1MQAA 4P5DA 1TE2A 1WMAA 2JIBA 3DE4X 1DKMA 4NZOA 4TQGA 4HSEA 1GNPA 4WBNF 1TYBE 4EF6A 2WLSA 3MILA 4TTTS 1DXQA 2C0CA 4P7FA 1RXVA 4P34A 1QJCA 1ESDA 2GZHA 1DAMA 2JFBA 3RJZA 1NE2A 1Z47A 1V8BA 5FTWA 2EX0A 5ARBA 3F74A 3B7PA 5AI6A 3TKYA 1H66A 2PRYA 1TD1A 4GZLA 3ZZ1A 3IPXA 1ESCA 4HQKA 1KYZA 1LI7A 2AUTA 1FX0B 2VQ6A 2ZJ3A 3A4LA 1DFHA 1WU7A 1OFHA 2C4VA 2ZJ2A 3R3WA 4UATA 4BQPA 3OX4A 4BUJA 2F8SA 1BVHA 1C30A 3ADKA 1IOWA 3C5EA 4IS3A 5HX7A 1Z6PA 2I6TA 3OHMA 4FWBA 1QB7A 2GCOA 3LUHA 3OVMA 4UDXX 5KDDA 3P0RA 2PUEA 3O9MA 2JHCA 5JAPA 3CZRA 4FDMA 1EE2A 4M1TA 4AZ3A 4EPRA 4FGLA 3T34A 1EXWA 1GEEA 1H2BA 1CEXA 4BTVA 3C3JA 1LLQA 1M2FA 2WLTA 3OIVA 4C07A 3H2GA 1K27A 1OLXA 2HLNA 3VTKA 1U2DA 1FDUA 3SHQA 1QR6A 2V7XA 5EUBA 3OX1A 1A7KA 3GDOA 3IO5A 4I19A 1WEKA 2CL0X 3LUPA 3D4LA 3V6MA 3CT6A 1MDFA 1P72A 2EG9A 1PK9A 4HO1X 4K0RA 4RE5A 4O3FA 1M3SA 5CCDA 3WBJA 2IEZA 4S0XA 3CMMA 5JD4A 2HCFA 4AQYB 1GADO 1MVNA 2C2HA 2EFDB 1P29A 3BGWA 3BXXA 4M76B 4AZTA 2VA9A 3SHTA 1IK6A 2BMJA 1AKEA 2IUEA 2J9ZB 3KUUA 5DGTA 3R76A 2Z3VA 4ZEMA 2JI9A 2FN8A 2PXHA 4CDRA 1EESA 4LF9B 4AC9A 5BR8B 1JDUA 4LBWA 2OXCA 4XYMA 2XJ9A 1P1HA 4XASA 2DFLA 4D3FA 2II6A 2NZYA 1B8OA 3MM4A 5T4EA 3NVKI 4M37A 1FVOA 1V47A 2AFIB 2Q3DA 3FHJA 4TV9A 1RKVA 4XIJA 5CMLA 5A4JA 3PHHA 1M2JA 4QGAA 2QTGA 5EMHA 1IG0A 5ALTA 3URKA 2FN4A 2Q5LA 4DCOA 4EZEA 1W47A 1NN1A 3A8TA 4JZKA 3DO6A 2WE7A 3PFKA 2Z8ZA 3C7CB 3LCUA 1T0BA 3SQXA 3KFVA 4B1FA 2O8NA 5FBLB 3ZDZB 1JVNA 1C0PA 4EZIA 1A9SA 4XDHA 2GF2A 1G60A 3UJAA 4LVUA 2CZCA 2YJ5A 3CJTA 4C0KA 3WRYC 5CHEA 3OTIA 1TTQB 5AP9A 2QPOA 3EC2A 4ZT5A 4QLOA 3QF7A 1H8EA 2H2FA 2I1VB 3L06A 1ZCJA 4Q82A 4U2DA 3TSCA 2Q5OA 1WNFA 1U9IC 3AIKA 3JVDA 4TS1A 3USES 4AS2A 1Q0LA 4NJMA 3U3KA 5AVZA 2X0FA 4YRAA 4ZQCB 3O8OB 3OTHA 3SBXA 2EP8A 4KSYA 3PSAA 2A33A 3NMUF 1O5OA 3MWDB 3SBEA 3WJAA 2BKXA 1XQWA 4CDGA 3BERA 3KXDA 2FETA 3NDRA 2DEUA 2JBAB 3A1EA 1MV5A 4ANFA 3HJBA 4WI1A 3TMAA 4TT8A 1NV9A 4GI1A 2JKVA 1CC1S 1ZG3A 3K53A 4UUQA 1U11A 4A9AA 4FU0A 5AICA 5J23A 4RM3A 3FCAA 5JFGA 2QVBA 4P4TA 1QFSA 1KVUA 5F7JA 2GPBA 4EL5A 1IN1A 1IG3A 2VHVA 4IOKA 1XB2A 1NHGA 1NVFA 2DH6A 1UMBA 3DEZA 3LLMA 1XVAA 4HVTA 1NRIA 2QQ5A 3TSYA 2O8DA 1PG5A 3NDIA 1NV8A 2XVMA 3T5TA 4FLEA 4JIGA 1M2NA 2W71A 1Z08A 1ACMA 3E9CA 4RVSA 5K4AA 5J4YA 1JJAA 1EGHA 1A2OA 2W2NA 4KE8A 5FI0B 1LVUA 2GD6A 3D64A 3E70C 5FUQA 2QI9F 5JNRA 1WV0A 2NV6A 3DWGA 3OQIA 1OZ0A 4TKVB 4ZQFA 1DC3A 1AGRA 1KJIA 2OD7A 4UMFA 3PNMA 4PZLA 3KX2A 2CHVA 3LRPA 5EE0A 1YZLA 5BSTA 3VO9A 1V9LA 5IUJC 4YASA 1KY4A 5JLAA 2MU1A 1PZHA 2BFWA 2W5UA 2WD7A 4D3SA 2W6NA 3RTEA 4Q4DA 2Q49A 1XK7A 4GM4A 1QO7A 1W2GA 3PNBA 5B55A 5JMWA 4YJ3B 3AL3A 2E5LB 2I6SA 3N86A 4B74A 4J16A 1IHPA 1Q77A 2MSCB 4KQCA 1TLLA 1I24A 1U7UA 1U0FA 2WUVA 3H3JA 4O8ZA 5C46F 5GM2A 1ZY2A 2XUIA 4YMSA 3RVRA 1GSIA 3EOAI 3GIWA 1JMKC 1LJUA 2VDUE 2A7XA 4G0YA 4GM0A 4TX1A 4EB6B 2JHGA 5JEEA 3O2SB 4L28A 5KYGA 5DH9A 1M2KA 2XUDA 3ANNA 3E61A 5ALVA 1E7QA 2BTQB 4B75A 1GTL1 3A9SA 1QCDA 3D54D 4AMUA 4WKGA 3TX2A 2FVXA 2AFIE 2DFTA 2HJRA 2QMUA 2LIPA 3IEXA 1P61B 4YFVA 3EGDB 4ZYXA 1EBFA 1SCBA 2PKYX 3B12A 2YFYA 4X1IA 1FMJA 2WMOB 3EEIA 3HKBA 4LJ8A 2GA9A 4OHKA 3DW3X 1Q2XA 5M29A 3O1IC 3C5WP 5U1PA 3PC7A 5T6MA 4LJAA 5EGSA 3QWFA 3BB1A 4B8ZA 1DIGA 2XUHA 2XMPA 4OAPA 1ADJA 5EXTA 1O6FA 1SZPA 1I80A 1IEVA 3O4JA 4EF4A 1LA2A 2HTEA 1HZZA 3SF8A 1K06A 2PBRA 3SZOA 5A04A 2ZBPA 1TPZA 1FTWA 4Z1MA 5CIWA 3SJ7A 3BVPA 2IYSA 3G2LA 3K5IA 4G0UA 4BS9A 1QTQA 1MC5A 1IEXA 1Z62A 3C8UA 4LYJA 3IT3A 2OCKA 1F4PA 4HC4A 5CVUA 4D96A 1U1FA 1QFXA 2XMSA 2VPWA 4WDRA 3SKYA 4PAOA 3WLAA 5ED4A 1PL6A 5JXHA 5HE9A 5FPKA 2PSJA 3MSXA 4P93A 2UV8A 4RLQA 5LNK6 4LHYA 5T67A 2QZSA 3BMNB 5GADl 1Z29A 2HW8A 3TF5A 3T8YA 1Y4AE 2W6ID 4O4IA 3ESRA 4L3OA 1FFAA 3R9WA 3IAHA 2RBKA 2WTAA 3EISA 1QLWA 1CLUA 1C3EA 1VP3A 2JZCA 4RY2A 1E2EA 4ZIRB 3A58B 2ABWA 2V6IA 1JB9A 1GZ7A 1YDMA 2Y1LA 4FYHA 4EMSA 3DMFA 2RIPA 1NKTA 2IELA 1NJ5A 4P3YA 1Q22A 1WD7A 3OE1A 4MYSA 4PSAA 1HFWA 5B4VA 1KMIY 4TXLA 1CJCA 4DCMA 1PG0A 1RRPA 1TM3E 2ECPA 2L82A 2OHIA 2VJMA 2Y92A 4GZ3A 4NS4A 3TLBA 4YYZA 2R97A 4U2GA 5LKRA 4W9NA 2X1HA 3BKXA 4DWJA 1J1UA 2QXUA 2PYZA 5C32A 1TUBA 3ZU4A 4FD3A 4ZCSA 2P62A 3NANA 5AK6A 3U2QA 3R5TA 3M82A 3WLQA 4ZXFA 3QWBA 4EY7A 5IDQA 3C15C 1JFRA 2NOAA 1CF4A 1Q0UA 3PBKA 1DBSA 2QTLA 1MNAA 5CCBA 4WGFA 3NHJA 2WJ4A 4UFOA 1QAOA 2F1RA 1ZFNA 3OA2A 2C9OA 2GF0A 4KJXA 4U39A 3DKKA 5DLQC 4CEHB 2I55A 3JYOA 3NP9A 4JUIA 1PS0A 4S2UA 4CF6A 3HB4X 3QK7A 4KVAA 1LNZA 2B1IA 3OUUA 4LC0A 1DSSG 4KBYA 1ML3A 2C2OA 1DAEA 2I2DA 1YACA 3AILA 3EZFA 4S1OA 4DSZA 3MRVA 4HUTA 1TMYA 5C5DA 5JCPA 3MYRA 3Q7QA 3ADPA 4ITVA 4OYYA 1ZAYA 1TKRA 2C5EA 2DQSA 2NG1A 2OYRA 3S2EA 5JXIA 4GL2A 1Z4PX 2X0RA 5D7BA 2AFVA 2ZJOA 3FSRA 1W4LA 3MJFA 1K9VF 2NU8A 1LTKA 3FCUB 4GP9A 4K3UA 5K6RA 2FMIA 1T1SA 1ZZGA 2OV6A 1GDHA 4LVOA 3GA5A 5AK5A 4E6EA 4BMCA 4PR0A 2QMQA 4RTOA 1Q3KA 4F4FA 1D0SA 2QTVB 3EDYA 4YUWA 1Z4IA 2DQZA 2GXUA 4V1CI 2XKAA 1OY1A 1DKRA 2M9MA 3P20A 4TVBA 3ASVA 3T6KA 1N3IA 4YJ3F 3K30A 4OLAA 1RXUA 3O8CA 1U5BB 5K8VA 2WMYA 3A10A 5LQDA 1QIIA 1L5MA 4B3JA 3PNLA 3GLIB 3F8TA 3K32A 3VR6H 2H1OA 1DXHA 5JCJA 5JARA 2H0AA 3WKAA 2JCBA 4QYMA 4W5QA 2GEDA 2G36A 1E18A 3SMVA 5IX8A 2J7PD 1CUSA 2J33A 2J7PA 4K1LA 2PS9A 1E1DA 1GZDA 3Q6NA 3TRHA 1Z35A 1ZNYA 2NTJA 3FTNA 2YQ5A 4GPBA 4HS9A 4L15A 3F0TA 2WZBA 1SWVA 2LDBA 3FPBA 3QVSA 2W6JD 4KXWA 5E38A 5EEHA 5B1DA 3U4CA 2L17A 3JPYA 4FIZA 3L6DA 5KYUA 1VHJA 3RBVA 3G1WA 4B9EA 4EBBA 6LDHA 3F96A 2Z57A 1MFPA 4AP9A 1DBQA 1D7AA 1H2FA 2AG6A 4FMCB 4REOA 1F0NA 2BJVA 3FKSA 4RPKA 1XLWA 4YFYA 4C29A 2XNSA 1NG9A 4PXYA 4CV0A 2QBYA 1ZMOA 4QQKA 2FPGA 4I66A 4EVSA 5JANA 2ZJ0A 5CVJA 3EGXB 1R5NA 4TOIA 3O7WA 3V46A 3MJHA 2W6QA 3NGMA 5JNWA 5ILOA 1A8UA 3P2JA 4RQTA 3ZK7A 3LVFO 1FZQA 5ITZA 5I7SA 1IE3A 4GVLA 3STTA 1UBMS 5ADUS 4H2DA 2AN9A 2YIMA 1LRKA 2QRJA 4NVRA 1LBTA 4AY6A 4IRMA 5KQGA 3LBHA 4ILKA 5GJCA 1CWUA 2BGIA 4QX6A 4RD3A 5JPCA 2GCPA 3IV7A 2IRWA 4EI8A 4HDSA 1R12A 5AK4A 2GUWA 3BX1A 1ZOLA 2BM1A 5THKA 1TTPB 4MV8A 3IALA 1SG9A 2VHEA 3WYDA 2YBEA 3DFFA 4Z4GA 4R2JA 3OSUA 4YB8A 4MKZA 5G2OA 4QBGB 2CLDX 3DCJA 4RLSA 1WRBA 1FPMA 2TMDA 4O2RA 1DS6A 1ZRNA 2IE8A 3L8FA 5E0OA 3UEOA 4WXPA 4CMGA 1H23A 2C07A 8LDHA 3O8QA 1C3XA 5K1ZA 4YAOA 3NATA 1U8FO 1UBRS 4HLDA 1U7WA 3E7PA 3G0CA 4IDCA 4ZOEA 4EEXA 5JJBA 3IAXA 3QMMA 4MVJH 4NYJQ 1RFLA 4MRMB 5NLLA 3ZDEA 3L7YA 5FLKA 3R0XA 1FUIA 4B4VA 2R1UA 1ZSNA 2JFGA 2PFGA 2B4AA 2C4MA 5REQA 4F4HA 1BS9A 4C14A 1I94B 2CJFA 2QVCA 3I9MA 4GOKA 4KPGA 5FAXA 1GYRA 2BEKA 2DHDA 3BJMA 3WLTA 5B7PA 2W2TA 3P26A 1FUKA 1PR3A 2R25B 3FPCA 3SIRA 2PTGA 1NBOA 1OQAA 4CJXA 2FKAA 1N4AA 5KO2A 4IIUA 1AQ6A 5IAKA 1XZIA 4DEYA 1SNYA 4C4OA 4J91A 1UBCA 4RIGA 4KN8A 4LQCA 5ULLA 4DOMA 1CUWA 2GBCA 3ZJUA 3AEKB 1FJ2A 1ZN2A 5EMLA 3GLIE 1N57A 2PQ6A 4V0NA 1H0RA 1YQ9A 3V3TA 1KSJA 1NVMB 3Q10A 1JHYA 3MGBA 2G6TA 4N7RA 3EDCA 1HE4A 1RAIA 2HH9A 1GPH1 5SY4A 1KI1A 1RQNA 1WUJS 1C0IA 4HB3A 2FJ0A 4OL0A 4CHGA 4LDZA 2IE0A 4XLLA 1UFKA 1L5KA 5TLSA 1EB8A 1UDCA 1NASA 3GNLA 3CRZA 2GF9A 3MT7A 4MLCA 4DJEC 1ZHFA 2ZI4A 4DLVA 4ZVMA 1W59A 1T5SA 1OLUB 3F78A 2HMYB 1X74A 3JW8A 4IRUB 3ZW8A 1WXXA 5CM9C 4CVNA 1SELA 3FAZA 2BH2A 4D26A 2OFOA 1ZMRA 3FJ1A 2J0UB 4BDTA 3DYIA 1Z4QA 2VIIA 4DGSA 4DCUA 3RBXA 1T6BY 1WHSA 1MENA 3AO0B 4HL6A 1JQLB 2GA8A 1KXJA 5DHUA 3SX0A 3AF1A 1U8TA 5TB5A 4ZGGA 1EFTA 1Q84A 2X9GA 3N3AC 1GQFA 2PHZA 3LM8A 4OHMA 2AW5A 4XWOA 2ECFA 3P0JA 3OX2A 1WBBA 3FPSA 3DPUA 4CL3A 2HPAA 2YN0A 3GYBA 3MRSA 4XCXA 3WMGA 4BZWA 1E9DA 2D06A 1HLGA 1RAEA 2CNWD 2D7CA 3CLUD 2WIJA 3ENWA 3IAM6 3ORFA 3MGAA 1AA9A 4L8WB 5JALA 3GK3A 3E6AA 5C8YB 3KOXA 1N3YA 2QRNA 2TRSB 2AUMA 5E1MA 2VDRB 3L92A 5AW3A 5AQ1A 1RYMA 4HAUA 2XUKA 3ZY2A 2HX1A 3TVDA 4JAVC 4FMCF 1K2WA 3W8EA 1HNNA 4P3KA 1KORA 3FWKA 3MUEA 1AE1A 2A92A 1OX4B 4BE9A 2NU6B 2IHNA 3JZFA 1KO4A 2GEFA 1R9MA 4G1CA 4JJFA 1UAYA 3J80A 2JI4A 3Q9UA 4IMRA 3U4DA 4LJ9A 5H02A 3H5RA 3DNMA 3FHOA 4JL5A 5FTNA 4YCMA 2WUFA 3O83A 3BUSA 4M9XA 4JOSA 4AUNA 2HYIC 4ZT2A 3I4LA 2BEWB 3CH4B 1WPXA 4ZRNA 2DY1A 1KIMA 1ICIA 3L9WA 4NYIR 2LRHA 1XKQA 1ZH2A 3E03A 3H11A 4OLHA 9ABPA 1C7EA 3I92A 3R6TA 4M0DA 1ZIXA 1H2ZA 4MS1A 3ZWOA 3CUWA 1RQGA 5DYIA 4HYEA 1QE5A 3DDUA 1RKBA 1WV1A 3KEQA 5F9HA 5ER6A 1WY5A 3RU3A 5HKKA 1WW2A 2QQ0A 2B4KA 5E2BA 1GKIA 2H8KA 1I30A 5EZSA 3SEFA 4YCBA 4M98A 3Q9LA 4UXJA 1D09A 1MTZA 4BLOA 4Q6WA 4DV3B 1UQTA 2ID9A 4YMWA 5HCIA 4MKGA 4C2TA 1VSQA 2GFIA 3M4YA 1GT91 1QRRA 4Q47A 4MLZA 4C0XA 1KKUA 3F71A 2FB9A 3RAFC 2IZ7A 4ALIA 1WBJB 3AVXA 3DHYA 1GRCA 3JQ6A 5JWHA 5BYBA 3ZVKA 1CEYA 3VC3A 4RMGA 4X84A 3UXYA 1C9KA 1UT5A 1HGXA 1RWWA 2H6EA 4JT4A 4XOUA 5IH7A 4GGPA 4G1BA 1BCRB 4LJ6A 2Y0PA 3S7ZA 1C2TA 1KNQA 3I3SR 3KQPA 1T2CA 2X3FA 4KNVA 1CSEE 3N2LA 4G65A 5D3KA 3ROPA 3VI4B 4B6FA 3U7GA 3U4MA 1X94A 1A9TA 4UQLA 1FUYB 3SYKA 3UJ3X 3PWTA 1N0IA 4Y1RB 2Z3ZA 2AF4C 3I45A 4MUEA 4NSNA 1M6NA 3DDOA 4YALA 5CLJA 1LU9A 3W2TA 3C4VA 4KVZA 1JKJA 1JDPA 1V16A 1ECGA 3K9CA 1T2FA 2TYSB 2AC2A 2O8EB 1U7XA 4XYBA 1N2SA 2DCMA 1NLZA 4J7AA 2ZG6A 1KSFX 1EX7A 3PX2A 5LCXA 3JATB 3S70A 3CB2A 3EYWA 4NV3A 4C21A 1JJVA 4H31A 1WZNA 4QTYA 2WG0A 1E61A 4FFOA 1XCJA 5T3YA 4PGAA 2RARA 4DCJA 1AT1A 2FGJA 5K7SA 1ZM7A 4IZHA 4RAOA 5DEOA 5I5GA 4OJQA 5CDSA 5CDFA 3OCZA 5DM2A 5EHQA 4CYMA 3OQVA 2GEJA 2O8FB 1FRQA 3I6MA 4MXDA 5ALGA 2RHRA 3B8EA 3LG2A 3UH0A 3GNQA 2A9PA 1D6NA 2NT3A 3FYUB 1IQPA 2HQOA 3N76A 1NL3A 1P2UA 2BKLA 2AMJA 3GAFA 4D4MA 1YQWA 1L4GA 3MXTA 2P90A 4HYTA 1YE3A 1EXMA 1M72A 1N7IA 4N6OA 1U1CA 5GZ6A 2A57A 2WWTA 4G1FA 3SZGA 4QT0A 1W0JA 3RFUA 3T12A 4M38A 4HBGA 2HA5A 4MV4A 3K20A 4TTSA 4TXHA 1XGKA 1PVDA 1KEWA 4HNSA 3BEOA 4FHDA 4YMHA 3CUYA 2G0NA 5D1HA 2FK8A 1EP2B 1X7WB 1DJNA 3G5TA 1GPLA 1Z8DA 2Z2YA 4I4TA 2O8CB 3INGA 5BMVB 4FQ5A 3AF5A 3E9RA 4ZAXA 3B6MA 3ILXA 4QU0A 1CZLA 1QKKA 3PXUA 2WM9B 4PS0A 4PLFA 4LNHA 2ADFA 4N39A 2COEA 3TLZA 3W04A 1X7YA 3DKVA 4LYHA 3RSQA 3URMA 4YRLA 5KOJA 1SIBE 2WJGA 4WDQA 4O1MA 1QK3A 5C8YF 2QHXA 3N2ZB 2CL5A 1AXRA 3MW8A 3ZU6A 2EQ5A 3ST7A 3CISA 1TTTA 4AJNA 3CKMA 4ZDWA 1F12A 4RCVA 3ZEIA 2O8BA 5AKZA 4F8EA 3AEUB 4Q1VA 5BUZA 2IHBA 1FYVA 2C3OA 2QP4A 2BL4A 2MSLA 3LX6A 4YH1A 4GMXA 2XY4A 3RVLA 4N5DA 4QPCA 3CU5A 4YWJA 1RXEA 3UMRA 3Q3VA 3FPKA 3W4KA 4JLKA 5ALWA 5AXCA 1JHXA 4QIHA 3RO7A 2LKDA 1B3BA 2I2BA 5JEDA 5DDIP 2GD0A 2EKLA 2JAOA 2NVUA 2FRXA 4JC4A 4OF4A 1R0LA 2YWHA 1BC5A 1U3UA 2D1TA 2VJNA 5C53B 3DEJA 3EZ7A 3LCCA 2G4CA 2FMHA 1F5NA 2OHGA 2MSWA 4QPZA 4AS1A 3N1UA 4NOLA 1KZHA 3NAQA 4ER0A 4FN5A 1B73A 1KI4A 1AXEA 2L0XA 4F72A 5JZMA 3PE4A 4JSYA 4RO0A 1GZ3A 2CKDA 2RDMA 4HXYA 1FNCA 2D1YA 3JQ8A 2Z5LA 4M21A 2GN4A 4MKRA 4NU8X 5AYVA 2H11A 1WP9A 4J4BA 1DOHA 2FG6C 1JRLA 5GPBA 1LPMA 3H2HA 3DM5A 1KJ8A 1GWNA 2EW1A 2G80A 2NN3C 3RIHA 3VSAA 4JQSA 3KQHA 1AZWA 3REQB 4JUCA 3M0EA 2ZYIA 4HYYA 5KTPA 1Z7WA 5CTJA 5LQRA 2H48A 4L5JA 4X95A 4BLPA 1G5FA 2NSHA 3QLVC 4MV6A 4KZPA 4TWRA 1ISIA 2ZUCA 4RXTA 2JHFA 4YCCA 5GGXA 3NG1A 2PUGA 4D9FA 3FA2A 2HM7A 1U7ZA 2DQ4A 2QGZA 3GGDA 4PSUA 1JSLA 4MA0A 2FQQA 3B51X 2GLUA 2HDHA 4DQ0A 1U81A 1VB5A 1OAOC 2E1RA 2P2SA 3JYNA 2DY0A 4L07A 1Z12A 4I3GA 4AQDA 3PUJA 3TZHA 1N9KA 5CXSA 2AC4A 5FUMA 2P3OA 4GVXA 3W1VA 2QUHA 3R24A 4KV9A 3QXCA 4G5RA 3B6ZA 3ZWPA 1Z5WA 3VVBA 2P6MA 2R44A 5EZ5A 1IBCA 1CUVA 3GPCA 1IUOA 3FLMA 1JHOA 1DJPA 4D2IA 1B0AA 2AT1A 4IJUA 1JBEA 4ISBA 2IYOA 5BW8A 3KKPA 4M0CA 2XHZA 4LCJA 1E79A 3EA0A 5CYOA 1YDWA 4V0QA 4PLGA 3LYHA 4ER5A 3HDGA 5TT0A 2NSDA 2WJZB 4GX1A 4OGWA 3S2ZA 4ZDIA 2B6NA 3SOZA 4IWNA 3I64A 2DPHA 5BVGA 3P27A 1GZVA 1KXZA 4RMNA 4FZ5A 4K2AA 1W35A 1XTSA 1GUFA 4J9VA 4DBLE 1R0WA 3C7DB 3F97A 3T1VA 2Z8XA 5AKKA 4LE1A 2GCGA 5D84A 5JUWA 1NT2A 3KPWA 4IGFA 5AW5A 3SJZA 2W22A 4DAEA 4LZAA 4B5KA 2F64A 2QTZA 1UJMA 3Q12A 1AB5A 2CMFA 2HEIA 3DEKA 4R8MA 4HN9A 4YCSA 1L3IA 4AJJA 2B4YA 2ZJFA 5AVUA 5F7ZA 2J5KA 1FTSA 2WWYA 5IJ9A 3IVMA 4JBHA 1VE5A 3KJGA 3LBAA 2ZPTX 4RJ2A 4F6LA 2VHJA 3NNDA 2XH8A 3QV2A 2A9OA 2Y0BA 3DDSA 3PHCA 4J0IA 2DHQA 4ZOLA 4ZVUA 5AJXA 1JX6A 3T5GA 5AOVA 5AW0A 4J94A 1XT6A 4Y2VA 1EVIA 3C6KA 5BMVF 5JI3E 2DHEA 1VE9A 4H4DA 1TIBA 5HRUA 2VT7A 1JLLB 3IMGA 3NTLA 3E9NA 3QPUA 4H08A 3UBTA 5LD2B 2DUNA 3MTIA 5EJMA 3OM8A 5DLPA 1BU5A 3D81A 1UWCA 1FJHA 3ECCA 1L3CA 3PWKA 1RI5A 4CDNA 4DM4A 4GR4A 3CHYA 2MSDB 2N46A 3OJLA 2UZIR 3EVAA 2XCTB 1H2AS 4PQRA 3WKDA 3PI6A 1F8GA 3J7TA 4ZYYA 4GBED 3OESA 3V48A 1LVHA 2WICA 1OGYA 4CL8A 4DLSA 3A4NA 5EMJA 1OI4A 2WBLC 3MGKA 1A97A 2QM0A 4IQFA 3KOWA 1U28C 3P32A 3C48A 3TUJC 1U4OA 1U9IA 1NBAA 1XZFA 3QENA 4KMMA 1IMOA 3UT6A 1L8OA 3P45A 1YFJA 4IMIB 3UWMA 2XZDA 3LT2A 1CY1A 2X14A 2P0YA 1STOA 3ZWBA 5KSYA 1X77A 4N54A 5FWNA 3Q3GE 3ZDAA 2QTCA 4LGMA 4MW2A 5G41A 5SY9A 4ZYUA 4X90A 1ZD4A 2RK3A 3S2GA 1X19A 2P69A 2FRDC 3QGMA 2ZSDA 4UM9D 4R51A 4GPD1 2K7ZA 4BOYA 3CPEA 3JTEA 3BFVA 3RVBA 3S2FA 2QL9A 3AYXB 4C4YA 2AOVA 4JENA 4ZT6A 4WLOA 2ZZNA 4DNFA 2PY6A 4AMBA 3V4FA 1IIBA 4MR8B 4K6GA 4JP3A 1W19A 4YIKA 2VBGA 1O9HA 2CCJA 2ZBUA 1B26A 1P44A 2JGNA 2VZEA 4MGIR 4P9NA 5DX0A 5J5VA 3NEPX 3KXLA 3JRXA 4DR5B 2HXGA 2RGEA 1GVNB 1PX0A 2BDTA 2NSJA 2LCFA 1UKYA 4FHGA 4HQ6A 4R3UC 4UE3S 2D5AA 2XTJA 3HSSA 4J2OA 4TS9A 3UWSA 5IT5A 1JQBA 1OSNA 1ZW6A 1H6AA 3M6AA 4UTOA 4ZO9A 1X86B 1QTRA 2DFDA 4OH1A 5I3CA 4L0CA 1U5CA 3KT3A 4QHSA 2O05A 5TQVA 3O91A 4EKNB 2ODAA 2W00A 1Q7TA 3ZTTA 4BQIA 3H5AA 5K6AC 1KQFA 1SKBA 4L2IB 1OLSA 3FZEA 4OIMA 3EXEA 4MYTA 3THWB 3ZD8A 4E07A 2BGMA 2M6SA 2ZJAA 3K6JA 3RS4A 5B58T 1WIWA 1K3UB 1FLAA 1LI4A 1H9AA 2HSDA 1A9RA 2OHFA 3E81A 4JLUA 2C8KA 4UVIA 2M1XA 4MTCA 2OMKA 4BASA 4KWHA 1DCTA 2P5YA 1I4LD 2Y2VA 1QRSA 1EDBA 1JMVA 1G8MA 5BO5A 2IOFA 1UEIA 1XWIA 3DTNA 2P65A 2ROQA 1PJSA 2GJ9A 3H1EA 2Q4RA 1UR5A 2CLOB 1RJ9B 2ZJ8A 4KRGA 2ZTUA 4MQBA 3TQCA 4YQFA 5KWVA 1PBNA 1R74A 4UHJA 3T0FA 1KMNA 1JJFA 1T6YA 3GLRA 1Q7CA 4QD3A 4RQUA 2VL7A 2A0FA 1F2UA 1RLMA 3U39A 3V9PA 3TQTA 1PJQA 3QTTA 4MVJP 2LZ0A 5LFAA 4EW6A 1XTUA 2A7QA 2EIHA 2B8TA 1PT6A 4GPIB 5LYJA 1CUGA 1TLTA 3QOYA 3P71T 3W9BA 1V6CA 4MO2A 4ROTA 4EMBA 3FVQA 4E3WA 5IEJA 2WF5A 4WY8A 2BBSA 2IWHA 2YR0A 4TS4A 3IBTA 2I2FA 2Z58A 2R6ZA 2GPAA 1UMCA 2X3YA 4D5GA 4UTRA 4NBKA 3QKIA 4BX2A 4DXAA 2WT4A 2YFHA 1Z0IA 2GM9A 4DHEA 4MOWA 4ZQHA 4JBXA 4MVJI 4DMUB 1QPZA 4QBHA 3F9IA 2HV8A 3ZU3A 3P0IA 1DBWA 1NBWB 1OLOA 4R2LA 3S68A 4HAWA 2Q4DA 5EIHA 2HDOA 3GH3A 2EEPA 1QRTA 5IJZA 1HLFA 5C18A 3U48A 5HA5A 1WTCA 2VF7A 4W1PA 5G0TA 5FB3A 4F8JA 5AI4A 5T6BA 4A91A 5IVKA 4ZEOA 4IZ6A 3GJZA 5C1BA 2P78A 3IAEA 3R23A 4UNPA 1RMYA 3AW8A 3G89A 4S35A 1L4EA 5AOBA 2G72A 4XUCA 3I9OA 5A6SB 2GDZA 4QLBA 2IPXA 3DD1A 3KTFA 4ZHSA 1F06A 2BFDB 3LA8A 1JLKA 2C97A 4DIEA 5ELMA 3K9LA 4H3KB 1X1EA 2JJQA 3FOBA 4F5ZA 1WVIA 1SHJA 4ZFNA 3C70A 3PCXA 4L78A 4DE5A 2V55B 3HSYA 4KWCA 2IDKA 5DB4A 4YRNA 4PPNA 3H13A 3FH0A 3QEMA 4PO3X 3I6YA 3KU4A 5DW3A 2ZYDA 1I4EB 3I1IA 2GD1O 2RGUA 4CM7A 4Q9AA 3KZKA 3OT1B 4FI3C 1MOPA 3V1NA 2O2SA 1JZSA 1YL5A 4WCFB 2WHRA 5C3UA 4AJKA 2JFHA 1BCSB 2A3RA 4M53A 2FQWA 2JJMA 2AJ8A 3RU2A 1UKCA 3IDOA 4J6EA 2AGVA 3MMSA 3GVIA 4DREA 1B6TA 2GBFA 2PJZA 4X00A 4M8KA 3RBZA 1OI3A 1C3LA 4FFDA 1ADCA 2XADA 5DOZA 4ERXA 1FIUA 1VL0A 3DEHA 1M6YA 3JQFC 4IHQA 3SZ3A 3RS8A 3AONB 3GLSA 2J7KA 3NYWA 3BFXA 5EIXA 2BI7A 1JJ7A 2GYWA 1TDJA 5HR5A 3B6IA 5IBCA 4MA4A 1SKYE 4LSWA 4GYKA 4IIHA 4UTPA 4X24A 1V71A 3IOBA 3VFDA 1O6GA 2VOJA 4H16A 1GCOA 2ZWMA 2ISSD 1TQ4A 1E9BA 4MLPA 1DX9A 2VQFB 3LJKA 1YVRA 1PYOA 5GMOA 2B1QA 2C0QA 1ODTC 3HA2A 1M1YA 1Z37A 3O95A 2BDEA 3DDZX 4RWEA 5TGDA 1KQOA 4KP7A 1VJ5A 2AG5A 3K05A 1WUYA 5CNJA 2XI4A 2GBLC 4BX9A 5EJ8A 5JO9A 5T4BA 3I32A 1T3ZA 3E82A 2X2PA 4N48A 4MWGA 1XD8A 2EZ9A 2TMGA 3AB8A 4CG0A 2QX6A 3M1IA 1RKXA 3C24A 4JKYA 3TUZC 3R7NA 4B7ZA 2FUCA 4K7JA 4CM3A 1XXLA 2XTAA 1EDDA 1EFPB 2ZJ4A 3TKAA 3KTAB 1NXTA 3T3IA 3ZLVA 1WOYA 3IDZA 3MPOA 3S1SA 3ESYA 3ML1A 3P2YA 3PS9A 1DXOA 4R6WA 1J33A 3KKQA 1L4HA 2ZT5A 4ND8B 4EHFA 3PC8A 1HRDA 1JLHA 1MAWA 3ESQA 3F1KA 3CLKA 4DV1B 3GRCA 1D7OA 2ZAMA 3PNKA 2BEVA 4UDNA 3V42A 1E0JA 1GSOA 4DJAA 5KNLA 3THYA 3TR0A 4PYOA 3M6LA 3HHPA 4LMBA 3VVLA 2YXNA 5IWAB 3I28A 4ZTBA 1X7XA 2CDAA 3F5MA 2QRZA 3LQQA 4IXTA 5EJAA 1SURA 3SYLA 1XHEA 2B99A 3A6JA 4WVLA 3D2CA 1SIWA 2IXTA 2Q5EA 3IR7A 3KT8A 2OCGA 1VIDA 4PLWA 3BN3A 5CVVA 5FR2A 1G98A 2H1FA 2POQX 4YA6A 1OA1A 2FE1A 4HTFA 3AESB 4KFTA 4DAOA 4JV5B 3PLNA 3TTTA 3UBMA 2FPMA 4E51A 2VUSA 3ASZA 3IHKA 1DQRA 1RZRD 2ZI9A 4UMDA 4BP9A 3UUFA 2C5HA 3EX7C 3ZIAA 4PY2A 1H69A 4BMYA 1QYRA 3SXJA 1DEKA 3UF0A 4A2PA 1E92A 1X92A 1GDDA 2WOJA 3R5KA 1A88A 4F1JA 3E58A 3ZWVA 4X3OA 3P96A 5EJFA 2H9AA 3FCCA 3LT1A 5CDGA 1V4VA 4G41A 1GTRA 1BMFA 4R1LA 1AJEA 3NS7A 2A6PA 1B1AA 3KKEA 2BMWA 1XVLA 2PLNA 1KA9H 3HKDA 4KN9S 4M9QA 1RYNA 4WN9B 1UDWA 5TY0A 3W1EA 4EUKA 2OHJA 3AFNA 1NW8A 3NHKA 1N2CA 4U9UA 3WIOA 3AIMA 3RSSA 2YFQA 3HXKA 4DC1A 3GUZA 5FCDA 2AKYA 2DUMA 4FKBA 4ZGWA 5IDXA 3DSRA 3A1NA 3LUBA 1PWEA 2NTYC 2F17A 5EIOA 3IPCA 1TZCA 1T9ZA 3NHFA 5DI9A 5I7VA 5DK4A 1SC6A 1ETHA 3CA8A 4D0SA 1BXZA 3KNZA 1Z7EA 3AUUA 4PNPA 2OC9A 5AK3A 4KQFA 3UHOA 1CY2A 4CHTA 1DG9A 3G8BA 1CJVC 2REQA 2PO7A 1DEOA 1PNQA 4WN3A 4G6ZA 1QGUB 2C98A 2ZRAA 5ENZA 4BV3A 4CV1A 3AG5A 4DIFA 3RPEA 5KC9A 3T15A 4N01A 3WA7A 1IXYA 2QJTA 1MAUA 3HUUA 3HA5A 1DB3A 1FFSA 1QNLA 1NBEA 2BD0A 2IEGA 3HNPA 1BX0A 1SVSA 2PSEA 1ZC3A 4PLVA 1O94D 4EX6A 3S5JA 1O94A 3VPDA 5HF9A 1GPBA 4S3MA 1E5DA 3KD2A 1OAKA 4XEUA 4MR9A 4DNQA 1ZD5A 3VMMA 4BMSA 1TFRA 1OYWA 2WHPB 1ZQ9A 2BGNA 4R1UA 3L0PA 5FLXA 1SEVA 1U9ZA 1DC8A 1X7ZB 1X1CA 1SBIA 2QIPA 2ZB2A 4KR7A 1RRVA 1WW8A 1YZUA 4JL6A 1OTYA 5EEGA 3DZ8A 3RK1A 3CWQA 3CBGA 5AT1A 5J5AA 3SC2A 2VVTA 4HJXA 5BN5B 3W5DA 4D81A 3EY9A 3N2NA 3MQ2A 1PV1A 1NXXA 1QJ4A 3G17A 4G01B 4D0NA 5A6VA 4QPNA 2C54A 1D0VA 1FVFA 2FSUA 4OP3A 4WTOA 1KSHA 2XXBA 1E20A 1Z7BA 1HI9A 3LUJA 5ECYA 1WHTA 2H2HA 3RU7A 2Q28A 421PA 3HCDA 4AKHA 2NQ2C 5KB3A 3HACA 1E2MA 1DDGA 1SQSA 5AO9A 4HMOA 4AJEA 1KJ9A 5C31A 4FIDA 5IK2A 4NBLA 1MJNA 2BHRA 1EG7A 1W4BA 3L93A 5J59A 1NF2A 4ENUA 2GZ1A 5GONB 4C4SA 1E2QA 4JOCA 4PCAA 3OEHD 4XAQA 2OENG 1GPYA 3PQ4A 2FEXA 3NWJA 3O84A 3PKZA 4XFKA 4M9UA 5AVXA 4RA9A 2I6QA 1F8YA 3OPYI 2JA1A 3TLAA 1OPRA 2HLHA 4OQNA 5HS6A 3RC1A 4EO9A 5CT8A 5LNK1 2OG2A 3MYYA 1DAOA 1BEEA 2JD2A 3COPA 3N2GB 1KKMA 3FGZA 3QHPA 4M86A 3IP6A 3LX5A 2HNAA 1J39A 3J81k 2D3WA 1QIKA 4I3HA 5BN4A 5IVHA 1RXYA 1EWYA 1IY9A 1XD2A 2P2CA 4MVJE 3X2EA 2C9BA 1NP6A 2Z3WA 3ZH2A 4I50B 4I55F 4IDEA 4WKCA 2Y1XA 3KYCB 1KSGA 1GCIA 5E9JA 3AQ4A 1PO7A 2UUCB 3ICVA 1VKNA 4PW0A 4D4HA 5LZ9A 3KS9A 2YXLA 1NF3A 1D1SA 1LLDA 1W96A 3EEYA 3O3MB 3QRWA 4K6OA 4R2MA 3U17A 1U3GA 1ZZEA 2M6LA 3RFTA 3D9QX 2I67A 1H1TA 1MT3A 1SXIA 3PQ7A 4X8OA 3UC9A 1L0BA 3I53A 3LQFA 4YJHA 1KQGA 2DECA 3N0XA 1LK7A 1KP9A 1L6IA 1Y1LA 3Q8XB 4IIJF 3UAXA 2HJVA 2KLBA 3QJYA 4RZSA 1MG0A 1TM7E 2C59A 3DD5A 1KPGA 3G7UA 4GU5A 2UZ0A 4R8KA 4X85A 4C08A 4DMKA 1VGVA 4K28A 3VH4A 2G8LA 2AR0A 3LLCA 1E96A 2AJDA 3GRPA 4KQ9A 4PIMA 3SQOA 4RH1A 2JA2A 4P98A 3FWHA 2V97A 3F6BX 3GLFA 4JASB 4NXMB 1P19A 4DN6A 3HJCA 3KYDA 3U3XA 1P7WA 3KFLA 1NDHA 4CCYB 2HMWA 3G2NA 4QDOA 3TD2A 1TD9A 3RGWS 4G36A 3V8NA 3TG8A 1VIYA 3JQGA 3G79A 4H7IA 4WBSA 1EUDA 1PR0A 4R7GA 2FPSA 3VA7A 3DFIA 1N1GA 2N75A 4FFNA 1OKKA 1A8HA 4HNAB 3ZHOA 3KZOA 1PS9A 3SYMA 1GG9A 1D2NA 2CVQA 3ITEA 5DTJA 3F3YA 1V8FA 1NQAO 3V34A 4BFVA 1EFHA 1VG0B 1SFRA 3HLTA 4FCTA 2OXFA 3EPHA 1FSSA 3LPLA 3MTAA 5FYDA 4DLTA 1NXQA 4PGFA 4TKLA 1ORDA 2BAGA 1DBPA 2JIMA 5JPIA 5A5FA 2ZR9A 2VJLA 1GL3A 1NJ1A 1TM5E 4TWIA 3G7NA 5AOAA 1EFLA 4UD2A 1AN0A 1P5RA 4PZCA 2AA3A 3C3CA 2YC4C 3OD1A 3UUEA 5BSWA 4YAGA 3OZBA 4PRKA 3W8FA 3SX4A 4G86A 4FNMA 1JU3A 4COKA 1VHDA 3VQTA 1FLVA 3K7EA 3ZHYA 2IHVA 1M34A 1PFGA 4H1HA 4EHAA 2QAGC 2BYTA 5LOVF 3DDHA 4XUGB 1GCAA 1NXSA 3GUVA 3H9JA 3ROMA 4CMCA 1BMDA 3TRJA 1XDSA 2D1QA 2N42A 4ODIA 4EW2A 5JBNA 2O0JA 2QRMA 3AR4A 3NHSA 3MT9A 4XJVA 5LN1A 3H5OA 1E9RA 4WZAB 5JQGA 1VMAA 4AM8A 4I9NA 4UBMA 1UDRA 3AJ8A 4JFAA 1G38A 1SBZA 3UAVA 1VJ0A 4RKWA 5IUNC 2H16A 2Y1KA 3AF2A 3TTUA 2IOHA 4OY3A 5IZCC 3D6NB 1SUDA 2QQEA 1T91A 2PKQP 4Z9AA 4BO5A 1FU4A 5C37A 2R8YA 2IEDA 4QAJA 3NM4A 3OLXA 3ZGOA 4FLMA 5FV7A 2JK1A 1YQUA 4WXRA 1EJ2A 1Z16A 2VF2A 4WX2B 1SZJG 1UFQA 4M7OA 1Z17A 4PCVA 5ALDA 3SZLA 3D3EA 3EQ2A 3VRHA 1U8ZA 5KYNA 1UXIA 1COWA 1L7VC 4TMXA 2BJWA 3C43A 4ENPA 1E98A 2Q3EA 1Y37A 5FUYA 1IHUA 4L22A 3HXMA 4RZXA 3IVCA 1ONOA 1CZKA 3KEMA 4JLSA 3JV7A 3I9JA 2NIPA 1P1JA 1EZ4A 2GAOA 2MWMA 3HY4A 4RZHA 3OKCA 721PA 3PVSA 3L0DA 1CVRA 4JK3A 4IH9A 4KQ6A 1YC5A 3FFAA 1GOTA 2H85A 5CNKA 5IC4A 3D3WA 4RZIA 3DE0X 1OU4A 2R8ZA 1N1DA 4U2CA 5EL0A 4HFMA 2AN3A 1JEQA 1TIPA 5F76A 5JCZA 3VMFA 3VHXB 2TMKA 3QW4B 1U2GC 4QOEA 4C3ZA 1W1IA 3W5BA 5CLFA 1XTJA 4EJSC 1ML4A 1CZNA 1WDLA 2EBFX 2RIRA 2YN4A 3BDVA 3OZGA 3TZ6A 5KU1A 1TJNA 4WUVA 5TJ9A 3CRVA 3WSTA 3ENNA 2IKSA 1YR9A 3QNMA 2WJIA 3P7MA 1RHMA 1OAAA 4HEQA 5KTNA 1HT1E 3ISJA 2WU3A 2QROA 4Q24A 2BR5A 4HATA 2HLPA 5JAQA 4I8DA 3OFJA 1QMPA 1P2TA 1Z4MA 2HJWA 1Y8CA 3IKMB 5A3SA 2VQSA 4FT4A 1HKHA 4OLJA 4B6EA 4DDVA 2GX6A 3W6OA 2ZT8A 3R0VA 2QP3A 2Y6UA 3IXMA 4NJEB 1AK2A 1HYEA 4RKQA 3WS7A 4N9WA 4Y2TA 1V9CA 3PQEA 1A8QA 1JFFB 1X13A 1WU8A 5EUCA 3NR2A 2IP4A 4QGHA 1J0XO 4F11A 1QP4A 1KZ7B 4LHZA 4OXIA 5KBYA 1PW5A 4QE3A 4BFUA 4N0DA 3RS5A 4KSBA 2ACKA 4GZ6A 5AVVA 5JNSA 1F9EA 3E9EA 4CGYA 3PQFA 3RIMA 2BSXA 3ZZ0A 3D1LA 3ONDA 1H22A 2RC5A 4LXQA 1UOQA 2SKDA 3G9QA 1ZD8A 1NW9B 3KCQA 4OQEA 2WZCA 3FTDA 4TKUB 4DANA 3EMKA 2EKQA 2FN9A 4WZAE 4INZA 3L6EA 2XZOA 5G1OA 2OOKA 5EJ9A 1I6KA 1RM3A 1JR6A 3PDIA 3NUZA 4BE7B 3ZWKA 1ONPA 1SY7A 3QLVA 3OIFA 2X1LA 3OCCA 1I36A 2WU0A 3NOOA 4N4AA 1GZUA 1O5TA 1P1RA 2BMAA 4IDQA 1M2GA 3VDRA 3EVGA 1XU4A 1MG5A 3WIBA 5KYXB 1BVRA 3ROQA 2X4DA 3WISA 3GZJA 4JITA 5DX8A 4HLQB 4KX5A 2XYVA 2Y1CA 2XV1A 3PJGA 4E5VA 2V7GA 4TZKA 1P73A 3U7RA 4D8XA 2EZ8A 3A9VA 3H83A 1V1RB 2Y1EA 1U0GA 4RPLA 1C1XB 2EKDA 2CNBA 2G1UA 5IHPA 5I9BA 3T06B 1OXBB 4G8DA 1W85A 2EWMA 4V03A 2R47A 4AZ0B 3PX7A 4LV5B 4INJA 1YQGA 1TU4A 4ZDJA 2VYNA 1H2YA 4C0JA 3GRZA 4FXOA 4HKTA 5G40A 4KLNA 5B3AA 1GNLA 1IHYA 3IAM1 4OI4A 3S28A 2F9LA 2HK6A 3D0QA 3ELUA 4OSOA 3ZDBA 3LQRA 3WP1B 2EGHA 3W5SA 2CSXA 4AI6A 3RYIB 4KC0A 3NEYA 4M54A 3AF3A 1FXUA 9ATCA 1IBLB 4LW8A 3W6UA 1NIPA 2OO7A 4CM8A 1XKLA 4M7WA 5LWQA 2D1SA 1NHWA 3UK6A 1D03A 2D0IA 4M0LA 3Q7SA 3AP2A 3WB9A 3T3GA 2HREA 1DHRA 1KH3A 1MX5A 2Q4BA 3U4QA 3W3ZB 4IV0A 3QKRB 3ZHTA 2G7ZA 2FP4B 4DR2B 4Q3EA 1A8PA 1QFYA 5JBIA 1EINA 1XZ8A 4P33A 4EGSA 1PNRA 2FEMA 2C5BA 1C7IA 2HWUA 4QBTA 4RFSA 4E7PA 2RGNC 3RRXA 3ORRA 2CJXA 1V11A 2H9YA 4M1SA 1ZX1A 1KQPA 5AJZA 3CNEA 2NZJA 3C74A 1ZJWA 5F52A 2V3CC 3SYRA 3JQEA 4OD0A 3V97A 1UZLA 4Y6GB 3CF4A 5LR6A 1B3RA 1QCCA 2AJTA 1DTWB 1NVBA 2C5LA 2WT9A 3NIWA 4FFBB 2Q7DA 1ZUNB 4B47A 4JI4B 3GCWA 4TZTA 1E3JA 2WYIA 5D7NA 4TYMA 4GNRA 4E3ZA 3TSOA 4F1KA 2D5CA 3V2HA 2HSEA 2PGNA 4BMDA 9MHTA 2VZLA 4M1QA 3S1AB 2BFAA 3LLVA 1A2KC 1Q1AA 1XL1A 2GCNA 4E94A 1I01A 2H17A 1ODJA 2R60A 1Y3IA 3L01A 3IVAA 1PFVA 2JLQA 2C5FA 4KXVA 2Q4OA 3FOEC 1U28A 2K2WA 4DCSA 2VBIA 2EL9A 1X8LA 4KGVA 2RGCA 2JLWA 5ALUA 1L4KA 1ELOA 3F5DA 4JT8A 3R6DA 2C2GA 2CUNA 3EG9B 2XEDA 5HG0A 4KR0A 3MFYA 3D1JA 1JQ3A 2IW3A 2RHDA 2PKRA 2DPMA 2RJ3A 3CO5A 3QVKA 2WWWA 3CGGA 4XCVA 4C89A 3A26A 1GM5A 1YR6A 5SICE 3PPVA 4LEIA 3PJFA 4OUDB 3FHLA 2Y0EA 2FRDA 4ABTA 3X1ZA 5IT0A 3SVLA 4GZMA 2VH2A 2BCGY 3KWFA 1ZLYA 2JVIA 1D6JA 4TTPA 1UBOS 5FNVB 3VAAA 5CA1F 4U7JA 4BGDA 1AN9A 2V6GA 4JY7A 3H4MA 3O4IA 3N8HA 5AM5A 3NCHA 3ZDDA 2ZKIA 4N41A 2CXXA 4HMQA 3AL0C 3PXDA 4CG2A 2DERA 5LXTF 3COWA 1M83A 2R2AA 4CLRB 4YVFA 4IFBA 3V00A 3LA6A 4Y2HA 3HVJA 1RQPA 1SCUB 4YMIA 4DW8A 1YVEI 1L9KA 3UMBA 3O74A 4I3FA 5IN4A 4DUYB 3OIUA 1WB9A 1KPHA 2XQIA 3RSLA 1AX9A 1ODSA 2BMDA 4Z9XA 5IJ9B 2QTBA 4LSMA 3AF6A 1QRUA 1IQUA 1NT4A 4ZZ0A 1NKVA 4KFRA 2A0UA 3DFZA 2X3UA 4JMLA 3SHWA 4RTRA 4J3NA 4XRGA 1YB1A 2FWBA 1I5OA 3WYBA 1NY5A 1RJFA 2PIDA 5K0ZA 3F6YA 3FBTA 4U2BA 1QDLB 3EW9A 3NH9A 4GDMA 4LBZA 4OGGA 5KCMA 3WWPA 4PPGA 4C4PA 1I14A 5KNDA 1IEWA 1DZ3A 1X7GA 5LBTA 4EHBA 2GAFA 1NZJA 2E4WA 1VE1A 3W0LB 4G0PA 1D6SA 4EKGA 1BHO1 3WAKA 1Q50A 4XB1A 2C31A 4M9ZA 4HADA 4IOMA 3ZHUA 3EASA 1ZH8A 2JH3A 2XCUA 3NBZC 1L4UA 3IDAA 2YINC 3ORSA 4I9UA 1F2TA 1GP2A 2GCEA 2O6LA 1DRWA 4CKBB 1ZH4A 2QR2A 4QRIA 5EWMA 2UZ1A 4KHZA 1OR8A 5FIUA 2QSJA 1M1UA 4JODA 1GPKA 4JB0A 3GMTA 5BSGA 1U4SA 1XROA 2C4HA 2P9GA 2WNSA 3R77A 5D86A 4BYGA 3WGIA 1EA5A 1G66A 1D9ZA 2F9FA 4WAUA 4UNRA 2WU8A 4Z2AA 3K70D 4NAUA 5DSTA 4D1YA 1JG1A 2AV6A 3HBMA 4IIEA 1YL6A 4L9SA 5BXYA 4Z7NB 1BFKA 5HHTA 2FR8A 5F5NA 3COJA 4GI7A 4J0FA 3H86A 2I71A 3NXKA 2A0XA 1YMUA 4JLOA 4BZZA 1M10A 2ZRQA 4KR9A 2P0EA 4XIYA 1F0PA 4DG5A 1SRRA 1K8RA 3WDMA 1SXGA 3K1TA 5DW0A 3Q6MA 5CB8A 1MU0A 1W8IA 5LB2A 2OA0A 1UBEA 3GJ0A 1QAMA 2P4UA 3Q1KA 3ZI7A 4RFLA 5CEFA 1UXJA 1TQDA 4ZP1A 3UN1A 5DHTA 3EIOA 1GAJA 3MTJA 3QX8A 5JG7A 2VJYA 3O0TA 2OQVA 3M1LA 3WWZA 4L50A 4JI3B 1IUKA 2FGKA 1LQTA 2CFCA 1O6CA 3UMVA 3ZC3A 4K9PA 4WL0A 5DN6D 1HRKA 2MCFA 3U80A 4IWYA 3DHVA 4J0EA 4LECA 4MGYR 4EG1A 1G2IA 3OJWA 2JGEA 1MQ9A 4KQEA 3UC5A 3ZZUA 1HYHA 4C2AA 2PM8A 3WWCA 1FW6A 2GLXA 5A9SB 3GVHA 1X70A 1YVUA 5DWDA 4H17A 5BRNA 4J8PA 1BQEA 2O2GA 4RVDA 4FOTA 4GBGA 2BT4A 5G1PA 4KKXB 2NUTA 3WK9A 1GXSB 1NP7A 4BJ5A 3ZHRA 1Y33E 3BHJA 4RL6A 3MJVA 4IDDA 4Q4AB 4TTAA 2I7CA 4G23A 2RGGA 3JY6A 2W8BB 4BO0A 2QAJA 4RX1A 1FP1D 1ATIA 1ST2A 1IATA 3KJIA 2G40A 4P22A 5F1PA 4BQQA 5DTMA 3E1GA 3G88A 1ZYUA 2MR5A 4LYYA 3THSA 3ZHZA 1FNSA 1BJRE 2XOXA 4LY9A 2J0QA 2FAXA 3WL4A 2BFOA 3CEJA 5KYVA 3BZBA 1JA1A 1M2VB 4RTSA 1JU9A 2AOUA 4PLYA 4KTVE 3ROGA 4BNTA 5L3ZA 4QBFA 4FGWA 4H3HB 5FFMA 1P75A 1T8UA 3JQFA 3BULA 1AQNA 1DBVO 3K0FA 5FPTA 1TVEA 1E1QD 1EVEA 2E6UX 3HWRA 3O82A 2CXRA 3V2UA 4DKJA 2F7SA 4IIGA 4BAGA 3TQIA 5AM2A 2OCLA 1T29A 1RAAA 2ZUVA 2W6ZA 2PK3A 1RWKA 2W4MA 5ECGC 3LO8A 2NV0A 3K0EA 2DPLA 4L16A 3AHIA 3B9QA 4NEQA 4A8TA 2R1VB 1W4RA 4ZI7B 1NOJA 1E1CB 5J47A 1O0SA 4EQZA 1HE8B 1EWRA 1Y3FE 2VSQA 3QPVA 4H9GA 3V7WA 4BFZA 1N9GA 4CLDA 3FMGA 5CDFE 5IJ0A 1V43A 4B3CA 5KREA 3EDQA 4PTYA 2WWFA 4EKDA 5A4IS 2TS1A 3CKYA 3MJ4A 4NTZA 1MA3A 1HF3A 3S2UA 2DBRA 3U31A 4IICA 4CL0A 3G82C 1OWPA 1YAJA 1EEHA 1RRGA 5D5HA 2AN1A 4AP6A 4D9CA 1A82A 4O2AB 3NDJA 2XOEA 2QLTA 2H1CA 1UWLA 1VKRA 3HU2A 2E4UA 1C4XA 2QI9C 1SXJD 4K46A 1SXJA 2YFKA 2Y1DA 5DBFA 1MR3F 3H9GA 4FC7A 2UVDA 4Y0AA 1B7GO 3ZY4A 4DIKA 4X45A 4Y6LA 1T0HB 4XWYA 4H7EA 5KYKA 1KYWA 4RHUA 3CURA 4O1IA 1Z5PA 2OFXA 4X9XA 4S05A 2RMKA 4WNAA 4CV2A 3IQIX 2BTEA 4NCJA 1UBHS 3HB9A 4N5LA 4DBVO 3I6ZA 1GZ6A 1GA1A 1CDOA 2CZQA 3N87A 4LBVA 1U02A 1QF9A 1JHUA 2QAIA 5LLTA 1OC2A 1POWA 1SOMA 2A9FA 5AJWA 3WKCA 4BAZA 5CXXA 1J0CA 2CLLB 5E6RB 4LFBB 2A1UA 2AJCA 1SB8A 4J90A 4AKIA 3KSRA 1JIVA 1HLDA 2X0KA 3NHYA 4U63A 2CWWA 2A9VA 2FPPB 2WIGA 4OPMA 3FPFA 3AFMA 3PR1A 5AKJA 4TUYB 4L85A 3VSBA 3QU7A 4TYNA 1I32A 2HRCA 2BHNA 2UVPB 4RDCA 3ETEA 2HSJA 1WDTA 1TVMA 3HYCA 3CUTA 4HDMA 3IMKA 5EE1A 5F51A 4B3FX 1BS2A 1NQUA 1W29A 2E82A 2G1KA 2IH5A 3I9LA 1QHFA 1N6PA 3PA6A 3RDPA 2PFKA 2XT6A 3GG2A 3GRUA 4HFNA 4QULA 1DQNA 1L1EA 1QBKC 2XBMA 3A05A 3EEQA 3X44A 4MDHA 1CETA 1JG2A 3ETLA 3L9XA 2YZMA 1YJ5A 1XFAA 4YJ2F 4D7AA 2C7OA 4F92B 3LWZA 3HTXA 4IG9A 4GI3A 2X9NA 1A7JA 1JVSA 1QPGA 3W90A 2EATA 2YWGA 4Y7DA 2F1JA 2DB3A 1TJ4A 3TRDA 5F23A 2EJWA 5CCEA 1M54A 2JASA 3DCYA 4EYEA 1E60A 1U1DA 3C85A 1HYGA 3JQCA 3N75A 4DRXA 1VI2A 4PYIA 1T2EA 4CM5A 3LC0A 2W2KB 1BWPA 1W5SA 3KB8A 4UBKA 4E46A 2PZAA 1E58A 3BWCA 4EGFA 3IERA 4Z3OA 1Q7EA 4FE4A 3QSGA 3SJAA 4MTLA 3ICQB 5KMGA 2WWXA 2O5VA 5HTKA 1MO6A 2Z5FA 3OZDA 5IDYA 5JVDB 4ZCTA 2Z56A 4QPDA 3PIIA 4E32A 5K0LA 4DA0A 4JNCA 1LK0A 4W1RA 4KWEA 1XIVA 1SQGA 3LX4A 5KOHB 3FTEA 1MC4A 2ZDHA 1NULA 1Y6QA 2C3PA 1ZHOA 1FP6A 1A5AB 1I1HA 1R9NA 1XO1A 1ZJ5A 4F3TA 3L02A 2Q6TA 3SBOA 1E6EA 1UP4A 5BSRA 1YC2A 3LO5A 4ALMA 1UDBA 4X91A 3T3HA 1QO0D 5TQ0B 5GZ3A 1QO0A 1KOFA 1Q44A 1LW6E 2HMTA 3U3OA 4BNFA 2O52A 5BYKA 2R6CA 1FMTA 3UV3A 2Q4EA 5EY5B 2HU2A 5DXAA 3SR0A 2DKFA 3H1TA 3B2EA 1LBQA 4Q7LA 2WMNB 5EJIA 4WKNA 3KKOA 1XX6A 5FNZA 3BICA 4K6HA 4A6XA 4PHFA 4ZI7F 1L5LA 2WV7A 5BPFA 2JCYA 3ZBTA 4ESVA 1H8HD 1JA9A 1H8HA 3CGWA 3B48A 4W99A 3MAAC 5JSUA 3BS4A 4C7OB 2FW1A 1G3UA 2CBGA 2JGKA 5CVEA 1DJLA 2R1TB 1T24A 4O2AF 3TMKA 2OCAA 3V1YA 4BB0A 1U0JA 4RY8A 2HZ7A 1TCUA 1SA0B 4IJQA 2V1UA 2CNNA 4FCVA 2ZT7A 5CIYA 4XYGA 2EYQA 1TM1E 2PLAA 4TXNA 1UBSB 3CH6A 1GAWA 1E9FA 3EF3A 4FGSA 3VR3D 2ZRDA 3VR3A 1J07A 3KB1A 3C6MA 4BTLA 3U7EB 5LQCA 1JBKA 2FWPA 2QRVB 3N2KB 4ZN6A 4KBFA 3DJFA 3QPBA 1U2EA 1YS2X 1H05A 1WL8A 2P41A 2UUOA 5CK5A 3G9XA 5CYFA 4GO1A 4EY8A 1QG6A 2I2CA 2OD2A 2WJAA 1C9DB 4GX2A 5F21A 1E3LA 2VK4A 1X8XA 3JALA 3PPIA 4EPWA 5K2OA 4B33A 3P2IA 4IF6A 1IOLA 1W5AA 3A1VA 4MI9A 4X44A 1N77A 5LJLA 1XCMA 3MAGA 4ND7A 2OLJA 2D2VA 1RYEA 4PZUA 3HU1A 2H1IA 2VRCD 1QC5A 4DWWA 3G0DA 1GCGA 2Q29A 3WLRA 5E6UA 4BCCA 1S9HA 1ECPA 4BGUA 1CS4C 1V2HE 2EERA 2P9BA 3L7CA 1UJ6A 4P3OA 2R6AA 4XPIB 3BGOS 1E2IA 5E6SB 4BMVA 3R6LA 3HYLA 3BORA 4HF7A 4XQGA 5DSXA 2R11A 2AQHA 2BSAA 3V1TC 4U6NA 3M7IA 3DXXA 5BOSB 2UZ4A 2CXNA 2D4AA 1USUA 1I4TD 3DTVD 1A69A 1DDOA 3WRXC 4MW6A 2HA7A 4MUMA 3KJHA 2BEUA 4GMDA 3BB4A 3KCNA 2BKVA 5ECDA 3T52A 2GPNA 2XUFA 2D00A 3NRCA 5C35A 4MP8A 5ALHA 3TGWA 2PUBA 4F56A 2OFFA 1P6QA 4DMGA 2P1RA 2AFHA 3EZGA 1X7DA 1J20A 3OM1A 4WD3A 3ZI4A 1B4DA 1VMIA 1WCIA 2NZVG 1QP7A 1J99A 5EKTA 3RTDA 2CVPA 4XFDA 3H5LA 4BQEA 5AUOB 4I7EA 1Z4OA 3IUBA 5BURA 1U63A 4E5UA 4KEAA 4LYFA 5TMPA 2COKA 4F7WA 3BE4A 4P84A 5FR1A 2ODPA 2ZIXB 3LOUA 1ORIA 4NYJR 5F1OA 3F46A 2GYUA 4RV4A 3VU1A 1OIVA 1NZFA 2Q8NA 2VFAA 1TGYA 1M8JA 2AYYA 3R8XA 1LFDB 2B21A 5JVDF 1QIJA 1GSAA 4EOGA 4PZDA 1FP4B 3SM3A 4H6PA 1X9HA 2ZR8A 3PUIA 3QMPA 4QYIA 1E1NA 1MTOA 1P31A 2QPTA 3IMFA 3K9BA 3X1WA 3WL7A 5BPHA 3PC2A 4HQRA 4DS3A 1CDEA 1OYYA 1N2BA 2J0VA 3F6CA 4HRYA 2FMXA 4P86A 2QAGA 3PGLA 4IJWA 4TSRA 4FE7A 4EVQA 2V6MA 3NDPA 3DLPX 3EQ7A 3FF4A 1FQJA 5DLDA 1F9AA 1TYCA 3QU4A 5E4YA 3C3DA 3S5UA 4CQLA 1L5SA 3JASB 3RC2A 4M0KA 3WYCA 1ECLA 2FPLA 3SSAA 4JKOA 4CR8A 5KYYA 1OX6A 1KEZA 2NNLD 2Z1NA 3GR6A 4C7KA 5L53A 5FTKA 4B6RA 1SOWA 4E6PA 4OA5A 1RAGA 3O5AA 4YRJA 3F5QA 5IZCA 3KKMA 4I4IA 4TN1A 3H5NA 1X1AA 3FBWA 3GGGA 3H0EA 3L79A 3A1FA 1AD2A 2R2GA 1S5PA 1R6TA 3C6YA 3PQDA 2CNOA 3X1YA 5KHAA 1ZN9A 1XCGB 2Y68A 4D02A 1Q7BA 4RKRA 1VLZA 3B8HA 2HJSA 3GPDG 1NTOA 4KMOA 2GFQA 4RVFA 1E63A 2NUAB 3WADA 3EFOB 5C1PA 3CNQS 5JZOA 5J1TB 2C1XA 1JXMA 4PAMA 2I91A 4N6NA 3M9XA 1UP6A 2YBDA 1U3VA 1NIJA 1EDEA 1MPTA 1N0UA 1Z34A 5LP6F 5IXSA 3BH6A 3NASA 4O4HA 3N39C 2V3VA 4OQDA 3RW9A 3TYXA 5JISA 1IM8A 3OOHA 5I45A 1W34A 2EJCA 5IABA 2XNHA 3JARA 3KYJB 4FYPA 4ML3A 1TEHA 5CLGA 2VF8A 5B3JC 4RL4A 2CEKA 3UANA 3ZYZA 1K7XB 1Y3BE 2RK4A 2WDZA 2Y4NA 3AHJA 3OT5A 4GM1A 3FXAA 1LSUA 4RIIA 2GQ0A 3LPNA 2CFOA 4S1PA 4OHPA 3K71B 3SLRA 4UXIA 4NAVA 3KQYA 1PW7A 1TXGA 1U2GA 6PFKA 4YQZA 1R0CA 5IFKA 1RI2A 1Z82A 2HI0A 3B3JA 4MUXA 1TYZA 2CSUA 1NQ5A 3I39X 4PZ0A 2CC2A 3QE3A 3ME5A 4QOHA 2R751 4AJIA 2BVNA 3B5IA 1O9GA 2AFRA 3UA3A 3OCJA 1A4XA 4BPRA 2X0EA 1VCMA 5KX5B 2XIQA 3RAEC 2FSIA 3WTBA 4DZRA 3UB4A 2NO5A 4JP2A 2AH5A 4OKSA 4UOQA 4KPFC 5HWSA 1D2GA 1RCUA 3QMWA 4G5QA 2ISQA 5ALOA 1RAFA 4CMEA 3VPGA 1ULSA 3D6TB 1ADFA 2XITA 2VNKA 1K08A 2BCEA 4QNMA 4LHWA 1KKLA 1Q12A 2IZZA 2ZJ7A 4W8GA 2NO7A 1KNXA 2HF9A 3ZDQA 3DKRA 3DDNA 4FVTA 2PVSA 2E5WA 2G0TA 2Y0DA 4JL8A 2ZXUA 4Q48A 4OHFA 3ROEA 4MHSA 1QUFA 3RTCA 3EZ6A 2YUTA 1HE3A 5DNDA 4K9LA 1GGEA 5HFJA 4ZI2A 1RBYA 2WF6A 1O95D 4JSTA 5AVTA 1O95A 4LHEA 2FDCA 2PRSA 1R0ZA 4QBIA 1ZN8A 3NU1A 4QRHA 2OFPA 2QTRA 3VR2D 4V0RA 4GP6A 1G7SA 2HKIA 1PU2A 3LCJA 2H5JA 1JN0A 1R8XA 4Q9DA 5G0SA 5BW5A 3MHTA 3SHVA 2FPIA 5KQMA 2NYUA 1JLRA 2WKPA 3QKWA 4M0EA 4UM7A 3CR3C 1HSOA 2RCNA 221PA 2WF9A 2Z6VA 3LC7O 4D9BA 3NBAA 5IT4A 2VKTA 3KO8A 3CLRD 4JXXA 1BU8A 4AYTA 1ZK1A 4HTAA 4KAXA 1TUGA 5T8KC 4CF3A 2RBGA 1UKEA 4KI0A 2HCJB 4CMIB 2GXQA 2J85A 3EODA 1RVDA 2FZEA 4II2A 3AR6A 3PQ8A 4G5OA 4A82A 5KVAA 4ZZIA 4ARCA 3SM9A 1M0SA 4RQBA 4Y2GA 4EFDA 1YZHA 1XPRA 2QN6A 3R7LA 3EIXA 1UM8A 1DINA 3GFPA 4GOJA 4K88A 5H1YA 2PT9A 3UQYS 2QLNA 1YMQA 3BT7A 4C22A 2PRZA 3H1BA 2P6UA 4IHJB 1K92A 2D5IA 3IHLA 3OUTA 3TXAA 4RK7A 1H93A 3IAUA 4QYXA 4V0ME 3SXUB 2GI4A 1DBIA 1JHZA 3PKJA 4I81A 1AY0A 3GFTA 3KJQA 1I3NA 4EDHA 1C3OB 2X8WA 3CG0A 1XC7A 3IO3A 4TV8B 3WQHA 5CB6A 3K6SB 1N4DA 1CIJA 2BM8A 3N6VA 3P5BA 4FSHA 1BDMA 4RKEA 1EEXB 5HRAA 5GINE 1XZJA 3UT0A 3BC1A 3JQ9A 1E6CA 2HAEA 2IUYA 3FOWA 4FTWA 2PKWA 3H5IA 4HWSA 1GQRA 4RZUA 2D2EA 1JQJC 4K6FA 3DBRB 4R2XA 3A6KA 3H9UA 4U5XA 1JR3A 1PNVA 3BXOA 3WNBA 1EFRA 4YRZA 1IVSA 1FW8A 2GTIA 1WZ2A 1MXFA 1UBUS 4H7FA 4TYPA 2ZBGA 4BVKA 5LMZA 4FOLA 4Z8YA 4H15A 3SN6A 3KAJA 5FO0A 4JN6B 4WFIA 4YV7A 3AG6A 1R5JA 3MQFA 1E4OA 5JOQA 2V7QD 5I4BA 3JVIA 4JLVA 1QBGA 2E4VA 5FULA 5JRZA 4ARSA 2BFEB 2ZULA 2IOQA 4R16A 1RWOA 3LC1O 4XWGA 1QWOA 1BROA 1L4FA 2DPXA 4OGLA 2ZDGA 5FBHA 5KQLA 3HFGA 4AUKA 4DDHA 4QHTA 4GMGA 9GPBA 1VXOA 1XEXA 3RODA 5AW4A 3BXHA 3K2QA 2AEJA 2RGNA 3NAGA 3Q5EA 3FFTA 5BQ5A 4LY0A 5BWBA 1XTIA 2DGDA 4LTNA 3T5CA 5I7RA 1TVKB 4JUAA 4F6RA 4MV7A 4AT1A 3DS8A 2AZDA 3QFFA 1ULBA 4R3WA 3DV2A 4CN9A 2DKNA 1N2ZA 1CRLA 1L7QA 1VHTA 2VBFA 2A5GA 2I7TA 2O20A 1FCJA 5IAGA 3SVZA 4CDMA 5BYAA 4MDEA 1TKAA 1JYSA 1ZBDA 2GTHA 3BRWD 3T7DA 4C4ZA 4ID3A 4US0R 5E1DA 2NXJA 4FYWA 4QTTB 3TLEA 4Y0VA 3WA6A 1OWNA 2BDUA 1EX6A 1VHLA 3PRYA 4HDAA 3VR5A 5KX5F 3FVTA 3QPAA 3ETCA 3H17A 1NBMD 1QZZA 1NBMA 2QLBA 1OZGA 1P7YA 2PBLA 3MERA 1GKLA 4A2QA 4ZYWA 4MDFA 3GEMA 1XKXA 2G09A 2NZXA 3KD3A 3PD7A 1XAJA 4GSKA 3GZTB 4BUCA 4NCHA 1DJQA 1V3TA 2G77B 2NMVA 5CJPA 3NFRA 1FDRA 4PONA 1RWPA 2A0YA 1BG6A 5B6JA 1KU0A 4Z3KA 3R3VA 3IXQA 3U49A 1CTQA 3WZMA 3LLSA 4H7PA 3ZLTA 3ZCUA 4JWTA 3SEAA 2GHTA 2BFFB 3D7RA 4KNWA 2Z1MA 1T36B 2JAPA 1U0OC 2WHXA 1YRAA 4LXHA 3PR2B 1SHUX 1UXKA 2VYVD 3BWXA 1HO3A 2VYVA 2NO0A 3B1XA 3GROA 2RE8A 4I36A 1ZXBA 3DHEA 3AP1A 1ULUA 2TMYA 2C84A 3FCXA 2FE4A 3OKPA 1BAPA 3N53A 3LTNC 2IU4A 4B6SA 1JEYB 2XNJA 1PDOA 1TW2A 1JTEA 2NPIA 4MS4B 1SKUA 2H7XA 4HZGA 4LCBA